3CRZA

Ferredoxin-nadp reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
257
structure length
257
Chain Sequence
SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP+ reductase
total genus 79
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3crzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3crzA02
1D8TA 4PC7A 1G7SA 3AVUA 4C0SA 3FJOA 2C78A 4C43A 4TN1A 3CCSB 1CQXA 2PMDA 1VQLB 1AMOA 1FNCA 1A8PA 1S72B 4YALA 5GV7A 1CNFA 3CB4A 2NPFA 3J81k 2OK7A 1J9ZA 4ZGQB 3G4SB 4YHBA 5TV2A 3ZBTA 2QTLA 1EWYA 3W5UA 3B8HA 1F20A 4RCYA 5FA6A 4MYUA 2X3UA 4B43A 1BX1A 2B7BA 3G71B 5THXA 3QSYA 4N3GA 4B47A 1GVHA 3CCQB 2EFGA 4DQKA 4NCNA 5TR9A 3ZBUA 2QDXA 2YWGA 3CXCB 5EMNA 3CW2A 1KD1D 4YAUA 1ZUNB 1DDIA 3V76A 1KK0A 2B7CA 1FNMA 2RC6A 3W2GA 1KRHA 4IW3B 3CCLB 2QA4B 4FK8A 3P26A 1FRNA 2GQFA 3FPKA 5H5JA 2VZLA 1QGZA 3CCUB 1KC8D 2C77A 3SJZA 3AGQA 3WYAA 1K73D 2BPOA 3I1FA 4ZGNB 1IJEA 3LYUA 3AVTA 2HDNB 2VYQA 1W87A 4QFMA 1G7RA 4K1XA 4RD1A 3WNBA 3CC2B 3VNUA 4RD6A 1EP2B 1QFZA 1VQNB 2ZITA 4UAJA 1WDTA 4TMTA 1NJID 1YHQB 1G7CA 3QFSA 4BPRA 2DETA 1EXMA 2FX3A 4B44A 2CNDA 1KQSB 3W2FA 5HXBA 2VNIA 3PENA 1U2RA 5DSZA 2QTZA 3VO2A 1VQPB 1DARA 2DERA 5GV8A 4R71A 1KJZA 3WNDA 4B4DA 3U2QA 1GAQA 2BMWA 3AVWA 2BV3A 3CMEB 3MHPA 1QG0A 1I7PA 1B23P 4YAFA 3CCEB 3AVVA 1W34A 1OB5A 2BGIA 2BF4A 2VNJA 4M2LA 4AF6A 2HMAA 1BX0A 1VQKB 2YWHA 4TMXA 1QGYA 4HE6A 3OZWA 1OB2A 1H42A 1VQ5B 3QFCA 4G5GA 2D74A 4YAOA 1R5NA 1EFTA 4ACAA 1YJWB 1R5OA 3QFTA 1EFCA 1K9MD 2HCJB 1Q82D 1VQMB 4Y9RA 1H85A 3ZZ0A 3OJWA 1M1KD 4TMWA 4PC1A 1EP3B 1FDRA 2GPJA 1JA0A 1YJ9B 4TMVA 1E64A 4PGOA 1UMKA 1ZM4A 4H9GA 1KK2A 4RD4A 3W2EA 3OJXA 3VMFA 1D1NA 1B2RA 4LBWA 4RJLA 2AHOA 4AF7A 1GJRA 1JJ2B 4Y9UA 1TLLA 3WNCA 3LRXA 1Q81D 3E20A 1EP1B 2XEXA 3LVBA 5TY0A 2XNJA 3WY9A 2BVNA 3U6BA 3OW2B 3ZC3A 1G7TA 3CPWB 4NBSA 1N0UA 3B82A 1R5BA 1NDHA 1JB9A 4B48A 1DG1G 1FNBA 5H59A 1GO2A 3VO1A 3CMAB 4N3NA 2BGJA 4MYTA 4LBZA 4HE5A 4G1BA 4RCZA 3ES9A 2QMUA 4M53A 1DDGA 2VNHA 3AGPA 1XB2A 4PC6A 1QVFB 2DY1A 1F60A 2B5OA 1OGIA 1FNDA 1W2BB 1IB0A 1QGAA 1VQ7B 1N8RD 2EIXA 3WXMA 1EFUA 1TTTA 3QE2A 2CRVA 2R6HA 4RD2A 4TMZA 1HA3A 4PC3A 5AN9A 1BJKA 1FRQA 4LC0A 3AVYA 4Q7JB 5JBQA 1KK1A 1GAWA 4J0QA 3WBKA 2OK8A 1VQOB 4P3YA 1YJNB 1VQ4B 3ZZUA 1TUIA 3CRZA 2PLFA 4F7DA 4Y7CA 1M90D 1IJFA 4LBYA 4ACBA 4U9UA 4M1KA 4WQMA 3WBJA 3I56B 1YIJB 1BQEA 4B3XA 3A1FA 1E62A 3CCJB 4FWTA 1VQ6B 1TVCA 1VQ8B 1XE1A 3QFRA 3P27A 1Q86D 2BSAA 4RD3A 3CCVB 1JA1A 1QUFA 1QFYA 1QX4A 1D2EA 1KK3A 2J7KA 4LBVA 2BN4A 1JNYA 3ZZTA 1AIPA 4FN5A 2QN6A 1YI2B 3MMPA 3CCRB 2OTLB 1YITB 4ZCIA 5KSWB 1QFJA 3JQPA 3CC7B 2YWEA 4QHYA 1OGJA 2BM1A 4RD0A 1QVGB 1VQ9B 3E1YE 4YAWA 1Q7YD 4PC2A 3MCAA 1GR1A 4ZCMA 4DQLA 2DEUA 1QH0A 1S0UA 1W35A 1ZM2A 2YWFA 3CD6B 2RC5A 4M4SA 2PIAA 3W5HA 2OTJB 3JQRA 1K8AD 4AC9A 3AVXA 2QEXB 3OZVA 2XNCA 3G6EB 2E1RA 2BM0A 1N0VC 2DCUA 1SM4A 1QUEA 3W5VA 3W2IA 1E63A 4M0LA 4G1VA 1CNEA 4EH1A 3B78A 2VNKA 3LO8A 4P6VF 4ZCLA 3U6KA 3CC4B 3CCMB 3VNVA 1ZM3A 3I55B 1ELOA 3W2HA 3JQQA 1KTVA 1ZM9A 3OZUA 1SKQA 4ZV4A
chains in the Genus database with same CATH superfamily
3GOHA 4X24A 2O8DA 3EC7A 4F8EA 3ZBPA 4P26A 1BIFA 2YASA 4JJGA 5ALVA 1Y6JA 3Q7EA 1C9MA 1U0RA 4HX9A 4YREA 4DG8A 4GXQA 3CCSB 1Z2AA 5EWLA 2X0FA 1A5TA 1EQAA 1XHFA 4OOXA 1OMOA 5FPSA 4F86A 1A8PA 4ZO4A 2FPOA 4EJFA 4TTVA 3LCMA 2Z4SA 2K2QB 4Q4JA 5IF3A 2CXHA 2PX4A 5A2QA 1YIOA 4MWCA 3JVDA 4QU5A 2FW8A 1MD9A 2OCAA 3KKEA 3PUYA 3QVSA 1QVZA 4DHWA 2YNMA 4Y30A 1TU0A 1N5KA 2RHGB 2HJ9A 4INZA 3QWHA 3T7SA 2I2WA 4DC9A 1DXYA 1ULZA 2JH3A 5C7OO 4ERNA 2RGEA 1XWWA 4TRRA 2YVKA 3DMFA 4J1QA 4IDHA 4MV8A 4FFWA 5C5EA 5JEDA 3VJLA 2XMCA 2GLUA 3EFHA 4R1MA 3D7MA 4W5NA 4EJ2A 4RPDA 5LBTA 4NU5A 3RSFA 1QZTA 3JPWA 5FA6A 1OFTA 3CY6A 4JC0A 4PCAA 3OCZA 3GNQA 4LOJA 2DCMA 3DFUA 1G3IA 5C1OA 2HO4A 3ZI7A 4YRRA 3PWZA 5C9ZA 4UHHA 1ULTA 5FTWA 3KJXA 2CLFB 1P1KA 1RMTA 4EY7A 2WIDA 2PAAA 2CBGA 3ZZNA 3DP9A 3I83A 3N7TA 4R7GA 1ZYUA 4OJTA 2QMHA 1V16B 3I04M 2GJRA 1R18A 3FNRA 1MA3A 4YAUA 3E5NA 4FYHA 4U1RA 4HQLA 5JCOA 5F9MA 2LCFA 2XUHA 1PJAA 2FX2A 4DUGD 3VSAA 5ANRB 4GOKA 3OIGA 3B1WA 3HU2A 4UJ5A 4J76A 4Y3UA 3H1GA 4BKOA 4B4UA 4HNSA 1NU8A 2WYOA 3IUEA 2Q9BA 5E1BA 2QP4A 3DLAA 4PHFA 4L4RA 1W5TA 1IN4A 1E3MA 1I1NA 1NLYA 3EZ7A 4Y6QA 4Y1RA 3BCUA 2NO9A 4XGNA 4DQUA 3HCNA 1Z5WA 4MS4A 5FNZA 3ZKWB 1WB9A 1Z74A 4QDTA 2PL3A 1UD8A 1SB9A 4ENSA 1UBNA 1K3FA 2EL9A 5ERYA 1VLQA 5M5BA 3FKSD 1O9HA 5I45A 1S02A 3IS3A 5FUMA 2XYVA 1QWOA 4MW6A 1HV8A 4LI3X 3AWDA 2ZBRA 2ZSFA 3EQZA 1E4VA 1UQUA 2ZKIA 1E2KA 3I2KA 4O4HA 1ZRNA 2CW5A 4UUOA 2XB4A 3HSYA 3GLUA 2EFHB 1Q1ZA 1PLKA 1YDMA 2GGSA 3ILYA 3MJTA 3JU4A 2GHRA 3C39A 4IJQA 1NV8A 2YRWA 3I34X 1XD2B 1T8TA 2V7VA 4YA6A 4C01A 4PRYA 3CMMA 2EQAA 5U1PA 3ZLUA 3TG2A 2YXPX 1XC7A 4MS1B 4GC5A 4MR7A 4C7KA 3C87A 4GGPA 1Z6XA 4KR0A 3BS4A 3H9GA 2IXGA 3HU5A 2JLYA 4Y0VA 1DFIA 1J8QA 3P9ZA 1SOWA 2BEJA 5BUQA 3STYA 1GCIA 4Q7QA 1RLIA 4RA9B 1PG2A 2W98A 1FYXA 1OXKB 4CQJA 5AW0A 2INGX 2NXCA 3ICPA 2ZZMA 1JIJA 4NLLA 1V0FA 4V03A 2C9BA 3RRJA 2P9CA 4O63O 3WJ1A 3HG7A 2UZ0A 2EFDB 4ZQCB 3KVNA 4ALKA 5JRJA 2I8CA 3BM5A 2G71A 3RYTC 4KQHA 