3CRZA

Ferredoxin-nadp reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
257
structure length
257
Chain Sequence
SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP+ reductase
total genus 79
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3crzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3crzA02
1K73D 4ZCIA 2RC6A 2R6HA 2NPFA 3ES9A 4RCYA 1GO2A 4TMZA 1B2RA 3P26A 4LBZA 3OZVA 3W5UA 5THXA 4ZGNB 1NJID 2BV3A 1YJNB 3B82A 3I55B 3OJWA 4TMXA 3MHPA 4FN5A 1AMOA 2VNHA 4QHYA 4N3NA 3VO2A 1KK1A 3WYAA 4P6VF 3QFRA 5H5JA 1VQPB 1A8PA 5DSZA 3LYUA 4TMVA 4N3GA 4RJLA 3VO1A 1H42A 3CCEB 4ZGQB 1N8RD 2OK7A 1OGJA 4PC7A 3FPKA 1Q82D 1QGYA 1CNFA 2CRVA 2XEXA 4M0LA 1FNCA 1FNDA 1VQOB 3QFSA 3WNDA 2VYQA 1XB2A 3WBKA 4LBVA 3AVTA 1EXMA 4NCNA 3QSYA 4EH1A 2BGJA 3LRXA 1K8AD 2BMWA 1R5NA 3U6KA 1WDTA 2BPOA 3WNCA 1VQ6B 1QUFA 2PMDA 2AHOA 4AF6A 1JNYA 1EP1B 4ZV4A 1YJWB 3W2FA 4YAWA 2VNIA 3JQRA 4LBWA 1QVGB 4DQKA 4RD6A 5GV8A 1VQ8B 4H9GA 3G71B 3CCQB 4PC2A 5H59A 2YWEA 2BVNA 3CCMB 1ZM4A 4TMWA 3VNVA 1KD1D 1J9ZA 1D2EA 1KK0A 2DEUA 1BX1A 4B47A 1G7SA 1ELOA 1QGAA 4AC9A 4IW3B 1VQ4B 4DQLA 1W2BB 1OB5A 3QFCA 1YITB 1KQSB 3CW2A 1E62A 4WQMA 2VZLA 2J7KA 1E64A 2D74A 2ZITA 3OZUA 1VQKB 3WBJA 3OJXA 3WXMA 1M90D 4C43A 3AGQA 1KJZA 1YJ9B 3A1FA 1EP3B 2PIAA 4M2LA 3W5VA 3CCSB 1R5OA 3MCAA 3U6BA 3B78A 4YAOA 2BM0A 4Y9RA 3CD6B 1JA0A 1QGZA 4Y7CA 4RCZA 1DDIA 3E1YE 1VQ9B 3QFTA 3CCRB 3AVUA 1W34A 3CCJB 3VNUA 1AIPA 2QEXB 1BQEA 1IJFA 3W5HA 1JB9A 2DCUA 4YAUA 1H85A 4J0QA 1N0UA 4HE6A 1D8TA 1QUEA 1W87A 3W2IA 2QN6A 2QTLA 1KK3A 4PC1A 3QE2A 3U2QA 1G7CA 1DARA 1EWYA 4LC0A 4ACBA 2XNCA 1U2RA 4F7DA 2B7BA 2EFGA 1QX4A 4M1KA 1IJEA 4PC3A 3AVXA 3ZC3A 1GVHA 5TV2A 1VQ7B 4G1VA 1YIJB 5FA6A 1FRNA 4YALA 1VQMB 3ZBTA 1NDHA 4Y9UA 1ZM3A 4PGOA 1DG1G 4HE5A 1EFCA 1M1KD 2BF4A 4R71A 3ZZUA 2YWHA 2BSAA 1BX0A 2GPJA 4M53A 2OTLB 1FRQA 1VQNB 1QVFB 1QH0A 1S72B 4TN1A 4B48A 4RD3A 1GAQA 2QDXA 2HCJB 1EFTA 1SM4A 4RD2A 3G4SB 1YI2B 5GV7A 2RC5A 3MMPA 1TVCA 2OK8A 4AF7A 1TUIA 4RD4A 3CCUB 4FWTA 2YWFA 1SKQA 2OTJB 4B43A 1B23P 3W2EA 3CB4A 5AN9A 3ZZ0A 2QTZA 1VQLB 1ZM9A 2GQFA 3ZZTA 3W2GA 1IB0A 1QFYA 1BJKA 1XE1A 2BGIA 2X3UA 1UMKA 4ZCMA 4QFMA 1YHQB 5TY0A 4MYTA 2EIXA 4K1XA 4U9UA 4NBSA 4PC6A 3CCLB 3CC7B 2VNJA 5TR9A 4MYUA 3P27A 3CMAB 1Q86D 3AVVA 3CXCB 4YAFA 2PLFA 1DDGA 3E20A 2HDNB 1W35A 1S0UA 4RD1A 2YWGA 1D1NA 4C0SA 1FNBA 3AVYA 1QFJA 2FX3A 1K9MD 3LVBA 1I7PA 2QA4B 3LO8A 1CNEA 1CQXA 3FJOA 1G7TA 2E1RA 3SJZA 3AVWA 4B44A 4M4SA 1JA1A 4FK8A 4G5GA 4UAJA 3VMFA 1G7RA 1N0VC 3W2HA 4B3XA 5HXBA 1OB2A 4Q7JB 2C78A 3J81k 1TLLA 1KTVA 1KC8D 3ZBUA 1QFZA 2BM1A 1ZM2A 1F20A 3JQPA 1EFUA 4G1BA 5JBQA 1VQ5B 1GJRA 3I1FA 3PENA 2B5OA 3G6EB 2DERA 2HMAA 3WNBA 2B7CA 4YHBA 1Q81D 3CPWB 3OW2B 2BN4A 3I56B 1FNMA 1E63A 3WY9A 2C77A 1Q7YD 1GAWA 1R5BA 4ACAA 4LBYA 1FDRA 3CC4B 2VNKA 1OGIA 1ZUNB 3CRZA 1QG0A 3OZWA 5KSWB 3AGPA 1KRHA 3CCVB 1EP2B 2XNJA 4P3YA 3CMEB 2DETA 1GR1A 4TMTA 1KK2A 3B8HA 1TTTA 3V76A 3JQQA 2CNDA 1F60A 1JJ2B 2DY1A 2QMUA 4BPRA 5EMNA 3CC2B 4ZCLA 1HA3A 4B4DA 4RD0A
chains in the Genus database with same CATH superfamily
1K73D 4RPHA 4R98A 1TT7A 3QJ5A 1UF9A 4C30A 5CDYA 1IG0A 3LAWA 1YH3A 1UM9A 4QLAA 1LPSA 1RKXA 2HB6A 1H6CA 2OZEA 5DCLA 4XSVA 4BLSA 2EBWA 4YY3B 1G6HA 3CRW1 3FHJA 3FTPA 4P7GA 3H11A 1KFCB 1RLJA 2HMWA 2PSHA 1OX4B 1VLHA 4NTZA 1HEYA 4BP1A 1AKMA 3E03A 4WK4B 4OBXA 3FOCA 1LQ2A 3HZHA 2Q07A 2FZVA 1Z08A 1MP0A 2BMDA 5FLKA 1ZGAA 5G2OA 5DOZA 2WSSA 1GKIA 4XB1A 1JHQA 2F8LA 5EEGA 3BVPA 1ZMBA 4DEVA 3VSDA 1G4AE 2HF7A 1YJNB 3TPZA 1BD4A 3N5CA 4DIKA 5KBYA 2I6UA 4QEKA 2XKKA 4NABA 4TMXA 2FLKA 1JWBB 4OJMX 1O9GA 2JFXA 1IIRA 1KI9A 1UEXC 2LGJA 2JLCA 3GBVA 3CTAA 4RDKA 4NI5A 3GYBA 4PTZA 4UVEA 3SM3A 5LVAA 4O4HF 3G85A 4O25A 5H82A 1KIAA 3UH0A 2IXTA 2FWNA 4ZI7F 4UEWA 5J23A 2ZVDA 2P2CA 3DOJA 1P44A 4PHTA 1FYXA 1KZ9A 4B32A 4LJ4A 1L7RA 3D5QA 1RLTA 1RPNA 4U3JB 5DSTA 1VQPB 5HKLA 2V5UA 4E31A 3RQSA 1TZJA 1X8JA 4KO3S 4LJAA 5G0UA 1ANKA 5JH7A 1Y9DA 4JSTA 1RTTA 1OWNA 4ZC8A 1XU9A 3TNLA 4LFBB 1MJGM 3ROEA 1E96A 1SUAA 3ZNQA 2HCFA 4G4JA 2V4ZA 1P1HA 2WD7A 3I1IA 4HOYA 2Q4TA 1T1GA 3F7TA 3ZDQA 2VN8A 4Q19A 4N82A 4L9SA 5JEDA 3P2YA 2P0EA 5I9SA 4YMGA 4LHVA 1JSRA 3NNNA 4H3SA 2PLNA 4LGVA 3LLMA 3WP1B 3N70A 1OR8A 5MN5A 1C3LA 4KACA 1RXUA 5AJZA 3DT8A 5BYAA 1QV9A 1DJQA 2QM0A 3E53A 3HY4A 1VIMA 1GEEA 4PO9A 4EUNA 2H7XA 2WIAA 5CPBA 2ZZFA 2HZBA 3EIFA 2AR7A 4XFJA 4FLEA 1HTBA 1N9GB 2Y3IA 1LU9A 4Q1DA 3UK0A 2FGKA 4ZP1A 4BECA 3BFXA 5FUYA 2LW7A 2CDBA 3HA2A 3AV3A 3KEFA 1ORWA 4K05A 1IZ0A 2Q5IA 3HYRA 1Z17A 1OAOC 3HB4X 3RC3A 4UD6A 3BS4A 3VPGA 2FMIA 3A6DA 2CLCX 1GNSA 1QZUA 3N8KA 3QOXA 3RGGA 1VQ6B 1J2EA 1DBQA 4FDVA 1F1JA 1KJWA 3NYQA 4GFDA 4OJKA 2H4ZA 5TPZD 4AK9A 4B17A 4DBLC 4O2BB 2W6ZA 1D0IA 4KLCA 4H4CA 2FJUA 3NGLA 1VRCA 1I5RA 1NJ1A 3CJQA 1JJ7A 3H19A 4L9RA 1KDYA 4UMEA 3SVLA 2NV0A 2ORED 3QUSA 5FPPA 3OLXA 5J1SB 1X86B 4EKNB 2DUWA 1YJWB 3KHUA 4MMXB 2OYSA 1P60A 5JU6A 2O8EB 3ASQA 3D3EA 3GLIB 2O3UA 3R3VA 4HVTA 2XY4A 4MNTA 4U5QA 1F38A 4Q1VA 2R6ZA 1JQAA 3D2AA 4JD5A 3HUTA 1X9IA 5E95A 4M37A 4RD6A 3PUWA 3H17A 5KPDA 3D7NA 3G2HA 3I04A 4FQ5A 