3CRZA

Ferredoxin-nadp reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
257
structure length
257
Chain Sequence
SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP+ reductase
total genus 79
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3crzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3crzA02
1K8AD 2PMDA 2OTLB 4LBYA 3CCSB 3QSYA 2EFGA 2XEXA 4PC1A 3J81k 3CXCB 1D2EA 2BSAA 3MMPA 4B4DA 3E20A 1OGJA 2VNKA 4TN1A 2NPFA 3WBJA 1KJZA 2GQFA 3AVXA 3WNDA 1H42A 3WXMA 3QFTA 4RD2A 3AGQA 3LO8A 1CQXA 2BM1A 1KK3A 3OZWA 2ZITA 3AGPA 5DSZA 2QTLA 2D74A 2OK7A 4NBSA 1BJKA 1YI2B 1GR1A 3CPWB 1G7CA 1A8PA 4Y9UA 4PC7A 4QHYA 3U2QA 1VQMB 2DEUA 1Q7YD 3CCQB 1EFUA 4TMZA 2J7KA 3B8HA 4AC9A 5FA6A 4ACBA 3P26A 1VQ6B 1VQ7B 3ZZTA 4FN5A 3JQPA 1QGZA 1YJWB 4NCNA 1YITB 3W5HA 4F7DA 3VO1A 4UAJA 3AVUA 2YWFA 1W35A 2C78A 2QA4B 5H59A 1KK1A 2DERA 1KC8D 1IJEA 1HA3A 3CCMB 3WNBA 4J0QA 1AIPA 1G7RA 3ES9A 1JB9A 3JQQA 3I56B 2BGJA 4HE5A 3W2FA 2OTJB 2YWGA 2HCJB 1JNYA 1Q82D 1WDTA 2GPJA 3MCAA 3WYAA 3PENA 3AVTA 4N3GA 5THXA 1GAWA 3W2HA 2DETA 1N0UA 4LC0A 3ZZUA 2CRVA 3JQRA 2QN6A 1S0UA 1TUIA 4RJLA 1XE1A 1QG0A 3SJZA 1OB5A 4B43A 4M4SA 1QFZA 2EIXA 3AVWA 4RCYA 5GV7A 1S72B 3U6KA 1KQSB 1KD1D 4G1VA 3AVYA 1E62A 1ZM2A 3W5UA 4P6VF 4M0LA 1J9ZA 3OZVA 3B78A 1NJID 1YJNB 2BMWA 2C77A 3QE2A 1W34A 1YJ9B 4AF6A 1VQ4B 3OJXA 2BPOA 3CRZA 1B23P 4U9UA 1FNBA 3CW2A 1F20A 3V76A 5KSWB 3W2EA 4TMTA 1QH0A 3VMFA 1VQLB 1VQ8B 2VNJA 2YWHA 3W5VA 2PIAA 4RD4A 1EP1B 3WY9A 4C0SA 1JA1A 4YAFA 2XNJA 1DDGA 3P27A 1GVHA 3CC2B 2RC6A 1SM4A 1GAQA 1BX0A 4ACAA 3OJWA 5TR9A 4PGOA 1DG1G 3ZBTA 1KK2A 3OZUA 3E1YE 4G5GA 1W87A 4RD6A 1ZUNB 1Q81D 3CCEB 3CCUB 3QFCA 1G7SA 1VQKB 1IB0A 1QFYA 4ZGNB 1ZM3A 1EP3B 1VQPB 1N0VC 3LVBA 2QMUA 3CCJB 2OK8A 4MYTA 1FDRA 1FRQA 3FJOA 3LYUA 1UMKA 1U2RA 1G7TA 1KK0A 3CCVB 3ZBUA 1Q86D 5TY0A 2QEXB 1JJ2B 4YHBA 2R6HA 4B3XA 4IW3B 1I7PA 1TVCA 4YAOA 1TTTA 1NDHA 2BF4A 5JBQA 1VQOB 4QFMA 4DQKA 1DDIA 1EXMA 1FNCA 3W2IA 2VNIA 3ZC3A 4RD0A 1M90D 1QVFB 4RD1A 2BVNA 4M2LA 1EFCA 5AN9A 1R5BA 5H5JA 1SKQA 4B44A 1W2BB 1QX4A 4LBVA 3WNCA 4P3YA 3CD6B 4R71A 4YAUA 4TMVA 1QVGB 2B5OA 2DCUA 2VYQA 4PC2A 1R5NA 4ZCLA 1EWYA 1GJRA 4RD3A 4BPRA 2HDNB 3QFRA 3LRXA 2BN4A 3CB4A 3CMAB 1YIJB 2BM0A 2VNHA 2B7CA 1N8RD 1E63A 2DY1A 3VO2A 1QGAA 4YAWA 1D8TA 4EH1A 1ZM9A 3I1FA 2HMAA 3G4SB 4LBZA 3W2GA 4ZV4A 4TMXA 3VNVA 4WQMA 2PLFA 4M53A 1BX1A 4Y9RA 4DQLA 1VQ9B 2AHOA 1KRHA 1D1NA 1OGIA 2RC5A 4TMWA 3B82A 3G71B 3VNUA 1FRNA 3A1FA 1YHQB 3CCLB 5GV8A 1KTVA 1EFTA 1OB2A 2QTZA 5TV2A 3QFSA 4PC3A 1FNDA 1EP2B 1GO2A 3CC7B 3CMEB 4B47A 3ZZ0A 4ZCIA 2B7BA 3G6EB 1ZM4A 2X3UA 4ZCMA 1M1KD 1XB2A 4N3NA 1JA0A 1VQNB 3U6BA 1K73D 4RCZA 1QUEA 4FWTA 4ZGQB 4PC6A 1TLLA 4H9GA 1CNFA 3AVVA 1QFJA 2FX3A 2QDXA 1ELOA 1FNMA 4K1XA 3CCRB 2BV3A 2XNCA 2YWEA 4MYUA 3I55B 4FK8A 4Q7JB 4C43A 4LBWA 2VZLA 5EMNA 1H85A 1K9MD 1F60A 1DARA 3FPKA 3MHPA 4Y7CA 4AF7A 1AMOA 1CNEA 1QGYA 4HE6A 1E64A 4M1KA 4B48A 3WBKA 3OW2B 1BQEA 1R5OA 2CNDA 1QUFA 1IJFA 2BGIA 1VQ5B 1B2RA 5HXBA 3CC4B 2E1RA 4G1BA 4YALA
chains in the Genus database with same CATH superfamily
2BI4A 1G0OA 1KI1A 4URHA 3BMNB 4CL3A 3QYJA 3VR5H 1YCGA 1KI9A 1U2ZA 2D8AA 3CCSB 2DPHA 2GEFA 2XWBF 4OI4A 3IT0A 1XRMA 4QBTA 4WY8A 4ZVPA 4CT5A 3I01M 2XEXA 4PC1A 4X07A 3DLBA 2QNRA 3T06B 3J81k 4G3XA 1HYGA 1AXEA 1W5FA 1OXTA 2JLSA 5B2ZA 4ETIA 5CB0A 1P77A 3K1JA 4Q4HB 2C7GA 1FVHA 1Y1TA 1YUBA 1U7WA 5INTA 1APBA 4MKRA 4WNAB 4R9RA 5T57A 1WU8A 2CLMB 3LQ4A 3FNGA 4O2LA 3L0SA 2VNKA 3C3PA 4UEKA 2GM5A 4YJ2B 5FWXA 4MKIA 5KWEA 2KS6A 1AO0A 1WU7A 4WA7A 3QG1A 3PA2A 4TMFA 5HM6A 5JSQA 1IBLB 4Z86A 1SQSA 4G86A 1R27A 3KQTA 2YC4C 2TMDA 1DWPA 3AVXA 2IIBA 3WNDA 2I6SA 4L9RA 2FLKA 3RV3A 3W7VA 5I3CA 4AY2A 1NUUA 4RKWA 1YZTA 4M0DA 2A94A 5JE8A 2IEGA 3FYUA 5JH7B 2ZYHA 3FUWA 3M5WA 3OE4A 1IZ8A 5KPDA 1FU4A 2IUYA 3VOAA 4TTSA 4C5AA 4NJEA 4ZVQA 4E0BA 5DSZA 2GN6A 4IQGA 3WTBA 1JV2B 1RRPA 4F4IA 4BP8A 4JEIA 1G1AA 3P9NA 5AO9A 3RWBA 2XRYA 3KHTA 1I36A 2M6RA 1PR3A 3T4EA 5CFPA 1E2MA 1BJTA 3UAOA 1PKXA 5FOTA 1FMJA 5A06A 3I32A 4FQ5A 4QFBA 2DPLA 1ZGJA 4IIJB 2I4MA 5TJHA 1NQOA 2EFCB 4ZT4A 3ZNNA 4DLAA 3W2TA 1L4GA 3JYPA 5B6PA 3G5TA 3H83A 2ZI4A 2RBGA 4E09A 5DHQA 4RZQA 4BB0A 2AMJA 3CZ5A 3CURA 2C5GA 1RCFA 4UVIA 3DNPA 1D07A 3B85A 1EFUA 1IUOA 4TKUA 1NRIA 4PQEA 3FWZA 1EXVA 2I0FA 3VPFA 4X7CA 2L2QA 2YZGA 4OEHA 1WUJS 4WOBA 1UBRS 4BAGA 3H2BA 1R2QA 2Q1UA 5IF9A 4Z4GA 3Q8KA 3KQKA 3LBYA 1GXSB 4HRYA 3ZCRA 1F2UA 3QKTA 5L7WA 4UBMA 1DRUA 4GSYA 1YRWA 3SQXA 2OL4A 4LYYA 4BTLA 2VH2A 1T2FA 2FR8A 1JG6A 1AC5A 1M67A 2WTNA 3HUUA 3SS7X 1NVDA 2R4UA 3WADA 1QBKC 3CKYA 3I92A 3IAEA 4H6WA 2D06A 4DCSA 5JQGB 1SBIA 1C30B 4BPBA 4AKGA 3WQBA 2VP9A 3K2QA 3QVXA 1XEWX 3K96A 4BQIA 1O87A 2EKPA 2YWFA 3R8CA 3V1YA 2YCBA 1NSFA 3EE6A 5H59A 1KK1A 4B4OA 1SVNA 3JCZA 1ODKA 2L42A 4D3FA 4LJAA 4OL0A 1UQRA 1IJEA 2Q5HA 3C4JA 4C0AC 1S8AA 1GCGA 1Z7GA 2GTHA 4V0KA 3RK1A 2H48A 1JQJC 2P27A 2W2OA 2WMYA 5DLPA 2F3PA 2R8YA 1LJ8A 3A3NA 3RSHA 1N2CB 3SHTA 3VPHA 3JQQA 4TRJA 3SU8A 4QICA 13PKA 1QGED 1KI2A 3N76A 1P5RA 2CXUA 1XVIA 4OLAA 4F3RA 5EQFA 5LYJA 4YWHA 3FR8A 2OEPA 2YWGA 