3CRZA

Ferredoxin-nadp reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
257
structure length
257
Chain Sequence
SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP+ reductase
publication title X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 79
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3crzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3crzA02
1GR1A 3OZWA 1OB5A 4M1KA 2QEXB 4PC3A 1DG1G 4RD0A 4PC6A 3W2FA 1D2EA 3VNUA 1R5BA 1TTTA 1F20A 2EIXA 2OK7A 3WNCA 1VQ7B 1IB0A 4LBWA 5KSWB 4DQKA 1VQPB 1QFYA 1VQOB 1KK0A 2QTLA 3B8HA 3QFRA 3QSYA 3CCLB 1OGJA 1K8AD 4TN1A 4G1BA 4N3NA 1D8TA 2BPOA 1YJNB 1GVHA 1EP2B 4LBVA 1CNEA 1Q7YD 5GV8A 5FA6A 2X3UA 2QTZA 4U9UA 1QVFB 3CCMB 2XNCA 4AC9A 1M1KD 3OJWA 4YAOA 1XB2A 3WXMA 3B82A 2QMUA 4Y7CA 1OB2A 3VO2A 5EMNA 1GO2A 4TMXA 3AVWA 1EXMA 3U6BA 3FJOA 4C43A 1NDHA 3CW2A 3LVBA 1W87A 2R6HA 1KQSB 2DY1A 4Y9UA 1W2BB 1VQ5B 1VQKB 1CQXA 3W2IA 1GAQA 3AVTA 3CB4A 4RD6A 4B43A 1BJKA 3W5UA 2VNKA 4RCZA 1QVGB 1Q82D 3AGQA 2BN4A 1XE1A 1CNFA 4HE6A 1FDRA 4H9GA 3G6EB 1IJEA 3VNVA 3W2HA 2OTJB 2ZITA 3ES9A 3LO8A 2YWGA 2DEUA 1N0VC 1FNCA 1U2RA 3W5HA 3W5VA 1VQLB 1F60A 4LBYA 3ZBTA 2BGIA 3I56B 4FWTA 1EFUA 2YWFA 3QFCA 1JB9A 4IW3B 3OZVA 3I55B 1JA1A 3CCRB 1EWYA 5H59A 4ZCLA 4QHYA 3CCEB 2YWHA 4J0QA 1G7SA 1KRHA 1E64A 3G71B 3WNDA 4BPRA 1N0UA 1KC8D 3SJZA 4ACAA 1W34A 5H5JA 1S0UA 4TMZA 1QFZA 2CNDA 4TMVA 1ZM3A 3ZZUA 5TR9A 1KTVA 3U2QA 2VZLA 3CC4B 1Q86D 1YI2B 1OGIA 4MYUA 4B44A 1BQEA 1SM4A 3OJXA 1QGZA 1ZM9A 4ZCMA 1QUFA 2RC6A 1QG0A 2QA4B 4G5GA 2BMWA 3I1FA 2PMDA 1G7RA 4HE5A 5JBQA 3G4SB 1YIJB 4B48A 1QX4A 4YAWA 1BX0A 4TMTA 3QFTA 1R5NA 4M4SA 1R5OA 4WQMA 5DSZA 1QFJA 1NJID 4P6VF 1VQ4B 1UMKA 3E20A 5AN9A 2B7BA 4RD2A 1G7CA 4QFMA 1GJRA 4MYTA 4P3YA 2AHOA 3LRXA 4EH1A 2VNJA 3CC7B 3CC2B 4DQLA 3WNBA 1YHQB 1M90D 5THXA 1FRNA 2J7KA 1H85A 2BGJA 3CCJB 2DERA 4RCYA 1K9MD 3WY9A 1I7PA 1DDIA 1YITB 1AIPA 1WDTA 4RD4A 1N8RD 4RD1A 3AVXA 2VNHA 4YHBA 3B78A 2D74A 1AMOA 2YWEA 1QGYA 1ZM4A 3CXCB 4ZCIA 1KJZA 3CD6B 4ZGQB 1EP1B 2XEXA 3LYUA 2C77A 3V76A 4RD3A 4FK8A 2DETA 4AF7A 3VMFA 3P27A 1YJ9B 4UAJA 1JJ2B 2EFGA 2BVNA 3OZUA 5TV2A 5HXBA 4PGOA 1G7TA 3WBJA 1E63A 3CCVB 1VQ8B 1S72B 3WYAA 1DARA 2VNIA 3MHPA 1Q81D 4PC1A 1VQ6B 4R71A 2BV3A 2GQFA 3PENA 3AVVA 5GV7A 1ZUNB 1BX1A 3ZC3A 1FNMA 2CRVA 1HA3A 1QH0A 4B3XA 1KD1D 4PC7A 4NCNA 2QDXA 2QN6A 3OW2B 1JNYA 3JQQA 4PC2A 3CCSB 1H42A 3CPWB 3J81k 1VQNB 3MMPA 1IJFA 2C78A 3E1YE 2HCJB 4ZGNB 4LBZA 2NPFA 1TVCA 2E1RA 3CMEB 2OK8A 1EFTA 1B2RA 4NBSA 4Y9RA 3CRZA 3AVYA 1E62A 4LC0A 1J9ZA 1DDGA 3VO1A 3CMAB 2DCUA 4N3GA 4ACBA 5TY0A 4RJLA 4G1VA 3WBKA 4K1XA 3JQPA 4TMWA 1D1NA 2XNJA 2HMAA 4AF6A 1KK1A 3AVUA 2BF4A 4F7DA 3ZBUA 1QUEA 2HDNB 1TLLA 3QE2A 3W2GA 4M53A 1KK2A 1B23P 3FPKA 4ZV4A 2OTLB 2PIAA 1FNBA 2BSAA 3MCAA 3AGPA 3CCQB 2FX3A 4B4DA 4Q7JB 4YALA 1VQMB 1W35A 2B7CA 1GAWA 2VYQA 3ZZ0A 2BM0A 1EP3B 3CCUB 2RC5A 3P26A 3W2EA 1FNDA 1KK3A 2GPJA 1ZM2A 3QFSA 4M2LA 1YJWB 1K73D 1ELOA 1SKQA 4YAFA 1VQ9B 1JA0A 4M0LA 1EFCA 1QGAA 1TUIA 4FN5A 2PLFA 3A1FA 3JQRA 4YAUA 4B47A 3ZZTA 1A8PA 4C0SA 2BM1A 1FRQA 3U6KA 2B5OA
chains in the Genus database with same CATH superfamily
3P4YA 2PGDA 2Q50A 2RGBA 4YJ3F 4MQFB 4YRQA 2H9AA 3FOFC 2QEXB 2ECKA 4P4GA 5AVRA 1KH2A 4IXMA 3L9WA 5FPHA 4D9HA 5TGTA 5ALFA 1DG1G 1V5FA 1CUWA 2H31A 3EA0A 3NAQA 4RW0A 3URKA 1ZRMA 2H1WA 4JCOA 2GZ2A 1T0JB 1XLUA 5JD3A 1QKJA 3IFSA 4OX9B 3RO7A 1QQTA 2AKAB 2MMCA 1FBTA 2G6BA 4G0XA 1FMCA 1LBTA 1E9EA 2CMDA 1S7GA 2ENWA 3BWDD 4P81A 2WTUA 4P26A 2ZR9A 2UDPA 3V7NA 3O8DA 3HP1A 4FX5A 4ROXA 4MVJH 1K6IA 4ICIA 1GV0A 3LFUA 2LKDA 2GEUA 2QU7A 2YRXA 3H5OA 2K2WA 4GC9A 5JSYA 4EFLA 1HNXB 2PFGA 5K4GA 3TDKA 4C5BA 2M6LA 3NEJA 1BWQA 2RB4A 1UJ6A 4H4DA 3F0TA 1GNLA 2KMLA 3UM9A 2B78A 3UYLA 2HWXA 2YFQA 1MB9A 4OBBA 4N5MA 1ZH6A 3LHDA 2RCYA 3CHYA 4KZPA 4X05A 4MJLA 4WUVA 4PGFA 4TYPA 5BSYA 5JXHA 2QL9A 4G4JA 3OQIA 1JBKA 1JR3D 2QW1A 3GJZA 5AUPB 3S8EA 2CYBA 2ZWIA 3OQVA 4HUQB 3OHMA 4XDZA 1Z8FA 4IIBA 4TTAA 1EESA 2FEXA 3BY2A 5FWXA 4MDEA 2RGUA 1DHTA 5JYBA 4MS1B 3LPNA 1H3EA 2Y2UA 3BMOB 2P4QA 2Q7XA 2ODBA 3VH1A 3TFOA 4X64B 1PJ6A 2C7QA 2B8EA 5KYYA 2FW6A 2ZU6A 4I50B 3MTEA 5G1OA 1NVDA 3QG5A 3ESBA 2VHJA 4LV8B 1DO8A 3NRBA 2CFIA 5KYWB 4Q1EA 3OF3A 4YI3A 3WLNA 3R20A 3S4YA 1SXJB 2VDWA 1G63A 4J16C 2H2DA 3TR0A 1SHLA 2ZRCA 1ABEA 2OXFA 1F38A 1YK1A 2Q4RA 3HWRA 3UH1A 3BHJA 1O97C 3JZMA 2WAOA 1GRCA 5IVKA 1IZ9A 2QQ5A 1KHHA 3IBTA 3KAPA 3OESA 2ARKA 2QVBA 5K3SA 3DBHA 1KE2A 3Q9UA 2VT7A 3QI2A 4RXTA 1N9GA 4Y7CA 4B75A 1K0FA 2ON6A 1BRMA 1CY1A 2GO1A 3DFMA 3JRXA 5EMMA 3SLDA 3IRVA 3KSMA 3L6EA 4JLOA 4M8IA 3T99A 3EPKA 3EB9A 4YJDA 3AY7A 2JFHA 3NHFA 4H16A 2RE8A 1GZ5A 1WKCA 1SBZA 2FWIA 3O7WA 3GZNA 4FW8A 4I8XA 2IYNA 4JJGA 1J7JA 4S0XA 4DADA 2AOUB 4OH1A 2FHSA 1RHRA 1CQIB 2V1XA 3EXEB 4WLFA 3IMEA 2VNSA 3LVBA 1TI7A 4F5WA 3REQA 1GGFA 4YUVA 3UAWA 3R6GA 4EL0A 3R6WA 1RE0A 2IS6A 2EJTA 4MGEA 1RD4A 2XYQA 2H54A 2OFOA 1MCZA 4FBLA 1GQ2A 5BV0A 2HO4A 3WSWA 4GKJB 1XOIA 4AKIA 1NUTA 4LHEA 3AEQB 2OBXA 2NV4A 5EIHA 2FSSA 2WOOA 3I58A 3H2YA 3PC3A 4IEEA 1J5EB 1A1VA 4HZUB 4MQFA 4J2TA 5U4QA 2Y4OA 1JB1A 