2WE8A 4G0UA 1DAGA 1ISRA 1B8OA 2XVMA 2ADMA 4YP1A 1ZS9A 1DEXA 1AXRA 2F2TA 2A3NA 4J0KA 1V8ZA 1AV6A 5DHUA 4B33A 3IBFA 1R0BA 3I8SA 1Q0RA 1ODLA 1E96A 2O8FA 4AULA 2CXUA 4B2PA 4HWGA 4P92A 4L6CA 1GSIA 2YQ5A 2FMHA 1Q22A 1O7JA 3IIJA 1XQWA 4NWIA 1WSRA 3M1AA 3CXRA 4HGYA 2ONCA 1T5HX 4BJ6A 2JGRA 2DTDA 4RS4A 3F4LA 3M8KA 4UNSA 1EZ1A 1W73A 4JYBA 4LQCA 5C1PA 2AC2A 4HB0A 2ZT6A 5A0VA 1GYPA 3PB3A 4B6PA 5KWVA 2H00A 5IMSA 4LTNA 2BI7A 3EH1A 1S96A 3SBXA 2OV3A 4DLKA 2Q2WA 1XRMA 2Z83A 3AEZA 4HLCA 2V9CA 1YZNA 1ZO8A 5EUQB 2ZRMA 1FMCA 1BFDA 1U1EA 4FZRA 1SXQA 5C8YA 3NDPA 2OWDA 3LQ1A 4OJYA 3OWXA 1JR2A 4PZPA 3CNQS 4RA6A 4U2BA 4W5JA 4Q9HA 3TLGB 3U39A 2IYAA 1TCAA 2NLOA 3S2UA 3V55A 1ZHOA 5LJLA 2F1LA 2QENA 3NM5A 4KKUA 2KLHA 2M9MA 4G5GA 1FOEB 2PNFA 1OBFO 4MPJA 5KDDA 3C3MA 1M5UA 5FO1A 1TPZA 3JQGB 2C5FA 5KHAA 4OO3A 4XW2A 2MYNA 3D8UA 2PJUA 4CI9A 1TM2A 3BH6A 4BO1A 3CS3A 4C29A 1Z7BA 4J4HA 3HO8A 1L4NA 1FUUA 1X39A 3NPMA 1W0KD 2B3DA 5DYWA 3URKA 3OUUA 4Y9RA 1C3OB 1YZKA 5A3QA 3HB9A 5KKNB 1P60A 1URPA 1XFOA 5UKDA 1JH9A 1Y6ZA 4V24A 3ONYA 2OYNA 3IUYA 3BTUA 5ALOA 4PC1A 3H5VA 5LA6B 2AH5A 3O8QB 4B80A 4LTDA 1PJLA 4BGDA 2CSXA 3P52A 1Y1KE 3ASSA 3DHNA 1E3LA 2ZWVA 3WISA 4A16A 4E1VA 3A1CA 3H9NA 2VOEA 4FX2A 3FCCA 3WIVA 4CKEB 1ZDMA 4P7JA 3ZEIA 1KFCB 2QMQA 2X86A 3HAGA 3F6CA 4QRIA 4QEKA 1TAHA 1LS6A 6NULA 3EXAA 2CLEB 2VHUA 3EDOA 2R8XA 2JPDA 3COVA 3JD3A 3L0BA 4C0BA 4XQCA 3L40A 2F67A 3QHAA 1TJ4A 4FGZA 3ESZA 3HMQA 4YUVA 1MU0A 3VOBA 3CEJA 2QI9C 4JX9A 1L7RA 1E60A 2GI4A 4C2AA 3HLYA 4P38A 2C4NA 3UHJA 2AN1A 5PNTA 5IYNA 1ZICA 4GMXA 5ALGA 5ARDA 3KXIA 3LX8A 1MB9A 2GBGA 3G2IA 3MTJA 3OH8A 2QD5A 3RTDA 2GWRA 5AXDA 1KPHA 4XQEA 3RBXA 4B5LA 2AE2A 2VHXA 1D6NA 3THSA 3ILSA 2XPCA 5BV1A 2REQA 2R5NA 1PQYA 2E85A 1M2GA 2FFHA 4PGFA 5GQSA 1AUXA 5H9WA 2X7JA 4KXQA 5IRCD 3KSBC 4MKRA 4ZI7F 1W76A 4MLCA 3EIFA 3P9CA 3VU1A 2FPRA 5HJ5A 4NBLA 4DK0A 4RZ2A 2Y93A 3FFAA 3BAFA 1H2YA 2PMFA 4BTVA 1IXYA 5LMNB 2XNJA 4L5BA 1QF9A 1U3DA 3KTAB 2XNDA 3EISA 5HWSA 5KX5A 4PSUA 2RARA 5LDHA 3VTZA 4DWWA 1NURA 1E7SA 4OQXA 1KNXA 4PRLA 4ZOLB 4YRTA 2NYUA 5EP3A 4BZWA 4I5FA 1V5WA 3ME5A 1REQB 3BHIA 3R44A 3B82A 4X54A 1R5BA 2GJAA 1H3FA 4H4CA 3X43A 2VAPA 1GEEA 4H77A 4K87A 7REQB 1TJ5A 3CJRA 2G88A 4GLJA 3I61A 3T9BA 5F5LA 4ZDIA 2PRIA 2NP6A 1P29A 2OOSA 4UTOA 1HEIA 1ZI9A 1QBGA 4Q21A 2J5QA 1SCUB 4E7PA 4UPEA 3EGXA 2OCPA 2WD7B 3PHCA 2C3MA 3ZQ4A 3EARA 1U90A 3IAXA 3LWDA 5A3JA 4FFNA 4NH4A 3I64A 1AM4D 1D0SA 1TZ2A 1UFRA 4MMXB 4YT5A 1QLJA 4R2KA 3HPRA 2BGJA 4PG5A 2I4LA 3UT0A 3KFXA 3GROA 1Y3DE 3L7NA 3O1LA 3SQLA 4E88A 3U56A 4G1BA 2F9LA 5DI3A 2XMDA 3L06A 2IQ5A 4ECEA 3WFJA 3F6EX 3L6CA 3N8KA 4GYKA 3RYHB 1A9RA 3QXCA 3AGPA 1ZOPA 4OQQA 3X3HA 2Q4DA 1TOAA 2RHTA 3OLQA 3U09A 4PC6A 2AI1A 3FKSA 3W7VA 3KCQA 2WKPA 1SK9A 3D02A 2UXCB 2YOFA 5KPDA 2PL1A 3RWOA 3TAXA 3WFIA 5ADWA 1U3WA 3GK3A 4YCSA 3HK2A 1QB8A 5LN1A 1TMYA 1AO0A 1MT3A 2C2BA 1EZZA 1E1RD 3KKNA 3ORFA 1DWOA 3L8YA 5EZYA 5BVGB 5CDFE 3FCOA 2A5YB 1Z2PX 4DEXA 1TTTA 2ON6A 5ED4A 1FFXB 1FIUA 3EZ2A 2V7BA 4BLRA 1NUPA 3UBMA 3KJQA 3AF6A 1B43A 1W4LA 1ZA1A 5ALPA 1KSFX 4MMZB 5JADA 1QZUA 3A3PA 3P45A 1A9YA 3O47A 1JLLB 1FA9A 1NOKA 2FWMX 4EL0A 4FHZA 3ZDXB 5FHQA 3EVGA 2POCA 4OJKA 3A6DA 4N41A 3PJGA 4LDQA 3AVYA 4ZIRA 5KWIA 2R1ZA 3IT1A 3WR5A 1MH1A 4ZC1A 4ETIA 3O92A 1SOMA 1XZCA 4F1KA 3BSYA 4MRPA 2HI0A 2Y99A 1EK0A 5I5GA 1H8EA 2ZRJA 4DNFA 1TUIA 3IBCA 4OK3A 5D8DA 4F7DA 4RPKA 3NG1A 4NENA 3KT8A 3WJAA 4BZQA 3ZDEA 1LBIA 1QG2A 4Y7CA 3BQJA 5IT0A 5A7FA 3TMAA 1D6SA 3QPCA 4I3FA 1PV1A 4ZVKA 2ZJOA 3L7AA 2X0IA 2PNJA 3TKAA 4MKZA 2RK6A 4PHHA 3RASA 5HZMA 2XZDA 3LXMA 3MTEA 2JCSA 3LBHA 3PA6A 4YLEA 2ZUUA 1AKYA 2P91A 1E20A 2ZETA 3KYCA 4FFMA 5DYGA 2FR0A 2X22A 5T67A 2GFQA 1VQ1A 3QVXA 4L9WA 3V7NA 9GPBA 3D0QA 2QN7A 2Z9BA 4UCQA 5JOQA 2G0AA 4IDEA 4NS4A 3GLVA 2HSEA 1CQIA 2HFJA 3EIQA 2BKAA 2QLNA 4GX5A 4JOQA 5J3JA 4AMYA 4BV8A 4AUEA 5ESDA 4OKNA 2D0OB 1G60A 3CBQA 4J3FA 3C3DA 2FZLA 1NN1A 5L9AA 2DPMA 4AJ4A 1F2DA 4EQ6B 2V6IA 1FNNA 4L08A 3UJHA 1XVVA 1E4EB 2AXNA 4IIBA 3A9RA 1FU4A 1AE1A 4DR2B 1EG2A 4LJKA 3WRVA 5F7OA 3CKLA 2V6BA 3HKBB 3NOXA 2BE9A 1Q0SA 4XUGB 5EHQA 5PGMA 4KGDA 5LL6P 3I6YA 1ZQ9A 3WGMA 5FD8A 4EA8A 5CJPA 2XRFA 3EVBA 3FF1A 1UDXA 2ZXHA 3UWMA 2JGFA 2D2VA 1JNYA 4D98A 3QLUC 3PG5A 3F3SA 4JODA 3OIWA 2H3EA 5ALNA 2H8KA 2AR7A 1VBMA 1E7MA 3FGNA 1GUYA 1U0FA 4UUPA 2R79A 2EYQA 1LTQA 3H3XA 2OFOA 4LZAA 3CH6A 4URZR 5D00A 1P1CA 3LJKA 3U80A 3CEMA 1QQ5A 2IYLD 1IU9A 2CNNA 2I87A 4LF7B 4GZMA 1B16A 4LF9B 3BD6A 2OXTA 1D1PA 4GLFA 1E4OA 3LY9A 3R3JA 2BFAA 3L0CA 2GA9A 2E5LB 4GSYA 3UH0A 2I7TA 1EQ2A 9LDTA 3GLGB 4BRZA 4WK6A 1NJ1A 3MB8A 1EFVA 1DJMA 4RD0A 1XZAA 3E1YE 1GGVA 2RGYA 1JG2A 3VO8A 4CRWB 5GVRA 2ZCJA 2BFBA 5ISMA 1GL9B 2HNKA 2COUA 3GJ8A 4L4YA 1T0UA 2BKUA 5BQPA 2GVNA 2LE0A 2OV8A 2W2QA 2ZXEA 5IH7A 4ABTA 1TO6A 1X7YB 2GEFA 3RWBA 4I1IA 3T1NA 4CIWA 3FUUA 1KZLA 3HP4A 5L8VA 5LR6A 1A8SA 1QH0A 5BWLA 2NNLD 4BMZA 3T3PB 4RZHA 3EIOA 3L1HA 2X1HA 4DNXA 4R2JA 1XTTA 1H2XA 3HFGA 3TZCA 3UGJA 1EVKA 5EQJB 3WYFA 3B8EA 2PUGA 5G4KA 1R16A 3BRWD 4E11A 1OZGA 3GHYA 2PN1A 5FI5A 1N5JA 2W2KB 3R9KA 5IVDA 3EMVA 4QTTB 