3CRZA

Ferredoxin-nadp reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
257
structure length
257
Chain Sequence
SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP+ reductase
publication title X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 79
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3crzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3crzA02
1YI2B 3CCSB 2DETA 1KK1A 1VQKB 3W2IA 1EP2B 3WBJA 1N0VC 3QFCA 4RD1A 3SJZA 1W2BB 4ZCIA 1ZUNB 1N8RD 1DARA 2VZLA 2QMUA 4Y9RA 1ZM9A 1CNEA 3AVUA 3W2GA 3W5UA 4ACAA 1FRNA 3VNUA 4YALA 3QFSA 4Y7CA 4R71A 2FX3A 3CB4A 4B4DA 4WQMA 1W34A 3QFRA 4LBZA 1K9MD 1K73D 3OW2B 2BGJA 3VNVA 1QGAA 2QDXA 2EIXA 1F60A 4B43A 1YJWB 4Y9UA 1EFCA 4Q7JB 5KSWB 4AF7A 2QA4B 1YHQB 1KK0A 4RD0A 3CRZA 3U6BA 1Q82D 1VQLB 3CCJB 2VYQA 1EFTA 3U2QA 3FPKA 1UMKA 3VO2A 1VQ4B 2NPFA 3ZBTA 4RD2A 1FNDA 4LBVA 2B5OA 1G7SA 4YAUA 3QE2A 3E1YE 4RD3A 4LBWA 4LC0A 4UAJA 1VQOB 1FNMA 1Q7YD 3E20A 1QX4A 1NJID 1VQ5B 1KK2A 3CCUB 1ZM4A 1Q81D 1M1KD 1EP3B 1Q86D 1EP1B 4N3NA 3A1FA 4K1XA 3MCAA 2QTZA 1OGIA 1CQXA 2HCJB 1QVGB 4B48A 1XB2A 4MYUA 3CCRB 2XNCA 4N3GA 5JBQA 3CCMB 3OJWA 3W2HA 1KJZA 3OZWA 4YAOA 5GV8A 1QG0A 4BPRA 3G71B 2RC6A 1KK3A 4TMWA 1TLLA 1FNCA 2QEXB 2QN6A 3FJOA 1ZM3A 3WYAA 1R5OA 1QUEA 2QTLA 2XNJA 2X3UA 1E64A 1BJKA 4AF6A 1J9ZA 4AC9A 3I56B 3CC7B 3CC4B 1G7RA 2C78A 3LVBA 3WNDA 1K8AD 1OGJA 2YWEA 3W2FA 1A8PA 4TMTA 2VNJA 1QGYA 2VNHA 4P6VF 1M90D 3AVVA 2BMWA 1NDHA 3CCVB 1OB2A 4G5GA 3LYUA 1QUFA 4PGOA 3LRXA 1H85A 3OJXA 3CPWB 1WDTA 2YWFA 3WXMA 1G7CA 4M53A 3ZZ0A 1E63A 2PIAA 1F20A 3CW2A 4PC7A 3CD6B 1YJNB 2RC5A 2DEUA 5DSZA 1N0UA 1EXMA 1IB0A 2OK8A 2BF4A 1B23P 1B2RA 3J81k 2OTLB 5FA6A 3WNBA 3B8HA 4PC3A 4EH1A 1JA0A 1KTVA 3CXCB 4M2LA 3ZBUA 1BQEA 2CRVA 2B7BA 1TTTA 3CCEB 4FN5A 1I7PA 4TMZA 1QFYA 5AN9A 3V76A 1EWYA 4B3XA 1AIPA 4PC2A 4RD4A 3B82A 3MMPA 4TMXA 2BN4A 1FDRA 4B44A 1YITB 3CCLB 3CMEB 4M0LA 1VQPB 3AGPA 3AVWA 4RD6A 4ZV4A 3PENA 1EFUA 1IJEA 1D2EA 2CNDA 4QHYA 2BM1A 4PC1A 1R5NA 3JQRA 1YJ9B 1QVFB 5TV2A 1VQNB 4M4SA 2PMDA 1D1NA 2DCUA 4MYTA 3AVXA 1GAQA 4C43A 4TN1A 1U2RA 1JJ2B 5THXA 4YHBA 3CC2B 4NCNA 2YWGA 1ZM2A 1QGZA 3P26A 1FRQA 4IW3B 2ZITA 2AHOA 2VNKA 1FNBA 3JQQA 1TVCA 2R6HA 5TY0A 1GVHA 2HDNB 3P27A 3ZC3A 2BSAA 2J7KA 3AVTA 1IJFA 4NBSA 1ELOA 4RCYA 1QFJA 5H59A 3QSYA 1KQSB 4B47A 4LBYA 1XE1A 2BV3A 1G7TA 1OB5A 4G1VA 3OZVA 2C77A 3LO8A 2OK7A 1AMOA 4G1BA 2HMAA 1GO2A 1VQMB 3U6KA 1R5BA 3G4SB 1DG1G 1VQ8B 1DDIA 1JA1A 2YWHA 3OZUA 4ZGNB 4PC6A 1CNFA 2VNIA 3AGQA 4J0QA 3I55B 1KRHA 3JQPA 2B7CA 5GV7A 2EFGA 4DQKA 3AVYA 1JB9A 5TR9A 2E1RA 2BPOA 2D74A 3MHPA 1VQ7B 3WBKA 2GQFA 4TMVA 2DY1A 3G6EB 1TUIA 5H5JA 1QH0A 1S72B 2BVNA 4YAWA 4ACBA 1DDGA 4YAFA 4RJLA 1GAWA 3B78A 1BX0A 4HE6A 3ZZTA 4P3YA 2BM0A 4M1KA 1QFZA 5HXBA 3VO1A 3QFTA 3W5HA 1SKQA 4H9GA 1H42A 1YIJB 4RCZA 2BGIA 4HE5A 2DERA 1E62A 4FK8A 1JNYA 3W5VA 4F7DA 1W87A 3I1FA 4C0SA 3CCQB 1KD1D 1GR1A 3CMAB 1VQ6B 1SM4A 3WY9A 1HA3A 3WNCA 2PLFA 1W35A 2OTJB 4QFMA 3W2EA 4DQLA 5EMNA 3ZZUA 4ZCMA 1BX1A 1GJRA 3ES9A 1D8TA 2GPJA 2XEXA 4U9UA 1S0UA 4ZCLA 4FWTA 1VQ9B 4ZGQB 1KC8D 3VMFA
chains in the Genus database with same CATH superfamily
1D2AA 1PZNA 4WJLA 16PKA 4Y1EA 2WKRA 5FQNA 3TRKA 2QD4A 4KKUA 3AF2A 5F2EA 5HSGA 2VJYA 1ABFA 4ZU3A 3CMCO 4L5JA 4RKEA 4BZPA 4BNYA 2ZP1A 4DR5B 3BJZA 1P73A 5HKKD 2C2WA 4FYJA 2C8KA 3AT1A 4ZMBA 1GNRA 3K5IA 1MB2A 1C30B 2F1HA 2JBWA 2ZG6A 4M8IA 5F7ZA 4ZU6X 3RLFA 5JIBA 1ZXBA 4RHXA 4QPJC 4YI5A 1GYQA 3MWJA 2VAVA 2YOGA 1K7XB 3V1YA 2PFSA 1TNDA 3O2NA 4Y8VA 1QV9A 4IHJB 1AGRA 1PHPA 4NY1A 5LZ2A 1UKEA 4F21A 1SG9A 1TZCA 2HNBA 2BISA 2VUHB 2YJNA 2XJ4A 2CHVA 3HBNA 3NTXA 4NFYA 4R9NA 4YALA 4NYMR 5FPPA 3QFSA 1QTNA 3RK1A 4IJWA 3SOZA 3KQNA 3E7FA 1SKMA 2HCFA 2BW0A 1WL8A 4EUHA 3GDOA 4PHGA 1HYEA 1R37A 4B4DA 1XJCA 4WXEA 1MJ5A 1MF7A 1S3GA 1CDZA 1QPBA 2E4ZA 2O7QA 3NIFB 4LXQA 4HNHA 4CM9D 1KBQA 1VE9A 1K5PA 4YT2A 1HDCA 4AMUA 5C4IA 1Z6GA 1SUWA 1T0HB 2OAP1 3TIIA 4CIAA 4EHJA 1GXSB 3EQ9A 3QM1A 2FSGA 1QGUA 3CY6A 4K9QA 3TCKA 2PQ6A 4MKGA 3LHSA 3F8TA 1GPMA 8ATCA 1MC4A 1K8ZB 3G2LA 1LU9A 1NWCA 4FS8A 4YO7A 5JDCC 1D2MA 3N2KA 1TAQA 4HQLA 3SBEA 1L4BA 1Q92A 2D1RA 3EGXB 3N75A 2VK4A 4DNRB 1II8A 2Z8XA 3T12A 5KQRA 1EDEA 4C3VA 5LPNA 3AHGA 2FRDC 4FR5A 1L7AA 1ZMRA 4F9GA 1KYVA 3HJBA 3R7AA 3RSOA 4MVJG 3ICVA 1J90A 5FQOA 4M9QA 5J43A 2A4MA 1E9AA 1HRKA 1K7FB 1MNQA 5IK2D 3H2HA 2EATA 2ZSIA 3AZOA 3V2HA 1B76A 1W93A 3PU6A 5E7MA 4ABYA 3R7LA 2G63A 1WQ1R 4IIBA 5DI9A 2CCGA 5KKCA 1FUKA 1TPYA 1U0RA 3IE2A 1EKXA 3EGEA 3AR7A 4MJ7A 2XWPA 1ZN2A 5KOHA 3ZBTA 5A3SA 3KYBA 1U3VA 1UFKA 2WPNA 3H86A 1W19A 4YCNA 4LYYA 4EEXA 3A4VA 4A6EA 1OVGA 3QTBA 4DDWA 2JFNA 1ZUHA 4TVBA 1ATZA 4XVRA 3SHQA 1EB8A 1SMKA 2O05A 3ZV5A 2H59A 2HI0A 4TL7A 1HFJA 4LUCA 3LLMA 1WCYA 3OZIA 5JR3A 5KWJA 2IHTA 2XUAA 1OHHA 5ELLA 3HA2A 1CHDA 3ADPA 1C41A 2FMXA 4KXLA 3WKEA 2BEVA 3R0IA 2WDPA 4JHLA 4Y2QA 2DC1A 4FW9A 1JSRA 4QYIA 2O20A 2NTEA 3S2EA 3L4KA 4FNGA 2YR0A 2QRVB 2WUDA 3ELUA 1ZKDA 2J32A 1DO0A 2PANA 4P3XA 4PZLA 4M0UA 4IX1A 2Q1UA 1BWPA 3FX2A 3ZCVA 3AW8A 4UBIA 2WTUA 1I4TD 4F5YA 4BC0A 4W5TA 2EZ8A 4ZTUB 3A6PC 4LSZA 