3CRZA

Ferredoxin-nadp reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
257
structure length
257
Chain Sequence
SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP+ reductase
publication title X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 79
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3crzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3crzA02
3CCMB 2DERA 1YITB 1K9MD 1E62A 2DEUA 5GV8A 1YJNB 1FRQA 1QGAA 3U6BA 3CCQB 1VQOB 4TMVA 1F60A 3VNUA 3QFCA 3CMAB 1XB2A 3CCUB 2HDNB 1XE1A 2GPJA 2E1RA 3VO1A 1N8RD 1JA0A 1HA3A 2QTLA 1OB2A 1G7TA 1GJRA 1VQLB 3CRZA 3CB4A 1W34A 3OJXA 2OTLB 1QGYA 4M1KA 1UMKA 3AVUA 4HE6A 3P27A 1TVCA 2XNCA 4YAUA 4YHBA 1KJZA 1ZM4A 4ZCIA 2BGJA 4R71A 3JQPA 2OK8A 1E64A 1GAWA 3W5UA 4G5GA 4J0QA 1QVFB 3A1FA 3WBJA 1QH0A 1WDTA 3ES9A 1VQ6B 3W2HA 1R5BA 3E20A 2BGIA 2VNHA 1W2BB 1QVGB 4RD0A 1YJ9B 3J81k 2B5OA 2QMUA 3WNDA 1JA1A 3B8HA 2DETA 3OJWA 4M0LA 4PC6A 4YAOA 5FA6A 3SJZA 3FPKA 1EFUA 1OGIA 1BX0A 5KSWB 1QGZA 4B44A 3OZVA 3MCAA 4M2LA 1JB9A 4RD2A 1G7RA 3OZWA 2BM1A 1W35A 4N3NA 1ZM2A 1D2EA 1AIPA 4MYUA 3CC4B 2CNDA 5GV7A 1YJWB 2XEXA 1Q86D 2BF4A 2NPFA 1D1NA 4RD3A 4DQLA 3CC7B 1A8PA 1N0VC 1R5NA 4UAJA 5DSZA 3WNBA 4LBVA 3WBKA 1NJID 4ZCLA 4LBYA 4FN5A 2DCUA 2BPOA 3WNCA 3ZZ0A 4TMXA 2QEXB 1FNBA 2VNJA 1KTVA 2QDXA 1D8TA 3QE2A 3CPWB 2EIXA 1EP1B 2QN6A 4FK8A 1DG1G 3ZBTA 3V76A 1EFCA 4ZCMA 1KD1D 2J7KA 4C0SA 1F20A 4QFMA 3OW2B 3W2GA 2CRVA 4IW3B 4PGOA 4ACBA 2B7BA 1DDGA 4G1BA 1IJEA 4M53A 1EFTA 3WXMA 1YI2B 3CMEB 3CD6B 5TR9A 4DQKA 3LRXA 1KQSB 1JJ2B 4RD4A 3CCRB 1GO2A 4YAWA 2C77A 1QUFA 1FNMA 3CW2A 3AVTA 3AGQA 4LC0A 4YAFA 1YHQB 3WYAA 4M4SA 2BVNA 2YWHA 3PENA 4NCNA 1KK2A 3W2IA 1FDRA 4H9GA 1OB5A 2DY1A 4B3XA 1QX4A 3CCJB 1KC8D 1IJFA 1NDHA 4ACAA 5JBQA 1VQ5B 1KK1A 1Q82D 1QG0A 2BV3A 2QTZA 1GVHA 3QFSA 1ELOA 1AMOA 2GQFA 3QFTA 4HE5A 1YIJB 3W5VA 1VQMB 1TUIA 1ZM9A 3B82A 2C78A 5H59A 3QSYA 3OZUA 3MMPA 4TMZA 4YALA 3ZBUA 5HXBA 2VYQA 2BM0A 4TMWA 1B23P 4ZV4A 4Y7CA 4Q7JB 1JNYA 1ZUNB 1Q7YD 1OGJA 1G7SA 1BX1A 4K1XA 3WY9A 4P3YA 5AN9A 1GR1A 3AVWA 4P6VF 2AHOA 4AF7A 2PIAA 1CNEA 2VNIA 4AF6A 4B48A 3AVXA 4B43A 3LYUA 4U9UA 3W2FA 2ZITA 1QUEA 1Q81D 3P26A 1DARA 2PMDA 1EP3B 1VQNB 3QFRA 3G4SB 4Y9RA 2B7CA 2HCJB 1SKQA 4BPRA 4B4DA 1CNFA 5THXA 3G71B 1EP2B 1QFJA 1IB0A 4AC9A 1KK0A 4MYTA 1S72B 3CCSB 1KRHA 2PLFA 5TV2A 4ZGQB 1I7PA 1TTTA 1BJKA 3VO2A 4QHYA 2VNKA 2YWEA 3U6KA 5TY0A 1VQ4B 4ZGNB 4PC1A 3LVBA 4LBWA 3I56B 3B78A 4WQMA 4N3GA 4FWTA 2RC5A 4TMTA 1N0UA 3ZZTA 1M90D 2OK7A 2X3UA 4F7DA 1H42A 4TN1A 1QFYA 3E1YE 1TLLA 3FJOA 3W2EA 1M1KD 4LBZA 1B2RA 2HMAA 3JQRA 2YWGA 1W87A 4G1VA 2BSAA 1VQ8B 2EFGA 2VZLA 3W5HA 4PC2A 1K73D 1VQ9B 2FX3A 2D74A 3MHPA 1U2RA 3AGPA 3U2QA 1ZM3A 3AVYA 1EXMA 2BN4A 1S0UA 4NBSA 3CC2B 1EWYA 4RCZA 1VQKB 2XNJA 3CCEB 1R5OA 1E63A 3CXCB 1QFZA 4RD1A 4RD6A 4RJLA 1DDIA 3ZZUA 1H85A 3I55B 4B47A 1KK3A 3VNVA 1FNCA 3LO8A 1FNDA 3G6EB 1VQPB 2QA4B 3CCVB 4PC7A 5EMNA 1FRNA 1G7CA 3I1FA 5H5JA 3AVVA 3CCLB 1GAQA 1SM4A 3ZC3A 4C43A 4EH1A 2RC6A 1J9ZA 2OTJB 1BQEA 3VMFA 2BMWA 4RCYA 1CQXA 1K8AD 2R6HA 2YWFA 4PC3A 4Y9UA 3JQQA 1VQ7B
chains in the Genus database with same CATH superfamily
5KSPA 4HAVA 4YBRA 4Q3BA 2XVYA 4HGPA 1Z9BA 2QAJA 3NGXA 1YITB 2QXTA 4GSLA 2DXIA 1UQRA 3PDIA 4QQKA 3FAZA 3UBMA 4NYIR 4RK1A 4RYLA 4Y2PA 1SUIA 4B5LA 3VGJA 2JFHA 1YJNB 3LRTA 1ZIYA 1QGAA 2NZVG 3QYJA 4IS3A 3IKMB 4HWRA 5K2MA 4BS9A 3F3MA 1RWKA 2PHZA 4UTXA 4OOSA 1KOFA 3AZPA 4FEAA 4PZYA 3IX7A 3NYIA 3IB3A 4J0DA 2XLCA 1J2EA 3CRMA 5DASA 4AJHA 4B80A 1VQLB 5BV8A 2W42A 4L4RA 2ODAA 3CX6A 4ZD6A 5SV2A 4BEWA 3AYZB 3GLHB 1A5TA 5BSTA 3L06A 4LOJA 2YKGA 4RGYA 2ONJA 1H8EA 1NB0A 1H6BA 1HL7A 1XL0A 1Z0UA 2AE1A 2AK2A 4O5OA 1WXGA 4OF4A 5JE8A 3IT1A 4NAHA 4LF6B 1LSJA 4DREA 1GGKA 4GMFA 1FEZA 2H06A 3HEAA 3ZNOA 1B8OA 3P0JA 1I2DA 3DLIA 3F5DA 3KVNA 1IUOA 4X1KA 2AOWA 4WZAA 1G3UA 2IF0A 3CUWA 1FTNA 3PG5A 1Y7PA 3GVHA 4R2JA 3TZHA 1E1CA 4D5GA 5JCPA 4ND1A 1EWRA 5KSZA 3ZG6A 5IDQA 3K0BA 4CKXA 1CQJA 2DUUA 3NRBA 4JA2A 3WQHA 5AIBA 1PJSA 1LDMA 4MVJM 4YJ3F 3HK2A 4YRIA 4CEJB 1J1UA 1E1NA 1PZHA 2XSZA 4KGVA 3ZU2A 5KPJA 2BMFA 2JBWA 5CDTA 1BH2A 1R6XA 4P86A 1UD5A 3B9PA 2VNHA 2CHQA 3CEAA 3EXHA 4D8VA 3CPHA 1L5KA 1LVHA 2ET6A 2CVZA 4LYDA 4MHSA 4BO6A 4FLMA 4CCYA 2IYEA 4FCCA 2CFCA 5EHIA 2P9FA 1CF2O 1TO2E 1ML4A 4ZEMA 1LD3A 1M6VB 3EZLA 1IAQA 2IIVA 1JDUA 1KRXA 4V39A 4XE5A 1OLXB 4OQLA 1JU3A 5A4IS 2PVCA 4LE1A 4BTVA 3P94A 2Y0DA 4FI3C 2WA2A 2F64A 1MX1A 4R3WA 3U37A 2Z04A 2JRLA 4WASA 3QHPA 2FP4B 5BSVA 1EFUA 2GEBA 1T1GA 3K9CA 5I8PA 2WDZA 4E12A 1G3RA 2IYFA 3P2KA 4N5NA 2HLNA 1NUTA 3HJNA 1SUDA 3VYRB 1M1UA 2QN9A 3DB1A 3ON5A 1OIVA 1AUPA 2NXEA 2XF8A 4KYVA 4O4LB 4PQRA 4PX9A 3HM2A 4CN8A 4CIBA 2A0YA 3FGOA 4BNVA 2WHYA 1C9JA 2ZJ7A 4RTQA 1CJBA 3H86A 4RK4A 4W8GA 3EBOA 3R9XA 1FPQA 3VNAA 5CYGA 3GDFA 2BIFA 3IA2A 5F64A 3X2EA 3U3RA 5M7EA 2QI9C 3LK6A 2JDID 4MGEA 1ECBA 2PWYA 4LZAA 1B6TA 3H9QA 3HLTA 2GZ2A 4M0MA 3QQPA 1XJQA 4Q93A 3CUSA 3I3SR 4LQCA 4UNSA 1UMBA 3NPAA 3SHWA 1QO9A 5EWJA 1CUYA 1UPXA 4O08A 5CCEA 1UPTA 3VR0A 2YY5A 3FZQA 5DK4A 1Q86D 1S2NA 3L79A 1DO8A 3NT2A 1A9XA 1RAFA 1LKZA 