3GIRA

Crystal structure of glycine cleavage system aminomethyltransferase t from bartonella henselae
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
361
Chain Sequence
SLKTLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALLKIGQSRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIALERVLLALQGPQAAAVLADAGLPGNELLFMQGFEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDITPDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFDGPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQRYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycine cleavage system aminomethyltransferase T from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 104
structure length 361
sequence length 361
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 3girA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 3girA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3girA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 3girA03
1V5VA 1YX2A 3AD7C 3GSIA 1X31C 3ADAC 1WSVA 5L46A 1WORA 3TFIA 1PJ6A 1XZQB 4P9SA 3GEHA 1XZQA 1WOSA 2GAHC 1XZPB 3AD9C 3GEIA 3TTGA 1VLYA 1WSRA 1WOPA 1PJ7A 1NRKA 3AD8C 4PAAA 1WOOA 3TFHA 3TFJA 4PABA 3GIRA 1VRQC 3A8JA 1XZPA 1VLOA 3A8KA 2GAGC 1PJ5A 3A8IA 3GEEA
chains in the Genus database with same CATH superfamily
1K8AT 2LA4A 1MN9A 2GJFA 4FBTA 1IB0A 1YSJA 2C3PA 4QU7A 4C8MA 4DSLA 3PXGa 5IFMA 2R7XA 1HHSA 3ZZUA 2X85A 3IM9A 3KHGA 4UZBA 4N76A 1EKSA 2XMVA 2WB4A 3W5HA 5THXA 1T05A 5AT1B 3I5CA 1NB7A 1L3VA 4RDLA 1MLAA 4UQGA 1Q5YA 2E1CA 2FHJA 3HVTA 4NX9A 1QFJA 4M5IA 1QVGR 3OT9A 4RNNA 2LFVA 4TMWA 3H4DA 3FBFA 4RBVA 1H74A 3IWNC 3CGIA 3HJFA 1WTFA 5L1JA 1ZS6A 3EPGA 2CPZA 1N33J 1JIHA 2Y8WA 1U26A 4JI6J 4BC7A 4QHYA 2M5SA 2P9GA 2BJ9A 3PJ9A 4MFBA 4X7FA 4NZ0A 3ISXA 4KAIA 3K17A 3MPWA 3KYLA 4NCNA 4U8VA 1I50A 4NCGB 2XM3A 3KL9A 2W9BB 3EVWA 2DYAA 4GVBB 4DF4A 1UJ5A 1NUEA 2KVIA 2DY9A 2Q66A 2C2EA 2M7SA 2BBEA 1D8YA 4E0DA 3LWLA 1NK0A 2Q1LA 2J0SD 1HWJA 1RK8A 5FNZA 2WVCA 2XNDA 4LRCA 3S15C 3CO0P 2R7VA 4J9PA 4OIXA 1VGYA 2H5IB 2K7KA 4KHRA 4F25A 2FJEB 2HVIA 1Y1WA 1KHVA 3T5LA 4KO0A 2VBTA 4E8UA 4FVMA 1J9ZA 4HE5A 3EUNA 4MEYA 2G4BA 1XNQJ 3J7Z5 1BY9A 5CJ9A 4LBVA 2CJXB 1ZM3A 5IYDC 4ZHRB 3S2HK 4Q5SA 4FNHA 1FX2A 2G13A 1UPMB 4X64J 1QE1B 4Y28C 2RHSB 4CWBA 1Y3JA 1TQLA 4JI2J 4XDDA 2FYXA 2ZDPA 4MMOA 1KOOA 