4G8CA 4CEHA 2JASA 3A1FA 1MNAA 2QTAA 5A04A 4G5YA 2K87A 1CQXA 1WTCA 1TCBA 3V42A 3A31A 3GLGB 2ZJ4A 4XB1A 5EPEA 2R6AA 1Q11A 2QTBA 3NAQA 1DAGA 5ALOA 1YVPA 3D1LA 1DXHA 2JNWA 3FPCA 2W2QA 3Q8LA 4RLHA 3OZWA 2PX5A 4DSZA 3HP4A 4OPVA 2JB9A 3FNEA 2IS1A 4TLDA 4F85A 1RIFA 4TYYA 5F3WB 1FP2A 3PFNA 4IHAA 2W8ZA 4BB5A 4OFBA 4GAEA 3QP9A 4ZOBA 1A71A 1U1GA 4UCQA 4F6LA 5J47A 3MSCA 1E6KA 4G0OA 1YKGA 4MB6A 5EXDA 5JS2A 2BHRA 2HR1A 4MPTA 1T1EA 4RF2A 1YB6A 1ZM3A 3K9HA 4L08A 2HU2A 2ZAGA 2C2XA 2P9EA 4GPD1 4KQKA 4Q37A 1QUEA 3ZTWA 1OT3A 2QJTA 1VG1A 4BLQA 4LHSA 3JQGB 2VCYA 2B37A 1ZESA 1YRHA 3A6EA 4KTTE 1LPMA 1CY6A 5J2TB 1P81A 3TZ6A 1IDOA 1RWMA 2BTQB 1DTWB 1T15A 3K31A 1DIHA 3U7JA 2QV0A 3JR3A 4BO1A 4HT3B 3IIEA 5JZMA 1DRJA 1HG1A 1UBSB 3NQ41 2HCTA 4KL8S 4LY9A 2YWEA 3IP8A 5DLPA 3UPDA 2X5XA 2HLDA 5BT9A 2W90A 3VBCA 1VHEA 3V5NA 3BTOA 3PC8C 2P11A 2P0YA 4A0FA 2AK3A 1NPDA 1Z34A 1D2CA 1BOFA 1CYDA 1JG1A 2HIAA 2N46A 4J0IA 4DXAA 2O3JA 1X80B 4PN7A 2AKAB 5JCOC 2PUJA 2Q4TA 3CURA 3I2HA 1I7QB 2I91A 2JBHA 3U4QB 1Q74A 3A4MA 1CVRA 3WHPA 3KAKA 4KMOA 1I1HA 4HSEA 1FF9A 4MR8B 4OMFG 5JO0A 2VDMB 3LRXA 1UMBB 3HEBA 1OLXA 5IJ9B 2D4AA 3M6WA 4OYHA 2XDQA 4WWHA 2LWIA 2JKZA 1T6BY 3UK6A 4DCJA 2NSYA 5A0VA 1MRZA 4WIAA 4AKHA 3OM8A 3PK0A 2QP9X 5KB3A 4C7JA 4MRVA 2Z08A 5K0FA 3BJMA 5CFPA 1PR1A 4MVJE 3T3NA 4B6GA 3B53X 4L2IB 1XGKA 5ICFA 1X8KA 4QFDA 4RV9A 3X0DA 3U4CA 3ODGA 4DV0B 2QGNA 1QQAA 2DEUA 3WZLA 4TVSA 2MOKA 3QU9A 5F7OA 1WUYA 4D8VA 3UBMA 1I7DA 1WXXA 4O6VA 2EFEB 4DR2B 1DJLA 4MW9A 2IXFA 4N5IX 3ESCA 3SEAA 3WZMA 3LNCA 4QKQA 2JLYA 4HLDA 4Y9SA 4AU1A 1N2IA 3RJMA 4YP7A 3NC1C 4J4HA 4QAJA 1D6MA 4C78A 1E2GA 5BY2A 1MR3F 3FF1A 5HR5A 3FHCB 1F9EA 3VMMA 1F2UB 2P27A 4HVAA 3LIIA 4R54A 1Q14A 1E4EA 1UXJA 5JVDA 5CFNA 2HRQA 1NF8A 4P4NA 4GR5A 3WGLA 5JBNA 3E1SA 3CR3C 3N8IA 5D3QA 2JGAA 3IDAA 2E6KA 1OX4A 3RKUA 4N4AA 3VHRA 4FHFA 5KIAA 1S8FA 1Q0ZA 1HE2A 1VJ5A 1BC5A 1P7PA 2H1WA 2BOVA 2J59A 2XDWA 3BIXA 2JJ2A 3E48A 4NP6A 1R6VA 1CUXA 3H5WA 1CXZA 3FPGA 3MUEA 4LYJA 5DH9A 4H3HB 1FMLA 2IHJA 4L95C 3N1UA 1BGXT 1QFYA 3STYA 1GLVA 2QS9A 5IYRA 3ZGLA 2BZGA 3OKAA 2IA5A 3TZBA 2Q8PA 1RRVA 3OJFA 1V7ZA 5DLYA 1ISRA 2W6NA 1OV4A 5J3OA 4QOFA 1KQ3A 3OTIA 4XGKA 4RD4A 5DGHA 5HDQA 3ROKA 5IT0A 1X7ZB 7GPBA 3NHPA 5IMSA 1WW2A 4HAOA 5L3SB 2DTXA 3DV0A 3ETDA 3W6OA 4YQFA 3MMPA 2X4DA 3KQOA 1EZ4A 4ITUA 1RLTA 4C2UA 2FSPA 4WHMA 4XIYA 3AOEC 4L2IA 4WAUA 1QQ6A 2JBAA 3MWFA 4GM0A 1DX4A 1CF2O 3KOXA 3SHWA 3RFVA 4K2AA 4NNJA 4RD6A 2REQB 4CYMA 4TZ0A 3VOTA 2ZUBA 1L5HB 2JGRA 3UWPA 2X2PA 3ANTA 3BA1A 3D8BA 1KP2A 1QQTA 2I4LA 3B20A 2FPMA 4QHYA 5EJMA 1E2IA 3L0IB 1HZZA 1R5NA 1VYHA 4XN0A 3B1YA 3IXLA 3AJ8A 3Q1LA 1N8TA 2F8MA 3IPLA 2DFKB 2YW9A 3O8DA 1EIZA 4RMHA 1AGYA 4YC7A 3OE7D 2BBOA 4X6YA 1QGDA 5HZHA 4E4YA 1VCMA 5EZYF 1R9GA 3H1TA 3IP9A 4MR9A 4NBNA 4GRDA 4KKSA 1C1HA 4EKYA 3SYTA 1RKVA 1FRQA 4PGMA 1K7YA 3GN1A 3PXDA 1O6BA 3QNWA 1CUDA 1Z12A 4H1UA 2IYFA 3DCNA 3V6MA 5EP3A 3WIVA 3U62A 2DUMA 2YHUA 3OQVA 1E8MA 1P1CA 1P1FA 2EG9A 2WWGA 3G5AA 1WLYA 3DKPA 3INYA 4GPEA 4R51A 3UT5A 3WKAA 2GNOA 4O4HF 3SICE 1VMKA 2WD7B 1Z4OA 4ZYTA 5L3SA 3ZC3A 2BFEA 5BQXA 5EXTA 4GDFA 1ZWLA 2HO5A 2JGDB 4FLMA 5DNAA 1B8VA 4XGNA 1T3HA 2NZJA 5IAEA 3UJ6A 4GLOA 4JEMA 3N0RA 2BSAA 3DBRB 4JP8A 1GSOA 2G3YA 1X6VA 4QQRA 2A5DA 2WJGA 4FZ5A 4BOYA 1SCAA 1E3EA 1Z83A 2DWPA 2JPDA 2VH2A 1MLDA 1PT5A 3EGWA 3LW7A 3K0AB 4JJFA 5EN4A 1T9BA 2Z3ZA 4IX9A 2LE0A 4Z4WA 1I6WA 3OPYI 1JSZA 4JT2A 1G5HA 4OIFA 5FOSA 4XLCA 4I3HA 2JCSA 4KP7A 3K4QA 2QUJA 2RONA 4N7JA 1RWQA 4DJDC 1N3BA 2HXSA 4RM2A 2CV1A 1JPNA 1Z5NA 5F3DA 1E9FA 1TIBA 1O95C 3W9UA 2C9OA 3NI2A 4B47A 5LQUA 1N77A 1ADCA 1WO8A 3BEDA 1PI3A 2GRUA 2I7CA 4EF4A 4IJKA 5JEEA 3VO8A 1XLVA 1WSAA 3V33A 5TX7A 2C4UA 1ZU4A 4W5JA 3G7UA 3EYWA 3PUHA 1UC8A 2VRCD 3U17A 1T29A 3SZ3A 4KVAA 4BWVA 5LQRA 2D3LA 2XUKA 2JFYA 5EQDA 2VPIA 3AR9A 1YDEA 4IZHA 1DKLA 3R3WA 1NVBA 4FW8A 5CDGA 1HDRA 5F9FA 2IFTA 5ALYA 1HDXA 4GVLA 2HMYB 3EIUA 3R5SA 1Q1BA 1T6NA 3USCS 1JH9A 1K4MA 2YWHA 1ZJ4A 4WBNF 5KINB 1USIA 4TYNA 5KTPA 2PE3A 1TM1E 4O4LA 3NFYA 3L6BA 3IT2A 2XRYA 2JGDA 3QV1A 3EWNA 3PJFA 4V0SA 2PZJA 4XSHA 3SR3A 1FZTA 3IAM1 2V4DA 4IO0A 3VPFA 1NB0A 1QYCA 1TM5E 2FWNA 4QIHA 1IHDA 3V46A 1XKTA 4UNPA 1VLQA 2WVHA 1ST2A 4OO3A 4EPTA 4YAGA 5CDTA 1JEAA 2R8OA 2JAXA 2XT0A 3KJHA 4Z4TA 1N7HA 1P0MA 3RI3A 2Q5JA 1FVXA 1RHRA 1NMQA 1X3SA 2QX9A 3T52A 3UYKA 4C1BA 5KJ1A 4JBHA 1WSBA 4FEGA 4JR2A 1GDHA 2HL6A 3GG2A 3R41A 4EFKA 4LDNA 1CQIB 1KAHA 1D0IA 3ZNPA 1PQPA 5D7NA 1KGDA 4LYDA 2WHPB 3HE3A 4LX8A 3ERCA 1YK0A 3PP8A 1K6JA 4DFDA 4HLCA 2XZPA 1SCDA 1WY5A 2G8LA 1N92A 4L8JA 2O3QA 3A27A 4UHJA 2BONA 2H54A 4UHKA 5ALJA 3K4PA 3WJ1A 1V7QA 1RS0A 2HGSA 1BS9A 2XDAA 5HDBB 4KWIA 1A72A 1G41A 3QBDA 3ZZ1A 2XSZA 3W6NA 3QNUA 1RLUA 4D9JA 1G3RA 4GR9A 3LHDA 3W4IA 1IBSA 4W6QA 1FFHA 4JJGA 4OUDB 5LDDC 1Y5MA 2IUUA 1JWLA 9MHTA 3QVWA 3NATA 2C1XA 3BVPA 4UFOA 1U0HC 3HWX1 2AIRA 5E9AA 4O4IA 5AW7A 1VJ0A 4HNAA 5DX0A 2EV9A 1E58A 1MV8A 4JH0A 3NW9A 3AFGA 4Y1FA 4ND6A 1UM9B 1RXCA 4UDYX 1F5SA 3BILA 2BH9A 3L04A 3S5UA 3L6EA 1XD9A 4WFQA 4Z0HO 4YR9A 4YV1A 4MW7A 2NT3A 2GN2A 3ZGOA 4RUKA 1JFSA 4N0MA 4DZTA 