3CRZA

Ferredoxin-nadp reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
257
structure length
257
Chain Sequence
b'SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKISPRMGEPGDYLIERAFVEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP+ reductase
publication title X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 79
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3crzA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3crzA02
5TV2A 2YWFA 1IB0A 3ZBUA 4RD3A 4DQKA 3WYAA 3B8HA 1KRHA 1GVHA 5TR9A 2AHOA 3OJXA 3G4SB 1TLLA 2BV3A 3AGPA 4P6VF 4ZCLA 5TY0A 1VQ8B 2D74A 1EP3B 2FX3A 4ZGNB 1OB5A 1KTVA 2XEXA 4QHYA 1Q86D 3CCSB 3P27A 1YJ9B 5H5JA 1TUIA 3ZZ0A 3CCUB 3MCAA 4TN1A 2B7CA 3CMAB 3PENA 3CC7B 1F60A 1OB2A 3VO1A 3P26A 3QFCA 5AN9A 4LBZA 3CCQB 1CQXA 1HA3A 2C77A 1ELOA 1G7RA 1I7PA 2QDXA 1XE1A 1N8RD 2DERA 2OTJB 3AVVA 2RC5A 1D8TA 2PMDA 3U6KA 1D1NA 3QFRA 2QMUA 3AVYA 3ZC3A 3CD6B 4G1BA 1K73D 1KJZA 1R5BA 2HCJB 4J0QA 1DDGA 1SKQA 4RD0A 1NJID 1IJFA 3FPKA 2BM1A 1M90D 2EFGA 1JB9A 1AIPA 1DG1G 1FDRA 2DY1A 1Q7YD 1ZM9A 1VQKB 1QFJA 4ZV4A 4HE6A 1QG0A 1VQ9B 1QUEA 1JA1A 5GV7A 3WNDA 3JQQA 4TMXA 3WBJA 3CCEB 1H85A 2VNIA 2VNJA 1VQPB 4YAFA 1OGIA 2BGIA 2E1RA 3ZZTA 1FRNA 4FN5A 1BX1A 1NDHA 3MMPA 1H42A 3I55B 1W87A 4F7DA 4ZGQB 1QVGB 1QX4A 4LBVA 3W2GA 4IW3B 2OTLB 3VNUA 2QN6A 4HE5A 2B5OA 1ZM2A 3WXMA 1EXMA 3ZZUA 2HDNB 1JNYA 1IJEA 1DARA 5FA6A 1D2EA 1N0UA 1VQ4B 3W5UA 3CCJB 4EH1A 3G71B 1E62A 3VNVA 2PLFA 4NBSA 2YWEA 2BSAA 1Q82D 5DSZA 5EMNA 2X3UA 1F20A 1GR1A 3CC4B 3E1YE 2HMAA 2QEXB 1SM4A 3CPWB 2OK8A 3OJWA 4M2LA 1VQOB 4YHBA 2YWHA 4Y9RA 2QA4B 1FNDA 1QGYA 3QE2A 3CMEB 4ACAA 1K9MD 2ZITA 2BGJA 1VQ7B 4AF7A 3CCMB 1EFTA 3CRZA 1YITB 2DCUA 4B47A 4RD2A 3I56B 4N3NA 3LVBA 4QFMA 4B4DA 3W2HA 4FWTA 1K8AD 4TMTA 3W2EA 1S0UA 1YHQB 1YJNB 3LRXA 1KC8D 4LBWA 4RD6A 2VYQA 1FNBA 1ZUNB 4PGOA 1CNFA 4PC7A 3LYUA 3WNCA 1FNMA 2J7KA 3AVXA 3ZBTA 3CXCB 4PC3A 1EP1B 5H59A 2OK7A 3CB4A 4P3YA 3OZUA 4LBYA 4LC0A 4DQLA 2VZLA 1M1KD 1J9ZA 5GV8A 3CC2B 2BN4A 1ZM4A 4N3GA 1R5NA 3V76A 1CNEA 4TMZA 3W2IA 4ZCIA 3OZVA 1VQNB 2BM0A 1OGJA 3AGQA 3FJOA 1EFUA 4YAUA 1TTTA 1FNCA 4B44A 1S72B 3J81k 1G7TA 3B82A 4M53A 2XNCA 1QVFB 4WQMA 1AMOA 1QGAA 1XB2A 1YJWB 2C78A 1KK2A 4RJLA 2QTLA 4YAWA 2GQFA 1EWYA 3G6EB 1JJ2B 4M0LA 3W5VA 3OW2B 3WY9A 1W34A 3QSYA 1U2RA 3JQPA 1QUFA 1VQLB 2BMWA 3LO8A 1BJKA 1ZM3A 4YAOA 2YWGA 1DDIA 1QH0A 1VQ5B 4U9UA 3B78A 4TMVA 1R5OA 2DEUA 4ACBA 4PC1A 1QGZA 4PC6A 1FRQA 4YALA 4G5GA 4G1VA 4B3XA 1VQMB 4RD1A 3U2QA 2RC6A 1EFCA 1GJRA 1GAQA 1B23P 2B7BA 3VMFA 1QFZA 1KD1D 3AVTA 2XNJA 3JQRA 2BPOA 3CCLB 4ZCMA 1BQEA 3QFSA 1KK3A 3W2FA 4C43A 4RCYA 4B43A 1A8PA 4RCZA 4MYTA 4AC9A 2R6HA 2VNHA 2GPJA 3QFTA 1BX0A 2BVNA 5KSWB 3E20A 3OZWA 4Q7JB 3WNBA 5JBQA 1JA0A 4Y9UA 4NCNA 1VQ6B 1Q81D 4AF6A 1YIJB 1EP2B 5THXA 3CCVB 4R71A 4H9GA 1E64A 4FK8A 5HXBA 3W5HA 4PC2A 1G7SA 4M1KA 3VO2A 3SJZA 1W2BB 1E63A 1GO2A 2VNKA 3CW2A 3A1FA 3MHPA 1G7CA 2EIXA 3CCRB 1KQSB 4C0SA 4UAJA 2CRVA 3AVUA 3U6BA 4MYUA 1TVCA 1QFYA 3ES9A 4TMWA 4BPRA 3WBKA 2BF4A 1UMKA 3I1FA 1W35A 1B2RA 4RD4A 2CNDA 1GAWA 2DETA 2NPFA 1N0VC 4M4SA 2QTZA 4B48A 4Y7CA 1YI2B 3AVWA 1KK1A 1KK0A 1WDTA 4K1XA 2PIAA
chains in the Genus database with same CATH superfamily
2OT3B 4LHEA 1T9AA 4XRRA 2R1ZA 2FZ5A 4LISA 4EUKA 1KP9A 4LXTA 4PYNA 3GRYA 3TLXA 1PSZA 2YNMD 3LBFA 4I5EA 1A2KC 3TEJA 4N76A 1VJ5A 2EWWA 3PRKE 2H7YA 2DSNA 5JNVA 1EWVA 1UPXA 2BGLA 2H2AA 4XN0A 3KXKA 3AY6A 4R3UC 1AXRA 1P1KA 2BFBB 4L5CA 3X1ZA 5JCXA 3I6MA 3K73O 1Y3FE 2OUIA 2F8LA 3WJ1A 4CCAA 1NXVA 4I4TB 3H4IA 2Q5FA 4AKTA 3TF5A 4BAUA 4OOSA 1A95A 3D7KA 4G2TA 4IIXA 4EEZA 1CDOA 1IWBB 5J4KA 4XONA 1THGA 2RHOA 2QQEA 3KJIA 1XYVA 3CXRA 2Z5FA 1CZKA 3TQQA 3JSAA 4NTZA 1EDZA 1GUDA 1HT0A 1P9WA 5DS0A 2FPGB 2R6JA 3A1NA 3DE2X 2DQKA 3OJ0A 4MQ6A 4MVXA 2RGWA 1M3SA 1XMOB 4RTKA 4IHQA 4OXXA 1SG0A 1UBMS 3G1TA 4QHYA 4CKBB 3FBTA 4RVGA 3WA6A 4EMBA 4U2KA 4ZGGA 5JDIA 4PGMA 4PABA 1KH1A 3NVDA 2WQZA 3EDYA 3OPNA 4BUZA 4QBGB 4EMTA 4PZLA 2P4EA 4UQLA 3USCS 2IX9A 3OX2A 2H11A 1PFQA 1UZNA 3LW8A 2PT7A 1BCSB 1R9JA 1MB9A 1ZN2A 3AX6A 1WOPA 1AOXA 1XRJA 4PHFA 1QLWA 2G6TA 4YAJA 1E2HA 2AOUB 3GGCA 4ZQBA 2C61A 2RI0A 1UP7A 1AF4A 3MT7A 2GJ8A 2P8JA 4YPOA 5L6MB 3HJAA 2RGCA 2ZTUA 3QPVA 1C30A 2W2MA 1R0WA 3ZLUA 3BCDA 3RY8A 3AF6A 1OW3B 3GJ3A 4HRXA 3U4MA 1Z13A 1G8JA 2EZ8A 2H4YA 3R2JA 1ESMA 2RIRA 2ZS9A 3MRVA 2OYNA 4S0XA 3C85A 1UKVY 1CZNA 1R7RA 1XQVA 1XTQA 2ZSFA 3OU2A 4WOPA 3RWOA 4WK2B 2FWNA 2ZL6A 3DV0A 4GFDA 2AZMA 5E1MA 4BGDA 2V4ZA 4X44A 2W70A 3CUVA 1CQXA 3L82B 4MPTA 2QG9A 1FLVA 3SZOA 1VJSA 2OZEA 4D0LB 1FLDA 2PWYA 5CCBA 5KIAA 1Z3CA 2OUKA 3BMOA 1BCRA 1XE1A 3B20A 4J4TA 1N8RD 3UM9A 4BV9A 4BZXA 1QZUA 3H1FA 4AMGA 1DC4A 1UXKA 3L6RA 4I7EA 1AVTA 4HZUA 3AUAA 4CU5A 2XSZD 4UPEA 5A1JA 2J59A 2XBMA 1D1NA 2M6RA 2WLTA 3NH6A 3QUTA 4Q00A 2ZRFA 1A04A 2HJSA 2ODNA 2PO5A 4OU5A 3MJ4A 5CX4A 1RWWA 3ZTWA 1W1WA 2TRSB 4YRAA 4EGSA 1YFLA 1FZTA 1GFIA 1TQ6A 3AR6A 2CSUA 5CB8A 4QASA 1M0SA 3NHFA 2FR8C 4WNAA 2JASA 1OLOA 3MOGA 4KR3A 1Z75A 2X8JA 1JH9A 1SIWA 1QDLB 1I4TD 2EQ5A 5ALKA 4M3NA 2QMYA 2Z8YA 4LJ4A 4MINA 2GHQA 2J87A 5JWHA 