2LCWA 4X0CA 4CO1A 1U2RA 4G65A 4TU7A 1CG2A 1R8CA 3R27A 1X4DA 1RTDB 3UE2A 3KJVA 5U47A 2FDNA 3GTKC 3IXQA 2L9NA 4J5OA 3LAJA 4KGZB 2L9DA 2DERA 3RBZA 1GNKA 1M1HA 2G0CA 5C44C 1X4GA 4B3MF 3S0XA 1Y5NB 3PM9A 1RI7A 3FEZA 3GQBA 1RT7B 2LQBA 2PLFA 2E5IA 3D3CJ 2QT7A 2XNCA 1CS4A 3KK3B 3LPEA 3I0RA 1NM2A 2GVDA 4X05A 4A48A 5HBMA 3VGTA 5EWGA 2NREA 3TX8A 4CLUA 3QGGA 5DDOC 4H4KA 1Z2ZA 5IOQA 4WILA 2QL5B 2HGLA 8ATCB 1TL1B 4TT3A 3VR1A 1NAQA 1G1XA 2QLBB 3BZQA 1H38A 2DEUA 4LSNB 3P27A 2V63A 2XZPA 1N36J 4KH1B 1CNFA 1O8BA 1KD1D 2AJ4A 1SKSA 3THPA 4PG5A 1N5YA 3TVYA 2AGOA 3G6EB 1S1XB 1OY6A 1TK0A 1ZYRA 3OEPA 2OELA 1FDRA 2C77A 4YR2A 3HCXA 1JB9A 3AQOA 4RW8A 2B4VA 1XBWA 2V6SA 2JJ1A 4U8YA 3W1YC 1U1PA 4DV1J 2JZ5A 1EP3B 4HHUA 3ILLA 2H4YB 4R71A 3WODA 1F9NA 4EMDA 1KRPA 2CPIA 4YAWA 2E1PA 4XIUA 2QLFB 1LW2B 2DO4A 4NLSA 3TFJA 2WCXA 3IBWA 1TWAA 1QFZA 2PEBA 4DL6A 3PDNA 4ZVPB 3BSCA 3S1QK 2BW7A 3MD3A 2VJUA 3U02A 2QX0A 3I32A 4GTFA 3AY0A 2PPBA 5IYQA 1EFUA 1QGAA 3NGDA 4W98A 2C1EB 2HWIA 4U7UK 4B08A 3CIZA 4KFBB 2ZTNA 3CP2A 4FKYA 2GAGC 3C14B 4NLPA 4DUTA 2KJWA 3AXKA 2BE9B 2VFRA 1K1SA 3MUVP 1UVLA 4JK1A 1XZQA 2Q6OA 2WZNA 2Q43A 2C4UA 4Y2CA 5K8NA 2KT3A 2CPXA 4DK0A 5TRDA 2W2MP 3PUNA 4EBEA 1HR0F 1YBTA 1HQUB 3CESA 2B5JB 1F9HA 1PIEA 3CD6S 4RDKA 3OTBA 3QLHA 2BZ2A 4DUZF 3GFZA 4LFAJ 4KYZA 2R7UA 3M2UA 4KIAA 2VICA 4KRWA 3VAMA 1VQ5B 1RT1A 2JA7C 2KTQA 1RAEB 3FKBA 4II3A 3EYZA 2HZCA 3G4CA 2JJ4D 3DKDA 3OQ2A 3AAWB 4OFZA 4JUZA 5GAHU 1HVXA 1IE0A 2CJBA 4I2PA 2N3OA 3GTYX 4ZPTR 5LT5A 4OQJA 2F43A 3HLUA 2J8SA 3E2EA 3GTKK 1Y1VK 3FQKA 1UVKA 1H8HA 2OPSB 1RAAB 2VNJA 1SV5B 1LK5A 3MMLB 4O2DA 4ANDA 1N4LA 2VBVA 1XC9A 3UNYA 2R7QA 1PJ7A 3N28A 2MQ8A 1CJKB 4I64A 3KUEA 3ZTSA 3L7OA 4G1BA 1RLCL 4I2QA 2XY6A 5J2PA 4LQYA 2A68A 5I3UB 4XORA 3G87A 2E5JA 2DTJA 4HE6A 2XMTA 4JV0A 1T95A 4CI0B 2BKNA 4JI0F 3S6EA 3UVJA 2H54B 1HYSA 2GFFA 3M2RA 2MXYA 5H1SV 3K57A 3TQ1A 3U1MA 1KQ4A 3NY0A 5D3GB 3W2FA 4I1TA 1BQXA 4EUVA 1JMTA 1Q86D 5D8HB 1X8DA 3A3GA 1BX1A 1KQFB 4B3RJ 3EGWB 3DRPA 1UFWA 3MM8A 1UFKA 1IWGA 3R5AA 4DDFA 2ZH7A 4DN0A 4WFYA 4OI1A 2KG1A 3HKZD 4X4VA 4ZVQB 2C2RA 2IBOA 4NI2A 3FBBA 3PKYA 3C15A 1KK0A 5KT4A 3ENAA 1QUFA 1HKAA 2IYGA 1TLLA 3POTA 3I1FA 1RU1A 1VYAA 5KT3A 2IVYA 5D0RA 5FIIA 4DNTB 5ETNA 3GYXB 4DR7F 1SQEA 2BV3A 3FVYA 2BJ3A 2IY5B 1Q82D 3QSYB 3RU0A 3CJRA 1VJQA 4KV8A 3MURP 4DSKA 2F63A 