1NBMA 3PDIB 3CLUD 3GBSA 5J1TB 1FFSA 4R9UC 5ESWA 4MRPA 4W5RA 3GHHA 2YWRA 1LCIA 4C0SA 5FFMA 4BO5A 2I4TA 2GCIA 3JVUA 4KV7A 4AJKA 4H59A 4GBMA 1L3BA 5DGDA 3RUPA 5JMPA 4FHZA 4D46A 1E69A 3ZCXA 4AMBA 5BW4A 2RHWA 1RMTA 2BGKA 1JL3A 1DKNA 3RF7A 2NUAB 1XHEA 2A78A 3D6UA 4HS4A 4JA2A 3UGQA 4WK2B 1FC0A 1W5BA 3R3HA 4ENRA 4NYIQ 1DCFA 2DQ4A 2PSHA 2MYNA 1R2QA 1Q0LA 2UUOA 3BKWA 4DQLA 1NXQA 3K9LA 4GE0A 5F12A 1KMQA 4KKTA 2PPVA 5C80A 3QY9A 4TLCA 5BSVA 3Q3JB 1X74A 4R7GA 3ES9A 5DCUA 3E0XA 2DJ5A 3KU4A 3RIXA 2JI7A 3UCFA 5K8TA 1ZVJA 4NEQA 4RY9A 3WIOA 3QMWA 4FEEA 5FXMA 2PYZA 1VHJA 2NUAA 3DBVO 3EYAA 3EOBI 1N2ZA 3GJRA 2H5IA 3KB8A 3MT0A 2UVPB 2HU5A 2CGEA 4PR3A 4XX0A 1DCKA 1QK3A 2GDZA 2O6LA 3ODPA 4OUDA 5CK5A 1NLMA 3URKA 5C9ZA 3HVHA 3F6PA 3EAQA 2A5LA 4M88A 1CSEE 2J3HA 3V1LA 4W5NA 2IXGA 2IDZA 4BLWA 3ADOA 3RIEA 1S9HA 4X0CA 4QLOA 5EOVA 4KOEC 4HPWA 2I6SA 5DFAA 1RCFA 1N0VC 1KY3A 2C9CA 3EXAA 1ZJJA 4MLCA 2FWPA 2JIZA 3E9CA 4QUEA 3H6KA 3K6KA 4LOIA 4UHHA 1I80A 3SG0A 4BFWA 4JJ7A 5IF3A 1S2OA 2EP8A 5JCPA 1G63A 3OO1A 3U44B 1NVXQ 3CKLA 1GN9A 3NT5A 2V1XA 3TXYA 2EEZA 2GZ3A 2ADOA 4FFMA 1VRVA 1YS7A 2M32A 1YR2A 4MB0A 1WPCA 1BS1A 1DTSA 2EU8A 1PGOA 1W1UA 1BROA 1CR4A 1PJLA 2VJNA 3C6XA 5IJ0B 2XMSA 4Q93A 3NBFA 3OTHA 4BWFB 2FLWA 4GUAA 2WEKA 3TL2A 3SC2B 2I7VA 4O33A 2V4ZA 4HUQA 1XCGB 3VR0A 2PS9A 1J2TA 3RRFA 1T2AA 2X8AA 2PJDA 1IUNA 4CKBA 3IV6A 4EY7A 3TB4A 2OGUA 2W22A 1OA0A 3T61A 2DAPA 3FDZA 1MDFA 3K16A 3KR0A 3PNOA 5JUWA 3CF4A 3HZRA 1PR5A 7MHTA 2W0SA 1Y1LA 1B3BA 4AJNA 2WB2A 1IEWA 1EHIA 4DIFA 1QIDA 4P1ZA 5JZ9A 2G76A 2O2YA 3VH4A 3MS7A 2V03A 4D9HA 5BW6B 2JHPA 2UVPA 4DPKA 2XE4A 3IPYA 3BCUA 1JVBA 1Z18A 3WLSA 4FDVA 4O59O 4ZC8A 4Q7JB 3TNJA 1K06A 2RK4A 2E4UA 4GYWA 3MJVA 4U8HA 3RAEC 2G77B 4FBGA 4AF7A 3GR6A 2ECPA 1E7SA 1L5MA 3HPQA 2HIGA 3I73A 2VR1A 2GD6A 2HIMA 4H4EA 1M3SA 1K0UA 1YS2X 3GVLA 3U6BA 2QG9A 2C31A 3LD9A 3OE5A 1C9NA 3LP6A 2R7KA 4Z4HA 1WABA 4UHFA 4IS3A 3U44A 1XD2A 3PLAE 3WFJA 1MAHA 1XRRA 1PX2A 4KDRA 1DEOA 2KW5A 3TPZA 3WL8A 3AL2A 3MZ0A 2IYSA 1H65A 1ILWA 5JSQA 4HDNB 4NMXB 4YJGA 4YGYA 2GF9A 1V8OA 1VGRA 1KJ9A 3NE5B 1QVVA 1TK3A 2VEDA 4LXXA 5E95A 5LYJF 1YOBA 3U3OA 3DHVA 3JWGA 3NOQA 4CMEA 3IOMA 1GGFA 1ZCFA 5KX5B 2YXBA 1UBJS 1QZZA 4Q24A 2P9BA 3L0OA 1E0SA 4OHWA 4C88A 2Q5CA 1J99A 3C2QA 5TQ0B 1FTSA 4HAYA 1W1IA 2YYSA 4FTWA 1U9IC 1WQ4A 5CVJA 4MGYR 3RSGA 1FMJA 3RTAA 4DMCA 3QE2A 2Z8YA 4O2LA 2FVXA 1YAHA 4XLAA 4ZVLA 1EVKA 2AJCA 2O19A 3QWBA 1J21A 1PFWA 2ZYRA 3FDIA 1DKUA 3KD2A 4PCLA 4CMBA 4E94A 4MQFB 3KVNA 4KN8A 5KW9A 5FTKA 5FULA 1CBUA 4ENVA 5BVHA 4GXTA 1PEDA 1YQQA 3B6EA 2XVXA 3UJDA 1AA6A 3P4XA 3LUFA 3NAZA 2XDYA 2GX6A 2QQ5A 3VNBA 1OBHA 3T3MB 4L27A 3IHLA 2BR3A 4L16A 3VYVA 1BMFA 2PZ8A 5DOVA 5EWLA 2DECA 5K3FA 1ZH0A 4KVGA 1AJEA 5LP6A 1VKRA 2MINA 1QP8A 3CW9A 1Z7YA 3FMVA 5D86A 1CUEA 1SBYA 1WOYA 2B20A 3EWAA 5E3IA 5EJIA 3TUIC 4I9GA 3KZ1E 3CZQA 3O95A 4YRAA 5C8YF 5K09A 2OR3A 2IYTA 3NIBA 1QANA 4Q6BA 3TIGA 4CGZA 4DJEC 1H6DA 2WU0A 4BQSA 4OP1A 4N3GA 1OFHA 3H1GA 4PQFA 4POOA 4KOAA 1QRDA 3SF8B 2YV3A 3WX0A 3B7PA 3OLYA 3HUTA 4Q39A 2YNMA 4E33A 2EEPA 3KLBA 3UMMA 2RC6A 5BWCA 3GX1A 3MWEA 4IHQA 1EAMA 5EMMA 1AKVA 5IT4A 2NXCA 1CJMA 4PX9A 4K40A 4L22A 4ZAFA 3ITEA 2BM9A 4MV5A 3M1IA 5M34A 2V1UA 1I3LA 2MMGA 2YWBA 3LC0A 4Q47A 3CH7A 5KAMA 1P4MA 3VVBA 1AK9A 3JU4A 5GWXA 2XWQA 1J4AA 2XNJA 2P9JA 2EFCB 2CNKA 3QF7A 1C8VB 1DBSA 3FOZA 1OFTA 3QTTA 3MNFA 1NX9A 1SB9A 2EZTA 1VCNA 1GG9A 3DE3X 3DVQX 3UO8B 2C78A 3FYUB 3CTPA 4M1SA 1ODKA 1OIVA 1BCSB 4Q1EA 3OC6A 2P62A 4FYYA 4MQFA 1ZUIA 2AW3A 3DPIA 3GJ8A 3I04A 2Y92A 1GILA 2Q6VA 4LZNA 1IPFA 2C4TA 1BEEA 1G1MA 2O8BA 4ZJZA 1IBCA 1Z5ZA 1Y3HA 4CLXA 1PQUA 1VLYA 4UREA 4UM9B 4P6VF 2OESA 5J5CA 3TDNA 1P2DA 2C0QA 2BGMA 3MVEA 4CQMB 1QPZA 4MI1A 221PA 3HJTA 4Y2PA 2ID4A 4HVCA 4MQBA 2C83A 1NC3A 1NR7A 2Q28A 3E8MA 4B6OA 3LRTA 3UFXB 5FNVB 2AMJA 3EZ7A 3HL4A 3OSUA 2QR5A 3EC7A 4J4BA 5JASA 4WKNA 2GYWA 4JSRA 4NULA 5DU2A 4EI2A 4GHWA 4WZEA 3SMVA 2OFWA 2G72A 4FX5A 4HWPA 3IQWA 1VG9B 2Y1OA 3ZW9A 1FFWA 3SMQA 4KSBA 4REQB 5FX2A 1QH1B 2GJAA 4EA6A 4ZHSA 1GNLA 1K5DA 1V5WA 1C8BA 2A67A 1PL8A 4B9EA 3WGVA 4TVOA 1JXAA 5BP7A 3OCVA 3R7FA 4YMHA 1VRCA 3RRXA 1EZ1A 2CXTA 3IRVA 4BNNA 4DMGA 2ZJ8A 5TF4A 1GUFA 1EGQA 3RTEA 3VSAA 3LZCA 3CPHA 1IB0A 2HQ1A 4UEOA 3A6KA 1E6CA 3HCBA 4RVNA 4Z0PA 3R7BA 3ZLVA 4A2PA 1JDPA 3RH0A 1HNZB 3T4EA 1JWAB 4UCWA 4NU5A 2OTLB 3FCUB 3V8RA 3QX8A 2Q6IA 1C3XA 2CFSA 3CG0A 2Q4BA 2XUQA 4I4CA 4N65A 4Y0AA 1BCSA 3TQRA 2XRZA 1D2HA 1IC6A 1XN1A 3L1JA 4GDMA 4YMSA 3QPWA 2B78A 1EWTA 2FR0A 1CZHA 1E2PA 3DQPA 4QATA 2UUCB 1NRJB 4QBHA 3IQDB 1FFYA 1ESEA 1DADA 1UT5A 4KFUA 4ZTZB 3LIPA 1WUKS 3KQUA 3AEKB 3TG2A 1F0KA 1PJAA 1JXOA 2QQGA 3ENNA 4CLOA 1T2VA 4QU5A 3FA2A 1WKBA 1VLOA 3G68A 1GOTA 2V5UA 3EMVA 1VKOA 4F84A 5FT9A 2GPTA 1NQTA 1EXDA 2C2OA 3I9OA 4ZT7A 1CHNA 4W82A 4QJ5A 4B32A 1T9ZA 3BGOS 4TSRA 4DNXA 4YDHB 1WQ3A 3FRHA 4WT7A 4JL8A 3RYIB 1NSFA 1FYFA 1XRQA 3ISVA 4F1WA 4NPAA 4PLGA 4FGJA 1VIMA 4WACA 4D6PA 2C4HA 3SQMA 5BWNA 3RYCA 1NPTO 2QVXX 3AUYA 4L72A 4M0EA 3UWOA 2PBZA 4UTPA 1RJDA 2PNFA 3TLAA 1NQVA 1VSBA 4P3OA 2NVWA 4OHMA 1E2KA 4IWXA 3V4SA 1PTJA 5JJIA 