4UTPA 2QBYB 4B4KA 4B40A 2YN0A 1JU4A 3H1GA 3UZUA 2PO5A 3FH0A 5IRCD 1O87A 1UOEA 4V0LA 2GD1O 3O3NB 2BVNA 1PSDA 4C4PA 1G5PA 2ZWMA 3R5FA 4X9XA 2Y92A 1J0EA 4DIBA 3MWKA 1P6XA 3E6AA 4R2JA 1GAXA 1QTNA 3QXGA 4LYDA 1SU8A 4BMSA 1SOWA 1A5ZA 4QSMA 3NKVA 3OKCA 3ZWCA 5K2MA 1F0NA 4ME6A 1IY0A 5KZMB 3GRCA 3ZY5A 1SIUA 4R1LA 2Z6VA 3VNBA 2X7JA 3PX3A 4JKYA 4QO7A 3GA7A 1GQYA 3AY0A 2OUIA 3DBHB 4KE7A 1DUIA 2DULA 4LNHA 5EOVA 3V4OA 1Q9SA 3FLAA 2ADMA 3CEJA 1MAWA 4GR5A 1WXFA 3ZCQA 2XADA 1KVTA 1GG8A 1P0IA 4JODA 2C96A 2Y8EA 2NO9A 2NZYA 3DE0X 4K9QA 4BLRA 3M6LA 1LXCA 4P9SA 5DO9A 1Y4AE 4X3PA 2QAIA 2YHIA 2XUFA 3AP3A 3CEPB 1Q7GA 2QG9A 3TINA 3BPSA 1JFFB 2PMKA 1W30A 1ZI6A 3GZ4A 2R7AA 3V7UA 2IYTA 3BEOA 2XTNA 5IEJA 1M90D 2C8LA 3VOSA 1JEJA 3HZOA 4UFOA 1E6KA 5FAXA 3ZCSA 3O4IA 4C0AC 4E51A 2XNSA 4BPBA 4P84A 5ALJA 3I2FA 3B6IA 3GFGA 4GP6A 4MAMA 2ZB3A 5JS8A 3PNYA 2MSLA 1VMAA 2BGUA 3IRUA 4N3AA 2ID9A 1P61B 4BNGA 1UMCA 1Q3KA 1KZ7B 1QCYA 3SJBA 1N32B 4Y9DA 4BFYA 4YJGB 2YIVX 4KIGA 2GN9A 2XJ9A 3FMFA 4R69A 1V25A 2PUTA 2YYZA 2IYEA 3I9V6 4L6CA 1GXSB 4Q7LA 1X1DA 1ND5A 3WFIA 5C53B 3MCWA 1Z4PX 2BZGA 4MTLA 3B3FA 1W581 4FHZA 5JANA 4PG7A 1FY2A 4AUNA 4BV9A 2FPXA 5C4MA 1DB3A 2IE8A 3H9GA 4LJ8A 2JD1A 2Y0EA 4RMHA 3AVUA 1V41E 1KETA 2D2IA 1IXKA 3LF2A 2DM6A 4UE2A 3WVNA 3L7KA 1UXKA 2ILVA 3GJZA 3JTEA 4FYMA 3NVKI 1NI3A 4FNOA 8GPBA 2R44A 2XB6A 2XXJA 2QEXB 1BQEA 1MUUA 1DIHA 1TUBB 2BMJA 3AI1A 4OXRA 5LNK6 2VFAA 3N2LA 2V97A 2CV2A 1TKBA 1X7WB 2CBGA 4W8HA 4RHEA 3P45A 1O97D 4DR4B 2XSZA 1QIHA 4E5VA 5DN6D 3ROZA 3P9CA 5ALPA 5CP8A 4L7VA 4KO1S 4EKGA 3IDQA 2C4KA 3W5JA 4LUCA 3D8RA 3KJEA 3C3JA 4LGMA 3GH3A 3UXHA 2I22A 1EGMB 4PR3A 3RRNA 1GU7A 4K81B 1T9DA 5E6TA 5IWAB 2G1UA 1YDHA 1EXVA 1DAPA 3GIWA 2I78A 1W88A 3CTMA 4PYNA 5DNCA 1CUCA 3OZTA 2PPLA 2QIOA 4NBLA 1N34B 4JB0A 2J3LA 1QJCA 1TJ4A 5I9LA 2WTEA 2ZDGA 3ETEA 3OMWA 4P7FA 1JG3A 3DMPA 3LUDA 4Q7EA 4WH0A 4RMIA 2G8NA 3T9AA 4EFMA 4C07A 3KSBC 2G76A 3LQ1A 2VP3A 3C24A 2D1RA 1Y37A 1VCNA 1GQSA 1NY6A 3SVTA 1UBMS 2XIJA 5DM60 1FXWA 1KS2A 2X2PA 2VP5A 4GECA 4YALA 4R2KA 3NAGA 1TU3A 3QTTA 3OHPA 1CD5A 3M3HA 4L7QA 2P3SA 1Q22A 4PLYA 3ZLTA 1P4RA 4CKEB 2BFBA 3MFQA 4MKHA 3WSVA 3D6HA 3JQCA 3NHWA 2ZIUB 4MLCA 4S24A 3I5YA 2HJHA 1TTQB 3KAKA 1CUIA 2Q3LA 3ZQUA 4RJTA 1T1RA 3JASB 4PGOA 4WZZA 4XOUA 3DV9A 4ZTUB 4UUQA 4MQEA 5AVXA 2G1JA 2CHEA 2QAGB 1KDZA 2CVFA 1OX5A 4RK5A 4KO2S 5UKDA 3RVNA 5AW4A 2WJHA 2Q9UA 2ZXIA 2D4AA 3D3WA 3L7OA 3QP9A 5CHEA 3TBFA 5JAIA 2QVLA 3D7SA 1T8SA 1XCOA 3ZNPA 4ZRDA 4PSUA 2XF8A 3P8ZA 4Q12A 2X0DA 2GKSA 2HQOA 3DE1X 1ZD2P 3VZBA 1QK4A 2QTNA 3GRKA 4M36A 1JPNA 5FTWA 421PA 1FDVA 5DNUA 4EY6A 1N36B 1QVFB 4NESA 5MN4A 1SGWA 2JJ2D 1QNLA 3BXGA 1C5KA 1XVLA 2G1AA 3PQ3A 4MIKA 1KY2A 1NBAA 1C3OB 1Q92A 1SKYE 3GI1A 3QVWA 4OHFA 4AI6A 4O5AA 4LDZA 4R8KA 5DGDA 4P2BA 4O63O 4CV1A 2GCOB 2Q4EA 2R7MA 4BOYA 2IPLA 3PI6A 3RVBA 1MXHA 1FTGA 2HU2A 1Z6YA 5GV7A 1RJFA 2F59A 2FRXA 3DAGA 2A7XA 1R8QA 1N92A 1QYWA 4MKGA 3VC2A 3GZNA 3WGUA 5BOSA 1JIIA 4MJXA 3AYZB 4CZ2A 4GDFA 4K86A 4YIKA 4RK4A 1EK1A 2BJWA 2VYVD 2OORC 5F4JA 3B2NA 1PV4A 2W6MA 3OPOA 3LBNA 4KDCA 5LB4A 4AN4A 2R6FA 4MW0A 2VK1A 3QVGA 3KV1A 4U7HA 4Y0VA 4P7JA 3TGPA 1MC5A 3DT6A 2IYVA 1M3SA 1M6NA 2DU8A 3U0VA 1ABBA 5GPBA 5AN9A 2VTEA 4DNXA 4B45A 4PM4A 3SBXA 2YZGA 1NOIA 1W36B 4I9FA 2I4NA 3E82A 4AJEA 2WTXA 1O57A 4LECA 4OI4A 1C2YA 1TC1A 3EXIA 4I4NA 4MHTA 3WHPA 1VSBA 2G3YA 3RH0A 3WRYC 3ASRA 3GD5A 4QICA 4DOMA 3BFVA 2J32A 2VWQA 5HP4A 4LZWA 3RCBA 1CRLA 2V6BA 4I6EA 3IOCA 2JGDA 4JMPA 1R8SA 4C29A 4EI2A 4RVCA 1HE5A 2FTKE 1C9EA 2ZYSA 4WUTA 1DRWA 3WRXA 3WZMA 2QLBA 4C4ZA 4EGJA 4QRHA 2JLRA 5B58C 3FCSB 4YJHA 1XTIA 3KZOA 1LLCA 1XQYA 2JF0A 2Q4OA 5CJPA 3SK0A 4X65B 2E6KA 2XI4A 5JD6A 1YZTA 3OQ1A 1S02A 1SA0B 3K1AA 3LGXA 2QSYA 4U1RA 4HT3B 3CC7B 3EMKA 4DB2A 4R1UA 4DXHA 4AMBA 4CT4B 1FFCA 3VPSA 2AC7A 4K0RA 3CLRC 2ZXFA 2GPTA 4JQYA 1U5CA 5A9SB 1TPYA 4JOBA 5EJ8A 3N2IA 3EOZA 4XD7A 1Q1BA 4BBAA 4BGUA 3C8UA 4RD1A 4UVGA 2UUAB 3VYRB 3CG0A 2VNAA 5SV2A 1NW4A 2ONZA 1W0KA 3VKWA 4MMYB 3NI2A 4ZVKA 1JR3E 2HSZA 2E5FA 1DXHA 1S9HA 4B35A 1FNBA 3PA2A 3KQUA 2QRMA 5AK5A 1F0YA 5GTDA 2PX3A 5CT8A 4L9WA 1M2EA 4IDQA 4TMKA 1JR4A 5IK2A 3ZE2B 4Q6WA 4X8IA 2ZUVA 4FFWA 5IG2A 1K9MD 5D1HA 1SB9A 2O2YA 3JWJA 2SKEA 4YJ3B 1C3OA 3ADOA 2BEVB 8OHMA 3ZLUA 1R50A 5D8DA 1JR3D 2BHSA 3A1CA 1GDDA 3CRNA 2CVZA 3OAAA 1FSSA 1XAHA 3MUEA 1KYZA 2PGAA 2FRVA 3A3KA 4UZSA 2JLYA 4MW6A 3AX6A 3Q8XB 4QDXA 2PYZA 4UZFA 3CUTA 3M81A 5IZCA 2QXUA 3VRHA 4D5EA 2BBWA 3SJPA 1DBWA 4AN0A 5L8VA 3KOOA 2JKVA 2FWBA 1NOJA 1XEFA 1N2CE 5JAHA 1YRYE 4LYJA 2ZRHA 2NO4A 4AX4A 4ZVQA 1G8GA 3EAQA 5LNK1 1SVSA 3HB1A 3EJ6A 3HS3A 4OA5A 2Y1WA 2KB0A 1BVUA 4X7DA 1SKBA 2P7HA 1FNNA 2QP3A 1JDBB 3HCRA 4UXHA 3WB0A 2FUKA 2NVWA 4P36A 1S1CA 1L7PA 5A3VA 2GPWA 4MR7B 4EITA 1AKEA 1GL3A 2YIMA 3BSFA 3RC2A 4O59O 2V0GA 5MFPA 2GBIA 2X4GA 1N3YA 3MCTA 1N6OA 3NV9A 2XAUA 3N7AA 4H1WA 1YC5A 2AF4C 4B8ZA 2ZE7A 2P62A 1XMJA 3QU7A 5LXTA 3G2NA 3W3AD 3U37A 1KYQA 2DBQA 3PQFA 2ZJOA 3PHGA 3UT6A 3ZCTA 1SG6A 2E37A 1T2AA 1E2KA 2FSSA 5HDQA 5IARA 1A8SA 3HVIA 3LPNA 3M6AA 4KNWA 5FO1A 3P0FA 3DTYA 2IWHA 2RHMA 