3U4DA 1PWXA 3AJDA 4MUKA 2MR6A 1RC8A 3EG9A 4WVFA 4LF9B 5T4EA 4RDXA 3TXXA 2GCOA 3MFQA 2YQZA 1LI5A 2FZ5A 3NZEA 4JZKA 2RHWA 4XKVA 1NVTA 3OQ1A 4KQHA 4O0MA 4IJWA 2NTEA 3OLYA 2VRCD 2X7HA 4G7WA 1OV4A 2WZNA 2VYCA 4MIOA 5G4LA 3UK2A 4DV5B 3GCDA 4EY5A 3SZOA 3L01A 4KIJA 3IO5A 3F9RA 1VMAA 4XXHA 2BPOA 2REBA 2FPPA 3QLEA 1UJ6A 3F2VA 4GH5A 1JIIA 4ZI3A 3THWB 2BFEA 1P7PA 3G7SA 2BEWB 2XXAA 2GERA 3FUCA 2QRQA 1SH7A 1U99A 1GARA 4RC9A 2XTMA 1Q1QA 3AOEC 4FFBA 1SD1A 4HG2A 4V0RA 3UH1A 4QL3A 2H5LA 2NUAA 2WAOA 4UEOA 1Z0IA 2EJWA 1Y8AA 1I9CA 3D7SA 4B76A 2QN6A 3WLMA 4LGCA 3OIYA 4Y1EA 4ZAGA 1BROA 5CIYA 1EXDA 1D6NA 2ZR0A 2YXEA 3KZXA 4I9UA 5FEMA 4Z9YA 1IHUA 1QYVA 5FTJA 1MQAA 1B0AA 2H1HA 1KF0A 3IPRA 4O4HF 3HI6A 3AZQA 1YOVA 3ASSA 3EQ8A 3EQ7A 2H0AA 1HEYA 4R1TA 3KB1A 3PRHA 4JYZA 3IAXA 1LPBB 3KKQA 4EJ6A 1EYZA 3ISXA 1Q83A 1YR9A 2YJGA 3FTQA 3QVXA 4XUEA 5LCXA 1I4LD 1NLZA 3EIXA 3Q9UA 4KC0A 4G1BA 4XN3A 1MNAA 1NZJA 4C06A 1LTKA 1IJEA 1A82A 1C41A 4L22A 2J5QA 2PWPA 2QG6A 1FS6A 3THSA 2BJVA 4QAJA 1JG3A 2JGRA 5FI1B 1Q0SA 1QRRA 1YI2B 1QTRA 1V5WA 2BR5A 2WVHA 3N70A 4QTZA 5FWXA 4DCGA 3R8FA 2XMGA 2NIPA 1ZZGA 4MS4B 2H5JA 4OHVA 4INAA 4ANFA 2A9FA 4EJ2A 2W22A 3ZE1B 4QDKA 2ZI3A 4YH1A 1GO2A 4KXYA 3BIWA 2WEKA 3FDXA 1HK7A 3RE1A 4WWHA 4AZ0B 4B0PA 4Z53A 4EVSA 3BGDA 3OM1A 4DLNA 4LGMA 1L4GA 4RY0A 3VO8A 3AP3A 3WIBA 2QZSA 1ZBDA 2YUIA 3GJTA 1DO2A 1PIWA 4K88A 2CE2X 4G26A 5IT5A 3FHJA 5ADWA 1XNRB 1Z0FA 3GJYA 5JD6A 4MWEA 5FQNA 3N6RA 1II0A 1RI5A 2AA3A 3CUVA 5CHEA 5AQEA 1U65A 4GNRA 3FYUB 1X3SA 1X38A 2QPTA 3GUYA 3HZHA 2GTIA 4HSEA 4UXIA 4BO5A 5A1TA 1L1FA 5FFFA 3L1HA 1NBOA 5HCUA 2AW3A 2C8JA 2FFJA 4P25A 2QLJA 4QXQA 5K3AA 3K1JA 2WQZA 1HGXA 4EKNB 2JN9A 1XZHA 2JIZD 2OY0A 5B58T 1EH5A 2FFBA 1F5SA 5D7NA 2IHNA 3OQ6A 2H9IA 1UODA 2FW0A 3HFJA 2VZ8A 4XGKA 2FPRA 1ZSYA 1CZUA 1LZKA 5DHAA 3BT7A 3IOEA 1NBHA 4TLCA 3U4GA 4Z9AA 2GN8A 1CDEA 2ZKLA 4OXRA 4P80A 4B45A 5EZYF 4BUZA 4D42A 4OQ4A 2LPMA 1HDXA 4LKRA 5CCXA 1EX9A 4P3IA 2PWBA 1YR2A 4BAGA 3OZUA 2PUAA 3F5SA 1FYVA 4DABA 5LJIA 1IZZA 1XJ5A 5JV5A 1RI1A 3Q15C 4KCGA 1PJ8A 1E60A 3AIMA 3CRQA 1VLQA 3TLMA 3IELA 5L51A 1JFVA 4XCXA 1DP4A 2P2DA 4N12A 1EINA 1L5FA 3NNDA 5SYMA 1SD5A 1FTQA 1NVGA 4PQFA 2Z57A 3DTYA 3F6EX 3MT8A 4O5AA 2Q3MA 3IIJA 3NBKA 4I36A 1VCIA 2IEAA 3D8TA 4XFJA 2RHLA 1XVLA 4AU1A 1QHEA 1IRIA 1LLQA 2KJQA 4K8OA 3WJ7A 3GJ3A 2A0KA 4JKYA 4AF6A 4B48A 2VJCA 3HN2A 3DLBA 1E6MA 1NVBA 1P4JA 4ID3A 2ZRDA 2Q21A 1ZGJA 2ZYHA 3BWEA 3JR3A 4C0XA 4HDRB 2ZAOA 3F6YA 4Y1FA 1TYAE 4L5IA 1VL8A 1THZA 3ZYCA 4WNAB 1OH8A 2ZGVA 1QHNA 5K8UA 4P81A 2XR1A 3W2FA 1NPYA 1FP1D 1MVLA 4H77A 2X8JB 5E3JA 1E9FA 3N7UA 1PJ7A 1GKYA 4ZTUB 2ZPTX 1YI8A 1WUKS 1ZUIA 4PRLA 2ZOSA 1K86A 3SHOA 2C9CA 3CJTA 1I6MA 1DX9A 2D1TA 3PQCA 5AUNB 2ZB3A 9MHTA 1P73A 1N78A 3WK6A 3THRA 3BDIA 1O9BA 2Y1EA 1VGRA 1HQCA 4EFMA 2HRZA 1XAGA 3NT5A 4IIGA 4X91A 5AVZA 3SBOA 4KNVA 2D1QA 4LOIA 3E7DA 5DGTA 3W9BA 5BQ3A 5IVIA 2VTEA 4RDLA 3MQFA 1JG1A 1XZPA 4LN1A 4TXNA 5JJCA 4BQNA 1CNFA 3REQA 5THXA 1YR3A 1GFZA 2NV0A 3L1JA 2FWIA 1NRWA 4HVCA 4FFMA 1L5HB 4NL4H 1Z4OA 1SWVA 2O7SA 4I5EA 4ZO9A 4X61A 3SYKA 4BFWA 4W9MC 3JVIA 1H9AA 2WWWA 4XR6A 1SKBA 2CFSA 3EGXA 1SHTX 4QOIA 4HB4A 5L3QA 1AA6A 5J4LA 2Z9BA 5SY6A 4G5XA 1ADYA 4LF8B 1GR0A 2P11A 3PHBE 2I4TA 3P5SA 4MS3B 4YT5A 1D2RA 5DHRA 4YJFA 3WO1A 3ZU5A 2GHTA 5JC8A 2R1UA 3HSYA 3VYTB 5CB4B 2XB6A 2JJ2A 4LDPA 3RQSA 5J2TA 4G85A 4MUBA 4UZSA 4ARSA 1PWHA 1U3GA 2YDYA 3PFIA 2GZ3A 1I10A 3DO5A 2FVYA 1YDMA 3U6KA 5P8WA 3COJA 5DYWA 1PZXA 4EQZA 3VUFA 3HYRA 1A7AA 1KR5A 3AUYA 4YTEA 3QTTA 1QK3A 1QMGA 2GD0A 1GRNA 4H3HB 6ABPA 1K3FA 2ORIA 1R4MA 3PWZA 4J49A 3PU6A 3T9AA 2WJHA 3OIVA 4CCAA 2F55A 2FW8A 2DLDA 1M7GA 2ZUVA 3G59A 3G2NA 3EAGA 1QR6A 1PZEA 3QPDA 3DEZA 2RHHA 1EUDA 1QBGA 4GMHA 4OFBA 1L7PA 1F06A 4X7CA 1RJWA 2VATA 5AXCA 1N3BA 5ICEA 1RYEA 1K3UB 1RWOA 1NQWA 4G0UA 5TXGA 4YMWA 2CL5A 1F4LA 4JNKA 1OWPA 5LN1A 2CNWA 1YNOA 2GJAA 2JEOA 3Q0IA 1EHCA 5I4KA 3FIUA 4GVXA 1RRFA 4UNPA 4J0GA 2J67A 2PRZA 2R1VA 2HX1A 2X0RA 1UAAA 3G1UA 4INOA 5L3ZA 3ZHCA 4B3IA 3PHCA 4XEUA 3D5TA 3UF0A 1ISSA 4PCLA 4JZYA 2W48A 2DJ5A 4BGVA 3IMGA 3O9VA 4DLWA 5FDFA 1QF6A 1OPRA 4O2BA 2QLLA 4OJTA 5K0CA 3U4HA 3TRIA 5DNUA 2I76A 4KH0A 4ZHQF 2X7XA 2VZLA 2VDWA 3X1MA 2AB0A 4PS0A 5KTKA 3SZGA 5DM4A 2PSFA 2WYWA 5EIFA 2JLYA 3B5IA 1V11A 3OM8A 4HLNA 1CCWA 1NMQA 2WMOB 3RVPA 1QIHA 4QPZA 3DZJA 2UVPB 3F4BA 3OOJA 4CBVA 1ISPA 2OGZA 3EH2A 1GZ7A 3HO6A 1ZS9A 4EPYA 2BN4A 1S3SA 2HDWA 5I4IA 3OQOA 3HYTA 3AF6A 4J6EA 5ALEA 5FWYB 1WZEA 2D2IA 2PUTA 3WGMA 3OPYB 1U8TA 3QBVA 4OHWA 2IP2A 1L5QA 2VWGA 2P75A 3CKYA 3X2FA 3GO4A 4F2WA 4XM3A 1EFLA 1QM5A 1HNZB 2P3OA 3IV7A 3S2FA 4BQOA 5AW4A 2Q8NA 1V9SA 3QXHA 5BQ5A 2C4UA 1FOEB 4MVYA 3ZXUB 2CDNA 1T4CB 3I9V6 5HQTA 3JV7A 2A5YB 4E5NA 5JO9A 1RVV1 2CYAA 2HCBA 3H99A 2EBWA 2SKCA 2ZRLA 4G07A 4RDIA 5EHNA 5F1OA 1E4EB 3G2MA 4TYQA 3RYIA 1C7EA 4XYMA 3BY1A 1YBFA 2R6DA 4BJ3A 1FSGA 3NALA 5F3RA 5L3VA 2WA1A 5JG7A 1P5ZB 4EA6A 3N0WA 1WIWA 1QVRA 2IGTA 2XYVA 1WSWA 4KN5A 3H4TA 3ADDA 5JVDA 2E4UA 5B2EA 4KOAA 1D6SA 3FWKA 1D09A 4EYSA 4WGFA 3QJYA 4H3KB 2D3LA 2C5EA 2F1OA 3GA0A 4Q05A 4EECA 1E59A 2H7VA 