3RC3A 2VJCA 4BEWA 1UJMA 3HZZA 5IW8A 3T5TA 5ITWA 1X7HA 5K03A 1EEXB 1V96A 5C8YF 1FDRA 3PL1A 2DY1A 1J90A 2QUZA 3JQFA 4I6GA 4MP3A 4MV7A 4O4HA 3EQ6A 13PKA 3TQIA 1ZM9A 3N8NA 3C3PA 2BGUA 3K3PA 4XCVA 5I7OA 3QY9A 4PRKA 3LLVA 2XGJA 1DOHA 1ZNXA 3LUFA 2I4MA 2HPVA 3HCNA 4WN3A 5JVDA 1XMVA 2D4AA 3A3YA 2CGEA 3GA0A 3IUJA 3NBZC 1QHEA 3RJ9A 2P3LA 1VLJA 3TOXA 3U7IA 2E3JA 2PK3A 3RRFA 3FHLA 1BDIA 4OKNA 4K6GA 2RHWA 2XYGA 1I7LA 3QM1A 4GPAA 5I9LA 5JI2E 3GDFA 1VJRA 2ZSIA 2P3SA 1YT5A 1ZL0A 3NW9A 5J4HA 2KSQA 1NBEA 1SOUA 4CLRB 4JI6B 3WLOA 1GILA 2C8LA 3CCEB 2PV0A 3ZJ5A 3ZEIA 2A8YA 4YAFA 1JHUA 3AM3A 1C8KA 1XZFA 3K2EA 4Z0PA 3W5CA 1Z62A 4ZRMA 3TUZC 3PEFA 2XBUA 3D8BA 2FX2A 2CXTA 1BX1A 1NDHA 3PUIA 2FCAA 1UKEA 3H2SA 3ERCA 3UAVA 3KKOA 1R8XA 4D4MA 1SKMA 1ICIA 1QX3A 3R0XA 4NOKA 4F7DA 4HXEB 3UBTA 4BNLA 1IBKB 4LY6A 3REQB 1NWCA 1IXSB 3AI1A 4AB1A 5CFMA 2HF9A 4DRYA 5FUWA 4D3YA 4EGJA 3GEEA 4HE5A 2FSHA 2HNKA 2XYHA 4FW8A 4D9JA 3N0WA 4WZEA 1RYEA 1X2EA 4ONEA 3DVAA 5FA6A 1X80B 5KKAA 4FMPA 1QIHA 3FMGA 4G26A 4KSCA 3BEDA 1OXSC 3QXSA 4QREA 5ENVA 3MERA 1KDTA 3BE8A 5IVHA 1N7GA 1R12A 3LQYA 4Q3KA 1JFTA 2XT6A 3RWBA 2DOGA 1U8YA 1OY1A 5JCJD 1APBA 3KTDA 3QTBA 3WWPA 3I32A 1Z29A 1DIHA 3AO0B 3EDCA 1N2SA 3ABIA 2BT4A 5M3BA 4ALNA 2ZCJA 4A1OA 3TX6A 3PYMA 1YONA 3B5EA 4NYMR 5IT4A 4LHWA 5JSKA 3N8DA 2GMWA 4BVHA 4HH1A 2OXCA 5HRCA 4B80A 4IIEA 3CJQA 3DOCA 5KWVA 3BJMA 3QUBA 2R7MA 4D56A 2L69A 4Y6OA 2FK7A 4DRXA 2PUWA 2YY7A 3DKRA 4ACAA 1MA0A 1QIIA 2QDKA 2QD4A 2XMCA 4F9EA 5A3RA 4MR7B 3W7BA 1VQ7B 2P6UA 1O95D 2QD5A 3X2EA 4A0FA 5C9ZA 2C82A 3F74A 1TCUA 2AK3A 1GLGA 3MUOA 3QK7A 3QE9Y 1W30A 2BTOA 4AROA 4CT0A 1ISMA 3BZBA 4OIMA 3UCXA 1Y3CE 2IOYA 1IIRA 4F3TA 1AKNA 1RHUA 4OJMX 4PSCA 1E9SA 2XA2A 1PKXA 3E1SA 1RYHA 4JB8A 4OAQA 3UQZA 5ICEA 2B2NA 1AMUA 1A5AB 1AKUA 2GHRA 3ZNNA 3WNVA 1SVSA 3S68A 3FVTA 3TL2A 2DFTA 1YHQB 1XRMA 2W7TA 4YRTA 4Z2YA 1IZ9A 1FTGA 3KQHA 4G0ZA 1TC1A 2DKOA 2WMOB 5K3SA 4IMPA 1H6DA 5CM8B 2H4FA 2R65A 2ZT8A 3W04A 2EHDA 4I50F 5AXCA 4ZK6A 3TSOA 4OI2A 1IM8A 1UWCA 4EAQA 1JXMA 1M34A 2FPXA 5LZ7A 3AEZA 3SYKA 3WRYA 1CEYA 5ERYA 4F21A 3U5TA 1M0EA 3BRQA 1OHHD 3FUTA 1BHJA 1KI4A 1Y1QA 2G1AA 5AVYA 4JP2A 5JNSA 4C08A 3NNNA 3O73A 5CBKA 4GBJA 2QROA 2IXEA 3M6LA 1QPBA 2QSZA 5HR5A 3K31A 4DCOA 3GX1A 4CIDA 5ITZB 3QZUA 2IDMA 1HFEL 4GGMX 5TPWA 1J5XA 2PN1A 1Z34A 4BNXA 1AKYA 4QUDA 3W6UA 1WB5A 4UCFA 3EIXA 3KEOA 4HWPA 1GPNA 3IAXA 1VXRA 4HAXA 2YVAA 4ZV7A 3L0IB 3ONDA 4KJXA 1J9ZA 1UK9A 1LDEA 2YJGA 4ZODA 1Y89A 2OV1A 4EMUA 1A2BA 2UZ3A 3IPAA 3HHEA 2G9NA 2HI0A 4URUR 1C3XA 1GCOA 4KQ2A 2J3DA 5EIBD 1MNAA 2MINB 3CISA 3W2IA 3F3KA 3GXOA 3HBAA 3MRXA 4GKAA 1M76A 3CNLA 4IH1A 5AESA 1QF7A 2X7XA 3MWGA 2ZRMA 4B2LA 4LJ6A 4PYKA 4BVFA 1O8BA 4XQ9A 5CBPA 5JMOA 5I9IA 1JEEA 1A3CA 2P40A 3GEHA 4BJ3A 4TSFD 3DE1X 2WA2A 3EMKA 3UYKA 3LOUA 3RC1A 2DLNA 5EJEA 4AZ0A 1DKLA 1IH8A 4C7JA 3R7NA 4B44A 3GMSA 1OLSA 4M49A 4TQGA 5DHAA 3UAXA 3JZDA 2W22A 1IBSA 3BPSA 2CVPA 5DHPA 3PFFA 4JR0A 4XM1A 1QYCA 4EGFA 2OMEA 3UUGA 3IL2A 4BGUA 3U3ZA 5A3SA 2GNPA 3WLNA 1D6MA 4TMKA 4TUYF 1Z5UA 4AIRA 3T1HB 4F3YA 2EAUA 2FE1A 1WBJB 3ITEA 3D8SA 4P86A 2DE0X 4IFBA 3ESQA 2H5LA 1UBHS 2P5UA 2X8KA 2BMEA 3AFOA 5C53B 2GQFA 5SYAA 4BU1A 3U48A 3NVKI 1MPXA 1EQUA 3IJPA 2LD4A 4P58A 4G5OA 4WDRA 2GBPA 5DK6A 3UOWA 4BB0A 4KNWA 3H94A 2NVUB 2I1VB 3JRNA 3ZH9B 1T25A 5KTSA 4EQZA 1DBIA 3GLIA 1I30A 2RHCA 4NQZA 4LV8B 1MX1A 3QNUA 3JQPA 1NNUA 3ZY2A 4X84A 3D3WB 2HDWA 3FMVA 2CL7X 4I6EA 2NUTB 4RFVA 1JYEA 1W0CA 1RMYA 3A3PA 1QH0A 2F3SA 1Z2OX 1ZS9A 4CM4A 1FFGA 2G70A 5CVEA 3HJFA 2XUIA 4TMVA 5TARA 2XX3A 4CG0A 2X19A 5LOVB 3H2YA 3N2GB 4DQUA 1T0UA 1UT8A 5GOTA 5LP6C 4ZT3A 2REOA 2FEWB 3DS8A 1XALA 3R76A 3HY3A 3TOCA 2YWBA 3HXKA 3GLHA 3O92A 3M1AA 1FP1D 2BBOA 2QJOA 3QKRA 4UM9B 2C92A 4YMGA 3GEIA 4L57A 1J7JA 3LSTA 4XM0A 1W88B 1ADBA 1RI2A 3ZCQA 1AMNA 4QM7A 3BTOA 3T7DA 1W52X 2DUNA 3UWDA 1XZ8A 1IUOA 1PCXA 2OCGA 4J0HA 4L1KA 4YJ3A 1WEKA 2WIDA 4ER3A 4WLVA 3KPYA 4R8MA 4PYOA 1KRXA 2DWCA 3RUFA 3ABQB 5AXDA 2ZJ4A 4H15A 4I14A 4AN0A 4RTMA 3SC2A 3QEAZ 2OSBA 2VNAA 5KNDH 3C1OA 5C1OA 1VGQA 1HSZA 1P1CA 1NATA 1GRCA 1YJ8A 2QGGA 2ERYA 2VDOB 4G8DA 3SJBA 4P83A 3CKLA 4NFYA 4YQYA 3LXMA 2X3YA 4J91A 4QPPA 3CKKA 4B4WA 1OFUX 2FI1A 3C7KA 4ZVPA 2HBQA 3VH2A 3DO8A 3CNQS 5E95A 1AM4D 3FTCA 3WWEA 4EG1A 3VHLB 4MARA 4C89A 3O8OA 4C06A 1P2GA 3TRHA 2R6HA 2HO5A 1O95A 5BURA 2Q8NA 1SC1A 3H9CA 4MICA 4OXNA 3LNTA 5LZ4A 1NPYA 1PGQA 2OXFA 1B6GA 3VI4B 5KSWB 1C0PA 1CY1A 1M75A 1W5TA 4MV1A 3BM5A 4R7TA 3GRKA 2OA0A 4UEWA 1ZVVA 1KDVA 4K03A 4O1MA 5CXSA 4RF4A 4Q4JB 1QHHB 6PFKA 4K86A 3WYCA 3HJGA 4J4HA 3THWB 2R5WA 3M7IA 3OHMA 1NBME 2A0XA 2GD2A 5ADWA 2XQIA 2SKCA 3BXOA 5ETJA 4F5WA 2JGJA 5DGTA 1I5RA 2HBZA 5LIRA 4PXSA 3R6KA 2J3HA 4LYGA 2HR1A 1MAWA 4OMCA 2H0RA 2Y05A 4RNCA 3ZGLA 1JDUA 1A4UA 2JATA 4R2XA 4UMDA 4JFAA 5TVKA 1GARA 2FK8A 1YRHA 2B4YA 3TEFA 4KHPB 4NCHA 1HPLA 1KI8A 2NZYA 4CM6A 2C7PA 2D5AA 1D4AA 1G5TA 4FXOA 3OIGA 3HCWA 4HDQB 4CKEB 2Q49A 3KEMA 2ZSEA 3EH1A 4HG2A 3UMRA 2FXVA 4MW4A 3LT1A 1EM8B 3E3AA 3SJAA 2I4OA 2JGMA 3MHPA 1OA0A 1I4LD 4A6XA 3LC1O 4F3RA 3PNPA 1G7CA 2ZWIA 2HEGA 4Q7QA 2AXEA 5DN6A 3E35A 