1Q7TA 2HWWA 4YEJA 3CCLB 2X5KO 4JMPA 4U5XA 3EWSA 4LWZA 5BQ5A 1S3SA 3E22B 4M7PA 4I4IA 2I8AA 1T4CB 4GKJB 1TYZA 2OHVA 4WESA 5DGTA 4ZV4A 1BS2A 2VOEA 2WM9B 2YZGA 4TMFA 1R15A 2FN7A 4W4TA 1Z56C 3VOBA 4JC8A 3ZCUA 1PYGA 2R1UA 3RS3A 1MP0A 1V6AA 3D9QX 3OF5A 4DHEA 1QRUA 3HGMA 5BN4B 5FL7D 4CL0A 4YRMA 5GM1A 1ESZA 2UYQA 3OKFA 4FWBA 3V8QA 3CUTA 5KCZA 2EW8A 4HJXA 4LF4B 5KQGA 4FYXA 4IYJA 3BMQB 3M6MD 3KXPA 4UMDA 2A30A 3ZUGA 3K53A 4HRAA 3LUAA 2KMLA 3LCUA 4GEKA 4AK9A 1DFHA 1CJBA 3AVXA 2R9VA 1T2NA 1DHTA 2IYUA 3ED1A 5DXJA 1ZVVA 4OLJA 3ETNA 3JTEA 2V3WA 3FBWA 1Q15A 3LCMA 5REQA 3LQKA 4F8EA 4DSTA 1MV5A 5B7NA 1K75A 1OXUA 5K0TA 4TKZA 3AU9A 4OVKA 2TMGA 1OZHA 1QGOA 1E7WA 3C39A 3QMPA 4Z49A 2XYRA 3AESA 4JB0A 4YK7A 4EWLA 2F55A 3FIJA 2R6HA 1LH0A 3GDWA 4OMUA 5EPUA 2WZNA 4YMUA 1TJ3A 3R5TA 3SEFA 4DY4A 3FNBA 3HJCA 4PCUA 4PG7A 1CDDA 2YMQA 3L7LA 1HF3A 1KARA 3HU3A 4LHXA 1SIWA 3VNAA 1TK2A 1RAEA 2YDYA 1FB5A 2DUWA 2Z57A 4JBWA 4EO7A 2OCLA 5H4GA 3PQFA 1AB6A 3ROQA 3D0RA 4PLCA 5ALIA 4DQDA 3HJRA 1EFDN 1G59A 3F9CA 2O6HA 4EA9A 1NQUA 4LJLA 5C51B 5FWXB 2YJTD 4C87A 4YS6A 1FX0B 3QU7A 2C5GA 2BDUA 5IJWA 1RI5A 2WYIA 4KQ2A 1NC1A 2P1RA 3IUMA 3OZGA 2X7JA 4PAQA 3HXLA 2SCUB 2YY7A 4NG4A 3HKCA 4COOA 3HBAA 3HK2A 4JUFA 1GZDA 3N58A 2H48A 3BZWA 1EK2A 1KU0A 2GREA 4PV7A 4TV9F 3DE2X 1Z2EA 2Y1LA 3H2YA 4HHEA 3OFVA 5LDGA 3N8KA 1A97A 5IYZA 5FLXA 4LYAA 5P21A 4LBYA 3BS4A 1TMKA 4EB3A 3P4UA 2WG1A 3VZQA 2NAPA 3A8TA 3HJUA 1BEZA 1BWSA 2LBPA 2SKCA 3LE8A 4FB4A 3PJDA 1AO3A 4ATNA 5F98A 2BJVA 3SC4A 1ZH8A 4X7FA 2WSBA 2Z58A 3KV1A 1PJBA 4JQCA 2HPHA 1XCPA 5BUSA 4XWOA 1XZJA 4RLZA 3KPJA 4PYNA 3FM9A 2C5LA 3GOQA 4EJ6A 3RC9A 1P2TA 4KDEA 1L0BA 1FOEB 1EM8B 2YXPX 4LQ4A 1JFFB 2Q49A 1HYQA 2O2DA 3BL6A 3BQ9A 5D3KA 4QJIA 1G64A 1V35A 1FFCA 1E4OA 1TF7A 1NQXA 4W99A 4ZP1A 5DCWA 4EF6A 1H05A 3HYRA 1HE3A 1QE3A 3ILXA 2IOQA 4PHHA 4IQGA 4RDHA 5E1DA 4TZTA 5SYMA 2JI8A 4B09A 1RXVA 3BIFA 4PBRA 4QC2A 2W71A 2G82A 3PHGA 1E3QA 2J3IA 1W0KD 3DE0X 4HAXA 1W75A 4DRXA 4UQPA 3FF4A 4ZHQA 4N41A 5CD9A 2J6IA 3ZE6A 5EUQB 2RAFA 3VKGA 4HNQA 2WAOA 1CZNA 1GLGA 3N3AC 3UWDA 2VHEA 1RYEA 5FRDA 2G71A 1V7PC 2Q5OA 2ZRLA 3WYNA 2C9DA 4UHDA 3DFZA 3A2MA 3DAHA 2GLXA 4QDKA 3L41A 2CXXA 2CXHA 2JGJA 1NLYA 5CFQA 2GFQA 3DMYA 2QYTA 4GMDA 4I4NA 4R2LA 1YDGA 2QRGA 1K97A 1KC1A 2K6GA 2PSFA 2ZS7A 1YBMA 2AN9A 1FLNA 3DJYA 5C4GB 4B5LA 1R9JA 5IZCA 1OIWA 2I6FA 1WDLA 1H2AS 2YOHA 1QZXA 2AG6A 4OGWA 4LGYA 1XV5A 1AE1A 2PEYA 1TQDA 1X1EA 1UMCA 2OHHA 2PCJA 2Q5EA 2QTVB 1DL5A 1X39A 3O94A 1PS0A 4RK1A 3I76A 4U2CA 4Y2JA 3COWA 4UNIA 4RJLA 4CMIA 2JLXA 3K9BA 2X19A 5ALFA 3ESAA 1QDEA 3S44A 2Q2QA 1GTJ1 1TOAA 2QY9A 3IUPA 2BY4A 2DUUA 1BXRB 1KVQA 3AJEA 3BTUA 3LXRA 4OGKA 2A2ZA 4KQMA 1WDWB 4ME6A 1ZJWA 3ASZA 4G4SP 1WHSB 1Z2NX 4Z2YA 4C7BA 4H9GA 2FCAA 3R6WA 1WU8A 1MAUA 1NVFA 1UPCA 4M49A 4XR9A 2IU3A 3ETHA 3RRYA 4YRKA 1QR2A 1IN4A 3GLGE 1BE8A 1Y7LA 3GCGA 4QJ4A 3NG1A 2GD2A 3HDTA 3SQLA 1KMHB 3VFDA 4ZQIA 1M6EX 2GYUA 1LBEA 2WYOA 3KCNA 1H2BA 4F7DA 1J2UA 2C9ZA 4KQ1A 5HZKA 3CCQB 1YRQA 2E1BA 3C7CB 2IP4A 2VJMB 2J0VA 4Y6OA 1COWA 4IO1A 2XE8A 4XGIA 1AGXA 3DLPX 4B79A 4B31A 4YJ3F 3WIDA 4TKVB 2Q46A 4YDQA 4JI7B 1L5SA 3Q98A 2FPIB 3N86A 2O07A 1AUOA 1YHNA 3MTDA 4PBSA 5KNCD 3T3IA 1STOA 5TEVA 3PPXA 1DRWA 3LXMA 1TYAE 5JXIA 3AL0C 4JIMA 3S2IA 3NTQA 2CJWB 4NS4A 4QGHA 1KEKA 1HC7A 2R3SA 2VEOA 2EKDA 1XF9A 1BX1A 1NXXA 2HA3A 2V55B 3MMNA 3IVXA 5BSGA 2WC1A 1IM5A 4RH0A 3D59A 3FW1A 4OQ4A 4KFCA 1YIOA 1IY9A 4XDZA 2HW8A 4ZVOA 4A8PA 2YCLA 4DCCA 2IY9A 5I7RA 4G2TA 1HT0A 5F2NA 1WDKA 4LWPA 1FRVA 3W3AD 2EX4A 2JFQA 4YAIA 5D87A 4ECEA 4ZGQB 2I8LA 4ESHA 4XD2A 1X1TA 5KSZA 1KC8D 1UBKS 1YZUA 3MQ4A 2DHDA 1RJGA 3ER9A 4KX3A 1KSHA 2XJ9A 2ZCUA 3P94A 2QN2A 1T9KA 1U80A 2QG4A 1U1FA 1U7OA 2QAIA 1KZ9A 3JWPA 1S8AA 3MPOA 3P2IA 2Q1SA 2WSSD 2PX2A 1RBQA 3R75A 5C7LO 3PQ2A 2V4UA 1IY1A 1SCQA 1Z33A 1PWEA 3CUUA 3A6LA 3EVGA 2OP0A 3OE1A 3VZCA 4AO8A 1GLNA 2MYUA 3FYUC 4I7EA 4ZCIA 1YF3A 1SXGA 3E23A 5KYGA 5H83A 1YL5A 1LDYA 5DTJA 1ZUNB 4X7EA 1ZXLA 2ZSEA 5LA6B 5C0OE 1DARA 1NSYA 1Y4UA 5T57A 2QL7A 3ANMA 4CKZA 1RLIA 1QP7A 2FSUA 5HJ7A 1U2QA 1GFIA 1Y4AE 3ADDA 3EG9A 5FA5A 1XZFA 4XPZA 3B36A 2GYYA 1T5HX 4F8YA 5EHXA 1PGPA 4ND5A 3A7DA 3THXA 4P32A 1NHWA 3GZNA 3A6FA 5DASA 5I45A 4AJJA 1OF1A 1QVRA 2CJWA 3BD6A 3T1TA 3OZTA 2VTBB 1ZU5A 2NADA 5EE5B 4JV5B 1BJTA 4DXHA 4ND8B 1SC6A 3I2YX 2VTDA 3VR5D 1DQPA 2VP6A 3AG5A 4JEHA 5CX1B 2BGJA 1CERA 1FDWA 3VDNB 3VUFA 3HVIA 4DWWA 2Z5FA 3Q88A 5KZMB 5CR9A 3QHQA 4CETA 2EIXA 2YQ4A 2JGFA 3C85A 3LPMA 1PJ6A 4IZ6A 4R7ZA 4DQXA 4EZIA 1XPOA 3O8NA 1X1RA 4CR6A 3Q3IA 2A0UA 1JLKA 4G4JA 3RHFA 2W43A 4KPUB 3SZOA 2OBRA 1L2TA 4B2YA 2CMKA 4GU5A 1M2JA 5AOCA 2IEYA 1EYZA 2WWVD 1QMGA 1TU3A 3NDJA 1W2WB 3FR7A 4XH9B 1T24A 1YQGA 3CRZA 1XQXA 4R2XA 1VCOA 1NU8A 4Q9DA 2H7CA 3X2EA 4CV1A 3D3QA 2JGMA 1T8TA 3FKJA 4P35A 1KWKA 3ISTA 1U2TA 4V39A 2HEGA 3T15A 1LUAA 2OPHA 5DSXA 1ZW1A 4P1VA 1I30A 2H63A 3CG4A 2JJ1A 2DPXA 4KPGA 4HS9A 1ZZGA 5KCMA 3TFQA 4MI9A 3FMOB 3E7PA 2QL5A 1QTRA 1G98A 2F64A 2YXNA 3ZWWA 3F8WA 3I5AA 3KDSE 4E51A 4X90A 3I4CA 4NKRA 4XQEA 3PXGA 4Y1RB 1JXQA 1I3CA 2YBEA 4DNPA 3ZZMA 4AG5A 2PWBA 