5DYGA 3WK9A 4PFQA 1ZD3A 2E3JA 4L16A 5LDHA 4ZHSA 1X7ZB 1EE9A 1G8AA 1PJ5A 2OXCA 4B3FX 2PZEA 4L0DA 4U39A 2DFDA 3NJ4A 5TRDA 1YDMA 2HHCA 1W46A 1U2SA 2W2PA 3KKPA 2PKQP 4ZZ0A 1NUHA 5DW0A 3N2YA 1ZIOA 3B2EA 3RUIA 1AV6A 3DP9A 4LOAA 3RWBA 1BEUB 4N6GA 4QGSA 1TUGA 2FEWB 1IEXA 5U9CA 1SG0A 5ALYA 1Q84A 1F8XA 4FPXA 2PGOA 3INYA 3ZV3A 1NWHA 1OAKA 2J1LA 4NYMR 4TUYF 4YRKA 4Z5XA 4EFKA 1KAEA 1E6CA 1OAAA 1YR3A 1C1XB 5G4LA 2C3PA 3SF0A 3VUFA 3FIUA 4DMRA 1U9ZA 2IZZA 5JD5A 1UZLA 4C1BA 3LY5A 2VYCA 3QKSB 2IT1A 1QO7A 1IPFA 5GJVC 2FEKA 2CXQA 3L41A 3W4KA 4DMLA 2X1VA 3F1KA 2HBRA 3OIYA 5K0LA 4AN1A 4EMUA 1P62B 2Q99A 2L69A 2NQ2C 1R6BX 3Q3HA 1U9YA 2FEAA 3BXZA 3T3OA 4DDMA 5IKXA 2V6IA 3HMKA 3KLPX 3DMYA 1HYGA 4PWZA 5CXSA 3OPNA 4HRXA 2G0NA 2BM8A 5P8WA 2EDCA 1DO8A 3BZBA 3HXKA 1SQ5A 1YUMA 2FPGA 5EPEA 5ARDA 3UYLA 1J8DA 3CR3C 2XHEA 1E5LA 3N3BC 1DINA 4REQB 4WAUA 3SHFA 1AGNA 2M98A 3RBZA 3Q3JB 1DC5A 1NJID 1UP6A 1JLHA 1NDUA 5M34A 1JP7A 3IO5A 1T5EA 1QE5A 3ZY3A 1JQ5A 1FU4A 3HE3A 1JEEA 4IJ5A 4AYWA 2CBZA 4MJLA 1INLA 4KP7A 3RYCB 2HOQA 4GX0A 4RAOA 1XL0A 3RU3A 3KQWA 3R7SA 2OILA 1FNSA 4RJ2A 2AXNA 1B3BA 2X0EA 5IF9A 4RULA 4LSZA 3SDZA 4HCJA 3IUJA 4GPD1 3WYGA 1HDCA 4B2LA 3PG5A 1A4UA 1JR2A 5JAQA 3D8SA 1HLFA 3LRPA 2FWRA 4RQBA 4ZI5A 1Y4DE 1BS2A 1M74A 3BZUA 3EULA 16PKA 3R5JA 3GX1A 4RHUA 3H0KA 2Q1XA 3AM4A 3G9XA 4KQKA 4IDGA 1TOAA 4Q1CA 5GVRA 2HRDA 3VSBA 4CCSA 1RE1A 1KZGB 4NC9A 5TRTA 4ZHQB 2XNDA 3BMNA 3UV6A 4JLOA 1RWPA 1K88A 2YWXA 1N8RD 2ZI3A 1WULS 3AMVA 4TXJA 3E2IA 3RSQA 1FJ2A 5AVQA 2CRVA 4E07A 4X1KA 3E22A 2DLCX 1MPTA 3SC4A 4NNOA 2ZM5A 1X1RA 3LQQA 2BLLA 4FN4A 1DX6A 3IPYA 5CB8A 5IU6A 2B4QA 1NAIA 1Q7BA 3WQHA 3MJVA 3GRAA 5LQAA 2EFYA 4JL6A 1QWSA 2QTBA 4L73A 2QZPA 2BGTA 4EA8A 4H4DA 4LJSA 4L22A 2PFGA 4Z2AA 1H66A 1XP5A 2V7WA 3D1JA 1GTZA 1IHUA 2WW8A 5COQA 3ESCA 1U7UA 2HWKA 2E82A 4B84A 5JAZA 1II8A 2QW8A 2CNWD 5I7UA 3IAM6 4N8SA 2AIRA 3VTFA 2E4UA 3O4FA 2E7ZA 1Q17A 4K40A 5EJ2A 4RFSB 2XCTB 3GP8A 1RBYA 3HGMA 4YRDA 4F85A 4N7MA 1CHDA 1SCAA 5E8JA 4I3HA 4X41A 2IIBA 4BAUA 5L3QA 3EISA 4UHJA 5SYAA 5IK2D 5JH7F 1O95A 1P9LA 1BQ3A 2XDAA 1JNYA 3FNFA 3IULA 1PQWA 2W2NA 3L8MA 4TKLA 1JYSA 2V0NA 1PWZA 5ICMA 2PGJA 6REQB 4Z0NA 1R0YA 3W2FA 1EQUA 4JYMA 2JCBA 5KAMA 1QYXA 1I6KA 3H6HA 3HBFA 1AUVA 4U02A 3V46A 3DCJA 1VECA 5ITZA 2OGTA 4O0MA 1QVGB 4DMMA 2UZ1A 2BH9A 2GHIA 4RM2A 1Z4MA 1GADO 1T8WA 1G9SA 1YQXA 1Y3IA 3MGKA 4YQFA 1VXRA 4M7RA 1ZRMA 4WKBA 2O59A 1NW7A 1MMFB 2R9VA 3C8HA 1XQBA 2AOTA 3BRWD 2DX7A 3WYEA 2LTAA 1L7DA 3ROGA 3G5TA 5BNTA 3GFTA 4OPVA 2XRYA 2GT1A 5K8LA 3VR6D 3OIDA 4F3NA 1O03A 1LCIA 1NRWA 5JIBA 2H5EA 2QRPA 2R2AA 3SF8A 2Q2QA 4EA6A 4ZIRB 2XWQA 2XOEA 4JDPA 3U31A 2NSYA 3ET5A 4AKTA 2R65A 3Q7SA 3BFPA 3T3IA 2B99A 2O2JA 3PEUA 3ZWVA 5BWLA 3GLFA 3I92A 2W43A 5LQSA 2VUUA 3ACDA 3UCXA 3BMCB 3FTFA 2KQUA 3INNA 1JDSA 4PQGA 3DOFA 3P20A 1VLMA 1Y98A 3GCZA 4RACA 1UBLS 4G8BA 1UDBA 2C9MA 1QIMA 3QYPA 4ALJA 5BRAA 4RPBA 1V35A 2Z83A 1VI6A 4DCJA 2UUCB 4PO3X 4EKIA 2RJNA 5FLXA 4CKBB 1XP8A 3PD7A 2HA7A 3ILXA 1ISGA 1ATIA 3JAWB 1TECE 1JXAA 3DL7A 1XR3A 4FBLA 4IQ8A 4Q3EA 4LDNA 1A71A 4AJPA 5L6LB 1WP9A 3DVLA 3WB1A 5GINE 5FORA 1VQKB 4GD3Q 3O90A 5JHHB 1CU1A 1BROA 3CZRA 4AY3A 4NFSA 3GHHA 1B8NA 3DOOA 1W52X 3MJCA 3M3DA 2G67A 5IDYA 4GLBA 4PLCA 2V58A 3BMXA 3O4HA 1ZH6A 4PBTA 2PIAA 1V2HE 3ICPA 4MKZA 5FYQA 4G0XA 1M5RA 1FDUA 3HPQA 4Y2PA 1OLXB 1NU6A 1R6UA 1RKQA 4E5UA 2CVOA 4WRRA 3GL9A 1TF5A 2QQ0A 2VJNA 4TVSA 3ESXA 4X8HA 3K9NA 3RSZA 4OI0A 1L0BA 1HDOA 2IOHA 2FZGA 4LJ7A 1AQ6A 1YHYA 2R6GA 2YXNA 1MC1A 3RRXA 4B74A 5TGDA 5JD4A 1X80B 1D04A 2CMFA 3E5HA 2ZUTA 3SJCA 2FW6A 2N3ZA 3DXXA 1POXA 2IDKA 3GLKA 4V0MA 3CCRB 5AI0A 2M6LA 3TPFA 3JZAA 1R18A 2WT9A 5MF6A 2BGGA 1S2MA 1PV1A 3C3BA 3D4NA 2VK8A 4FJ2A 2WU8A 3TLZA 4AWXA 2VJLA 2CXOA 1YIOA 4OHMA 3BHNA 2FMUA 3LVRE 3Q10A 4BCDA 1WL8A 2NP6A 4N18A 2AZ4A 4HLUC 2V7TA 3AF4A 3OQ6A 3OZEA 2PM8A 4YAUA 1DO2A 2PBZA 2CXRA 3S1AA 3I2HA 1HE8B 5CLFA 3VYUB 4AUMA 3K94A 3OOYA 3TD6A 3TG2A 2OZPA 1TAUA 1E3JA 4WBSA 1ZVVA 3N6VA 2NN3C 1DIGA 2Q21A 4IIXA 1XMXA 4EDFA 4R40A 3FNQA 3C1TA 2A14A 2RK6A 2QTLA 2W4QA 4HEQA 5DYWA 3C6BA 5IAOA 5SYNA 3ECAA 1W1IA 3AKEA 3D0KA 3Q1LA 1VB3A 1UUFA 3DL0A 2Q6OA 1OW3B 3U9TA 2OBRA 2C98A 3VHQA 5AUPB 4J6EA 4BLVA 1OI3A 1ZXLA 2I3ZA 2QLTA 3K0CC 4GM1A 3PUZA 1W0KD 4XKWA 1VE3A 2CFSA 1UOOA 2H52A 4LZLA 3RI3A 1LS1A 1G2QA 4I08A 2DQ4A 4BP3A 4QPDA 4MQMA 5FADA 2QS9A 1QAOA 3EODA 1YR2A 1PNTA 2DFPA 2UUPA 4TV8B 4WFQA 4WE3A 3OHMA 3OC0A 3ZC3A 1QHGA 2KWIA 1GVHA 1PGPA 4DWOA 5A4AA 2GZRA 3LUPA 4AZ0B 1KFKB 3RYHB 4D3YA 4HQLA 3E3OA 1NMQA 1DOZA 5C80A 1Z0FA 2EWWA 3S2FA 1E7QA 1YMUA 3CKKA 1XNJA 3GJ3A 4FHDA 4RM0A 4LRSB 1OLSB 3CPEA 1XVUA 3NKFA 3Q9SA 4J07A 5DTRA 1ZM3A 4PZ9A 5KTTA 3PFCA 4AROA 2AZDA 3AWDA 4HADA 4EUFA 1MV8A 1YTLA 3EDYA 3V6MA 2QL6A 4HYEA 5A7HA 4PG8A 3RLIA 3H5RA 1C8LA 4IXTA 1YQEA 2JH9A 2CWDA 1PT8A 5G4KB 4HQRA 2IU3A 4UCXA 4Y2JA 4D4GA 2UKDA 3KQSA 4KK4A 3N0TA 1OB0A 3UCEA 3W5DA 4B0PA 3NFRA 1ZJWA 3OOCA 1KJJA 2X8JB 1YULA 1OWMA 5EKXA 4C04A 1I6MA 2GPJA 4M53A 3B5IA 3ETLA 1XSEA 4YECA 5I8PA 1O0BA 1L4GA 1LF0A 3QXXA 1CEYA 3PB3A 1WUIS 1QCCA 5KU7A 1Z15A 