2IPOA 3GCDA 4RAQA 1ES9A 3H6GA 3KYIB 3RR2A 5FV4A 1Q82D 1ONSA 1Z4IA 5DTQA 2QI9F 4FYPA 1ZK4A 3K3PA 1PHPA 2WU3A 2GYUA 1WXXA 2C9MA 2FN7A 4WOCA 4YBZA 3VH1A 8OHMA 3I5MA 3K9FC 4X05A 1JQKA 1Z8DA 1P3Y1 2Z8YA 4H18A 3PENA 2IYSA 2ZROA 3BSFA 2IK8A 5D85A 3W9BA 4PBSA 1Q9SA 3VC7A 5K7SA 2DETA 3LXRA 2O59A 1YBVA 1XLTA 3E1KA 4GI7A 1H5QA 1A9TA 1HYEA 1ORDA 4LCBA 3CUKA 1RHQA 3ABSB 5A89A 2Q8NA 1YVUA 1JLSA 3LCRA 3M4XA 3TOXA 2QM8A 3H6KA 2X86A 1XE1A 3RRJA 3IJ5A 3TRDA 1V0FA 2R7AA 3O8QB 2I7XA 1MZVA 2PBFA 3NH6A 3ZDYB 3DTTA 5FL7D 4F12A 4QJ5A 3BD6A 3C8ZA 3OD5A 3RFXA 3VV2A 4AZSA 4TZTA 4FUTA 5LZ9A 3NTOA 4AY3A 1A8SA 1EM8A 1U7XA 3BWVA 3FRHA 3HK2A 4CF7A 5A04A 3KOYA 4LRXA 4OGGA 1S72B 1LK0A 3E2MA 2R6DA 4KQXA 4LN1A 3HP1A 1L4NA 1UPXA 3U4QB 2OM6A 2PMCA 3AUJB 1O08A 1E62A 3OIYA 4L1KA 1YSCA 4R69A 3ZHBA 3ZR4B 2Y1GA 3OZVA 3A4MA 4UUPA 1CQJB 2NUBA 1JN0A 1I6LA 3HB5X 2PUCA 1DUSA 1DU4A 1MKYA 1SWVA 1R4AA 3Q41A 3ROEA 1PL7A 1WDLA 3LC0A 4DB4A 2XGOA 2R7NA 5F33A 3Q3CA 1PNTA 3PDIB 1GGHA 2JK0A 4LSWA 3HUEA 4PICA 3RG8A 1WPRA 3T94A 1C8KA 1DI0A 2VLBA 2P79A 2VSXA 4GWLA 4HBZA 3TW0A 2V45A 5DNVA 2XYRA 2ICAA 3HR4A 3LOQA 2XJ4A 5A03A 1LDYA 5JVDF 3FZNA 2C7PA 4AS1A 5K3BA 5G4KB 1RXSA 4Z99A 4M3NA 1FXWF 4BVJA 1WVGA 3GRKA 4US2R 1VJGA 4RSHA 3SM9A 4DAOA 3PXAA 1YAHA 3IH5A 1XRLA 4BNXA 2FPUA 4K81B 4HHEA 3UCEA 5A2QA 3ZHVA 5E8RA 4QT0A 2ZBDA 4S1TA 2RB4A 3KYCB 1D0SA 4N01A 1FFHA 3ICEA 4WKPA 5BNIA 1SEPA 2NSJA 3H99A 3OETA 4GQIA 4K2AA 4Y1RA 3IUNA 1HDXA 4NMXB 3RYTC 4W8GA 1AZTA 1ZCFA 3RAGA 4AJIA 5E6SB 1ZQ9A 5K09A 1G8PA 2H5IA 1XTZA 4I6GA 4L9AA 5B36A 5DULA 4DA6A 1CE8B 1ESMA 1FS6A 1YTUA 1JAZA 1N3LA 2PUAA 1QZZA 3V8RA 3S8YA 4Q16A 1L5GB 4B2PA 3DO8A 4QU8A 1GRVA 3TMKA 1YR7A 3CXRA 3G7NA 4M1YA 1NVFA 4JC5A 1T0PA 3IAS1 2Z0MA 3OIDA 3BRWA 4F6RA 4ACAA 2PX2A 3PFBA 3AP2A 2NUPA 1SUEA 1RWMA 2ECQA 5ARCA 1CYDA 3WGGA 3IB6A 3DUFA 4C0QC 1BYUA 2B37A 2VEDA 3FWNA 4FYKA 4DRZA 4E6PA 4FIZA 1UEJA 3E1YE 2H4JA 4BGDA 1LQTA 2IWHA 1YR2A 3QF7A 1TCBA 2IIPA 1RTKA 2VF8A 3BMCB 5IJ9A 5KTSA 4ARZB 3CCEB 3K0CA 2I87A 3IUJA 1HZJA 3PD7A 4KE9A 1CRLA 1DT3A 1YRYE 3HO1A 1EA7A 1PT9A 3U3MA 5DCYA 3DOEA 2ZL5A 2HA2A 2QTCA 4YONB 2HBRA 4EVSA 1IQPA 4Y2UA 2IOFA 1G21B 4Q6BA 3T5PA 1R10A 2SNIE 2AZXA 4FN4A 3UT5B 3LA6A 1H2ZA 3C0KA 4CR7A 1NI4B 4QXPA 3LVBA 3PXBA 1MF7A 4FS3A 2DQKA 4CEHA 4MYTA 4ZAFA 1Z6TA 2ZUVA 6REQA 1YOVB 3HBAA 3HJTA 1XAGA 3EVNA 3N3AC 2O7SA 4HL6A 4UUBA 4X60A 3MT9A 5KHOC 1CFJA 4E21A 2CB9A 4RIFA 5H02A 4ZZ2A 3O3OB 4D9FA 5I9BA 4REMA 2GJAA 2NADA 3A31A 4XCQA 5GONA 4B4UA 4Z54A 2O4CA 2AG1A 5KTOA 1E5QA 3RVBA 2AF4C 4D0SA 4DLVA 5EHXA 2D7DA 4ID3A 1X1QA 4OOVA 1F1JA 1TDJA 4HDKA 1PRYA 2DCMA 2FH5B 4HDKB 3UB3A 3R2JA 4XD7D 2Q50A 3TTYA 2WT9A 1F2UB 2QL7A 3N87A 3X1JA 3PEVA 1R8QA 2R5NA 3PHBE 3ZKWA 3O84A 3WP0A 3IQXA 1J0BA 1YMVA 3WFZA 3ZIUA 4IS3A 2IHNA 2WBLC 1XJQA 1ZG3A 1UMBB 4GYKA 3E05A 2PUVA 2GA8A 2N1BA 2OGSA 1M8FA 3H2YA 4ZVTA 1JFFB 4WA8A 2DR0A 4F6LA 4MRPA 2NAPA 4TT3A 2G88A 4R2JA 1C3LA 1XK7A 4EPXA 2GMWA 4QRDA 3O8OA 1G5PA 2AK3A 3SKVA 4K0KB 4M2LA 3IT2A 1YONA 1ZOLA 1WMAA 3DE0X 1ZIPA 1ZC3A 1QIEA 2RAFA 1B42A 2X6RA 3WO1A 4GWKA 2JKVA 4BV2A 2QRKA 2EEPA 3DBLA 4QEKA 1KY5A 1LLCA 1TYDE 2FN3A 3A6GA 3K5IA 5G0SA 3WMRA 3WL4A 2PUJA 2I2XB 2YQ4A 3BTOA 1T5IA 3WMWA 3P2KA 4PZZA 5AXBA 3FYCA 1BAPA 3CTPA 4E7OA 1X7XA 5J58A 3EGWA 2JZCA 1IXSB 1F12A 1NJ8A 2PJRA 2ZXHA 2ZSJA 1NP7A 2REQA 4KMSA 1PJ3A 2BH9A 2QX7A 2ZIXA 4I50A 5C31A 4ZI7B 4Y2RA 2R5FA 4DKJA 1W4AA 2A5DA 2Y68A 2JFBA 4JBIA 4CWAA 2X3YA 5C5DA 4BPRA 4HAOA 1LA2A 1MXFA 3PUXA 5DXJA 4YJDA 4BJ1A 2DFTA 3KYBA 1ZCBA 2QQ5A 4UU0A 1VPTA 5EZYA 2EC5A 4ND8A 3WIEA 1JYSA 1EJ0A 1RJDA 4LQCA 2CD7A 3GMTA 3OLCX 2JLWA 5IYRA 5EA2A 3HFRA 4ZV9A 3KKOA 2CL6X 4G4JA 5CX1A 3S8EA 4OUKX 1EBBA 1T2AA 2QORA 4FKBA 4MMYB 1AKMA 4RA6A 2FPGB 1T24A 4P22A 1UBUS 4P9NA 1CUAA 3AT1A 5E95A 1P2UA 3G2HA 3H4VA 1E2DA 2B36A 4DM4A 1T3HA 4BNIA 1ORTA 4TTQA 3TDNA 4V1CA 3D4NA 2FZ5A 2GYYA 2OVBA 4CLHA 4E07A 4BVEA 3CNLA 4LJKA 5JXIA 4H17A 3NCHA 1YS1X 1CY0A 1HLDA 2OCGA 5CFRA 5ED4A 1USWA 2HSDA 1PT7A 1DAMA 2V4ZA 5CT5A 1V5FA 1EBUA 3NG1A 2H51A 3DZCA 3EGOA 1DRJA 4JLWA 2PJDA 3DAPA 4HEQA 2GREA 3N59A 1F0PA 2IXFA 4N39A 4JJZA 4IIFA 2V7TA 3DZ8A 4X63A 3ZD8A 4COOA 2O3SA 2CK3D 3KKZA 3OCCA 4DKXA 2P3MA 3NHWA 4OH7A 2LBPA 1D2MA 3VR3A 3LJKA 1PUJA 3AEUB 1GNQA 4TGLA 1RXIA 3CUUA 1EFDN 2ZBVA 3E7DA 4JX8A 1P2SA 3WAGA 5K51A 2NAFA 3RANA 4URXR 1KMNA 2ZRPA 3LDHA 2AV6A 3RB8A 2EKQA 1U7ZA 4HNSA 1T29A 5AVUA 3BB4A 2QLLA 4QYTA 4B3CA 5LQCA 1WCIB 4ZT2A 4BTVA 3AWDA 1Q21A 3M6XA 2IHUA 2XCUA 4KU4A 3OE7A 3T1NA 4F93B 4BX8A 4FMCF 3Q39A 1B4DA 1E1QA 1A0OA 1UIRA 4G9BA 3ZDEA 3QX3A 2IYFA 1NW4A 3EXG2 2F64A 2RGRA 3NHYA 1T1SA 3BL6A 4EJSB 3D5TA 2PG3A 4X5OA 3NTLA 5AOAA 5F3DA 2OG1A 2O8NA 5CM2Z 5KYYA 1P5HA 2OKCA 4BEJA 2BEUA 3CNQS 5DASA 1D7AA 1KZ9A 3G13A 3G7SA 4HQLA 3ZDRA 4CN8A 5GJVC 1K0UA 3N2NA 3OSUA 4NLLA 3CKMA 3H11A 3EUEA 2YFKA 2QRLA 2JFQA 1OBHA 3O03A 3OUZA 1H2WA 4CLRB 2BYTA 1ESNA 1E2GA 1O03A 4LGCA 3SF0A 1H1LB 3KLMX 2YHIA 1ACJA 4MP6A 2W5UA 2BFDA 3Q7EA 4LYHA 1N06A 2DG2A 3FHCB 3CCRB 1UFKA 1YQWA 2RHBA 3CINA 3CZPA 3F7NA 1CR0A 4EG4A 3UCFA 3R5FA 4KSCA 3A3GA 