1ZIOA 3KALA 1DBWA 1VQKB 1L1FA 4AAYA 1L4UA 4XIJA 4PO8A 4QXOA 2P62A 1PEYA 3AU9A 1TRKA 3F78A 4OQLA 1ODJA 2PT6A 4X91A 4JUFA 4E2ZA 4NSNA 2CEKA 1P74A 3AETA 1U9IA 4HMQA 1QRDA 4BLTA 2WQZA 3H18A 2AT1A 3ME5A 4ZVKA 3WDMA 5B1YA 3WFZA 2V65A 3M5PA 1XXLA 4K9KA 3U7HB 2WSIA 2YJ6A 3AILA 2J3DA 3B3JA 4N7RA 3RSSA 2B94A 2ZZKA 1Y5RA 5JS2A 4N7MA 2WSYB 1U8FO 4X6UA 5JAPA 4HVLA 1VYUA 2WZPP 2QN7A 1Y3DE 3CUKA 4FYJA 1NQTA 2AYXA 2P2GA 4Z4VA 1M1YE 3JQ8B 1IUNA 3QEBZ 5I6DA 1PQUA 4MTCA 3OSUA 3D64A 4RKQA 5B3KA 1EXNA 1WRBA 2PRYA 4YCDA 3EGVA 3M9LA 4KQKA 1N2CB 1F4VA 1RDFA 3IUNA 2GEVA 4DLPA 3UMVA 4YI5A 3EUAA 3U56A 1P7YA 1TYEB 3GRAA 3IX7A 3WLRA 4DIMA 3OURA 1C9DB 1XZEA 2BGIA 2A3RA 2A5JA 4GS5A 3VDQA 4D6PA 3D3KA 3ZW7A 2P2ZA 3DAPA 3HXMA 1HY3A 3AY3A 4DV0B 2YWFA 2AUNA 2PAFA 4X6LA 4CKWB 4US2R 3I5XA 1P6QA 2R1ZA 3CNHA 1CUSA 4IDOA 4QDXA 2QE7D 4QL3A 4NFLA 2X0JA 3CCRB 4OMUA 3ESZA 1K6JA 2EZTA 2NQ8A 4BS9A 3IC5A 2H0RA 1Z8NA 1XTZA 3DL0A 4PPGA 3ZXSA 4D3ZA 3K96A 2YWHA 1YNSA 1E3IA 5L51A 3IIJA 2EVWX 3BMOA 5A7GA 1GPUA 5A7FA 4NJEB 1WV1A 3WMEA 4DK0A 4I50A 2V96A 4AICA 3E8XA 4LVUA 1VKZA 4P80A 1UODA 4R0VA 4A15A 3RS3A 1M2FA 1JVSA 5DBGA 2GM5A 2OCBA 4OHUA 3J7AC 3NTUA 3WMXA 5FFMA 4CM8A 1LB1B 3M0EA 1SXJA 1E9CA 2GLUA 3TTWA 4Q3CA 3OZCA 1JTEA 1YBHA 1SVWA 5K0LA 3RHFA 5DTJA 3TGPA 4ZJPA 2HLPA 4I9HA 3EF1A 2JIBA 1WUYA 2WICA 4QDUA 2GILA 3C3WA 3U3DA 1HLPA 4HEJA 3A1EA 1NXVA 3ZWDA 4ETMA 5BRJA 5LNK1 5IXJA 2ZRJA 4FGLA 4KFSA 3D7RA 3G2MA 1ULSA 3KPWA 4D56A 1OIWA 2Q5CA 2X42A 1NB0A 1B8OA 1EFLA 3K0FB 3DMGA 4P7FA 1L8AA 4LUCA 1R1DA 1W29A 2D0IA 3AY6A 4R2LA 4YA6A 1WCV1 2GSDA 2PEYA 2FUCA 3EAQA 4KNVA 2EF0A 4QNMA 1WMFA 3PUWA 4NFYA 4URWR 4BZWA 2AA3A 3M6VA 3KQQA 4N0EA 1CQIA 3A28A 4LYFA 2HC9A 4MI3A 4V3CA 1CRZA 1LDNA 4D43A 1JLKA 3PFFA 2XCIA 2B3DA 4DCGA 4EYGA 3HY4A 1YJ5A 1UJ4A 2VK8A 4AWBA 3I2JA 4Z1MD 1PGOA 4K3VA 5DM4A 4HEA1 3CTAA 4RF2A 2NLOA 3NKLA 1N36B 1R5NA 1I2CA 2JJ2D 3QZUA 1JN0A 2Q3EA 1L7RA 3D6TB 4IKEA 4WZAE 1ACJA 4RX1A 3KTAB 1FLNA 1C81A 1PBTA 2HLNA 1J9GA 1B8PA 4ID3A 1D7OA 4HZUA 3EWSA 3MQFA 3LV8A 1DC3A 1QG2A 4AYTA 1U8ZA 4IH4A 2B7BA 2JHGA 1GP2A 1VRCA 4D9EA 3B9RA 2A0XA 2JFYA 2WJAA 4LOKA 3AHJA 1WTCA 1VGRA 1VLOA 3BUSA 2C3PA 4HXGA 1NXSA 2VFAA 3WGYA 2Z1DA 4CGZA 2Q9BA 4TSKA 4C4TA 2ZKIA 3WFJA 1XQVA 2YV3A 4RENA 3RIMA 5JAUA 4W5NA 4QICA 2OAEA 2Q8PA 4LY3A 5T57A 2BF7A 4A8JC 3K1JA 3LRXA 3ZBQA 1EQ2A 4FEGA 3JYLA 1SOAA 3LUDA 5LQKA 1JUDA 1YDGA 6Q21A 4RPGA 2ONJA 2M6SA 4HR7A 2OPBA 3M7IA 3JQ8A 5JMPA 4YAKA 5KTRA 4RVGA 1O57A 4XOUA 3U7FB 5LLSA 3LQKA 4Y6QA 4NRDA 3QWAA 1KVSA 1DKMA 2A4MA 1N2CA 4PWZA 2HR1A 2XY4A 4DA8A 3HLYA 2HX1A 3MWFA 1IZ7A 1ISIA 1JW9B 1MOSA 1NMEA 3ESDA 5CDUA 1DDIA 3QTTA 5LOVB 1U2PA 3BMXA 3DEHA 1WE2A 5KTNA 1C30B 1Z6GA 1EUZA 2AZ4A 2Q3BA 1PG0A 3ZXIA 1CUDA 1D0IA 1VLHA 3DE2X 2OD9A 3ZWPA 4RD1A 2AJDA 2Q6OA 2QN8A 3JYOA 4OQEA 4RJJA 1OSNA 1NRWA 3HA7A 4ZODA 3K53A 3MTAA 1D2HA 4MQ4A 4LFBB 1HX7A 3X0DA 2UUBB 3PD0A 4JROA 5KC9A 4XH9B 1L4EA 2B8JA 1QF6A 4NJEA 2PMWB 1DIHA 3LYUA 2ZXHA 3RQSA 1UP7A 1G60A 4B2PA 1E6WA 2D4HA 5F76A 1G2OA 1Z13A 2VC2B 4MUHA 4AO7A 4EHKA 1R0YA 1RM4A 5T4FA 4G7WA 2P68A 5KEIA 4DNFA 1YKSA 1T0IA 1H23A 2JD1A 4ZOLB 4XN0A 5FO0A 1N5IA 3DEYX 3FOCA 1XZPA 3TD2A 2NXNA 3B1KA 1V8FA 1LQUA 1Y5MA 3DWGA 4XGRA 3IBYA 4FFOA 3VFDA 2IH2A 3EZNA 2ZS8A 2PT7A 2L17A 4KUGA 2WVGA 4WZAB 5E7JA 4GC5A 5CM9C 5D6OA 1NU8A 2IXAA 1ISSA 2BL4A 2IPNA 2OR3A 4Q1CA 4CTMA 3DMTC 2NO5A 2QJOA 3C4VA 1IK4A 3N39C 3H2KA 4I4LA 2L0XA 2WFMA 4BUZA 1CZOA 2HMUA 2CDBA 1YDHA 1F5NA 1XR3A 2G1KA 1Y8RA 3E7FA 5INTA 1ECLA 1I4LD 2R86A 1QBKC 3D0KA 5LMZA 2D00A 2H11A 3UATA 2CV1A 2GPNA 5CJ2A 1PL8A 1WXFA 1FFDA 3LOPA 4HFRA 1ZH4A 4LEIA 4XCQA 4JLKA 1E77A 1PVVA 1W75A 2IXDA 3H11B 3HCPA 1N8SA 4L9WA 3ZU5A 4IL5A 3ZWXA 1Q9SA 1XGKA 1XP5A 2ZJ0A 4K6HA 4TL7A 5TVGA 5BN1A 5KNBD 4PC1A 1VQ6B 3OD1A 2VK4A 4IIJF 2BFNA 3L79A 1RLUA 4N7JA 1EFHA 2PZ8A 5DK4A 1F17A 4Z2YA 2WHXA 1MH1A 1UPAA 1UZLA 3PJFA 3QBDA 4FFBB 5DMHA 4K9RA 5TGZA 1VJSA 3X2FA 1M1YA 3PFCA 2I34A 3V8RA 1AQ6A 2NPIA 3EWIA 1CHDA 1ZIDA 5U9CA 2ZBDA 4LGVA 1QB7A 1E9FA 3B9QA 1HLDA 3UAVA 4B17A 4HGRA 4Q00A 3IDSA 4RY2A 1J42A 3UK7A 3S1SA 1GYRA 3CCSB 2CL6X 2P3SA 4XDGA 5JI2E 2GAJA 5JJKA 4V0KA 2JJ1D 3RC9A 1XD2B 4Q3BA 4BV3A 1JFFA 3CU5A 1NUAA 5J4VA 3PDIB 3V55A 3RR2A 3QX8A 4O25A 4NBLA 4Y2HA 1FS5A 3OZIA 3MIIA 5ERGB 3ZKWB 2Y9PB 1KDPA 3INGA 3L01A 4F4IA 4MR9A 1BMFA 1V3VA 3N5CA 2P6NA 4K0RA 4KN9S 5B7PA 1T29A 3ZWVA 3H8VA 1RYFA 3GAAA 4N1AA 3KFVA 3U1VA 4MQLA 3EC1A 5GZ3A 5HM8A 1U9CA 2IZ0A 4BNZA 4HKTA 5NULA 3SS7X 1JPNA 2PVSA 3HC7A 3VYWA 4W1QA 4DJEC 5M04A 1MW9X 4A0SA 3U26A 1YCDA 2FGJA 1NC1A 4IGEA 2G5CA 3VO1A 1BKSB 3CTPA 3TFWA 3GVKA 3PHBE 1ILWA 4ZYVA 4MKZA 3LY9A 5LOVA 1PWXA 2FVXA 1C30A 2WZBA 3A6EA 4M0EA 5ECGC 3Q5GA 1M74A 5BN4B 4CPDA 1AUQA 3IJPA 5ER9A 5FKJA 1ZJJA 1XX6A 4FFVA 1XCJA 2IP4A 2OHVA 3NU1A 1Z47A 1RWBA 1P5JA 2COUA 3ABZA 3K8YA 1H1DA 4JKOA 4K2AA 4XB1A 4DA7A 5DIZA 3WL6A 4R2HA 3BTOA 2BMFA 1FRZA 3HR7A 4QQKA 3E5HA 2W5UA 4HGQA 3ZJYA 4G0ZA 4N0PA 3D1VA 5DN9A 1KK1A 1K7FB 3HK2A 3TBKA 1YIOA 4FB4A 4N3BA 1IXRC 3HBNA 2W6NA 4MW1A 4MCHA 1KOGA 2BZGA 2QT1A 4DM4A 2HT6A 1U4NA 4DK1A 3EIWA 