4EQ6A 5C8VA 4EX7A 1LRLA 1N7JA 1RWQA 2IXTA 3RAJA 4YQYA 3V42A 1E92A 3W9SA 1P1RA 2C7OA 1P19A 2YHBA 1E99A 1P1CA 4RA9A 4AP5A 1SM4A 3EQ6A 1BXRB 3ADPA 3TI7A 2J3JA 2P0AA 3EASA 4R5HA 2G9NA 1T0BA 2I66A 4B3MB 1E6CA 5T8KA 3L6RA 4Q3CA 5JARA 1J9ZA 4EUSA 2BFMA 4Y2UA 4BKQA 3DE1X 2YRWA 1HG1A 1XPJA 3O4VA 1XXLA 4NYJQ 3HKEA 2VCYA 2QPAA 2XA9A 3AEYA 1WPXA 1HT1E 3ZHBA 4L9AA 4U7WA 4RTNA 3RFTA 1LLUA 1RBQA 4LWQA 1OLUA 1JTFA 3JQQA 1E2UA 4BNYA 2XE6A 4XNFA 3T4PA 5C18A 2HLPA 1OJ7A 4MVJF 4TWAA 1DIRA 5C1IA 2OPBA 3TXAA 4DNOA 2NN3C 1FSZA 2Q6IA 3DEKA 4PXSA 2CNNA 1U3WA 1TO1E 1JSXA 2MYNA 3WFJA 2CLIB 2BUAA 4UBJA 1HFKA 2VTBA 4O2BF 1TMGE 2NU6A 4O4JA 1FJGB 2OBBA 4KFTA 3BF7A 1FMLA 2HSZA 3ODGA 1ICEA 2JI6A 4U2EA 2ZB7A 1E7RA 4GXTA 4HH3C 1FVXA 3WRVA 2VJNA 1P4HA 1UC5B 2F43B 2MU1A 4NK5A 3SEFA 4OLBA 4YCDA 3OJEA 3W1WA 3CB4A 4Z0NA 4YECA 2ONCA 4IOKA 3OJXA 4U63A 3K0EA 1SXJA 4MROA 3BEOA 1I5RA 1JVNA 4PPQA 3OQNA 3KDPA 3HNPA 1PFKA 4Z4QA 1E77A 3COYA 4Q5IA 5KQSA 2XDQA 3LPNA 4MUJA 3ICWA 3TRDA 4PSDA 2VP6A 3SXJA 3T0IA 1H1TA 2IBMA 3QQ5A 4HDSA 1ZM7A 4XQGA 5CR9A 2R6CA 1AGPA 4L08A 5HF9A 4F60A 2G1JA 7REQA 3AESA 3UYKA 3KB6A 3OKPA 4C0QC 1XI2A 2GFQA 5F4MA 3QVGB 2W70A 1UZUA 2JFYA 3W5UA 3STTA 4J0QA 1JT9A 3A10A 2PD3A 2ZBRA 4FOLA 3TN7A 1HR0B 5EMKA 1EU1A 4BO3A 2BMEA 2EXXA 2L82A 2OE2A 3SM3A 3ES9A 2GBLC 1N6RA 1COWA 2Z2JA 4ZTZB 3BXEA 2PUJA 4NATA 2NSYA 1OFUA 1CY6A 4K40A 4AQDA 4DE5A 1FX0B 3M2TA 4N7JA 1ZSNA 5TGTA 4IQ4A 3EFOB 2B5OA 5JVDF 1RFLA 2MCFA 4C87A 4EW1A 2C7RA 1SBZA 2ASVA 1FJXA 3F90A 1S01A 3WDMA 4PC6A 3BXXA 1P44A 3ZWNA 3QVUA 3SJZA 3DS8A 4DA0A 4P4SB 1BXKA 1P7YA 5FL7D 3PPXA 1DHTA 5ERYA 5I7OA 1T4MA 3ZY4A 3IL2A 1CY4A 4MNTA 1RQRA 3AEUA 3TTYA 1EVQA 3R41A 4NYJR 4YN3A 4ZI7A 1M2JA 4CKBB 1K7XB 3P9KA 4OUKX 3S2SA 2BGLA 2OR3A 5H7XA 4DB4A 1XC7A 1O77A 1Z26A 2JGDA 2OGUA 2G4VA 5EP1A 4EEZA 5FLKA 3A4TA 5HNKA 3K9FC 2QZPA 4B3HA 3E9MA 1A95A 5BUZA 4LYYA 1BLIA 2XRMA 3LIPA 3PNQA 1E94E 3M4YA 1FFHA 3UWPA 3LWDA 4KJZA 1AGXA 3MAJA 1NF8A 1NBMA 2YX1A 1KFJB 4RD2A 1J0BA 3BH6A 4P4LA 2E48A 2ZSFA 2PH1A 1T6NA 6REQB 3S5UA 1I94B 2ATCA 4GYYA 5H16A 3BGIA 2F3UA 2OVFA 3D3JA 5TMEA 3UWSA 4EMSA 2PZAA 3X0DA 1VRVA 3DXZA 4HN9A 3EXG1 3H75A 4DA8A 2J1LA 5HOEA 4LDNA 5E8JA 3ZQ4A 5KYUA 2P2LA 5U1PA 1JT2A 1XCGB 4GEKA 5DTMA 5EMHA 2IV3A 5B5SA 4HDKA 1QGOA 1ZCFA 2IUFA 1UT5A 1MIOA 2IA5A 4J0EA 4PYIA 3QIVA 2Z4TA 3ETJA 2J5BA 4Q47A 4B75A 4DUGD 3U5ZB 3DKRA 1ADFA 5BWBA 2C4HA 1JLHA 5IKOA 1ISHA 2VJKA 1NSFA 2WWGA 5FPQA 1KJIA 1TK3A 1DQRA 3LDHA 2XZTA 3OT5A 4G5YA 3F0TA 4HVTA 4PLCA 3VTZA 3NOVA 1FRFS 5DLPA 3LUBA 1KI9A 3TJRA 1M8KA 4LWZA 1EP9A 4ZMBA 1NSTA 5CLGA 4DDKA 5L6LB 1TFUA 1ZJ4A 4NJEA 3PS9A 2ZTNA 2XXJA 4YY3B 2OFPA 3DMPA 4MMZB 1U3UA 3F1LA 3G2LA 3JRNA 4XLFA 4V0ME 3JQGA 4YR9A 1DKNA 2B36A 3IP9A 4P84A 1DEOA 3RYFA 2X6YA 2XTNA 4D41A 2QVXX 1KEEB 2JAOA 2P67A 3CF4G 4HDNA 5DGIA 5AW5A 2PGXA 2RJNA 3UAGA 5J4VA 5JFOA 3U4QA 1VLMA 1W1WA 4HSGA 1SPBS 2WT8A 4DMRA 1GTG1 4X95A 4Q37A 4P5PA 1AQJA 3WNCA 2FYTA 2MJLA 8ATCA 4FZJA 2GK7A 1IFXA 2WICA 1QHYA 1L7VC 1FNBA 3V2UA 3EQ2A 3ZVRA 2JHGA 2QTRA 1RC1A 1L4YA 4IH9A 1X1RA 4AKSA 2WKPA 1ZR2A 1KTVA 1ZI8A 3CPWB 3L8FA 2XB2A 1RBMA 5HWSA 4CPDA 2A1TS 4BQPA 4PLHA 3UN1A 5IBRA 2H52A 1F3OA 3PE6A 2XT0A 1IHYA 4GQNA 2HIMA 4ECAA 2PTGA 4WZKA 2QM3A 2RBGA 1QRTA 1WBDA 2AG1A 2C20A 1EFCA 2EDCA 4OHZA 1BMFD 3CH7A 2D3WA 3BC9A 1TZCA 5C35A 1Z2EA 5HW0A 5K09A 5K0ZA 5CA0B 3F7OA 5BSHA 1IZ0A 3D8RA 4Y3UA 3TEJA 4EWLA 1UBCA 2CUKA 3NDPA 2ZUTA 1G42A 4P1VA 2O4CA 4KR3A 3MT0A 4KE9A 4M8NE 1P2GA 2WJYA 1TLFA 3MUEA 2Z6UA 1DDGA 1JDJA 1CERA 4RLZA 1PSDA 2ZIXB 4QYIB 4CM3A 5F1KA 4RPDA 1XU7A 3C48A 2O0JA 4OK6A 4WZAE 5EA2A 3IRVA 2CV0A 4M53A 4Q1AA 4OUDA 4YJGB 1Y8CA 4NFYA 4RPGA 1E3MA 3SZMA 3WXMA 4NBUA 5BR1A 3CMEB 5JJLA 1FB5A 2IZ6A 3A3YA 3WSVA 4BNHA 3B1JA 4HZIA 4BZWA 1PZNA 3PR3A 3P9ZA 4HB0A 1J97A 2GLTA 1LLCA 1RHJA 3LC7O 4JD5A 2C0PA 5F1YA 1KQSB 2P4QA 2VJAA 3MJSA 4C0HA 1JTEA 3E7XA 1VJTA 2WV7A 3S29A 1OH7A 2B83A 3WKBA 4P7GA 4XWTA 3TIFA 4N47A 3FJ1A 3KZKA 2RKOA 3LGXA 3P9IA 3R6TA 2DQYA 5EWMA 4BMNA 2ZL5A 1SPXA 2JI7A 3GHHA 2P9HA 3VKWA 4GF5A 2PSDA 4QU5A 4WACA 2YC4C 4LC0A 2G9RA 3ZU3A 4RIFA 5HKOA 4A8JB 4UATA 2IDZA 3IPCA 4MQ6A 2QVCA 3WYAA 1GAEO 5FO1A 2V31A 2ZT8A 1V6AA 3NC4A 3EDOA 2TRSB 3P4YA 4JMPA 3RAGA 2ODWA 2Y2UA 3JWHA 1V16B 1OZ0A 4MRMB 8ABPA 3W2IA 2AN3A 4G24A 4BX0A 1ZVQA 3Q72A 1OWMA 3IURA 1OCEA 4QRHA 3V6LA 4BAZA 5JJ5A 4HQLA 3EGOA 5FEUA 1NI4B 3TE7A 3OY7A 4IEFB 1I7SB 4U9HS 1NDHA 2BGUA 1M8JA 3OF5A 2CLHB 3WGTA 3K9NA 1Y63A 4L16A 2I55A 1D5CA 3IB6A 1AK9A 1Q82D 5BVGB 2BRUC 2YJ6A 3C0KA 3QFSA 4AO8A 3E8XA 3MBOA 3QPBA 1Q74A 3TW4A 5IJ0B 1CEQA 2V8OA 2ZUEA 1C0EA 3HBFA 1S2DA 3H65A 4P7KA 3TF5A 1FQWA 1O58A 2F67A 4Z1MD 1TNDA 4NFLA 4AMYA 1HDZA 3ZD8A 1NYTA 3IBYA 1D2AA 3T41A 2OB1A 3DOHA 3QSYA 3LXMA 1BC5A 3R5HA 1Q44A 2AN5A 4Q1FA 4UVDA 3SSMA 2IEZA 2FZ4A 5KW9A 3WYNA 2G80A 2FF5A 4BU1A 4PO8A 3I2HA 2WI8A 1GG5A 1RWPA 1X14A 2VOEA 4KTVE 5LXTF 2CXNA 3TFOA 3LW7A 3I9LA 3AR4A 5B1HA 1L5RA 3DMRA 1RDFA 2QSZA 2FDRA 3N2GB 5B2FA 1KZLA 5C9ZA 1X7WB 5AI8A 3HFRA 2VI5A 3NYRA 3O8LA 3L04A 2ZE8A 4OLHA 4EG5A 1C8VB 4C3OB 3WLJA 5AN9A 4GL4A 5JCJD 3GIRA 