5FOSA 3U48A 4ZIRB 2V5UA 2VBSA 4MQ6A 3OU7A 5JEDA 2EJVA 4MV6A 5DP1A 2P6MA 2G9QA 3N8DA 3ER8A 2PLRA 3QK7A 2V8BA 2AA3A 2ZRNA 1IQUA 4D9IA 1KORA 1BXRA 3RBAA 1ZD2P 4G2TA 3SI7A 1Q1QA 5D3KA 5DNDA 3OQIA 3QTLA 2ARKA 4MX8A 4C4XA 4EW3A 2XSZA 1XSEA 3AW9A 1XX6A 4J6EA 1UL1X 1V39A 2E3JA 2UYQA 3EF1A 4L6AA 2AUMA 1H6BA 1FDSA 3A2MA 2R62A 4PYIA 4E2ZA 2AL7A 3GVPA 1E1DA 1SZJG 1VLQA 3FI9A 4GBMA 4LDZA 4JEUA 2AW3A 3M34A 3UF0A 5HVNA 5F73A 3ZY6A 3OW2B 2A9JA 2GJ4A 2G3YA 1RHRA 4B35A 4IUYA 1GTVA 4WEOA 2AE1A 5EHZA 5DVZA 2DUNA 1I2CA 2JGEA 5A7FA 1T1GA 4O63O 1OC4A 2X0RA 3WKAA 1ZVVA 4YWJA 2VATA 1SD5A 1IBSA 1TM4E 3E9EA 3BT7A 3NMUF 3RC8A 4E4YA 1V3UA 1O6ZA 1W94A 5AIBA 3OFNA 2TMKA 3TAHA 1NV9A 1IVNA 3OP4A 4M46A 3U62A 5JFGA 1QQAA 2OTLB 3I64A 4O2AB 1NF3A 5B4UA 4MR7B 2HMYB 1Y37A 1GDTA 2J08A 1SKYE 1CVIA 3C7KA 1K8YB 4X3OA 3IBYA 1E2EA 1VDZA 2DVMA 2JFPA 4XPIB 5JARA 2GZ3A 4LAFA 3SXUB 4MO2A 5JI2E 2G7MC 2AFIA 4JR1A 4G84A 5GOTA 1DPFA 2XYQA 5FNVA 4JYBA 1E9DA 1YFLA 3EUFA 3HZZA 4QODA 3AM4A 4M9CA 1ENPA 2P35A 2YBEA 1KHTA 1X1TA 2VYFA 3KQHA 3ZWBA 1W5TA 2IYLD 3PF8A 3LLSA 1QIJA 3DTNA 3AR9A 4O4LA 2GEKA 5TB5A 3TTTA 1CEQA 1A7AA 4UUQA 1DRWA 2IYTA 2IF2A 3KB6A 3JVDA 1FFDA 4UUAA 2FMUA 3GJYA 2WD8A 3KT3A 3P0IA 5LLSA 5CEEA 5KJ6A 2OCLA 5FD8A 3NDBB 1SUCA 4PW0A 2J09A 5IT4A 5ICEA 4JT4A 5DGHA 5ADHA 1A9YA 3SKXA 4DJ5X 4FCVA 1LU9A 3R0QA 9LDTA 1T15A 1VSQA 4JLOA 4EBFA 1Q50A 2I66A 4TM7A 4JGBA 2VZ0A 3OJ0A 2WY2D 1NXVA 3U16A 2HY7A 3QOFA 1NUTA 1A9RA 3ADOA 4KR7A 2AG5A 2FQXA 3LLVA 1MG5A 1YI2B 1MOSA 3TNYA 5AVRA 3TJZA 3NFRA 3LUPA 1T6XA 4GBJA 1AKTA 4JJIA 3NBUA 1CIPA 3RDPA 3VX4A 2CYAA 4N0MA 2R0QC 3H1BA 3CWZA 4ZYTA 5CH8A 1KDZA 1FLDA 2X85A 1R0SA 1SELA 2P78A 2XI4A 4IEIA 1XC7A 3TO5A 4C88A 5HYVA 2DEUA 1YK1A 4G67A 3IPXA 2WLSA 4X7RA 4V0ME 2A57A 4KAXA 1PIWA 4GM1A 1Y6QA 2JI7A 5JS2A 4TMZA 2PZBA 4QRHA 3TNFA 2IY8A 4MS1A 1UH5A 3WHKA 3RGWS 1MR3F 5KNBH 2RFLA 5JVDB 5TE9A 1I33A 3C15C 1RE0A 2WB2A 1PZMA 3OT4A 1J09A 3GGOA 2R7LA 3D4LA 1R4NA 4YRGA 3JQPA 4N3AA 2WKRA 3F7TA 1NBAA 2B82A 4DIDA 4CR8A 3LVFO 2NXNA 4ENRA 1UFOA 2CDNA 2D7CA 3GVLA 1V5WA 3FRJA 2I6XA 2HRBA 1ZSYA 2HR1A 1A27A 5DXAA 3PKJA 5CCXA 4E5DA 4QPZA 1YR8A 1P0PA 4W9MC 5EXXA 2VDPB 3FB4A 1TO1E 3LGAA 4TSRA 2CJFA 1BA2A 3QA9A 3HR7A 1EE2A 1JJBA 5DPMA 5IC6A 3Q8WA 5F23A 4G6IA 3KJQA 1YA6A 1K92A 1QAMA 3IGFA 2FCRA 2J9GA 3E53A 5FOWA 1MA3A 4B84A 4KFRA 1LPPA 4ZI3A 3LKVA 1JB9A 1IQRA 3BH4A 2HA5A 1EVIA 1GRCA 1XVUA 3COJA 5AW9A 4WLFA 2X0NA 5CYPA 2QUAA 4CKYA 2SKDA 5CB4F 4FBMA 2I3BA 4IIVA 3Q0EA 4HDNA 4UBJA 1WSVA 3DDOA 2AN4A 2QYSA 2XUDA 3IUQA 1Y7TA 5AUPB 3Q8LA 2XDAA 2FVYA 2XGSA 4MUXA 1C3XA 3DOUA 3GQVA 3BFVA 1EGAA 4HVTA 3IP5A 2NACA 2FOLA 4FD2A 3C3JA 2FSIA 2C7BA 3WGZA 3EPHA 1DC7A 3U3XA 1Z2AA 1NM5A 3IE2A 2X6TA 3DAFA 4DQUA 1SCKA 4NG4A 1I3LA 1M1NA 5I4IA 1CUSA 1C0PA 2V55B 3UJCA 1J9EA 2ZB7A 4ZC1A 2OBTA 1NW7A 2WWGA 3GOQA 4XB6B 2Y9MB 4NQZA 5IHPA 4KHPB 2I91A 5KEIA 5ICCA 3W3ZB 2PS3A 1E1NA 2QWXA 1L7NA 2OA0A 1WF6A 4FOLA 4ALLA 1QIKA 1K2WA 1T5DX 5AXDA 5ALNA 5IG2A 3IEXA 3INTA 3KEWA 1QGUA 3G8CA 2AW5A 4C5CA 5KVVA 1H8HD 1YQGA 2LRHA 3Q72A 3RYFA 1JSXA 1L5QA 1PG5A 2FUNB 3AB3A 2PS9A 3LPCA 4F8JA 1K98A 4YIHA 4V0OA 2ZTHA 4WE3A 3USZA 2RARA 5IVHA 3C97A 3DL2A 4I81A 4MW4A 5JECA 3GFVA 2XQFA 2AB0A 1KVSA 4PINA 1US8A 3ZHTA 2RHGB 3KU1A 4F46A 1KY4A 3W5UA 5AM5A 5TX7A 2Z6BD 2R9VA 3JU4A 1DWQA 3BZBA 4PRZA 2FYTA 4H15A 1YJNB 1D5CA 3BL8A 2H4ZA 1EGMB 2LV8A 4EENA 4OBWA 3KJNA 4WKGA 2XVZA 3ACBA 2RBEA 5KNDD 1F0NA 1EVJA 4ERNA 5IHXA 3I9NA 3R77A 3TUZC 4ND7A 1OA1A 1MNAA 3UQZA 2SKEA 3IHKA 1KI6B 3DZBA 4LOAA 4HH0A 5CVCA 2BKXA 3Q3VA 3PI7A 5DI3A 1CV2A 3VU9A 1UJ5A 1H6CA 2F3RA 5HIJA 5A3JA 1EX9A 4BJ3A 3CVOA 4EMTA 3FTQA 5I4KA 4NCIA 2AJTA 4R54A 3NBQA 5SYMA 4CLOB 4EB6A 5I4BA 1S4QA 4HLQB 5DOZA 3MGBA 4WK6A 4LFAB 2R4QA 5DU2A 4ND1A 1RPNA 1YH3A 3ASRA 3GW8A 5L7TA 1K7YA 1WRBA 2G1UA 4QUAA 3AM3A 4NBRA 4QXQA 1M6WA 4U7GA 2JANA 2YMLA 5LP1A 1KEUA 4LY6A 4LI3X 4B82A 2X8WA 3TEFA 2YOGA 3PU6A 3DBIA 3PDHA 1YVPA 3GYGA 3EN0A 3UK7A 2AFRA 3DYIA 1OZGA 4WLEA 3ABIA 4YAFA 3RVNA 4YRTA 3GLRA 2XXJA 2O2CA 3ZWPA 5KVAA 3EQZA 4DEXA 5FBHA 4CCYB 4EK9A 3DKIA 1Z18A 4ZHQB 3A8JA 1Y1RA 1SCJA 3QEKA 5AK6A 2NV4A 2GLTA 2ZIWB 2P9ZA 3D81A 4OY3A 4RZSA 5DM0A 1T9AA 1C7QA 2Q62A 1FDIA 2ZE8A 3U80A 3VVLA 4CEJB 3GNLA 5K0JA 4AKIA 1NY5A 2RGDA 3SF8B 4PHTA 3LGXA 2CMKA 1NQTA 3UAWA 1JVBA 1KJYA 3FTNA 3TI7A 3OQMA 1YTLA 1IQ0A 3GI1A 4GVLA 4D9HA 2IH4A 5AKZA 3MWYW 4MV1A 4PXAA 2WK1A 2BFEB 2J59A 4C4AA 4ZXPA 3T3OA 1Z7BA 4GMFA 2Q7DA 2F90A 3DDHA 5FPKA 1PLJA 4KBYA 2LIPA 2GJRA 2HC9A 4O8ZA 2QYOA 3W6OA 2DLCX 3RO7A 1TADA 1YE8A 4Q3CA 5EWJB 3D6UA 1KWKA 3SZUA 5LD2B 3SC4A 4I4IA 3RABA 2OWDA 5SYNA 2XGGA 3VGJA 3AQ4A 1EE1A 1UP4A 3BM5A 2FRDC 2XWPA 2C99A 5ARDA 3RRZA 3VYRB 3MRTA 1GT91 4C05A 1G8HA 4ZAGA 1NB9A 1I30A 2RE8A 4NARA 4BMVA 4GVPA 5TMEA 1ZGZA 1YJBA 2Y76A 3R3WA 4C4ZA 5J2TA 4Z49A 4EG0A 2QE7A 1N6RA 3A05A 2A1IA 3HR8A 1SG6A 2N46A 2F4NA 3TJMA 3E9YA 2BH2A 1QO9A 4OHOA 2PZ8A 5A8AA 1BGXT 4MLZA 2IHJA 4NZZA 2H4YA 2JLZA 1P9LA 3IAM1 4BZXA 5DF1A 2ZJYA 3FFXA 3CCVB 2GS9A 1GCUA 2ZUSA 3DE4X 1JJ2B 4WJZA 1V1RA 4ZTZB 1EWQA 2QD5A 3O31A 2PKQP 