4LJ5A 2NUBA 2ECFA 2A14A 2FPIB 2O7VA 4H7FA 4L2IA 4GXNA 1EHYA 2A1TR 1S8FA 5G0SA 1CDDA 3MCUA 2JLZA 4PN3A 4MVJP 3ICEA 2MSEB 1HDEA 4X90A 1NF2A 3AUUA 1L9XA 1GCIA 3OT1B 4L0MA 4WZAA 5T6BA 5ICCA 4GZLA 2IGBA 1UMBB 3TWOA 2XIQA 4YYEA 3SQLA 3MJTA 1PFYA 4Y9DA 5IVHA 3G85A 3CR8A 3ASYA 3A0RB 2JGJA 3W3AA 4MS3B 1WY5A 3I76A 3WYFA 3EN0A 1YB4A 5CA1F 5DZSA 4BRSA 4JKIA 1VIDA 3MRSA 4OHWA 4W63A 1MB4A 3QVUA 4M76B 1A9QA 1DFGA 5DT9A 3NM4A 1F6WA 2W2LD 5C3MA 4TLEA 4LNHA 3LQ2A 3CN9A 3VM6A 4HH0A 4JAVC 3O90A 4KSYA 4RWZA 4EJSC 1ELOA 1L5QA 3H11A 3O9VA 3SQOA 5AVYA 4NE9A 2C8LA 5JNTA 1T9CA 3DAOA 3PFBA 3WB9A 3IVAA 4W9NA 4R41A 1W9MA 1CULC 1NVVQ 1UJBA 1ISPA 1W9HA 1ZN8A 2V98A 2H7XA 3RYTC 1RHQA 3CNLA 3PITA 4DLLA 4FFBA 1IAQA 1N0WA 2AXEA 2UUOA 4MVYA 3T3EA 4RBNA 3T7JA 3F4LA 3QPBA 4EY7A 3OKCA 4OGFA 2JATA 1TT5B 3AU8A 4FDLA 4QDJA 4HNVA 4MIYA 3CP8A 2HB6A 2R3SA 4XYGA 3FTQA 2C0QA 3HXKA 1IPHA 1G6Q1 1HSOA 1Z7EA 1XZHA 2GREA 4PFJA 3CSUA 3EMVA 1YUMA 1AV7A 2W6IA 4W6ZA 4EYQA 1N4AA 3MTBA 1XD2A 1YZVA 2XQIA 3H9GA 3U1TA 2WZQA 4ZO6A 1D3AA 3M82A 3O83A 2VSQA 1PUXA 4YQEA 4CTKA 4BOYA 4IFBA 3SGLA 5CTJA 3U3RA 2P3LA 1IY9A 1PDWA 4FUQA 3I0NA 2EATA 2KWIA 3D5EA 1M54A 1DT5A 1BJTA 3QKUA 3V8VA 5IT5A 5F4JA 4D25A 2RK4A 2XMPA 2OHIA 3NDPA 5IDXA 1SG0A 5BT9A 1P1KA 4HI0E 2CFTA 2I87A 4AG3A 5AIAA 3V3TA 4YRAA 1D2EA 1KRXA 2R5WA 1ZBQA 3BE5A 1SZPA 3AIOA 1Z2AA 4EENA 2VS1A 1TEXA 3C5HA 1IB0A 4QBFA 4PSAA 1ZEJA 4G65A 4P7JA 4QGAA 3V1KA 4WLOA 5BN4A 1GRRA 4DMHA 5KDLA 1IN7A 2VQDA 1Z12A 5ALIA 1ZXLA 5EMJA 4LK2A 1VSBA 1XRJA 5EIXA 1QFYA 1J1IA 3NJRA 1QG6A 1U6KA 3ZDXB 1WD5A 1VJCA 5IWCA 1QYIA 4MLPA 1RKVA 1DB3A 2QPLA 3L3BA 4BNGA 2ID9A 1ZGHA 4FKMA 4JT8A 2LWIA 5AOVA 1JQBA 5KAMA 2H1OA 3ZDCA 3RREA 2RFLA 4I46A 2VJNA 2GEDA 4LNAA 2C3OA 3GHHA 4C14A 2R4UA 1AQJA 3M6UA 3CGGA 1NONA 3BAZA 1X1BA 5I7AA 2CZCA 2Y6UA 4P8RA 1IY0A 2X8WA 3LMKA 3D0QA 4Y1RB 4HAIA 1CV2A 1KYWA 4ZVSA 2GEJA 1G291 2OP0A 3GCXA 4LY6A 3OT1A 3HA2A 4KX5A 4C7VA 3RJZA 1N0IA 4P22A 2QRKA 2GHQA 1M67A 2YYYA 3GNTA 4WLEA 1YZQA 3X2EA 4D80A 2ZM5A 2GM4A 4P0TA 3GRYA 4HMOA 2ZAGA 2GJAA 3RGWS 2NQ2C 3OPXA 1I4DD 1U9ZA 4YX9A 4QNNA 3TKLA 4J43A 5LIPA 1O58A 3ZD8A 2WOJA 1NM5A 1RW4A 3KUDA 2OV6A 1K27A 4QJIA 3GYBA 1SMKA 4II7A 1Q7GA 3AJEA 3OKAA 3VDNB 1O8CA 4KN6A 4GOND 2DWCA 1O94C 4LRSB 1XMIA 3CS3A 1DJNA 3G82C 1JDVA 1JHDA 1TM1E 2PZEA 2N46A 3TMYA 3PUXA 5DHTA 5JPIA 4F56A 1QO9A 2O8CB 2ZRQA 4CCSA 3HCCA 5BPFA 4GXTA 4P0PB 2YVQA 1Q57A 1TT5A 2D5IA 1AF7A 3HGTA 1P5RA 4M1OA 3BG5A 4LC1A 5L7YA 2IH5A 1B6RA 2J6HA 1ZZEA 3TDNA 1V5WA 3DP7A 5I7RA 4DV1B 2EEPA 5LA6A 2EEZA 4TSFA 1PJZA 1U2QA 1CW2B 1KMIY 1UOQA 2H1VA 2QP4A 3B51X 5E1DA 1U7UA 5LZ8A 1RACA 2WF5A 2BKEA 3WRXC 3SR3A 2ALJA 2AFHB 2FE1A 4ZU3A 1GDHA 2J09A 3FDIA 4BNJA 1LFDB 3C1OA 4PIPA 1N9ZA 1CY6A 1XPRA 1YDEA 3S70A 3BTSA 2A84A 2WRZA 4TTJA 2IV3A 4A7PA 5JSZB 1W76A 4ZVRA 2EBFX 1EPUA 4O5OA 1GA6A 1GTL1 4WZBB 1RJFA 4HPXB 1MP0A 1PNRA 4RTOA 1R4MB 1GAQA 2H8KA 3QE3A 4REQB 3DA8A 2GTHA 2RI1A 1BD4A 4DA9A 4EQZA 4EUEA 4ZEMA 4RDXA 5IRCD 4LZWA 4MUAA 5ARDA 1KMHB 1ZRSA 2VNKA 4HAUA 3L0PA 2IA5A 4TV9B 4LZAA 3V7UA 3EC7A 3ZJVA 3FKSA 3UFBA 1ZHFA 2OV2A 3BSWA 2XVAA 2QIOA 3E0QA 4IZIA 3LNTA 2HPAA 3QOXA 4L7QA 3T5CA 1CNFA 1AGRA 4UW9A 1XMVA 3E9MA 2BSQA 4AZ0B 4UE2A 3ICCA 1LJUA 3WGMA 2VBGA 5A0TA 1XTJA 3W5IA 1JS1X 1MVOA 3DO6A 3MS4A 1LI4A 2Q8NA 1U2RA 2EV9A 3OT5A 4G5FA 3EDMA 3AUJB 4PCUA 3KB8A 2D2EA 5ERXA 2PWPA 2RJOA 5L40A 1EKXA 1S2OA 2ECQA 4OHMA 3V8QA 3OLWA 1P44A 2C94A 2ESRA 3JS5A 3MFYA 3R5KA 3S2ZA 1Z4NA 1TPZA 1RRFA 3TINA 1VLMA 1T1SA 1YZLA 3CKKA 3BA6A 2MT9A 1N7HA 4UKDA 5DKFA 3OPVA 5D2CA 3LCRA 4LZNA 4RMGA 1MFZA 2J3KA 1Y1TA 2R7KA 1EP9A 4WNCA 4UXJA 5EZ6B 4EK9A 4Y1RA 5JJCA 3RC3A 3U5TA 2O3QA 5IJZA 4GP7A 2I33A 4NENB 1NQOA 1RXYA 2A33A 4IP0A 3VU9A 2H3HA 1MV8A 3U7QB 4QOFA 2RAFA 2G7MC 4HXFB 3NDJA 4NOLA 5IUKC 4JI0B 2O3TA 2PBZA 4D2IA 1D1QA 3FYDA 1J0DA 2CLCX 4H15A 1CJBA 3Q3VA 1M1ZA 4EPYA 1L2TA 2C3YA 2VI5A 2YWCA 1YCGA 2Y66A 3GJ6A 4M83A 4GX2A 2W70A 1FSSA 3ZY6A 4HDNB 4R8RA 4JC4A 4J03A 1XE3A 3ZIUA 2FXVA 1XAGA 4HAOA 4C7BA 1CDZA 1TJYA 3D0OA 3M4YA 4LISA 4WY5A 2EP7A 1B15A 1W0JD 3CLRD 1LTHR 1Z4MA 3AR8A 4MP6A 2GRUA 4OJKA 5H3LA 3VZDA 2GPYA 4TVBA 4MH0R 1HZZC 2UVPB 3LKVA 2O8CA 3WS7A 2HXYA 1P45A 3H19A 4OP1A 5J58A 4PZDA 4QPDA 1QG0A 1VKRA 1DKQA 3N87A 1L5MA 5HE9A 1E7RA 1HKUA 3AIMA 4AZVA 1N2SA 2FWPA 4BLUA 5JWOA 1RMYA 1E8NA 1HE8B 4FGZA 1G7RA 1Y1RA 1E3XA 1A8UA 3L6DA 5IANA 4B32A 5AM3A 4PX5A 3IAHA 2MHCA 5KI6A 4DZRA 3LQFA 4K5QA 4BO1A 3K15A 1PS8A 3EULA 1MX5A 4PFKA 2I0FA 4Y6GB 3Q72A 4HGNA 3WA6A 4TMTA 4WH0A 1H0SA 4DYVA 4EARA 3LZ6A 4EQ6B 2VP5A 4TQ9A 4RH3A 3I04A 3FTFA 3NTOA 1NJFA 3I3OA 3JYQA 5DGXA 4CG3A 5JSZA 3FRHA 1GXSA 1R0KA 1UFVA 1L4MA 2QLFA 1AS0A 2QR2A 4JEIA 1YDWA 1N2HA 4WD3A 4IJ6A 2E6KA 4YRBA 4RD2A 2P69A 4GNKA 4JP3A 3ZHOA 5L45A 2PO5A 2HNBA 2EXXA 2AS0A 3D31A 3Q7PA 1KMHA 1GJRA 3ZX5A 2PYIA 3L49A 4EA8A 5ITZB 1VHTA 2GASA 3MT7A 1HDZA 3K5IA 4JA0A 3FE2A 3PZRA 4GOXA 4K86A 4TV9A 1QONA 3PGLA 3V4RA 1HG0A 2W2XA 1KTIA 5TGDA 3NDBB 1NMQA 4QD3A 3G2LA 2CXOA 1GT91 5A3VA 2FN4A 4AZ0A 4DIOA 1EM6A 5AM4A 1VG9B 2DHQA 3CVOA 1BFUA 2JBWA 1O77A 1A27A 2F43A 3PJGA 