3BRSA 5T5QA 4JL8A 1I7NA 2Q3FA 1E58A 3ZGXA 3Q0IA 2QXUA 1E9RA 1D2AA 2FRVA 4IKPA 2X6TA 1JSRA 4L76A 2JJYA 3OEYA 3WK7A 1HVXA 1IFXA 4A73A 3A35A 1OHHD 4OK6A 4P5PA 2WD9A 1U0BB 3GPLA 3HO1A 5T4EA 2MWMA 4LY9A 5CH3A 4CMKA 3OIDA 3K94A 3O8CA 1EWKA 1TLTA 4MUMA 1MIOA 3S55A 1YULA 4TS9A 5MDHA 1UBTS 1UKCA 2A4MA 2B5WA 4YRGA 5KBYA 5DTEA 1DXQA 5D6OA 2G04A 3K2EA 4Z4WA 4YCDA 4Z3DA 4PBTA 1KVUA 1EUYA 3Q6NA 4B3JA 4YDQA 3FPSA 4MHSA 3DEJA 1GNTA 4YRFA 3PYLA 1T9HA 1JR3A 1QH1B 1YJCA 3L4BC 3U31A 4DE5A 3QK7A 2LKCA 3U4HA 1GV0A 4C6SA 2G67A 2RGCA 3BSWA 1HMPA 2A30A 2GBIA 5ERGB 4A8JA 2QZPA 1M75A 3GX1A 4MK4A 3IDAA 1D4FA 2IHVA 2QMOA 5K09A 2VP2A 1XA3A 1Z5UA 1E7QA 4YASA 3G59A 2Q3DA 4DSNA 2P9BA 4KR2A 4FBGA 1J1UA 1YR9A 4MS3A 3W2TA 4XGQA 3UC9A 5G40A 3OOHA 1F6WA 4NJEB 4RDHA 4BC0A 4C43A 4GD3Q 3KXPA 3MOIA 4PCUA 1QU3A 2WABA 1U1GA 2IPXA 2JBWA 3AEKA 3JSXA 4Q0MA 1UPUA 2PMDA 2B99A 1GZ4A 2PU5A 2QSJA 3IDZA 5EIWA 4BO8A 3ER8A 3HKEB 1DEHA 2NYAA 3I58A 3WTBA 4DA4A 1ODIA 1CERA 2VDVE 3NAZA 5CX4A 2PE5A 3LNCA 2R7NA 2SKEA 1QF6A 1WWKA 1ESDA 1JVNA 3DYIA 5DIZA 3R9XB 3WLEA 2IYQA 2XIQA 5LD2C 4U7PB 3T5GA 3HB7A 1Y5LA 2FQYA 1T9DA 2G5CA 4L8WB 3J81k 3F98A 2I03A 4UNNA 4OPVA 4Z1MA 2KVOA 3I28A 4G1UC 5GP1A 5HIIA 2P79A 2Z9DA 3WAJA 3FFWA 3X1MA 1WPQA 2VH5R 2KPOA 4ODIA 1EFAA 4X9XA 2EBWA 1QFSA 4IQGA 5LQJA 3J7TA 3H6KA 4RTJA 3CTMA 4PHTA 3E5MA 2A2ZA 3CVJA 2H9YA 3RVSA 3GRPA 3CPHA 4NC9A 4YROA 1U98A 4PYLA 3QSYA 5IKXA 4R69A 5C34B 3TLKA 4ESEA 1NN0A 1TUBB 4J7XA 1KZ7B 1YRLA 5E9QA 5K3OA 2V7UA 4BKQA 5IAGA 1FCJA 1G0OA 1UBGA 3ZDZB 1QCCA 4TQUS 9LDBA 4R1TA 3LFTA 4IV8A 5K0LA 5B5SA 5KTOA 4ITRC 5GIPE 3FTFA 2X8JA 4F1WA 1KD1D 2VFAA 4J2OA 2P7HA 2ACKA 2FXIA 4H7EA 1U8XX 3PITA 4E5NA 5JSHA 3RIYA 3NTVA 5CFRA 5D2CA 1KK0A 5ADHA 1SOUA 2YFHA 4G8BA 3HWRA 5E7IA 1K8XB 1DLIA 3UG7A 1CULC 4IO1A 2PWAA 2P9EA 1A9QA 4KIGA 5E7MA 3LLSA 3W7BA 1JV2B 2HCTA 3A0RB 4YJ2A 3ZI4A 1D0IA 5D84A 1KEKA 4C05A 1INLA 2O52A 1LLCA 3RYFB 3ZY2A 1R8JA 4JROA 4B32A 2X1VA 1J8YF 1P5ZB 1PFWA 4KYVA 4GVLA 4ND2A 4RSGA 5BYJA 3DZIA 1W5FA 5DTIA 4KFSA 3VR3A 1CJBA 1D3AA 2WQ7A 4H0CA 1Z8DA 1D2HA 4Q16A 4N82A 1DWPA 1IH8A 1SGWA 5DYYA 3FBGA 3D59A 1XCJA 2X2PA 2ATEA 1CY0A 2XCIA 1NHWA 4AK9A 2DZDA 1RLJA 3GU3A 2YIDA 2CLLB 2J07A 2OB2A 2GEVA 2ZVJA 3QWFA 4RY9A 1ZVMA 3M6LA 3OCWA 4KQGA 3GFPA 2YTZA 4WXEA 2VYQA 2W2LD 3SIXA 2EGUA 1QP4A 2D1FA 4IZ6A 5JRDS 2I8LA 1G7RA 5J2TF 4OAQA 3AVOA 3WMEA 2VAMA 3T3EA 1YVPA 1R2QA 3ZGVA 1NL3A 1MLDA 2FW9A 3JD4A 3NBXX 3OLWA 1KZ1A 1RWKA 3IXQA 3C5WP 5P8WA 2Z4RA 1E9EA 1M8PA 3NCHA 3VHXB 3IVRA 2QD2A 4UAJA 2QXYA 3AEXA 3KKLA 4JUDX 2YHAA 3P8ZA 1E2UA 1T4CB 3URMA 4RH3A 5BSVA 3QMWA 4F5WA 3FI9A 4Z5XA 4M55A 5CVTA 3I9JA 2V8BA 1VPWA 4IMIB 1C4KA 4M1TA 5DLEA 3OTHA 2GAOA 1EXMA 4IJ5A 4B6EA 2FR8A 2H11A 3UT5A 3FKJA 3O1IC 2WA2A 2W48A 1YZFA 3C43A 4BKMA 2XRYA 2GAJA 2HJSA 4WVLA 3NP9A 4PTZA 4CZ2A 4JGGA 3S6JA 5BMVA 1KYZA 3B51X 4OB7A 5AUOB 1Z37A 4ARZB 5IANA 1Q95A 1CR6A 2P9QA 2V96A 1QIEA 3K0EA 2ZJBA 4ZPXA 2WEKA 3UY4A 3K92A 3W79A 5A06A 2BHRA 3A8IA 2QTMA 3D2LA 4K6OA 3AVWA 1B6SA 1U9YA 1RPZA 1GG9A 3ET5A 2SCUA 4YAKA 3VR2D 3UA3A 3UWSA 1U7WA 3HKCA 5F4MA 2D5AA 3C3BA 2C98A 3I2GA 4U63A 1Y0BA 1PL7A 2PRKA 4E1BA 1REQA 2WV7A 4WDRA 2ZYAA 2X5XA 2NAPA 1J25A 5AVJA 3OA0A 1TYEB 1FEZA 1UXJA 3U3OA 2WINI 5E3JA 1JKJA 1HFKA 3C6ZA 3WQRA 2YWHA 5CG1A 4ILEA 1CW2B 2BMVA 3IUNA 3WRYA 1R8QA 3CZQA 3O3OB 1M0EA 1W5SA 2BL4A 1WHSB 3GARA 4MYHA 4IH1A 4WNAA 4JI5B 3QTBA 4II3A 3LHSA 4C4XA 4EFMA 1EFRA 2C7OA 1NR1A 1CUWA 3IXMA 3ZNPA 3FNQA 2C2YA 2X0JA 2ESRA 1OFVA 3SEAA 5KVAA 1T3LA 2W22A 4LGYA 3AY3A 3LT2A 4KLRA 4KZPA 4DYVA 1I1OA 1B42A 1TM7E 2QRVB 4QYXA 1P0MA 2AKYA 2VHWA 3PWSA 4DY6A 1PEAA 1L8LA 1AQJA 4I1PA 1QU2A 4YXWA 1OFHA 4U9HS 3DBHA 3FYSA 4TKUB 3CCFA 1D2RA 1N9KA 4YMHA 2OAEA 4K0KB 4OGWA 2BZ0A 1YC2A 2PO5A 4V0ME 4HV4A 4IBOA 3S5JA 1J90A 3KAQA 3GRRA 1J2EA 1T4GA 4LX0A 4MPRA 2FFBA 4DSOA 5IKEA 4JLUA 1N36B 3JZFA 4N3AA 2JFUA 2A14A 3WGOA 1D1SA 1K7EB 2CFOA 2PD6A 3C70A 2PV7A 1Y48E 3OZSA 2XYHA 3FY4A 3EPKA 2JGDA 4WDQA 3SBOA 1XA4A 3RM3A 1N78A 2A7QA 3EA0A 4HRVA 4MUBA 4NCXA 4PO1A 4QUJA 1VJDA 4RKWA 1JIKA 1UKEA 5JSUA 5B4UA 3D3WA 1P2GA 2VUIB 3C7KA 1XMOB 1K2WA 2ZCVA 1DBSA 4WZ6A 5BUSA 1KEWA 2GCOB 3IE1A 4R9VA 2A33A 4JGBA 3NQ41 5JSZA 4AMUA 1HPLA 5H1YA 2ZYIA 3CLKA 3GRCA 1ZSNA 4MJXA 5I7OA 4GKBA 2QTHA 1C1DA 4V2UA 3AXSA 3VJKA 5DXFA 2RONA 4B7XA 4EK9A 4TUYA 1DT3A 2BEWA 4JVOA 1BVHA 4IIJF 4MJ3A 4TV8A 1RQ7A 4X6YA 3AF2A 3H4IA 3RVQA 3EQ9A 4CM5A 1Y8CA 3GWZA 4FS8A 4R6WA 5G53C 3I9MA 4WNCA 2O8DB 2DWOA 4XEUA 2EJTA 2B4TO 2NG1A 3EVNA 4AXBA 3RU2A 1U7XA 4JASB 1H5QA 1OTYA 4FX5A 3F7NA 4HNAA 3QX9A 2ZEJA 3VZRA 4EO7A 1AA9A 5JW6A 3TLZA 1SR8A 5TY0A 4QULA 3LNNA 3K6SA 2DHEA 3DHWC 4HS9A 1E6LA 2JARA 3G1WA 4LEIA 4MQFA 1P2SA 4TS4A 3QYAA 3QI2A 3TXXA 3VC7A 3W5IA 1QPBA 3H2GA 4TL7A 1W29A 2HBZA 4ER3A 5LDGA 1TYBE 3E9ZA 4TTJA 4XEHA 5CM9C 5BQXA 3M6FA 2D1QA 4B6FA 2IJGX 3CKKA 1V1RB 4N12A 4MICA 1N0UA 1A72A 1CDZA 5TPWB 1N32B 1ZZEA 1ZUNA 1WORA 2ZJ8A 4U7FA 4WESA 3RVNA 1CBUA 3BDAA 3KSAC 4ZN6A 1K7CA 2CYAA 5DHSA 1FDWA 3R3YA 3RVJA 2PQ6A 3GZTB 5H68A 1N2IA 1NVBA 4D81A 1G16A 2Y76A 3L92A 1G2QA 1IBRA 