4PIPA 1Z06A 3BFXA 1CZRA 1X1RA 3QVTA 1N2ZA 2ZYIA 1UDBA 3PC8A 4CQMA 5C32A 4XKVA 4W5OA 5TC4A 4JQOA 1HLPA 3H6HA 4Q4HB 2LDXA 4CFYA 2OV3A 3AXSA 3ND8A 4BJ5A 2DGDA 3ZPNA 1E5LA 2VHCA 2AN5A 4JP5A 2CEKA 2IYTA 2F8MA 4HNSA 3H2BA 2R2AA 1G291 4AYWA 1NR5A 1PT7A 5JZSA 1Z7GA 2ZRIA 2ZQYA 4KMSA 4S35A 3A3GA 4TKOB 4BMDA 3GD5A 1C7FA 5GAJA 1KZ4A 5F2KA 3JVUA 1GG8A 3QENA 2MT9A 1QHYA 2XHEA 3B5JA 1T4CB 3LXXA 4RYLA 4UMFA 1O6GA 2WG1A 1EUQA 2PUAA 1S3FA 2D3WA 5HK9A 2J0EA 3H9BA 2C1ZA 4IJWA 2ATVA 2DQYA 4LSMA 1TYDE 4HUJA 1FFEA 5FTWA 4QU9A 1GG9A 4DJJA 3PUZA 4F12A 3KHSA 3V5NA 1BJTA 1RXEA 1N0VC 2FW6A 2II6A 1VSQA 1DT5A 3O9MA 4BP8A 1NOJA 1AQJA 3GVXA 5AJHA 3BH0A 1EIZA 3KEFA 3TVYA 1X38A 4QUZA 3JAMA 2HCRA 3SS9X 3AUJB 4CL2A 1SVLA 2W48A 4K88A 3BJZA 1I7SB 2X9NA 4MWTA 1KK0A 2HYDA 3V7AA 3LIPA 1J70A 2CD7A 4CM8B 5JXGA 1GGKA 4MEBA 1R16A 2NXNA 4Y1GA 3HC7A 4AY6A 2QLTA 3L1KA 1HQYE 1O0BA 1IB0A 4J0CA 1VKOA 4RD3A 3LRTA 4DPLA 4QT4A 2FUKA 2Z57A 4CQLB 2WPDD 1TD1A 5TR9A 1QBKC 1CVLA 1EBBA 1XV5A 1NN5A 2JFBA 2O3UA 4ZEMA 1Y8QB 4HV4A 2Y1OA 3RHZA 2MSWA 2SICE 1QCCA 1TLLA 2EFDB 3INGA 5E8RA 4KAFA 5TSDA 4YCLA 5IC4A 1V4VA 5BR4A 1Z4LA 2EYQA 2WT9A 5EJIA 2PU5A 3OQVA 1DX4A 3S1AA 3DFIA 2C2WA 1EP3B 1DBWA 1P72A 4N7RA 3JD3A 1ANKA 4DUYB 3BN3A 3S4YA 3HV2A 4KMMA 4AJPA 4G4JA 2ZXIA 3BYZA 3H65A 5IVDA 1JG6A 3LY9A 5ABPA 1IEQA 1L7VC 3TZQA 4FKMA 3A31A 2AX3A 4XLFA 5A3JA 2C4UA 1AKMA 4CF4A 4FOSA 2VXYA 3SKYA 1AY0A 1XRLA 3UWOA 3NXSA 4YJ3F 2LCFA 4UZUA 4NCIA 5L3ZA 1WE2A 2HK6A 1TX4B 1DELA 3K2BA 4BTLA 2H6EA 5BWNA 3CE9A 1WPGA 5C18A 5CHYA 4EYQA 1WXIA 5HZHA 1ISFA 1AD2A 2HRRA 2P4HX 3IBYA 2ILTA 5G1OA 1E6EA 3L79A 2C5LA 4EHAA 3P45A 4IGIA 2CHFA 3CZRA 4J1TA 3T3IA 3LTNC 4JJ8A 4PWZA 1VHQA 4H1VA 1K06A 1YTLA 3EHEA 4NNJA 3BMQA 1JQJC 3QKIA 3UMFA 5BVGA 4LMPA 3BDIA 2VTDA 4G0PA 1WLYA 3DC7A 1Y8AA 3VQTA 1JLMA 4EHNA 1NPDA 3JU3A 3UGQA 1MB3A 2IPXA 3QTLA 3CNOA 1ENZA 2XZTA 4N49A 3DXFA 4C7XA 1OSNA 4NATA 3F6EX 3K20A 4OQEA 3Q5GA 2YMQA 1W0JD 4HO1X 3RDPA 4KIFA 1P5FA 3FJ1A 1OPRA 2X8LA 2ZOSA 4NFLA 2VSQA 1MPTA 4YRMA 1P3Y1 1E3WB 2R7LA 2W58A 1CR6A 3JYNA 2HK9A 3KR9A 1PVVA 3D81A 1ZNYA 3WLTA 4CFSA 1DQRA 5ALQA 4U6SA 4DLXA 1V37A 4E5DA 2MYNA 1JI3A 2E6KA 4UTNA 3EEYA 2RHDA 2HRCA 4AG3A 4KPUA 1IHPA 5HF6A 1NXWA 1Z0FA 3VR5D 2FG5A 2O9JA 5IZ4A 1R0ZA 3ZHBA 2A94A 5H7XA 2XCOA 4ND5A 3KHTA 4LOAA 4NP6A 4RM0A 1GRNA 1DV1A 2C20A 2QT0A 1A4RA 4O63O 3CH6A 3H7AA 2JFQA 1V0JA 1DL5A 2Q9CA 5AKKA 2ILVA 5DKFA 3B3GA 2X86A 4QJ4A 5DWQA 3RW9A 3A4TA 3GRZA 3BHJA 1S01A 1U81A 1CQIB 1AB5A 2WILA 3CUKA 3NDJA 7MDHA 5KHOC 1QAQA 2G7ZA 2IZZA 1Z8NA 1PJCA 3BF8A 4CI9A 4L8JA 5B1YA 2DQ4A 1QP7A 1OX4B 3IYLW 2VJYA 1FFWA 4IXNA 4LRYA 4MWEA 4WERA 1DG1G 4ZO7A 5EHGA 1D2GA 4QFDA 4II3A 4PX3A 4GX0A 2BKAA 3F9IA 3SLDA 3ND6A 2GVNA 3GAAA 3H9UA 1N8SA 3Q6QA 1VFNA 1D0VA 4ZQCB 5DX8A 4ZT6A 3VZBA 1ZO8A 1CHDA 3A1TA 2RGGA 3GA5A 3AOEC 1WR8A 4JIMA 4ZYXA 5E9QA 2HXYA 3FPBA 2VHEA 3OIWA 3VAYA 2C57A 4FCCA 5CDGA 1JHOA 2VYCA 3GGPA 3H5NA 2HJHA 2A0YA 2B4RO 1VLLA 1BEEA 4JH0A 3VHQA 4QVJA 4IPTA 4WLUA 1YJCA 3DE4X 2XCLA 1PJ2A 2GDZA 2P2CA 2WHXA 4PU0A 1U7TA 4KVZA 2E4VA 3DE3X 2QLBA 4M87A 3FNQA 4BQOA 2V59A 1I6WA 4YMLA 1AXGA 1IVNA 5HCUA 3K6KA 4O2BB 1OAKA 3FSRA 2JFOA 3REGA 5T8KC 1XMXA 1XU4A 2ZQZA 1XAHA 3JW8A 2ZKLA 3IEUA 3PUKA 4IJUA 1DX9A 3RE1A 3EXFA 4M7PA 3ZQUA 1J49A 2JIRA 3H19A 1GDTA 5H02A 4Y6RA 1G63A 2CN1A 1DNPA 2G4VA 1G5HA 2AUMA 1WUTA 4GXQA 4I9UA 4IIVA 5HBRA 2BELA 2I62A 2Q5OA 2YS6A 1TU4A 4KSYA 2QF7A 2RGDA 1PG2A 3H5WA 3AHCA 3CHYA 3HVKA 1V1MB 5A4FS 5G40A 1U31A 4ZAFA 4OXKA 3RARA 4V2IA 4CMAA 2OTLB 2V65A 3A4IA 5KJ1A 3W8DA 4U7WA 4L4XA 1U8CB 4NPAA 4BNFA 4RGYA 2AUNA 3FZEA 3RASA 2NO4A 2BUCA 3A1PA 1A2OA 2A88A 5AKIA 3ZDRA 1N2XA 5ITVA 1WDKA 5EPUA 1XFDA 1K7XB 2ONZA 2ZS7A 4IZHA 3DTYA 1AC5A 2H08A 2XMPA 3AP2A 4J9UE 4BNYA 1GFWA 4YXFA 1X1TA 2WYOA 1E62A 1U8XX 2GS9A 2YRXA 2MSNA 1DKMA 2QL6A 4NBSA 1GNQA 5ALTA 4N47A 2E4XA 1Q82D 1QIDA 4EJSA 3OX3A 1HYEA 4Q4LA 4RQTA 4AN4A 1YDMA 1F20A 5AM5A 5IF3A 3H9EO 1AJEA 4ZZ1A 4O2RA 4Q39A 1MIOB 2C2XA 3D54D 4RF3A 3CQ9A 4L6CA 1HDCA 2ATCA 1DEHA 2H7XA 2IHTA 1KZ7B 3BTSA 4FYIA 3SIXA 4ERNA 4WY8A 1N2IA 5HQTA 1H2RS 4CW7A 4G0WA 2WTUA 2AN9A 1C2TA 3LVRE 4C03A 3KB8A 1BX3A 4FCVA 4WVFA 4RA9A 1QIEA 3MWYW 4H2DA 4E4YA 4FCTA 1WF3A 3VOBA 1RXVA 3SQXA 5C2JB 3O03A 2JLQA 3KBOA 5AIBA 1HDGO 4R0VA 3C5CA 5KQMA 2FUNB 3GJTA 2V7QD 4E2YA 2Q3MA 3IEPA 3TM4A 2OHFA 3HP7A 5EWMB 5LLTA 1KEVA 3P9IA 1YQGA 1NA5A 2AEEA 3VDQA 3DE6X 1AA6A 5AJXA 5BT9A 3LVBA 1N5OX 5JSZA 1D8AA 4F3CA 3A2LA 3OP4A 3G9QA 5IJ9A 2XB2A 2AMYA 2ZREA 3G0OA 1LTQA 2H06A 2VP6A 3KQMA 1RAFA 2GZ3A 4V0SA 3RU7A 3ZIDA 4UUBA 5FWNA 2GN2A 3HDHA 3LLSA 3WFJA 3CN9A 4RZ2A 1RYNA 3I23A 3I37X 3W2EA 3TECE 2PBRA 3ZY5A 2Q5EA 4H7IA 1PAUA 3ZTYA 2VYQA 2Q3DA 4E33A 1EE1A 2B30A 3OHSX 3CX6A 3K1JA 2ZRLA 3OCZA 1L4MA 5DULA 3LQ6A 3G85A 2ECFA 3ZR4B 4R2JA 1WHTB 1ZDMA 3L8FA 3ZZ1A 4EVSA 1KIAA 1LK7A 2G8NA 2I4IA 4G5FA 4LNAA 1L4BA 3GJ8A 1GLVA 2YUIA 5AI8A 2XTJA 3GK3A 3ENZA 4RC9A 1DEAA 5FI1B 3KAJA 4C30A 1M6EX 5KPDA 3LYLA 4BS9A 2C2HA 5FORA 4INZA 3RHSA 3E3NA 3F2IA 3LW7A 1XQYA 2C4KA 3ZW8A 4D3FA 2QA5A 3NNDA 3S5JA 1H3EA 4B46A 1SUSA 3LPAA 2LKDA 3GGGA 