1UEVA 1UVIA 4G7OA 1V6HA 2KU7A 1SKWA 4X7DA 1HQUA 5CQGA 2D74B 1GX6A 3Q0AA 3GPAA 3HD1A 1YVFA 2FZKB 4IH6A 3R1LA 3W2HA 2NVYA 4AFFA 1ZM4A 2GQQA 4F4AA 3CPWB 4DV2F 3BQ0A 2BJ7A 1IKWA 4KJIA 1GMWA 3PHEA 4NOHA 1OPZA 2HWHA 1N33F 1YJTA 3ZTRA 2XCPA 1Y0HA 3UR0A 3RRKA 2WJVA 1DCPA 4ZIVA 2ZKTA 1YQHA 3FZ2A 4DV7F 1PCAA 5KFYA 2KT5A 3QFWA 2VA2A 4M63A 1DQAA 5KFAA 3RRHA 4PQUA 2JA5C 1F0XA 4D3HA 3DLLQ 3W2EA 2DJWA 3PENA 3CW2C 2XO7A 2HRUA 3HOUK 2C4TA 1J27A 1F7VA 1IJFB 1YNNA 1S57A 1NXIA 3OEHA 2V8DA 4IUFA 4KC5A 5L9XA 4C48A 1XZPA 4PXEA 1LWFA 3MR2A 1ICEB 2W8LA 4QWBA 4NE9C 3RAQA 1CJUA 2ZHAA 1R31A 3RB4A 3Q2SC 1YITB 2E1MC 2BQ3A 4A3BK 5DDPC 1S1TA 2XCRB 3O8WA 2H1YA 1HNVB 4XN3A 1QTMA 5HROA 4WXOA 1Q8BA 4B9NA 3WDOA 3CD5A 5J1PA 1VBZA 4HKQA 1FXLA 2J7UA 3C8YA 4CLLA 3IFEA 1AFIA 4DSEA 1S12A 8RUCA 3SKBA 3FK4A 4P3IA 2XTJP 3BS9A 2OKQA 3WIUA 5HQLA 3LW5C 2RS8A 4C6AA 3WBZA 4R5PA 3OFHA 2J9DE 2MDAA 5TJ3A 5IV4A 2W7PA 4K4TA 5C25B 1Q82T 1E64A 2RE1A 1F1BB 1KD1T 4GT9A 1HI1A 1S9FA 2Y9HA 1CBKA 4RUHA 2BOAA 4RZRA 5DS0A 2ZH1A 2V4JA 3GCWP 3M8SA 3ZIAA 1X5SA 2PMWA 4BY7K 3Q8PB 1ITPA 2OD6A 2MKCA 1WCMA 3TZZA 4M53A 1VH2A 4QW9A 4I69A 4P25A 3QQCD 4NRUA 2CXEA 1SFOK 3W8GA 1FNDA 3SDEA 2QMUA 3GTPC 2QO3A 4RL1A 1I50C 5AE2A 1MMNA 2CZVC 1D3WA 2C3YA 4P74A 5A8WA 1QUVA 2EK1A 1CSJA 1O29A 2VBSA 4YB7A 4R0JA 3BPDA 2QA4B 2DNOA 3NGRA 2GIQA 4M5GA 4A3IC 3G8QA 3W5UA 1CVJA 3MR3A 1WDTA 2BM1A 3TA2A 3NL0A 3GIKA 1IM6A 5DDRC 2JLGA 2ATCB 3I55B 1DAXA 1S6QB 3DDYA 2WVEA 3I31A 2Q6KA 2F9DA 2G9OA 1VQ6B 3GDZA 2XHCA 4K50A 2W6IA 2GO8A 3MEGB 4FYWB 4QVJA 3MOJB 1K1QA 4DV1F 4H4OA 2KZZA 3OE7A 4OZ3A 1NZAA 3C3LA 4ILDA 4LREA 4KMUA 1Y7PA 4AUKA 3DXSX 3LP1B 3BDPA 2Y1IA 3DOLA 3MUMP 2BJ8A 5H9FK 5IOLA 1SUQB 2YKMA 1SVDA 3KJFB 1C2PA 3EX7B 3Q3QA 2R7TA 1KHWA 5IWAJ 4LRBA 1VLOA 3ZZTA 5B0EA 2DRAA 4I7FA 1U24A 4Y9RA 2CQ0A 3W2IA 1OPIA 4GKJJ 2C2DA 3AB2B 4ZPAA 4V19J 1UD3A 3K5OA 3PO5A 2CZ4A 1DFDA 2HGNA 4X62J 5KG1A 3J80U 1JLGA 3I5BA 3CQZK 5D4LA 2VONA 3LANA 2CNDA 1GMVA 3D9BA 3LA0A 2XG8A 5AJ3F 3TR5A 1HR0J 2WVFA 4YAOA 3H5YA 3VMFA 3W5VA 2DXDA 3FEYB 4PEOA 4O0IA 1U6ZA 3Q8YA 1R5OA 3KLVA 1RTJA 2B9XA 2IAJA 3TZYA 1WSVA 2D3O1 3GTJA 2VA3A 3CC4S 1J5EJ 2G2OA 1QE1A 2V68A 3RTVA 1JQGA 3IO1A 2YWFA 3BEGB 4OYOA 1AZSA 3CAGA 2QA2A 5C44K 3DU6A 4F04B 2J9CA 2WBRA 1W7WA 3MR5A 2HS4A 4ED3A 3SIPB 1XNRJ 3EVMA 4RD2A 2CQPA 4YUDA 4PC3A 1GTEA 