4YCBA 2VI5A 3TLJA 2G8NA 5T8KC 4Z9FA 3DAOA 3U7FB 2YN0A 3B3JA 3LKZA 5FEMA 1ISSA 3O0DA 1OH6A 3FB4A 1KH3A 2VTBA 1HSZA 5I5GA 3HEAA 1FS6A 3ZVLA 4C4TA 1Q3HA 1GZ5A 1E6EA 3P9KA 3PFKA 5KNDA 1YRAA 4D92A 4RD3A 3RABA 3QU4A 4UAJA 3O2SB 3TZHA 1APBA 4X1IA 2WV7A 3Q2OA 5F7XA 1A96A 1XVVA 3AHFA 1W1WA 4WDRA 3D6VA 4ZAWA 2HCRA 3HDQA 4EBBA 1NYQA 5DJ5A 1DAEA 4FFRA 2PZFA 5DHRA 3TN7A 3TZQA 2ZS8A 3RK4A 1I18A 4GSKA 3QHAA 3Q85A 3L6DA 3EEOA 3AFHA 1WF6A 1AV7A 3L79A 3RUFA 3E2MA 2VJBA 1OAAA 5GZ1A 1OGIA 1PR3A 4JZYA 4PSUA 5L9AA 2W2OA 3JYPA 3OCXA 1K3FA 1LLCA 3AI3A 2QE7A 4OI2A 4PGGA 1QF7A 2G4LA 4R0VA 3TJRA 4MYUA 3R7WA 5B1SA 2QUIA 3MTEA 1EX1A 3DNMA 3T94A 2XQIA 1XNGA 4DC1A 3W2HA 1D1SA 3FUTA 4BPBA 2JK1A 2I4IA 2DU8A 2YZ2A 3FDFA 3I01A 4TGLA 5IU6A 4FUTA 3HH8A 3ROFA 4CG0A 1PNTA 2F3TA 4Q12A 1SKUA 2OFOA 5FPKA 5BMVA 1GQYA 3WAKA 1LSUA 3BCRA 4PXAA 4IR7A 4G0WA 2Q50A 3FNQA 4LDAA 1N0WA 1RE0A 2YUIA 5AOAA 3ZWPA 5A4JA 3W7AA 3AXTA 1M0EA 4F45A 1TJ4A 2JW5A 3B6ZA 1ZGHA 2J1LA 2IP1A 3HDHA 4R1LA 2Z9DA 3TVTA 4H7IA 2ZM6B 1QLHA 2SKDA 2CL6X 1KNQA 1XAGA 1M1NB 2ZRNA 3NRJA 1L7OA 4I1VA 4WXHA 2VYVA 5JDIC 2ZI9A 2D1TA 3LVBA 1Y1QA 4URFA 2Z8ZA 3PEEA 1C7EA 4GMKA 1NNEA 1K8AD 1XROA 1A1SA 2B4RO 5LJIA 1E5DA 1OASA 3PUXA 3HWRA 4PPGA 4D42A 1HX7A 3K09C 4B3DA 5BQOA 1ZNWA 4B76A 1B6TA 2O1XA 1QX3A 4L8FA 5COQA 3RFFA 3WTCA 1XTIA 2YH2A 1E9CA 4EFDA 2V6GA 3A10A 4E5PA 2QAGB 1W44A 3IEXA 1H9AA 4TM7A 1G21A 4HFMA 1JGTA 1Z0DA 4KJZA 3RV3A 2HY7A 1TK9A 1E2NA 1RTTA 2I29A 4JITA 4Y2SA 3CCVB 5LXTA 4ZDWA 4DNFA 1QDLB 3IAHA 4G5GA 2LZ0A 1ZI8A 1Y0YA 2X5NA 5AXBA 3UHPA 1I8TA 2HCBA 3H2JA 4JNCA 4LDJA 4MS1B 4BVAA 4Z4ZA 1S02A 3HZZA 1YGYA 4FP9A 1H85A 3PRHA 4P80A 3TE6A 4CUZA 2P9YA 4W1SA 1JEEA 2F1KA 1GPWB 2CJXA 5DXAA 1YZFA 2D8AA 3V00A 2H8KA 3DMHA 3T9DA 2E4AA 2GNPA 2P4UA 1FXWA 2V97A 2V8BA 3HFGA 3JQ7B 2VRBA 3KM0A 4NU0A 5EG5A 2G0TA 2NUTA 3VU9B 2MR5A 4EO4A 1OH7A 3DL4A 3PD1A 1Z88A 3QEBZ 1G1AA 2EGUA 1P7WA 1ORVA 2ZM5A 3ZHXA 4Z0TA 3CWZA 1PWYE 1CZUA 2CHEA 3A58B 5A9SB 1P3DA 1AV6A 4P83A 4PTZA 5DOZA 4PZAA 2YICA 4OQLA 4AVYA 5F4ZA 1PUJA 5JS7A 4ZRMA 3ZBQA 2O8CA 3NRCA 5H1YA 4P4TA 2D4HA 1ZGBA 3IQEA 5E9WA 4QBGB 2V7XA 1NBEA 2EJVA 4XORA 1BW9A 4LJ5A 2IS4A 2VNAA 3LUKA 3SKVA 2A6PA 4GIBA 3IHKA 1WXGA 3DVAB 3ICPA 4X6LA 4I5GA 4UBJA 3ZDRA 1N2OA 4FOPA 2WSYB 2IDMA 3CONA 4Q3LA 5G1PA 3ZCRA 5P8WA 4BKMA 1OI7A 4LG1A 3TSYA 5B12A 3BB3A 5JD6A 1GG5A 3LWNA 2PD6A 1CIJA 4II7A 4A0SA 1G4HA 3G05A 2CCKA 2RI6A 1K8XB 3IKMB 3M6IA 1ZC3A 2YIJA 4QGGA 4MDEA 3HCRA 4MS3A 3GVKA 1LVUA 1XXHA 2LW7A 3AUTA 3THWB 4G65A 1M74A 4QG7A 3E35A 3V76A 3MGBA 5IWCA 5NLLA 1TO6A 2P40A 3CHYA 1RBYA 5JY6A 3PKIA 5GQSA 5JQGA 3VH3A 3AUXA 4A27A 2WFMA 1OBFO 3AYXB 5GZ6A 1BOOA 1JIKA 2YFQA 3L8CA 4NBRA 4QYXA 1BMTA 1SCBA 1R9MA 2ZBGA 2IYRA 1IPEA 5AH0A 5K20A 4ES6A 1YFLA 4GBGA 4DUZB 1HT1E 2R96A 4OK6A 2BN4A 1VL5A 2FE1A 1FDRA 3CZRA 1GEEA 1N6RA 1UD8A 1T2DA 4XM1A 5KSOA 1DCTA 1YITB 4DN6A 4IGFA 2IELA 1NW7A 3H3XA 3LYLA 4PM4A 1XDDA 4RYLA 5ECWA 4GBED 3DC7A 3T9FA 4QUAA 4IKPA 5EWJA 3ZCSA 3B3FA 3CUKA 1B8PA 5AKEA 3RB8A 5BV0A 3ASUA 2FFHA 4XJSA 5BRJA 4CBVA 5AVVA 3RADC 1AM4D 1J1UA 1NR1A 3QKWA 4WNAB 4XB6B 1E6UA 1VL8A 3KAPA 2AFHA 2B4AA 3HVUA 4MARA 4LRSB 1P4SA 2P65A 1YZVA 5CW1A 1XU7A 5ADHA 2AC4A 3VKFA 5EYPA 3LMKA 3V4ZA 5EXXA 1XF1A 4QUDA 4Y6QA 5FV4A 2XUIA 3GP3A 2X41A 3UJBA 3AIMA 1N2GA 1T9DA 4BECA 2WOJA 3WQBA 4G5OA 5JAUA 4HH1A 1IHMA 1AUXA 1XSEA 3C7DB 3KL2A 3QLTA 3RREA 1VYTA 3AW9A 1KFEB 2DTEA 1JALA 3H8JA 4ODIA 4I66A 3RAFC 1G8SA 3VSBA 5FH9A 2WE8A 3P8ZA 1ICEA 2HPAA 5DRTA 4X20A 1F4PA 3TBFA 1XQVA 3WBFA 3R7NA 3RBXA 1VRWA 4CGYA 1KF0A 1W29A 3SF0A 2LKDA 3N70A 2BZ1A 5JV5A 3ELBA 3LUGA 4JYBA 1XMIA 3O4VA 4ZO8A 5JMOA 1ZQ9A 3JARA 2JD2A 2YMMA 5ALKA 2PUVA 1D4OA 3NYRA 1Z3IX 5DK6A 1R0KA 4XVCA 3SLKA 3K35A 5AKHA 1ZVQA 4EHLA 3C5EA 3LQ4A 4B34A 5LN1A 1DX9A 4YMWA 5HS6A 3EARA 2LCIA 2DSTA 3H84A 4QDUA 1SWWA 2CKMA 2J7KA 3X1DA 3PQ8A 1X15A 3G13A 3CUSA 2NMVA 4O4IF 3PUVA 4P5DA 2W8BB 3P7MA 1TJNA 3OM9A 4D81A 1ZX1A 4IL5A 1AZSC 3CFYA 3HN7A 1E77A 1Y0RA 1ODLA 4XUDA 3ZK9A 4F0JA 5A88A 3PUKA 2FF5A 2IW1A 2CHUA 1CIPA 1SR8A 1WZUA 1SOAA 4IGAA 4AZ0A 2WKSA 1ZDMA 2CEKA 1U1CA 3IUEA 5K3BA 5SZKB 4BMZA 3C3EA 2F9MA 1MQAA 3BK1A 4HNGA 3I1IA 1U7HA 4Y3UA 1XE1A 1JG3A 1GPNA 1Z0AA 4XNFA 2RIRA 2V96A 2W6ZA 4LOAA 3DNFA 1ZC4A 3AHIA 3I4FA 4LQDA 4ZOCA 1YAJA 5HKAA 2BV3A 2Q5IA 3LGSA 5AICA 4WRRA 4ZCTA 3E9MA 3FCSB 2Q1XA 5GJWC 1C14A 1P5JA 1JFVA 2JIMA 2ATVA 4XL9A 4TL6A 4D4HA 2OK7A 5AW9A 1FPMA 2FZCA 1NOKA 3UK1A 4Z7JA 4X54A 2NNLD 2HZBA 1E9DA 3KAJA 1I7SB 3GGDA 5ESRA 4WK4B 1X7YB 2FPKA 3GUZA 4BQIA 1P91A 2NO6A 1FUYB 1O7JA 4MVJH 1J09A 2ZVDA 2IYLD 3IQXA 1E59A 1GARA 2XMGA 3HVKA 3RRBA 4IGKA 4FMDB 1P7ZA 3EIOA 3RR2A 3ORYA 5G4KB 5LOVB 1U8TA 4FGUA 4L9AA 3K2QA 2DKOA 2WABA 4LPSA 1T9CA 1FTQA 3IOYA 4FDTA 4RZQA 2WIAA 4RDIA 4UBLA 3H5IA 3FNIA 2W8BA 1QO9A 3GJ0A 4K0KB 3HS3A 5TR9A 2JJ8A 4UNQA 3MHPA 1KP3A 1XLTC 4MULA 2JEZA 1G8HA 3OQ6A 2ZR8A 5IBRA 1Q2UA 2GQFA 1KYXA 1M8JA 1K2WA 1VQ1A 3DZDA 2HM7A 1E5QA 1L4UA 5CNKA 1LF0A 4AKGA 4CHTA 2ZBVA 1N2XA 2IYZA 3C70A 2AZTA 3NPMA 1L7VC 2W4IA 4MLZA 3ZJVA 4M89A 2VP3A 1V5GA 3BD8A 4P3KA 3R5JA 4GC9A 