4AF8A 1N78A 2FUNB 4IH1A 2CDCA 4GI7A 4CM3A 5CW2A 2XYHA 1US8A 4KXLA 4IG9A 2IX9A 2RHLA 4ZAWA 5B36A 3H87A 3MLEA 2YV1A 2WC1A 2UXDB 3RFTA 2G08A 3IE0A 1P1FA 4J43A 1PJSA 1S89A 5THQA 1C8VB 1HETA 2A9QA 1FDTA 5CNMA 5DX8A 1C0LA 4PG4A 2HTEA 4FGWA 3U4CA 1KMMA 1RLOA 3SR0A 3E58A 5JZVA 4IVQA 1Y1QA 2GFIA 1L4EA 5CTAA 5EERA 3AESA 5FFFA 1JKXA 2ZVQX 5CBPB 3PQCA 2CNNA 5LQMA 1Z25A 5HNKA 3RTAA 4JJ4A 3B1WA 4PX3A 4B76A 3LUFA 3UT5B 4Q15A 1I4TD 2VXCA 4QXPA 4XORA 4LI3X 2GBLA 3N8HA 4H7PA 5EA2A 2ZI9A 3T9FA 3CVWA 2VYFA 4XYEA 3MUNA 3WXBA 3RD5A 1CRPA 5ALTA 3WLFA 3C8MA 4DC9A 1OH5A 1EFDN 2CLMB 1XCJA 1CR4A 3MT0A 4ZTBA 3SS7X 3NBYC 1B16A 4B6SA 2XDQB 3OEEA 1E3DA 4OTZA 3A58B 2ZTUA 1U8XX 4ALLA 2EP8A 1QFYA 2JJ1A 2GA8A 2JEYA 2PNFA 2X40A 1DVRA 2PQ2A 3D6NB 3KSZO 2JKZA 5CXXA 1YHZA 3ETHA 4DGQA 4UQPA 2R48A 2C5SA 3MJEA 4O2AA 3HCDA 3V80A 4CF5A 2FOLA 1ML4A 4LNUA 3EA5A 2B37A 1JPVA 2CE2X 2XITA 3RWMB 1U3CA 4ZCRA 2IS6A 1K06A 3RSCA 3DZ8A 4QVJA 2HK6A 3R0XA 3UJ8A 3H9CA 3MERA 4MRAA 1AGPA 2HDOA 2G4CA 1TM2A 4TL7A 3I2IA 4JOCA 1L1EA 3K8OE 2A9VA 3KR2A 5F73A 4V02A 4G6IA 4X00A 4OP2A 2OOKA 3OHSX 1R12A 1USWA 3C7AA 3BG5A 4L5YA 4G0QA 2CLOB 3HJAA 1ODKA 4DRXA 3K6SA 4HY3A 4MUGA 4E5MA 1XU4A 1C9KA 1PZNA 1A5SB 2PZFA 4DJFC 1ZJ5A 3PT5A 3GLRA 1YZFA 3EGXA 3M6XA 5BN4B 3VV2A 3ZDZB 1VFPA 5K0SA 4W9NC 1H2HA 2P8SA 2PRJA 3GT3A 4OUDA 4CLRA 5B1DA 3GFOA 1FVHA 3C4VA 2FX3A 1IDN1 1N2HA 4IDDA 4FINA 3SEAA 4HUJA 3HSKA 5KWVA 1LNZA 2WTBA 4GLLA 4E33A 3KXPA 5CFMA 1DC8A 1XPJA 1KVQA 1ZCJA 3ZHBA 1U4OA 1Z8HA 1P1BA 2GTIA 3UQZA 1J22A 2Q6LA 4TRMA 121PA 3TAUA 1NR7A 5KYTA 2I2AA 1ZWKA 3SJZA 3FJYA 4DPKA 5LP6F 4Z54A 1ZNYA 4GGMX 3PFIA 4J4BA 2YJ6A 4LXTA 1EFVA 5TPWA 5C4IA 2G7ZA 5JDCA 1OXTA 1XTJA 2P35A 4R2LA 1WPRA 1R4MA 2XKAA 4YP5A 3T7KA 1EP9A 1OWLA 4HPXB 1M8JA 4B3XA 1I4OA 1DOHA 1NUUA 2X5NA 2IHYA 3HZRA 1A7KA 1PK8A 2M6RA 5JASA 2TMYA 1QO0A 5CPFA 4KITB 1CUDA 5AI8A 5T67A 2XBUA 4G4SP 4ZVOA 3UM9A 4B3SB 1Z6QA 2JA1A 4Q4JA 2V59A 1HRKA 4HEHA 1E2JA 3DDYA 3PVZA 5JS6A 3RGWS 1U2TA 4ZICA 5BURA 1ESZA 2X19A 4Q3AA 4R1MA 4RWZA 3DOEA 2JAUA 4LPSA 1DX9A 1E89A 2EF0A 4CKWB 3ZHOA 1RMQA 5A1JA 1GUAA 3LC2O 2BFDA 5T57A 4WBNA 4YUVA 3K70C 3QLTA 3R5SA 2VO1A 1RC8A 1LSJA 5ALZA 4BFZA 2CUTA 5HZKA 1UDXA 3P0IA 4DZRA 4PLTA 5HZHA 1LNSA 5IBPA 3ASZA 4L95C 3V8RA 1ZDMA 3AW9A 3SOPA 1U3FA 1LK7A 4HH1A 2Q46A 3GLVA 1ORRA 2WYUA 4WOPA 1XOIA 2W2VA 5JQWA 1ULZA 3WAJA 2PWYA 5DNDA 2VH2A 4I4TF 1CRQA 3K9CA 1F8FA 1ADYA 2IXAA 2QUIA 4TVBA 3HG7A 4DC0A 4UJ5A 4DKJA 3HJHA 1CUBA 3KTDA 1VPEA 3NETA 4DM4A 5C1OA 1DFIA 2OVFA 1HMPA 5JY1A 3O74A 1TK2A 3HR7A 4R7ZA 5ALSA 1ZLXA 2CCKA 3QVXA 4DBZA 3V4SA 3TRJA 2PUHA 3BGDA 3GDWA 1C41A 1SD1A 1S2GA 1TYZA 4MIEA 2ECPA 3B60A 2VDLB 4R7TA 4RKQA 2W70A 3RJMA 2BH2A 1QH8A 2E9SA 4DQXA 3F74A 3CURA 3LUJA 3H4MA 2QZJA 4HL6A 4N9WA 4XQ9A 3THYA 2WM8A 1KRHA 4HQKA 1XVAA 4XYBA 3PFBA 2C58A 3HVJA 1USGA 4M8IA 2WUWE 4Q34A 2NU6A 5EKTA 1BVHA 4KE8A 3CMEB 4XEHA 2LCQA 3UGKA 5ADUS 3NHLA 4KQMA 4G0YA 3QEBZ 1KK2A 4E1AA 3V5NA 3C7DB 4RIGA 5K0TA 4H1HA 4AJHA 1NQTA 5K3DA 1T3GA 2RH4A 4NKRA 1CY1A 1JJ2B 1NM5A 3PR1A 3IHLA 5FBRB 5CLQA 5KNBD 1I80A 4DRYA 4WGGA 9GPBA 1GKLA 3IUPA 4PR0A 3MMSA 3DKRA 4K9MA 4RMGA 3PCRB 3TE7A 4OMCA 4EHDA 4G67A 2VCEA 1YGYA 1W6RA 1PYOA 1TPZA 4KWTA 3TUIC 3ZDEA 4ZCIA 3DYVA 5HM8A 1O08A 5HDBB 4MMZB 3G8BA 3K6KA 2QX7A 5IJ9B 2V1UA 4MVYA 4XAQA 4YO7A 1ID8A 2Z0MA 1LPOA 3WGZA 1VG8A 3UIEA 1DLIA 3QYFA 3CMCO 2VZ9A 2ZDHA 3X1JA 1I6LA 2YFHA 5G0SA 3TR0A 5IPFA 2CXUA 4K0KB 5FFMA 2UZ4A 3D7LA 1N05A 3OPYA 2XMQA 3PPIA 2HDHA 5IBRA 3TSCA 5C31A 2D5AA 5F4ZA 1ENYA 2CSUA 3I32A 3P32A 4M0DA 5KS2A 1Y9JA 3A4LA 2ZANA 4D4KA 2ZUUA 2VC2B 1HK7A 1LDBA 3M4NA 3EZ6A 4CEJB 1L7XA 2AK3A 3N8DA 2R8ZA 4ND5A 4F9FA 5DU2A 1ZMXA 1E58A 4G0PA 2H5JA 4MI9A 5FOUA 1CDZA 2O0HA 2J6HA 3PFFA 4TT3A 1VRVA 3FFWA 2PBRA 3VO2A 4JLKA 3WA7A 1I1NA 2IZ1A 5P21A 5HMLA 4PQRA 1K0UA 4DCVA 2QE6A 4MV8A 4P98A 5KOJB 1FPQA 4LDPA 1WTAA 4CMAA 3H1EA 1GA1A 1P1CA 1I1HA 2IW1A 3ZWMA 4C3ZA 3MJ4A 1X2EA 4ZXPA 1G8KA 3BZWA 3QTLA 4FKBA 3SNHA 4ZANA 1FYEA 3MWEA 1RYDA 4I50F 3FKSD 4FYKA 3LX8A 4U2KA 4WINA 2IPXA 3TIXB 1U2QA 1WJGA 2P11A 4ND3A 4CM4A 2WQ6A 1KJ9A 3RFUA 4OX9Y 3H3FA 4PSCA 4RZSA 4NJOA 2EJCA 3AEKB 4BNNA 4PC7A 4JJ6A 4BCCA 1M8FA 4TTAA 3IDFA 2HIGA 4LVNA 9LDTA 1FNDA 5JNTA 2WHRA 1XA0A 4QD3A 2QP9X 4R6WA 5KQLA 1C9YA 1VE6A 3E9MA 4X63A 3EDQA 2ZRJA 3TW8A 3V32A 3QXSA 2HIAA 2XUIA 3V4FA 2E85A 1VLZA 2FFQA 1ISSA 2O7RA 1XWFA 4S1PA 4DV2B 1WOSA 1AS2A 3IOYA 5JC8A 2RBKA 3LT2A 1NI4A 2EP5A 3AV0B 2IZ6A 3LK7A 4NYJQ 3FF1A 1SU4A 3CEMA 4LBVA 3RVPA 5K3AA 4AURA 4YAJA 3WDKA 1EG7A 2DWCA 5LDGA 4KC0A 4DCMA 1Z2DA 2G0AA 3F0TA 4FHFA 1MA0A 3IEXA 4TLCA 1DC6A 2BPOA 1ECPA 1LLDA 1PNQA 1TW2A 2ODPA 4XCVA 3D2LA 2Q4BA 4JSYA 1OXUA 1MR3F 2AWNA 2ZBVA 5BY2A 5K3EA 4BE9A 2K7FA 3CH7A 5K8VA 2ANCA 4W1SA 1ZGCA 5KNDD 5E4TA 3GFVA 3WFZA 2ZRDA 4QPNA 2C83A 4LAFA 4PONA 1RHJA 4WK6A 3UPDA 2EKZA 3LQYA 3CX4A 1L4YA 3VH2A 3ZD8A 3OQVA 4OM7A 4IDFA 1EGAA 5H9WA 4RLZA 1LBSA 4Y2GA 3ZE1B 4DQKA 5GV8A 1HDZA 1T25A 1N2ZA 1U7OA 3LBYA 2VPXA 3STTA 3I2JA 1AKRA 1E9VA 3E27A 2ZIAA 5IN4A 3GAAA 1LK5A 2ETVA 2XCUA 4QYIB 3NEJA 4XKJA 1YI1A 4DLWA 