4CDIA 4A3GK 1TL3B 1N06A 1WWHA 1JNZB 4F0MA 2AMCB 3TZXA 5HROB 1L3KA 3UDLA 4YEJA 5HZAA 1JLEB 3KDOA 2Z57B 1FTRA 4XK8C 1V3RA 4KHPF 5E3AA 3M7VA 3AB4B 4FF2A 5H5JA 3V81B 2FY1A 5C25A 3OW7A 1RT3A 1FTCA 3VVTA 2RF2A 5EHHA 1PC5A 4R5PB 1U1RA 1B4BA 4RNMA 1QFYA 3FBEA 1CQXA 3S15K 3EZ5A 4LF8F 4UZEA 1CJUB 1F3FA 3TRGA 4HVZA 1MRZA 1BLIA 5I4MA 3ASRA 3ZC3A 2V6AA 3C16A 3OZVA 3ITHA 3VAHA 4PCQA 2FVRA 3OHAA 3ILIA 2FQTA 3RG6A 1V3ZA 1U4BA 2YKPA 3VAIA 5DSZA 3GP9A 2C42A 2RS2A 3GTOK 2XULA 3KJVB 2JC0A 4BLAA 4XONA 4ZLPA 4Q0BB 2L48A 2JDIA 1IR2A 2HFOA 3W2VA 2KH9A 1HBUA 4XO0A 1RQRA 4KY3A 2Q3PA 3AD8C 1H98A 1T11A 2RDJA 2D9PA 1OIAA 3GSIA 5KFBA 2Z2YB 2B51A 3GEHA 1NSQA 4LVOP 3TQEA 1YJ7A 4QV2A 3W66A 1WHVA 4XAKA 4WP8A 5B0CA 5DGAA 4LJZA 3IN5A 1SH3A 3OAAA 1U1LA 5ETVA 1S1UB 3TOQA 4LRFA 3OJSA 1IUJA 3W2WB 4F50A 3QZ8A 4KARA 3Q39A 1D1UA 3MFHA 5F3ZA 5CYQA 1O2FB 2A6OA 4F67A 1J6VA 1GO2A 2JA6K 3J7ZT 4E2FB 4LJMA 3CPXA 3QIDA 2HNDB 1PG5B 3MM7A 4UW2A 1PKVA 2R93K 3PX6A 4C7QA 2AX1A 1U2CA 4P2MA 2A2DA 1B7YB 5EMNA 4RMFA 3G4SS 2OLWA 3PR4A 2LQ8A 1OS5A 2PA8D 4ECUA 2DOGA 2AV5A 2HQIA 1RYSA 4PR6A 1W35A 4L74A 1Y1VC 5F8LA 2PGCA 3BGLA 2GSNA 2VNIA 5D4PA 4Q8FA 4ZJLA 4Y2KA 3FJ2A 2BQUA 2MQMA 3EZUA 4MAKA 4ELVA 3W3SA 2POKA 4BHQA 1N34J 1KOHA 1QTNB 5HVGA 4TN2A 1YRUA 4ROXA 1R8PA 4ZP8A 4DR5F 2OMOA 1OB0A 1KZLA 3SSSA 4P73A 3M8RA 1QX4A 1NHVA 1VQYA 4U7CA 1JA0A 4XLEA 2E2HK 2DT9A 4NCAA 4PG7A 2Y8YA 3NRBA 4BBSC 2CQHA 1Z4UA 1I6VA 1TWCC 3DGPA 3BQ1A 2WR8A 1TWAC 4FF3A 2CYYA 2C2OB 1T8EA 4K2JA 1DBDA 3N5FA 2HVHA 1LWEB 1VR6A 3CDUA 1KJZA 1JNYA 4ECWA 3CE8A 5DETA 1CQNA 3QRPA 1JLBB 4QJVA 3ONUA 1S0NA 4DV0F 2B7CB 2PE3A 3D1QA 1U1NA 1UA0A 1H7WA 1ZA2B 1JLCB 4ENOA 1DRZA 4M5LA 4WTOB 1K83K 1HLWA 3MCSA 1UKUA 3OR1A 4C2MK 5HN0A 3WNDA 3HT3A 2NPFA 1YJWS 2CW5A 2WOMB 2OPPA 2ZL7A 1KK1A 1SQGA 5BYRA 2R8JA 2KB2A 1IBKJ 2VBWA 5K5MA 3CJSA 5A8KA 1WQGA 5KG2A 1WU8A 1R8AA 3HFKA 4TN1A 2D7SA 2KYXA 2MJNA 3BDEA 3BH6B 3R5DA 5KT2A 1RHMB 3GTJK 2HVDA 4WXWA 3LP2A 3OUYA 2KXNB 3HOZK 1RWKB 2H51B 2VG7A 3CTAA 5C4JC 4Y0FA 5G4DA 3GG0A 3HD2A 4UTGA 3RB6A 4Q4ZA 1C1BB 5GAGU 2W9AA 4M1XA 2CRLA 2UZAA 3MR7A 5ETPA 3B4MA 1FFWB 3WXMA 3KNGA 3PYGA 5E0OA 5EWEA 5ITHA 2K2PA 4GVBA 3UN5A 3KLFA 4Q43A 2GREA 3K7RA 5HVFA 1SB6A 1Q16B 4TYAA 4USWA 5M2PA 1HHQA 3CCZA 2M70A 3HHDA 3W5YA 3CT9A 2UXBJ 2XEXA 2VC0A 2VIHA 4UZCA 2DYIA 1D8ZA 5IT0A 2CWXA 