4Q4AB 2C0QA 3MQ4A 4KJXA 1NDHA 5C34B 2WAAA 3HC7A 1P8JA 3OPQA 2A7QA 4MJ3A 2YW2A 3H1PA 2NYRA 2DH6A 4CLEA 1MC1A 5EN4A 1EDEA 2R00A 4L50A 2CNOA 4YP6A 2QTVB 1JALA 1RU3A 1SQ5A 3PJEA 4HBGA 4Y0NA 4KR2A 4W5NA 3ZHSA 5AVKA 1KAQA 3ZC3A 1KA9H 4DLBA 4RD0A 1WF3A 2FEOA 2RHMA 4BQFA 5FUYA 5BN1A 2IS6A 3BRWD 2HHHB 4PTYA 1YQUA 3FETA 3ML1A 5CNJA 3KLNA 4AURA 2QT0A 1BE0A 3D0OA 3GGJA 4KZKA 6AT1A 1L5VA 3SHFA 3V7UA 3GLFB 4WTOA 2BBSA 1FQJA 4HSEA 4PLCA 1PS8A 3ASZA 3HSKA 4H7PA 5HEKA 2XCLA 2B2NA 2ZJ1A 2AI3A 1LB1B 5IZCC 2OHFA 5FX2A 5CEJA 3EH2A 1NIJA 2CNKA 4JQZA 1TTPB 4EYEA 1AY0A 1J24A 4PZDA 1Z0UA 1Z07A 4NEHB 1P2VA 5M3BA 3W5SA 3GLGB 1GSIA 4GRDA 1HMPA 1JHDA 5CK5A 4YROA 3PJGA 3WNCA 3L9XA 3RVSA 2CLOB 4DM3A 1G8MA 2NOAA 3KRTA 3O0TA 3E0XA 1WP4A 4IY1A 3SZLA 5IM4F 1XRQA 2I55A 4QTUB 4V0NA 4M37A 1JT9A 3L7OA 1W25A 2CF5A 1CJSA 1T0IA 3S2IA 5ITZA 5LDHA 1OHHA 1K6EA 4LA4A 1U7DA 4UFNA 5G4LA 4KQFA 2ZB2A 2VYVD 1TT7A 1BCRB 5IAAA 3JD2A 2R8BA 2FZCA 5B3KA 4HGQA 5ICFA 3ELWA 1AQJA 1LY1A 4GX1A 3CLHA 3ET4A 4U7HA 1UBNA 2KWIA 2AFHA 4MXDA 2TECE 3MS7A 3SBXA 3MA0A 3RFFA 1X7ZB 2XOXA 5CBPA 3BL5A 3A1CA 1J6UA 2V98A 2OGWA 1Y42X 1PBTA 3HDHA 3K31A 1IXZA 3GVCA 3DMRA 3GRCA 1VA5A 4YCDA 4MWBA 3B20A 5KNCH 2G1KA 4O2AF 2C5AA 2Z8YM 1U3VA 2ZWAA 2IV2X 3CJTA 3ZGLA 2R751 4NCBA 4TMXA 1KMQA 2EBWA 4GYJA 3I58A 1RM5A 2NPOA 4WQMA 4EB3A 4XLEA 1ETHA 1ZD4A 4AKSA 1AKVA 2W8BB 1L4UA 1RIFA 2REBA 3OF5A 1SC3A 3I2GA 1HE1C 1KOGA 2YXLA 1XEXA 2HJWA 5IT9A 4JCOA 2PD3A 3AR6A 4QVKA 4FLEA 2RC5A 2VF5X 3T7JA 2PX5A 2FMXA 3LWNA 3A9UA 3PQCA 2JHCA 5D6OA 3V7AA 1TI7A 5TQ0B 1KEZA 2Q2OA 3HMQA 1CIVA 2O5VA 2VNSA 2K2WA 2W2TA 3A4YA 5B6IA 3IP7A 3K9LA 4QLAA 1T35A 1EX6A 2QTZA 5P21A 5D8DA 4KUHA 4JK3A 4CIBA 4CYMA 5JS7A 2Q3LA 2O8EA 4UDXX 2J67A 5B37A 3EFBA 4AULA 1HEUA 2Q29A 1ZCAA 1VCMA 2OC9A 2ODWA 3KPJA 4RYDA 1Z4NA 4MVJF 3G6EB 2YJ6A 3PQEA 3VZSA 1AHPA 1N57A 2YV3A 1AK9A 3KFXA 3SBOA 4ZCMA 2XJ9A 2FF7A 2P6RA 1EP9A 1PG0A 1Z5NA 2HRQA 3BHNA 1OX5A 5SY4A 3FPLA 1KGSA 1Y7LA 4O4HB 2GYWA 5BQ5A 1NR5A 3Q88A 4Z2AA 4TVBA 5C8YA 2OT3B 1NJ1A 3T54A 1QUEA 2DBYA 5KJ1A 2ZVPX 4FWTA 1PQUA 3RUIA 2QXUA 1JIVA 1Q1ZA 3GJQA 4IXMA 4PM4A 5DISB 2EJTA 4WBNB 2OHOA 4GSKA 1MC4A 3FZQA 1TO2E 3P2EA 5A05A 2WYVA 5DYNA 1RPJA 4ALMA 2OD9A 1QF6A 3HGTA 4M1EA 1KWGA 1K7CA 1OYYA 1SUPA 3ZDZB 3EZNA 3ZGZA 1DRVA 3MSXA 5FQNA 4Z0HO 3FWHA 4G9EA 1XBTA 4Q7EA 2JFWA 4XLCA 3HJRA 1HDRA 2YVUA 2YWEA 5ALMA 4CV1A 3AHHA 4L3OA 1T9BA 3STHA 5IU6A 4O0MA 4Q05A 4BASA 3WLJA 3EXIA 4UNRA 2AZMA 3R6KA 1LS1A 2P90A 3DZJA 1QANA 1N08A 1NQ5A 1BN7A 5LQAA 1VJDA 2YXEA 2MINB 5L8VA 6Q21A 1U7TA 1B26A 5A6SB 5CDYA 1TNDA 1H2XA 4QDXA 3SIWA 2H6EA 2PWYA 2VBFA 4XRRA 5I45A 4WFIA 1O94A 1JVSA 4JIMA 1K27A 1QGYA 2AZ4A 2BRUC 4LJ6A 4EAQA 5ELMA 3ZDDA 1O6GA 1Z0DA 1TOAA 2WEKA 2PNJA 2QP9X 3RVDA 5A1JA 5KREA 3S3TA 4XWKA 4UZUA 3SR4A 3VOSA 4UOEA 4C06A 4PCVA 1SUWA 1QF9A 4PBTA 1KGDA 1DEAA 3D6NB 5ENVA 5BSRA 4WN9B 1ISSA 2PMDA 3AF3A 1UPUA 1Z2PX 3UK1A 1KEVA 4BRUA 2JCBA 4NDZA 3UWPA 1ZH4A 5BRJA 2BKAA 5KUTA 2NQ2C 3AG5A 3E9RA 4BLQA 1V71A 1PR6A 1MB0A 2YNMA 4PLTA 3C1AA 3KVYA 4NMMA 1I13A 2OLJA 1JR2A 3FCAA 3S1LA 4E0FA 1CDZA 1EQ2A 1D2EA 1TM3E 2O0MA 3DF7A 3OUTA 1TQHA 4KO4S 3WLFA 2O20A 3KEFA 4JVOA 1DCTA 3A6PC 1BH2A 1RXVA 5I47A 3RTGA 2B69A 3BEDA 1EFVA 3V55A 4XB1A 5B57C 4DLWA 5D5PA 2GEUA 3EG5A 3QVOA 4N0EA 3T4XA 4QTYA 5A71A 1LGYA 1WDWB 2J3EA 5IBCA 5KDLA 5BPHA 1OWPA 2FF5A 4GXQA 1R66A 2H4XA 3QFTA 4J0IA 4KL8S 4RFSA 5F5XA 4ANFA 4G0ZA 1VKRA 3JV7A 4WAUA 2GRUA 4G5QA 4O2RA 4F86A 4GL4A 2PMBA 4N5HX 3TSAA 2PLWA 1T2DA 3CN9A 4DCNA 2WMNB 1C3OB 4QDOA 1Q3TA 1Z82A 4OI1A 4HRAA 3OTWA 2ZJZA 3TRIA 2C7VA 1T3SA 3N8IA 2UZ1A 3ZJYA 4C0KA 1ZHOA 2W6OA 3STXA 5AIAA 2YMPA 3NUGA 3TFWA 5IRCD 4XL9A 1HDYA 2CLCX 1IZZA 3DAHA 3HVHA 3EMKA 5BNFA 1G6KA 1VL5A 2BR5A 1N92A 2JNWA 3QKSA 2B35A 2FPSA 5F4BA 2FMKA 1Q3KA 4LE0A 1GKYA 1G7CA 1CIJA 2P6PA 4Y9UA 3H5RA 2JGDB 3OTHA 4P38A 3ZU2A 4P3IA 1C3JA 5EPOA 3U2QA 5CLJA 4F9FA 1IN8A 3DDSA 1Q7YD 3I12A 5TQVA 2FFAA 3SLNA 1J22A 2VXBA 4WNYA 1FUKA 2A0FA 3Q0IA 4MHOA 4UEQA 2FB9A 4JLUA 1R0BA 1T36A 1SHJA 5I7UA 3IE1A 1C29B 4IWNA 1NDQA 1PS9A 2G9VA 3HVIA 1NLZA 1NOJA 1ISPA 1Q77A 3F6BX 1A96A 3LHKA 4KWHA 3T0GA 1O5TA 5LIRA 4RF2A 1XNRB 1T0JB 1C5KA 1NNSA 2QVYX 3NKFA 3GLKA 4MUIA 4BMCA 5AM2A 2HU7A 1CLEA 1J7JA 2ZTUA 3QLEA 4CIWA 5JCOA 2MDTA 1QB7A 2BFNA 2WTAA 1HORA 4RJJA 5CLLA 5DTJA 1DAGA 1Q6YA 2NT4A 3EVFA 7ABPA 2WU1A 2E82A 2VDWB 3Q7IA 1YQ9A 1SUFA 4CHGA 3H0KA 3AVUA 1DC8A 2V7QD 1UR5A 4REOA 1KZGB 2HRRA 4F2HA 2C95A 1WOOA 3EDCA 4QUGA 4CG1A 1RQPA 4I5GA 1WULS 4NI5A 4YA6A 2QEQA 3ROKA 5BOVA 3RVMA 3SC2A 4HWPA 4R0MA 4NZPA 5DLQC 5EC8A 2AFIB 2X9VA 3AHDA 1RMTA 2R66A 3HH8A 4D7AA 2JFOA 2OR3A 3D5EA 3GVIA 3B3FA 4QDZA 4RZ3A 3UBMA 5F98A 4A73A 1PL8A 5JYCA 3ZJUA 5KTMA 1CD5A 1LQUA 2X6QA 2QD3A 4KQGA 3WVNA 5KINB 3W5BA 5A6VA 1JLMA 3L07A 5HE8A 1QM5A 4HAUA 3S4YA 1YZNA 3TR5A 3VTAA 3NXKA 1G17A 2HLPA 3NOQA 1XTSA 2XUFA 2B4RO 4P3OA 5FTMA 3QEAZ 2C7QA 3AIMA 5E2IA 4RZIA 1SRQA 4OXXA 3TZBA 3ROTA 1YI1A 4MUFA 1SR8A 1OQAA 2GZ1A 3OEHD 3MCAA 1GZ4A 3LRPA 3KJXA 2GEVA 3FOWA 2V9CA 1YVRA 3FDFA 5DV9A 1NP6A 2BMEA 3LPDA 4XKWA 2DFPA 1OLOA 