4IDPA 1GNRA 4YECA 3VZDA 1BSVA 3E5MA 3U0VA 5HZKA 1BGVA 1PNRA 4C7OA 2P2LA 5JV5A 1KO7A 5DW0A 1HE1C 2PPVA 1ZA2A 3TXYA 2OP1A 2AEJA 3O75A 4F1WA 2EKQA 3ED1A 1F0NA 3DD5A 3FUWA 1L4LA 3KRTA 1GYPA 5THQA 2HQBA 4OI0A 4HSGA 4URXR 5J2UF 3Q8MA 5ER6A 1TCAA 1N2GA 1P7PA 1TA0A 3IT3A 3GPBA 3M6WA 3NQ41 5IJ0A 1N0HA 3ZK8A 1Y4UA 3OZVA 1I80A 1VQNB 4HGNA 4RVHA 1OFGA 2A4KA 2CXHA 3CIFA 3D8RA 2QT9A 3IIJA 3ZGNA 2ASVA 2O8FA 1OGJA 1Q84A 4H0FA 2F43A 2IQ5A 3GYBA 4HAYA 3UJ3X 4BWYA 4DQDA 2GRUA 4CEHB 3ILVA 3ETNA 3NYWA 1ORVA 1SVWA 2OZPA 4WJZA 5DYIA 2H5JA 8OHMA 2OXTA 2O19A 2OHOA 1TTTA 3ADDA 1FP4B 1WMBA 2A0KA 5D5PA 2D0IA 1Y8RA 3NUQA 3UC5A 2JF0A 1FNCA 2PL3A 3U0BA 3WIVA 3T9AA 4CV2A 1OXUA 4LDRA 4LCBA 1Y1TA 2JDID 5FOWA 4DA8A 3R6TA 1GQSA 1XK7A 2CVZA 2EL9A 2WKPA 3G49A 4X00A 3VR6H 4BLUA 3RRBA 1RPZA 4N0EA 2EU8A 2OBMA 2V0CA 3R0VA 4HFRA 1L6RA 2AN3A 3V8QA 3L0CA 2WD7A 4V38A 1P33A 4XGIA 1YX2A 4X61A 4Y67A 4XWKA 4PG7A 4ZDKA 4WA7A 1UMDB 5JT1A 4Q9DA 3CZAA 1LV7A 2PV7A 2QRLA 3EWIA 2HK7A 4BOYA 2P3MA 1JHAA 2XUAA 2V7UA 1YC5A 2MMCA 2ZUUA 4MWZA 5BNIA 1QU3A 1L5FA 1RP7A 3WRVA 1P1FA 4L75A 1XZPA 4UM8B 4KYUA 3ONNA 3RM3A 3PTZA 1YVUA 2LKCA 3O83A 3PZRA 5JBIA 2HTFA 4E07A 4OGFA 1SCUB 3T7SA 1GG2A 2C0PA 3T1QA 4JBHA 3U26A 1H2HA 4P8RA 3WLFA 4WBNA 1IWOA 2GVZC 3R0JA 4CLDA 1VQLB 4X45A 1GUYA 1WF6A 3P71T 3D31A 2CCJA 3FW1A 3TXAA 2FMXA 1UKCA 1U8ZA 3A4YA 1ODLA 4UVEA 3WLQA 1FXWA 2ONKA 4TVSA 2WMNB 3HBLA 2XLBA 4L8VA 1LU9A 1H1LA 4UM7A 3SHWA 3HN6A 1MABA 2EFEB 1RI4A 5IU6A 1CG6A 2XTMA 2XUKA 4HQNA 4KFSA 2FX5A 2XQKA 3H5VA 2C9ZA 2GYWA 3GLFA 1ZJZA 3ZY3A 3BE6A 5B1SA 2QU8A 2JS7A 5FOQA 4LJRA 1U9YA 4XFKA 4ZVNA 1K7CA 1OWNA 5A5DA 4JR2A 4KDFA 2B7BA 1HQKA 4LQLA 4D3ZA 5GJCA 1QKIA 3KTAB 3MTIA 4JCOA 2JVJA 3SX0A 3UKOA 3K9WA 1DJMA 3ASQA 5A6VA 4OQFA 5IM4A 1LK5A 1V3TA 2ZEJA 3WHIA 2WG0A 1P0MA 1ZEMA 3WIUA 2G1PA 2QRNA 1RWMA 3F46A 4HB4A 5IBQA 3DNFA 2VUHB 1QDEA 3RSSA 2XODA 1EJ6A 1KJNA 3EZXA 3H3XA 4BYMA 1VYHA 2Q62A 2W00A 4C43A 4QECA 5TMPA 3GVHA 5JLAA 3UMBA 4XD7A 2JGNA 4HYTA 3RGWS 1L5ZA 3EHDA 1HFJA 1M2FA 1M9NA 2HGSA 5ALIA 3RTDA 4CTNA 2WP0A 3TKYA 3STUA 4Z4TA 1GN8A 1K9VF 3OOEA 5FULA 2IEDA 2O4CA 3HCEA 1YKGA 3PQ6A 4OJQA 4J3NA 3DZCA 1G8HA 1S2DA 4H1TA 3PDCA 1OFHA 2DHCA 2PFGA 1JTFA 3OTHA 4RM3A 1Z07A 3STWA 4C6TB 4HDSB 3AFHA 2Y0BA 2DFPA 1LLFA 2V6JA 3IERA 3S2UA 4ETNA 5CA1B 3I4CA 1A7JA 3NP9A 3PGKA 5HS4A 1Q81D 1XNQB 3PA8A 3HS3A 2JFNA 2VN8A 3N2KB 4NYIR 2O59A 4JENA 4DLZA 2GUGA 1EP2B 5THXA 3UJDA 4AJOA 1SRQA 3CLUD 4OGGA 2D5IA 2G71A 3PPXA 4EBFA 3UOAB 3EVZA 1NONA 4XIGS 3V1LA 4B7UA 1FNSA 4ZHQF 3OBBA 3P2IA 2AOWA 4IDCA 1MEEA 3D5EA 4PLHA 3HCPA 4UW9A 3TRKA 1FA9A 3LM8A 1DO2A 4TKLA 4C0JA 2UYCA 3PXUA 1MX3A 4GH5A 1FX0B 4FMBB 4UE2A 2VP5A 2CBXA 3CW2A 1E2IA 3DUFA 1V7QA 2QAGB 3QXXA 5GZ3A 3E18A 4ZAYA 3CCRB 3T9EA 4YUVA 2FOXA 2OBNA 4MR8A 3X1DA 4B74A 4EY5A 2ZB3A 3V55A 1FFBA 1KSHA 3WGNA 4P4NA 4GI1A 3GF4A 4DWJA 2B6NA 3PEUA 4YUAA 1NUPA 1CR1A 4YGXB 1TJ4A 2ZB4A 5U1PA 3ORFA 5HF5A 1YB1A 2LUOA 3L0YA 2WR8A 2HA4A 1OD6A 1UDAA 1UMKA 2AG6A 1IG3A 3P94A 4PVDA 3V1KA 2PMKA 3DLTA 1F9EA 4GG1A 3OI7A 2VPPA 2ZROA 3QIAA 1P39A 3D6JA 1W4LA 5CU7A 4AKIA 1NYLA 3BIOA 5A4AA 3KKLA 4BIIA 2AF4C 2BEWA 4M54A 3AV0B 2EDCA 3PUMA 1GRQA 1E1MA 3THXA 3EASA 2R1UA 3MINA 4OTZA 1B0PA 1NW8A 2ZPUA 1P31A 2P2GA 2ZRGA 4MQLA 4A26A 1FSZA 1WP9A 5DYYA 3WZLA 3Q9SA 4UCWA 4KEAA 3AJDA 3B9PA 2V7GA 4RZ3A 2DUUA 1I7NA 1U0LA 4GOJA 4PYLA 1BVUA 3TTSA 2W6ID 5BSEA 1ENOA 3ZG6A 1ZONA 4C78A 5KTRA 1HZJA 3NFRA 5KSPA 2OECA 4RY9A 1U1IA 1LQ2A 2YMMA 3THRA 5K51A 1JB1A 5IYZB 1O57A 4KFCA 2G36A 4QLAA 1WDTA 4BVAA 3VKWA 2VTBA 2IW1A 4QWMA 2I76A 3TIFA 5ALNA 4QTUB 2IDJA 4V0RA 2ZUTA 3FOAA 3LDGA 5LNK6 3A11A 4H08A 5FUVA 3ICQB 4V1CA 2VTEA 2ECPA 2QV7A 1CUBA 2FR8A 4R9VA 1E7YA 1KBOA 1XLVA 4K9OA 4QZVA 3PU6A 3LTEA 3VNSA 1BIFA 3C6ZA 1X7YB 4H17A 4BO1A 3LZCA 2HH9A 1L5QA 4EPTA 4ZCLA 2UZIR 3E82A 3HJBA 1YZQA 3NWBA 1M33A 1R3DA 1YE5A 3B1WA 2ZXEA 1JZQA 3INRA 3L7AA 2IU0A 3UT5A 1VRVA 1HKUA 1OWMA 1WB4A 4ZGNB 1EB9A 2E49A 2FLKA 3E7PA 3Q7PA 1QC5B 2PLAA 4KC0A 2OFFA 2FZLA 3TTUA 5BN4A 1FJXA 1C3LA 1GL9B 4FE7A 3EBPA 1YB7A 3VVCA 3BL8A 2JLBA 2A9RA 5JHGB 1YMVA 2JHFA 4ZI7B 1HMPA 4E1VA 3CGWA 4X9XA 2AWOA 2HWXA 2Q1SA 1S7GA 2B35A 3QE0A 4NYJQ 4M7RA 3SC4A 3JAWA 3HXMA 3WS7A 2BFAA 1KMHB 4PHGA 2X5OA 5F7JA 1LBIA 2VP0A 5EE5B 4COKA 2FG6C 4Q21A 1M1XB 5DM2A 3N3AC 1G98A 5I9MA 2QUAA 1MTOA 3KSRA 2LBPA 2GNAA 5K6AC 4ER0A 3IVGA 3EFOA 4HX2A 3PENA 2AN1A 3ZWMA 3KB1A 4F92B 2XOKD 1KL7A 2G3YA 4O4LB 1CCWA 3OMXA 4KWCA 4R2HA 3KYCB 5EFOA 3U17A 2WIKA 5HNKA 4JI8B 1U1CA 5EJ5A 2VCYA 5DX1A 4BN0A 2R6AA 3AY7A 4DV1B 2VFAA 3PQCA 3G3EA 2NU7B 2Y3IA 3V1MA 3D6MA 2FHPA 2PVSA 1CUGA 2C2OA 3DQQA 1UBFA 4FFBA 5CFNA 3ONYA 621PA 1ZH0A 5CXUA 2ONCA 3D6TB 5E3IA 1WU8A 1V6AA 1EHIA 1IK4A 1SQSA 2CE2X 5FBZA 4EWLA 2HPHA 1P2DA 5AI4A 5EZSA 8ADHA 5J5VA 3H2GA 3L8MA 2PNFA 3DDWA 2DUMA 2QI9C 4WZBE 1GL6A 1Z26A 4D44A 1WOOA 4EA7A 5ICMA 3F73A 3UT6A 1RAGA 1VCNA 4FNMA 3FSGD 3DKKA 3IDAA 4OI4A 1E98A 2WICA 5CUQA 3IO3A 2XVZA 1XRNA 2VRCA 3L8YA 1PS8A 1S1MA 2MR6A 1U9CA 3GI1A 3JVEA 4RVOA 2P77A 1FUKA 3MFYA 3ZC3A 1IMOA 1WHSA 1ZWLA 3TLMA 1P5JA 2PXAA 2QRVA 5EJ4A 