2EEYA 2GJPA 1L3UA 3J81Y 2ZBRA 1TV6A 3DNCA 2QDXA 5DRKA 3HFVA 2OPQA 4ZPCA 4P12A 1JOEA 2DGWA 3LO8A 3MOZA 5FLMC 2DO0A 1RE1B 1R5NA 3AXMA 5KG4A 3CC7S 5E3QA 3NS6A 1IWAA 1S6UA 3H2UB 1Q53A 2XGQA 1Q9SA 1PGZA 3FSYA 2L41A 5IORA 4BWJA 3IR7B 2KYZA 4GKJF 4C3MA 3S1RK 2YNIA 1FXDA 3GFYA 2L9WA 3DCAA 2IM0A 4X62F 2UXCJ 2DCLA 3T1YJ 2W6JA 1ZTWA 3BH4A 1JQWA 5M3MK 3HXMA 2UVWA 4RW7A 1IKVA 1NK5A 3HSDA 1BDFA 4OHYA 5KAKA 3ONQA 3MM6A 2P6TA 5T7LA 3QT6A 3HFZB 2ZNZA 2VPZB 3CCJB 5KFFA 4ERDA 1YJNB 1ZZNA 3T5KA 1EX8A 3HT0A 1SC4B 1TWHC 1J5EF 3BPSP 1ULRA 4LF6J 4Q45A 3IBFB 4NEYA 2XYGB 3H40A 2ZOMA 1FHTA 2AHOA 3O44A 3UR3C 2B7CA 2PA3A 3MMAA 1X4FA 2DGSA 4YN3B 1ZM9A 4WU3A 1PAUB 4KMHA 1XR6A 2RSQA 3MPUB 2B63K 1KQKA 3CCLS 4OI3A 2B6AB 1SIWB 3I87A 3ASSA 1T9UA 2XMMA 3M6UA 4YR3A 3E1YE 2CF4A 1S1VA 4BXXC 1MMLA 3P8BB 4FF4A 4XLNA 1EHWA 4FP9A 1RT2B 1K83C 4Y7CA 1HI8A 5E7OB 4P9SA 4P6QA 1NPKA 1XK8A 1O28A 2V2VA 1PYOB 1FRQA 2YH1A 3OVBA 1TL3A 2ZZQA 2KO1A 1T3NA 4N3GA 2E2JK 3PVXA 5EN1A 4IKAA 1CQMA 3R2CJ 3S14K 3KUHA 5HSPA 3CXCB 3RZAA 3F56A 4LF8J 1SC6A 2FQQB 5BSXA 1M5HA 3T3FA 4B48A 3FSIA 4KATA 4LK1A 4IG0A 3BNWA 2FC9A 2GV1A 3PJWA 4R8UA 4DMZA 2ZITA 2CG4A 4LF9J 2RB7A 6FDRA 4AH6A 3PV8A 4AF6A 3HZEA 2A6EA 2QSFA 2VUMK 2ZE2A 2KXFA 2KVOA 2Y1LB 3FCWA 2MHNA 3QATA 4BBRC 3HDSA 3GIMA 1BGXT 3BGRA 4DX7A 3UPFA 3P4UB 4F0HA 1DARA 5FLXY 2HMIA 1HPZB 3C16B 2QLXA 3M8PA 3SJPA 2VNHA 3HOWC 4K4VA 1AA1B 1MROB 4GTEA 3V6DA 2E2HC 1IJEB 4RDJA 4BBSK 3ZXWA 3RRGA 5FLMK 1ZOTA 1TWCK 3LAKA 3LO3A 3HOXK 3AVWA 1EXMA 3PYDA 4X4NA 5IT9Y 2XZWA 1R5BA 1YHQS 3HK2A 3QT5A 4L6V3 3BN7A 2PE8A 4OJ3A 2X1FA 2HVEA 1WCMC 5C4XK 2RUGA 4JI6F 3C2PA 5HMZA 3QAUA 2X1AA 3CMAB 2W2NP 5CCLA 2ZJRQ 3G71B 3CDAA 1H0HB 1NJID 4FM9A 3BSOA 3WBKA 5ADZA 4UY85 5ETLA 3CVKA 1YLXA 1JJHA 4JI4J 3PY8A 2HBRB 4O23A 1AMOA 2Z0GA 4WZMA 2CVEA 2ZUEA 1Q1KA 5F8IA 3PKMA 4PWUA 2FVGA 1H2UX 5IP7K 4OZ0A 2NXNA 1XN9A 3MMCA 4EYHB 1H2VZ 3QFCA 2FPHX 3T9ZA 3GJQB 1S49A 3HVWA 2J0WA 4GC6A 4KKUA 1NJIT 2HK2A 4KV8B 2ZL6A 5HJYA 3QFSA 2J6UA 4ZV4A 2V5HG 3DRPB 3C46A 2MTLA 4DEZA 1KK3A 1ZQ1C 4OHXA 1U6BA 4IR1A 2GGPB 5E5NA 1UVNA 4DR5J 1FDAA 3C15B 5E3PA 4IOCQ 2I6WA 1NZ8A 3GV5B 2KJVA 1DDGA 4M8LA 3U2QA 2D3ZA 1E62A 1NK7A 1GAQA 1VGXA 3D68A 2XLKA 3KTQA 4A3JC 2ZC3A 3PZPA 1UW9A 2GJ2A 4DFJA 3OR1B 1TVCA 2N3LA 3MM5A 4I2QB 2E9TA 3IG1B 4IRKA 1A6LA 3M32B 1YJ9S 2M5YA 2XNJA 