4TV9A 3R9XA 4TYQA 1N2IA 4J75A 4EHJA 1OV4A 1LI4A 4X93A 4EHKA 3NTUA 4KKVA 2W7TA 3B1WA 4JC4A 1R50A 4MW6A 3I3SR 4DK1A 1GQFA 3LZCA 4E2WA 1D2HA 1NG1A 5KC9A 2CJWB 4NATA 4XZ3A 1T1JA 2AE2A 4I2VA 1B3BA 2YWXA 5F1OA 1OYOA 2B2CA 3BK7A 7REQB 2C9ZA 2ID9A 4X9XA 2WTUA 1IPHA 1T9CA 2Y1XA 5EJFA 3UT5A 2EIXA 3R0JA 1QDEA 3I0ZA 3W0LB 1WZ2A 2L0XA 3DEYX 5IN4A 1CUGA 3FYUC 4OJKA 4KVZA 4EHFA 5BURA 3L0PA 1E5VA 4G1VA 2VQSA 4KG7A 4D4JA 4UCWA 3H9EO 3KVNA 4PSDA 1XP8A 2RHJA 3QLJA 3K4HA 2JAOA 5TF4A 2QUIA 3FLAA 2BMWA 3M2PA 3DCYA 2C77A 4FC6A 1E6WA 4LWOA 5GPBA 4DJTA 2PSHA 1IOVA 1L7BA 4DNOA 4YUZA 1LVUA 1VI5A 4JFRA 4RU1A 4B9AA 2C9BA 2P4HX 5D5HA 4ZREA 1TLFA 4D3YA 4FWIB 5CVTA 3HLYA 3B9BA 3BC1A 1NKTA 1KKUA 4NJOA 4MICA 2XKBA 4UW9A 3T7SA 1U2PA 1Y3DE 3B9QA 4EJSA 4QU0A 4H60A 3WNVA 4CMGA 4MS4A 3KC2A 2AEEA 4NONA 1EB9A 5BT9A 4F9EA 1N2OA 2GO1A 4JV5B 4YCLA 4OJTA 4E5YA 3IDSA 4P8RA 2I2WA 4C2BA 1DQRA 2XMGA 1KMHA 3DMTC 3TSCA 2ABWA 1DVRA 4BJ6A 5DMXA 1N77A 1PR4A 1QCDA 4IRXA 4FGUA 4HR7A 4IDDA 1WV0A 4IL5A 3U17A 3DDNA 5JCPA 3X1YA 2ZYTX 2Z04A 3Q7TA 4OHKA 5A4IS 3V7FA 1NA5A 2CJWA 2CVQA 4XLAA 2ZS8A 3HJCA 1FX0B 2ZRGA 3LGSA 4L4YA 1V9CA 1WUHS 3AUKA 5CAEB 3LD9A 2BIFA 2EBFX 1EFRA 1SM4A 3QXSA 1FA9A 1GAQA 2PPVA 1TZKA 3CLSC 3WHPA 4EKYA 4C01A 3UYKA 4GS5A 1OU4A 4HD8A 5FI3A 1RI1A 2FLWA 2QMZA 3CF6R 5JZMA 3R4CA 4X62B 2W6MA 1WTAA 3E3AA 3EK2A 4DFDA 4TTPA 4PPGA 3ABZA 1WZUA 2B94A 3DBHB 4LOKA 4LVUA 3ZBQA 4B2LA 5KIAA 2VWPA 3OZUA 4RLHA 4X7MA 3RVLA 2GZHA 1XU9A 4WFJA 4F38A 5AM1A 4AIRA 2JLUA 2O0HA 1QVWA 4L4RA 4ARAA 1C4XA 1AKEA 3AVQA 3LLCA 4LJYA 4OGWA 4W63A 1LWOA 4OOFA 3JWPA 4CN9A 2AI1A 2J30A 4TLAA 4UTRA 1MN6A 2O06A 1K8ZB 2HLHA 3QEMA 1D5WA 2OZKA 1I0LA 4I2NA 3IA2A 5CYGA 5H4GA 4YQZA 1JE0A 4JI5B 3E3LA 5FOVA 2ZPUA 1PDWA 4QG7A 4I6JA 5DN6A 2Y93A 1YQDA 1CS4C 1T0HB 1ZXXA 3TTWA 1DMSA 1N2JA 5HP4A 4L6CA 4KAAA 4XUEA 5CVDA 3TR0A 1X6VA 2GN2A 3EZ7A 4UVGA 4BFCA 5F9HA 3IEKA 2YX1A 1TPYA 3K4PA 3G8AA 1FCJA 3D2AA 4KQ2A 5EVJA 3W8EA 3S29A 2OK8A 1Y82A 4QUHA 3CUVA 1MIHA 5L46A 3FCSB 5I5GA 1UXKA 1M0SA 3LYUA 4KREA 1D4FA 5MGBA 3B6ZA 5FA5A 3VMMA 4D45A 1UMKA 4FFWA 4LJ9A 5BORA 2RHLA 5KOHA 2WJVA 4CXMA 5BSXA 2Z9CA 1FVFA 2G07A 2Q4EA 3LDFA 4ER6A 4Q3EA 3H3JA 2CXPA 1SZDA 2O8CB 3SG0A 2ZT5A 5CXSA 1TZMA 3U1TA 1YZFA 4BLVA 1QP7A 3IMEA 4Z4ZA 1GCOA 2VF4X 3HCCA 5T4HA 1TTQB 1NQAO 4RK0A 3BXZA 1JQAA 1IBCA 1O9HA 1E4OA 1Y8QA 2ZP1A 4F3NA 5IWAB 4IOMA 5BVGA 5CITA 1PT6A 4B8WA 3FSJX 5LOVF 4NAVA 4NE2A 3IVGA 2P3QA 3ESZA 3F98A 3OVMA 4JHLA 1I3CA 2XA1A 2H2WA 3RJ5A 1CS0B 2WIKA 4IKPA 1YC5A 1S89A 1WD5A 2OESA 2PZJA 2WZBA 3AVOA 4FHGA 4MWZA 5C5IA 1SQ0A 2QGFA 3E81A 4IPTA 4IIBA 3LOPA 1SVMA 4OQYA 3ECCA 1N2CA 1SKUA 4CUZA 3LNCA 3E4CA 3O4VA 4RHCA 5F4JA 1W88B 1RAAA 4BFTA 1E6CA 4KK3A 1T13A 3IO5A 1YD7A 1SVUA 4L0MA 4D0NA 1JSCA 1HFJA 4MLCA 4ZJYA 7MDHA 1ZGHA 1ZKDA 2FVXA 1UZUA 2X7XA 3VHXA 1XZLA 1GU0A 1RKBA 3TIGA 3UN1A 1HEYA 3TQSA 1KFBB 1ISIA 2I6FA 1WXQA 4AZ0B 4DTIA 5TARA 1C3EA 5H70A 4EY6A 4ZTUB 3EDYA 4OQNA 1A88A 3V1UA 4K9PA 5LZ8A 3ZOZA 1HBJA 4B2IA 5SZKB 4KXXA 5EP2A 2VJAA 2YMQA 2XA9A 1HT2E 2PKYX 3PNSA 4TL8A 3RC7A 3ZDBA 2GFHA 4Q3KA 4LXTA 3EASA 2AQHA 2J3IA 4N65A 4P3YA 3B2EA 5HMLA 3GPLA 3U61B 3VR6D 4GXRA 1JLRA 1KARA 2BGUA 1NXXA 2B5OA 1Y89A 1P8AA 1VXRA 2HQOA 1Y6GA 2ZEJA 1XDBA 4I9GA 1RACA 5E6TA 2ZT6A 1D2GA 2PXHA 3C5CA 2P0YA 3AG6A 1QK5A 1U6JA 5J5VA 1KZHA 2YH2A 4QO8A 5FWAA 1QHFA 4CG2A 1LDGA 2AC2A 3LUHA 5CA1B 1N8RD 2W6JD 2BGKA 2DP4E 3A6EA 1L4LA 2IVZA 3FFTA 3TAXA 2HK7A 3WLEA 1FF9A 2R68A 4MRMA 4BO9A 4DMFA 2WSSD 4TTRA 1UOPA 1GP2A 4JXKA 2HJ9A 1O96A 3V7WA 1ISGA 2OECA 2FA9A 2AR0A 2DJIA 5KZMB 4LJRA 2I6GA 3P4XA 3I1FA 3GGGA 1JHPA 1QONA 4E5KA 5LXTA 2F1OA 4RF3A 2BLLA 2Y05A 1IM2A 4Y9TA 3WLAA 2NUPB 1EQUA 3CSDA 5K9ZA 1GUAA 2C5EA 3DLIA 3BMXA 1ABEA 4FB4A 1NUPA 1N6IA 4PY2A 4F84A 3TNDA 4K8OA 1N05A 2H07A 3DQQA 1GKKA 1N5RA 2PYDA 4HN2A 1V8PA 2DULA 2V5VA 4FWBA 1DFGA 3DE5X 4LKOA 4IO0A 2AHOA 3LUDA 3DAOA 4WBXC 4W9NA 4I19A 2FPWA 1BHSA 5LXTB 3MCWA 4KJZA 3AJ9A 4KQ9A 5EJ2A 3GLUA 4MLPA 1QCZA 3UKOA 2JHGA 3KUDA 1SXJB 4D4MA 4J07A 1EFTA 2GSWA 4QXOA 3T35A 1DTWA 4K6OA 2QNIA 4XPZA 3L1UA 1X1RA 2DPYA 3CZQA 3M4YA 3O8LA 4GO1A 3QUTA 3RSQA 1Y8AA 2P9HA 3H4TA 2Z5GA 1XZIA 1NWCA 2ACWA 3P1JA 1GFWA 1Y1KE 2LKDA 4B47A 1C0KA 3BKXA 3R20A 5FWXB 1VP3A 2I67A 1YQEA 3MILA 3ZWVA 4QJ4A 1KQOA 1U5BB 3F6RA 4HXFB 1A7KA 4UBNA 4BNVA 1GUBA 4D81A 4G0VA 4G8DA 3S1AA 3WRYC 1QPGA 4WXRA 1U8UA 5ADVA 5JO9A 4DILA 3D6AA 1IXRC 2JJ1A 2A14A 2H3EA 4JA2A 4TTTS 2IYQA 2A86A 3WK7A 2JAUA 2PWAA 1U8EA 3NBKA 1GGMA 2FZ4A 1JHRA 2D2EA 2QTFA 3DJYA 2NSYA 1W5EA 3PUMA 5DK6A 2OYCA 5CFQA 3UHFA 1KU6A 2EP7A 2A3NA 2PVSA 2ZJOA 3DMGA 3FB1A 4IBOA 4BZWA 2N75A 2WG0A 1RLUA 5H68A 2DWOA 1FUIA 4K6FA 4PR3A 1O95A 2C61A 1G6Q1 2A1UA 1RLJA 1X19A 4TKMA 3NGMA 1U8XX 1Z8NA 4B7AA 3MGAA 2H7YA 2WYWA 2GBFA 1LNZA 4RL4A 4ZOBA 3SSNA 4C2UA 3IR7A 1KYQA 3AF6A 1NMQA 5LQDA 3REQA 3A9TA 2CXRA 4O59O 5IYWA 2VJPA 3DT6A 3R6TA 4YDSA 4Q6WA 1S2OA 3F9IA 3LVRE 3D7SA 3ASQA 2QDKA 1WHSA 3PFWO 3H84A 3B70A 4L8FA 1HRKA 1RYEA 2HK6A 5LFAA 1H05A 3WK4A 5AJZA 4BKPA 4R1PA 3GJ5A 1DQYA 1JG3A 4O4LF 4MR9A 1T3LA 3GFPA 1QMGA 1S6YA 