2WWXA 1RW4A 2G4LA 2J32A 3DUFA 3LUGA 2WC1A 1UXKA 2V3VA 2QS9A 2X8BA 3UICA 1OXVA 2BYTA 3S7TA 3AHIA 2VO1A 4AICA 3QZUA 5CVUA 4L4UA 1U8YA 3GEGA 3C7AA 3IPCA 2EFEB 4BYGA 3T1YB 4KW7A 4ND8B 4QL3A 1Q21A 4L50A 4EUKA 1USUA 4A8JC 7MHTA 3WDKA 1H93A 5AICA 1U7ZA 3ECCA 4XR4A 1ZC4A 5BYBA 1K3UB 4RVHA 5SICE 4AN0A 1HNWB 1I3MA 3FPGA 1COZA 1E2NA 3OLYA 5FNVB 4BLUA 5KVQA 4EZIA 2F00A 2QD4A 3CRQA 1LW7A 3U13A 2AFHA 1OWPA 3CUWA 3GV0A 3H0KA 4IXMA 2I34A 2ZRDA 4DLNA 3H4MA 3FPFA 3TD9A 4WT7A 3Q7QA 4U3JB 5JAUA 3F71A 2OGUA 3A7EA 4N4AA 1XD2A 4ZHSA 1OYWA 1CZHA 2G9UA 5MF6A 2IHUA 4TLCA 2J30A 2ZAOA 1L5WA 2QAGC 3HE3A 2B69A 1LJLA 3KG2A 1N4DA 1MOQA 3K1ZA 3RBVA 1VDZA 1FS5A 2P4HX 1IJKA 1RWOA 4IMJB 5KAMA 2JVJA 1KZHA 2O7VA 2YUIA 4KRXA 2C0CA 1YOVA 3AINA 4Q6WA 5GAJA 4G81A 2OQVA 4JLPA 4I4IA 4RTRA 2OYSA 4C03A 1SU4A 4PR3A 1UBOS 1Z2NX 3KOMA 5FI1B 5LUBA 3B38A 4G37A 3HEAA 3WJ2A 3MQ2A 2VXCA 5IJ9A 1T8WA 2Q3LA 5KYXA 1ZK0A 3EBLA 4XRGA 2KMLA 4IIYA 3EEOA 1V71A 3S70A 1DJLA 3SXPA 4MGZR 3GRKA 5EJGA 4ACBA 4Z4RA 2AEJA 1CJUC 4XOTA 1GRCA 2B1IA 2ZXFA 3DKRA 1HDYA 4O02B 4QDUA 3K71B 4MB6A 2OD9A 1KSGA 5K5EA 4BXOB 4DRYA 4GOOD 2C2GA 1B4DA 1MO2A 3WWEA 2CDAA 3M2PA 4TVOA 1U8FO 3E82A 3EA4A 1W49A 2YHIB 1NUTA 4UCXA 3PICA 5BYAA 4W5QA 1SKBA 1QORA 3I76A 4AJ9A 5JPCA 1FFHA 1DXOA 3R76A 2NU6B 2FQ1A 2YMLA 2D8AA 4YDHB 3AUJB 3PYMA 2BZ1A 4O4JA 1ESMA 1M1YE 1MXFA 3ZU5A 5HF6A 2NTEA 3P27A 5JMOA 4BRWA 4KIUA 1SHTX 3VTKA 1NLMA 1E5VA 1N2ZA 2RHDA 4QVAA 3DDSA 3G2JA 1G3MA 1ODSA 3ITEA 4MRNA 3O9ZA 4M1OA 4Z4VA 2NU7A 4P86A 4KI0A 1P4MA 1JAYA 1W46A 2Q1YA 5EKTA 4WH0A 5TEVA 3M9WA 1MJGM 4GLBA 5JZ9A 3K0SA 1RPNA 3AR3A 1AURA 4WUVA 1BE8A 3MT0A 4AW9A 4LQ4A 4D4KA 3R6JA 4DADA 3D7NA 2FR1A 4Y2HA 1GOTA 1Z3CA 4N0QA 1HSOA 3PGJA 4GIBA 3S1AA 3DCJA 4AKEA 3HYSA 3IP1A 3KV1A 2M2IA 2RAUA 3FTDA 5TE9A 3BD7A 3M5PA 1QC5A 3UFXB 2PGLA 1EGMB 1UPXA 5ELMA 3FCSB 1CB7A 4H6XA 3ROFA 3NV7A 4M87A 2N9UA 1XTPA 4MV6A 3JWEA 1PJRA 3OFSA 4QREA 5T6BA 2NZXA 5HKOA 3N2EA 1T5LA 4QUAA 5IVPA 1ISPA 1M7BA 1RKBA 4DB4A 4YJKA 3HJAA 3QELB 4B3HA 4X8OA 3P32A 1I2ZA 2VUTA 4IZOA 2NUBA 1J09A 1E7YA 2E82A 4BGVA 3EIXA 5CGQB 4AKIA 2SNIE 3F49S 3AIIA 2ASVA 1CZNA 2H65A 1FDSA 1KAMA 2Q5FA 3IV9A 3ZDYB 4FOPA 5ALEA 1QM5A 1ZH4A 2GD1O 1ORDA 3KQYA 1OVMA 2VPPA 4GLOA 2JEYA 2FAXA 2WILA 5CNIA 1BPLA 5JXIA 2OEPA 2R47A 1UKZA 4NOKA 2MIIA 2VNAA 3S68A 2YCBA 1NBIA 4WGGA 5E0KB 1ZFNA 1W0JD 2RAPA 4FINA 2HDWA 3QKIA 4WFQA 3PX3A 1KOJA 2XI4A 1E61A 4EX6A 1YI8A 1NBOA 3FG9A 3SR3A 2JGAA 4OGFA 1L4GA 2HOQA 3SHOA 1WMFA 2JJ2A 1QHEA 2Q27A 4LQDA 4YYEA 1SXJD 5IN4A 1IC6A 1RLMA 3CW8X 4JZYA 4KAAA 4E31A 4DDUA 1I3NA 3U5ZB 1N0VC 2DCUA 4ZI5A 4C4RA 1M2HA 2XYRA 3NEJA 2PSFA 3WGLA 5I7UA 4REQB 1P3Y1 1FP4B 1L5YA 2B1QA 3DG9A 3H13A 5DXJA 5IM4F 5C4GB 5I48A 3B6KA 3GJ4A 3IQDB 3JU3A 4NMWA 1DC5A 3PIRA 1KFJB 3M70A 4NI5A 4E5YA 4LRYA 4ZCSA 5JNSA 1E1CA 4KDRA 4DNPA 3KZOA 3LO8A 1OXMA 1WUJS 2HRDA 4NDZA 5B1YA 3ETJA 3CCMB 1UJ5A 3PUKA 4MA4A 4BKRA 5EHXA 4GMFA 4QHSA 1OAAA 5FAXA 1U9IC 1XJCA 2YVUA 4HGOA 4INOA 4DCCA 5K6RA 3JYNA 1EX1A 2QZ4A 1N2CE 2PH7A 3EEFA 2PFGA 3G8DA 2HU5A 2GSDA 2R1VB 2OKGA 4D8XA 3ZHCA 5HW0A 1XI2A 4QTUB 2ZVDA 2ZBDA 4G09A 1J2UA 3OAAA 2UDPA 4GX2A 4JCOA 2O8NA 4F46A 1XPJA 2YMMA 2I66A 3PVDA 3KT0A 3HI4A 4XPZA 2D59A 5HA5A 5AVVA 3ONFA 5DGXA 2IOHA 2QAIA 4HAUA 3A4IA 3GLQA 5E2IA 3IJRA 3IPXA 1TGVA 2VXBA 1FP7A 3PPVA 5ALWA 4IQ8A 4YRJA 2FSGA 4D99A 1A97A 1FK8A 4OQZA 4AF8A 4YP0A 1IHMA 1S3SA 5BN4A 2CKMA 2QG9A 2CVOA 1IOLA 5IYZA 1IHXA 1LBTA 4DBLE 2K7FA 1NVFA 1P4RA 2VWPA 4OUDB 121PA 4MKXA 4OAOA 3TIVA 3RYIA 4UCWA 4BP9A 2VK2A 2Z2IA 3N2GB 1I94B 1AK2A 5F2OA 4M8LA 2HD4A 4BIIA 4YDRA 4PZYA 2X9VA 3FLEA 4M1SA 5LQDA 2PO7A 3MIZA 4ZJPA 5FPQA 3G4SB 4IG9A 5KJ1A 2XOXA 3SKBA 1UBSB 3M4YA 2X41A 1MIOB 2RH5A 2YOGA 3WQQA 2FMXA 3GGGA 1KKLA 5L4SA 2JCXA 2JJ8A 3R3UA 2QDKA 4XD2A 3BGIA 2FOIA 1NFQA 2XIJA 4QLOA 4F91B 2FQWA 4GR5A 4NBUA 1TDJA 3EZGA 5CD9A 2BTEA 1Y4UA 2NYRA 3PPXA 2TMKA 3GP3A 3HDGA 2B7BA 2I9PA 3QG5A 4PLWA 4NJEA 5A9RA 2P78A 3C8UA 3VR6D 3GLKA 2JIPA 1BEZA 2H17A 1GP2A 3GJYA 4G8JA 4NCJA 1BXKA 3V42A 1B3BA 1D7AA 3BC1A 5FUYA 2WQ6A 3OQIA 2H85A 1JDUA 1RWBA 3DEKA 3ANXA 4EF4A 3LKBA 4ZOAA 1RXSA 3FCYA 3WYGA 1X8LA 4GQAA 5B53A 4M54A 3UMYA 2RC6A 4UBIA 3HKBA 1U9JA 1UDCA 1KMMA 3EAFA 4N5HX 3DE3X 1QAMA 3G0GA 3HEMA 3OHSX 4TV9A 4QWWA 3A11A 4IW3B 5EXXA 4KPYA 1Z35A 2FW6A 3H7AA 1N2BA 4RHYA 2QN9A 3JWJA 2R8BA 2YNMD 4O0MA 2VHTA 2OGWA 2X3YA 3VUFA 5CYGA 1QQTA 2ZE8A 1EIZA 1P75A 2X7XA 4D4GA 4OHKA 4OA8A 4MWZA 2VZLA 2V7QD 3ZVKA 4GGOA 1XAGA 2XUQA 1KC8D 1V3UA 3BJEA 2C9YA 2PRSA 1TJYA 5DEIA 4BNLA 3GLTA 4PYKA 3WNZA 4A36A 2CXOA 3IVXA 4OQYA 2R7MA 5DWVA 2ID9A 1M2WA 1LZKA 4WOPA 5A1JA 4GS5A 3VOAA 1L9KA 4B7CA 1THZA 2OCKA 2A1TS 2PE3A 2P9ZA 1J9GA 4JBHA 2PWBA 4QFMA 2N0SA 4DR7B 4MVJD 5AVQA 3HRIA 3G2HA 5EA2A 1YR1A 2JIZD 1S7CA 2QLJA 3TK1A 4AS3A 4CM9D 3HZZA 2M6KA 2QRMA 3VNUA 4OG2A 5GADl 5D3KA 3LLUA 1YS1X 3HVIA 4FYJA 4FI3C 4JB3A 4JJ8A 3DM9B 4EW2A 1YJQA 4CYMA 2H48A 2WPDD 3B9PA 4XVHA 4TRNA 3ZCUA 2QUIA 2QW1A 1LC0A 5KTTA 4UQPA 1QC5B 5DP2A 1J06A 3A2MA 3NHFA 5FLKA 3PEFA 1F0YA 1WKBA 1XZLA 2O3UA 2PSEA 3L7CA 3MWJA 3QG1A 3DO6A 