4UU7A 4KITB 2ZUVA 3K8OE 1OU0A 4ZVTA 1P4MA 1KORA 2A84A 3PD1A 4ZV9A 4DBLE 1WOMA 3AILA 4V0ME 4FDVA 3IT0A 3UHPA 4YJDA 3COJA 1T8YA 5FNVB 5KC8A 2CLIB 4J8PA 4L4YA 1BD3A 3AHDA 3KOZA 3V1NA 4TZ6A 4P0PB 1PK7A 2ZI3A 5KNCD 1RFLA 3PVCA 1C7QA 4YACA 3SNKA 2ZT5A 1DCKA 1ZBDA 3ORHA 1RM0A 4FFSA 1JNXX 3HPQA 3QQ5A 4XQGA 1H8EA 5DT9A 3RQIA 3T1VA 3PNMA 5K3EA 2EERA 3KQNA 1GM5A 4C2TA 1DRVA 5LMNB 4G4GA 2L82A 3RVOA 2I78A 3QVKA 3NONA 2CNOA 1MJFA 1UZUA 3EGOA 4XEHA 1L5MA 1JDJA 4G7WA 1IATA 1ECPA 1UANA 4Q3EA 2X5NA 4W7HA 3IVRA 4O1IA 4RZHA 3PUVA 3DBHB 3PQDA 1I8DA 4R9NA 4UEKA 3VGJA 4KR0A 2WTEA 2PX0A 1OBOA 3O2JA 3ZU5A 4D57A 3WNDA 3DEZA 4E88A 3JQBC 1MRZA 1NW4A 3R9KA 5EZ6B 4WNCA 1UK6A 2XMDA 4L4SA 5DHTA 3IQEA 5CFLA 1T10A 1VIYA 3LY8A 1NRWA 3QPUA 2NO7A 4I9GA 5DOVA 1KEWA 4TV9F 5KCZA 5L9AA 3UUEA 1SXQA 3D26A 1FVOA 3DMRA 4ZQIA 4DS3A 2X6RA 4OUKX 3ZWDA 1AQLA 1P2BA 3D6UA 3HJCA 5KUTA 4QBHA 1SIUA 1ETUA 1XU7A 1SBZA 2XT0A 3HYNA 4EY4A 2I1WA 3JWGA 2ZM6B 2F3RA 2QVCA 4D41A 1FL9A 3QBEA 5LA6B 1YR8A 2Q28A 1FMLA 4ARSA 2HY7A 5HRUA 2EJCA 2RG7A 5C31A 1H42A 3NZEA 5KNBH 5HGJA 3GHHA 3WICA 1J2YA 3AF5A 4B7ZA 1A5ZA 4GE3A 1G21A 2B25A 3EGWA 5IYWA 4UXJA 3TBHA 1X0XA 2H63A 4ENWA 2G0AA 1UK7A 4ND7A 1Y1LA 4XR6A 3KPVA 4FGJA 4EW1A 3B7GA 2R66A 4MS3A 1OYYA 1NXPA 5LZ8A 4BEJA 3R9XB 3G5AA 1DPFA 3EVGA 4DB2A 2L18A 3CCJB 2PRJA 3TRFA 4EH1A 2BAGA 2GK4A 2OFXA 3K0AB 4WBXC 4K3UA 1RM3A 4C0HA 2WFLB 1BMTA 1QRUA 3FNRA 4QOIA 4N6NA 1VHTA 1XCOA 3RYHB 4DHWA 5MF6A 2VWGA 4FVTA 1JH8A 4P3KA 5F3DA 1GR0A 2BHNA 3PHHA 4UTZA 3NHMA 3E5NA 2ADOA 1YIDA 4YRSA 2VBGA 2CMHA 5GONA 4Q15A 3I5AA 5EJ9A 3EGXB 1EK0A 1SBTA 3M1LA 4KI7A 5SY6A 4MVJI 2YVLA 2QA4B 4GR4A 4CT4B 3S8YA 3UWPA 4PTLA 5LDGA 5JAMA 4CMBA 4QL3A 4WL0A 1RKXA 4BO2A 5K9ZA 1AKTA 2C2KA 4DFDA 4OP1A 3DOHA 5SZHB 1DXQA 4WZBB 5FP0A 2FFJA 3QVMA 1GDHA 1EVJA 1RLMA 3AL2A 3Q3GE 1POXA 4GGOA 5E4TA 2FA9A 1QQ7A 4A8JB 4D4LA 3WGMA 2V9CA 1FK8A 1Z35A 4YV2A 1SVMA 3L9WA 3QXCA 4EOGA 2WI8A 4L9SA 3U4AA 1N0IA 4LRXA 1R00A 3EFBA 4N01A 1OBCA 2GZ1A 3ETEA 4X8MA 3IE1A 3URMA 4PZCA 2GHTA 4UVDA 1XTTA 2B78A 2EX4A 5DPMA 2C7GA 5TPZD 4HXYA 1S0UA 1PJ3A 1HBJA 1UADA 1WCWA 4X20A 5TQ0A 5FR2A 1GZHB 2RAVA 4DG5A 3W8RA 4RD6A 4YT5A 1N36B 1FNBA 2JJ2D 4MI3A 1YJXA 3VPDA 2DYIA 4QAJA 1DTWA 2JJ1D 1G16A 2CHUA 3BILA 3DR3A 3E9DA 4NZPA 3SFZA 5B1EA 3SOPA 3LFTA 1PHPA 3X2SA 4FMDB 1JQKA 1M2KA 1V8FA 2B8EA 2EKDA 1TEHA 2J7KA 4IFTA 5DT2A 3VNAA 3C70A 1JILA 5IDQA 1A0OA 1JDBC 3P2MA 3RABA 3WKEA 3AJEA 5AKXA 5I7SA 3VKGA 3KJNA 5M29A 3QEMB 4NHOA 2H3HA 2R8BA 4RS3A 3G2OA 4BFSA 1NYTA 4KN9S 2H1OA 4FT2A 5E0OA 4HQ0A 4BAZA 3THYA 4RORA 4H4DA 4LBYA 1JIXA 3SQDA 3EEBA 3TR5A 2AKYA 2BRUC 3C4VA 4JDUA 2HSJA 4MVYA 2UVQA 2M6LA 4WAUA 1AX9A 5AIAA 3QVXA 2WJ6A 3E1GA 1SEPA 4GZ3A 1FQKA 4MPDA 3C5VA 3O1LA 3SJUA 3EXEA 4AY4A 1X7ZA 5DBEX 2IUSA 4KRGA 4QC2A 3T8YA 1NQAO 1JPJA 1Y7HA 2I29A 3R7BA 1TT5A 1YOBA 4PXAA 3SYNA 1SD5A 2B36A 3PLRA 5EJMA 3V76A 5JSHA 3H7IA 4IICA 3QFHA 4YAIA 5BORA 1DTSA 1FJ2A 2IKQA 2Q4DA 4HRAA 1UBNA 4AYXA 3UATA 4BX8A 4R1MA 4A8JC 5ARBA 1X42A 2Q7OE 1NKTA 2ZRCA 4JBXA 3DL2A 1LQUA 3OFND 2NUAB 2FB9A 1QRTA 5CDFA 3NYRA 2NU8A 1YR1A 2BEUB 1CIJA 3F5FA 3GT0A 3V4ZA 3LPDA 1L8XA 4P4UA 2ZZMA 4EIWA 2FPPA 1KC3A 3AONB 2X4LA 1RBZA 1YACA 4OIFA 4IXMA 1C7EA 1N07A 4BFLA 4B5KA 2PL9A 2NQ2C 3FZGA 3E27A 3VU3A 4YDRA 1NJFA 1Q95A 2ZBPA 4JQSA 4D9HA 2IUEA 2IEZA 4HLNA 3B60A 3RYIB 4L28A 3C7AA 4B7AA 1BU5A 2HNAA 2X9LA 5KNBA 1VI5A 4B84A 5CDTA 1ZHFA 1L5GB 2K5UA 2QAIA 2AV6A 2JI7A 2ZRQA 4D3XA 3WDSA 3V1UA 2CK3A 4G07A 4KXQA 1Z6ZA 5T5QA 4DCGA 3LX6A 2H85A 4ZU6X 1ZCFA 3AKDA 2H1RA 4MV0A 1YWGO 3B2NA 3TFQA 4KE8A 2OORC 4C4ZA 3HL0A 1JYFA 5ADHA 5FOTA 1ZNWA 4G1CA 3SQNA 3L9XA 3RKRA 3UOGA 2V3VA 1XPUA 3HBFA 4X24A 2VH2A 1XU9A 2AOTB 1X1AA 2O2CA 2R25B 3AEKB 4DSNA 2IOHA 1GGFA 1IN5A 2BONA 1WVMA 4OX9B 3K09C 2B92A 1IOVA 2RKBA 1IVYA 2Y4OA 4FHCA 3M4JA 4C2BA 4DCSA 1R0LA 1A72A 4UUAA 2D8MA 2ZVPX 4U9UA 4BUJA 4ASUA 3BREA 3FY4A 2ZTGA 2IYVA 2QXTA 1Z4OA 2RJNA 2DZDA 4MROA 1YZUA 4C4AA 2HHHB 3BJEA 1F17A 4WESB 3TS1A 2NLOA 4D8UA 2X2PA 3A3NA 1JDPA 1UJCA 1E9AA 2D5LA 3E61A 4F9FA 4MGYR 4R1PA 2O3QA 3GEGA 5L4NA 2I6QA 2Q4OA 2XDQA 3NDBB 3G79A 3L4SO 5BPHA 5AH0A 3ZV4A 3PC7A 3KIPA 4S1WA 1CRPA 1BO6A 2I87A 3DLCA 4P3NA 4W1SA 5FNZA 5EXSA 3ZDQA 3OFJA 4MCIA 4RQAA 3WL4A 3M6FA 2H2DA 3PFWO 2UYHA 3W7VA 4YHHB 2PZJA 3TJRA 1PE0A 3QVVA 1I2ZA 2OR3A 4P53A 4W8HA 5AK6A 3RT1A 1GEEA 1CC1S 1XDSA 4TTQA 4OQNA 3HCFA 3FLEA 4GOND 4HHEA 2R9VA 1X15A 2O20A 2P78A 2VHXA 1RBMA 3GV0A 2DHRA 1JPNA 1RLJA 3QX7A 4L16A 2XXJA 4P84A 1IHDA 1A8PA 4YS6A 1XLTC 3NGXA 2XMGA 4FW9A 3P7MA 3R20A 1L5KA 3ENVA 4DR3B 3UFXB 1L4NA 1DIRA 2PX8A 2WWWA 1HQCA 3MM4A 4AO6A 2J46A 4UCXA 1VYTA 3G05A 3KOXA 4X1KA 4DIFA 1ZUD1 2QGZA 2VHUA 3T52A 4V3CA 3JPWA 3FYUB 3UJ7A 5LQDA 1JEYB 2B8NA 3HO1A 3G5TA 4MEAA 2E37A 5EWJA 5C81A 1NT4A 3GIRA 1YVDA 2BCJQ 4JLSA 1NBHA 4TV8A 4IHAA 4Q7LA 5K8IA 3H4TA 4D4GA 4URWR 2XV1A 1RLUA 4BNMA 2WTAA 3F9RA 3QW4B 1O87A 5KQGA 3X44A 4H1HA 4ISBA 1AO3A 3ZS8A 1N5JA 4M6WA 3CPEA 1UOPA 1P4AA 3KSZO 3NR2A 4HYEA 5C8YB 1IZYA 4PX5A 5LP6F 1KEEB 4LJAA 4P4TA 3CPSA 1B3RA 1YR7A 4Y0NA 2KBFA 3UAYA 3E7DA 4DLBA 1JT2A 3H0EA 