1KFCB 2VIIA 1ZSVA 1Q11A 3BH0A 2G5CA 2FW7A 4HDOB 4I4CA 4RUKA 5F77A 1OYVA 3HGMA 3SR0A 4Q3OA 3KXIA 4W5JA 1T43A 4GP7A 2COUA 3T5MA 3VGPA 4WSOA 4URFA 221PA 2BCEA 5HMMA 3AKCA 4DGSA 4G41A 3W5CA 1YFZA 2GERA 4D0GA 2ZIAA 2W8BA 1XZJA 4MCAA 1ISMA 2AOXA 5CK4A 5AI8A 1MCZA 1N6NA 2C2ZA 1OBCA 4IUDS 1LV8A 1TM2A 2CXXA 1MXHA 4NJMB 2K6GA 4JI6B 2IY7A 4D5EA 3ORYA 1K8AD 4IM7A 4DE5A 4F91B 4OFWA 3QM1A 1HVXA 3OA2A 1TFUA 2JFZA 4PZ0A 3WGLA 1WEHA 3AONB 2JLAA 4YMTA 2CUZA 2V6BA 4H7DA 1W76A 1GSOA 5IK2A 1U2TA 1BDJA 3E23A 4ND6A 1U3UA 2DHQA 5JJLA 1JU3A 1KZYC 3U3ZA 1A97A 5K45A 3VR4D 2A9QA 1XU4A 2PUEA 4W9RA 3AFIA 2XNDD 3PXDA 3GJTA 4UUMA 1XDUA 5JATA 4F5WA 3O3MB 2LW7A 3MWKA 4Q9DA 3ZXSA 4KXWA 4O5OA 3ZQJA 2W71A 2FZKA 3CEHA 3JZDA 3EGXB 3P8ZA 4Q9IA 4H77A 4XAQA 1NJGA 1Z6YA 2FUEA 1W85A 5DNEA 2NW6A 2X41A 1G8SA 2P6UA 3AHEA 1A82A 4LQ4A 3WYCA 2R6AA 3UEOA 2ZCJA 1IEVA 4XTRA 1C14A 2Y1EA 1QHIA 4XI9A 3ZWQA 1V6SA 2AD5A 3NHRA 5A5GA 1XGKA 4EFLA 4IJ5A 1ID8A 4U1RA 1YIDA 4BNKA 2GOYA 1DEOA 2ZITA 1UADA 2HPHA 1V7QA 2Q5JA 3H5TA 3S5JA 4CEIA 1DG9A 2PZKA 1HYHA 5HF5A 4ITRC 1WMDA 1N25A 1RADA 1OT3A 3A14A 3IOMA 3PHLA 1B8VA 3QHPA 5CVEA 3U56A 3DH0A 5CFZA 1O0SA 4TKUB 3KVRA 4XWAA 2A84A 3MAAC 3W6NA 4OHPA 3Q9SA 4K9OA 1GUDA 1V47A 1YB5A 1AB5A 3ZJ5A 4CKCB 3IELA 5JCXA 5C7OO 1KJWA 1U3CA 4R2MA 5IBPA 3NAGA 3TLXA 1P1CA 3BVPA 1M7HA 4X95A 1XPJA 2HSEA 5KCMA 1BKDR 2D1QA 3A4IA 3II6X 3TXAA 5BR7A 3R41A 3L46A 4R5MA 4BAZA 1W4LA 3ABOB 4NCXA 4IQ8A 4FZRA 1RQNA 2VFAA 2WNIA 1TM7E 2XRZA 4TWBA 3ZHXA 3AZOA 3VO9A 1HWYA 4ACBA 4IXTA 4AY4A 4B7UA 4B40A 4FHFA 4P81A 4DR7B 3ZZTA 3L6UA 1T0UA 3MRXA 4JR2A 3DOHA 5FEMA 1UM9A 1VJ1A 2W2LA 5ALTA 3JD4A 2FJUA 4QSMA 4UHCA 4GQNA 5EE3A 3VR4A 1S8OA 1EUCB 3MS2A 3W5HA 2CDCA 3MRVA 4I1YA 1YT5A 1T9KA 4O4IB 5COQA 1COWA 2ZTNA 3VQTA 5JNWA 1BVYF 1T3ZA 3G1UA 5FR1A 1KOLA 4BMNA 4GWGA 3I9KA 3NRBA 3WAJA 1Z6QA 1ESCA 1RKVA 2AMFA 4Q21A 5K0GA 4FQ8A 3WRXC 3FPCA 3ONWA 3IUYA 3D6MA 2PGAA 1DKOA 1RJEA 3DS8A 4ZU3A 2WLTA 3RFUA 3CF0A 5F4ZA 1FPMA 1RRMA 1PAUA 4P7FA 5H82A 5IANA 1G20E 4BQSA 3AILA 1UOOA 1F1BA 3DP7A 4G0XA 2RHCA 2MINA 3OZ7A 3L84A 1IC6A 3LI2A 3PGLA 4QLOA 1CQWA 4L5JA 5DLYA 3OZEA 4FGWA 1THMA 3NVMB 4GICA 3FNEA 4GOJA 4V2IA 4ZMBA 3THOA 1C9KA 2WUVA 2IX3A 3ZVKA 3BS4A 4I55A 1X7DA 2WDZA 4L0CA 4RC9A 2I29A 1J42A 1FLVA 2ZFUA 3CW9A 4YHHB 2AOTB 1SVIA 4K6GA 4BU0A 1QC5B 1VHTA 5THXA 2A9FA 2PWBA 4S12A 3W4JA 5BN3B 1JAIA 3I2IA 3EEOA 3ASVA 3WLIA 1N0UA 1F3OA 3QF4B 2HLDD 2VHVA 2HPAA 3MMXA 4XLLA 5EZYF 3TOCA 3V8QA 3RTBA 4GYYA 3FOBA 4FHZA 4MB0A 1ZWLA 3SQLA 1QJ4A 1W30A 3BCHA 4G9GA 4G1CA 1YOVA 3OUUA 3JZIA 1Q0QA 3THWA 2H2AA 4OQEA 1TC1A 3FG9A 4TZ6A 3OT1B 3G0HA 5TT0A 1LC0A 4DDWA 2G40A 2Q3JA 3QEMB 2Y1LA 3MWDB 3T8YA 4M8SA 4M7OA 2XDQA 2LCQA 1JXAA 4NU0A 4YO8A 5J59A 1G4HA 1ODIA 2ZB4A 5EXEA 1WXIA 4LOLA 4MGZR 4CQLB 4G7XA 2ZYVX 3NEJA 2WV9A 2CLDX 2J0UA 2J9ZB 2B4QA 3H9JA 3K5HA 3L4JA 3MWLA 3IAS6 2ZRAA 4EW2A 3HU5A 3PFFA 3R7SA 4XLHA 2RCNA 2XWQA 4OG2A 3VU9B 1P2FA 1A4XA 3ZKAA 1HK7A 5LOVB 4Z7NB 1TW3A 2BJVA 2ZI6A 4A5OA 1H0SA 3WIOA 3ZLBA 2YUIA 1ZWKA 3KUUA 3BY1A 2XQJA 2J33A 3S2SA 5A88A 3HUTA 4PS0A 5DCUA 1CY4A 3EXFA 2WJ6A 3GUHA 5E0OA 2PK3A 2VCHA 4BGVA 2PXCA 2XXAB 5IAOA 4GLJA 4NMHA 3TOVA 4DDTA 3RS4A 1C0IA 3UWMA 2G36A 3KK0A 3HB0A 4HB2A 2ZXIA 5LC1A 1RXYA 4E5VA 5BY2A 3E84A 2YY6A 4V0RA 2PUBA 1YJXA 4RTPA 3IEVA 1Y4AE 3KV1A 1AD2A 4RD4A 5G3YA 4BBJA 5C0OE 4H6PA 1WKBA 2D4HA 5SV2A 1PJTA 3T15A 3HMKA 3MUOA 3ZNOA 1QKKA 4DPMA 3PC6A 3W1EA 4KVGA 3TTUA 2O6HA 5B64A 3QKWA 3AL2A 4H31A 3HSYA 3PUKA 3H2SA 4KV7A 1UPTA 1SXHA 3FUUA 3NWOA 1ULBA 4N5IX 1G2OA 1BN6A 1Z9BA 3L93A 4NJMA 3VM6A 2PANA 3JS5A 1IBMB 2ODPA 4B0OA 4S24A 2RGBA 4JSYA 2VS1A 2F3UA 5MN6A 1J0EA 3QE9Y 1PN3A 4WCFB 4Y2XA 3GROA 1U63A 1E8NA 1P4AA 2VSQA 3X1MA 1Y8RB 4PAMA 1QQ7A 1TCVA 2PSSA 2ZZNA 1O2DA 5IUJC 1L7QA 1W9HA 4JOSA 4JYPA 4BU1A 3ZCUA 4ICIA 2PE3A 3FUXA 2WJ3A 5M34A 5FTNA 1G38A 2I80A 4D80A 3MNFA 3CRVA 5C7IO 1VPWA 3NEAA 2P4QA 3LKBA 5HZMA 2BZ1A 1POXA 5ULLA 5BR1A 3P9XA 3SLKA 3G6KA 2QU8A 1A5ZA 1QHHA 3NETA 1RYFA 4LHXA 5AXCA 2A9PA 3MQFA 1E1QD 5LOVA 4GX5A 2FMFA 3U9LA 3ZV6A 2XDWA 2XZOA 1QIDA 1SHUX 2H1RA 3O8QA 3E27A 2GK7A 3IERA 2CXOA 3PX2A 5EMMA 4I1UA 4TV9B 2OCKA 1E2HA 3R0ZA 4IZHA 4CGZA 2W6NA 1Z33A 5CMLA 3THWB 2JGNA 4FR2A 1GGKA 1U31A 3LSTA 4EG1A 1EGVB 4QFCA 3KOZA 2G71A 2VAWA 4KKXB 4YASA 3SMVA 3NT2A 3ZBUA 2NP7A 2WNSA 2FN8A 3F97A 1HM5A 2AYXA 3MXTA 1KQ3A 5IVDA 4MITA 5CXQA 4BNMA 1ZUIA 2O52A 1H3FA 3FYTA 2ZCUA 3EIXA 1ADFA 1V11B 3DG9A 2V9PA 3L0YA 4V0MA 1O97D 3OE5A 2C2HA 2XKAA 3M6LA 3PTZA 4PZPA 4XGNA 4DHWA 5BSFA 1XNQB 2GR9A 3B7GA 5IVPA 1AA9A 3EOZA 5JVDA 4B32A 2B9EA 1DDIA 4QYMA 2XB8A 3GQBB 4P86A 5BQ3A 2DJ5A 1RP7A 2P2CA 3M9WA 4I1PA 3FAKA 1RWKA 1EHIA 1G8YA 1XA4A 1M90D 1WW2A 2PGOA 5FBQB 2ONJA 4PSCA 2VOJA 5IM4A 3BCFA 5DMHA 1H93A 1SURA 5EEGA 2JA1A 5I01A 2XITA 3M4JA 2OB2A 1RW4A 1RYHA 2DR3A 1KS2A 2QN9A 1KI8A 4PRYA 4F6CA 3IEMA 2GHTA 5DN9A 4DC9A 3GJ7A 2GEJA 3B3JA 3ROGA 1VG1A 5DK4A 4GKJB 1DIBA 3VR3D 4Q00A 3KR2A 5DM60 5KJFA 2OHJA 2C82A 5EINA 3EVZA 1NULA 2WPDA 3RUEA 4AMBA 2C2MA 2P1DA 3MGGA 2CFTA 1B7GO 4RVSA 4KXYA 1FFCA 1TYZA 3DVSX 2Q3CA 