2FU5C 2UXDB 3BQMB 1M0SA 3B2NA 2JLAA 1FYEA 4Y8VA 3CUEF 5C1DA 4C0JA 5HXAA 1QH1A 2OCDA 3IUYA 2F3RA 4U7FA 1H22A 4Q3NA 1QOZA 3U4DA 1IH8A 3JQ6A 4GZMA 2ISCA 3AJ9A 4IIYA 2UVQA 2TMYA 3OJ0A 2CBGA 4ZVPA 2HW8A 3LWDA 4LTNA 1IOZA 4PYLA 3D8TA 3TUZC 2BFFB 4EHIA 4FE7A 2ZZGA 4GQAA 3F6RA 4MGIR 2DU8A 5FAXA 4BWVA 1SVIA 1YVEI 2A6PA 3RYIB 3OZSA 2REOA 1EK1A 3CH5A 3HV0A 3ROPA 1ZM4A 1K89A 2B20A 3L40A 2OTCA 1Z6YA 3DQPA 3GAFA 3HJNA 4GRDA 3IVXA 2XUAA 4WKOA 3WLJA 4YJ2F 1E0SA 3LAWA 3ZDBA 4L9AA 2XWJI 3RS7A 5KX5B 4KV9A 1IHYA 1NNEA 4G63A 3U7QA 1MBZA 1E79A 3L8MA 3V76A 4DRYA 4AS3A 3CE6A 1XRPA 3RRBA 4NX2A 1E3LA 4I36A 4EPVA 5BOSB 3ZHVA 2ECOA 4ZHQB 4TS3A 2E21A 4DY4A 3EX7C 2UUAB 3TW4A 3D6NB 2GPBA 1XD8A 1KAOA 2GI4A 3ETLA 3FNRA 2RJ3A 4K40A 5DYYA 5G3YA 3RYHA 3UJ7A 3H9UA 4ZCTA 2G06A 2QTMA 3LA8A 3OW7A 3KQUA 3HSKA 3V3KA 1QOQB 1RVV1 2NZVG 3UHPA 4AJEA 2QX8A 2FG5A 1V96A 1PEDA 2J9ZB 5E9QA 1GL3A 2X1LA 5BQ5A 5FFFA 3GLKA 5CPBA 5JEEA 5J23A 3ZVMA 2IS2A 3KL4A 4OFBA 1JQAA 2F90A 1LUAA 1V5EA 3L6CA 2X53S 1LV7A 1PJTA 1ZD8A 4G0PA 4R83A 4G67A 3L1VA 2IVFA 4UZUA 2Q9AA 1ZUIA 2PPLA 4MPPA 1ISRA 5AIBA 5GONB 5DP2A 2FWBA 2V4DA 3KEQA 3VISA 3BICA 4NE2A 3SC4A 1MG5A 1W48A 1YRBA 3MJVA 4KOAA 4LYGA 3M6LA 1QP7A 4LDJA 1RRMA 2B2CA 4O8CA 2B6NA 1TK2A 4Z0HO 4XRRA 2J0VA 3ZW8A 2B36A 4TL9A 4LE1A 5FI1B 1IY8A 3A6GA 4EQ6A 3ORQA 5K0GA 5HZHA 5DS0A 1K0UA 4R2JA 2PGNA 5CDYA 5IXSA 5B3JA 3RM3A 2QTWB 1V8BA 5K0JA 1GHTA 1SPXA 4U7GA 4J07A 5G0WA 5JDIA 4H7JA 4XJSA 4KQIA 5E9WA 1WUHS 2WUDA 3VR4D 1LVUA 3LF2A 1JU9A 4P2NA 4YXWD 2PUBA 5L4LA 3EVEA 1HLGA 5HJ5A 2Z57A 5J47A 2E1RA 2F62A 2XGOA 4L95C 4ZRNA 2XKKA 1I2DA 1SBIA 2VH1A 4OVKA 3UXHA 1EFTA 3I05A 3ASSA 1M75A 4YP5A 2ZVQX 5J2UA 4ISCA 3BNWA 2ST1A 4M9ZA 6AT1A 1YQUA 4Y9RA 1X7XB 1QQ7A 3HSYA 3N8KA 5FL7D 3ZWBA 4B2LA 4NNPA 5AW0A 5K45A 5LKAA 2DIEA 2JHFA 3VKGA 1ZMOA 3KWFA 3E9NA 1CVIA 1Y7HA 3PX3A 1N33B 4YDSA 1TJPB 2W71A 2Q2VA 2YDYA 3SQXA 4RJKA 3PR3A 4X24A 3E70C 3K92A 4MQ5A 3EVBA 3TR5A 1RXCA 4QYIB 4XIGS 1EB9A 1JMKC 3UQZA 1JSXA 4G1MB 3T6KA 3Q0TA 4JQZA 1MW8X 2HWWA 3AZPA 5DBHX 5E4FA 3BWCA 1TE2A 3AJ8A 1R8SA 2FSFA 3BXFA 3GJQA 4LSMA 3SNKA 2B82A 3RYIA 3HDYA 4FKBA 3H05A 2ZTUA 1R64A 3X1YA 1ULTA 4U6SA 3IL2A 1UC5B 1D1NA 1YQEA 5DLDA 2VA8A 1U7PA 3KBBA 1IG0A 1N6HA 2EWVA 2DSNA 1Y1SA 1RWNA 1K7EB 2FZWA 2KBEA 5A8AA 1RI3A 1JQ5A 2HREA 3GGPA 1Y1KE 3H8WA 2C5GA 1IAVA 2RG7A 2XA9A 3L92A 4FT4A 5AHRA 4EJFA 1T5LA 3G7NA 3ANNA 4M7OA 2X9GA 2Z58A 3OZGA 4GGMX 3TL3A 1FUYB 3C85A 3LLVA 3C3PA 2KLBA 4H60A 2BMJA 4PXAA 3TQCA 3UA3A 3UMBA 4ZHQA 1IOWA 4NU8X 4P3PA 2O8VA 2QRMA 3GJSA 2Z6VA 4UTNA 1NV8A 1C41A 5I4IA 1A1SA 1J2YA 1E7QA 2BJVA 5HBRA 4CJXA 4GUDA 2IL1A 4MKXA 4BZZA 1SN7A 1O2DA 3DGFC 4CKZA 3CPXA 3DW1X 2QS9A 4J0IA 5FPYA 4H1HA 1ZNYA 5KVAA 3R76A 1QWSA 1WW8A 2AN9A 1ONSA 1QHNA 3OJFA 1PAUA 3FCEA 3TSAA 2ZTSA 1RNLA 4B3CA 1YZTA 3GZ4A 4LX0A 4BRWA 5JSQA 3PNYA 1QNFA 3C4QA 5H3CA 1E2GA 2NNLD 3P26A 3N2LA 3Q3GE 3RROA 5HNKA 5K1ZA 1QO7A 1ZM2A 1KGSA 4TQAA 4KIWA 4H7HA 5IKPA 2IE8A 1B3RA 3BB4A 4IV0A 4E4YA 1LC0A 2NTVA 3FTCA 4KHPB 5GOZA 1X1QA 1I7LA 1WF3A 5D5HA 4NP6A 2OORC 3CBQA 3COVA 3WRYC 2FCAA 5CLIA 1K8ZB 3WDSA 1AKNA 1VHOA 1G8JA 4KXLA 5AM2A 3Q7QA 1Z73A 2PJDA 3NTRA 4Q9NA 3A1FA 4EHNA 4MRVA 3ACDA 4G0YA 1U7HA 3HXLA 3E84A 1HQYE 2JGIA 3KQKA 5KJFA 2OV8A 4GMHA 1TZMA 2BELA 3L0ZA 3W1EA 1RADA 2PZGA 2JGNA 3DF7A 4YMUA 1GN8A 5C3UA 2YUIA 4HFNA 4L0DA 2I4NA 1P9NA 3KJIA 2ZSHA 3QRWA 4MV6A 3UMFA 4EHJA 1HYGA 2G28A 2O3SA 3EHEA 1QG4A 1L1QA 4KFUA 4NZNA 4XX1A 5DGTA 1CJVC 5KAPA 2B0JA 3RAJA 4B4UA 5C46F 2VLBA 1GR1A 3M1IA 4GMGA 1VPWA 1SUFA 2JGEA 3JQBC 4MPDA 1G41A 2AVDA 1GQYA 5KMGA 3OCYA 2B4KA 3N0TA 5KSYA 2PH3A 5K20A 1A88A 2Y1WA 1JAHA 4RD0A 2CFOA 4IM7A 4WEOA 1XRSB 2Q3CA 3NWJA 1EWKA 1T9BA 4FLMA 4A92A 2PZAA 4BEJA 4IDPA 1DJMA 1AVTA 4HIZA 2J67A 4D8TA 1L5RA 1T8RA 3SNHA 1T6XA 3Q6MA 4FS8A 4U5XA 2GARA 2J5QA 2N42A 4FEEA 2CKDA 3KLPX 2JIQA 3K09A 3LLSA 3MTJA 4HDRB 4QYIA 4BQSA 1CPYA 3V8EA 5CYFA 5EJ7A 3PU6A 4XFJA 3S68A 4C04A 1NB9A 1G0NA 1GGVA 2H59A 1QK3A 4FJ1A 3SF8A 4EY4A 5DULA 1ATZA 4WECA 3C14C 5C4IA 1BD3A 2ZWAA 4Y2XA 1GKLA 1SY7A 2BI8A 3MWGA 1PJQA 3ER6A 4L4YA 5LL6P 3ZD9A 5JJIA 1J06A 3R7LA 4BNWA 1XLWA 3GLFE 1XMPA 2FPGA 4Z9XA 3DL4A 5K8UA 3HB5X 5EXSA 3NQ41 2GXAA 2WE7A 5EXEA 4D3XA 4DT1A 4HJRA 3W90A 1D1PA 1UK8A 4RNDB 3BWEA 3T7EA 4BQPA 1W36B 5L3RA 3ISXA 2YQ4A 1RMTA 3M5WA 2VRWA 4KXQA 1GVHA 5FIUA 2ZUTA 3I83A 1NQVA 3LOUA 1DV2A 1JEQB 4YQYA 2OCLA 4E4TA 1HT0A 3QBTA 4FQ8A 2OBFA 1CJCA 2FEPA 4Q1AA 4LJKA 4X97A 4OL0A 5D7BA 5CT6A 1TF5A 2ZVDA 4KAXA 5H70A 4YUYA 2ZJ1A 2CUTA 5AVKA 1T0UA 5J4YA 2O0KA 1J2UA 3CBGA 4JLAA 4GMKA 5DBEX 3I73A 3MBIA 1G4UR 4OFZA 2CC2A 4OIMA 1FRVA 4U9UA 3H2IA 3TZHA 1OCEA 3FHTA 1K8RA 3FGNA 2OXTA 1SCUB 4MEJA 4UAGA 3KCQA 1G8SA 4WUTA 1SG9A 3GGJA 2XNCA 4NEQA 2Z8YA 5HJ2A 3OJWA 1OVMA 2J0EA 1E3WA 1LGYA 3OA0A 4MO2A 3KXIA 1BHQ1 1OH5A 3HWSA 1G3UA 1YUNA 3R5FA 5I9IA 4Y2RA 1SUWA 3S2UA 1SUPA 3WICA 5EMNA 2GPAA 3A8TA 3AO0B 1YI1A 4HTFA 2BR5A 4S3MA 6REQB 1UXKA 1MX1A 3R8CA 3R9IA 1HOXA 1KERA 1OROA 2OCGA 4AKHA 4Z0PA 5JSFA 3CQ9A 3FJOA 2PUTA 2VTVA 3FOZA 4JEHA 1NVXQ 2FJ0A 2HSGA 1NI5A 2JFGA 5B58C 1NMZA 