4KWTA 3THOA 3O1HB 1GCAA 5FBLB 4BE9A 3A7EA 3U1VA 1JXQA 3PTLA 2ZU0C 1A9XB 4YP6A 4YN3A 4BQQA 1DO0A 3NOXA 3F8TA 5CG1A 2OAGA 3IAAA 3EX7C 3L6CA 3LH5A 1LF5A 1PUIA 4F72A 2DR0A 3DTVB 1PJ4A 1O0SA 5COQA 3TZCA 1AUOA 2BH9A 2CJWB 4XWGA 2A92A 3R4CA 4DNQA 4ZDJA 2I2BA 4ZARA 3BK2A 1Y7PA 3O6VA 4NRDA 2GRJA 3FGNA 3W9BA 2NM0A 4P5EA 2YFKA 1GGHA 4II2A 1T8SA 3DMDA 3P0RA 2VQFB 5BUQA 1G6Q1 4XTRA 3HNPA 1KZGB 1RKVA 4ZOAA 4HTFA 2OENG 3LY5A 1YZKA 5LYJF 4CLXA 4ZYVA 2BFEA 2J9RA 4MIKA 3RIEA 1KS2A 2GR9A 1KI6A 1BQ4A 1Q7TA 4YROA 4AWBA 2UVDA 3VPFA 3CUWA 4M7OA 5AJZA 4YELA 3PX7A 5IBRA 1O97D 3JATB 3CVVA 4M1WA 1CY8A 4OQYA 4RIHA 2IPOA 2XMBA 1YQWA 3O31A 4E5KA 1OPXA 3BWCA 4PIMA 2FRDC 3EGCA 3NRJA 2PT6A 3GP5A 4WZKA 3KELA 3GVKA 5LZ2A 4KRFA 2Z3VA 3ZVRA 2QTZA 2DECA 3QPBA 3G7SA 2I33A 2MMGA 3CZ4A 1P73A 4FEAA 5FBQB 2IVFA 3UHJA 3CG4A 4FXUA 4EG0A 1S2OA 4BBAA 4DF3A 1OUMA 3HYCA 3E7WA 1A7UA 4OA8A 2P1RA 5DB4A 5FTKA 4DLRA 3PGJA 2IYSA 5ESXA 1V6SA 4WFKA 4JLJA 2RBEA 2G9VA 5GJBA 1C8VB 1K8RA 3KT3A 1SA0A 3O8QB 4LYDA 4N4AA 3TUIC 4B2YA 4JT4A 4TKUA 2ENUA 4MDHA 1X1SA 1XFAA 1G5QA 1JZSA 2H5EA 1FDWA 3JQ9C 3QVGB 3ICOA 2ZSHA 3CNNA 3PKZA 1ONNA 3FTDA 5J5AA 4NNPA 4IRMA 1YQ9A 4Q3CA 3SBOA 4EF4A 1Z6YA 4KE7A 3T3HA 1J20A 4TLCA 1Q22A 4E31A 1C9EA 4W8OA 1KMQA 1Q92A 1P3JA 1RRKA 2AMVA 5JQGA 2DWPA 1H65A 4HLUC 4J16A 3A36A 2QTGA 2QUBA 3RG2A 4XSHA 4TXHA 4PLCA 1KETA 3IJ5A 1K2VN 3UH1A 4ENPA 1W36B 3Q0IA 3H8WA 3AOEA 1NF2A 1Y4DE 4DEYA 2WNIA 1CETA 4FNGA 4IVNA 2QYSA 1ECGA 4JB3A 4P1ZA 4XCQA 3NIDB 1XTUA 1VGVA 3H11A 2R60A 5J2TF 2UKDA 2HEIA 1KYWA 4C1NA 4B4UA 4TYMA 3GGSA 5A9SA 5CD1A 1GPLA 4O2AF 4IKEA 2ABWA 1USGA 2PA0A 2YHIB 2QW8A 5DZSA 3U3DA 5G41A 3ZJTA 4H7EA 2QYHA 4KXMA 4Q37A 4QVAA 2BKEA 1PZNA 2P27A 1HLGA 2QUIA 1KBZA 3OT1A 2NO1A 1UAYA 5EXEA 2JEYA 2P30A 3CRQA 4HAZA 4QUIA 5B3AA 4DQXA 5KQSA 3PRJA 2A5GA 3F96A 4I50B 3ZV3A 2PD4A 1BC5A 4HWSA 5K09A 2I8LA 1YVRA 2VHJA 4UAGA 1FYEA 4UDXX 3UJPA 1BCRB 2H5IA 3DHEA 1IBLB 3EGDB 3H4VA 2WE8A 2XITA 1F4PA 2NZXA 1RHQA 4F2PA 1MW8X 2ZIEA 4X71A 2X23A 4IEEA 3RV3A 3I9MA 4TWRA 3TDMA 3OZTA 2XE7A 1KKLA 4HNTA 1EB8A 1LTHR 1UPFA 3DC2A 5BO5A 4D42A 2O2HA 4HZIA 1HA3A 2Y71A 1KOJA 5FADA 3Q1KA 3IEIA 1YZGA 5HVNA 4DXAA 2VDKB 1TPYA 2H9YA 2R8XA 3M81A 3ML1A 4IUDS 4ENUA 3CE6A 5IARA 4H7PA 4WNAB 4JUFA 4Z4IA 2P90A 3HGQA 3AVVA 1KSFX 4N03A 4D96A 4AQYB 1F5NA 1WABA 1WORA 5BR8B 1HEYA 3JARA 2IYNA 4IXWA 4RSHA 2GPSA 1DAFA 4OV6B 5E9WA 3IULA 1GTRA 3BG5A 1M34E 5IVPA 3FOEC 4C7MA 1DXOA 1R6XA 1HETA 1Z4JA 4O4HB 4F4FA 4Z3KA 2OHHA 3D3JA 3U4HA 2KW5A 3KNZA 5CCEA 2XR1A 4BJ6A 3G8AA 8GPBA 1OLUB 3WV5A 3JWEA 3VDNB 4X66B 5IJWA 5KX5F 1CR0A 2AI3A 5IKOA 3ZV5A 3HUDA 4GBMA 1SZJG 5GOZA 4IM7A 3TAHA 2PKCA 2FOIA 3HY6A 3FPKA 4WKPA 5A71A 2E87A 2E4WA 4A8PA 1ECLA 2G4CA 1E60A 3E8XA 1UD8A 2HT1A 2I34A 4MLCA 2KYRA 2QQFA 3OE5A 4XPIA 3A9CA 5AJYA 5LBIA 2FEMA 2WJYA 5F4JA 2IPAB 1JJFA 3EBOA 1LA2A 3FYHA 1GZ6A 1AUXA 4KBGA 2RCNA 4AKGA 3MAAC 4G81A 1X9GA 5GIPE 1Z4KA 1KFCB 4PZYA 1NWHA 4GVLA 1B2LA 2Q9BA 1QFJA 2XDAA 2ZIXA 4H31A 4WBSA 1TO2E 4L9AA 4U9HS 1I18A 4XWYA 1KDRA 1KQOA 3AUTA 4DIMA 1U3UA 3IMGA 1E20A 2E48A 1GCUA 3QU5A 3L7NA 4CM3A 3IIEA 2F3QA 1EUDA 3EAQA 1H3NA 1LI5A 4R31A 4WECA 3BMXA 3LQ1A 2XMQA 4C2UA 1EP9A 2YASA 4O02B 3WFZA 2HO4A 2PSJA 3IC5A 2DQZA 1FEZA 1QYRA 3PCRB 3GYGA 4LTDA 1I94B 3I34X 3K6RA 1L0BA 2D2FA 1L7MA 1QH8B 2I9KA 1IHUA 1FMCA 5DTRA 4BKOA 4BVKA 2P6PA 3DVAB 2HV8A 2R85A 4FU0A 4IIJA 4KW7A 1FRNA 2DT8A 1PLJA 5DTQA 4EO4A 3HLKA 4OYYA 4EPXA 4CEIA 1BS1A 5B3KA 3N5CA 1TYAE 1BA3A 3FPLA 1L8LA 3VPHA 2YWJA 4HPXB 4XQCA 1W87A 5AO9A 2XRZA 1MFZA 1XTBA 1YQUA 2AW5A 3DZHA 3HYSA 3KC2A 1Q1GA 4WOJA 4AECA 1YZ3A 2X6XA 2DTEA 4PO9A 3TZEA 4GKVA 4ITRC 3L0DA 2ZBUA 1J0EA 1T36A 1T29A 4LNHA 1DFHA 3AUUA 5JIBA 3I9V1 4NBKA 4BFVA 1JP7A 5DHRA 1U2DC 1GKUB 3GJRA 1TDJA 2B5VA 1U1GA 4WZAA 5F33A 5IYPA 1V48A 1M6VB 4GO1A 4PQGA 4AMUA 4NFHA 3GLIE 2RKOA 4OU4A 3UANA 2GQ0A 5KEIA 4AO7A 1UR5A 5EUMA 4UBJA 1FPQA 1R74A 3KJZA 4U2GA 2ZZEA 3GNTA 5DO9A 1E2BA 5F4MA 8MHTA 1RJWA 4E0FA 1M2EA 4BZWA 3OPYI 4CDGA 3BNWA 2GZHA 2MSDB 1LVUA 1O6FA 1QHXA 4LHXA 3CRNA 1U6KA 2AQKA 3E84A 1CDEA 4NK4A 3O2QB 4BNJA 2VKTA 1LDGA 3TG2A 4KO2S 1BE0A 3EEFA 3NJ4A 1YBFA 2HZ7A 5IWCA 1ZHOA 1SQFA 3GLHE 4U7TB 3ZKAA 1ZW6A 3B6EA 3OKPA 4J0IA 3ZD8A 3VR0A 3FKSA 1QGYA 1UPUA 1GY8A 5EJAA 1ADJA 2BZ1A 3RAGA 5D8DA 1Z33A 4QVKA 5E6RA 5LWQA 2QP4A 2IYOA 4B3MB 4CVNA 1VHDA 2ZITA 2IY9A 2J6IA 4GUAA 1WSRA 4MUEA 3S8MA 5HYVA 3QNWA 3CCMB 1V2HE 2WD8A 3E3LA 4DUGA 4QKQA 3VSEA 4ZYYA 3CZPA 2JAOA 4OXIA 3UWSA 4LF5B 5D3QA 2FF7A 4IP0A 4YLYA 1II9A 1ABEA 3IT2A 3N87A 1SCNE 5FA8A 5CIWA 2RK4A 4JEMA 4MLZA 3FCXA 3AG6A 1UM8A 3ZD7A 1U3DA 3M5PA 1M34B 3RNOA 4DG8A 2BSXA 3K9FC 1BFUA 1Z56C 1V7ZA 1VJGA 4QEZA 4F5YA 4MKHA 4GLJA 3O7MA 1E69A 4X7FA 4J0FA 1CIVA 2PMEA 3RJZA 1NN3A 1N8TA 1XTPA 1VLHA 1XZQA 3FA2A 1UQTA 5E6SA 3H9GA 3Q10A 1U28A 2IYLD 3GH1A 3R6GA 4IF4A 5IAJA 5LQMA 1TYEB 1PEDA 3Q8WA 5PNTA 2YR0A 5TPWB 4QXOA 3DLIA 4U39A 2B7LA 1JXAA 1RYFA 3Q6IA 3TOVA 1CRWG 1EH5A 3F9CA 1ZD3A 1DKOA 4JLDA 5JAHA 2PFKA 1YC2A 4FDTA 3WNCA 1WCXA 2Q0XA 3OZAA 1CV2A 3A8JA 1H8HD 1T6YA 5PGMA 6ABPA 5KOJA 4HNQA 1AZSC 4MP6A 2L17A 