1MT0A 3DDCA 3HKCA 5ECWA 5HBGA 3C4JA 1RP7A 4G97A 1UOPA 3Q40A 2PBLA 2B4RO 1OBHA 2PMWB 4WA7A 5EFZA 4ISCA 4JL8A 4YRSA 2PX8A 4J2OA 3EPJA 3RARA 1VKZA 2M2IA 2PRYA 3BYZA 5KYYA 3TIXB 1XDZA 4GRIA 1G8SA 1WD7A 2HCTA 4EO4A 3ZKAA 3CQ9A 2CXSA 2JH8A 5AESA 1AX9A 1PR6A 4PZEA 2CK3D 4I4TF 1DC8A 1XD9A 2M98A 3U16A 4LYFA 2CLFB 1H0HA 5KTNA 2DH5A 2FUNB 3DT6A 4IFBA 1WZCA 4MQFB 2BUCA 1MHPA 3AB7A 4IG9A 2XJ9A 1DX6A 1Y1LA 4OL0A 3DQZA 2CMHA 3GRZA 3G9UA 3L7IA 3K2BA 4JLMA 2C42A 2M5SA 2RSLA 3PJDA 1Z5ZA 1D2MA 1TCVA 3D43A 4LZZA 1F14A 1B7GO 3MTIA 5AKEA 1F1BA 3A3KA 3D0OA 4MAMA 2H5EA 3ZCTA 5CDSA 1HDCA 1I01A 2VQSA 3K92A 4RPLA 4B9EA 4C0KA 5CFNA 2PMDA 4WRRA 1FNNA 1ZH8A 1ZU5A 1MVOA 5CTAA 1O97D 5BMVA 5C46F 5JTTA 1R0BA 5EXDA 2QRNA 3B38A 1L5NA 1G1MA 4OI2A 3BCHA 3D5EA 1U9CA 1MKYA 4MPJA 4AKEA 5IXSA 3IUYA 3V6MA 1KS2A 3GEHA 1FSSA 4RBNA 3T4XA 3QU4A 4R40A 4XM2A 3A31A 1ZIPA 1B0PA 4RIGA 3D2BA 1Z22A 4FFNA 5IAJA 1YB5A 5GOTA 3E3OA 1OAKA 2JZNA 4QULA 5JCXA 2LR0A 2HNAA 2AQ8A 2AUNA 3TDNA 4UAVA 4PG8A 1I2AA 2QTCA 1INLA 3HSSA 1Q57A 1W94A 4HFJA 2WSMA 3SBXA 1AVTA 2I80A 3QEMB 5HYVA 1I32A 5D51S 4BB6A 4JMQA 5T4BA 3BSSA 5JU6A 2Z6VA 3PRYA 3FOFC 1FQJA 5BO5A 1PL0A 1DAIA 3HE3A 4C2BA 3GDGA 4MOWA 4HO1X 1YZYA 2PZKA 3EVGA 4BFYA 2CL6X 3SSNA 5EZYA 3WLFA 3TLEA 2X5XA 3OFKA 4TTAA 1N06A 1Z2NX 3L1KA 1DIBA 1PNOA 5DTJA 1I6LA 2HA2A 4J91A 4OBWA 2CVPA 3PT9A 4QASA 2RI6A 4FR5A 3ZHZA 4AZ3B 1ZO8A 3HBLA 2GHIA 4EO9A 3MERA 3P45A 4WZTA 4EJSB 4IIUA 3R3JA 4HWOA 4YJ3B 3LVBA 3WOVA 4BVHA 1XMQB 3S5JA 1JMVA 5HIJA 4YCNA 4L2IB 4J4HA 5ARDA 2QLTA 1W4AA 5JS1A 1NUPA 2ZI6A 5ITVA 3DEJA 1HG0A 1KAMA 3Q0EA 1KDZA 4IDQA 4JEIA 2Q3FA 4JELA 5JPCA 1GYQA 3LQ2A 2E7ZA 3DE4X 1UK9A 4AL4A 2OORA 1ZISA 4PAMA 4OPMA 2Y1CA 1CUZA 2Y68A 3M6FA 2FX2A 4WJKB 4KKTA 3DOCA 1IQ0A 1EK5A 1NW7A 1A7KA 3WK5A 4HHEA 4W9NA 1GQQA 4EEKA 1RQLA 5K8LA 2O7QA 1ZHHA 3FPCA 1B2RA 4KQWA 3FFBA 4PONA 2O3UA 4Q39A 4B0OA 4R8LA 4IBOA 1PJ5A 2ZRMA 3EQ9A 4GOMD 1QBKC 4UUBA 1HBJA 1XLTA 4UDNA 1Y80A 1ZUD1 1Y5IA 1A50B 1XRLA 1R6DA 4F92B 1KDVA 2C9YA 4AJ9A 4DCMA 1Z2PX 1CS0B 1N9GB 2FPKA 2G8LA 4ZYTA 1FFWA 5AJUA 4B6FA 2G77B 4V03A 2OZLA 1U2RA 2VF7A 5BMVF 1TJ4A 5JDIC 1Z63A 1AJEA 2B4KA 4N9QA 3A0RB 3T3IA 1JLRA 3P9PA 1L7RA 4U2BA 1H4VB 3CKMA 3HG7A 4LHWA 4WPGA 3UJ8A 4GGMX 3WBFA 3A3OA 3ZK9A 1QTIA 1QIKA 4GM0A 1UC8A 1SVOA 4TUYF 1XPUA 4C05A 4HKTA 4ZIRB 2JKZA 4HNQA 4OPSA 4IAOA 4J0KA 3FTEA 4GE3A 4R1QA 4UM9B 5J3OA 1OXUA 1XHFA 3FSRA 2FI1A 3O92A 1Q3HA 4G0QA 1CB0A 3ELWA 5AVJA 1U31A 1QIMA 1J0XO 3AIKA 5G3ZA 5JNRA 5K4GA 5EJGA 4CF5A 1S8OA 3NV7A 1KI7A 1YQWA 3BXFA 4BEJA 4EA7A 1ZRSA 3PE4A 1LLFA 5AJVB 5KNBA 2P9YA 3OPQA 4GUAA 1RQPA 4Z4TA 2I2WA 3TYXA 1L7OA 4TYPA 4G6IA 2G5PA 4EYQA 1VP3A 1CTQA 3Q9NA 4HYTA 4M9SA 3RIYA 5E2BA 1E8DA 2VSYA 3QKUA 4X8OA 4MW0A 1R88A 2IF2A 1NQTA 2CVOA 4FHFA 1C8BA 4R4JA 4IDNA 3LO8A 7ADHA 1K68A 1PTKA 1XTQA 2BFBB 3I83A 3L4JA 2HHLA 4ZDKA 5IJ9B 3A3GA 1ESMA 2EWMA 3GJRA 3JX9A 3PC3A 4RFSA 3K70C 1WETA 1OXTA 3U31A 2O19A 1AT1A 1AKRA 3GGOA 3IJ5A 4I1YA 2YJ5A 2ZAGA 4CM7A 2ZIEA 3O4FA 2QL5A 1FRNA 4CNQA 3Q3CA 3I9JA 3QM1A 3QVMA 3PDHA 4I1OA 5TARA 3QE0A 3WRYC 1YU9A 1XOIA 1PQWA 2BTQB 3BVPA 2XCTB 1EAMA 1XKXA 3ZWOA 1NMYA 13PKA 3C8ZA 5DCYA 2R65A 2ZS9A 1KC3A 3I76A 3R40A 1CE8A 5KHLB 2X85A 3KHSA 1ADGA 3S2YA 2BJWA 2C3PA 5K0NA 3R3ZA 4CMAA 4Q1BA 1K9SA 1NGSA 1SU7A 2AH5A 4YUVA 1XYVA 4EPWA 2J7PA 1JDZA 2QLNA 4O4HB 2WY2D 3IMKA 2G6TA 3V55A 1K8AD 4TKLA 1AHNA 3V7YA 1SULA 1XTBA 1Y33E 4OL9A 4S1NA 1CZOA 2ZRIA 1J99A 3TBKA 2IS2A 3R7LA 1SBHA 2MYTA 2BMAA 3D7LA 1B42A 3KT3A 3UV3A 3PEVA 1M10A 2DY0A 1QS0B 5LBIA 3TS1A 4IG4A 3AI1A 1QKKA 4W5WA 1XMPA 1H2AS 1JSCA 3K96A 3IR7A 4G4JA 1TIKA 2ZJZA 4PO1A 1QONA 2IKQA 4H7HA 4C0JA 1Y3BE 1ISJA 4G0ZA 4WJZA 1YMQA 5HOQA 3V4SA 3ZY5A 1OF1A 4EB0A 1XE1A 3AEXA 4NRDA 1WB5A 1QYCA 2ODTX 1DC7A 2PFKA 2CXOA 4H3SA 1EFKA 2GREA 3DZCA 2CFTA 4ALLA 1ONBA 3AONB 2AJTA 3QUAA 5B4UA 1MABA 1DXQA 1WXEA 1X7YB 2HMVA 2BJHA 3FPHA 1ILWA 3FSJX 4EO7A 1NSYA 3A3PA 3OE7D 2C92A 3I2KA 4RK0A 1W4LA 3QWBA 3RROA 2TMKA 5AXAA 5SZHB 4EYKA 3L1VA 1YVRA 1DI0A 1XKQA 1VF7A 2OCLA 2JIQA 2QZZA 3STHA 1K6IA 5FT9A 4JR0A 4Y6OA 3PXGA 1UMBB 1ZM4A 3IP1A 4NCKA 1VKJA 2G07A 1YI0A 1T2CA 1N3YA 4AKTA 3RUHA 4I9NA 4XAQA 3TKAA 2D1RA 5DLDA 5LYJA 3WFZA 4JT9A 1CB7A 5JEDA 4FZ3A 4XFKA 3PKIA 1IXZA 1NW9B 1PQUA 3INRA 1S2GA 5BR8B 2ZYSA 4MR7A 2O07A 2YJTD 2FZWA 2IYNA 1GDHA 2JK0A 2Q6OA 3KL2A 1W2HA 2QMZA 1HDRA 1W59A 1B93A 2AXEA 1BW9B 1JJFA 2OXEA 5IYRA 1MOSA 2BLNA 4TV9A 3S1AA 1T2EA 3RUCA 3T3PB 1AKTA 1JQKA 3WG9A 4IEEA 1IQRA 3NDIA 1W5FA 2QX7A 3NM6B 2VQ6A 2ZJ0A 4JROA 4NCJA 2CNOA 2AG6A 4YRKA 4IXDA 3N53A 3L0OA 4WXPA 3AF2A 2Z6BD 3A1CA 1X7HA 1TJ3A 1WDMA 3GAFA 4LK3A 5TQ2B 2DWPA 5FTMA 4CGYA 1YKFA 1TYCA 1EDOA 1QKIA 1R74A 4YRFA 3UXEA 4YAOA 2PQMA 3QIAA 1T24A 5ICSA 3OLQA 4A8PA 5CH3A 1O03A 1RYDA 4X97A 3CXRA 2RGYA 2GLUA 3FF4A 2XITA 2FH5B 2IZ5A 3BIXA 3VC1A 2HBZA 1Z7EA 4ARZB 1B6RA 1PL7A 2ENUA 4YA6A 3R5TA 4C7OA 1NXXA 1OW3B 4AS2A 3AKDA 5DBGA 5HUQA 2YJ4A 3HWSA 3GNQA 4OM7A 3V7AA 2QT0A 4QYWA 3LWBA 2GM5A 3I9FA 2E3JA 3DWGA 3QXCA 5KQLA 2PKXA 1PYDA 2G09A 2WR8A 3D5QA 3OD1A 3FRIA 4NK4A 4ARAA 2APJA 1W35A 1DUIA 