5HEKA 3C41J 3OM8A 1W44A 4S1NA 2VPWA 4B8ZA 3KVNA 3H5TA 3IH5A 1ZJ5A 1E1LA 1W8IA 4OQYA 1N75A 1DBQA 3ESRA 3CZAA 5FLKA 4HVCA 4A2CA 3HYNA 5EINA 4NZPA 4PSCA 1GDTA 1JR3E 1FP4B 1RAHA 3A11A 3AHHA 4REOA 2QAGB 2DJIA 4L76A 1PNTA 1U2GC 2WAMA 3RTAA 3S1AA 4V0OA 3CF6R 4NF2A 3DS8A 3UFXB 3IJRA 3M3DA 3O84A 1H4QA 3O0DA 4XQ9A 4C5CA 2R1VB 2OO3A 2AC2A 3I01M 4PQRA 2BUCA 3FI0A 2DPMA 3CF4A 2VUIB 1R3UA 4Q21A 4UHFA 1E4OA 3BSSA 3AVTA 5EJ6A 1DAEA 1JE0A 2J1LA 4BMXA 4X1OA 4YRKA 1PCXA 2HFJA 4KR2A 4M7WA 2VDRB 3W5UA 2Y1DA 3TMAA 2B1JA 1SELA 4GBMA 1LPOA 4RY0A 2ZB7A 1A5SB 1YVDA 4PO9A 1QVGB 1I10A 2IV7A 4M0PA 3ZZNA 4AJIA 2CN1A 1PDOA 1AU9A 5EP3A 1DC8A 1JH9A 2WM9B 2WMDA 4GUAA 3UYKA 2NV2B 1A9RA 1NQAO 1NI3A 2YOFA 1XVLA 3INTA 4Z7JA 3HPRA 4DWVA 2DYIA 3ZVNA 1WCXA 2D54A 2TMGA 1H2HA 1W19A 4IWNA 4RE5A 1OYVA 4M36A 4XLTA 4FDVA 1POWA 3RRZA 1UK6A 1KSFX 4C4SA 3ASVA 4H18A 4EFMA 1DKPA 1NBAA 3G2NA 3HB1A 5KTOA 2YZ7A 2B1QA 4DR7B 4D8XA 1ZS9A 2CNBA 4PZPA 4I14A 4MQUA 1LPPA 3Q8LA 4NOJA 3RUEA 2FI1A 4N5DA 2PRKA 4KKUA 3R0QA 3CMMA 3A4NA 3NRJA 4KIUA 2P6OA 4E09A 5JTUA 1N5MA 3L7MA 3TLJA 4XLZA 4RLZA 3AFMA 4E32A 4JJ8A 3ROGA 4WNIA 5ALVA 3Q3HA 4V39A 5CLFA 2C58A 5TEWA 1PD1A 1F8FA 5CH5A 1PL0A 2GEFA 4FFDA 2P2YA 1ULBA 5CYOA 2OAGA 4Z7QB 1QO0D 3HLKA 2XIJA 4QT0A 3ROMA 3ET5A 4D02A 3M6MD 2JIZD 1U0FA 3LCVB 3ND8A 1JEQA 4JHXA 7ABPA 3NHLA 3HE3A 4KAAA 1SKYB 2C4NA 1KC8D 4ZO7A 2NQTA 3CONA 2XCQA 4JBXA 4N82A 5EKDA 2HRCA 2WIAA 1XVTA 3FPBA 1R5JA 1DAFA 3K31A 5EJAA 3VHXB 3NBUA 4GX0A 1CFJA 1JKIA 1QIGA 5TR9A 2BUAA 4RJ2A 3STYA 4V0SA 4DREA 4FM9A 4UHEA 2XRZA 3JASB 2PLWA 4AW9A 4YRNA 3STTA 1SC1A 3L0SA 1CY0A 3RNOA 5TF4A 1BYIA 1NY6A 4FMCB 5JBNA 1ZJWA 2IEGA 5BNZA 1ZHHA 3RKSA 3HJCA 3AF1A 4BMSA 5LBUA 2BHTA 4LHWA 2P5SA 2F67A 5JJ5A 5FR2A 3OLYA 2ZZEA 1LY1A 2YOHA 4R1TA 2AF4C 1LX7A 2A78A 2ICAA 3AX6A 4FD2A 2YMMA 4JOCA 1TLFA 4KE8A 3RG2A 1CTQA 1NT4A 1ZM9A 3KR0A 1K6EA 4R84A 4FZ5A 1ONNA 2QV7A 3PLNA 1BQ4A 1ZD1A 2H1LA 4M0MA 1PLLA 2NYRA 2W83A 3NFRA 3KPUA 5CVVA 1JEJA 5FX2A 4BFCA 2FFHA 3LFTA 4RF3A 1T9GR 3QVGB 1A8IA 3QYJA 3CY6A 1RPNA 4LPKA 1XTQA 6CHYA 1VP9A 3AKYA 3OT4A 3CSSA 1OTYA 4V0ME 3CRNA 2CBXA 1BCRA 5HUJA 3EXIB 1D2CA 3TLXA 1PJLA 2DWUA 2VJQA 2Z2IA 5JCJD 2QTHA 2V4MA 4L16A 3CM0A 3T5PA 1KMNA 3I34X 3ONEA 4NZYA 3REFA 2QAGA 4FDAA 2BKUA 2WPNA 1MPTA 3NJ8A 1WXGA 2O3UA 3UFXA 5LOVF 3EY9A 1A98A 1OWPA 2VPIA 3JALA 2LV8A 4M1EA 4M9UA 4TTSA 4B7CA 1NBOA 2R1VA 3E20A 1LSOA 4PYNA 4PZCA 4XGIA 3L7DA 3WLSA 1EH5A 3GLFA 3OFJA 5HVNA 2B25A 3KB2A 3V4LA 3FRJA 4I9GA 2BM9A 2YRWA 3RYFB 2ORWA 3LT5A 2R8EA 4MYTA 1E9BA 1TFRA 3BE6A 3LC1O 3SE7A 3P2KA 4FFLA 2AJ8A 3JD1A 3PA8A 4OM7A 1P7VA 4W5WA 1VF7A 3E23A 1E3MA 2VWQA 3LJKA 3K3PA 4EB0A 4J7UA 1DIGA 3KL2A 1R88A 2E4AA 3FG9A 4E1BA 1KFKB 3NNDA 1L7AA 2G1UA 4PHGA 1FUEA 1MIOB 5BV7A 5J5AA 2OC9A 4HATA 4E5KA 3R7SA 1ZI8A 1T5TA 4ZOLF 4MQBA 4E6PA 5ISMA 3BSYA 2ZTNA 1UOPA 3GLTA 5LXTA 4B4WA 2I4RA 4PG6A 4KN5A 2NW6A 3LP8A 2QYOA 3CUYA 2A0FA 5HX7A 3C87A 2P4SA 5AKJA 4BB5A 1GFWA 3MWJA 4Q15A 2Q9CA 1QP8A 2V8BA 2ZRIA 3LP6A 3WL5A 2JFQA 1CR6A 1Z8DA 2C98A 3U4CA 1VHEA 1BS2A 2RHGB 3KHSA 3N74A 5SZJA 4GLFA 4YS6A 5HOQA 4I3GA 3WB1A 3IEIA 3LPLA 4TUYB 4BN4A 4J2OA 3OU6A 2BBSA 4MOWA 4F5ZA 3QBEA 4YK7A 3RYCB 4LGMA 3O8NA 5K4AA 1XKLA 4IS3A 4DC0A 2Q0XA 2XEDA 3BE8A 4TXJA 1GPKA 2JARA 3I9NA 1E1CB 3A3NA 4Y6OA 3BGOS 5H80A 4PFQA 4B31A 4KLAA 1VB5A 2XZPA 2QU8A 4QE3A 4QRHA 4MHTA 4KKSA 1R6TA 4NTZA 2J7PD 1IVYA 3IKVA 4KXXA 5EL0A 2Z3WA 3WKAA 2ADFA 4BGEA 1IOVA 3SEFA 3JASA 3A58B 1U9JA 2PDAA 3HCDA 4D4JA 4BFYA 1X8XA 5IJ0B 3CNNA 3T3OA 3FDZB 1CF2O 4EFDA 3IUBA 1VPVA 1JR3A 1CP3A 1P31A 1FXSA 3L7NA 3MWEA 5J4KA 2PHZA 2Q7DA 3I9LA 2E48A 2CXTA 1MVLA 5AJUA 4ZAWA 3GOQA 3R0JA 5DV9A 3KU4A 2V4ZA 3MOIA 4PICA 5LYYA 5LYJB 5C53B 1PKVA 2GF2A 2Q1UA 1JIKA 2FP3A 3C8HA 1E63A 1SGWA 1DS6A 3K9LA 4E31A 5B55A 1ZJ4A 1Z5GA 1KH3A 1X13A 3E61A 1UKYA 3QVGA 1Z0DA 3WYAA 1EZZA 1II9A 4X54A 2C5LA 1CVLA 1WCWA 3UW3A 2PUEA 4C08A 4YQZA 1G8YA 1VCOA 2Z95A 1ICEA 1LQTA 1XAJA 4GI3A 2FTKE 1LH0A 3EXIA 1ENYA 1OPXA 2EERA 3TTSA 3REGA 3S27A 4F04A 4F7WA 3ZC3A 1R6BX 2L42A 2RI6A 2NUTB 1V71A 3SX2A 3LBYA 2G4VA 4CG0A 4W5RA 1JPUA 1ZD4A 3KOOA 1MOPA 3PGA1 4Q0MA 2O8FB 1JAIA 3WSTA 1JQEA 1IQ0A 2IYOA 4MK4A 2V7VA 2JCVA 3F90A 3SVZA 3I8OA 4TVOA 1E60A 4ZMRA 2XUKA 3GDGA 4GPZA 4ZGBA 1E2HA 3CPWB 1DC5A 3J81k 1HOTA 2GZHA 1ML4A 3WO0A 3DD5A 3MMPA 2P11A 4ZAFA 3KTOA 4EB6A 2E4YA 3GELA 4K9MA 2UYCA 1Q21A 2XECA 1M1UA 3KHTA 1U2TA 1OFUA 1UKZA 2NPFA 1OU0A 4GZ5A 4IKOA 4BKPA 3CMEB 4UZEA 2E37A 3NDIA 1B0UA 4ERNA 2K7FA 4R2WA 5TC4A 3EY4A 4L5AA 5COQA 5DGDA 5DSXA 3WZMA 2IYZA 5B6PA 1TPYA 2BP7B 2WAAA 2J9YB 2X5NA 3NCTA 4R81A 5J1SB 1XI2A 3T1QA 3TLKA 5IEJA 1E20A 1PGJA 1CB7A 1H1LB 3W9BA 4U7WA 2ZJFA 2VUTA 1RBMA 4RSHA 4XWYA 1BG6A 4MIEA 4INZA 4EX6A 5A5GA 2J6IA 2RGEA 4RO0A 2H4YA 4AQDA 4HAZA 3PP8A 2OILA 4LXYA 1L4BA 5TY0A 2O2CA 3Q10A 5IVIA 3WMFA 1E69A 4GI5A 1Q92A 3C6BA 5LQSA 2GSWA 4BFSA 1QFSA 1O9BA 3QKSB 1U2EA 4B3TB 5CD9A 1IN1A 3FPJA 5TJHA 4JGBA 1TUBB 3S2IA 3DE6X 1JG6A 4E2YA 5FV4A 2VO1A 3A1UA 1E1CA 4FMDB 2I3DA 4AJ1A 3GAMA 3NT5A 4MYHA 3H0CA 4LYJA 2GF0A 3K2BA 2JK0A 4UE6A 5K0FA 1NUHA 