1GT91 5H5JA 4FR0A 4IVQA 4UAVA 4WESB 3TKAA 2Y76A 1S72B 4TKOB 4QNMA 2IPOA 4WE3A 1SUPA 3NEPX 2XKJE 3VNRA 2NQTA 1Z2AA 2Y05A 2XT6A 4HWOA 3I09A 3VR6D 4BEWA 2F8TA 2CNWA 3UJNA 3WIEA 4KWEA 4GKAA 4IICA 5DHUA 1XZPA 3BZBA 1SH7A 1U5BB 3KXIA 2GM3A 4X61A 5TPZD 4AJPA 1T6YA 1SRQA 3L4BC 1HKHA 3IUJA 1J06A 3WO1A 2NVUA 4IZIA 2G1PA 1UBGA 1XRJA 2VSFA 3QJ5A 4HE6A 2J31A 1YE8A 5HQTA 1KVTA 1LNQA 4P84A 5IYWA 3OPYA 2OYNA 1UOPA 1AC5A 2ZPAA 4MV0A 1U8CB 2VJDA 3D4IA 4IJ5A 5HXBA 1JJIA 2JEOA 2YUTA 3NVAA 4RZSA 4LI0A 4NAHA 1J07A 1YIJB 1JAXA 4LRQA 3BYZA 1ZD9A 2HH9A 3EF1A 2QJWA 2GR9A 2PMCA 3Q5GA 4I5IA 4JB3A 4EJMA 5DBFA 4F6RA 1TZMA 3PX2A 4MV3A 1LK7A 3KT6A 4Q1AA 1E62A 1ESDA 4EB6A 5CLGA 1JB1A 3W5VA 1UC4B 4HLUA 2FSVC 2FRXA 4PHTA 3FUXA 5DBOA 1DXOA 5AVTA 5JC8A 3JQEA 4OXYA 1AB5A 1JJVA 3BXEA 1BPLA 1OJ7A 1E9RA 4MR7A 1Q84A 2E49A 3IULA 2ZT5A 2ZTVA 4E5SA 2CHFA 2UZ4A 2C4MA 5LC1A 1YL7A 5D3MB 5EGNA 4ZZ2A 3MOIA 3ZHOA 2VHQA 2J9XB 2C3MA 3WICA 3ZY3A 4OREX 3RKRA 3NH9A 1DBWA 1JFLA 1YLOA 4QTZA 4JGGA 1ADFA 1N33B 3SXUB 2J85A 1RKUA 1MXHA 2GJRA 3NANA 1O6FA 4IPTA 3RFCA 1SXJD 5C81A 1SBQA 2GPBA 3O8OB 5EJ8A 4LF8B 1KDOA 2O1EA 3ZPNA 1EUZA 1IJBA 4LJ9A 1QO0A 3AK4A 4O2BF 5EEHA 3TQHA 4DA8A 1F8GA 4GX0A 1J8VA 3B3QA 2D2IA 3BXFA 1FTGA 4H4DA 3LT0A 5DDIP 4JT8A 1XUOA 4FI3C 3FCOA 4C06A 4EGJA 3NBQA 2PA0A 1JDVA 2J67A 1P29A 4HDOB 4BFYA 1IM2A 3FWNA 1UK8A 3N8DA 4IH9A 4CKWB 4IYRA 3VMFA 1IEXA 2P2LA 2GPWA 4AJHA 5IXJA 2O5EA 1XZHA 4EPXA 4BVJA 3AERA 4MKHA 1A9TA 2AX3A 2WZCA 3BHMA 3EA4A 4JELA 4B5KA 5K45A 5AJTA 3D8NA 5D6NA 4DLSA 1ZH6A 1Z63A 3S2FA 1XVIA 3MRSA 3GDFA 3I42A 1PBTA 4RS4A 5LP6F 4D9CA 4JLWA 3T41A 2PBFA 1NZJA 1XIVA 1YJBA 4HRYA 4MDYA 4E32A 1DLIA 2YJ6A 3L0YA 3C3YA 5CDUA 4JLMA 3I2JA 4PQRA 5FBWB 3T9AA 4JLOA 4DA9A 3AVUA 4EVQA 2ZB8A 2FZEA 1ZY2A 3K2IA 2JATA 2QAGC 4TTPA 4RNDB 3PVSA 5IKMA 1A9PA 1JU3A 4A0RA 1P0QA 4A26A 1QRRA 4I81A 1P74A 4YRSA 4RFVA 3VSCA 4KYVA 3EVNA 1Y6ZA 1Z4KA 4YEDA 1QF6A 3HKEA 1CUHA 2Q1TA 2E9SA 2RARA 3CB4A 1UZMA 3JYLA 4PYRA 4W7HA 1C3OB 1LJUA 3VH1A 1M67A 1W9MA 3GEBA 5FI0B 3IAS1 2PUGA 1CEYA 2G5GX 2D7CA 2PRYA 3W5JA 2H1IA 4RDCA 4UDNA 1MOPA 5DM1A 3SIXA 5IYPA 1IOWA 2FCRA 3AG6A 1TGVA 5TMPA 7AT1A 3KPYA 2EZUA 2RHOA 2ZJ3A 2IL1A 1NHGA 4IIGA 4F4UA 3DMTC 4NBVA 4UXJA 2WF9A 3ND5A 2PKWA 3RYHB 3RVSA 2QLJA 1GL9B 1P45A 2WUGA 4MUMA 4CKWA 2Q9UA 2QA4B 1BHSA 4DG5A 4QVIA 2C7PA 4A7PA 3DS8A 1XZDA 3A26A 3DT9A 4C0KA 5EJEA 3SE0A 5JSHA 2JAUA 4GMHA 4RTNA 4ZOLA 1ZS9A 4M9RA 4DDHA 1Q82D 1PG5A 3IP3A 1RAHA 1ZOPA 1I8DA 4Q3DA 4Q7MB 1MRNA 1KVSA 2C8LA 4ADSG 2JH3A 3OOCA 1ULHA 3NX4A 4EW6A 1N08A 1XKQA 4KK4A 2EIHA 4INJA 2A35A 3IOEA 1X77A 621PA 3LUPA 1E5TA 4HBGA 5K0EA 1JKJA 4NOLA 3TW6A 5AVKA 4RFSB 1G60A 4FSDA 3BH6A 1QHNA 1WPXA 1EGAA 1SU6A 1MG0A 2QENA 1SIOA 2J3DA 1JI0A 2OO5C 2R60A 2H18A 1O0BA 4NZMA 4QU8A 2R68A 1UKCA 1M2FA 2D0PB 3E3NA 3GFTA 4RGBA 4X1KA 1TYEB 4CLRA 1JBEA 1ESMA 4Q03A 2R00A 2CFIA 2Y9MB 1ULZA 1P1BA 2YYZA 3K1ZA 3F4KA 4NHOA 2X1MA 3CV3A 3OJOA 4KU4A 4UMFA 5IKPA 2MJLA 1DEXA 4XD7D 2Q29A 4RHCA 1IUKA 2QSYA 4MB2A 4MWDA 2IWRA 4CMGA 1MOZA 3GFRA 4O8ZA 1R16A 5IUKC 3ZX5A 5AW1A 1ACJA 2R5NA 2TMDA 4Q9AA 1XAJA 3G5UA 2Z4RA 3M4JA 2E37A 4RADA 3SX4A 3UKJA 4GNKA 3OCCA 2HFKA 4G9GA 3WL5A 1VQOB 1AKTA 3GP8A 2L17A 1PWXA 5JH7B 1A50B 4OM8A 1OLUA 1SPBS 2R8EA 2XF2A 3DKVA 4BL5A 4MKFA 3HCFA 3KYCA 4EW3A 1ORWA 1KK2A 2WMNB 2ZWPA 1RXUA 1UEJA 3TSAA 1D1QA 2JVKA 5AJYA 1YDMA 4Z7NB 1V1MB 1Z4NA 1ECBA 1GGMA 4GQAA 1GTVA 1YI1A 1LGYA 3L5KA 1V16B 1KPGA 4B48A 1XZEA 3K0FA 4AICA 2FUEA 2NO4A 1MXFA 5HIIA 4UNRA 4RE5A 4KBGA 5JZBA 3WHIA 1XDWA 1QAQA 2QM0A 3SZLA 4QG3A 2P7IA 4CV0A 2B98A 2ZYAA 3M0EA 3VU3A 3DV9A 1UDWA 4WZZA 2M6KA 4E70A 4EAQA 3HB0A 1RJ9B 4DLBA 1NUUA 1W2GA 4FXUA 3QV2A 1E3XA 3LKDA 2A57A 5FD8A 4O5OA 5FUMA 2ECOA 1T4DA 1MABB 3PNLA 5CDFA 4KMSA 1BGVA 4LV6A 1DO8A 2QTLA 2EHJA 2WPDD 4MVJF 4PYQA 4UEJA 3KB6A 2P6RA 5IAAA 4AF6A 3BE4A 3MD9A 2ILVA 3QEMA 2CK3D 2Q41A 3JV7A 4DJ5X 1G7RA 4MWGA 4FD3A 4BYMA 1MFPA 2BUBA 4H1TA 2OWDA 3TGLA 1Q7GA 4N0EA 3AX6A 1ML3A 1XZLA 3O8LA 2VBIA 4RH3A 5CYOA 1MENA 1U2DC 1P0IA 3W2FA 1DKRA 1A8PA 1VDMA 2BFDB 4K03A 4DXDA 3VZPA 2VP9A 4M46A 1RC8A 3LAWA 2HA2A 3JVVA 4JNKA 4MTCA 3TR5A 1WNTA 1N1GA 4KQ9A 2J6CA 5KMGB 2I6QA 2ZRIA 4H7EA 4DNTB 1M6HA 1ZOOA 3PPIA 1G3UA 1JTEA 3GUUA 2CFCA 4MUYA 4OOFA 4U3JB 2PFGA 2CUNA 1GUAA 1RRPA 2MSKA 3BHJA 3CZAA 1TI7A 2ZUVA 1Y89A 3UBTA 3IBYA 3CPWB 3M5WA 2QW0X 4DSAA 5HM6A 3Q7TA 4DMKA 1JR2A 2PWYA 2Z2XA 1YZHA 5CBKA 2Y0CA 4BNFA 2YIDA 4IDCA 1G7CA 1GP2A 3UOAB 2QE6A 1PVOA 1G6OA 1EIWA 4D25A 1G291 2IUSA 3CM0A 5CGZA 4MQ4A 5I7UA 3FGZA 1G3IA 2QVCA 4TN5A 3V6LA 1I4OA 2J07A 5KOJB 1S4MA 3W04A 5PNTA 1I1QB 1WHTB 3GFBA 4RMGA 4YWHA 1X42A 4C3OB 4YRZA 4PZ0A 2GVZC 5CA1F 5KDDA 4NDNE 5EERA 5BV1A 1F8FA 4N40A 1XOIA 1YHYA 4Q15A 2DT8A 3GLHB 3FWZA 5KYKA 2AZDA 5KNDH 4HI0E 3CZ4A 4AJ1A 2PN1A 3IGFA 2DFLA 1W94A 2JIBA 1SOWA 4C03A 1EJ2A 1SVUA 4RXUA 2D7JA 5B2FA 4FGWA 2AXNA 4RETA 5ALRA 1E3LA 1KZ7B 1R10A 4ANFA 1XMXA 4O2AF 4OHBA 5E0OA 3FOAA 3I83A 2VQ6A 4WEQA 1N8KA 3CN7A 1YQUA 1K63A 4PX3A 4OGGA 4J0JA 1DRKA 5CYFA 3BPSA 2ATEA 3E81A 3BJIC 3ZN2A 5C1PA 4C2AA 2FGJA 3GLIA 4OU4A 3ITDA 