5CXQA 2NZ8A 1FLAA 1OA1A 2ZRFA 4ZQGA 4BQPA 1RTTA 1RP7A 1V45E 1V9SA 3W2FA 3VAAA 3GPCA 4BNIA 2Q7DA 3MOSA 3G5UA 1AQIA 5EWJA 5FKJA 3MINB 4LVOA 2EP7A 3BQNB 4WFKA 5IBRA 4ALIA 5HZHA 2PZ8A 3MK31 2VQFB 3BDIA 2WQZA 1LBEA 1SIUA 2AJLI 5JD4A 3OQMA 2DR2A 1DJOA 4J9VA 1JGTA 4HH3C 4I9UA 3FOAA 4H6WA 4HNHA 5L4NA 2Z04A 2I8AA 3GVPA 3MUNA 4UHKA 5CK5A 5E8JA 5JEEA 5JJIA 1WHTB 2IHBA 3HDTA 3ROMA 2V7XA 1SA0A 1SVUA 2R2AA 1BXGA 2C8JA 4MW4A 2BWJA 2NU8A 2CZGA 5JVDA 5DISB 3O6VA 4A4DA 1YCDA 4M2LA 2C2KA 4GZ5A 4AF6A 3UTCA 5CDGA 4MOWA 5DI3B 4IZIA 2VJAA 3GF4A 2EX4A 1VQKB 3O8OA 1XLTA 3ZX4A 4NJMB 3FDZA 3H8WA 5KPJA 3PNOA 2YINC 1NPDA 4ENUA 5IASA 4F6RA 5GINE 4RTMA 1QRUA 3NTRA 3NFYA 5JTUA 2UYOA 3LP5A 1LK0A 4MVJP 3NHAA 5I9LA 3CUEF 3O3MB 5D7BA 2D74A 3MWDB 3CF4G 4OP7A 1ECJA 2WBLC 4YJ3F 4X3PA 5GJCA 5CLJA 1ZN2A 3HCOA 2O3RA 2GEJA 4S1WA 5EJ4A 1OFUA 3QELA 4PLYA 4PSCA 1H2FA 1NW7A 2H4JA 3WK4A 2P2DA 1G6KA 3R0IA 8ATCA 5J4VA 1XZ8A 1T1RA 2YMPA 1T34A 2WR8A 1HRKA 2D3WA 2QTFA 2QAJA 2QTWB 1Z16A 1GGEA 3B1XA 4AY3A 1VKRA 2A5GA 3ESXA 3BMXA 3GJ5A 5IKOA 3CLUC 2R4QA 4HBZA 2QRJA 1UADA 2XNDD 1ZHHA 4PCLA 2ZTLA 4HXFB 4RF4A 1FDRA 2I1QA 2RHWA 1YOVB 3BMNB 4G5YA 1KMHB 3VMMA 4EPWA 4MW0A 4LF6B 3L8FA 3LECA 1FFBA 1M67A 4KXNA 4GZ3A 1IHOA 5LB4A 2VHQA 1IVSA 1Z5NA 3L4KA 3AL0C 2YZNA 3ZWWA 2GF9A 2VJCA 3GVKA 3F1LA 1GD1O 3HA7A 3NIBA 3ZW7A 5CLIA 4AXXA 3W5CA 4JBWA 2G36A 2NAFA 2J87A 3I53A 3AQIA 1YNSA 3VBEA 3QJYA 3R3ZA 2PS3A 4KE7A 4XM2A 1HORA 1PWHA 5HRAA 3SICE 5TDHA 5I4KA 2PK3A 4KKTA 3E61A 1BJTA 2HA5A 4O5AA 2C2ZA 3RHSA 4B3SB 3SMQA 3BE8A 2FPPA 3KJZA 4ZEWA 1NUHA 2F64A 5JSFA 2ATVA 5FNVA 3DT9A 1JEDA 1MNQA 4KFTA 5F1PA 3TZQA 1YIAA 2YHIA 1Q7EA 1RLTA 5JARA 5HF8A 1DC6A 4LF4B 1K6JA 3FROA 3EW7A 2A0XA 3FNBA 3RIHA 1A5BB 1TUEA 3TRKA 4V3CA 1FFCA 1XD8A 3HADA 3RFUA 2G1UA 1UCFA 2OB1A 2WI8A 3I6ZA 5DM2A 2ZJ2A 4WBXC 4MRAA 1XRJA 4EECA 2R8RA 1B1AA 1NY6A 1XRPA 1B8NA 2FRXA 1SPXA 2F62A 2CLHB 2O2DA 3H5OA 3U7EB 1OT5A 4P83A 1VKJA 2I3DA 3IP8A 3WI7A 2V3CC 2EW2A 1GUZA 2WWWA 2YIJA 2BFEA 4EKGA 1F6BA 3LS2A 4XQGA 1F51E 4AN1A 3UJBA 1V9CA 2CXQA 4BQIA 3NOQA 4EAAA 3L4BA 3JAKA 1YF3A 2VAVA 4OATA 1SUCA 1SO8A 4KQFA 1KMQA 1LH0A 4FC6A 2O3QA 4RABA 5IUKC 3L5KA 3HNOA 4I55B 3K1TA 3QW2A 5KHLB 5J9FA 4GICA 3UK2A 1GZUA 1XZQA 1KP3A 3EF1A 1V8FA 1SKMA 4NEQA 2F59A 3HDHA 2W93A 3I3OA 3ROKA 5BQ5A 2ACEA 1NU6A 1NI4A 1QP8A 4MGKR 2WSLA 5BWNA 3OM8A 4RYLA 1GO2A 5G0VA 3O8RA 2SKCA 3RC3A 3IQWA 1Z12A 2J9FA 3PUWA 4G85A 1VHEA 2OXEA 4V0NA 1XEWX 2FOLA 2JVKA 2E1BA 2QEQA 1JDBC 4UFNA 5AJYA 2GFIA 4WKGA 1XDUA 2OBRA 4EFKA 4CN9A 1Z4JA 5HTKA 2B9EA 4FZJA 2P69A 1UC5B 1AKQA 1JLRA 1CX9B 2QMUA 1K9SA 3EIUA 3FHTA 4FYKA 4IGEA 4X91A 4FXUA 5KX5B 1DCTA 3J7AC 2GNPA 2W4QA 4XN0A 2CLDX 5ES3A 1NMYA 4C9BA 1J49A 1YNOA 1GCGA 2JFWA 2AOUB 3QKRB 4JD5A 3NNDA 5HGJA 1JMVA 4C21A 1UBMS 3G13A 1TADA 1KAOA 2VT3A 4MLPA 1EINA 3R1IA 4J6FA 4RKQA 1IPEA 2VJLA 4YWJA 4F8YA 5F9FA 2P4EA 3AO0B 3CMCO 2VQ3A 3VU8A 1UOEA 1A1VA 3OFNA 2HFKA 3GEMA 4QXOA 1L5QA 2G06A 1GWNA 1JIUA 4D8WA 2QL9A 4RJTA 5HIKA 1E2PA 3CISA 3GEBA 3VAZA 2BF7A 3A1TA 3MOGA 1OASA 5E9AA 3LC1O 3FX2A 3FNGA 5DVZA 4JMPA 2IEBA 4MCHA 1H0HA 4TMZA 1FFGA 2EP5A 4AJ2A 1JQBA 3JYPA 7MDHA 3GWGA 1ULUA 1XTZA 5DGTA 1MUUA 5EESA 4JHLA 3T9DA 1U7PA 3UJ9A 1JG1A 2FEMA 4JYCA 4WZAE 5AM2A 3JAWA 1OV4A 1EGHA 1W85B 2QKYA 2WHPA 4BNYA 3TNJA 4HGNA 5AI0A 3WRWA 5HP4A 1CY1A 4MUGA 1G20E 3EW9A 2IOQA 4C4AA 2IZ0A 1KK1A 1QJCA 2V8OA 4JT8A 4UAGA 3IBYA 1IY2A 4DJFC 4DWOA 4RK1A 1XVIA 3L9XA 1ZXLA 3PC3A 2XAUA 2BJWA 3TL6A 3OQVA 4QYWA 2NTVA 5EZSA 2NZUG 2JDIA 1PDVA 1SC6A 2LNDA 2Y27A 2VAWA 3FBWA 4K5QA 2WIAA 1IJFA 5KNBA 4GDMA 4XWGA 5D7NA 2A57A 5JH7A 4GEKA 4TQGA 1GY8A 2GB4A 2LGJA 4AX8A 4E5UA 1WB4A 4Y6OA 5C5IA 3EG9A 4REMA 3V7YA 5KREA 1BQEA 1X0VA 2C1ZA 1TA4A 4TRMA 1S6YA 4YBRA 2P3LA 5ALJA 5AW1A 1R50A 4YTEA 2YWDA 4CQMD 4CW7A 4DRZA 5FNVF 1KEUA 1N1DA 1PD1A 1R6BX 2IEDA 1YAJA 3JARB 5DT2A 3RKSA 3S2YA 4BCCA 1GDTA 3PE3A 3VPHA 4ZJUA 3S8EA 4E2ZA 3L1UA 1EDDA 2QTRA 4Y2RA 4ESOA 3O21A 1YFJA 1JBQA 5J2UA 2C31A 2EX0A 3ELDA 4TKOB 4MUYA 4Y1RB 1LK5A 2FYTA 2YJ5A 4I5GA 1W8DA 1NQVA 2FW7A 1VKZA 2H2GA 3L0OA 2Q50A 4NNJA 3O4VA 4HJXA 4U4AA 3ESAA 3AHDA 1R27A 2VYCA 3G02A 4IEIA 4Q6BA 3PHHA 4XPIA 5JS6A 3KZXA 1Z34A 1AK9A 3ZD6A 4MDFA 3OEED 1KBQA 1XZGA 4L5CA 4R8KA 5KJCA 1EUZA 1NQTA 3V8RA 4RFVA 1Q3HA 3DBHB 2YXLA 1O5OA 4MIOA 2ZVPX 3EZFA 4AURA 4RHXA 3F3KA 3I3SR 5BNFA 1S01A 5A8AA 5ADVA 1YB7A 2UUOA 1OZ0A 3GMSA 5I7FA 2O3TA 3DFKA 4EUEA 3IQZA 2QN6A 1JR6A 3OMWA 2OCXA 2YZGA 3UT6A 1AUQA 1WO8A 4NR0A 2C7VA 3DA8A 2ISQA 3FOFC 2OTLB 4A6PA 4HNGA 1P1BA 2EERA 4W82A 5AI5A 2YWEA 2Q2VA 2ZSBA 5FYDA 4XKWA 2Q4TA 2EFYA 3UJCA 1NVAA 2WJ6A 3RC9A 2HX1A 1VB3A 1FQJA 1CRWG 3BREA 3GY0A 3FM9A 3PVZA 1AQ6A 1LA2A 3OKAA 4PO9A 1TF5A 1IK4A 1Y3FE 3B2QA 5T4FA 4PAQA 5FQNA 3IEXA 1Z6PA 3GGDA 3ETEA 2PBZA 1YBVA 2QK4A 1FLNA 3QBVA 1Z56C 4NABA 4PX5A 3W90A 2HIMA 3L02A 4DMLA 4ZEMA 8GPBA 5TSDA 3OD1A 2ZAYA 3M1YA 2ZS8A 3SYRA 1C1HA 1R6AA 4AKTA 3CD6B 4KXVA 3BXPA 2PG3A 1KETA 2IS4A 5TMBA 3PIDA 4NK5A 1T4DA 3LY5A 3QITA 4PX3A 4WTOA 3VOSA 4BO7A 5K45A 5FFMA 5KU7A 5FR2A 5I9IA 1GNPA 2WUGA 2OTJB 3L18A 4M0EA 