1CP3A 4GX0A 1FFXA 1LZLA 4QBIA 3Q3EA 4FB5A 2X76A 2CUTA 1JU9A 1JG4A 1JFVA 1G4UR 3OE7D 4X20B 1W2HA 3SX0A 1RD4A 2Q6KA 3UJNA 4WJKB 4LJ5A 3O9ZA 2XF8A 1QH8A 2FKNA 1T36B 3KSMA 4KO8A 2VYQA 1M2GA 3AXTA 4MTLA 4MRAA 3VZPA 4XQ9A 3ZBPA 3W8DA 1F9AA 1PFQA 3A6ZA 3OQBA 4MR8A 2CLLB 1LJLA 2J3QA 3HACA 1EDOA 4RMJA 2BN4A 2PMFA 5IM5A 4ZXFA 5FR2A 2RAUA 4EL5A 2EZ4A 4FE7A 1NQVA 4EI9A 2GUGA 4LEIA 1IY9A 2JIMA 3EQ9A 4KQMA 4MV3A 5FO0A 4UBIA 4B71A 2VHTA 5FTKA 3EIHA 4QOGA 2PZLA 4LSGA 3EIFA 3RNLA 1BWRA 1EUZA 2HXYA 3VO2A 2Q3HA 3ZGYA 1JF8A 4ND3A 1RBQA 1B15A 4HXYA 3L8YA 1BMFD 1NXWA 3NM4A 3TLMA 2EW2A 3BTUA 4CM6A 4WNAA 1ZM9A 2P11A 5L3SA 3QYAA 1UANA 3LXMA 3EEQA 5KU7A 1DXQA 4QDUA 3IRVA 1K68A 3GJRA 1UWVA 1YRQA 2FLVA 4M8NE 1XEXB 4R1OA 4AW9A 5LYJF 4OXQA 1X8XA 1RIIA 2GT1A 3C6ZA 3DF9A 4JI1B 4R8KA 1EMDA 1Z5OA 3LC2O 2O8CA 4RK6A 5J2TF 1FSGA 2CZCA 1JIXA 1H9AA 3G02A 1M10A 1A04A 2RGCA 2VHJA 1GILA 2Z83A 2XZPA 3ANYB 1B0PA 2C1XA 3EA4A 1SCNE 3M5CA 2EZ8A 3QMMA 4ZEXA 4MVJG 1DBQA 1JVNA 1ABFA 1BA3A 1XK6A 2X23A 4WZBE 2IZ6A 4IJWA 5JS6A 3ONUA 5FBZA 1NN1A 1XN1A 3EUAA 3UC9A 2B25A 1EWRA 3E03A 1ZY2A 3HL4A 1JGTA 3TLKA 3H6HA 2A5YB 3NATA 1Z83A 4HQFA 1U8CB 3BWYA 1LLFA 3M6IA 3UGQA 4JVNA 1E8MA 1I2AA 3ISXA 1T26A 1XIVA 3AB7A 4LHEA 3BGSA 3IDZA 3UXMA 3PGA1 4BZZA 3G2IA 4GR4A 3PVSA 4Y2HA 5K3AA 1K6XA 4FE3A 3TLCA 2W6QA 2AUNA 2B61A 1AQLA 4HDCA 5HIMA 4D97A 2EJUA 2NU9B 1NBOA 1EX7A 3RUPA 1J1UA 3H9GA 4KH0A 4UHDA 2YJ3A 1LC3A 5IP5A 1YB1A 4J0JA 1NMEA 3U31A 2FV8A 2Q5OA 2W6ID 5B1EA 4K9QA 3BORA 1E3LA 3HDJA 1P4MA 4D82A 2VJQA 3PFKA 1H23A 1Q1AA 4KUEA 4P5EA 1FP6A 2JIDA 4BNJA 4Q9NA 1DX9A 2RMKA 4XQEA 2I5PO 4PC6A 2HV8A 2FG7C 2ZUUA 2PFSA 3BRSA 3ZX5A 4B3BA 5IASA 4C7VA 3VNQA 1G98A 1WDKA 4BMDA 1V11A 2O2SA 3PVCA 4BS9A 3A11A 2GPSA 1CERA 4M6WA 1I3OA 2XTZA 3UH1A 2HWUA 3ORSA 4LRTB 4Q9AA 3Q38A 3KZOA 5JMPA 1ZESA 4M36A 4BCBA 4INOA 5ABPA 1PT8A 1R9NA 2CY0A 2ZRIA 4EI2A 1Y6FA 4EUFA 2H08A 2CDAA 4DR5B 1QVAA 1XYGA 4YT2A 1PVOA 3AOGA 3D8BA 3HPRA 2QM3A 3DTYA 3KXLA 3PKZA 4FYJA 4J0GA 4R68A 3F2VA 4MVJE 1FMLA 1BS2A 4YJHA 3A3YA 3IKTA 4RJKA 5BW5A 1WLYA 1SG0A 2FEMA 3TE7A 5CURA 3GY0A 4D9MA 5A5FA 3MHPA 1DQNA 4Y7CA 4P35A 2RI6A 3MBIA 5JLJA 1I7LA 5JQGA 5J5CA 2Y2UA 2HQBA 1VG8A 2DM6A 2H8GA 2JARA 2PFKA 2X9NA 3R76A 4F4FA 8MHTA 2QTBA 1ANKA 3NB0A 3TRJA 4D25A 4NNOA 5EJMA 3Q1LA 3RFTA 5HQTA 3HL0A 1TEHA 1Z6ZA 3EEYA 3KEMA 5FBVB 1B2RA 1JDTA 1UFQA 5KSOA 1DXOA 4U63A 4Y2GA 4X1KA 2W98A 1JL3A 1Y1SA 1I80A 2W70A 3F6CA 1TRHA 3T7DA 2DOKA 2G25A 2BI7A 3WYDA 4BNDB 4JBWA 2XT9A 4LKRA 4ABTA 3WJ1A 4FFOA 4ZFNA 3O9VA 1XJCA 3UMJA 4A2WA 4CEHB 1YXMA 2VLIA 2VYVA 1IUPA 4V0LA 5EIEA 1CK4A 1G5RA 2XLCA 2IDMA 1FSPA 4B83A 5CJPA 6ABPA 1GKIA 4IDAA 3D3QA 1T2EA 5FRDA 3ZVLA 3QVSA 5JQGF 3DL7A 5JRJA 4FMDB 1W7AA 1YACA 3Q6RA 4OOXA 2NQTA 4EG8A 1ZITA 2VDRB 2B30A 3D3KA 4IVPA 1CC1S 1RJWA 1FUUA 4J7XA 3L9WA 2CDBA 3C48A 4EZIA 3KVVA 3NHMA 2BFEA 5ADWA 3WXMA 4JDPA 3JPYA 2CYBA 3O21A 3MWGA 2Q3FA 1RHJA 5EJGA 4S0XA 1JLLA 1VL8A 3LX8A 2CMFA 2VDOB 5HKKD 2RH5A 1NI5A 1PQ4A 4CM3A 4AO6A 3FYUB 5JD4A 3PA6A 1YO6A 3W9SA 4DBZA 1OFUX 1T8YA 4Y6PA 4YT5A 5B4VA 4JEHA 3DFMA 1Y3IA 5E3JA 4GDFA 3STVA 3OEWA 1TKRA 3KZKA 2O8FA 3GRAA 4WHMA 3LW7A 1NIPA 5AWFC 3AC0A 4KPYA 1U0EA 2GTIA 1M2HA 1N5DA 1SC4A 4Y1EA 3SBEA 5AVOA 1TUEA 5AVWA 2E6KA 4C4PA 3RIGA 2BEJA 4RORA 3K0KA 2PUGA 4M1TA 1QE5A 2BC9A 3OZXA 4NX2A 3CIFA 4RY9A 3I61A 1GL9B 5E4YA 2DXIA 2J0UB 4IS2A 2EW8A 4CKCA 3EARA 4R84A 2XD4A 3FPAA 2OZVA 4LPKA 3ZS9A 4WXYB 1VMIA 3FPHA 2AOUA 4QQFA 1WXWA 3DGEC 5G40A 5A9TA 4I08A 5NLLA 4XRGA 2A3RA 2XGJA 3M0EA 4MUYA 3EW7A 1N2SA 4JZKA 4PQRA 5HX7A 1I4LD 1DWUA 1QP0A 5FA6A 3NV7A 2QMYA 1DV2A 2DSNA 1QH8B 1E2QA 3D8TA 4MW1A 1LDNA 5E2BA 1Y4DE 3GD5A 1SQ6A 1VQ7B 3ISVA 5TS2A 5JZ9A 3T3EA 2R79A 1BG6A 3LUJA 2GARA 2NO6A 4S1PA 3ADKA 4AMUA 2HMTA 2ZCVA 5TGDA 3L8MA 1XDWA 2IUSA 1NF2A 3E7WA 3D6FA 3P5BA 4DC0A 2ISSD 3MJVA 3A36A 1IM5A 2EX4A 2P9JA 1U1IA 3O4JA 5DM2A 3WBBA 4JT9A 2YJNA 2ALJA 2CBGA 1V8DA 1WP6A 3H97A 3O38A 3EGIA 5CNKA 4TKVA 2R1VA 3RHTA 4DV5B 3E1GA 5JCZA 1ESDA 1LPNA 1V96A 2UYOA 3OQPA 4K28A 4BMXA 4BVFA 3RG2A 5HR5A 3EFHA 1ZIDA 2YZMA 3ZE2B 4RADA 1PWEA 4R3WA 4AWBA 1IUNA 4KEAA 5ITWA 5KYTA 2JJ2A 1NKSA 1ODTC 1PU2A 4YV0A 4QULA 4POOA 2DU8A 1Z88A 2PJUA 3FBGA 1QNFA 1U94A 2J6HA 5B1YA 3IDFA 6PFKA 5IDWA 3D3JA 1WOYA 3KQLA 2NM0A 4E3WA 4B75A 3IKMB 5F51A 4BQRA 1V7PC 4ALKA 2ISQA 4Q5IA 4F8YA 4FFPA 4PLZA 5T4FA 2G4VA 1BRMA 2QE7D 4OM7A 1MQSA 1Q74A 2HWKA 4RHEA 3VU3A 1L0BA 1U7OA 1EVKA 4INPA 5H16A 4PTZA 3TD9A 2ZM6B 4JGGA 1NR1A 2UVDA 3CM0A 3D6HA 3F9CA 2AZTA 2ERXA 1E4VA 2BJWA 3RHZA 3PCXA 2EJWA 2YXDA 3DZGA 3EEFA 1KBZA 2EF0A 1E9EA 1M76A 2PRYA 2UKDA 2XMDA 5J4VA 3THXA 1C1HA 1M1UA 2H5JA 2LDBA 2OD7A 2R1TA 3QKRB 3T9AA 1R0LA 2QRGA 4MWCA 2PUHA 4MYSA 3B5JA 5JBNA 4K1LA 4XGRA 2QM7A 1WPGA 4WX2B 1RWNA 1ZK0A 4PSVA 1GHTA 3KZNA 4LC0A 1AGYA 1HQKA 3D54D 1T6BY 4MDFA 3V8PA 3IVXA 3PPWA 4Q02A 3GSIA 4TOIA 5B53A 2HA6A 2QN6A 4CM8A 4C1NA 2HBQA 2FFQA 2VP3A 3COPA 4DRXB 3K6KA 4EY8A 3BCRA 2X19A 3R8FA 3LQ2A 2YWJA 4ZOCA 5K01A 1W0JA 2VSYA 2VT7A 4HQOA 2AZDA 1NVEA 1T25A 2BGRA 3OW7A 2ETXA 3DE1X 5A7HA 3FDZB 1SBTA 5DX1A 