4TXSA 2VZLA 1X4HA 3PR5B 2V4QA 3TX0A 2ZM6J 4DR1F 4D3GA 2W9CB 2YY3A 3IM8A 3W63A 2HIYA 3H8YA 3AJDA 1NK6A 2B4UA 4B3TF 4PC7A 3IAM9 5E2QA 2CNLB 2W2PP 4P5AA 1W34A 5CZXA 1C0AA 1X0FA 1PBAA 5CCMA 1FKOA 3HMJG 4JV2A 4CM0A 4RW9A 4NLWA 2DH9A 1SH2A 2HURA 1S72S 3WBJA 3I4HX 2WK4A 4X65J 1U1QA 1RQ0A 4A8MP 1B2RA 4J9MA 2W24A 2X1GA 5KFKA 1XTZA 2VQEF 4DCPB 1EQRA 4C3JC 2QC3A 1F93A 1LEOA 3FMBA 4LK0A 5C42B 4OX9J 4JOUA 3EZOA 4NXMJ 3MMCB 1UD5A 3CCUB 2UXDJ 3NUHA 1N36F 2QTZA 3QPIA 3I4MC 1ZUNB 4B17A 1VIOA 4X66F 2QIFA 2XYPB 4FK8A 4DV4F 4P26A 5DS7A 3PACA 2E2HA 2P3MA 1AB8A 1JJCB 1R6YA 3AA9A 2ZD1B 1KWMA 2UXBF 3DRRA 3QSIA 1HBOA 1VQ9S 3O1LA 4YFNA 1YRTA 4CYUB 3W2WA 3DYAA 5SZTA 3QFTA 4QQBA 1LFPA 3ENWA 1RTHA 3S7RA 2JX2A 5FIUA 3DRSA 2ZEJA 2PFFB 4DPTA 4RD6A 2YWWA 3IGVA 4FXWA 5HQ8A 5BJRA 3FOEA 4N8OA 4NZ7A 1NK9A 4DR3J 1Y1WC 3M4OC 4A8YA 4P2XA 4DSIA 5B0GA 3QJJA 2VG6B 3AVXA 4YFKA 3KLHB 3J80Y 5IYCK 1V5IB 4OZLA 4ILRA 3OSPA 4G1VA 3BR9A 4AE5A 2V8GA 3H0GA 2KI2A 1FDBA 4FWTA 3NWRA 2IRXA 3BBCA 2K3KA 3OLAA 4CLSA 3SV3A 4USMA 2CQ1A 5HI7A 2VJJA 2MSTA 4Z4UA 4JI3F 1VQ7S 3Q6RA 3V6JA 3IAS9 4WFZA 5CHPA 3V6DB 4K0KJ 3AD9C 1G51A 2WPDA 1GQEA 2DGUA 4ICLA 2BANB 5C7PA 1BQNB 1KQGB 3VZIA 4UOHA 2BGIA 4LF6F 3MEDA 3GIIA 3D0GE 4O3SA 3GE9A 1SFOC 1RADB 1CLFA 3GTPK 2BUNA 4K4UA 4V1Ak 4NMXA 1LW0A 4QOTA 4ZVFA 1AT1B 3K58A 1HNWJ 3QAEA 3HVRA 4DR6F 2MGZB 2XO6A 1KC8T 3D28A 3WYAA 1I7PA 4XD7A 2E2IA 1S1WA 4CLYA 1C0TB 4ZLLA 4A3IK 3CMAS 4J90A 4DPOA 1EK8A 1JLFA 2GVZA 2VKZG 2YNHB 1C4CA 2DHXA 3VZHA 1S0UA 4GC7A 1VC6A 1WQFA 5B0FA 2RH3A 2PN6A 3FKIK 1P8GA 2ZBVA 2W01A 2QSWA 4OI2A 3RZDC 2R93C 1EP4A 1ZVUA 3QJLA 2DEIA 4DFMA 3MM5B 1RTIA 2I38A 3DGPB 3LP0A 5F8JA 2HZVA 2ZZNA 2BVZA 2GX8A 2ZUAA 3RYLA 2P8TA 3SCKE 2MY7A 1J6WA 1I6JA 4A3CC 3MMBB 3D3BJ 3CQZA 4C0SA 3T01A 5T14A 2FVQA 4J0QA 3OL7A 1XR5A 4OPSA 4IO9Q 4JMQA 2BE5A 1SJQA 5B7WA 5GVQA 1OO0B 1YIJB 4M5JA 3ONYA 2KN4A 2KL8A 1KTVA 5IV3A 3NOGA 2V7VA 1TUIA 2WW8A 4FXDA 5AE1A 5DO2A 5M5XK 3T9NA 3H5UA 2CJ9A 3EE3A 3DRXA 4AYBD 1E63A 3M2VA 4LSLA 5IZHA 5EWFA 3K5LA 4WFAQ 1RTHB 2VV5A 2YKMB 3M6XA 4QIWL 2V7QA 3CCJS 1HWIA 1XFOA 1TU0B 3MZIA 1NNDA 1VQOS 3FSXA 2E9ZA 4RJVA 2K1RB 3LQEA 1QD1A 4OLPA 5KFVA 2Y1JA 1DLOB 4GMKA 2RDDA 2MKIA 4ECTA 1REVB 5HAOA 3HHNB 2XMWA 3WIVA 4USUA 2BYCA 3THTA 2I5JA 4ANCA 5IC6B 4M4SA 2OPRA 1D2EA 1XMQJ 2DGXA 3C19A 4LFBF 4DR4J 4P2FA 