5EMKA 3AR6A 3BWEA 3DVRX 4HFNA 1TPZA 2F1LA 3O3OB 4J43A 4U1RA 4RVHA 2DBZA 3QK7A 3A0RB 3M6UA 2QVBA 4ZVTA 1GKIA 4UAUA 1ORTA 4IXMA 4J1TC 4X95A 4BV2A 5JSUA 3F3SA 5TS2A 4B3XA 4C4ZA 3H4TA 1KYZA 2AEFA 1JIIA 1MJFA 1OI2A 1X1DA 5JJ5A 2BHTA 3CZ9A 3ET5A 2ODNA 3MMXA 2J9FA 2BFPA 3R0QA 4L78A 1UBLS 3OX1A 3A6ZA 2C2BA 1UD3A 4EA7A 2ZJ6A 5I7OA 3FSGA 1ZA2A 1T9GS 1NJ5A 5JECA 3AKCA 2AT1A 5E0KB 1SVOA 2GZMA 3K1AA 4DDTA 3S6JA 3RS4A 3ZYCA 5L4SA 1L7RA 4KIJA 3LCJA 4FNOA 2ZZFA 3F9IA 3Q3CA 3BIJA 4YLGA 1V47A 2UZIR 3DBLA 3QLJA 2GJKA 1E0JA 2BBTA 1CUUA 1JE1A 4TS9A 5J4VA 1OXXK 4G4GA 1OW3B 3GIWA 3IEKA 2DWOA 4FGLA 5M04A 5I01A 2BM1A 5FFNA 1Z38A 4MXDA 3ROGA 2HADA 2COKA 5JZSA 2QSJA 3JQRA 4MIKA 3L4EA 1SUAA 2VAMA 4I4TB 3UCXA 3CWQA 4TX1A 4IIJB 4E88A 2W98A 3CRQA 2XYVA 2ERYA 4P54A 4RL4A 3COZA 1GPBA 1RC0A 2IU0A 4BJHB 1JHAA 2IPMA 3TNFA 5K6AA 5GONA 3T3DA 1C7ZA 1D2RA 3KJQA 4Q1FA 3LA6A 1J70A 3AFIA 4I08A 3O84A 1GYRA 1U2RA 2AOTA 1ZOLA 3P5BA 4EL5A 5THXA 1D1PA 1Y4DE 4HATA 4LV8B 3CC2B 2FW1A 2VBSA 1PR9A 3L7IA 1W47A 1ZRSA 3OU2A 1NBHA 4LNAA 4U6NA 3NYWA 4B6SA 2NU7A 2YWGA 4BRWA 3WMFA 3HABA 1QGZA 3P26A 1IY0A 1KYYA 2ZITA 3AHEA 3VX3A 1F3LA 1E3SA 1OSNA 3HCPA 1I0LA 1CS0A 2AOVA 1TO1E 3H8SA 2JFPA 5AK4A 5CA0B 3DEJA 1VXRA 2Y0BA 1GPYA 2VWPA 3L1UA 4OB6A 2IOFA 3NEJA 1X7WB 2H4WA 3S70A 2FH5B 3C3AA 1NXPA 1UM8A 2Q4DA 1FVOA 2ZSJA 3EN0A 3GT3A 1M10A 2NTJA 3GJ6A 1RYYA 4HXGA 1U31A 3ONVA 5LKAA 2ZR9A 4MO2A 3A70A 5E6SB 3WYGA 2JN9A 1QHYA 4KO3S 2ZIWB 1KBZA 1RVV1 3NHJA 3NTRA 5DWDA 4AD8A 5EIAA 4CMKA 5JFGA 1C1DB 3TTTA 3AVTA 3AFMA 1HOXA 4BZWA 1LI7A 1QK5A 2NUPA 1QIEA 1SNYA 1KAMA 5AM0A 3BGVA 4ZI2A 1RYBA 2V7QA 2ZSAA 1UC5B 3GZ4A 3QYFA 5E2BA 3WWPA 1TUBA 2H5JA 5AW3A 3DOIA 4RCYA 4FFSA 1U7WA 2A14A 4QBFA 4DT1A 3IAEA 4O2RA 4MRAA 3QSYA 1VFNA 4FQ7A 1EFPA 4S1PA 2IWHA 2TMKA 3SE7A 1PGNA 2B5VA 3KXDA 4B74A 4JLVA 4D79A 1F8YA 4B3TB 3LDAA 3U1TA 4CIVA 3Q10A 4FYPA 1Y9JA 2PZKA 4OF4A 2JFUA 5KYUB 2GK4A 3NNNA 4DK1A 2VHCA 1ISIA 4IFBA 1GA4A 5HA5A 1FJGB 1NDUA 1K8QA 5KS2A 1L7QA 1ZNXA 4GI3A 2ODTX 2CFRA 2X8JA 4I8DA 2JDIA 3R5XA 1Z29A 3QUBA 4KUEA 5G3ZA 4YIHA 4IDHA 4PNEA 2R2AA 2X13A 2DBYA 1WZIA 2OENG 3B85A 3HKDB 3LF2A 4M9ZA 2FI1A 4EG8A 2D1SA 5JLJA 3HRKA 3FXAA 3IH5A 4FEYA 4C4OA 4YUXA 4D0RA 5CA0A 1YX2A 5I7AA 1GL7A 4XDHA 4PC6A 2R00C 4HEQA 3PGA1 2QR3A 3UANA 5KOIA 1ORDA 3DZKA 1A5TA 2CDRA 3MTAA 4JLPA 1ZAYA 3G2KA 4NFSA 5IKOA 2NT4A 1SO8A 3IB3A 3SIPA 1E3IA 1G5FA 2FG6C 4RVOA 2BKUA 2MDTA 3EQ2A 5AXAA 2QTNA 4A23A 3R3XA 2P5YA 1C1DA 3E18A 3WYFA 4CDGA 5I9IA 1E2BA 3WI7A 3IUBA 3ZY4A 4YX9A 1N7GA 4OP7A 1JB9A 1E1RA 1BE1A 4MROA 4UZFA 2E1RA 4ZQEA 3PQ6A 5EIFA 4B8YA 1T34A 4FDAA 3GGGA 1QC5A 2QB5A 4TMVA 2J4FA 5CGQB 3TECE 5IHXA 5FO0A 4DW8A 3DP9A 3USZA 5IKXA 5LUAA 2UU9B 4C0HA 1YB1A 3THYA 3IMCA 1NZDA 3ZHBA 3LKBA 5C34B 3SVLA 1PR0A 1QH0A 4QEDA 2X5JO 1UPAA 4WMLA 3MLEA 1BAPA 4Y98A 4RC9A 3PWKA 2ZJYA 3B1KA 1X8XA 3EC2A 1OQAA 2L2QA 4A91A 1M8PA 1WR8A 1ZINA 5A0TA 2V0CA 2HLPA 2M1ZA 1ZICA 2WD9A 5KYNA 4UU7A 5BW8A 1C3VA 1WCWA 2PGNA 3G8DA 3JAKA 4BMVA 4LF6B 2O8EB 1XA4A 4KXUA 4GPTA 3A9UA 4GX1A 4N76A 1U0OC 2ODWA 4C4XA 2FSSA 1N3YA 4POAA 3G2IA 4DCNA 4YXWA 3DZCA 4B3IA 2AFVA 4RTQA 3UATA 1CPYA 2O2GA 1DXQA 2GN8A 1SKQA 5EVCA 2WJJA 2NO1A 4BO4A 4DTIA 3RFXA 5I9BA 1PJSA 2BMAA 5CNIA 4MCHA 4KVFA 1VC2A 1HKUA 3F49S 3HVJA 5A1JA 2Q5LA 2XMBA 5KVCA 4GKKB 1U98A 3JW8A 3BEOA 1JNYA 3M4NA 3OF3A 1S8NA 3GO4A 4JZKA 1NSTA 5C7OO 2FEXA 3GC6A 4FKBA 2G9VA 3EAFA 3VV3A 2NSLA 3WL6A 1NVWQ 1VQ6B 2H5LA 1F12A 1DP4A 2HWUA 1THTA 1HA3A 2WG2A 3LWDA 4TTQA 1I3MA 4HDQB 1ZI9A 1XQ1A 4OQNA 1Y7PA 2X9QA 3PWSA 5HM8A 3UMYA 3PA2A 2PLFA 1JAZA 2VK2A 3LSTA 3LVFO 4LC9A 1XHFA 2QQEA 1Q0SA 5EZ6B 4DLUA 1W35A 1D7OA 1MGPA 1XG5A 1YB2A 2OD7A 3IVAA 1A98A 2DF8A 1H1LB 3RK0A 4ENUA 1UXKA 4BO3A 3OMLA 1UIRA 2X85A 2WZDA 1JHOA 4HXFB 1ZOIA 3R9XB 3S2YA 2EAUA 1Y7HA 1MD9A 1NT2A 2CE7A 2OGTA 4NU8X 1K6XA 2BAGA 4RHUA 3WS7A 1SULA 2P77A 2PXXA 1I51A 5C3MA 1I01A 2OCXA 1ZD1A 4DIBA 4UTOA 2GSDA 3LFHA 5BUZA 3HCAA 4TROA 2QVYX 4EI9A 3U7GA 2NP6A 4JBXA 1RRMA 2H4FA 2QPAA 1GWNA 4R2HA 4EZBA 1GZSA 2GAAA 5JAOA 1KY2A 4F2WA 1IJKA 1MC8A 4GEGA 1HXHA 4D8WA 2NO9A 2PH3A 1Z0KA 1GSHA 5ADVA 2FWJA 4HDAA 1VL0A 3OX2A 1EI9A 1B74A 5T4EA 1FIUA 1Y4SA 2VDUE 3FD8A 2AG1A 4OLBA 1K9SA 3P0RA 4PRKA 4I9HA 1LSOA 4X6UA 1S01A 1Z45A 2AVDA 4FFPA 4YVFA 3D0QA 4CT5A 2QBYA 1ZMOA 3KQWA 1NNLA 3E2IA 1H6AA 3HLKA 4JOCA 5JTUA 1WD5A 4BAGA 1VHTA 2Z6UA 1JIVA 5A71A 4DREA 1CP2A 1XP8A 3QBJA 4I55B 4QAQA 4KPYA 1J20A 2DGDA 2OECA 2Z83A 3D6MA 4XWKA 1PRYA 1JECA 2NZUG 4RKQA 3OICA 4KDFA 1SXPA 1XL1A 2G9NA 3QOWA 1E1CA 1VPDA 4L4UA 1OY1A 2FOLA 2INGX 4GXNA 4MS4B 4FYKA 2I2WA 2IZOA 1J25A 3OQIB 5DN6D 1IUPA 3GEGA 2WVJA 4I9UA 4W63A 4CRWB 4PIMA 2F17A 3I5UA 3OWHA 1J0AA 2QLLA 3TMKA 3TSWA 4M0CA 3GMSA 1HE5A 1UEXC 1H1TA 1NUHA 4JJ4A 3GJXC 3K9FC 2ZRHA 3NTOA 3P45A 3ZIAA 2ZJ2A 7REQA 4DR4B 3MUFA 3P9YA 4Y9TA 4XARA 3N8HA 4OJQA 3KPVA 4IDPA 3TX6A 2BSQA 4EPYA 4NAUA 2RKOA 1BHO1 3UM9A 1QYDA 1AURA 5ALWA 3SVTA 1CUAA 3NYIA 3KKQA 1Q9SA 1S2MA 3FI9A 4J0DA 4B6RA 5BSFA 4JXZA 4MQ5A 5FWDA 2QX4A 2FTKE 2H16A 3QLVC 4O08A 2CCJA 2ZB3A 4QRIA 1Q0QA 1SZDA 1PEKE 4EGSA 4OOVA 