1P0PA 2IITA 2QN2A 2WU3A 5C4GB 4X61A 3OQMA 4RF5A 3FVRA 3PJRA 3AM5A 1ADBA 4GX1A 4IF6A 3IMGA 1E5XA 1GZVA 3GQBA 4V0MA 1RYEA 2EX4A 4JKYA 2QM0A 5K01A 3RWBA 4QVIA 2NP6A 1UANA 4OL9A 4C7JA 3G68A 5IWAB 2NVBA 3FMFA 1Q15A 4RL6A 3FDZA 4UU8A 4D5EA 5BVHB 1KR2A 3HGQA 4HX2A 2ZBEA 2IPLA 2FQXA 1T13A 3KXDA 4NCIA 4KPFC 5FWNA 4J0FA 1YOVB 2H51A 4J9VA 2WMOB 4CV2A 1J23A 3ZX4A 1A2BA 3SQDA 2C4UA 1FA9A 1WIWA 3MAJA 4M8LA 2V55B 4XKWA 4AROA 3HGMA 3A6LA 1GAWA 1J8VA 1PR9A 3JQDA 1N6RA 1YVUA 2WKSA 3GA5A 4QBGB 5B1SA 4KRYA 5LYJA 3V8MA 2Z6UA 3CCUB 2ZK7A 3NAMA 1Z35A 4HRVA 4MP8A 2RC5A 5SYNA 3LUAA 1JEEA 1VFPA 3W2EA 3WRYA 4F93B 1O54A 4DR2B 2WHPA 4CMGA 2BDTA 2ZUUA 3BWBA 3BH7A 4IIFA 2A0YA 3NIFB 2ZJ3A 3PQ6A 2XAUA 4H0FA 1UT8A 4KHZA 4RA6B 3E3AA 3ZK9A 3LDGA 2YJNA 5DJ5A 5IP5A 2G82A 3V42A 1A9XB 2DR2A 4F72A 2LUOA 4PLYA 5DX0A 1QU2A 2NO7A 1B0ZA 1DEOA 1Q17A 1Y7LA 4MR7A 4PLVA 1NLUA 3FZYA 1TUIA 2LTAA 3IEUA 5T41A 3EZGA 1Q1QA 2A1UB 3ENQA 3F5SA 4LJLA 4R3NA 2NUTA 1N1EA 3N6XA 1NW9B 3A3PA 3PDWA 4O2AB 4CTJA 5BR7A 3MJHA 1EX1A 3IIIA 2X6YA 1M2OB 1LK5A 2ATVA 4IMPA 1B1CA 3AV3A 5CEJA 1RKBA 1U9YA 1ZKMA 2HCTA 4HFJA 2AX4A 2MYPA 3V7AA 1MB0A 3B7WA 4QOIA 4FINA 4CKEA 3QKTA 5CURA 3QITA 4IXNA 4AK9A 3FOEC 1QANA 5EZYB 5BRNA 3AVXA 1G66A 1WOSA 1Z2PX 3B53X 5E1BA 3RSZA 3R0XA 3ON5A 3JWJA 3MT0A 2QX9A 3EGDA 2DUUA 4Z1MA 2F6RA 3HBMA 4CG2A 1W0CA 3E82A 3N53A 1W8DA 2X9LA 2F1HA 3R7WA 1CZHA 1E5DA 1EM8B 1JQLB 2D1TA 4K03A 5B37A 2NZJA 4YPFA 2D06A 5JVDB 2JJ2A 3W5DA 5A9TA 1B93A 5KNCH 1L4GA 2VR1A 1UUFA 2XLBA 3E5RA 3QA9A 3T1TA 3GU3A 1CRPA 2AQKA 4WOJA 1UC8A 3FN4A 4XYLA 4XIYA 2QSYA 3ZW9A 5K3AA 4LJ8A 1NURA 4KRFA 4WFJA 1YB1A 3RRNA 2Q0SA 2TMKA 3HL4A 4C9BA 1WXDA 2FPSA 1O8BA 4J76A 3F47A 4ZOBA 1JFTA 5JYDA 3EVZA 1DXQA 5E3HA 1VQPB 4YV7A 2C92A 3TR6A 1KRWA 3QYAA 4F2WA 1TUBA 3C48A 1Y82A 4D9GA 2G76A 3IUMA 4BYGA 1LI5A 2G6TA 2GBIA 5LZ7A 5L9AA 3QFRA 4RLQA 5MGNA 3ILVA 2W4QA 1CIJA 3T5TA 1QE5A 2DUMA 3DM5A 4R3UC 3WNQA 4B45A 4NS4A 1VQ1A 1YGYA 2GGSA 3WADA 2YFHA 2IW1A 1GU0A 3B48A 1EVLA 2RHTA 3HJTA 1YJNB 1XRLA 5EE9A 2IHYA 4POOA 3DEJA 1GUBA 4MQEB 4UU7A 4PSVA 5GM1A 1T1GA 3RBXA 5JD5A 1FJHA 2CDAA 3WLPA 1HZEA 5F52A 1BO6A 4G4SP 5A3SA 2GN6A 2PBRA 3LECA 4ILEA 4K3UA 1IZ8A 5EVCA 1P8AA 3K2EA 4DLBA 4PM4A 5LQAA 3M3PA 1CR1A 3I53A 3EGIA 4M9XA 4ABTA 1AQUA 5CP8A 4HLUA 3MGCA 2WDZA 3L8YA 4JZKA 1WHTB 5K8CA 4JR2A 3OEEA 3B85A 2J6BA 1I8TA 5COAA 3SHWA 3W05A 1F9EA 1P0QA 3BX1A 5H81A 5G4LA 4L22A 3TS1A 3WJ1A 2ZT6A 3GWGA 1ODCA 2E4ZA 5CDHA 5ICSA 1XJCA 2EKPA 1EE2A 4EUSA 1GADO 4QU5A 2OZVA 5AWFC 4ZCQA 2BH2A 4RVUA 1BE0A 3ELYA 4G41A 4YRCA 2J3MA 3AW9A 2YIJA 1A2KC 2ODWA 1E96A 4JITA 1L3CA 1JXAA 2A1UA 2I2XB 1H2FA 1E3ZA 3R41A 5ESRA 2NU9B 3L1JA 3P0JA 4EL5A 5THKA 4O2AA 1A3CA 4LJ9A 1PGPA 3CLTD 4JBGA 2Y0EA 4ONEA 1KWGA 1RPZA 4Z9AA 1M2OA 4FYHA 1SD5A 4KE7A 3KAJA 3SR0A 4QJ3A 4O33A 5HQ3A 1P1RA 1QQBA 1PR0A 4ZVOA 3N86A 3CZRA 2ZB3A 4QGFA 1QV6A 2P8JA 2RKOA 4CCWA 3HKBB 3G1UA 2BFCA 2NO6A 3CT4A 5EZYA 2VF4X 3RS4A 4YMLA 4X1IB 5J2TB 1TCBA 1JALA 4BV8A 3H0EA 3QPCA 5KNBA 1F7VA 5ECYA 3PEVA 5ALRA 3W2IA 1TQDA 4GWKA 3ZHXA 4MDYA 3QGMA 5KDDA 3C5CA 2JBHA 5SZHB 1N2JA 3CB4A 3H5WA 1J56A 4QEKA 1P7WA 3ZZMA 4BV2A 4DPMA 3QVWA 1G20B 3E1GA 4JL6A 4GMFA 4R6WA 1Y9EA 3RUCA 3T35A 3WQRA 4L8FA 3DLTA 3TQTA 2W8BB 4AJLA 1ZCAA 2BN4A 4FSXA 4MRAA 1R0ZA 1J5XA 1O6BA 2DHDA 2D8MA 4X3PA 5EWJB 4D0SA 1DMRA 1YA4A 4OCZA 1E43A 3AUFA 3I5AA 4EKIA 2JJ1A 1OA0A 4P4LA 2W2VA 1P39A 2Q27A 3VNVA 2FMXA 3EW7A 1ODKA 1SULA 2GD1O 2HJRA 1QRAA 3ES9A 3BHNA 4P3OA 4X94A 1EIWA 4J0DA 2XUPA 4MW6A 3MXOA 5H9WA 5ESXA 2FZ5A 3A1PA 1VE6A 2DEUA 1FNCA 4OPVA 4POAA 5F1YA 1MR3F 3E7XA 3W5HA 4AJ9A 2CXUA 3B8EA 3QNUA 4ANFA 3IQZA 1FJGB 2P9JA 4ENSA 1TECE 3KM0A 2XMDA 3EDCA 2C7OA 2Z2ZA 3I56B 3OKXA 2GJ4A 2JN9A 4N03A 3A3OA 3TLEA 4CM3A 1Z07A 4AMBA 4OLJA 3IIMA 2D7CA 2FRDA 3QU4A 4UUQA 5FI3A 3UB3A 1Q7EA 2OD2A 3SDBA 2EJWA 4K6OA 4R9RA 5IAGA 3OPQA 4LZZA 1JWBB 3MJEA 3SK0A 3VDRA 5F35A 8AT1A 1INLA 1ODIA 1ZSNA 2W4MA 3HKCB 3U80A 2F3QA 1SKUA 3IO5A 3LW7A 2VF7A 2X8AA 5E0KB 1JDBB 1TAQA 2VBFA 1CK4A 1SBQA 5CLHA 3SYNA 3T9DA 2FOXA 2QSZA 5CG2A 4BKUA 1YTUA 4JUAA 2ATCA 2D3NA 2NTNA 4H2DA 5B4UA 5CGZA 3GVIA 1NNUA 3KQSA 3E3MA 4RZ2A 5CB6A 5G0UA 4DCJA 1IY2A 2CDRA 5F1KA 3ZZUA 1ZM3A 1E2UA 1RC8A 4K88A 3AP3A 1USKA 5CA0F 7GPBA 3PE6A 1DBRA 4HNSA 1WHTA 5FPSA 5DNVA 3KJXA 2ZSFA 2WE8A 3I6MA 1C2TA 4PAAA 1THGA 1O97D 2YV4A 2FB9A 3WDLA 3ZCRA 1KP2A 4FZVA 4ZD6A 1GILA 4BNLA 4ATNA 3K1ZA 3F1LA 3MERA 4IX9A 5EYPB 2WHEA 2XYGA 3RWOA 3K9FC 3WWYA 5TDHA 3LDAA 1NVGA 2P3QA 3TNJA 1ZMBA 2FWMX 2QMQA 3HN7A 4I4IA 2GWRA 3R3JA 2K2QB 1Q0LA 4Z3DA 3TCKA 4D41A 2Y77A 4R1MA 4KPEC 1UMCA 3CWCA 3KJFA 4RAOA 2Q46A 3QLEA 4RE6A 4BWYA 5KBYA 4LYYA 1CFZA 2WKRA 3UANA 2RAPA 4JLVA 1KFJB 2J0QA 2NU9A 4L0QA 4LPSA 3VC3A 3EW9A 2OHOA 1UJCA 1E2LA 1IEWA 3P0IA 2J46A 4PGHA 2XHEA 5BSFA 1CWUA 2ZJ5A 1XXHE 3G4SB 1T6NA 4UUOA 5CB0A 1YJXA 1R3DA 3HY3A 5B53A 5F7OA 3Q6QA 3W6PA 1NP3A 4HLNA 4RTQA 2BFDB 1ZQ9A 1QX4A 2W2LA 4C0XA 4JQOA 4TLCA 2IY8A 4GSLA 4M4SA 2X6RA 4YP9A 2O48X 3HKBA 5JCOC 5J2TA 4X1IA 5GAJA 2NYVA 1AM4D 4LOAA 5T8KC 4PBRA 4JIMA 3QUAA 2R60A 4OMDA 2CXNA 1DAPA 3DDCA 