4RW8B 4QFMA 1S59A 2HEKA 4A3GC 4DLEA 2ZXIA 3KK1B 3UWTA 1XQBA 2CJQA 3QFHA 5KFRA 2XNRA 3EWGA 2UV8G 2NUUG 3DC2A 3WNBA 4F36A 2GHPA 5GAGI 1EP4B 3ICLA 4M2LA 5B0BA 4H4KC 4MIAA 5RUBA 4DG1B 1R0CB 4DUYJ 4XLPA 2OBSA 2ZBCA 3LP2B 2GHVC 4WP9A 2DH8A 3BO4A 1FCAA 3MMPA 1RAFB 4MK8A 3IGNA 4JI8F 4A3FK 2C3OA 2B4PA 1VQ4S 3EMTA 1QY7A 2AJ0A 4DV5J 1YHQB 3MEEB 3VR6A 4Z4YA 2QRRA 1S0MA 4N56A 4OPVA 1WHWA 4P75A 4DR2F 2JNJA 2B5JA 1TAQA 2AF6A 4KR0B 2W1BA 1E6YB 3H9NA 3RAMA 3JU4A 1S9EB 4DQSA 1LNQA 2DR9A 2H65B 2R9LA 1E1RA 1XE1A 2HFSA 4QIGA 3TAPA 4LRDA 3OR2B 1VF7A 3K8WA 3HF5A 1YNJA 3KK2A 3W8PA 1TL5A 2G0JA 2NSBA 3S1RC 4G7HA 3S16K 1JNRB 1HW8A 3PW5A 2KM8B 2RUSA 5H9EK 3DGVA 2MGZA 4ZP7A 4QU6A 2DR5A 4B3TJ 5D0EA 3A8JA 3CD7A 2WW4A 1VBXA 4FS2A 2JWNA 1D8TA 1UVJA 2CW0A 4GTAA 2CNNB 4WBFA 2HLUA 4AF7A 1YBUA 4O3QA 4U95A 1AB4A 2EBGA 5F3TA 1HD0A 3BC9A 1ELOA 2QN6B 2F7VA 1VQLB 2LXFA 5HP1A 1FKAF 1VQKB 2LLZA 1GK8A 4KC6A 2BN4A 3V6KA 3ENVA 2MHEA 1IXKA 4X65F 3S8SA 1IVZA 1K0VA 1TK5A 3CD6B 2V8HA 4B9VA 2RQ4A 4NASA 5MLCV 3D4JA 3BSAA 4LF4F 1YCLA 2HDNB 3BF4A 1V5VA 4TQSA 2EK6A 4XPEA 1M5PC 4DJBA 4YALA 1E6VB 1RT2A 3GTMK 3S17C 4OOVA 4RBUA 3CULA 3ZO7A 2VDIA 3CIMA 4J9NA 4ZCMA 2FHOB 4ZN3A 1F9FA 3D6FB 2R2RA 2XNQA 4J9QA 3VO1A 4EO6A 2QLJB 3FUYA 3CP8A 3NNHA 4TYBA 1O24A 2I5JB 3N0BA 1IN0A 1HPZA 2AD9A 3DOMA 4XNFA 2XSJB 4UF4A 4DL5A 1CPZA 2F4VJ 1S97A 1RHRB 1TWCA 2LP4A 2F65A 2P8IA 4ZVUB 2AX0A 1W26A 3PO3K 1B0VA 1S1XA 1K9MT 1UEUA 4GO7X 4I0WA 4NLTA 3BJYA 2FB0A 2NVQC 2W8KA 2DNGA 2HQ3A 2ZHOA 3QWPA 2BJDA 3IA0A 2JL9A 1G6BA 1REVA 5E3RA 2IM2A 4ZVOB 4ILLA 5AXLA 4HH0A 3CJ8A 3WY9A 1YITS 5C24A 1U6FA 1MMDA 3O5TB 2QFIA 2AYBA 1NK8A 2QE7A 2QEXB 3S2HC 2W2QP 4K4YA 2Q6IA 1D9AA 4JYAF 2V2QA 5A8KB 1ZBTA 4Y7NK 1SL1A 4W92B 2NZCA 3QBCA 4IFVA 3MECB 1M5VC 2XCQA 5IYBC 4I6WA 4JI1J 5KT6A 4DCOB 4FZVA 3IR6B 1FRMA 2GIFA 3HOYK 1RZMA 3Q2TC 2ZH8A 1UETA 1JLBA 4LSZB 3CCWA 1WCMK 2O67A 3R5CA 4G7XA 4ZVTB 4I6YA 4YY3F 3PG9A 3CXCR 2KXHA 2EFNA 1KN6A 1E79A 3F0NA 3GG1A 3KDNA 5KG6A 2RQMA 3HOVK 1KLNA 3T1HF 1JXEA 2F8HA 3WQPA 4NA3A 1DJ0A 3KK1A 1E1QA 1WUUA 3MPDA 2CPJA 1NSPA 4OI6A 3CCQS 2A18A 1REGX 3R6JA 2DCUB 1B3TA 1X7VA 1TKTB 4CLTA 2YX1A 3HHKA 4WJ4A 3IP0A 3PW7A 1BX0A 4YS2A 2J7WA 3OL8A 4USVA 3DRYA 3JSRA 2WJYA 3LOUA 4PG6A 1N8RT 1RTZA 4O3RA 2R3VA 2P5VA 2ZVSA 4WJBA 4DQPA 2E7XA 1LK7A 2EC2A 2DHSA 4OIQA 1T9VA 2QMWA 