2RH5A 1FP4B 3DP9A 2Y9PB 3U4CA 1Z4QA 2OVBA 4RS4A 8ADHA 5JQGA 3EXHC 5BSYA 5F1PA 4BBJA 3NVMB 3A14A 1U6JA 2XQIA 2IQIA 4PCAA 4IQ0A 1TZBA 5D3QA 5A7HA 1N08A 1BNCA 1WPRA 5CB8A 4YGYA 1WKCA 3ANNA 5FADA 1J23A 3GFPA 4PAGA 1YR8A 3G0DA 2AX3A 3IIKA 3ND6A 4OGKA 2QGGA 3DTVA 4LG1A 1SUFA 4G2NA 2XTZA 5AI6A 3E48A 3PCTA 5F4ZA 3MM4A 5JZVA 2NPFA 1KI3A 2P69A 4LV8B 5G0SA 1EVKA 1WR8A 5DYIA 3ZJYA 3DJFA 2QTMA 2PIDA 3LHSA 2NNWB 3M5PA 3NHRA 1ODSA 4GP7A 3WWDA 5L7WA 2YWDA 3O26A 1LBEA 2IH2A 1S7GA 2ZRNA 2XVAA 1N0VC 5GJWC 5CLFA 2YZMA 2BL4A 2YASA 2V7WA 1M1NB 3TZBA 3TGPA 2PUFA 3E9CA 3SHFA 1XD2A 2FXVA 4ZCLA 2Q3EA 4KLNA 2YWJA 4MI6A 4REOA 1J20A 4YP5A 3HB0A 3ZXSA 2WU0A 4YRDA 3TM5A 4BV2A 3CWQA 2ZDQA 5SYNA 4KSCA 4RWEA 1WU7A 2P7HA 3AKCA 5EPOA 4TMXA 2C4KA 3PEUA 4ZU3A 4KK4A 1FDTA 1K27A 2X53S 4XVRA 3RS0A 3U3DA 4MI1A 4F4FA 2X2PA 1EGHA 2RI0A 4ZT3A 1K63A 3OLWA 5EL0A 1TC2A 4GPAA 3R3UA 1MORA 3K0HA 2ORVA 3BMQB 4DNRB 2NO7A 2PNFA 3G5LA 3H5VA 1NQVA 1MLDA 3EGIA 4LK2A 5DI3B 4B40A 1YSCA 1JLMA 4GC5A 2X13A 5GTDA 4X7PA 4WEQA 4BO0A 4E4TA 1T43A 1SU6A 1Z7WA 4MUXA 5HFJA 3RUEA 1NWHA 3SXUA 1DG1G 1WQ1R 1KYVA 1PZGA 2XQKA 1PDWA 2VHUA 5DSTA 3T5DA 1HLDA 5FI0B 3TZEA 3ZW9A 5MF6A 1NWCA 1SXJE 2V74B 1GPJA 5CB0A 4IIYA 3M4NA 4XJXA 2W6JA 2J7KA 5FB3A 3FOBA 5EKXA 1FSFA 4TWIA 3AR2A 3ORFA 1MAAA 1Q3TA 1T9GR 2AWNA 1ISIA 4XCQA 4EPRA 4Z4EA 1HX7A 2QUZA 1R00A 4M6WA 2Q9UA 2B7BA 2XAAA 5BURA 1OLSB 4TWBA 4Z1OA 4U7PB 3MHTA 1TAQA 1R8QA 1SG9A 4DMCA 1Z8NA 3IBGA 1E3JA 2A30A 1AHIA 1RJDA 3L7NA 4I50A 4UPVA 3TG8A 3GGCA 4KGDA 2UXBB 2JIDA 2EU8A 3BBLA 3F47A 3FA2A 4Q7MB 3MWDA 3MTQA 4G9BA 5KNBD 4RLQA 1TM5E 3SK0A 3A9SA 1XK7A 1JIJA 1GN9A 1XRQA 4XGNA 2GFHA 4A26A 3SHVA 1H1LA 1I8TA 2C5LA 4IHJF 4QA9A 4AXXA 1FMTA 1MG0A 2PBFA 2K2QB 1N8KA 3D6JA 2WIJA 5JZ9A 4M9RA 3L7KA 3CX7A 3LIIA 1XO1A 4RZSA 3RU7A 3QBEA 4A23A 4KDFA 3Q3JB 3HADA 4DMFA 5A03A 1YHQB 5F4JA 2C9MA 2DYIA 1FMCA 3BHNA 1KZ1A 1V8ZA 3HR4A 1I0ZA 1SNYA 2RHRA 4MV4A 3UHPA 4IDPA 2IYTA 3NKVA 5FLEX 1QR2A 2FN7A 3LOPA 4ZHQB 3N1UA 4JVOA 3VSAA 2O2YA 3GJSA 3WHPA 2IFTA 1NX9A 3NX4A 4XLLA 4FGWA 2VQEB 2RIRA 4G8CA 5DHSA 4ZWNA 1OFVA 3U7FB 1PQYA 4X7FA 3Q98A 1K06A 3OY2A 1VHQA 3LFUA 1ZHFA 1Y1QA 1PJRA 3N07A 2RB5A 4JLJA 5IAKA 5JTUA 4Z4FA 4N6GA 2BV3A 2AT1A 3KKKA 1OU0A 4R8VA 4UFOA 1BEEA 5EGNA 5DWDA 1CP2A 3UMFA 2P77A 4ZCTA 3AH8A 4CWAA 1CY7A 1X77A 3BRWD 3AJ8A 3U7RA 2FQYA 2LRHA 3BXGA 1RXSA 4I6JA 1YVUA 3DOUA 4DDMA 1NBME 5HZBA 1TUIA 2DULA 3E15A 4FYJA 4YQZA 5CJPA 3TRFA 4TVSA 4YDQA 3KQNA 2C78A 1NL3A 2FETA 4QO7A 1FBNA 3EIWA 3KSZO 4N5HX 3DGFC 4U0JA 4PABA 5FPYA 1ES9A 3SSAA 3QGMA 3BORA 6YASA 4XD7D 5FHRA 2PKYX 2W8BB 3LC1O 4MGIR 2LNDA 4PN7A 3FZEA 4LYEA 2ZI7A 4DNFA 1LS6A 1NASA 1EDZA 4Q66C 1GPLA 3AFIA 2P9GA 3D1LA 3HYSA 1T5HX 5CBPA 4AO7A 2IS4A 1IOWA 4LNUB 5B64A 1NRJB 1EHIA 2GN9A 4WESB 4XLTA 1U7OA 2NSDA 2XOXA 4GE0A 4NOLA 4O33A 4DZZA 5B36A 5HRUA 1OOEA 4U39A 1JJVA 2Y9MB 1OI4A 1TZJA 3KOXA 1ZOSA 5C52B 3BILA 4KQKA 2VNIA 1FDUA 1XLVA 3EULA 1LFAA 1ZI9A 3WP1B 2CJXA 2HF8A 4Z3OA 4TT8A 1M1XB 4I55F 3UK6A 3AVXA 2WWYA 1FSPA 4YT8A 3HUEA 1Y98A 3ITKA 2C7VA 3ENZA 4BIIA 5HQJA 4WVLA 3IAS1 1MENA 1M6HA 5EP2A 3MMZA 2O2GA 2CB9A 2BSQA 3K72B 2D0PB 4JNCA 3T12A 2IS1A 1JPJA 1Q1EA 1X13A 1Z5PA 5TC4A 3UWKA 2UUCB 4FFPA 3TOSA 4NXMB 3BL5A 1Z45A 3THXB 2AJCA 4LSWA 2HFKA 5DM2A 4OCZA 4LC9A 4RCVA 1T1IA 3L0SA 1NATA 3D3NA 1QHFA 1XK6A 2QYSA 1PV1A 4RPCA 3OECA 2HCJB 2GPYA 1I4OA 3PTLA 2XQJA 2OLEA 2YOHA 1EZ1A 2IYRA 3M9WA 4QXAA 3CXUA 2ZUSA 3ZLVA 3ER9A 2OXFA 4NIMA 1XLWA 3NJRA 2DT5A 3O3MB 4N5LA 3P0FA 3T3DA 2Q4BA 3PA2A 3DE2X 5B7QA 2UU9B 4TL8A 1J0CA 2PQ2A 2SKDA 1GRRA 1TD9A 3KAJA 3QEKA 4LRSB 4P5EA 4WBSA 1X7XA 1Q9SA 5B3AA 5KNCH 2RMKA 4PLTA 1GZUA 5B53A 2QW1A 4B8ZA 4OOXA 3DMNA 3H0CA 1T36B 3FYCA 2R6JA 1YFJA 1C9DB 3NBXX 2QRVB 4RA6A 1RZRA 2GJRA 4BLSA 4P9NA 2CZQA 4M38A 2VDJA 4Q3DA 5F4BA 4QHSA 1BDJA 1M6NA 3M4JA 1XZJA 4MRVA 2Y1DA 1SA0B 4E03A 1A2BA 3N75A 1MQ8B 3RYCA 1ARZA 2WMDA 4UMDA 3TTUA 1EDDA 2WF9A 3NONA 2ORWA 4K9KA 5K8TA 5THQA 4ALKA 1ZA2A 2WNHA 3WNQA 2FRXA 2H2WA 1N2CB 4E5KA 2YHAA 4V1CB 3TGLA 1QP7A 1NQAO 3VAAA 1ND6A 3GJ4A 3MTDA 2YW9A 4JI2B 5F9FA 2Q3CA 4BLTA 1VTKA 1KQOA 1WHSB 1JEYB 4H7PA 1PW5A 5CGZA 3V8QA 3GT0A 1I18A 1IBCA 3OC0A 3R8XA 1E3DA 2DMRA 4N0QA 1BKDR 1ZNZA 2NPIA 3RKSA 5I7FA 5KX5B 1D1QA 4QLAA 3BTUA 1R4AA 2BE7A 3DWFA 4M9UA 3GRPA 4MJ3A 3AFMA 4ND8A 2LGJA 4QAQA 1IAVA 3EMKA 4YP7A 1SK9A 1I2CA 4TQGA 4BFSA 4S1OA 5IVKA 3RVBA 5FV4A 2WF7A 3TCKA 1GRCA 2NVUB 1ZX1A 1RXYA 3H2JA 1IOLA 3IT0A 4M60A 3LX6A 3O4GA 3OFJA 3T7RA 3UT5B 3BE5A 5AJTA 4DS3A 1WVGA 1FVFA 2QUBA 1T9BA 3OQIB 3N8HA 3I4LA 3UCFA 2X0JA 1IXKA 2I6TA 3AQIA 3DBIA 3PPIA 3COZA 3GLRA 2DH6A 2G0NA 1HLGA 2INGX 2QHXA 3C70A 4ZCQA 1Z37A 3P0EA 5J2UF 1QIIA 2RDMA 4HJXA 1GNRA 5LQRA 1C4XA 3H17A 1JEQA 2QR3A 3L7OA 3FBTA 4BJ5A 1NNLA 1X9IA 2AUTA 2XWQA 1SFRA 3CUYA 4GLOA 5ED0A 4B7CA 3E9DA 4BTLA 1YZHA 3OKAA 1W46A 4N3CA 4RTSA 4K2HA 4EHJA 3D3WA 4QRDA 3MTJA 3E7PA 3HNOA 2X2EA 5I7HA 4G36A 2FUEA 3CESA 3TFWA 4C04A 3NHBA 4MKHA 1KY5A 2ZPAA 1IEVA 3VGPA 1GT6A 1KJWA 4I5FA 3MJFA 3IUQA 1BXGA 4PZAA 5F78A 4EPXA 1ZOLA 3DAPA 3PFCA 2V9CA 3U7QA 3EIHA 3L0PA 4TTSA 