1Z0SA 1U0HC 4HDSA 4HQ6A 3CN9A 3VJMA 4E30A 3HJBA 2V7EA 2WAAA 3VHLB 2JANA 1T5TA 2XKBA 4Q02A 1HNXB 2ATXA 3V2UA 5JYCA 4H60A 3PE6A 1P81A 4JIMA 1OPRA 1XZBA 3B7WA 1JAHA 3RB8A 3TZHA 1NB0A 3C4JA 1EQAA 1GT6A 2UUOA 4CM4B 1KI1A 3M2PA 4KHZA 2GMWA 4QYWA 3L0OA 4E21A 2VYVA 2DPLA 2ZJBA 1NRKA 2H5IA 4V1CI 1BMFA 2ACEA 2PUWA 3ROMA 1KQSB 1QQ5A 1H1TA 4ZYWA 2V96A 1O4WA 2J3IA 3DLPX 4IIDA 3P0EA 3VC7A 1BH6A 3PXEA 1YO6A 2NSDA 3RPEA 3W04A 4C4YA 4F72A 4NCAA 1DZ3A 2R60A 2AOUB 3FGZA 5GZ3A 2BFFB 3FLMA 3BMCA 2PH1A 1RD4A 2W2OA 3TDMA 4PZDA 2HXSA 4WT7A 4DA9A 4XVCA 4AY5A 4FMCB 1RPJA 5EVCA 1TYDE 3PR2B 4TT3D 3PWZA 1E7YA 4Y1GA 1C0PA 3B6MA 1Q6YA 1VPVA 4FWIB 3JASA 4AD8A 2W83A 3A3OA 4JJFA 2DPMA 5LYJF 3NHZA 4YMHA 1H2ZA 3WHLA 4JJGA 4CM8B 5A4JA 1G20A 4ND1A 1W0JA 4P26A 2IIQA 1J0CA 1UBTS 3CU5A 3ET4A 5GONA 1MH9A 1PRYA 2VXOA 1ULUA 1W8IA 1ZZEA 1U5AA 3LKDA 3G9UA 4FGUA 3RS2A 1H2BA 2POCA 5K6AA 1VM6A 4LQLA 4ZRNA 3ETDA 4GC5A 1NBWB 2RHWA 1LDMA 1XPUA 4G0VA 3MMNA 2IZ7A 3A6HA 2WRZA 3GRPA 4XM3A 3ITKA 1Z6TA 4Q03A 1DRVA 3GV0A 2AG6A 2EL7A 4FHGA 4FJ0A 5J5CA 1LSUA 3OQBA 1VPWA 2CD9A 1W94A 1X7DA 4HZUA 2HYIC 1KFEB 5I4CA 1YD7A 2DUMA 3OP4A 4WHMA 5A7GA 3U9LA 1ZRNA 4U63A 5LP6B 3R9XB 3NATA 5KSPA 1KI7A 3L82B 2XCIA 4AO6A 1K7XB 4OFWA 5ILQA 3EVZA 5KQSA 1DE0A 3WQRA 2HFJA 1AHPA 2OHXA 2W6JD 5F5NA 4CIBA 1E3IA 4OHZA 1ILWA 3OCUA 4M9SA 5KJ6A 2IYQA 4QUJA 4X07A 1X3SA 4OPSA 1ICEA 1V4VA 3Q15C 5IF3A 1OROA 3DLIA 1E1MA 4MYRA 5KYVA 4FFNA 4MWCA 4AZ3B 3FPSA 1N6KA 2W37A 4NL4H 1K75A 3MVEA 1ICIA 2P6NA 1M10A 1XQ6A 4D96A 2P9TA 1K6XA 4JN6B 2GTHA 1Z8FA 2QD3A 3A26A 2ONJA 5I5EA 3FPCA 3RC7A 4IR7A 3WAKA 1G1MA 4PC3A 3QIVA 2D2VA 4FQ8A 4TPKA 4XIFA 821PA 4MAAA 3SQMA 3UAXA 4AM8A 2ZTNA 3EFHA 3NT2A 1G41A 2ARKA 1TM5E 1GZUA 2HUPA 1NP3A 2MR5A 4MEAA 1MOSA 4X6UA 5T3YA 3SCZA 3SY8A 1PT9A 1SCUA 1KVSA 4QFCA 3O4JA 3MG9A 1FRNA 4RIHA 4WD3A 2B8JA 4CF3A 3U3ZA 4D81A 4F3TA 3RIMA 2O8CB 3HI6A 5A1TA 1OKKD 1ADJA 3P4UA 2RHJA 1OV4A 3FKQA 4FSHA 4EHKA 1ZM7A 2QQEA 2I7CA 5HIJA 4QM6A 3IBCA 4QU0A 4J16A 4NXMB 1NNUA 2IP2A 5T64A 4DREA 4JI2B 1PZMA 4EHLA 5ABPA 3OD1A 3OM8A 4KGVA 4I1RA 5C8YF 3QX3A 4KREA 2ZSFA 4JX9A 1QLWA 4R71A 3QWHA 4ZOAA 1JDVA 4ZQGA 3HTXA 1KEWA 1RQ7A 2DH6A 3V2HA 1MVOA 3ROFA 1W5SA 1XT6A 2PKQO 2Z5GA 2PU7A 4XR6A 3BWCA 3F3KA 3IEUA 3U5TA 4NHEA 4DQ0A 2B34A 3ZU3A 1A69A 5F2NA 1GCUA 4L50A 3O82A 4MUJA 2PG3A 2AFVA 1M54A 1E99A 2X5OA 3AIMA 1C4XA 3GAZA 1KYYA 1B1CA 4I5DA 4RZHA 1VGRA 1P7ZA 2OHJA 4UC0A 5AXCA 2PD4A 1O6ZA 2A9OA 4DCGA 1KWGA 2EZUA 3BORA 2HJSA 5DS0A 1KNQA 1RBMA 3DR5A 3V7WA 2AFHB 4ABYA 3H5AA 4E2WA 4LK3A 5AHOA 2CMGA 3QPAA 4MS3A 1I2ZA 4LWPA 1GAQA 1QGED 2QDXA 3TXXA 3UYKA 3SC6A 4BVEA 3BA6A 5LMNB 1SM4A 3E8SA 3ELUA 4BQOA 4RD2A 3GC6A 3H83A 3LC1O 1BIFA 3MCVA 1PT6A 3FSEA 3VI4B 2GZAA 3OT5A 4GPTA 1XZFA 2Z95A 3PXCX 4ZYLA 2J33A 3IUEA 2Q9AA 4FGKA 4BDSA 3MTEA 2WA2A 5DVZA 5DM70 4LRYA 3RROA 2XGJA 3UMCA 1NBEA 2JH3A 4I4IA 2JAWA 1O9BA 3F73A 4KDFA 1GFWA 2C4UA 1SXJB 1VI5A 1WF3A 3MS2A 4MWSA 1GARA 4LCBA 1LRJA 1PR0A 1YU6A 2J6CA 4OP3A 1BS9A 4C5CA 4WZBB 1XN1A 2UZ3A 5EJ5A 3L0ZA 3K70B 2QTZA 2JLSA 3U80A 1CIVA 4AG5A 3JAKA 3OFJA 2WTUA 1WZ2A 1LLUA 1QCDA 5L4SA 4O29A 2FEXA 1KKMA 1QHHA 3FDJA 2GQFA 2J4DA 2QXTA 4EFDA 4BIMA 4GVLA 1T2VA 3TR5A 3G0OA 3RNOA 2HLDD 1OBHA 3NBQA 2VZ0A 4PXSA 3V1NA 3GVCA 4N49A 3ZE6A 2Y76A 1UKVY 4BTLA 2C3OA 4KZPA 2I8LA 1SBYA 1Q2UA 3KQPA 3FTEA 2WFMA 4UEKA 3OJOA 2Z2YA 3EGXB 3H13A 5GJWC 4A0GA 3NBFA 4KPUB 3UB3A 3CCLB 3TM4A 4CKEA 5DGCA 1TAGA 4QBGB 1H2YA 3T7TA 3ZIUA 5IX8A 1Q86D 2KLHA 4YI5A 3N05A 4Z3DA 4I7EA 4W9RA 6PFKA 4YAFA 1R9NA 1ZH0A 1RWNA 4LXUA 4GZ5A 3A3BA 4J76A 4MI1A 1E1LA 1QZTA 4FJ1A 5KTMA 3NO4A 1L3BA 5JFTA 4RLSA 3OWXA 5DFAA 2Q5LA 2ZSHA 3QF7A 1FFSA 3DAYA 4JEHA 4HIZA 1ZA1A 2R1TB 4P3XA 5AVOA 2GZDA 3IUSA 3L7AA 3NXKA 5B1SA 3EA4A 4BKUA 2O2DA 1JEYA 4RZQA 4EQ6A 2Q2VA 1UJBA 3NYWA 2UU9B 2Z2IA 2BKEA 3TQCA 3CP2A 1PJ3A 1JXMA 1XZCA 2XUKA 3JRNA 4XZ3A 4B6GA 1CUXA 1MPXA 2IJGX 3QUCA 2NU9B 2C2GA 3EPJA 1JDTA 3KWLA 1VE1A 4JGIA 1VP3A 4QXMA 1M1XB 1I7PA 1F8GA 2W0SA 3BYZA 3DWFA 4DA7A 1Z18A 1A1VA 2P0AA 2P9CA 3BWYA 3PNQA 3LO8A 1CNEA 4OF4A 4YLEA 4Z53A 4MS4B 4DK1A 3U7HB 3LCRA 3IEMA 4X7EA 1W1WA 2OO5A 1Y8AA 4CKWA 1A77A 1QPZA 1DCTA 1GLNA 1KSHA 1E8NA 3BIFA 4WW0A 5IDVA 1DT3A 3G0BA 4CQMA 4HRVA 1NJ6A 4LZAA 2CHFA 4PW0A 3TSOA 5DTQA 8ADHA 6ABPA 2WYHA 5CFPA 3Q8LA 3S81A 1E79A 1ORTA 2L0XA 4I19A 3J81k 3CP8A 1SVWA 1YRWA 1EWKA 1GIAA 3RSSA 3H75A 3QYAA 1UJ4A 5T6MA 3VDMA 4K6MA 5JPCA 1I7DA 1DV1A 5KTKA 1L5QA 2C5EA 3FFXA 3KEGA 4PLWA 3EFBA 5FUXA 2Z6AA 3LUHA 2GX6A 2BM1A 3FDZA 1SNYA 2WQ7A 5JWHA 4G0WA 4BQSA 3VC3A 1Z2NX 3OQIB 4DDWA 1II0A 1VB5A 1WCIB 1RRCA 4I4LA 2C97A 1ZICA 2UV8A 3D54D 1ONSA 3EXFA 4LTNA 5C7YA 1LVUA 5IDXA 3S7ZA 3PQDA 3BB3A 1A72A 4NOLA 1NC1A 3G6EB 1XV5A 2R6CA 3BL8A 3E1SA 5KNBH 1SQ0A 1GOTA 3GAFA 3HI4A 1XA3A 3B7PA 3BH7A 2PMEA 3U3XA 1YRHA 4BQEA 4MKFA 4P82A 3LQ2A 2XOXA 4TUYB 1Y5MA 1C80A 1F2UB 2WSMA 4TYPA 2CT8A 3EMBA 3L1UA 4MI6A 1XI2A 1IUKA 1VI2A 2RDMA 3NR2A 5A06A 1JEDA 3BTOA 3GGPA 3NAMA 1RQLA 3JD4A 3IB6A 1NW5A 1COWA 1SA0A 4PAAA 1I3NA 2C77A 3PI7A 4H7HA 4E09A 4Z0PA 3VV3A 5BSRA 2X2OA 1R0LA 3VZDA 