2PQ0A 5AN9A 1DOAA 3RIEA 1BPLA 2P4EA 2HBZA 1AGYA 1M83A 2IH4A 1KMMA 2TSYB 1ZISA 4P3XA 1EX9A 2OCXA 3KVVA 1CUVA 2JFWA 3FJYA 2NNWB 3RIYA 2F1LA 1FSFA 2WNSA 4FYWA 3NPAA 4BVGA 1PSDA 4P3YA 3S81A 4OTZA 2ADMA 2Y1EA 2ZI6A 5KX5F 4O29A 2W2TA 4PX3A 3RVKA 3TE7A 2P5YA 2JI7A 1MN6A 2IEYA 3EZ9A 1S01A 2FJPA 1M90D 3JW8A 5F5XA 1NVMB 1OZ0A 3ECAA 4NU0A 1FBNA 2HD4A 2UZ1B 4K9LA 4MS4B 2G1AA 2JF0A 4UBNA 4PLHA 3T06B 4RTKA 4P3NA 1RKXA 1H85A 1OQAA 4HPJB 3DMDA 3URMA 4AZ3B 4ZHQF 5FEMA 4BNFA 1W88A 1ZN2A 3C7DB 1R0SA 2AC4A 3WTBA 5BSGA 5GZ6A 5IKOA 2Q6VA 3VKWA 1K9MD 3HDVA 4YLGA 3HM9A 1GG2A 3EGEA 1UBNA 4FOOA 2X40A 1V35A 3ZWQA 3A35A 1E1NA 2EDAA 1AUPA 1C4OA 2PCJA 3LU1A 1EHIA 1J24A 4LDAA 3TD9A 1T36B 2QI9F 1JL3A 2FXIA 2HCRA 3TIIA 2WTAA 3VOBA 1QQAA 2B4QA 4HB2A 5DM0A 2Z5FA 4ZQIA 2IYAA 4Q1DA 1XDZA 1PV4A 4DQUA 2XV1A 3UKJA 4KKXB 5TX7A 1EU1A 5B4TA 5GONF 1WDKA 2PLRA 4A0GA 4FFNA 1MA0A 5IPFA 1Q0SA 1AV6A 3I1YA 1WB9A 1M66A 1YA8A 2Q41A 3D5QA 2VHCA 3VSEA 1J25A 4R8KA 4B71A 3DF9A 7AT1A 2AJLI 4H6PA 4P33A 3KZMA 3VSCA 2PBFA 5IK2D 3JCZA 4JLUA 3N05A 4X20A 1XXHB 2BDUA 3H1TA 1UT6A 1R15A 4EJMA 3QUQA 1L7QA 4C29A 4DCOA 9ATCA 4XEUA 4PXYA 4TZTA 2H65A 1OAKA 2WF7A 2A0KA 2JVJA 3BOSA 4LJ6A 2H5JA 4AS2A 1J33A 1ST2A 2WHQA 1SCJA 2PA0A 3OMXA 4K05A 4EA6A 2N0SA 4TTRA 4M1QA 1T2DA 1WEKA 5TV2A 1HL7A 1L5YA 3OI7A 1NQ5A 2Q4BA 4JYZA 4IDNA 3QPUA 4I55B 4P34A 3GBSA 1BWSA 5BN5B 1WX1A 2LE0A 3GPLA 3QK7A 5HXBA 1TFUA 4ZV9A 1BS9A 2SNIE 5ESWA 3L18A 5G4KA 1PSZA 2D62A 3QELB 1QTQA 5JS8A 2VSFA 1NN0A 3KKKA 3JWEA 1UZAA 4P5DA 3AOGA 4J6FA 4C7OA 3JQCA 4GT1A 2PUCA 4G24A 5BW4A 5FA8A 2PLAA 4WI1A 1JHZA 4XM0A 3GPDG 4FVTA 4O6VA 1RHUA 1NNSA 3KYCB 3I01A 4I1SA 1PK9A 4IUYA 4RHUA 4PZYA 5D01A 2YHSA 1BZYA 2V59A 4LDNA 5K0CA 3K0AB 3AXTA 1OF1A 3LHFA 3HJFA 3MQ4A 1L5WA 3A1SA 3WGLA 5MHTA 2BFDA 3D0RA 3KLMX 4O4JB 2CRVA 4QXMA 2HV8A 3GZTB 3MJ4A 1VCMA 1QH0A 4GRAA 5ALGA 4B3BA 1M2HA 2A3NA 2OSVA 1XAIA 2A9JA 4AXXA 5A88A 1BGVA 2QGNA 2X0RA 2BJHA 3SLNA 4FFRA 3HRHA 4JXKA 4W7HA 4XSHA 3RVLA 3SI7A 1FYFA 3WGKA 4Q7LA 3IP7A 4UREA 2ZAOA 2ZPUA 4CL0A 4W9RA 1W4BA 1RZVA 1JDJA 3A9SA 1VLVA 2F48A 4BLVA 3H83A 3ABIA 4IV5A 2A9OA 1RJEA 4X7FA 1HDYA 5B6IA 3IVGA 1MZVA 3JU3A 3GGOA 4MW0A 4OHKA 3QLJA 5M3BA 3W8DA 1RZ3A 1FYWA 3SKYA 4TS4A 3UCEA 2XZLA 2QXUA 2H18A 2QLBA 4J6EA 4YRIA 1IY1A 1F1BA 4IOKA 4TGLA 1VSQA 3H2SA 3MCZA 4X00A 3USCS 3Q3IA 1JAZA 2UZ1A 4MS4A 4ZALA 3D3WB 4HWPA 1C8BA 1EBFA 2VRCD 4L6CA 5TS2A 1CY4A 2E4VA 3PA1A 2DPXA 4OJTA 1IJBA 2FWNA 4UNQA 1XTVA 2GYUA 4KUHA 2D3LA 3AOEA 2D5BA 2RH4A 4Q16A 4KV7A 2IHJA 1NOIA 2C29D 2WJJA 4LF4B 4JI6B 5JFTA 3GT4A 4DMGA 1WXEA 2VYND 3L7OA 3GP3A 3H84A 3UOGA 1I13A 1T36A 2W2OA 3DTVD 4TRJA 4FLEA 4MNTA 3WJAA 4Z4WA 2JFNA 3WB2A 3LHSA 3UC5A 4AU1A 2VDMB 4CKXA 1QP4A 3PWTA 2B99A 3GNQA 2OZPA 2XNJA 3AHDA 3HLTA 4PYRA 3SS9X 3JQAB 4XDYA 2O8DB 3P96A 3DPIA 2IX9A 2FOLA 4Q6BA 5HM6A 3ZBUA 2YXLA 3PDUA 3LZDA 3MUEA 2V7GA 3ACCA 2IEBA 3HP7A 2IUUA 4BNDA 3KOUA 1JJAA 3ESCA 1JJVA 4AJOA 3T0IA 1NV9A 1X74A 2PJUA 1XXHA 4P35A 2DAPA 4J7AA 3GGCA 3G5UA 4X3CA 1F4LA 1P0CA 2O1SA 3G2QA 5IT0A 1ZVJA 2DQKA 1B23P 2GXQA 3HCOA 3SICE 4YY3B 2WT9A 1E2NA 1S2DA 3OTQA 2OTLB 4PCAA 3EGXA 4I6EA 4RKEA 4XCVA 3RS0A 1USVA 4D9BA 4ENVA 3T5AA 4TYWA 3K6KA 4CLXA 4YCCA 4DYDA 3CCQB 2GN8A 3EZFA 3SYTA 2YJ4A 3LK6A 3EF0A 3TX6A 1O96A 3WV4A 4FI3F 4I55A 3ICPA 1KI7A 1NE7A 1XD9A 2VNAA 3B1XA 4KRXA 4MPJA 2B7CA 3LCMA 4IGKA 4JT2A 1E66A 3IXQA 5J4LA 2FGKA 4IFTA 1X19A 3MLEA 1I3LA 3QELA 4BLSA 1Y6GA 1KIAA 4MKFA 1EP3B 1W49A 4BX3A 3NTQA 3RK0A 1IYZA 2W37A 4OHPA 2J3HA 2BFEB 3CP2A 3Q5DA 2JFPA 4HF7A 2ZM6B 2OCYC 5A0VA 3LC7O 3ID6C 1UBRS 4LTDA 4J1TA 5DI3B 4OPMA 4Z6KA 2Q4DA 3AKCA 2YV5A 4D4LA 2YHIB 4FCVA 2J48A 4XQEA 4O4JA 4GEKA 1Z4IA 5HZMA 1EFCA 5G1PA 1VXRA 2ZRHA 4BO8A 3LX8A 4EPWA 2GYVA 3HACA 2BHNA 4NVRA 3K30A 1W0JA 3LIIA 1XT6A 4BMPB 2C4VA 3I6IA 1L5HA 1A96A 3DMYA 4R1OA 3WKCA 4ND8A 1AZTA 1GUZA 2XNSA 1OI2A 3ZZTA 5DW0A 2DP4E 4MI9A 4OQDA 1J5PA 4JYMA 5M2QA 2BM1A 1DFIA 1JBQA 2ZT8A 4A0QA 4NBRA 3DOJA 5AJHA 3A1NA 1C4XA 1QFMA 1CRWG 4CMKA 4QG3A 3U6KA 2BFPA 3R3YA 1R0WA 1ZEMA 3P7MA 4B6JA 4AKTA 1PIWA 3PEFA 5JISA 4PLCA 4D0GA 1WHSB 4F45A 3IP1A 3GLQA 2YJZA 5HE8A 4KWHA 3LC0A 4B9AA 5L7WA 3ORSA 3BEDA 2QENA 3A37A 1GTZA 4QPJC 3TO5A 4AJJA 3BFPA 1RCFA 3G8CA 3MFQA 4AM8A 5KNDD 4EMUA 2XB6A 3WNCA 1CEXA 1ZA2A 2VDQB 2BGWA 1XKTA 4QOGA 3FOAA 4ARAA 2CNNA 5B4VA 4J1QA 5CH3A 3DV2A 5BW8A 1J8YF 1PFGA 4LBWA 1YBVA 2P2SA 4J94A 1XZMA 4E7OA 3BN3A 1KQ3A 1FOEB 2FMKA 5JH7B 2DKOA 2G9NA 3A3GA 1JG1A 2HKIA 4XVRA 5I4CA 5FOXA 1PVDA 3JD3A 3MMSA 3UN1A 4ZN6A 5ABPA 2ACWA 4CEIA 3CZ4A 3L4EA 3NH6A 4ER7A 3NIWA 4R9SA 4RXMA 5CVCA 2NV6A 2H8GA 3ZNOA 1E2JA 1UDXA 3H16A 1KVRA 3QH4A 4ON9A 1LX6A 1JSRA 2P2NA 4YVFA 4RAQA 4LRQA 1K6MA 1R9JA 4NH4A 4RIHA 3VU8A 2V7BA 1UF9A 5AR1A 1OGJA 421PA 4HCJA 3VR6H 5A5DA 5T6MA 2F17A 4EGQA 2CJPA 3P5BA 4G1BA 1JU4A 2Q07A 1BQ3A 2OAP1 1VYHA 1D8TA 1CY7A 5ICGA 3QY0A 3FOBA 2I1LA 4X7BA 1LSJA 3ZE9A 3DNFA 4TPKA 3VZPA 4EW2A 4OGKA 3QWFA 1MJGM 1FDTA 2F1OA 4WOCA 4RPBA 5JNSA 2UXBB 1Q16A 4GFDA 2C5HA 1F3LA 4FNGA 4LG1A 4XCXA 1GPAA 1CQZA 1Y7IA 3FGZA 4I5IA 1NXQA 4YLEA 5B64A 3CH7A 3GDWA 