5KNCA 5IVDA 1YR6A 2VR1A 1YRYE 2VNAA 3NEYA 4R8MA 4PVCA 2EOAA 1UINA 3RC1A 4BECA 5E6UB 5D86A 5C8DA 2Q1TA 1NVWQ 4XQ9A 4GZ6A 2XWPA 1QO0A 4BRSA 3EZFA 4FBLA 2AE2A 1KMNA 4YIKA 1CJSA 2FZKA 3D6AA 3N87A 4US0R 5CVVA 4Z6KA 2VJIA 1CR2A 2YZKA 3CXCB 1PEDA 1WKBA 4PFJA 2HWUA 1IBSA 1JR3D 3EEYA 4FXPA 1GAXA 2GH1A 3G0IA 1NT2A 2IKSA 3JTMA 4LRTB 3RSLA 1YBHA 3IC5A 3R5KA 3DL2A 4EHAA 1GFWA 4FT4A 3MMSA 4UCFA 4D8WA 3H94A 5FULA 1OR8A 4XL9A 3PDJA 1XF1A 4AG5A 4ZI2A 1N33B 2FCRA 1N3IA 3CF4A 3H1GA 1EUCB 5ECGC 5EFOA 4EG0A 4F72A 2K7FA 1F4PA 4NY1A 2IYVA 4MK4A 3CLKA 2NU7A 4COOA 2XUGA 1T4DA 1KZ7B 2QP4A 1OXVA 2D2XA 2JAUA 3PC2A 1TYBE 1SU4A 1XEAA 1PKXA 3JZFA 4BU0A 5I4CA 1RXCA 2HJRA 3KQPA 3O1HB 1LB1B 1WMEA 1KI8A 2J30A 2VH5R 3E7FA 2R00A 5ILGA 4OA5A 4YVFA 4RY2A 5ETJA 2CCGA 3MG9A 2YV2A 4FUTA 1YJAA 4GXQA 5G2OA 1U11A 1GZ5A 1Y4SA 4FXUA 2HQ1A 2ZRAA 3A70A 2ZUFA 2OTJB 2WWXA 3V80A 3K71B 5ANRB 3PCXA 1VIYA 3M3DA 1XR3A 1QWOA 2EHDA 3EPPA 4IF4A 4WZBB 2NSHA 4B46A 2CXRA 4DIMA 4PY2A 4HYYA 1TU3A 4EAAA 4N01A 2CWDA 1XEWY 3DVAB 2JS7A 1A4UA 2PH3A 3BA6A 2BT4A 2DEUA 1N75A 3LCMA 3NHPA 4R98A 5E6TA 4NENB 1E2NA 4ZVVA 1YE5A 1FRQA 3P32A 2WJ4A 4CKCA 3LX5A 5GM1A 1DQYA 1BDBA 2ZVDA 3ZDAA 1V5FA 4EGAA 1R2QA 4WH0A 5EZQA 4Z9BA 1YZQA 5KWIA 1EB8A 1N05A 1SUAA 1VE6A 2UZ1A 2ZZKA 4MQEA 3N7TA 5F3WB 1DADA 1H3NA 4RX1A 1WX1A 4J0HA 4P4GA 3PHHA 4CVNA 5IUJC 2MSKA 3JALB 3KR1A 3O0DA 4RIIA 2Q5QA 1QRUA 2O3TA 4J4BA 3CZ5A 4HFMA 4S0XA 5K0JA 2ATIA 3ETLA 3M33A 3PYMA 1KMMA 4J8PA 4CHGA 1DCTA 3ETDA 1RABA 1WXXA 4JI4B 1HYBA 1A1SA 2VDMB 2Z83A 2QRLA 4TRJA 1NIPA 4E4YA 2ZYTX 2Q28A 1R6VA 3A1UA 3GN1A 4UEQA 1LPSA 2OAEA 4N65A 4JXJA 4PYMA 2F1MA 3QVOA 5L7YA 2I4RA 4CL0A 3C2QA 2F62A 4G5GA 2AFIB 4OMDA 1TF5A 3A11A 4ZDWA 1D6JA 1S1CA 2PH5A 2FSIA 2H4ZA 2Z8XA 2WJIA 3DBRB 4BX3A 1JU9A 5LDHA 1ODKA 1FP6A 2QW0X 1L7EA 1GYRA 2J41A 3K4HA 2F3PA 2WJZB 3C97A 4FS8A 2IV2X 3GAZA 3W3AD 4YWHA 1CR1A 1G21A 3HJTA 4BYMA 3ZDYB 3QE9Y 3DDOA 4WXRA 4YUWA 3B8HA 2ZYAA 1AXEA 3I6IA 4ZO8A 2R2AA 3GFOA 4RJ2A 3QSGA 3VVMA 4E5DA 4XX1A 1FFBA 3QPAA 4EB6A 3A27A 1UP4A 1U1CA 4FIDA 3RSGA 3ZIAD 1J5EB 1JHVA 3GXOA 4FWIB 4HAUA 4KQEA 7YASA 2O8EA 5LXTB 2HV8A 4TQ9A 1VE9A 2H31A 3EK2A 4NG4A 1AKVA 1H2XA 3B2EA 4UHBA 5FA8A 3TSZA 4ZHSA 3DLAA 1BO6A 3EA4A 2ZYUX 3HP7A 1Q91A 4PWZA 5CVTA 1Z6PA 3K9WA 2AFVA 4K1LA 3DP7A 3BICA 2H7YA 4NZOA 2FVGA 5EJFA 3S27A 2AZXA 1H66A 1ND5A 3G68A 3G0GA 4L8WB 1ZONA 6NULA 2O06A 4P4TA 2FDCA 4C2UA 1UBLS 3P5BA 2QPLA 3SKBA 4MQMA 5D00A 2XZLA 2WD7A 5DBOA 4Z4SA 1G7RA 1CUWA 4R9SA 2GZMA 4FFLA 4PLVA 1VGVA 3JYOA 3IV9A 3O91A 4IX9A 5KOHA 1Q0QA 4X6XA 5KKNB 2GCPA 3QX9A 4I4TB 1ZH0A 4Q4JA 3ZU4A 5CFOA 5JBIA 2R6GA 3KUUA 1T2DA 4NF2A 2FW9A 4F2DA 3WGGA 5KC9A 4HQRA 3AUUA 5EVCA 4C4RA 1JHXA 4D6XA 5TVKA 1QB8A 4FIZA 1D0IA 1NLUA 5CNJA 5CDFA 2XEXA 3AR5A 2V7BA 2V9PA 4ONEA 5D1NA 2QM0A 3DTNA 3UJ9A 2NVOA 1I2BA 3D8BA 4PLYA 1CZRA 1D1NA 4TRNA 1W8DA 3QHAA 4JLDA 1R9MA 2IE8A 3RFFA 1P3JA 4KXNA 3MMXA 5L95A 2FOLA 3QX8A 2H1SA 1II9A 2YZ2A 3B2NA 1MQSA 3E61A 4G0OA 3VXKA 3BB1A 1F38A 1O2DA 3PKZA 2IPMA 4I7EA 4TX1A 4YDHB 4ITUA 4LBVA 1P33A 2O7RA 5LYYA 4J90A 1BGXT 1C7IA 3KKZA 2WTXA 1JX6A 1YE8A 4G25A 2CLDX 2W43A 3EWSA 4HEQA 2IP1A 4XRRA 1FFXB 3QNMA 3RIGA 1FPMA 1ODFA 1VL1A 4MP3A 2GCIA 5HRAA 4FEGA 1BN6A 2JVIA 4MARA 3EPLA 4EA8A 2JCXA 5LZ8A 2WUDA 4JR2A 5BW8A 4Q18A 4N8EA 1G9SA 3MOSA 3OMLA 5I9MA 1V41E 5KKAA 4CCSA 4DLVA 2UYQA 4FK8A 5CHYA 2JLUA 1ZXBA 3BHMA 3ZBTA 4C6HA 4LZPA 4P9SA 5IC6A 4URFA 3DPIA 4YI3A 1K28D 1P4SA 1YB1A 2RAFA 1KD1D 4OU4A 4QIHA 4O2AB 1O54A 3TIIA 2OQRA 2JDIA 4KH1A 4TS3A 4CYMA 2AF3C 3OW2B 1L9XA 2QNRA 1EDEA 3BG5A 3VHLB 4DNTB 2QNBA 3HTXA 4QDUA 2DG2A 5GZ3A 1LPMA 5BOSA 1XXHA 4KRFA 2CLCX 1N4DA 1Z06A 3ZWBA 1XBTA 5J63A 3STXA 1U2QA 5ICMA 3ISTA 1Z5UA 4WIAA 1H9CA 1KERA 1Y7IA 2FSPA 1YQDA 3DEHA 3INYA 3LKZA 4PBTA 4KR0A 1EK1A 4MS1A 4PLFA 1SUPA 4C89A 5EVJA 3LCVB 2Z3WA 4ZODA 5BQOA 1TB4A 2X8AA 4JGBA 1EFTA 2CHGA 1XGKA 4L4UA 4HI0E 1MO2A 2YV3A 1A7JA 3GH1A 3KOYA 5JD4A 1ZP6A 2DOKA 1IJBA 1IVYA 1SCDA 1YRQA 1NTRA 1B73A 1IG3A 3B53X 3NEAA 2FMKA 1UBFA 4HADA 4OQYA 3JD4A 5HMLA 4IJVA 3V4OA 2P78A 4UCQA 3NR2A 3VPGA 2FUCA 2J4FA 2GK6A 2BTOA 2RCYA 2CV2A 4BFXA 4YMLA 1YKGA 3RJZA 2G17A 4FQ5A 1IY1A 3WWPA 5DDIP 2R5FA 4M4SA 1DAPA 3AL2A 1TPYA 4F9FA 3C14C 2XTAA 1JKJB 4DJDC 1P75A 2WFMA 2DBVO 3JXEA 1OB5A 4WECA 3P0RA 1Z74A 4P0PB 2NO5A 3LUKA 3SYRA 2ACVA 2NU9B 3OFND 3VQTA 1KH3A 5ICGA 4IV8A 3KSUA 2UZAA 1KC8D 1RU3A 1MGPA 1RHUA 2B99A 4KUHA 3AHFA 1T8RA 3CPJB 4IJ6A 4QFCA 5F77A 3RODA 4OU5A 4XOPA 4DA6A 4R0MA 1PV4A 2DBYA 1G8AA 4RPBA 4YQEA 4HEJA 2H8GA 4ZC1A 4I1PA 4XKWA 2OECA 2PTHA 1G6Q1 2M32A 4DEYA 1OFGA 4X0CA 4TUYB 5DNVA 4RMJA 3W5VA 2J9YB 3WLIA 2I78A 3PWKA 1FFDA 1J8VA 3HCFA 5BNZA 3I34X 2OGWA 4F84A 2BH9A 4MICA 3BFJA 3SF8B 4ZOLA 2EFJA 4Z2AA 1DIAA 2O8FA 4MUYA 2XE8A 1RPNA 3PUNA 1EUQA 1BMQA 2GCEA 2Y76A 4F86A 4LZLA 4HQOA 3TBHA 3WLHA 3R3VA 1FBTA 3AM1A 3CP8A 1CG6A 1GV0A 4LVOA 3RM3A 1GYPA 3IIIA 4XQEA 1E9EA 1WW2A 4KQ9A 3FTPA 4ZV4A 4BLVA 2WJJA 2GN0A 3JQAD 4H2DA 2EIHA 3PD1A 4JMLA 4R41A 3ZGYA 1WEKA 1F0YA 2AEEA 3EF0A 3M1LA 2X0DA 1SQ6A 4K1XA 1KWGA 2EP8A 2BY4A 3FHCB 3KD3A 2VDLB 