2H29A 4K3UA 1HE4A 2DSTA 3VU9A 4NYMQ 4WZZA 3GIRA 5TB5A 5B4VA 1ID8A 1DTWB 1ZUWA 3QTTA 4X8HA 2XCOA 3ADPA 3AOGA 2IP2A 4KWIA 4RMGA 2BELA 3WKCA 5ALFA 4GNKA 4PTLA 4YMUA 2IXFA 1Z82A 2W4IA 3O2JA 4K9KA 4M37A 4R4JA 4P4SA 2XUAA 1DG9A 2OXFA 2FGKA 1KU0A 2GM5A 3SD7A 4DK1A 5A62A 4RDLA 1AB6A 3PNQA 3T9EA 2D1YA 5E4FA 3RKRA 3DMHA 3THRA 4I1UA 1ZD3A 4XUEA 3TZKA 3TO5A 4LYHA 1CNEA 4G5RA 3Q12A 4MCAA 4BNHA 1W4BA 1T8YA 2V0CA 2G4VA 1NP7A 3INGA 5DRYA 1QIHA 4JELA 1II8A 2QTVB 3MLEA 2AVNA 3H6HA 3R3HA 4MI9A 3VSCA 4DV4B 1G21B 3PF8A 4CM4B 1VIMA 5KYNA 1B0AA 3RJ9A 2I6TA 4HDOB 3ONVA 4R83A 4A26A 4EG4A 3ANYB 3DMPA 1UKVY 2VZEA 3AB8A 4FTWA 5DSXA 5B7PA 1U0SY 4B8WA 3JQ8B 1CE8B 1EUCA 4H1TA 3QLVA 3MMSA 4UE3S 3N2KB 4OKIA 3W7AA 5F3DA 4DT1B 1I10A 2I0FA 2X4LA 3OU6A 5CLFA 4YY3B 2IS6A 3UPUA 1X19A 3K0BA 4WN9B 2OHGA 3VGPA 3HN6A 1G21E 5IT9A 1WOOA 5JO0A 3CVVA 3DV0A 1ECBA 3LT1A 1WDLA 1JQEA 1XCGB 1EXWA 2H7YA 4U02A 3V6MA 3LMKA 2G9VA 1U7TA 2BSXA 4ZQEA 5AD1A 1JDTA 1X1CA 3QXSA 1N9GB 3SZGA 2VEOA 3BSSA 3NETA 4US1R 1QHYA 5IM5A 4D9JA 4EEXA 4EGSA 10MHA 1K27A 3N0RA 5GV7A 1P1IA 2PFSA 4FJ1A 4M1YA 5KQRA 2P9GA 1ZHFA 2RE8A 1GGJA 4CUJA 4MAMA 1Z5GA 1BA2A 4M9XA 4IF6A 5THQA 3EQ2A 5ALSA 3CLTD 1KEEB 2OENG 1T0IA 2EP8A 4H6PA 5AVRA 2HCRA 3I5AA 2J0UA 3T5AA 4OCZA 3PQ2A 4ZMSA 2KHZA 4LJ8A 4IMPA 4XFJA 2V65A 2CBXA 3E2IA 3H97A 5B12A 3LY8A 2IHYA 3I5MA 2UZ4A 3ZXIA 1NVUQ 1RAGA 2IYWA 4RANA 1BH6A 3LQEA 5DOZA 1VECA 1UJMA 3ESDA 3O31A 5J5CA 1BDJA 3A3BA 7YASA 3U0VA 2Q4OA 2EFGA 2HM7A 4I3GA 5E95A 4JJ7A 4NV0A 3ZJ4A 5ICCA 1G2OA 3FYDA 1BE1A 3WK5A 4UVEA 3DQPA 4H7HA 4LYDA 2QY9A 1YVDA 4BB0A 4EY4A 5IN5A 4BN4A 2O2HA 2GA8A 2QLLA 3CUKA 5M2QA 4FXOA 2E4XA 3AY7A 1X1AA 1DQPA 2QGGA 3G6KA 4GEGA 3EDMA 1HWYA 3O4HA 4IIVA 4HAWA 4IFIA 2R5WA 3QY9A 5EWJB 1E2DA 3WKDA 4O25A 4B3CA 3TSOA 2V3WA 3GJXC 3W2GA 1U0TA 3VDNB 1JNXX 2OTCA 4IWYA 2BGMA 1RJ9B 4HMPA 3ZTYA 3NONA 4B7UA 4AQ7A 2ZUBA 4MKIA 3EXG2 3CP8A 4BKUA 1ADCA 1VL5A 4GW3A 5FLYA 4UVDA 4O2AB 4MZDA 1G5TA 1P1JA 2GEDA 5KOJA 3QF4A 3E9CA 4OQFA 3LE8A 3IKJA 5D5HA 3WIDA 1VHLA 4JJ6A 2DFKB 3O4GA 3SZ3A 5ILOA 4CEHB 4G1MB 2IW3A 3BICA 5F1KA 3RYIB 3OETA 2G1JA 2ZOSA 1YQ9A 2DKOA 3C2QA 3I8XA 2A1UB 1SD5A 2VCHA 1ADBA 3ISXA 3A36A 3AGQA 1K73D 1YHNA 2ANBA 2X0NA 4QU0A 2DIEA 3WK9A 1Q0TA 4COKA 1TIBA 1E8NA 3F5SA 1IJEA 5HR5A 1GA6A 3K9FC 1NNUA 4F11A 2PZAA 2C9OA 1WMBA 1J9EA 4PF1A 3T5DA 3P0IA 4HPWA 1W87A 1A50B 3GJRA 3O4JA 3LA8A 4F04A 2OM6A 3OCJA 4I4TF 3UMVA 2OV4A 1JDVA 3IVAA 4TUYF 4A2QA 5M29A 4HQNA 1E89A 4L2IA 2AFIE 1HG0A 1MTZA 4HQFA 4LZOA 4D92A 1HTWA 4F6CA 5AWFC 2FWNA 4AIIA 3HHPA 1TU3A 4Y6SA 1AHIA 3M6VA 2FLVA 3W6OA 4AWXA 2XGMA 4D6PA 2WJHA 4ZYVA 2VDPB 4GPIB 1E92A 7AT1A 1G7CA 3DOJA 1I32A 4MRRA 5DM4A 8OHMA 2GJKA 3LHDA 3MHTA 4H31A 3NHLA 3A6KA 2GFHA 4U6QA 1Z2CA 3X2EA 4BBZA 1OQAA 1PQ4A 1KQSB 1QHHB 5ARBA 4OPOA 3AUYA 1CRLA 4II2A 4CIDA 4R2MA 3H2ZA 4RKEA 4IM7A 5KQSA 1O6GA 4C30A 3HXOA 1Y4SA 2JIDA 2REXB 5DMHA 1V96A 3O1JC 3OKPA 3QEKA 3VO2A 1VQPB 4MP3A 3LL4A 3T5MA 2ZAIA 4DVJA 1JG3A 5GV8A 3EFOA 3NC4A 4U2CA 4M7OA 3N8GA 5HVNA 1NXQA 1EWTA 2FLWA 2NZWA 4JOCA 4MQEB 4NZZA 1BWSA 1GAQA 4QELA 5EE5B 5IJXA 5ICSA 1BH2A 4EFDA 2RB5A 3LIIA 3HCPA 4RFSB 4ZT5A 5I9BA 3PYXA 3DMRA 5I9TA 5EYPA 2PVSA 4YAFA 1N5OX 2HF8A 3ETGA 4I50A 1I6LA 3BL5A 3K9LA 2O0HA 4XB2A 4CKYA 4CNQA 3V1MA 2PCLA 2MDTA 2ZIUB 1FP2A 2DUUA 3LAWA 4H3KB 4URFA 4XOUA 4TKVA 3K70B 2EF1A 1JR3D 1UJCA 1XTVA 4JJIA 4EUFA 4OHFA 5K8UA 2VVTA 1GRVA 1T6XA 4L28A 4RTKA 1YVEI 3OKXA 2BR4A 3NOVA 1H42A 4XCQA 2GK6A 1V47A 1GT91 3GSIA 2HC9A 2G9NA 3U7IA 4D56A 2JB9A 1Y7TA 1E1CB 2J3KA 3TCNA 1D09A 1FW6A 4MVJM 2UVQA 2M1ZA 1KVRA 2WM3A 4KCGA 3RRFA 2JIMA 1WZEA 3DXYA 2ZCUA 1KY3A 2E37A 1QZXA 1GADO 3L4EA 5J1SB 4HG2A 3CEAA 4QODA 4L8FA 2I4RA 3KUDA 1M74A 1VQMB 1KFBB 1PL8A 5REQB 1CUVA 3T9CA 4E2YA 5JWOA 2C9CA 2Q0SA 3PJEA 4DKXA 5DNEA 4WY5A 2A88A 2J5XA 2IH2A 1K8RA 4I9FA 2VF4X 3UUFA 4B8YA 4H27A 1ECGA 1NWCA 1QIIA 2ZUCA 5FWXA 3B60A 4FZVA 1B6TA 3OT1B 2F4VB 4LFBB 3RW9A 2PL5A 4P0QB 5FUXA 2O5VA 1YJ9B 1I80A 1SHKA 1J0CA 1EFKA 4TSRA 4QJ5A 1C9JA 5I7RA 4TMVA 4YO7A 3ETCA 2BZSA 5MN5A 3CINA 3ZHYA 1T9AA 1U65A 2CLSA 4L07A 2DLDA 2EV9A 3E22B 1D9XA 1FYDA 2WNSA 4KO8A 3MAAC 2XB2A 1YZ3A 4S2EA 1ABFA 1ENOA 1QTNA 1YBHA 5BUZA 4DC0A 4V1CI 5LYJF 3GZJA 1JYEA 3K9BA 4P4SB 4D6XA 4C2UA 4NULA 3RSSA 4X7BA 2EZ8A 3O90A 2PUDA 4KGVA 1VG0B 1VCOA 1UMBB 2GXSA 3RC7A 4DCOA 4FDTA 1VI2A 1YRWA 3SZMA 1WY7A 3AR4A 4N54A 2B36A 5F21A 4O8ZA 3SM9A 2EWWA 4HMQA 2B8EA 1ZN7A 4NPHA 1F9AA 3RU7A 1T0PA 4Z9YA 3ZY6A 4OYLA 3E20A 5E1MA 5AM1A 3VKHA 2BOVA 5D86A 3L79A 4UHBA 4XQ0A 4J75A 3EZYA 3M5CA 1R0CA 2VRWA 3STTA 3H3JA 5JZBA 2ZBEA 3QJGA 4Q1BA 1WZUA 3K0AB 4MHOA 2FEXA 2JJ1D 3ACCA 3DTYA 5KYKA 2H1RA 3ZZ1A 1ZAKA 4POOA 2R1TB 4BBPA 3COWA 4JLWA 3FF4A 3E6AA 2I1LA 1O94D 1NI5A 1X7DA 2XOKD 3AUKA 3P20A 4L7QA 3VR1A 3IAS1 2VHYA 3JQEA 2ODTX 1LEHA 3LIPA 2QTBA 4B2YA 2O0JA 3C3XA 5FUQA 2AK2A 2ECPA 1P3JA 3DE5X 1BRTA 4JIMA 4B48A 1SBQA 5A7GA 3UNXA 4H4DA 5FBWB 4D57A 1QKJA 2EC5A 4HWRA 4QKQA 1DWQA 4LJ5A 3ZYZA 5KJ6A 1RYMA 1XQBA 2FV8A 5C7IO 4ZTZB 5CW1A 2Z2JA 4KQ9A 4D5EA 2DB3A 5AQEA 521PA 1I7DA 5AK6A 2IIVA 2FHPA 