1UH5A 2P5UA 2GB4A 4G26A 2WWYA 1BRTA 1NPDA 1NXOA 3QIAA 4GR4A 4PLFA 3ZHUA 5FUBA 1GG5A 4ZHQA 2OC9A 4NENB 1JLLB 3JQFC 3DDUA 3MWLA 3AEQB 5JY6A 2R6R1 1EEXB 4J75A 5CT6A 2NSJA 5GONB 1X0XA 1IC6A 1QP8A 1N1MA 1P45A 4UDYX 3W5SA 5LD2C 1MZPA 4RSHA 3E9RA 1O9HA 2WYIA 4IP0A 1PSZA 5EY5B 2GJKA 5F3WB 3LW7A 3LD9A 1SCQA 4J0IA 5K8IA 4ZVVA 5IC6A 3CN7A 1SBHA 5HE8A 4IIJA 2NXNA 4CRWB 1NMXA 4KGZA 4F8JA 1L8AA 3AF0A 2I55A 2YRFA 5IAGA 3ILVA 1M34E 1J07A 3G1UA 3I34X 2J9XB 3QU4A 4EB6A 1QH8B 4Y2HA 2FDCA 3QNUA 4U6SA 5FNVA 3FE2A 2I8AA 4Q37A 1N3IA 2I99A 3JR7A 1NT4A 5FT9A 1OYVA 2Q3CA 3COWA 3LBFA 4RORA 3NW9A 1FFGA 4BMNA 1FW6A 3HLYA 3N2KB 4IIBA 1ENOA 4PFJA 3ZVLA 5LR6A 3U60B 1E1RD 1I2AA 3QA9A 3WISA 2GOYA 4RCYA 3C8DA 5KC9A 3CUWA 4TZ6A 3AJEA 3IRVA 3HQ4O 5PGMA 1UK9A 5JZ9A 4NMWA 1QIKA 4TXNA 2ZE5A 3AERB 1YQGA 1ZK2A 2IHJA 4AIRA 1LLQA 3QUBA 1T8PA 1RI3A 2H1CA 4GX1A 4B3MB 2VK4A 1TKCA 2W98A 2EVWX 1XRRA 3CM0A 5JZOA 1QFMA 2IYXA 5A8AA 5J2TB 2YRWA 4OUKX 2NW6A 3CGGA 3NH9A 2V55B 2X85A 2BZ1A 3KWFA 2ZBUA 1GITA 1NPTO 2N75A 2QMEA 2SNIE 1BCSB 3EHDA 4RBNA 2KHZA 4WDQA 2UYHA 1N5KA 2FQXA 1F2UA 3H11B 3PFKA 4QHYA 1P7PA 1CE8A 5BN3B 1PQPA 3HY3A 2RH8A 1O94C 1QB8A 2YOGA 4OIMA 4Z86A 5KJEA 1NN3A 3B5JA 3JQFA 4P7KA 2Y99A 4QOEA 4D9HA 5HIKA 1KI6A 4AAYA 3MS4A 1EVKA 4ADSG 3PA8A 1KHHA 5EYPB 4A91A 3COJA 3EGDA 1WXGA 4GPIB 5ELXA 1OBCA 4P3NA 4BO1A 2D1QA 3RG8A 2H65A 5B4TA 1TFRA 5GOTA 3FUVA 3JWPA 3GF4A 3AXSA 4NBVA 3BCRA 1IULA 4OYRA 4PZLA 5FF9A 3V6LA 1ZHFA 3QE9Y 1WORA 4R2MA 5B1HA 1A76A 1OI4A 3ESRA 2GR9A 4EO4A 4A2QA 1C4KA 2ZRIA 3C3YA 2YV5A 4YB8A 3HP7A 3LY8A 2QYSA 2B7LA 4KLAA 1BAPA 2BAGA 3Q40A 1WETA 4XPIA 5H8WA 1UFOA 2HNAA 4HNHA 4N47A 3SFZA 3QFSA 4EP1A 3SHVA 5C5DA 2YV4A 4MS1B 3PNVA 3VU9A 2J0SA 4IIJB 3W9BA 5EKDA 4XRGA 1Z4NA 3TLXA 1IM8A 4IILA 3C6YA 1FP6A 2WJWA 4Y7DA 1K2VN 5GZ6A 2JIOA 2BDEA 1KP9A 2GYYA 3L9XA 4IUCS 3O0TA 2I3GA 3X1MA 5DHRA 3UJ7A 4EY4A 1E66A 3K5PA 2ZYUX 4MS3B 1QO0D 4KTTE 2FJ0A 2VUHB 4P58A 5TGZA 2X8BA 4Q7MB 3V55A 4ZMBA 3FBGA 4L72A 3EWNA 1F4PA 4YRMA 2PCJA 3PDCA 3REFA 2IBMA 3T7IA 2KLBA 2PA0A 1UDAA 4ZT6A 1EB9A 1MHPA 3FWNA 1WHSA 2OBLA 3L4KA 1HT0A 2W0MA 2A1IA 4G2NA 3FGOA 4WNCA 3QLVA 3UENA 3AEXA 2P75A 3MRSA 3KT8A 3GA5A 1QBGA 3GW8A 2P6MA 4K2HA 4NDAA 2O3TA 1L5NA 4DM3A 4CL2A 4I1VA 1ADCA 4G7WA 1YJCA 5E4JA 4JL8A 1WHTB 4TTTS 5CCXA 1IM5A 2C82A 2WZCA 3TN7A 5DT2A 1VJ1A 2HIMA 3DMNA 3DFIA 3KAQA 4FE4A 2AC2A 2EFHB 3KB1A 5IYZB 2OENG 2IIPA 3KPJA 3T41A 5DYYA 4BWGA 3WI7A 4YRPA 2R00A 4FUQA 4EVRA 3UO8B 5KI6A 5ES4B 4PBSA 3QOYA 5ER6A 3MJFA 2QD1A 3RT7A 2O57A 2FRDC 3NWJA 1R9MA 3TLEA 4J91A 4EYEA 1D4OA 3MOGA 4UATA 2B4RO 2YKGA 1GRRA 4REOA 1PS9A 4ED9A 1FC0A 1VMEA 1K1EA 1E7MA 1VXOA 2IEBA 3H2JA 1R4NA 3HJUA 4FT2A 3UXYA 1M6HA 1E1KA 1RVV1 1TAHA 1SK8A 2R62A 1O7JA 3T0IA 3ZGYA 4E0BA 1CQJA 2B69A 2TYSB 1BX1A 2X53S 4JI4B 3QKIA 5KYXA 1QPGA 5HTOA 2IZ0A 2X0KA 1T5IA 2QP4A 3CLHA 1PFYA 2BFFA 1FP7A 1IMOA 3T53B 1KI6B 1DJOA 4JUBA 5A4MS 1B6GA 4QNRA 4X45A 1QU3A 1TMYA 3ZS8A 2AI3A 5JJIA 4AKEA 1PUIA 3CW2A 3C85A 3SYKA 1AKWA 1JU3A 3S70A 2IEZA 2CHUA 3UJPA 5BSTA 4U7FA 4DILA 2J7KA 5A5DA 1V8ZA 4L4RA 1XGKA 4EM6A 1O5TA 4G0NA 2AN9A 5IAAA 4LF8B 1CEQA 4MDEA 1TF2A 2FSGA 1PE0A 4BQIA 1IEWA 3H8WA 3LHDA 1K2WA 2D7JA 3BHJA 1G2PA 3SQNA 3WNVA 1C3VA 1Y7HA 2GO1A 3R7WB 1HF3A 2F8TA 2E4ZA 2FP3A 2C4WA 4DY4A 4DA0A 1R9JA 3MTAA 3IAXA 1PEKE 1ONNA 4MSUA 4A15A 3CONA 4BWFB 2X4DA 2ATEA 3QBVA 4OQEA 4F3KA 3P94A 1DAOA 1ARZA 1A3CA 1GNRA 1UXGA 2F9MA 3GLHE 3KVNA 1VJSA 1R66A 3DEAA 4M1MA 4TTVA 2HC9A 4URUR 2B8EA 3S7TA 4D4IA 5BSWA 3JW8A 4H0FA 1SCNE 3ULKA 4BFVA 4DLTA 2ZJYA 3NDPA 4D8UA 5IJ0B 4L4UA 3VR5D 2FI1A 4KR3A 4F4HA 5AVTA 4C3VA 3A27A 3U3OA 1ZIDA 1F6WA 4WLEA 5C5EA 5LLSA 1PZXA 4UUOA 1YC2A 1NN0A 4K9DA 5EJGA 2YXLA 5EHZA 1XU7A 2WVHA 1A8HA 1N2SA 1EU1A 4AQDA 4D92A 3WLOA 2PZGA 3MCUA 5ECWA 2GYWA 1N2JA 3FMIA 1SXJD 1UXIA 4HAXA 3SR4A 2WWRA 4CMHA 5BUSA 2FZEA 4G8DA 2ZWIA 1RSZA 3QX7A 4XVHA 1K7CA 1FE8A 4D42A 1PVOA 2HJVA 4CQLB 4WZAA 4CXMA 1UL1X 1TD1A 3MMXA 4Q7QA 3HYCA 3N7TA 4XDHA 3REGA 4MVJF 4XYMA 3BIOA 2D5CA 3FCEA 5HEKA 2SECE 2AFIA 3CZCA 1W93A 4B3TB 2A5DA 3ZVRA 2R5NA 3H0CA 4UBOA 1Q57A 3KU1A 1G66A 1Z82A 1F12A 3HEAA 1CETA 3PJDA 3TB6A 4DBLE 1FTWA 1TCVA 3O2JA 2WVAA 3W2IA 2VKQA 4RK0A 3O95A 3UUGA 4E15A 1H4VB 5BQ5A 1DGQA 1W19A 1OLOA 2OCAA 1J42A 2VEDA 4JT9A 4J4HA 1YFJA 4H2DA 2BEJA 5AHWA 3S3TA 1MAAA 2OV3A 5EC8A 3B1XA 3CXRA 3R76A 3L6DA 4J2TA 3C0KA 5CGZA 4FE7A 1A96A 2FSVA 3KL2A 3ZQ6A 5BPFA 3PUVA 1HORA 2EFGA 3DPSA 3PLRA 2V7QA 2DSNA 5D3QA 4CCYB 2PUBA 1RT9A 2I3BA 1T13A 5KYYA 1IJEA 4ESHA 3VR4D 4UVIA 3HKBA 3HN6A 3JPYA 1NUQA 2WKRA 4CNBA 1RRPA 2WKSA 3LDHA 1WNTA 4BTVA 4E2FA 5D7NA 1P3JA 1OD6A 3ISTA 3PHBE 2IVZA 1WCV1 2OV2A 1QIIA 3F97A 5HJ2A 1WMBA 5FH9A 3KQVA 4Y9UA 1XTSA 1X7XB 3ECCA 3IT1A 4E94A 1IBKB 3RVDA 1HNNA 3L77A 3OX4A 4ENPA 2AQIA 2WWIA 1RIFA 2NYVA 4L07A 1R88A 3SIXA 2DT5A 2O4UX 3JALB 4HFMA 3IYLW 3MWGA 3VJKA 3QOWA 1M1KD 3DZBA 3DYIA 5J4HA 4WGFA 1TVKA 1BN7A 1WUKS 5AESA 2YNMA 1SKUA 4UBLA 1WX1A 4DJ5X 1U2ZA 1QCZA 1VG1A 2QVZX 2WMNB 4ANFA 2I76A 4BQQA 1U2GC 2BHNA 2H29A 2PYIA 4XONA 3D31A 4DN6A 6LDHA 1VQNB 3ONUA 3GLSA 