1CUSA 3NHUA 2ZTGA 3AVWA 2Q1XA 5EJ6A 2B98A 3DL0A 2JEYA 4RJKA 3LAWA 5LDGA 1AS0A 2NYAA 4P6YA 3JYHA 4XKJA 5LWQA 1FXSA 2DYKA 2QORA 4K6OA 1RRGA 4XEHA 5JY6A 1S02A 3D6MA 3NHMA 4CXMA 4IV0A 2HIHA 4MPRA 4UM9D 1UKAA 3A4IA 2VF5X 3IR5A 5CH5A 4YB8A 4Z0PA 2XB8A 1UQTA 2EG9A 4IHQA 4AYWA 1YB7A 2L42A 1PUIA 1LEHA 3VU9B 5EYPB 1VG9B 3SR3A 4K6HA 1KMIY 4I66A 4DZRA 1T1SA 4U9UA 1FUUA 5JYEA 1JWBB 3FKQA 2YS7A 2VDKB 4IMRA 4BB0A 3GLFA 3H8SA 1Z8HA 2QAGA 1K8RA 2JIZA 4X63A 3EZ9A 1Q81D 2WB4A 4RL6A 1KQGA 1WCXA 3R3WA 2CCKA 5P21A 3U44B 3BZUA 2BI7A 5G02A 1VG1A 2AZMA 3FB4A 4H7EA 3B48A 4ZN6A 3DO6A 2NX2A 3G79A 1U2DA 1RQXA 3GI1A 5E7IA 3RRMA 5FAKA 3L0BA 4WFJA 2OV1A 4UQOA 1TA9A 1VJ1A 3T7DA 1YBMA 2RIPA 2A84A 3UG6A 1QNLA 5JS8A 3KPWA 4UPEA 1O6ZA 3NHLA 2IELA 2J45A 1D9XA 1IB6A 3ED5A 3GG2A 4IFEA 4PBRA 5DK6A 4ETNA 5L4LA 1RPAA 3H5WA 3IP6A 3PNOA 1IU9A 4FHCA 4IJKA 4TROA 4TTTS 4OB7A 5E6SB 4ABYA 2KBEA 2VKQA 4PINA 4XWGA 3EXEB 6CHYA 1L4FA 3RHZA 3OT4A 3OTWA 1A77A 1UOEA 3KWLA 2FFRA 4OH1A 4X84A 2C82A 4DBVO 4EW2A 1QE3A 1FDIA 3CLVA 1CRQA 2V55B 4CV3A 3E3AA 3ONWA 2WM2A 4MKGA 2ZUCA 1DC4A 2P9BA 5BWNA 3KLBA 3RKUA 3WK9A 3D26A 2E5FA 3KJIA 3WE7A 4QFBA 3KETA 5MHTA 2ADFA 4OHPA 1F8GA 3RVOA 4O2LA 5JRJA 4QUAA 5DW0A 2WG2A 4O25A 1NQOA 2R62A 4M7RA 4MYSA 2YHIB 1TTTA 4CQLA 4A16A 3ZCVA 4Z4VA 2J5XA 5AW7A 2FN3A 5FNVA 1QU2A 2W00A 4E2YA 4HWTA 1FE8A 4V3BA 3R0QA 5CK4A 3S1SA 1C1XA 3WS7A 3TW0A 3C6QA 3W04A 4A0HA 1P5RA 3HQ4O 4TL6A 4UMVA 1BE6A 4NJMB 3GHYA 1DIHA 3KIPA 4TRRA 2Q7OE 3OPMA 4KUGA 2Q1YA 2UUAB 2RHCA 1K0UA 2CJWA 1SBYA 3UKOA 4WERA 3NXSA 1C3OB 2D54A 3E0XA 3EXIA 4IVQA 4JLUA 3N5KA 3WRXA 2ZL7A 4C4PA 1ZRNA 4F5YA 3ZZMA 2CHUA 4OI4A 3GP5A 2C2XA 3OQMA 3AW9A 3PUWA 3UXMA 2GA9A 4IKPA 1OMOA 4AP9A 5IM5A 4AZVA 4DT1B 2QD1A 3EAQA 4ENTA 2PYDA 1R0XA 5LSAA 1W49A 3ADKA 2ETXA 4A10A 5C81A 1J0DA 7MDHA 4AICA 5JPDA 2I7DA 2WUEA 2V0GA 3IUJA 2PRJA 1M2HA 1ZU4A 2B6HA 5EI5A 3TWOA 1NXTA 5ELMA 2VUHB 3TXYA 1KZ9A 3T56B 2XMZA 2DZDA 3BE6A 1EPUA 3NM4A 1JFTA 1MVNA 4W7SA 2HRRA 4CLEA 3C4QA 5DI9A 1HMYA 3PQFA 3WX0A 4F1KA 5K45A 2WB2A 2F8LA 3BL8A 3ABSB 4JV5B 2J9FB 1MX3A 4ZPXA 1BYUA 5AUPB 3WV5A 1ZK2A 1UBRS 2B0JA 2EFGA 4F3TA 1UAGA 3O82A 4BB5A 1WCYA 4RZ2A 3OTHA 3Q5DA 1OXMA 5MN4A 2CXHA 1QKJA 2R47A 4P34A 3FPLA 4DJTA 4BJHB 3GGJA 3V4VB 4G4IA 4NU5A 2SCUB 3I5YA 3EIUA 5FBWB 3HABA 3QPUA 4G37A 4GZ5A 3WLAA 1E2HA 1UBEA 3L8DA 1NDUA 4LNAA 2BMDA 3JASB 2J6CA 1SELA 3B2QA 4Q4AA 4W8HA 2VDOB 1LPOA 5F7JA 3HJCA 5TX7A 1H0RA 1L7NA 3UKJA 4E46A 4PNEA 5JNLA 1VPWA 4CHTA 3NMUF 2V7VA 1MTOA 1CRLA 4TZKA 3LZ6A 3FI0A 2QX8A 4WOPA 3D8UA 4KAAA 3Q0TA 3HGMA 4HDMA 1TM7E 5EEGA 3GT7A 1TT5B 2P3SA 2OORC 1SUSA 2C07A 2JIOA 3GLIA 2ZVJA 4IDBA 4XIJA 3ACBA 3OBBA 1QDLB 3CKKA 3REFA 2F9LA 1HFJA 4DUPA 2FPGA 2FJ0A 5EMMA 4W9NC 1GLNA 4LYJA 3TZCA 1QU3A 3EZXA 2XMQA 3GVCA 3M6LA 2XWJI 4EZEA 1CJVC 4KXUA 1SUCA 1RMQA 3EGVA 4CJXA 1VLYA 5FPHA 2A67A 1EB9A 2IHJA 4FNGA 1XLTC 2FCAA 4G65A 4QBKA 4AUNA 2C7QA 4IQFA 4LQLA 3H42B 5JAUA 4KWEA 2R8XA 1BZYA 1GWNA 4QXMA 3SE7A 5K2OA 3AETA 2FKAA 1MH1A 5CT6A 2Z4SA 1ZITA 4E2ZA 5JZOA 1G7CA 3L46A 4NU0A 4LI3X 3CCLB 1AKYA 4LIPD 3TLJA 1P0IA 3ZVLA 5LKAA 4MW7A 1Q2UA 2JIMA 2VJLA 3QG5A 1NZFA 3ZC3A 4N82A 1DCKA 3KEGA 2FPSA 1XYYA 3DDUA 3PRJA 3UGQA 3VPSA 3VDMA 1BTOA 3VNQA 5KOJB 2D3TA 3K1YA 1DAEA 5DNEA 1E3WB 2DM6A 1DAOA 4QOEA 1ATZA 2VSQA 1DC5A 3GAMA 3LUJA 4K03A 3UO8B 3ETGA 3IDQA 1C7FA 3BKWA 3F6PA 4WUVA 3MJTA 2D2EA 3JAKA 2I4IA 2PFGA 3MWLA 1EVIA 2BFDB 2CHVA 2ZWPA 4P2NA 1W29A 3LUAA 5CX1A 1CR0A 1Z0DA 4INPA 1G55A 2HGZA 1DBRA 2IUYA 3U6BA 3RS3A 3CCQB 1E1KA 3HVRA 5E4FA 3KSAC 1EUZA 4KZPA 3HJFA 5BRNA 2IEBA 2FV8A 3X1YA 2I4LA 3ZDFA 3FDZB 1XEFA 3JPWA 3R2JA 4O02B 2LZ0A 4KK3A 4JBNA 4TTPA 2PUCA 4KN8A 5IYZA 2QR5A 4CM9D 1IM2A 1PT9A 2Y0CA 3HCEA 2WHXA 5TQ0B 3USZA 1Q3KA 4HLQB 4NG5A 3KVRA 2OTLB 1QZUA 3EVBA 4IHJB 1BQ3A 1L2TA 4CMIA 4GR5A 3AVUA 2OO7A 4EZBA 1EBBA 2DPGA 4A8HA 1CBUA 1UXJA 1WNFA 1CUFA 1KY2A 5TEWA 3NOXA 4MYHA 1KZ4A 3Q9SA 2VF4X 1V45E 3LL4A 1GLGA 2HXSA 3R77A 5C4IA 1JECA 2Y8EA 5DHTA 5B37A 4YREA 2BGJA 3GEMA 4IIBA 2DOGA 2CF4A 3JQPA 3MB8A 5EY5B 1TUEA 1J8MF 3RAEC 3MAGA 4FGJA 3DMYA 3FW1A 1XNGA 1KI2A 2G40A 4I46A 2R4UA 4HXGA 3VR6H 4G1MB 3NGMA 1YIAA 2Q5FA 4KVAA 2RBEA 1RI3A 1VZ2A 1G9XA 2J08A 2W4IA 2O59A 1B26A 3I1IA 3JVDA 5IF9A 1QIDA 2OMKA 3SQDA 3D2AA 4BKRA 1QGED 4KBYA 3Q41A 3S40A 1R5BA 2I2CA 4S1TA 3WLEA 3GWZA 2BGIA 4BMOB 1J25A 1Z7BA 3COPA 2SICE 1U0JA 1ZH6A 2XYHA 1GNLA 1BS2A 3F5FA 4TKVA 2EX0A 3FYSA 1QMPA 3PZBA 3H2GA 3R6GA 5EHQA 4YRGA 1K75A 3L6BA 1KVSA 4D5EA 4X1YB 4GO1A 4D74A 5AVYA 2P40A 3AFNA 2JZOA 3OUUA 1OPXA 1QCYA 3K6SB 1M34B 3KAPA 4UTOA 4OXXA 5EAIA 1XELA 3TQSA 3DQQA 1KOGA 4MZDA 3L0IB 1VI6A 4NPHA 4DM4A 3LY7A 2QRJA 3JQ7A 3K9GA 1JQDA 2ZSHA 1WSVA 2I3GA 2ZWOA 2ZT5A 3OU7A 1AHHA 5DM1A 4PXAA 1JQ5A 4POOA 3ZQKA 2I4OA 3OKFA 2CLEB 1TU4A 2QYOA 1YK1A 3D4BA 5LL6P 3G17A 4NMLA 4IUBS 1YJ5A 3OICA 1TJPB 1VG8A 1UZAA 2OBLA 3HVUA 4ID9A 4Q4HB 2CZGA 4DQ0A 1LJUA 1T3ZA 1VKNA 4F1WA 3KE9A 4XLZA 1HE2A 4WNYA 3HCNA 4ZDIA 3B3GA 4CLHA 3PI6A 5MGNA 3I09A 1L3BA 2Y77A 5HKKA 3ENWA 1OB0A 2E4XA 1XRMA 4UEJA 3S44A 1L8XA 3F2IA 3QJGA 4I55B 1RKUA 2IYYA 