5AVSA 5FORA 2CUTA 1Y8RA 4OHUA 5EE0A 2JG3A 3KVYA 2MR6A 2OCGA 2XKJE 4LJ9A 4GMDA 4RCZA 2Y2UA 4OYRA 3DNPA 3IDFA 5A05A 3L1VA 4MVWA 3TNFA 1T9GR 3OLVA 4JL6A 4MQ4A 1OR8A 2BJHA 3QIVA 1MC4A 4FI3F 4QRDA 1V95A 3N39C 1CR4A 1MABB 3U26A 2E55A 3LDGA 4N6OA 1XAIA 3VR3D 2BHNA 5JNLA 3IODA 1F60A 4BO2A 4YJHA 2ROQA 4YEJA 1JHDA 1ST3A 4A0SA 3OJEA 3C8HA 4DUZB 2D7DA 4A0GA 2PT5A 1F48A 3DOOA 2OC9A 4E5KA 4ABYA 2P2GA 2LUOA 2BM9A 3IAM6 4MVJI 1U2GC 3OM0A 3PJDA 1E3WA 5G0WA 1YR3A 4C4YA 2JGNA 5L51A 2HMYB 1Q16A 3F73A 2J6HA 2QSUA 4IDNA 2A6PA 4F2HA 4JSYA 1FLDA 3VKGA 1KOFA 1XXHB 3T7KA 2KS6A 1Q15A 2V4ZA 3TMYA 3WIBA 1YA4A 4F3RA 4RY8A 5IULC 2EDAA 3DOFA 4PBRA 1QVRA 3ZD9A 1GSOA 1XLUA 1F9EA 2VF2A 4XVQA 5DWDA 1IQ0A 1IN6A 1XL0A 3O91A 5KNLA 3FAZA 1WLSA 3B3AA 1HZEA 1RM0A 2BGLA 5DPMA 3WWZA 4ZAGA 2VN8A 4OLAA 3WBKA 4BFWA 4EGQA 1PT6A 1O58A 1OFUX 5ER9A 5F76A 1BG6A 5TS3A 4EB6B 4J0GA 3KYBA 4KNWA 1QO9A 1PX2A 1WB5A 1ZINA 3AMVA 1I1HA 1XR3A 4O2BF 1DBQA 3WDLA 4BXOA 5M3BA 2DPHA 3C8MA 3COZA 2O7SA 5E9JA 4BO5A 4K28A 5CBPB 3DZKA 2GXUA 3LGAA 1ZNQO 1ISGA 2C82A 1OXSC 3G7NA 1MC8A 1KYQA 3K4QA 2GO7A 4LE1A 4RV9A 2UYYA 2XMQA 3VPFA 2D3LA 3K9GA 4X8MA 1XNJA 1RCFA 4KPFC 1AUVA 4EW3A 3V2IA 2BTQB 3AUXA 3IMFA 4OHPA 1KYIA 2R8EA 3VX3A 1E62A 5JWRA 2XT6A 3OA2A 4X60A 4AT1A 4UREA 4ZVNA 1VQ8B 3GG2A 1LLUA 4D4JA 5LFAA 4ZXPA 1GCOA 5BNWA 1KH1A 2BGWA 3KE9A 3VR6A 3RH0A 2DH6A 4XPIB 1ONBA 3C97A 3N2IA 4KKXB 1JWAB 3WXBA 4QG3A 4OH1A 3HI6A 3NYIA 4M0DA 1ECPA 4WLEA 2R48A 1E7WA 1MJFA 3DZCA 3IPAA 4J0FA 4TXJA 4TKMA 1JFTA 3X2SA 1V0EA 1L7DA 1RWNA 4QVJA 3H0CA 3N7UA 4UBNA 5LU8A 1MO5A 1W47A 2QYHA 3KSZO 3ZK7A 4YCJA 5LUAA 4IJMA 2OBYA 3IILA 1N9GA 2GDZA 3IT3A 1YLOA 2JN9A 3HDYA 4KQMA 4OTZA 1CRZA 3A6GA 4JXJA 4X6XA 5JUWA 4BFZA 1HX7A 2VYVD 1AIPA 4FN5A 2FE4A 2EZUA 2K5UA 2ZPUA 4QQRA 3S2EA 2ZRCA 5CFLA 4NV3A 4F38A 3KHKA 2ZBGA 1KC3A 2DFLA 3DR5A 1A9XA 2PH3A 4CR7A 1FUEA 5C31A 5M7EA 1I6KA 5C2JB 2NTYC 4MRVA 2ETVA 2QE7D 2NO0A 2FEKA 1VP9A 1RXYA 3L7MA 4P33A 2OCLA 4TV9F 1A9TA 4ZT7A 1N2JA 1ZUD1 1POXA 2ANCA 3S29A 2DFTA 3AETA 4Z7JA 3LI2A 3OFJA 1JEAA 1BDBA 2JAHA 1U7HA 2DKFA 2Q3BA 3HH8A 3OFND 4JEMA 1QNLA 5FA8A 2JCVA 5BXYA 2RG7A 2JBAB 2Q07A 2DX7A 2BEVB 2CCGA 4M9RA 1K6MA 2YY7A 1IATA 4DMCA 2AEFA 3KZNA 2UU9B 3WQHA 1LV7A 2D5CA 4XM0A 3QBDA 3UYKA 2CXSA 2HXSA 1II9A 3KELA 3PUIA 2GZRA 3JZAA 3DAOA 1WXWA 1QB7A 3VH2A 3K5PA 4IJUA 2QX8A 4NARA 3L7OA 3L1IA 3DVSX 5CVVA 3TLGA 4BGEA 3C0KA 2O54A 1LB1B 3HJUA 4R1LA 3X1YA 3A4NA 2F3SA 1GTVA 1O3YA 2O4CA 2XGJA 1V4NA 3D9QX 1NSFA 1Z7YA 5AVWA 4AP5A 3G89A 3RU9A 1OH8A 3AVXA 1EZ4A 3EFBA 4GDFA 4MPPA 4MYDA 3D2AA 3T7TA 3QXJA 1L8AA 3KBOA 4RL4A 1ZD9A 2A78A 2VSOA 3CF2A 2E1RA 1Q0HA 5AM0A 2VRNA 4RNDB 1K75A 4CHTA 1Y7IA 1AKVA 1NJ8A 4L72A 3U4AA 2C9DA 5DI9A 3QBEA 1Q0QA 2X1MA 3ETDA 1ML3A 4MR9A 1EI9A 5EPOA 2AOTA 1COWD 1X86B 1KDVA 3S27A 3SDZA 3SX0A 3WGZA 4OMFG 3RUEA 4QXQA 1E63A 2WWVD 3SJUA 4Q18A 1CUBA 1X2BA 2ADOA 4L0DA 4K9SA 4NSNA 4Y2PA 3VZSA 5T7BA 3B7WA 3QKRA 1NF3A 1PWZA 3H65A 4OREX 3ER9A 2AKEA 3D0KA 2AG6A 4QPZA 4BLTA 1EESA 3KQKA 1RNLA 3IUPA 3ZCXA 5JSZB 4IF4A 2QBYA 3FN4A 4ZZ0A 4EHHA 2GN9A 5CA0F 4LSWA 2PSJA 3THXB 1W36B 4DV6B 3DLTA 4DCTA 3OZUA 3W6UA 1H1TA 3GVHA 1PQPA 2FEPA 3A1UA 1UBLS 3NWJA 3VYRB 4JLJA 5DCLA 1PLJA 4D25A 3WKEA 1JSLA 1XKQA 2EBHX 2HHAA 3IEKA 4W1SA 1VFNA 5JFGA 1LSUA 4ALMA 1W0JA 2C78A 2GPYA 5TF4A 2GYUA 3OPVA 4BDTA 4WACA 1Z15A 2WFLB 4FFSA 4C4SA 4ESVA 1WZCA 2WOOA 2O8VA 3SQDA 1Z08A 2XQIA 3LXRA 1L7QA 4DJ5X 2IYPA 2ZIZA 1L4YA 3PR1A 5LKAA 5CEFA 3FVQA 3H99A 4HAXA 5B3KA 3L04A 1X92A 3D4PA 3KUCA 3RS7A 3FIJA 1GCUA 3DAPA 4HLUA 4C7MA 2OP1A 1R4MA 4LG1A 5K3CA 1TKBA 1GPH1 2Y77A 4BVAA 3NDRA 3QMPA 1N06A 2YYYA 5T8KA 3IALA 4KN9S 1NVMB 1V1JA 5TT1A 2F3UA 3DOEA 4UE2A 3CB4A 1GPWB 1GZSA 1V5EA 1WW8A 1C9DB 3GLIA 5ALTA 2V9ZA 1OX4A 4LC9A 4XRRA 1AHNA 1OLUA 1TQ4A 2C5LA 3HRHA 3SIWA 3UB4A 3H86A 1NJ5A 5H80A 3NDBB 3IPLA 1NYRA 1RI4A 1P72A 1VHJA 1F5SA 1L7MA 1RYFA 1YJ5A 1TZKA 5LLDA 3PX7A 2ACVA 3G68A 3JX9A 3OJ0A 4LRQA 5EP4A 4BMXA 1YQWA 1MENA 1NMZA 2EAUA 1T1EA 1V3QE 3B3FA 3EXHA 5BW4A 1Q7CA 2XKKA 2IUTA 1EMDA 4JJ4A 3RT7A 4RTNA 1H69A 1JPUA 2D7CA 1KO4A 3WFZA 1W6RA 5DSTA 3ZWBA 2YYZA 3DT6A 1GILA 4L8YA 1J0AA 1YB4A 4TTSA 4YRPA 1YRQA 3COJA 2UXBB 2NV6A 1KSJA 4HQOA 3U4CA 3TKYA 1SUDA 2E4YA 4YAIA 2WPDA 5C5CA 4PS1A 2RHJA 3KWLA 5AKKA 1N6IA 2AL7A 2I2XB 1ZH6A 2FPKA 1ONNA 3GJZA 1G8JA 1SVIA 1ZUNB 1UZNA 2H59A 2HBYA 1E2HA 5CXSA 4YAEA 3UWPA 2QSZA 8ADHA 3NVKI 1OOEA 3I9V1 3PQDA 2GMWA 5A0TA 1M1ZA 4NCBA 4Y1EA 1HZZC 1VXOA 3BF8A 1VG9B 4NBVA 3MCZA 4XD7A 1E1LA 1RM4A 2R7LA 2W6CX 3UJNA 4AKHA 4Q7EA 3MWDA 5KVSA 4B8ZA 1VCHA 3ZIAA 3FDIA 3EQ7A 3NYRA 4PZZA 2FTKE 3NKLA 3RRBA 1X7HA 4ZI7A 1TEZA 1G18A 4UFOA 3IR5A 4OBWA 1T9CA 1B74A 2FWPA 2PX3A 3D7RA 4UTNA 5HYVA 1GM5A 4PZ0A 4TM8A 1GUBA 1Z38A 221PA 4ML3A 5BO5A 3TW4A 4S04A 5DBFA 1SZJG 5IF9A 4YN3A 4DVGA 4TTTS 1XO1A 3UWOA 4Z4GA 2QV7A 3EGVA 1TO1E 2F1OA 1EM8B 5JZSA 3X0DA 1IEWA 4B2IA 4L57A 3UWDA 3Q7SA 1ZH2A 2XECA 5ARCA 1G2PA 4WCFB 4KQ1A 3IB3A 2F7SA 2VDQB 3EFEA 3KYDA 3ML1A 4YFYA 4K3VA 4WKOA 5WRFA 4EG6A 2Y71A 1UMCB 2RSLA 1B76A 3D6HA 3DZFA 1CDDA 1FRFS 2L0XA 3MZ0A 