4PRKA 2WFAA 3P2MA 3B89A 4N5DA 5E6UA 4V38A 1SKMA 1E4OA 1R0KA 3K3PA 4EPXA 3CF2A 4LV5B 1JHRA 3RY8A 1DO0A 1R5JA 1FQOA 2C2YA 2X6RA 3K4HA 5FCDA 5EFZA 3K92A 3X43A 4FFRA 1TA4A 1AXGA 2AFIE 3AU9A 1P7WA 5CVVA 4UUAA 3TI7A 5LWHA 2MJLA 2OGWA 3EGVA 4HNRA 1W2GA 2X3YA 2NOAA 4JOQA 3ZWPA 3ZW9A 2HU8A 2Z98A 1GZHB 1SU6A 1EAMA 2Q8NA 3F2IA 3G8AA 1WCXA 3UATA 4EGCB 2GD6A 3FPHA 3K6JA 3A36A 3HXLA 1VE7A 3L7BA 3HWRA 4LW8A 4M9UA 2F62A 4M9RA 5JXHA 3EEBA 3ZDYB 1Y6FA 2EOAA 1SHLA 4YRSA 3PNMA 4RL4A 5K6AC 2OV8A 1GPYA 2WMYA 1MOQA 2YQ5A 4JC4A 4OV6B 1LBEA 1T5HX 3R23A 2OGZA 3HA3A 5BSEA 4XLAA 5B5SA 5JCZA 1F6BA 3KTFA 1XN4A 2CVHA 2PLWA 1GP2A 2HJGA 2QJTA 3RV4A 2M6SA 2PQ6A 4W5TA 2C2MA 4KR9A 4E70A 4I9GA 4AT1A 4ZI2A 2AK2A 3X1KA 3A70A 1XXHE 1ODCA 1P8AA 4IIJF 1L5ZA 1U9IA 3U0BA 1ZJYA 2WDPA 5NULA 2WNIA 1O4VA 2C99A 2ZBPA 1Z12A 1Y6JA 1GZDA 1VL8A 2IHKA 3UC5A 4ZN6A 4RA9A 4Q9LA 1ZX1A 3HA7A 2GAFA 2B78A 1Q1AA 2W2XA 3KKEA 2BTQA 4GWGA 3GB9A 1BJKA 4LRTB 1NQWA 5CM8B 3C3CA 1J90A 1EX9A 4JLUA 3RYIA 2VBUA 1Z06A 2RHTA 2KPOA 1OLSA 1JHZA 4A5SA 2BD0A 1EM8B 2WJVA 2PT9A 3GXOA 2VL7A 4ROSA 5EMMA 1L5OA 3MB8A 2CFOA 3JAKB 4I1PA 2WHPB 2PXAA 3V1TC 3SMQA 1C8KA 1VIDA 5AI9A 3ERCA 4BO0A 1D6SA 1JFLA 2X1HA 1GSOA 3LGAA 3HJCA 1U31A 3LSYA 2CLDX 2F3PA 1V48A 2EAUA 2GZ2A 2HCTA 1UQRA 2KI5A 4KGXA 3W8FA 5FPYA 2KYRA 1TYEB 1E1RA 2PLFA 1QYCA 1NQ5A 1R4AA 2C4VA 3PQ5A 3LQEA 1WEKA 3GD7A 3LNCA 3AL0C 4IGFA 5BV0A 1XTPA 2JDID 4ZVUA 1GZ7A 1V3UA 1VMKA 4AZSA 1ZJ4A 3M9WA 3AUTA 3TQTA 3WLEA 4EVQA 3EX7C 5A62A 3WLQA 1FBNA 1G98A 1RQNA 3ZJVA 1CVIA 4HDCA 4WY8A 4MXDA 1VLQA 2C9ZA 4R0VA 2RG1A 5EJFA 3U62A 2BEWA 4BRWA 3ZHSA 5K6RA 3ONWA 1VL5A 3H1BA 1XD8A 2EYUA 5CYFA 2VBTA 1ORDA 4B4OA 1FJXA 3DONA 5EPOA 4FOOA 4B75A 5A6SB 2FLVA 1IATA 3NUGA 4TXHA 4BFXA 1MZVA 4YCMA 3AVQA 2G40A 1XKQA 3QPCA 1AQIA 3WLRA 5LZ2A 1GM5A 3DTTA 3CZ5A 4R2WA 1WW8A 4PXAA 5K3FB 4P0QB 2QR2A 3WWYA 1VMDA 4PAWA 1WKVA 2HQ1A 1BWSA 3AESB 3B5EA 1A97A 2G9QA 3G2KA 3IQDB 3KT0A 1OFIA 3MWDB 4KL8S 5IABA 2QRVB 1T1SA 1T5DX 2IHUA 3SZUA 4GP9A 1VKJA 1Z2PX 3M89A 3CRMA 4JWKA 4R7GA 3FYSA 5E2BA 4ZYTA 2Y1FA 4PF1A 1QF6A 2BZ0A 5A0FA 3SU8A 1QMPA 3DHWC 1UBJS 4NFHA 1XCGB 3M9LA 4G1CA 3W77A 3RE1A 1IQ0A 5A3SA 4I4TB 4ZT4A 2A3RA 4QJIA 1NZFA 1X13A 4QOJA 4GDMA 1TQ2A 3AIOA 3L0YA 5DXAA 5A6VA 2QJOA 5D1NA 1AGXA 3FUCA 2HBZA 4OYYA 2HRZA 4HXGA 5DCWA 4DSOA 1DJNA 4CV0A 2C8VA 5FEUA 2C7QA 2W6ID 1XAJA 4HF7A 1VLLA 4MUKA 4BEWA 2J0EA 2FZ4A 3UKDA 3I01M 1T9GR 3FNEA 4FIZA 1OZ0A 1JU9A 3ZQKA 2A58A 1T6YA 2QX6A 3E23A 1UBNA 4PZAA 1EBUA 1KJ8A 1NE2A 4IDEA 4RESA 1EFUA 3ORYA 1Q74A 5D84A 4QLBA 2JS7A 2P2GA 3DSRA 3C3DA 4U5XA 5DEIA 4C01A 4UNSA 1UEJA 3IUNA 3F6BX 1L6RA 3CSDA 3KYIB 2PMCA 4IOLA 1RQ2A 3FHLA 5AKIA 1UKZA 2QN9A 3WWZA 4AJ1A 1EK6A 1K7SN 4MRRA 1QVAA 1XDUA 5K3OA 5AI5A 5JWRA 2AOVA 3PWTA 1SUIA 1QVWA 2QVXX 4IYJA 5FI1B 3D5TA 1T5OA 2CNLA 3HBJA 1X38A 3IEPA 2YUTA 3BXEA 1KDVA 3UWPA 2BGNA 4RSGA 1JMKC 1YZYA 5IUNC 1GFZA 4H27A 3WQZA 2O52A 1XNQB 3D3JA 4OB8A 2DC1A 2HL6A 2GETA 4LTMA 5EWJA 5F9MA 1E4EB 3T3GA 1MCZA 1K98A 3UHAA 4D8YA 2ZIXB 1VG0B 2HI0A 3K1JA 2YXEA 4LF6B 4J29A 4PHFA 3D0QA 1P1RA 2ZM6B 5KVVA 5AOVA 3GJSA 5FTLA 3N9IA 2VBCA 4PZYA 4N7JA 3GBSA 1NRXA 1U9JA 4QOGA 2Q5CA 1UOPA 2FK8A 1V95A 3TUZC 3LO5A 5KYNA 3SZOA 1CJSA 3BBPA 1H5UA 4WVFA 1I4DD 2CCGA 2SBTA 3BUSA 3C4QA 3D6VA 3T7SA 2DETA 2EW8A 4Y2UA 3SICE 1LS6A 3I72A 3T4UA 3CNEA 2VP4A 2PJDA 4JGBA 2P9FA 3KYJB 3WQQA 1HH4A 4XIYA 3WGMA 1T2FA 2DWPA 2EFJA 3WGYA 3TZBA 2ZTMA 4WY2A 5JSUA 4IQ4A 3DQZA 1S8FA 4F11A 4G0UA 3DJFA 2IEDA 4LHEA 4OJNA 1FMLA 4NJMB 2JFYA 2Q1UA 4OPMA 3REOA 1EDOA 3GRRA 3ZJTA 2X22A 2HJ9A 3PIDA 2NQTA 3QUAA 1RWQA 2HCBA 2R6HA 1U8ZA 3DHVA 2H18A 3R40A 4G1MB 1X6VA 5I9IA 1MO6A 3OQNA 2JGAA 2GEJA 2DWUA 1NKSA 5KVSA 2XMDA 4QM7A 1MDBA 4LBZA 4Z4QA 3ON5A 1XG5A 1ZU4A 2OGUA 3GNQA 2A0KA 2ZRAA 1ESMA 1MW8X 3QNMA 4IL5A 4OKNA 4YONB 2WSBA 2EGHA 3NP9A 1NF3A 2HQSA 3OFVA 4PPQA 4UTZA 4BO2A 5AW3A 1M1YB 2EXXA 2VJMA 5EMLA 1L5GB 1AGYA 1DCFA 4FOLA 5B1EA 3VUEA 4Z4SA 1REQB 2L2QA 4C08A 4FX2A 1SCIA 3AUAA 4XIJA 2X9NA 1XQ9A 4MUMA 1Y81A 2A30A 4W7IA 4TKOB 2I1VB 4DVJA 4LOHA 2RHBA 1R10A 4UHHA 5JC1A 1C0EA 4HR7A 4E5NA 2QM7A 3G2IA 1B2LA 1MTOA 2BI8A 4QNMA 5AM5A 4ZEXA 4DA6A 4RDXA 4YCJA 2CLHB 4RANA 1ZNXA 1JHDA 3LQFA 4D74A 3I9OA 4EB0A 4C7JA 2GM5A 4XRRA 2ZKIA 4BE4A 1IHOA 4IXMA 4IKOA 5C8YA 1TQ8A 4CEHB 2B82A 2ZYIA 3BGSA 3G2PA 4LOLA 1ODJA 2OV1A 2VXBA 4JJ8A 4AECA 2OECA 3FGPA 3FZNA 4N7BA 4XTRA 2W6CX 1UKBA 3CCEB 2HREA 3DVSX 1MU0A 4IV0A 4R54A 4V2IA 2I6SA 2VJPA 2VJQA 2AW5A 4HYYA 5EWLA 3OFNA 1CYEA 1LD3A 4ER0A 2B25A 2G07A 3OTWA 4DQUA 4LSGA 2MYTA 4UNNA 4HSEA 1QF9A 1U7DA 4OP7A 3UUWA 5LFAA 3WNDA 3QK7A 5LU9A 3PKIA 5CCEA 2PMFA 5HQ3A 4GOKA 1RZRD 4GBED 3A3NA 1AE1A 3R75A 1XB2A 3TW6A 1Q1QA 3BC9A 4YREA 3MJSA 4D8WA 5JTUA 1NMEA 2GEVA 3SLKA 4QLOA 5K99A 1XELA 3KTAA 2Z6QA 1BXGB 2NXJA 4KN6A 5DWVA 4KR2A 1GFIA 5FTKA 5CB4F 3U3RA 2RKOA 4HWTA 1VBNA 3HY6A 3VXKA 3C87A 4JP8A 4E11A 4X91A 1RRVA 1R6AA 1K8AD 1ULBA 2BMWA 3A1WA 1D1QA 3GEBA 4O8CA 2BHLA 3W1WA 4RA6B 1NX6A 1XYGA 4Z4RA 2VP2A 4ZODA 5FOSA 1HYHA 3T3HA 4XLLA 3U7RA 3UMBA 1ZL2A 4FGLA 4B9AA 3WO1A 4IPTA 2D0PB 