4LVOA 2EJWA 4D4KA 3IMKA 5BNWA 3W8FA 1EEHA 2RH4A 4FWIB 4DM7A 4OJKA 5CB4A 3AU9A 4GZ6A 3WJ2A 4TYYA 4OFBA 3KSMA 1J97A 4V39A 121PA 4LHVA 2V6MA 2HIMA 2XZLA 1RAHA 1JQDA 3GNQA 3TJMA 3FPSA 1W29A 1HQDA 3MWDA 5HUJA 5FF9A 1XDUA 1JHQA 1UWLA 3BMCB 3F3MA 3QLUC 1VCIA 5MN6A 2I1LA 1F14A 1G5PA 4AZ0B 3QUSA 2VP3A 1OLSB 2PX4A 4Q7EA 4Y6LA 4YRQA 5DU2A 1X7DA 2XUFA 4BO0A 3WR5A 4DZRA 3HE3A 2WF6A 4ANFA 2GOYA 2V5AA 1E3QA 1K5PA 2HFJA 4XUEA 4HKTA 2QPOA 3U7HB 4H60A 3VX3A 1GTMA 1ONPA 4JYPA 5DGCA 1QCYA 1O1YA 1THMA 2DBYA 5B2EA 1BGWA 2AKAB 2GYUA 2PWBA 2WIFA 4YUXA 3KUCA 2R6DA 2XF8A 1T8TA 1WMSA 3BZUA 3PR2B 4X0EA 3WYFA 3CZQA 4S0ZA 3UCFA 3P9NA 5KDDA 2WP8J 3W3AD 1E79D 5CNKA 2CNLA 2Q5LA 4KQGA 2JGDA 5F4OA 2VF5X 3A6PC 1E1DA 4PLPA 4NIMA 4TRNA 2I7XA 5DYGA 4NJEB 1JKJA 2HV9A 2KS6A 4OK5A 1ESNA 4W7SA 1WM1A 5DX0A 3SSNA 3ZCSA 1ULSA 5BRAA 1P9RA 3GLIB 1Q0LA 1T15A 4YAWA 1N5MA 1TJYA 4N9WA 4RGVA 3ZOKA 1CDZA 3GNSA 1UFOA 4DR7B 1W73A 1ZJ5A 3MJCA 1XZGA 1N32B 2NUBA 1K7FB 5AW9A 1EWYA 1JFFA 1SXIA 1U1EA 2RGAA 3ETHA 1D4FA 4OHXA 4CM4B 1U2SA 3AUSA 2VF4X 1R4NB 5IMBA 4M0LA 1I24A 1CQWA 1JRLA 4M86A 2HLDD 3C3BA 1JF8A 1OJ7A 3CLSD 2EX1A 1PP4A 5B2FA 4TTVA 1II8B 4ID3A 4ALJA 5IHPA 4YA6A 5FV7A 2Q6KA 3A3KA 3GLHB 5E4YA 2JLUA 3A37A 4IHKA 1UFKA 2XGMA 3I6IA 4Y2VA 3QKRB 4YCDA 2FRXA 2D9RA 4AVZA 3LVQE 1B73A 4LHYA 2O57A 4UQPA 1OV6A 3TLBA 1OB0A 3M9XA 4ROTA 2PR7A 5FPKA 4Z4VA 3T1YB 2JLWA 4M0PA 4RNDB 1UBCA 1T3GA 3DP7A 3M4YA 4YJ3B 4BQSA 4ACBA 3O21A 2ZXFA 1HT1E 1USWA 3ZXSA 1BQ3A 3EXAA 1ESCA 4O8ZA 3SC2B 1A9QA 4BV3A 3E15A 3OZGA 3E9RA 2JEZA 3GPCA 4DDVA 4RH0A 1GG5A 3IV7A 4KLCA 3GARA 5HE9A 3LP8A 2XNKA 4D9EA 4Z4QA 4BO3A 4TTPA 3DO5A 3FMOB 3ISTA 3EODA 5AMXA 4V3BA 3WMGA 4EENA 1GQRA 1M66A 3LHSA 1WETA 3J7TA 4MW6A 1JFLA 5TB5A 1RADA 1RYBA 2PH1A 2F4NA 1H2EA 2VDUE 1Z68A 3KJHA 3O8OB 4WW0A 2G76A 1B74A 2NQTA 1KD1D 1CR4A 3H97A 1ESZA 1L4UA 1V8DA 1XLUA 3M1YA 3KTFA 4Y6PA 2WQ6A 2B2XA 1V0FA 1W5AA 3IRVA 4CXMA 3WIDA 1EYZA 4LFBB 1EINA 3PQ2A 4RCYA 5CVVA 5EMMA 4TSKA 1SNYA 1TW2A 2QRPA 1IRIA 2VJBA 4CIWA 1GNTA 2GEUA 2NX2A 4EG8A 4CGZA 2VDLB 3PRHA 2JFZA 1IPFA 5BQFA 4HGRA 4CMHA 3NPMA 4PSDA 5FJIA 4CKBA 3C3DA 2VXCA 3VOSA 1G1AA 2M98A 4H3SA 1MZVA 1TZKA 2XMRA 4A0HA 3CX8A 4Q7JB 3BE4A 3RVPA 2I6XA 4E2FA 4EVIA 1QJCA 4MRAA 1NBIA 2ZVQX 3ICWA 4QG7A 2ZJ3A 2PKEA 2TECE 1ZNQO 4RIEA 1PFYA 2IHZA 1MJGM 2GNOA 2QB5A 2WWXA 4O0LA 2V4MA 4QYSA 3C6BA 1Q57A 2Z5VA 3P0FA 4HC4A 2YTZA 5K1ZA 1U1DA 2W2TA 5J5CA 3RSGA 3E9ZA 2RH8A 4QUHA 3KQSA 1X7WA 4G97A 5AXBA 3CCVB 3ZCVA 1PFVA 4HB2A 4O0MA 2XWSA 5ALFA 3AIMA 2CUNA 3RS4A 2FVXA 3MYYA 2O0HA 3DB1A 4FYYA 5A7HA 3WLSA 4CQMB 2QVLA 4P80A 1PUJA 3AP3A 1DS6A 1MB2A 3H2HA 3PNQA 2WUWE 1MO4A 2GARA 3GVPA 4EHLA 4YDSA 1N8KA 3FWYA 5IJAA 2C2MA 4LFCB 4BFXA 1UFQA 3OWOA 2VDPB 2YHSA 3MLBA 2VT6A 4DK1A 2QR5A 4U3JA 2FFQA 4F86A 4J9VA 4FDLA 4OK3A 1KP2A 4B17A 5BN1A 2TMYA 3HXTA 3FRHA 1H5QA 4QBKA 1NLYA 1TVKA 2IZOA 4B09A 2I55A 5B3LA 1B8NA 3VHRA 3A1CA 1A9TA 3MJVA 3TRDA 4EUEA 3BWEA 1U7HA 2VDNB 3M83A 4JGIA 5ENDA 3TTYA 1XHEA 5KINB 1KTIA 2HSGA 2VH5R 5IUNC 3CVYA 2QJWA 1MORA 1ITZA 4BWGA 1E9FA 4UBOA 1U3FA 4W4TA 5K6AA 2I8CA 3AEYA 1ZD8A 2AC7A 3RUEA 5IUJC 5H8WA 1NVVQ 2J3KA 5HKBA 3FGOA 1PYOA 4NCXA 3GAZA 4PHTA 1KWKA 5JXJA 1G6KA 5SV2A 3SXPA 5FL7D 1RMQA 3A70A 2Z2JA 4XE5A 5CD9A 1XZEA 3D7SA 1RQXA 4WK0B 4BE4A 5B7NA 2CMFA 1U1FA 5K0EA 3KEGA 1HEIA 3HAGA 4G8JA 4J03A 2CNDA 3IUBA 2YY5A 1JQAA 2N1BA 2W5UA 2ZBVA 4WLEA 1OXMA 1TZJA 3IPCA 4CT5A 3KCQA 2WG2A 1D3AA 2EBUA 1GPUA 5ALLA 4M8KA 4RDKA 4RYDA 3RRYA 1X1CA 2GBCA 5A0TA 4KN6A 5IZCA 1GZVA 4ALMA 4FGKA 3IR5A 4Q03A 1XQ9A 5FOUA 4RELA 4DC1A 2HSDA 3KV3O 2ORYA 1E8DA 1TKCA 5C3UA 3RTBA 4MS1A 4L27A 1JEOA 1Z8HA 2YW9A 4ZP1A 3SQLA 9MHTA 4CNBA 1LF0A 1ULBA 4ZCTA 3TD9A 2YDYA 5F2EA 3SU8A 1Z47A 2IIVA 4XDGA 2XE4A 4FB5A 1HK7A 1ZUHA 1ZY2A 1G9SA 4N54A 4P6YA 2VIIA 4XYEA 3S1AB 4DV4B 4JJFA 3DE7X 3M6IA 3PIDA 4PTYA 5G0UA 2ECQA 2Q5CA 3HMKA 3OTOB 1NLMA 4G56A 2DJIA 2HRZA 1ZGBA 4GEGA 4GUDA 5I3ZA 3TZ6A 1Y3IA 2VQ6A 1KDZA 2X8WA 1GZUA 2WYIA 2XYRA 1IY9A 4M38A 4R7ZA 2BH2A 4PF1A 4JJAA 1DKUA 1FDOA 2D4HA 3HKDA 4EITA 5JXWA 4TZ0A 1H0RA 3L7KA 1RZ3A 3NASA 4Q5IA 4V0OA 4DKJA 3TVDA 2D2XA 4EHHA 1V8BA 2DBVO 4ESVA 2EW2A 2O2YA 2ZJAA 1Q83A 1UKAA 3CZCA 1W2HA 4EX7A 4ZZIA 2VTVA 1GPH1 3AYXB 1S2MA 4P54A 5KS2A 1H2BA 4L07A 3N39C 4Q19A 4DSZA 4GC5A 2V55B 1PV4A 1LLCA 4M60A 2JJ8A 3ADKA 5TGZA 3RUHA 4C0KA 1FRVA 2CXQA 1YK0A 2ZTVA 5DHFA 1VKJA 3WADA 3B3AA 4HYQA 3OCVA 4BQNA 1ZAYA 4P7GA 4EFMA 3BMQB 4KN8A 3KL4A 4QAQA 1U8AA 3I8XA 4C22A 2A9QA 3EWAA 1HE8B 4UTRA 2JRCA 2R1TA 2D3TA 4HNVA 5K0NA 2NGRA 3R7AA 3FZNA 4BFZA 1QU2A 3JQBA 4NICA 3IUYA 2FRVA 2N42A 1PRYA 2I7VA 4UM9D 3V8BA 4DCPA 2IGBA 5B57C 1EFAA 5K2OA 5T6BA 2H1VA 1RHJA 3KB2A 5BSVA 4DHEA 1T35A 3KJGA 3D02A 4OHCA 1I33A 3IQGX 3N70A 1CUIA 3C24A 2GBLC 3NTVA 2J5RA 1KYYA 4NU5A 2RGRA 1TM7E 3DL0A 4JDPA 4KPUB 3CEMA 3CVJA 3IESA 4Z7OB 4EJ0A 1DCMA 4OA5A 4R0NA 4PLZA 2RGXA 3MCTA 3SC6A 3U7QA 3OEED 4TLDA 4R6WA 3LIIA 3HLYA 3OO0A 3R41A 4Q9LA 4MR7A 1LPSA 1F0YA 5CW1A 1HZEA 1R0KA 2SCUA 5L51A 1I6LA 3LKVA 4YMTA 2UAGA 4ABYA 1OF1A 3AB8A 3ZYZA 3L7JA 4A10A 4ZTZB 2ZLBA 2DERA 4Q9KA 5F35A 