3QE4A 1DRUA 3COPA 5FLEX 3SF8B 1TPYA 1HF3A 4LYAA 1ZMBA 3SN6A 4DDVA 6REQA 4O4JF 5KNCD 3PUZA 5LZ5A 2P2ZA 3MCTA 3MGGA 4KIWA 4YP9A 3HXKA 2HJVA 1TLFA 1YXMA 2LD4A 2MYTA 2R4TA 4B6QA 5KZMB 1E9FA 1KE2A 4K9QA 1N77A 3U0BA 3A6JA 1YHQB 4G0NA 2PWPA 3OX4A 2R6R1 2PH5A 2WM8A 4GWLA 3FWYA 3UZUA 5J23A 1CQZA 4M1QA 2JBAA 1E2JA 2PKRA 2VBSA 5GMOA 2W8ZA 3F4BA 3OP1A 4G4GA 2OUKA 4WUTA 1P81A 1JHOA 1QO0D 4X1YB 3PCXA 4K6GA 3T7RA 4B46A 1PS0A 3N3AC 1JAIA 2I4OA 2QX4A 1XIVA 5KIAA 4Y1FA 3FH0A 4WVFA 5CCBA 3RT9A 4MI6A 1PK8A 2HPVA 4FFBA 3QUSA 1SQSA 5LIPA 1ZVKA 3D8RA 4IILA 4URUR 1G3RA 1V11A 3BGOS 2G63A 3MHPA 1LDYA 4XYGA 3OO0A 4PYMA 3E84A 3RYCB 5KCZA 5FHRA 2VSYA 5CT5A 2CXXA 3DS8A 1OB5A 2XQKA 2JCBA 4JX8A 4L78A 4Q39A 4F3KA 1EJBA 1J20A 1U8TA 1SHJA 4ILKA 3FJ1A 5JS7A 2A7XA 1IUOA 1JEOA 1BX0A 1WKCA 3AUTA 4MXDA 1ADFA 1XVUA 2GKSA 3CLHA 1J2JA 4IDGA 4D9IA 1S2IA 3QMMA 4WJKB 3K7EA 3CQ9A 3H1EA 1GGHA 1IG3A 3GJSA 1O9BA 2CJWA 1RXVA 4QU8A 1TK2A 1PVVA 3MWFA 3O7MA 5CVJA 2J33A 3QFHA 4PYNA 2GHIA 4EI2A 1QMGA 2FJUA 3CX3A 5AKZA 4K40A 4M6WB 1J5EB 5IJZA 2VP6A 3EXFB 5THKA 4YJHB 4PXAA 2ZI4A 4DW8A 1FJ2A 4XX1A 3T3MB 2OG1A 2BUCA 2VDJA 3DLHA 3S5UA 1YGPA 3KLMX 1SCJA 4EBFA 4PYOA 3OE1A 4TXLA 1Z45A 3KSUA 3PC7A 1SU7A 4KBGA 4N7JA 4LK3A 1CY6A 2HJRA 3FMPB 2WWIA 3JATA 1Z8FA 3HB4X 2H2FA 4W8GA 4DMUB 1NB0A 1EA7A 1QE5A 1A7AA 3C41J 1RXIA 4X1OA 3PI6A 1O57A 3ED1A 4BX0A 1C0PA 2HKIA 3EWIA 3PDWA 3TGWA 1LFDB 3ONDA 4J0EA 1KJJA 2WFZA 3RSGA 1I7LA 2JLQA 4CGZA 3FSJX 3NEYA 2BAGA 2VNSA 3N5CA 3PKJA 4L85A 4ROSA 3OZAA 4W8OA 2HHHB 1I2MA 3EHDA 4HQRA 3RUIA 1CYEA 1AKWA 1K66A 2V58A 3INRA 2P2LA 3KEOA 4XORA 2BGKA 2BGNA 1Y9ZA 3NBAA 4RGBA 4KO2S 3WMGA 1CT9A 1ZM4A 4H9GA 3GVLA 3HVUA 1KK2A 1EVEA 4F06A 2PZBA 1J2YA 3FR8A 5GJBA 2G40A 3DE0X 3VMFA 4D02A 2RIRA 1M2VA 1UOOA 1Z5VA 4EKEA 1AVTA 1MB2A 2LIPA 3UENA 2WHEA 3WTCA 3CO5A 3D4BA 3WB0A 5B6JA 1U7UA 2LW7A 3A0UA 3BWYA 3KDSE 1P44A 1PJ3A 4F4JA 2DJ5A 2OBBA 1K6IA 1TC2A 3BEOA 3MJRA 3WGNA 4HUTA 3A6FA 3LWNA 4DCNA 2PCJA 7GPBA 3H7IA 4JC5A 1Z06A 4N0PA 1Z63A 2WMOB 1VE3A 1Y5IA 1UBHS 2Z8YA 3R6TA 4ZEXA 3PXGA 1YR2A 3W8RA 2LR0A 1X7YA 5IBCA 3MGAA 1OZHA 5SZIA 2ZRQA 1VJ0A 4B83A 1QYXA 4ER5A 2FZGA 5AKLA 3M5WA 4HZUB 4JA0A 2Q8NA 4JS0A 4RDIA 3ENNA 5FBHA 4NXMB 4MRMB 2C7BA 4R0VA 3U6BA 5LZ8A 4MGEA 5TGDA 3WWPA 2JF0A 1O6FA 1CY7A 2XLCA 3AI7A 2HDOA 2WWRA 4GOJA 4ER7A 1L4HA 3QVUA 4PVDA 3IRVA 3N5KA 4O59O 3DD5A 3JD1A 5KTPA 4GZLA 1VSTA 4WLOA 2XVZA 1OZAA 5ITVA 3FOZA 4RNCA 4AS1A 1S3GA 4KN6A 4DLTA 1FNBA 1R9JA 5JJBA 4DCPA 1AY0A 2EEPA 1UMBA 3D81A 3JWPA 4H3HB 4C5BA 4QD3A 1G59A 3PDIA 3ZJVA 1ULSA 1RWXA 1LVGA 1ODTC 1JAHA 2A5LA 1G4HA 2AK3A 2YC4C 3VO1A 3HBMA 1WSDA 4AG3A 4DCJA 3V8MA 4XLEA 2VSFA 3AM3A 2NT3A 1NXPA 2OAP1 4QUBA 4RVGA 3ZZMA 3EZ9A 4E1AA 5FDFA 3TX6A 1T1IA 1RWVA 3PQ3A 4CF5A 1YDHA 4QOIA 1EYZA 3KLBA 3LZCA 5CHEA 1BQ4A 1DC8A 5JS8A 2B7LA 3IAUA 4RJJA 4EABA 3O4IA 1G1MA 4QQKA 2ZR8A 1KEZA 4OSOA 2P6RA 2X58A 4MVXA 2B20A 1CEEA 4F6RB 2ZUVA 2XDYA 1E3SA 1WP4A 1R3DA 2BR3A 4XNFA 2XKBA 4H15A 4IKEA 4MEBA 5GZ6A 3RB8A 4C2TA 2ZDQA 4C6RA 2HTFA 1QCZA 5DHAA 4C0LA 4P54A 2QR5A 3NTQA 2P1RA 2J3LA 2P4UA 2WD8A 1F4VA 1Z4OA 1Q9SA 2FDRA 1N1GA 3OZXA 3WA6A 1V5IA 3KX2A 2XUKA 1YVUA 3K09C 3QE2A 2WA1A 3BIXA 3SZUA 3UEOA 3WMRA 5AP9A 2LCQA 1X7XB 2NV2B 2UZIR 3AR8A 1HT0A 1OBVA 3GMDA 4NYIQ 3WADA 4RD2A 1U6IA 2E2WA 2NPOA 3G0OA 1FS4A 1JVSA 2F8MA 4M7RA 4B3GA 3S7ZA 3KBBA 1W96A 3H2YA 1HEYA 3SQOA 3L8ZA 4GI1A 4PAMA 4FBMA 1NJFA 3Q72A 1ZNZA 4RZXA 1A8HA 1EK5A 3CH4B 4NKRA 3ILXA 4PPYA 2F1MA 3K72B 2WLSA 1E5LA 2FEWB 1MZVA 4RF2A 1HE1C 3DLCA 3MM4A 4L02A 2BCJQ 4RZ3A 5F64A 1QQBA 4ZDKA 4NF2A 3WLMA 3HCCA 3I8OA 3NTOA 5G0TA 5GZ3A 2QUJA 1M6NA 2I54A 2PS1A 3I9NA 3O5AA 2XITA 3VR5D 3QLVC 3PDUA 2MSEB 2IOFK 2VJMB 3CZ5A 5IC5A 1PYOA 4G07A 1W9MA 2OQIA 5HBRA 5AJXA 4CF6A 4DA7A 4BBJA 2QNIA 1M34E 3F1KA 2IPNA 3GDOA 3PZBA 5KNCH 3WBJA 1GAXA 2BM8A 3EDYA 3F6SA 2XCTB 3VSBA 5BVGA 1IQUA 1NW3A 1SPBS 1UXIA 5J5VA 3UGQA 5M34A 1T6ZA 3OF5A 2GBFA 3G5MA 4FWTA 4DLRA 1TVCA 1GZ5A 4Y2GA 1Q3TA 4X7FA 1S8FA 2VLBA 2GARA 2CMDA 2CNOA 1R6VA 1TK9A 2P30A 2AJCA 1KH2A 4HB3A 5B3AA 3TSWA 4AL4A 4FJ0A 3UJPA 3I6BA 3L0PA 4MWEA 2I6GA 1U99A 1UM8A 1JPNA 2OSVA 1MC5A 2VWQA 1JILA 1KP9A 4DV5B 1JLLA 1P33A 1IBSA 1ZZGA 1JJBA 1M34B 2SECE 3DE7X 3NX4A 2AW3A 4HO1X 1U1CA 1QOQB 1QUFA 2GPAA 4LYEA 4O4JB 4PY2A 2PSHA 3SK0A 4RJ2A 2GXAA 2HADA 3VNSA 2JD2A 1PJZA 4FE7A 1IHPA 1YQTA 5JU6A 4KG7A 3LG2A 4OI1A 3WIOA 4LE0A 2Q6LA 2P3SA 5CRIA 1U6KA 5BR4A 3TLMA 4KQXA 3H11B 2BN4A 1OD6A 1KQGA 2OWEA 1BWQA 2WDZA 2VP5A 3OAAD 5DKFA 4EIWA 3C6BA 1TIKA 4XLHA 4ZOBA 1H1LA 4YACA 1QQ6A 1TVMA 3EGEA 4TXMA 4E51A 1TYDE 1GTL1 4O2LA 4D0GA 1YQQA 3KTFA 4KDCA 1YI2B 4AB1A 4G0VA 2DXIA 1KAGA 3AR5A 3ZE1B 5DNCA 4JFRA 3O8QA 5SZHB 2R8OA 2DKNA 3HCAA 4XSHA 2VF7A 5G3YA 3CC7B 3D7SA 3RVDA 3QPVA 4W63A 5H9VA 3OPNA 1U4NA 5ECDA 3B3JA 1W4ZA 2QNBA 3CPSA 4YAGA 1E5QA 4S24A 1PK9A 3RK4A 2VJPA 4B45A 5E6TA 1PW7A 2ZQ5A 3K2IA 4U5QA 3TZ6A 1M2NA 1L5SA 1AS2A 1JFFA 4F9FA 4JB2A 5KYYA 3LC2O 4PC2A 4GSKA 4C0HA 4EY8A 2ZK7A 5BN3A 1T5TA 3JVVA 1CJSA 1T8SA 2B6HA 4UEKA 4OBBA 4P34A 5LXTF 3EUFA 4ENTA 4INPA 2NWQA 4HD8A 2Z3ZA