2V9ZA 2ZR8A 1P0FA 4OKIA 2ZSUA 3CNHA 1MJGA 3O1IC 1K4YA 1KFEB 2GWHA 4FB4A 5FPKA 2HWXA 4DV6B 1UKBA 2G1AA 1UJ4A 1QGUA 4E14A 4CQMB 4C88A 3DFKA 3EIEA 5C32A 3K0CA 1U2SA 1FFGA 1W6RA 3Q7RA 2CLKB 2ECKA 3VAYA 2QG4A 2ILTA 4NBVA 4CMHA 1A2QA 2FHSA 4DMHA 3DAHA 3DTTA 4Y1GA 2VPYA 2BFCB 3WGVA 4UHJA 2JCYA 1UMDA 2EBUA 2ZEJA 5LQKA 4S05A 3KXPA 3UT6A 3V7NA 1U0BB 1N6HA 1N07A 2A0WA 2VT2A 2ZWVA 3L7LA 1T9KA 3PHJA 2JFQA 1PJCA 1ZMXA 2BHNA 3RJTA 4A1OA 2R66A 1CJCA 2ZJ8A 2VPPA 3A9TA 3FWPA 3GLVA 1VJRA 3QWHA 1W96A 5HXAA 2QD3A 4CG3A 3UMBA 3L4KA 1ZH2A 1TVKB 3ABIA 3M6MD 3QXJA 2OBYA 3UOWA 3DH0A 4NZNA 2ZT7A 1A72A 3WLSA 1GY8A 3F6SA 3KXDA 1E5LA 2BKXA 4KQ1A 3DV0B 1W88A 1X80A 3BGVA 4I3FA 5L4NA 1DVRA 3R7BA 2UDPA 5J9FA 1UKVY 1ZXXA 2VAXA 4LFCB 1QX3A 3VPFA 3EX7C 3G6WA 2AFRA 4G5RA 1GZHB 5HQ3B 5IVHA 5JS2A 1UXOA 1K6EA 1N7IA 1US8B 3CFYA 3K16A 3ETNA 2UYYA 1LRKA 3RS2A 3OZAA 3Q38A 1LK5A 3LX4A 1BXZA 1X8XA 3KHTA 2OHOA 3BMOA 1Q19A 1SWWA 4QUZA 3CLHA 4HK4A 3V33A 4UE3S 4B6GA 4KRYA 3A2NA 3SZLA 2FMUA 1P9WA 1FFSA 4GPEA 3E9YA 3ZJ4A 4J94A 4CL2A 4HGNA 1YA6A 1AUVA 1LSSA 2JANA 3AMVA 4C0SA 3F4LA 4IUDS 2GEDA 2OXTA 1KI6A 1YQUA 3NBZC 3NUQA 4FX2A 2J0UB 2VPQA 3HY6A 4MVCA 4O6VA 1RXVA 4W1SA 1XTPA 3CONA 1J7JA 3I2YX 5DT2A 4FYMA 5H70A 5FOTA 4TGLA 1DZIA 3T3MB 1TYZA 3TPCA 4DUGA 4DDTA 4E7PA 3ZV6A 4ZXFA 1X0XA 3GFQA 2LV8A 3FKSA 3UICA 3TUZC 4TSFA 3TR6A 3ZW8A 3K70D 1MB0A 5CLHA 2PGLA 3IVCA 1K4KA 1TIPA 4CMCA 4DDWA 2IYQA 4OLFA 5FFNA 2ANCA 2GUGA 2V6MA 2AD1A 1V26A 4Q1CA 4DILA 3ROPA 1E1RA 2VSFA 3OLXA 4W7HA 3MGKA 2GVNA 5A4FS 1XAHA 5I9IA 1XN4A 2HQOA 4PG6A 4YMGA 1Z4KA 3CCRB 3E3LA 3RFXA 4FYIA 5I7WA 3H5NA 4B7UA 2AZTA 4WN9A 1KI1A 5DBEX 5DKFA 1UDWA 2E4VA 3DMGA 2FRVA 3AVTA 4I3GA 4MV8A 1BOFA 1G21E 2EP7A 1E3EA 4JGGA 2HO5A 4DBLE 2QP9X 2C7BA 4F8YA 3ESXA 5J2UB 3NHAA 5JCOA 3STUA 1KSHA 1BD4A 3SX2A 4HB2A 5IWCA 4GSYA 5KSOA 4S24A 1BMTA 1L7MA 2AN1A 5EJEA 5I6DA 2DY1A 1JQ3A 2X14A 3HV0A 5KQMA 2PLAA 4M83A 5BN5A 4FMBB 3DBLB 1KBQA 1S89A 4M1YA 4EBFA 5AK0A 3D4IA 4DUYB 3WIVA 3BNWA 1B1AA 1E2PA 3HEMA 4M9XA 4XSVA 5D3MA 4YP9A 4XYGA 3T7CA 3U9LA 3G2IA 2VRNA 1BMFA 3D2CA 1UD2A 2GJ8A 2YFHA 5EKUA 1Q16A 2IT1A 3LXXA 4RKEA 3KYDB 3IIEA 3AG5A 4XARA 1PFWA 5G4KB 5GZ6A 4AN0A 2H4JA 1NF3A 1UDCA 4Y6RA 3VYVA 3ELBA 3SJPA 4GYJA 4OB8A 1VQMB 5CPBA 3WGKA 4HAYA 2WD8A 2A4MA 1VJCA 5DX8A 3RHTA 1H8HD 3AHHA 2ZS8A 3BQNB 3KJNA 3PEEA 3WICA 3GEDA 3GC6A 1HSOA 5H59A 1IBKB 4DJJA 4B6RA 3ZE0B 2IX3A 2R8YA 2GJ4A 1YFZA 2G3YA 4QGBA 4QJ4A 3RS8A 4FC7A 2C96A 4DGQA 3MS7A 1PR3A 3H1FA 2ANBA 3PUKA 5EESA 3FCUB 3K7EA 3SWWA 5TJHA 5IWAB 1AKQA 5D3ZA 1H2FA 2JPDA 4JUCA 1A8HA 2CD9A 4AJKA 3LT2A 4D56A 1Z25A 1KJYA 4JYMA 5CDFE 5FPSA 1SOWA 4N3AA 2ZJ4A 2OBFA 2VPIA 4M7WA 5H81A 2WUVA 4W5QA 1KR2A 2PZJA 3KT8A 3VZPA 3HDQA 3LWNA 5EIHA 3WYFA 3L4EA 5G40A 1AQLA 4DBZA 3LE8A 2GYWA 2JCVA 3CO0S 2CWWA 5F98A 2V7GA 4UUPA 4O1MA 3L8CA 4AF7A 3LCJA 2PIAA 2YXBA 5GONA 2O3RA 3O1JC 4HNAB 5CNKA 1E3SA 1K97A 5EE9A 3UMYA 1GTSA 4KG7A 1TT7A 2CLSA 4M1MA 2JF0A 4M98A 3OZDA 3PJFA 4N0PA 4JI5B 1WCWA 2VJMB 4WLEA 1Q21A 1M0TA 2BEKA 2RGBA 4P3OA 4C3UA 4EOGA 5JAMA 5LPNA 2ID4A 4R2MA 1ZVKA 1E32A 3HUFA 4RVNA 1EE9A 1T8PA 3HPQA 5FO0A 4FE3A 3T3HA 3B8EA 2JCGA 1T3TA 2Y99A 1F7UA 4CKWA 1DOAA 1TQ6A 4RQAA 3U40A 2QN7A 2NQ8A 3U61B 3V8BA 3A06A 1JFFA 3SQLA 4I5IA 2WF5A 2GO7A 4ERNA 3REOA 4DB2A 4R16A 3QFRA 1I4DD 1S9HA 1DEKA 4HWSA 2YZNA 3CMCO 2KI5A 3RR2A 2X9NA 4FMDF 2ZJOA 4Z1MA 4IOJA 2BISA 3I0NA 1N57A 4CODB 4UNQA 4BPRA 2X15A 1JEOA 2QMEA 2OAP1 4GYWA 3RDPA 4EDHA 4F2HA 4KPYA 4QNNA 3O3NB 4AM8A 3ME5A 4EW3A 3OOCA 2IVZA 5BT8A 3LDGA 4X1IB 5B1DA 5A9SB 1BYIA 4C76A 5AW0A 4GS5A 4N5MA 2ZTSA 4RH0A 5E2AA 2DTEA 5HUJA 3OPVA 1VKHA 2V4UA 3D7NA 4ROSA 3EEOA 3CVXA 3EOBI 3KBOA 5JCJA 1DLJA 2RK3A 4RKRA 4IOLA 2X3YA 1MAWA 1J2YA 3U7GA 3ESRA 3PPVA 4MRNA 4PZLA 2HFJA 4DF3A 2OC4A 3RO7A 3F4KA 1Z18A 3SC6A 1F3LA 4CT4B 3UJ7A 4ER7A 4C2AA 5FR2A 3Q1KA 3GIDA 1A2OA 1PWYE 2EFEB 2C3MA 2G7ZA 2XRYA 3Q3HA 3SS7X 5HJ7A 2C3YA 1DPFA 3HA5A 3PFKA 2CK3A 3TSOA 2PMFA 2O8BA 4C0WA 1E9AA 1UEIA 3PFFA 4MMXB 4TXLA 5JI2E 5LIRA 1VQ4B 3ONUA 4UTZA 1VYHA 3GBPA 3K6RA 4CIXA 2E5LB 1FXWF 3EDQA 4IHKA 4XB2A 5DSXA 1G2QA 1M2OA 2CJFA 4U6SA 5JW6A 5JAPA 3D54D 2YINC 1ZL0A 4L75A 5C34B 4YV0A 4BFTA 3FNHA 1G4UR 2X0KA 2FWJA 1NJ8A 4B84A 5LNK1 4TT3D 5C4GB 3V97A 5B30A 2GJPA 3WZLA 3JRXA 2PLRA 2VXYA 5J5CA 4YJHA 5IUKC 1ZJ6A 4DIOA 3LU1A 2W90A 2G7MC 4DNQA 1V6CA 1Y5MA 1Z8FA 5F2NA 4D4LA 2LXNA 5GONF 5K1ZA 3UXHA 4LSZA 3P4XA 3QLTA 2B8EA 3ETHA 1XFAA 4JXKA 4E0BA 2C1ZA 3OCWA 1DWUA 1Z0ZA 2O3SA 2ID7A 1VPLA 1KEZA 4CF4A 1LPPA 5JS6A 1MIHA 1VYTA 4KE6A 4KAFA 1T0JB 3PKJA 1V9CA 4OY3A 3MQ2A 1UUFA 2Y71A 3IR6A 4KLRA 4W5JA 5BN4A 4BGIA 1XAJA 2NUPB 2P2YA 4OV6B 1JAIA 3OI7A 1VYVA 3W77A 2IU0A 5REQA 1XDGA 5BNIA 2D74A 4FZVA 4DOMA 2NOAA 2VHCA 3RV4A 3L8ZA 4G86A 2XGGA 4PFKA 3GEPA 3L8YA 3SC3A 2XGMA 1KZHA 3R9KA 2I7CA 2V1UA 4ED9A 1O8BA 1TO6A 2BHRA 4B17A 5C1BA 2E85A 3GZNB 4UQLA 5KTOA 3U3JA 2KHZA 1VE3A 2EGGA 4KIUA 4EUFA 1B8VA 1VSBA 3D7MA 4D9MA 4PW0A 3H1PA 1Z6TA 4JBGA 4ZFNA 5EG5A 2GF0A 4CIAA 2GYYA 4R2LA 2AXNA 2AJLI 3VHXB 1GPBA 5I9NA 3DOFA 8OHMA 2DUMA 2FW1A 3E1KA 3GDOA 1Z16A