3JQ9C 2NG1A 3PCTA 4I9UA 4L2IB 4QA9A 4G4IA 1BC5A 1DKPA 2K5UA 4P4GA 5C8XA 2O5VA 3EYAA 2EL9A 3HUFA 4BMYA 1Z37A 2HXYA 3BMQB 4MQ5A 1UMBA 1GUBA 2CUKA 1A2QA 1USKA 2QHXA 4YAWA 3F7NA 1K63A 1T9CA 9LDBA 1WNFA 4BY9E 3KDAA 5BVGB 3NIWA 1GPNA 1YOBA 1X92A 1BZYA 3FMOB 3JARA 1Y5NA 3I01A 2YX1A 3A1DA 1QLHA 4XPZA 1MABA 5IC5A 3M9XA 2V54A 4B71A 4EF6A 4CQMB 3HDVA 3M4YA 4DIEA 3P0HA 3B38A 4H0NA 4M8KA 4EDHA 1J8QA 1C7QA 4K8RB 2D1TA 4TMWA 4XWAA 3TMYA 3VZQA 1HM5A 4LMAA 3ZGLA 4DLNA 4H3KB 1MORA 1KD1D 4JR2A 3URMA 1GPH1 4B31A 2HHHB 3HKEA 4X7BA 3S2UA 1S3SA 1R9GA 1I3OA 1Q0PA 1X7HA 2AR9A 3C1OA 4L5CA 3AVOA 4YAIA 1RXYA 2BF7A 3H9JA 4NV3A 4OHUA 5F1KA 3IFSA 2PSDA 4OIFA 4AO7A 3C6KA 4H3HB 5JECA 1ZUWA 3VKHA 4RXTA 4UFPA 4MK4A 2QIPA 1AKTA 1CEXA 3JWHA 1AN0A 1F8YA 2HJRA 3SXJA 4B73A 3GFRA 3IV7A 4Q1EA 4X7CA 1TRHA 2AYZA 1IN4A 1X42A 4R81A 2CD7A 2H2WA 3BCDA 2Z2KA 2OPBA 1IWPB 2R3SA 1WU7A 4GMXA 1LZLA 3KJNA 4RTLA 2JLVA 4YJFA 5DTEA 5JJ5A 4M49A 4UBNA 2HLHA 3BCUA 2WHYA 4B80A 2AKEA 3EB9A 3EQ8A 5IT4A 4ZMSA 4EVIA 2Y1KA 4YPFA 3SEFA 4RETA 2IYNA 2OHGA 5F2KA 3AGQA 2AX3A 2DYIA 2BE9A 1PL8A 4M38A 4PZPA 4RH3A 4YTEA 2D9RA 1BE1A 1V1MB 2GA9A 2Q7XA 2Q5OA 1U6JA 3ANMA 4HUQA 1L3CA 4CI9A 3T3EA 2CLSA 5KNCD 1R5OA 3U6BA 1A9YA 3S8YA 2GLUA 4FCTA 3D7RA 4L4ZA 4CTNA 2YW9A 3QHQA 3A9RA 4CR7A 2WDZA 1G5IA 3MD0A 5CURA 3KKZA 2I5PO 5F12A 3VNQA 3H2HA 3C3MA 1PZHA 4GF5A 3GPDG 3QPVA 3QLJA 5LPNA 4RCZA 2XZTA 1EAYA 2YFYA 5TQVA 4BU1A 2QJWA 3TTXA 1ADBA 4BTEA 1LPMA 3CV3A 4G25A 3W8DA 2Q5JA 2VJAA 4QU5A 3GSIA 4ALKA 3K1ZA 2I1QA 1UQUA 2RARA 4J1NA 4CLHA 5JRZA 1ZJ6A 2REBA 4TWJA 5DW3A 4AJLA 1JKMA 3A1TA 1SUBA 2PVPA 5DEOA 5FPQA 2OCGA 3SS9X 4CG0A 5CIYA 4FI3F 4DNTB 5AVKA 3TIFA 3QELA 2PLAA 3WGKA 2JFVA 4EG7A 5K0ZA 1Y48E 4Y0NA 3RODA 1B7GO 2NUAA 4HGPA 4N0DA 1G8HA 2CMDA 2X7HA 5IJAA 3HLTA 2VXYA 1H85A 2DFVA 4M9XA 3PC3A 2C2KA 4OFXA 4QIHA 2XMBA 4ZEMA 2B2XA 1EQ2A 2K6GA 4TSFA 2J0UB 3WSWA 2JI7A 1U5BB 1LGYA 4AJNA 4M1YA 2FWJA 3HPRA 4Q5IA 1FFXB 1C9DB 4PZEA 1CS4C 4QUKA 3QU9A 3PA1A 1E5DA 3AJAA 4OHKA 3I9MA 3TNYA 3EZXA 1MB2A 5JS1A 2W42A 5DF1A 1DARA 2MSNA 2V8BA 4F3CA 3HXMA 1UK8A 1DQRA 4NFLA 1X14A 2QK4A 2XNCA 2C29D 3RUHA 5J2TA 4PQEA 3GLIE 3TECE 1FDWA 1GZVA 3ELBA 3ENQA 1G2OA 4QC2A 5KYUB 1U11A 3IKMB 3IJEB 4OSPA 2JG3A 3UV3A 4L15A 3IAHA 3LE8A 5FX2A 3JU3A 4G01B 5IDQA 2ZBGA 3TW4A 4ER3A 1PHPA 2O3RA 4D82A 1W29A 2Q6IA 2H1RA 4IFEA 1Z26A 1S3FA 2WWWA 3EHEA 2ZIXA 4WCDA 4WK2B 2NM0A 1RXSA 2P9QA 5ALUA 4DIFA 3P4YA 1ZRHA 2A0UA 2REQB 1KDOA 3Q7QA 5FA6A 4XVRA 1Y1TA 3U17A 1E3WB 3F4BA 1WKBA 3WJ7A 1FIUA 1F4LA 1CY6A 2HXGA 1TE2A 1QIDA 2G4VA 3MHTA 2J5XA 3CO5A 4KOEC 1CS0A 1J0BA 2VQEB 5LQRA 3EIUA 4BBZA 2CXNA 2QQGA 4DCSA 1RQXA 2IL1A 2JIZD 2PE5A 3WIVA 1OFHA 3RAGA 5DGXA 3FRJA 2QTTA 3FCCA 3LOPA 1G20B 2VJIA 4WOJA 1YQTA 4WJKB 4NDNE 3G23A 1LWOA 5SZKB 3TCXB 1USIA 4QXOA 3WNQA 2HIHA 2IUFA 1Q7RA 1Z0AA 3WSTA 4JBWA 1FUIA 2E0IA 4WX2B 3I28A 5AJHA 2AWOA 2ON6A 5AT1A 2OTLB 3KV3O 3LW8A 1R0XA 5C0OE 7REQA 5BSFA 2J07A 5EE1A 2C00A 3FROA 1GPLA 3H2SA 4QE3A 4P3IA 3RAPR 2A0YA 1U1GA 4YV1A 4F2HA 1BMDA 3PNLA 1UC9A 2CL0X 1DOAA 3NQ41 4NR0A 4XLTA 3ZYCA 4BX9A 3BXOA 1WOYA 2NUAB 2RJ3A 3JYHA 4A6PA 3KDSE 4MB2A 2JGJA 3CPJB 1I0IA 3K9WA 4FFDA 5I3CA 3K2QA 2NTEA 4FMBB 1NVEA 2Q6VA 2OEPA 2WQZA 2AKYA 2VJYA 1N2BA 1R6DA 1R8JA 1W6UA 1S01A 4PIMA 3IEIA 2D7CA 2O54A 2Q1WA 4J90A 1XLUA 3KG2A 1NW8A 1SXQA 1KMIY 5SY6A 1T0IA 5HFNA 3T1HB 3DBRA 2VHQA 1PS0A 3BH4A 1Z74A 2VAPA 4MPTA 4AJIA 4EL0A 3CKLA 1C7IA 1URPA 2QE7D 4L85A 5JSZB 5KOIA 4BJ1A 1F3LA 1CK4A 1K8ZB 4UKDA 3BJMA 2ZCJA 5DYTA 2O9JA 1MT3A 5J1TB 2WF7A 2LIVA 1C7ZA 2X5XA 2M1ZA 4QBTA 3SFVA 3WZ2A 2WF8A 4HTFB 5JCJD 3W2GA 2ORIA 1T9GS 5DT9A 3ASUA 2XUOA 4YXFA 3V34A 5JQGB 4JY7A 2J6IA 2WILA 4Q9NA 3RABA 3UG7A 2JCYA 1F4VA 2BFBB 1ST3A 2JGKA 3NT4A 4JA2A 3RS7A 2CVPA 2YQZA 4IMJB 1RMYA 4M9ZA 4PLZA 5KSOA 4NOKA 4X62B 3H84A 1PJ6A 1NVUQ 1YK0A 2CK3D 2CZGA 4BLTA 4CE6A 4BQRA 1VSVA 1M8KA 4YJ2B 3ZXXA 3G1WA 3ZWXA 1S2LA 2P77A 5TR9A 5K05A 3AVVA 1I5EA 1RLMA 2G7MC 2RHCA 2PL3A 1U28C 4F5WA 5DHUA 3G79A 3ZV5A 1SWWA 3QVSA 4TM8A 2GRUA 1W35A 5H16A 1TD9A 4JJKA 2IHVA 3O47A 4N5HX 2W00A 2BDTA 3VAYA 1L5SA 4RXMA 3SI7A 3NT5A 3PJEA 2BFCA 4POOA 2SCUB 3BWEA 4A6DA 3EVFA 3ANSA 2Y6VA 1NSFA 2Q9BA 1VCHA 3NHAA 1NN1A 2ILTA 4MVCA 2X0FA 4PVDA 3UJHA 3VR0A 4CUKA 1VDMA 3NJRA 4LF7B 3GRVA 1VKHA 4MWDA 3THSA 1YZNA 3W7VA 2GVZC 2XGSA 1G60A 2VHWA 4L2IA 2MOKA 1QF7A 4B3IA 1VBFA 2HK8A 3I73A 3NV7A 1XZKA 3R4CA 1CF2O 5BQOA 5AVZA 4DR3B 4DA4A 1RPAA 3H04A 1P0QA 2BKXA 2IITA 2OHOA 3HU5A 4LRQA 2B4AA 4RPJA 2AE1A 4MKIA 4J16C 4QRIA 1KJYA 2ZRLA 2IQIA 2SKDA 3I05A 4B7UA 2NAFA 1I0LA 2YMPA 2CVQA 1EX6A 1DXYA 1H2WA 3U49A 4C2UA 4LS3A 2IYOA 1Z62A 3Q39A 1FF9A 4G5GA 1XXLA 1ZBQA 2ADOA 3H3XA 3R5XA 4IDNA 4JYPA 4NEGA 4GBMA 1Z7BA 2D62A 5AOBA 3WS7A 6Q21A 3LY9A 3AKYA 2QRGA 2IH5A 2W6IA 2PEZA 4QELA 2G72A 5BV1A 1KIMA 3ITEA 1BE0A 2DQZA 1P2TA 2PS9A 1WW2A 4WUVA 4ECAA 5LQUA 4H18A 4RTJA 3CNHA 721PA 1RLUA 2AD5A 3KR9A 3UXEA 2W6NA 2YDXA 2Y1CA 5TNXA 5A5FA 1RJWA 2J8ZA 3JQ7B 3CMMA 2QT9A 4JBHA 2H6EA 3AFNA 5ADWA 1KC8D 3ZBUA 4IBOA 3I6IA 3I6QA 4FTWA 4YLYA 1GGEA 3EEYA 1PD1A 4FQ7A 2A9JA