2XE6A 1KK0A 1SCNE 3GDGA 3E82A 3QENA 1UANA 3OT4A 1N2EA 4WY5A 4C7XA 5LM3A 1CUZA 2RI0A 4ZRNA 3V32A 2XA1A 1VE5A 4LNUB 4K6HA 4HDSA 3M82A 4CLHA 5FWYA 1JHYA 5LXTF 3AUKA 4QDJA 1U9YA 4PX5A 4EY5A 5B4VA 3VO2A 2BDTA 4JI6B 2Q5HA 4YBZA 4TTAA 4P22A 4BMDA 3R8FA 4RPIA 3OC0A 1MDBA 3I58A 4EJSB 4EG6A 3UN1A 3AVPA 1ISMA 2XNHA 5FUQA 2UXBB 1R8QA 5FWNA 3PVZA 1TDJA 3EVBA 4XUEA 1R0LA 3I3OA 4MHTA 3HKBB 5WRFA 1DWPA 3ZLBA 5HRAA 1M8GA 3TF5A 1MVLA 4J7CA 3NKLA 4H1HA 5CTJA 3F5MA 2NXWA 3CNBA 4A8JA 3P2JA 3D8SA 1E2HA 1PJQA 3H16A 3HB1A 3MMSA 3OTQA 3HWWA 1VOTA 3P4YA 2PSDA 5SY9A 3ANLA 4IFIA 1O0SA 2MWMA 4N48A 1ZMXA 2L69A 1PCXA 3KV3O 2EBHX 3ZTYA 1US8A 3QPVA 3DXYA 2OUIA 4LZWA 4BASA 4WZLA 1PR4A 2WWHA 5AM1A 1M7GA 2GYVA 3OG9A 4HD8A 1J8FA 3UXMA 4L8YA 4YA6A 5JTTA 3I3SR 2WTBA 2P1ZA 3A04A 3I2GA 1NQWA 2ZRBA 1QGED 1FXSA 5BYBA 3T0IA 2R8PA 3U7HB 4PFSA 1GPH1 3R23A 4WOCA 2G83A 3EJWA 4RSMA 1TKAA 4Z4FA 4M83A 4C0QC 4Q02A 5JS8A 2ORYA 4IDNA 4BBAA 4F5DA 4C04A 1BMDA 2EJUA 3F7OA 3RY8A 1BDMA 1HFEL 2A0WA 4X41A 2XCQA 4R6XA 3NHMA 1GTG1 4MVXA 3PFCA 1PZHA 1ZXXA 2PRKA 1BHQ1 4XJTA 3FZEA 4QLBA 5KYYB 1UFRA 3AEXA 3GLFB 1Q1EA 2R1VB 1D0SA 3ZHTA 1VZ3A 2QUHA 4BLTA 5JQGF 1MIOA 4QJBA 1Z4PX 2FDRA 5JEDA 5HMMA 3HKBA 3MINB 3P9CA 4WFJA 5LQKA 3LK7A 1U7UA 1E6WA 1Q19A 2W5UA 4G81A 4UDOA 4G5FA 3H1EA 1OGYA 3OY7A 4QPCA 4CKXA 2C00A 1GU1A 5AXCA 3RDPA 1VCIA 1GRRA 1T1JA 2Q0XA 3QF4B 4XEHA 2JANA 4A2CA 2VATA 4CMAA 3A3GA 4QECA 1DBIA 1ENYA 2FB9A 2JFXA 3HM2A 1YUMA 3V8MA 3WNDA 2X0RA 1KA9H 5DM4A 1UD5A 5FOVA 5FORA 4JBNA 2L42A 1U04A 1HOTA 2R84A 4Q3CA 4RXTA 5DN9A 2QVZX 5EQTA 3I2IA 5E4YA 1TAGA 5F52A 1MB9A 4E1AA 4UUOA 4OPMA 1DAOA 4KGZA 2NW6A 3HSKA 4ZVMA 5JNTA 5A6VA 3MFQA 3TW4A 2RHGB 3O8CA 2F59A 2VHJA 2I65A 5H68A 1MAVA 1S1CA 1VIAA 1XCOA 2OHFA 4UHCA 1L5FA 3CPEA 3ITNA 3LL7A 3ZHYA 4BKRA 4R31A 5BQ3A 2OY0A 4URWR 3DQZA 4HRXA 5E9QA 5EIWA 6YASA 3MJEA 4LTMA 5IKEA 4QUIA 1Y81A 4LZPA 1UBCA 1H4VB 1RWBA 2WU1A 5LBTA 4BMPB 3WXMA 1U2PA 4K6OA 3R9IA 4QJ3A 1V71A 2H07A 2RBKA 2ZWVA 4C29A 1CR6A 1QPGA 1GUZA 4MVWA 3T9CA 4B83A 2WJVA 1ZN9A 2F1OA 2VDVE 4EL0A 3JQ6A 5KYYA 2EJCA 3HY6A 4FBMA 4D8UA 2P6PA 2R1VA 3DCIA 4XVQA 2ODAA 3FCEA 4D0NA 3AOGA 3K70B 2DM6A 1OXMA 3IQFA 4RY2A 3PXUA 2ZL6A 2RH5A 3CUWA 2WI8A 2CHGA 3MWGA 1WMAA 4RZ3A 3M9LA 3LYAA 2PVPA 3H75A 2OK8A 2WYUA 4JR0A 1DC3A 3FN4A 1U3UA 2O2IA 2V6MA 4Y7DA 3LC2O 4Q66C 3VJKA 1CQJA 1N1MA 1WCXA 1VYVA 3D7RA 3DGEC 1IONA 4I6GA 1RJEA 3SQOA 3WDMA 3WDSA 2WF6A 3KDPA 1XLUA 2VHWA 2WWRA 3Q38A 1DSSG 1G3QA 3KOWA 3PE3A 4HTAA 3WXBA 5JCXA 4BATA 5JBIA 5KNBD 4K3VA 3IPAA 1G16A 2JHFA 3EOAI 3LVRE 2EFJA 4KB5A 4S1OA 5TDHA 3FSRA 3SY8A 5JRDS 2FVYA 3BTSA 1EDBA 2ISQA 4W7IA 1EEHA 2PT5A 4PZUA 4X71A 5AM5A 4BGDA 3HUUA 4HUJA 5CW2A 1HYGA 2CJPA 1I2CA 3CCEB 3O90A 1W96A 3HBJA 4J76A 2XA2A 4NZPA 1AUPA 1HDGO 2GERA 3L0SA 4U7FA 2R97A 3JASA 4NMWA 2OBBA 2FFAA 4FFOA 2H4YA 4LSWA 4RPCA 3TRFA 4P7FA 2PRSA 2V6JA 3F2IA 3NEAA 2I1LA 1RADA 4ZGGA 3LOUA 1OLSB 3BQJA 2D8MA 3KJEA 3UMSA 3ZWMA 2X9NA 4EMUA 3Q9LA 2WJIA 4WLNA 1V0EA 3STWA 3WRXA 4DLLA 2PD3A 2FV8A 2UZ1B 4JJAA 2FEPA 3NDPA 3RW9A 3VC2A 2PXHA 1ONOA 3K94A 1ACLA 1W7AA 2FX2A 2I8CA 3CF2A 5ES4B 1UADA 3ZVKA 3RJZA 5I8PA 4KDCA 4Z4RA 5ALSA 2ZVPX 2JCVA 4JB8A 2PQ0A 4I4LA 1CULC 1TKBA 4INOA 4L57A 1ODIA 1KSGA 4OIMA 3FTCA 5L7TA 1I5EA 1NJGA 2Y2VA 3AEQA 3IIMA 2I1VB 3PUNA 3QOFA 4OHPA 5BSKA 2HQOA 2PEZA 3O75A 1WVGA 1P4RA 4I8IA 4R1UA 5BXYA 4HIZA 1QHXA 4BEVA 3DAPA 1ODSA 3EODA 4EFMA 3V7AA 1XMSA 5GIOE 4HN4B 3V1TC 4N8EA 4CT0A 3W5SA 3OJLA 3V4FA 1U28C 4DUPA 4ZEVA 5EJ9A 3GXOA 4WVFA 4DLKA 4CQJA 1GVNB 1R6UA 2JI6A 4CM4B 5A06A 4M4SA 3WRWA 1C81A 2QLMA 2ZI6A 3H5TA 3UMFA 1YIAA 4PG8A 3F5SA 5JAQA 3T5PA 3GD7A 4LOJA 2X6YA 3B6MA 5E7QA 1SEVA 5EI5A 4UKDA 4YY3B 2GTIA 4UVEA 3I30X 3L7MA 2XD4A 3I1JA 1W8DA 1SRRA 2R7NA 2V6IA 3LI2A 4F2HA 2AG0A 4U7DA 5EHZA 2P6MA 2LVBA 3AQIA 3PLNA 5TF0A 1AH2A 1NFRA 1G5IA 1UJBA 4C0JA 2P3SA 3KAQA 1P5FA 5EWMB 4UUQA 4AZWA 4RY0A 1JJFA 3H5OA 2F62A 3QUAA 3BQMB 2UKDA 3NHYA 1JU9A 5EE0A 2G5PA 1BD3A 2L0XA 4R8MA 5ALEA 3VSEA 4CWAA 1J7KA 3FPSA 1JHXA 3KB2A 5I9NA 2QXYA 3AY0A 1T5IA 3G9QA 2ZZNA 2BZ0A 1TEVA 1EX6A 2FUNB 1Q0UA 2Q45A 3C98A 4B7CA 1FDUA 1M75A 2J5QA 2GFHA 2Z2JA 1ZD5A 2ACVA 2ZUUA 4AMZA 3CE9A 1TA9A 2AOXA 3KSRA 2BT4A 4F4IA 3OD5A 3AM4A 3BIWA 4RABA 2GESA 1N5LA 4PLHA 4WKBA 1QQ7A 3F5FA 4G41A 4X8HA 2O4UX 1KQSB 3CNQS 3EPJA 3FTQA 4GZLA 3STVA 1UZNA 4CM9A 3N2GA 2F9LA 4BBZA 3H11B 5T64A 1Z17A 5K1ZA 1SCUA 2HHCA 2ZT6A 5IH7A 3MGCA 5FBLB 3CIOA 3H2ZA 1XJQA 3RIMA 5KI6A 1BDHA 3MERA 4G4IA 3IV9A 3M3PA 4N6GA 4E5NA 4HEA6 1UJNA 3G1UA 1QWOA 5F4BA 1M6VB 2ZU6A 3TQFA 3GH3A 5BURA 2HLHA 2R4TA 3HDJA 2YZ7A 1XRMA 1OYYA 1N5DA 5AKKA 1PU2A 3E7DA 2OFXA 1U7TA 4Z54A 4XCVA 4TT3D 4CEJB 5K4AA 5IK2A 4O0MA 3ESQA 4EJSA 2RI1A 4HUTA 2A5GA 1K5HA 1T3ZA 3TR6A 5HVNA 2ASVA 4P3NA 3KE9A 2BMJA 4XWYA 5LBUA 2QMEA 2JFHA 3N2NA 1AX9A 2VPWA 2XLCA 3O03A 1PD1A 4YFYA 5I4BA 1U4SA 1WEKA 4Q4HB 4IEIA 2BMDA 3AJRA 3LL4A 3M8KA 3QVGA 3BC9A 1T1SA 3FSEA 4IIHA 3TQTA 2RGRA 2IUFA 3IMGA 4KBFA 5BOSA 1EVYA 3KWJA 5JS6A 721PA 3WB0A 2G1KA 1YRWA 4G1EB 4YAJA 3AETA 2EBUA 2PCLA 1SXJB 2YFYA 2DY1A 4I1UA 3RYFB 1JKXA