3SJZA 2NTJA 2J9XB 5F9MA 1QCYA 1X1CA 3KHUA 1CFZA 4L74A 3SHVA 5IK2D 4EW1A 5JMOA 1T8SA 1KBQA 2Z3ZA 1I4DD 3O82A 4E7PA 2F55A 1F8GA 1HT1E 5BV1A 4LF4B 4NYIR 3LZ6A 2VR1A 3V4SA 2Z58A 1H94A 3U6KA 5TGTA 3I0NA 3M3DA 3WGNA 1WMSA 2HNAA 2Z2ZA 4PFJA 5B6JA 1C3VA 2WF7A 5IAKA 4M0LA 3CY6A 1NJID 2VUUA 1LLUA 2YVQA 3SFZA 1NW3A 1ZISA 2RI0A 2AJLI 2WZDA 3IMGA 1XJ0A 1QH1B 3BXOA 4M76B 1TTHA 1M7GA 2XBUA 3DEKA 1S3FA 4GI3A 4P53A 4G81A 3RU3A 4AF6A 3TQFA 5B2FA 2P3SA 2FPRA 3G2KA 4LTMA 4QBGB 2D1FA 1XCGB 2J8ZA 3RJ9A 2MT9A 2FWMX 4OPSA 1OIXA 5HF8A 2GILA 1QYWA 4U9UA 4A1FA 1XVAA 2IUFA 1P31A 1YC2A 1QFMA 1A4RA 1R0XA 2C98A 2CFIA 3BMNA 4FFBB 3B3AA 5IDYA 3U7RA 2KB0A 1C8LA 1XRJA 1KDPA 2H1LA 4TMTA 4U7TB 1ZBQA 1DG3A 2BISA 5LVAA 2Q9BA 4CT4B 3PQFA 4MYRA 1E2UA 4PF1A 5H3CA 4ZU6X 1K4MA 2XUIA 5FLKA 1QF7A 2FX5A 4YCMA 4P36A 1KEWA 4TYPA 2A59A 3IBFA 4TWAA 3QI7A 3FLBA 1G8KA 3RVRA 4DIEA 2YZKA 1ZVKA 2TMYA 3LL4A 3P9IA 3CG0A 4TMKA 4ZVOA 3WWCA 4F2DA 3IVAA 3VVBA 3OLQA 1X1BA 2AKAB 4LHSA 1HE5A 1MJHA 2B4YA 3DQPA 5AKYA 5TQ2B 3ZE7A 5J1SB 5DNYB 1N6PA 4XD7A 4UZSA 3THRA 1TYBE 3DV9A 4DYVA 5DI3B 1PYOA 2AEFA 3CF2A 1VJRA 1DDGA 3QTTA 4KWIA 5EJAA 3U1VA 4ED9A 4EJ0A 4DUZB 4DSOA 4B80A 3DKPA 4BMOB 5CB4A 4XONA 4UASA 3UOGA 3TQTA 3U4GA 2RC6A 2WE7A 3HDVA 1KO8A 1W581 4X20A 2MCFA 3S2ZA 4S35A 1QG2A 1SK8A 3G23A 4EPWA 4BRSA 1BQ3A 1WJGA 1F6DA 2QLTA 4Y1GA 3GT7A 3OJWA 1Y3CE 4JB2A 4WW0A 2F3TA 1GPNA 3OQ6A 4HQKA 3OOJA 1UPAA 1WSAA 1XKQA 4K7JA 2F4VB 2X5JO 1MLDA 2JF0A 3PDCA 4ME6A 5DTRA 4C08A 2V58A 4JQOA 4LSMA 5FV7A 3HRHA 3A4VA 3OFVA 4G01B 3WWOA 3D0KA 1KH1A 2WJYA 1GGVA 4W7IA 2REXB 4UOZA 2IXDA 2YYAA 1NMXA 3GFBA 3P94A 2IYEA 4CIAA 2ZTMA 2P75A 5BN5B 1PHRA 1PI3A 2OV6A 5JPIA 4NZNA 5DM1A 2CBXA 4DLYA 2ZRMA 4NABA 2C00A 1WXGA 1M34B 4OJNA 4EUNA 5ELXA 1KL7A 3CUSA 2O8DA 3P5SA 4HS9A 4PAWA 5J2TB 4F4CA 3L0DA 1C1DB 4N0QA 2C84A 2Z4RA 1JR6A 1DBIA 5J35A 2VP4A 2KHZA 1TXGA 1CR4A 2F2TA 2FSVC 2XWJI 3HKEA 3CX7A 1HDIA 3QXGA 4B6GA 4TRRA 2AR7A 1CU1A 3IDOA 4QNNA 5I8PA 4KN6A 1SXGA 2W2XA 4ZO4A 4YRLA 5IDVA 3IAXA 4XIJA 4Q3AA 5LMUB 4UREA 1T1RA 4M9UA 3JQAD 2B4TO 3R9XB 1TAUA 3RF6A 5BN3A 3ZWYA 1M3SA 2YV1A 2G9RA 5J9FA 5EWMB 5KNBA 1B73A 5GMOA 2PH5A 2C8LA 2VP6A 2R6HA 4E46A 3OZDA 5AVTA 2ID8A 2D0IA 4EDFA 2P5SA 1ZI8A 5T8KA 2V4DA 1CZKA 1OXUA 1JQEA 3V5NA 1KJJA 1ZEJA 2IYXA 1CT9A 3HCOA 2GXQA 1J00A 1GZ5A 2ID7A 3N39C 4HLNA 3A6HA 2PD6A 3L4BA 2X8BA 2ZSHA 4XX1A 4AZVA 5IKMA 5K8JB 2DQZA 2ZSEA 2DFLA 4TLLB 4UXHA 1S3SA 3I37X 4PZUA 2DFVA 3ZH9B 3OOEA 2R5WA 3L92A 2QMOA 1YRAA 4UE3S 2XQIA 4XGKA 4JLKA 1L5HA 4AUKA 5C51B 1XALA 2JFVA 4PPNA 3GFQA 1Z63A 1N5IA 3PLNA 1GAJA 2XLBA 4HAIA 3ID6C 3IEIA 3Q7PA 5AJVB 4RA9B 1E2JA 5K0EA 1UCFA 5SZHB 1E3MA 3EQ7A 4GQBA 3N75A 2PNFA 1IJBA 1UQTA 1BS1A 3FAZA 1CXZA 2PL5A 2EHJA 2ZZMA 4D0LB 2NPIA 1W8IA 3MAJA 5ALQA 5CDFE 3HCEA 5IDQA 3NUQA 5LUAA 1YDHA 2ACVA 3QX9A 3TGWA 4PFSA 4ML3A 4IIXA 2BTQB 1ZHHA 2EL7A 3PPIA 3I9FA 1OU0A 3CX6A 5LB4A 4BO6A 4DJDC 1RI5A 1BIFA 4EY3A 2NZVG 2WB4A 3L40A 2UZIR 4OQMA 2BTOA 3HNOA 2A33A 2YHBA 3CGWA 1P9NA 4I1SA 5U9CA 2O2HA 5EESA 3WB2A 5BNZA 3ZJTA 1P0FA 4R9VA 1DOAA 2RD2A 1Z4OA 2DCUA 4XEHA 4EA7A 1R5NA 5KYUB 2VJBA 2QSUA 1TUBB 4GR5A 2QR2A 3DOJA 5FFNA 1L2TA 5TF0A 3R7BA 3UJPA 3ZK9A 4PLVA 5HKBA 3HPQA 2AQ8A 5C9ZA 3KEOA 2O0JA 3OPYI 3T0IA 1GDDA 1ZD5A 3M9LA 3C5VA 3FXAA 1Q44A 4FYWA 3C98A 3PJDA 1YZKA 3JYOA 2VDMB 1XROA 2E55A 4FEAA 3E8SA 4H3HB 4OHVA 4EFDA 3P9CA 4LDNA 4JB8A 1DWOA 2VPQA 3DW3X 2DFKB 4QREA 1HYBA 3DSRA 4C03A 4I55F 3BIJA 5A4FS 5JC8A 3EIOA 2J07A 1GNRA 1WDMA 3KPUA 2DWUA 1SWWA 3PQ8A 3KJFA 4AJHA 4IJMA 4M0KA 3C6BA 3UJ7A 1R16A 3BG5A 3QU2A 1I5RA 4O29A 4B1FA 4B3SB 2HU2A 4NU8X 3EVEA 3PE3A 2AOVA 1E0KA 4W5HA 4QPCA 2JLXA 1UQUA 3OQVA 4YP5A 4JU8A 2X0DA 1S3GA 5IXSA 4ZV4A 1W8DA 2J6CA 5LD2C 2EU8A 5J3JA 5CA0F 1NFQA 1E5DA 1UAYA 1H4SA 4ZOQI 4LDQA 3PUZA 4C3UA 3M9XA 3N7UA 4MAMA 4PX3A 3T1VA 4C3ZA 3PC8A 3G2OA 4YCBA 4ZT3A 5JNSA 1NT4A 2Q3MA 3DWEX 2AJCA 5EIBC 3UMGA 1AGRA 2D0DA 4LZWA 4DRYA 2F8SA 4NAHA 4R1QA 2VUSA 3LPLA 2M6SA 3X2SA 3PZRA 5HK8A 2ECFA 2EF1A 3ONVA 3SN6A 4DSTA 3OKPA 3R75A 4X8IA 1HH4A 3EJ6A 2IF0A 5BQOA 2Z8XA 3JWIA 1XQYA 4KVFA 5EUBA 5KYNA 1U3TA 4YRPA 1IPFA 1X92A 4JJ4A 4DBLE 3K8QA 4Q39A 4ZQEA 4H7FA 4ZZIA 1P6UA 2FZEA 2QRVA 4OPMA 1PWHA 1Y48E 2IFTA 5I9NA 5JASA 2V31A 5HFJA 4H7JA 1JFLA 2B7BA 3RHSA 3RT9A 2LKCA 4YELA 2QQEA 1AGXA 2V7EA 3EXEB 3F6PA 3OT5A 1T2UA 3VI4B 1IMOA 2XCIA 3ITNA 2BP7B 2E89A 1U2EA 3IO3A 4P54A 4XQGA 4BX3A 4LQDA 2X8LA 3AETB 4US1R 4N3NA 4JBHA 1OXVA 3HADA 4I9NA 1R15A 3BA1A 2VKQA 3ZD9A 5IKPA 5F2EA 2IOQA 4WWVA 2NO7A 2IYPA 3RSSA 1FTQA 1GR0A 1V1JA 2FE1A 2ZAOA 3DXFA 4IDHA 4WH0A 4BMZA 1GWNA 1PT5A 1RZRA 4W5WA 4DADA 2NQ8A 5FA8A 3ZE6A 2QDXA 2NLOA 2RKWA 3EFOB 1X1EA 3VR6H 1FPQA 2B92A 1ULUA 2RDMA 4K1XA 3JQ9C 4W82A 3R3YA 3QVGB 4CKWA 2B1RA 3KOOA 1N1GA 2I7CA 3V4RA 3ZD7A 5CW1A 1XKXA 1VRCA 1XZCA 4Q3NA 1PEAA 4NENB 3DAGA 3MD9A 3MLEA 4FYYA 3U3KA 3VYVA 4RULA 1XZQA 4XD2A 1BDIA 3OCJA 3I2YX 3KBBA 1Y1QA 3VOBA 2OO5C 5ICMA 5IUNC 5ITSA 1AQ6A 1W46A 4BQNA 4PSUA 1ZN8A 1MO6A 2QKYA 3GJ3A 4JL5A 1MAAA 1U7HA 1Y9DA 2F1HA 2ZBGA 3BCUA 3ENNA 3PSAA 1J99A 2FSGA 4JNKA 2E1BA