4MHOA 1NUUA 1Z7GA 2FCRA 2JZOA 1NJ1A 3L0CA 4IXWA 2ILTA 4RLFA 4N49A 4TYQA 2K5UA 4UE3S 3TVDA 2VF8A 1NBEA 2O1EA 4KBGA 3WGQA 3TRIA 1NJGA 2FUEA 2BFEA 2GZAA 4P31A 1QHSA 1NBMD 2AB0A 5DI3A 4RSMA 4MV9A 2XADA 4BTLA 3OUZA 2J9RA 4YCAA 3MXTA 5HIKA 2YHIA 1C9EA 1JRLA 3OO0A 4RPLA 4RIFA 1JMVA 1LZKA 4IY1A 4JLBA 2C8KA 2X0EA 3OSZA 2Z1NA 4E0FA 3EFOB 3N9IA 5DEIA 3TZ6A 2HRQA 2YVKA 5HRCA 2ISSD 3A3YA 4JLJA 1HFWA 2Q0QA 1U2DC 4C43A 3HG7A 4II2A 1HEYA 3C3AA 3T9EA 3WWZA 2HQBA 1VLQA 2C2YA 4RVDA 3J80A 1UJ2A 3IGFA 2ZRBA 3ECSA 3Q7TA 4GE3A 1Y8QA 3WVNA 4NLLA 1JQ3A 1FJ2A 1JQKA 1QLHA 1QMPA 4U2EA 1OT3A 2DLDA 3KUCA 1DI0A 2PXCA 3QHPA 4UDOA 4Y1FA 3SC6A 2DY1A 3T5GA 4ALIA 1U8YA 3VQTA 2PCLA 5HZGA 1YS1X 2J08A 4I3HA 1KMQA 1CE8B 5E1MA 3PQ8A 3VZBA 1ZCBA 5DTMA 1R74A 2Q28A 1EK6A 4Q4HB 3W5AA 5KWJA 2RHWA 4X3OA 1A9PA 1WHSA 1Y5IA 1RPAA 4G5QA 5K51A 3ETCA 2ZJZA 2OA0A 2IK8A 4D74A 5KYKA 1YR1A 2YVAA 3DOCA 3PT5A 4DUZB 2ZS7A 1WZIA 2WFZA 2WR8A 3AL2A 1OH7A 1XL1A 2YW2A 1XJQA 4RCZA 4MIKA 3E03A 4FNAA 2QGGA 3NHPA 1YQTA 4FOPA 3R4VA 1E4YA 1UBUS 4AIIA 1QIFA 1I8DA 3HVJA 3IXMA 5GJWC 4BPBA 4Z4IA 4H6WA 3G6KA 1IOLA 1XHEA 2ID8A 1I7SB 2BFMA 3JQFA 4JL8A 3TTUA 4F8JA 2SKEA 3A4LA 4X60A 3VR4A 4DIBA 4D5GA 2OTJB 4OB8A 1ZVKA 1DRUA 4YXWA 4ZI7B 5JH7A 2FEKA 1MKYA 5DMXA 5JNVA 2VUHB 4BKRA 1I1OA 5CHYA 3KYBA 1GPDG 1UZUA 3O4FA 5AICA 5L46A 3DXFA 5FD8A 1VQLB 3X43A 2FR8A 4FMCF 1KQFA 5K2OA 1J20A 1VE5A 1VDZA 1SQFA 3I4CA 4H4CA 3RCBA 2G9QA 2B1IA 2XDAA 1REQB 1UIRA 2KPOA 2BR3A 4FIZA 4HLCA 4KZKA 5FL7A 3SQNA 2N9UA 3ENWA 3PL5A 1JB9A 4XX0A 3WG9A 1P2SA 2Q2WA 3OZVA 2HHLA 3G0HA 3P9CA 4O4HB 4RPIA 1TDJA 3MTDA 2QTRA 3C7KA 1E94E 3D4NA 5LBTA 5BXYA 4WKCA 3PNQA 1NF3A 3BE4A 2BBWA 4CEHB 3DR3A 5F9MA 5EFZA 3TD6A 4MUKA 5HF6A 1EUDB 3CCEB 1I0LA 5AKIA 3SSOA 3DHNA 1FW6A 1S2NA 3CGWA 1SCBA 3C3CA 4NABA 5DDIP 2ZSJA 4KCGA 1AS2A 1HQKA 4BPRA 1W85B 4ZDJA 2XF2A 5A4FS 2C59A 1P7ZA 2XUZA 4IDGA 4WZEA 1PEKE 4ZEWA 4C1BA 3AR6A 3OWHA 4PX2A 3E2PA 2OP1A 5IULC 1I7DA 3UAZA 4CQNA 3ZCTA 2BKAA 1Q7TA 4LE2A 1ZRNA 2AW3A 3MWLA 1G38A 4MLDA 2PUAA 4INJA 2O7RA 1J00A 3HJUA 1ZMRA 4LI3X 5EWMB 2PR7A 3CJRA 4N6OA 5CT4A 4HS9A 3HBJA 3ICWA 3QMMA 5IEBA 5K6AC 4FE4A 3DZCA 4IMJB 1V7CA 2PFSA 3U7EB 1U7XA 1YR7A 2PYZA 4IX1A 3E18A 2ID4A 3MJFA 4QXQA 3GCGA 3NBQA 1I2BA 4DV5B 2F3SA 4ASUA 1FNSA 3OFND 3THWB 3CRVA 2PSSA 1SM4A 3R09A 2QPAA 1P5HA 1O94D 3OJXA 1K86A 2GZMA 1CKEA 3IODA 4MAFA 4GAEA 3V2GA 5JI3E 1W47A 1EFRD 5B3AA 3GBPA 1XCPA 5FBHA 1SZJG 3QF4B 4JL5A 2YC4C 1TTPB 1M6HA 4QOSA 4CI9A 3EFOA 1HTTA 1G8FA 5L3ZA 5AHXA 4L3OA 2CUZA 2XYRA 3GYGA 3OQ1A 4IJWA 4B6SA 3PKZA 1C7RA 1D6NA 1UD3A 1HDRA 3E4DA 3H1EA 5PNTA 1WPXA 3FCOA 2JFBA 1NKVA 3IBGA 2WTNA 3UUGA 6GPBA 1OILA 5JBQA 3C6YA 4IDFA 4XWGA 3RS5A 3SU8A 4GH5A 3SSMA 3OZ7A 2ZR8A 4U7TB 2ZFUA 2N47A 3IDAA 1ORDA 4YAWA 1TAHA 2QRHA 3MN1A 2F1JA 1MAVA 1R5OA 1WNFA 2JFXA 3OE7D 3R3VA 5CVEA 2O23A 5F23A 3QJGA 3PQ4A 4Y67A 2A4KA 4YDRA 4JI5B 4XYBA 4Q4LA 4ZAVA 1DC6A 2CD7A 3PIRA 3FJ1A 2WWTA 4OLAA 1CE8A 2ZJ7A 1XWIA 5FBZA 1JDBC 4Q4HA 3ASRA 2JGLA 4X1YB 5I8PA 2ZYHA 3GZJA 2XCRB 1HL3A 3PXUA 3CX7A 3CVUA 2XDQA 3SJ7A 3JD2A 3U7GA 4IUBS 2FN9A 3INNA 4TUYF 1TW3A 5DGHA 5CIWA 3H9CA 4LA4A 3WOVA 2RARA 2DM6A 3QV1A 4M38A 4TYYA 1KYZA 4L08A 3PHCA 3ONYA 3ANSA 2VK2A 4R9UC 2VUUA 1TJ5A 3VZQA 3JWHA 3L7BA 4UEQA 3O9ZA 4EH1A 2QMOA 3RSLA 3PJDA 4NDZA 4NIMA 4E15A 3OWOA 4QV2A 5HOEA 3ONUA 2VAMA 3ORYA 4HB3A 1KXZA 2X7JA 3U3ZA 3D7NA 4C22A 4ZI7A 2DOKA 4WDRA 3KS9A 4KX3A 2YFKA 3ZCSA 4D81A 2NYAA 1YR3A 3RSFA 4UTVA 3VBCA 3WHLA 5IF3A 1NSFA 4K46A 4K0KB 2Y1LA 3H5RA 3RRMA 4TOIA 4BZXA 4ZVQA 1Y3CE 4LOIA 2ERCA 4WESA 1YHZA 2M1XA 3L6BA 2XB8A 2V7TA 5IAAA 1FB5A 1NN3A 3PRHA 1OHHD 4RMJA 3RARA 1AIPA 4I1IA 4A5OA 3ER9A 2A92A 3BM5A 1G4AE 2WMYA 2EKQA 3E9RA 4LHVA 4Z4GA 3R5SA 1I36A 3T9FA 4YHBA 4O4HA 2GD0A 4WNAB 3I6QA 3FD8A 2XT9A 5JAIA 3KUKA 3R6DA 3LY8A 1HI9A 4OQPA 1ZKDA 2P3MA 1P60A 2PL3A 2QTVB 4CQJA 2VRBA 4G36A 3D4IA 1XZLA 3A6PC 3KK0A 1Z63A 2WJIA 1XNHA 3QVTA 4GPAA 3BMNB 4RHXA 3N76A 5C34B 3ILYA 3SFZA 1J0BA 4E07A 1EP1B 4KEAA 4Z4ZA 5EHGA 2OM6A 2C77A 3OZTA 4DEXA 1T3GA 4OHXA 4RD3A 4U2BA 3KT0A 3OIUA 4KTTE 1UBHS 4PEVA 3L0IB 3WMGA 1W2WB 2AC7A 3HN2A 3PNVA 1E18A 2CFRA 5FOQA 3LLMA 1JKJB 2GCGA 4H1TA 1RI4A 3E5MA 2NZ8A 4BB6A 3DPSA 1WOOA 1A5ZA 4Q3DA 3HABA 1C29B 3CPHA 3Q9SA 4IIEA 2I6TA 4ES6A 1EMDA 1L1EA 3D9QX 4LJ4A 2BBTA 1TQ4A 3FCAA 4OEHA 4RFSB 4R2XA 5EHQA 3ZV6A 4ME6A 1TMKA 3OZUA 2OB1A 3TJZA 1PFQA 3QENA 2HRZA 4L72A 3TMKA 2V6FA 2PS1A 3N2GA 4ZVVA 1VLZA 4GL2A 3E9EA 4DYHA 2V3WA 3WIBA 4WDQA 4WKGA 2COEA 4YRLA 1IN5A 4KODA 2W48A 2GN2A 4B5KA 2R79A 3CVVA 4RDLA 3PNBA 4WXPA 4B80A 1XRQA 1XQ1A 1V8OA 3DDWA 5FNVA 4OGWA 3VHLB 1RPTA 3L7YA 4UDXX 3ONVA 3WWDA 1DVRA 2W0SA 2I91A 1NSTA 4JNKA 2BFWA 4ARIA 1H0RA 2GT1A 3F7OA 1GSHA 4PR0A 3ZQKA 2C7VA 3FLBA 4ALKA 2XQJA 4JYCA 4P1ZA 2VP2A 2VHQA 5IMBA 3ZU2A 4EMBA 1OV4A 3Q8MA 2QUJA 2WUEA 3GCDA 3PTLA 4QJ4A 4S24A 1OT5A 1P75A 1HQCA 3EGOA 4R40A 1JR2A 4C7KA 4L73A 3GBVA 3R3UA 1XEXB 1NNLA 3WGGA 3EH1A 1J21A 5FI5A 5CRIA 3IB3A 1M8GA 4X1YA 4F4UA 1UXGA 2ETVA 5LQRA 1KY3A 1RI1A 2NSDA 3QF7A 3IVCA 3NYWA 1MAAA 3LPAA 2Z2JA 5IN4A 4X7PA 1DIAA 2D13A