4QGBA 3AWIA 1Z0JA 3DM9B 4EB0A 1IMJA 3WGIA 1I3NA 1Z5NA 4OMUA 2NMVA 4D9KA 9ABPA 1J0CA 5BXYA 3LK7A 3H9NA 3FPCA 4IS3A 2I3BA 2K7FA 4F97A 1NPTO 4DJAA 1TM5E 3DVSX 3TW4A 1OZFA 4BBJA 3PI6A 3CD6B 5IEBA 5I48A 5G1PA 1KJZA 2PUEA 4AYTA 3ZUPA 4WJKB 3K0EA 5A9TA 3ESRA 3CINA 1GPKA 5KYKA 1IBRA 3EPJA 3LCMA 3U49A 1LLQA 3RF6A 1W4RA 2VVTA 3N9IA 3WLMA 4ZC8A 4Y30A 4P1VA 1IJFA 2ZRJA 1UKYA 3RVQA 3X0DA 2JEOA 5T3YA 3KR1A 1CQZA 1TQHA 1VMIA 3VYSB 4DCVA 5FO1A 2UYOA 2FDRA 2I8AA 1FU4A 3IDSA 4AW9A 5DLQC 3K16A 1XPRA 3F67A 1MT3A 4PO1A 1L5LA 3WOHA 2VL7A 3PXAA 2I4RA 1IUNA 1KNQA 2ODQA 3OKXA 3IOCA 4Z0NA 1TM4E 2H2HA 3GIDA 4XEUA 1MV8A 2EP8A 2HHAA 1SUEA 2B4KA 3DFUA 3M6XA 4MW9A 4DDTA 1PT8A 4ZJPA 2NZWA 5L6LB 1VSBA 1T0IA 2YJ6A 2IX3A 1Q7RA 2RH5A 4M36A 2VJJA 3HUEA 2POCA 1Y3DE 3OZEA 4HGPA 5K0LA 2PQ6A 5KYXA 1G4HA 3R7WB 5F9FA 1HTTA 1URPA 1CZHA 3FOWA 1BDBA 1QV6A 4EI7A 4F7WA 5C1BA 2CYBA 1KPHA 1S1CA 5LCXA 4G24A 4CLHA 3V32A 2IE8A 2OHVA 4EB8A 1XAIA 3MUNA 3GDHA 2DKNA 3CLTD 3PD7A 2D7DA 2ISQA 3A7DA 4ILKA 5JD6A 1ZH6A 3LFUA 5EQTA 4FJ2A 3CG0A 5ITSA 4W8GA 1G55A 3IAEA 2JI6A 3JVIA 1AK9A 4A6PA 4TKMA 3EXG2 5H9VA 5JQWA 1ODIA 1EFKA 4DBZA 1EM6A 7AT1A 4WKBA 3V4LA 1E5QA 1ZMRA 3CT6A 1RACA 4QFCA 4GBGA 5LJIA 1KRWA 3LQRA 4ZVOA 1UXHA 3NTRA 3FZQA 2CNWA 4NBVA 4FN5A 2C2BA 4RLQA 5EKTA 4Z8XA 4DYDA 5FBRB 4E51A 3I55B 2HM7A 4K9MA 3NKLA 1D1QA 1PDVA 2VJNA 3VI3B 4RPCA 4F4UA 3FDZA 1W59A 1DO8A 2Y27A 2VO1A 3C14C 3W2GA 3Q3JB 4LK2A 3TVTA 4EJSB 3GCZA 4KO1S 5HIMA 4DAOA 2A5DA 4PICA 1N9GA 4P7FA 4TLMB 2AJDA 4HDCA 5EA2A 1QG6A 3UWKA 3ZDYB 1JNYA 3GNLA 3M6AA 2RDMA 1Z0IA 3OEYA 3OLQA 3CP2A 1JR3A 3EY4A 3P97A 4L0MA 2P75A 5I45A 3LF2A 1CVIA 3PF8A 3LO5A 5JFGA 3HVJA 4NG4A 4EABA 1KE2A 4ZZ0A 3IAM6 4OLFA 2QUKA 3G71B 1V8PA 1NBWB 1PDOA 2VTKA 4D4HA 3TH5A 4QDZA 4JI3B 1MUUA 1PVDA 5FRDA 3GOQA 3TPZA 4A8JA 1ZK4A 3GP3A 3TIXB 2FQXA 4U7JA 2G82A 2NVUA 1HEUA 2YWRA 4RO0A 3T1NA 3PUJA 2A59A 2AZTA 4HQRA 3TIIA 3TPFA 4Q6WA 1SR8A 2YWHA 1TQ4A 1WJGA 3NM4A 4AX4A 2PX6A 3D3WA 4I9NA 1IEWA 1NUUA 2W2VA 3GJSA 3T9BA 1NMYA 3QMVA 1ILEA 4TRJA 1P6UA 1QE5A 3O4IA 3VTZA 4YRZA 1N2OA 3GLFE 4EG3A 2H07A 4JR1A 4YDHB 3SM3A 2ICAA 2JGEA 1V4BA 2YQZA 5DEOA 4XXHA 1D1PA 4AKEA 3N2GA 3D4PA 4I99A 4OAPA 1TJ5A 5LOVA 3W4KA 2XUOA 2OQ2A 3UHOA 1KGDA 4WRRA 3VYRB 4MDEA 1TYZA 1YITB 3EOZA 2DCUA 2EKBA 2H59A 4M0KA 3GLUA 4F4JA 3FG9A 3NC1C 4JKYA 3HNOA 5BYJA 3SGLA 4ER6A 1NI3A 1P9OA 1T5DX 4B3RB 2JCBA 3OE7D 5I4KA 3GLGE 4OLAA 4K2AA 2JKYA 4EKIA 2IRWA 1NBMD 3EF0A 2GM4A 1YCHA 1E8MA 4LC1A 1WUYA 4Q7MB 2JN9A 5JYEA 3T7IA 5IG2A 4BCDA 1YJNB 2CLHB 5I7FA 2WU8A 1WXXA 2XYVA 1VL2A 2GJ9A 3I01A 5JRDS 3VZQA 1JKMA 3PHBE 1Y9EA 3EXIB 5IUKC 4CUZA 2JCGA 2VCEA 2DHQA 1NNSA 2G1KA 1R50A 1SD1A 3F6CA 1ZUNB 3FE2A 4U7GA 3IV6A 3B1KA 4S1NA 1G2IA 4PSAA 2JZNA 3L92A 4EGAA 1EPUA 1FNMA 4QDTA 2GB4A 2ISCA 3BUSA 4YX9A 3RUDA 4PNPA 4N48A 1XOIA 3VYTB 1NF8A 3LF1A 3SEQA 1R8SA 3UK7A 3RUAA 1U2TA 3LI2A 2V9PA 4FKZA 2I6UA 4B31A 2I9PA 1WPQA 3H6KA 4XDYA 3OTWA 2VPXA 5F1OA 4QTXA 3PXGA 1GNPA 2O8FB 1NUTA 3ZE0B 2X8BA 1NI4A 3COZA 3ETCA 1CWUA 3LY7A 4IHJF 1EDEA 3T5AA 4Z9AA 1CT9A 4MGZR 4Q4JA 1QHHA 1UBRS 1BPLA 2DPXA 3AY0A 4MYHA 3U4GA 2ADFA 4LV6A 4AZWA 4G41A 3O84A 2G1UA 4CF5A 1D5CA 2XVMA 4HADA 2J32A 3URKA 5CEFA 4L8GA 1SD2A 2F8SA 2WAOA 3QKUA 5BUSA 4F5DA 6LDHA 4BV8A 4CM5A 4PY2A 1F8YA 3CUYA 4A82A 4LI3X 4NH0A 4HAIA 2IELA 1DX6A 1JQBA 4W6ZA 4PONA 3T7CA 1UZMA 4LTNA 4YWJA 2PTGA 2P6OA 1VE3A 3D5QA 4CKEA 5IAEA 4YP0A 5AW5A 2QY6A 1P4SA 1JBQA 1XLTA 3MWEB 4PCUA 5BY2A 4L6AA 4YJ2A 2F8TA 4FLFA 1EM8A 3G1UA 4I1VA 2QAJA 1B42A 2VP4A 3O38A 5E9AA 1S72B 2QTHA 1B8UA 3BK7A 3QV2A 5ERXA 3BAZA 2V7BA 4C5AA 5SY4A 3NALA 4PG8A 4RTNA 2A1IA 5EL0A 4DWVA 2WF8A 1BWPA 1I2AA 4Q4HA 2P3QA 3U81A 4EB6A 4PG6A 3AV3A 4PM4A 4QPJC 4QPDA 5IK2A 3E4CA 5ELLA 2F90A 4PTZA 1U7PA 2Q1WA 5FPSA 2AC4A 4JZKA 3CSDA 4BFWA 4Z5XA 1JJ2B 1EA5A 3ZI4A 4C29A 4NARA 5B58T 3WJAA 4BB9A 2F6RA 5TEVA 4YMUA 8ABPA 5G1NA 2C3OA 1IQRA 3T4XA 2PU7A 3WO1A 3UW3A 3LT2A 4N0MA 3UICA 1FS6A 1H1LB 2O6LA 1AGYA 3ROMA 4M1MA 4ZK2A 1MABB 1NVDA 4BB6A 2WSMA 1T4CA 1MGOA 3GUVA 5FLKA 1VIDA 5DGHA 3SJ7A 1JVNA 4QRHA 5HKKD 2WU3A 3VISA 1U7WA 2OV8A 2UUAB 5BNFA 2JAXA 3B51X 3GLFB 1JPVA 2FGKA 4YAOA 2AJLI 3CN7A 4UUNA 4DW8A 3IDFA 5JADA 4GL2A 1P75A 2R7NA 3QFFA 2UYQA 3HH8A 1XD9A 2NZJA 1TMGE 1U2PA 3HG7A 4N3CA 4X07A 4CCSA 4I8DA 5AVXA 3BWVA 2A5LA 4KDCA 1RWNA 5ULLA 1R8JA 3KWMA 1F48A 2DUJA 3LUAA 5C1DA 3OD5A 1EQAA 1Y9ZA 2W71A 3A9RA 3GUYA 3QMMA 4LYHA 4JVNA 1NVUQ 1Q15A 4GMGA 4QULA 1RQNA 4ETMA 4WKGA 2OSVA 3GLGB 4KYIB 1NVEA 2X22A 4HAOA 1HFWA 2W4MA 3JZAA 3OP1A 4OHKA 5GGYA 5C34B 5T3UA 1WAMA 4GSKA 3RC8A 1GJRA 2ZRNA 4HWOA 4TTSA 3REOA 1OZGA 2I6TA 3E53A 1F51E 4WT7A 3T4EA 4ZO8A 3KX2A 1NXTA 1S8FA 3LL4A 2PMBA 3MZ0A 4KZPA 3VYVA 5J1SB 1Y8QA 3IR6A 5GVRA 1SULA 2WSYB 2IHUA 4L76A 3ZGZA 3R40A 2V1UA 3JTEA 3EQ9A 1BQEA 4LGVA 1U0OC 3IKJA 1EI9A 3P9KA 1XZCA 3P5SA 2VPWA 5FPQA 3TZKA 1HE4A 3KQOA 3SN6A 2YC2C 1Z88A 2XD9A 3UC9A 4K9QA 1IZ8A 2WWIA 3DYBA 4WZ6A 2O54A 4DQ0A 4M0UA 4RZXA 4WD3A 3ZJYA 4GPD1 5KDOA 4U6QA 5L45A 4MLDA 2AE1A 4CM9D 3KZKA 3EDMA 1ZISA 1DRJA 2GF0A 2PS1A 4FYPA 3RYTC 4HWRA 1KEUA 1OASA 1S7CA 1VYVA