3LGHA 3PRDA 5IT9U 3M8WA 2WB1D 2MLZA 3CCQB 4JV5F 2FX3A 2HG4A 5I3UA 2E1AA 2ROGA 2BQRA 2E7VA 3JTNA 3BR8A 4KBIA 5HMWA 2M8DB 3MCMA 3D1OA 5F8NA 3GJSB 3W9HA 2YKNB 3Q8VA 2D9OA 4AQYF 3ZZYA 1R9TK 4LBZA 3M8QB 3QGHA 1FRLA 3K5NA 1ZPWX 3TYTA 5EX0A 1HNXJ 1HARA 1GEHA 1R7IA 2ZHBA 1HW9A 2E29A 3TVZA 2AHOB 4OI4A 5IYNA 1VMBA 2CDRB 2OEKA 4Z4RA 3JTOA 1NDHA 3GIRA 3R2DJ 4TLRA 4DS5A 2QE5A 1OYDA 4CO2A 2X6WA 1HWUA 3TO8A 1Y5LB 5F8HA 1CJVB 4FYVB 2LEBA 4NLGA 4K1XA 3TA0A 4L75A 3PW4A 1FNXH 1CJTA 3TFHA 2JEGA 2LU1A 4A93C 4Y9UA 3KLIA 3DLKA 5C5JA 4AYBL 1CNEA 4LC0A 3P5TL 1TKXB 4RPFA 5IM0B 3HSZA 4C8LA 1HL6A 1XMQF 4IYQA 1F9EB 5L1IA 2M9KA 1RYRA 2CG8A 3MEKA 1WP6A 4ED1A 1FO1A 3OPOA 2CQ4A 4PAAA 1N0UA 3R5BA 4DPYA 2JJ2A 2LKZA 1JVIA 1EFCA 3VAKA 3PA1A 1FE4A 1N5YB 2JA5A 1JXLA 4DX5A 2KT2A 3ERED 4NYZA 2IM1A 1SC1B 2F4NA 3L95X 4CH0S 4IG3B 2XHWA 4KGXB 1NKBA 4DQIA 4OIPA 4PUOA 3QZ7A 4P3YA 4CNZA 4ZGQB 4WFXA 2PMHA 4TSFA 4Y3CA 5F8MA 3L9ZA 4JI5J 1N5QA 2X3DA 1Q7LB 4NBSA 1RBAA 2FUG9 4IDKA 3N4WA 4U6PA 2UUAF 4ED2A 1TWFC 3A3OB 1I3QC 1HA1A 1KKHA 2XMUA 2Z30B 4ELTA 2V94A 3MECA 2R2UA 4IOBA 3O2IA 2R2TA 2J0XA 3BY2A 4A3DK 1I51B 4ZVGA 4X64F 3S1NC 4GQNA 3BCFA 3SQGA 5K9FA 5M2RA 3DMJA 4MK7A 4LR9A 3E01A 3LVBA 2JDJA 2OSQA 3QX3A 3JAMY 2X6XA 1XWLA 2IDLA 1TKTA 2CPEA 3P3DA 1RTIB 4RR5A 2LYVA 4QUZA 3CCVS 3T5JA 3VA7A 1LQ9A 1M1KD 4KGVB 4FBUA 1VI7A 2BMWA 1UP1A 1FVQA 4LF1A 1APSA 4EEYA 1I18A 1JXVA 2DIEA 2DNNA 1S0OA 4PWDB 2GC8A 2ZBIA 4LR2A 3FJOA 4E98A 5GV7A 2QLWA 1TWHK 4CIOA 3D26A 2YBVA 2Z4PA 2JEFA 4DV3F 2A6HA 3ZNJ1 4Z4VA 3WZ0A 1IBKF 4Q2MA 3HOXC 1RWNB 4EBCA 3EXCX 5IK2A 2HCJB 1UFLA 3JQPA 4F8RA 2YNHA 5A6PA 1IQ0A 2IM3A 3M4XA 4TU9A 3SSRA 3ZBTA 2ZH9A 2D3UA 2PD1A 3DM2A 4J9UE 1DHMA 4WCEQ 3A1YG 4R0EA 2ZBUA 3D54A 2LZJA 1WACA 3SZZA 3HVAA 4RPDA 1AFJA 4YHHJ 4DBQA 2U2FA 2E5LJ 4QYZK 4G1IA 2BOPA 5ETQA 1ZH5A 2DETA 1EIYB 1O0PA 1M90D 3VO2A 4ICLB 1O5JA 3S14C 3FKIC 2L08A 3F73A 1PILA 3FPKA 2IYIA 1UWBA 3MTKA 2NVYC 3GTOC 4FYYB 5DN6A 4RU2A 1TKXA 4ELUA 5CYMA 2YWKA 4C0OC 3JQMA 1HBUB 4XTTA 1G2EA 1Y5IB 1WTBA 3G6XA 3UN3A 5L39A 2NQPA 5I42A 5HMXA 1EI6A 3WHIA 2EFPA 2MKKA 1WF2A 3S2DK 1EQMA 1I6HK 1L3SA 3W61A 2NUHA 1HNIA 1S0VA 3SLDA 1RT5A 2DNQA 4LOWA 3T00A 3CDBA 4DDQA 3KOAA 1MN7A 4DCJB 2HHSA 1VK3A 4XM3A 2D3LA 3GYNA 2ZL5A 5JBQA 4XPCA 2ZH5A 3A1PA 2J6TA 4DSFA 1K44A 1S6PA 1CJVA 3T1YF 1QVGB 1BJKA 5HMYA 1T5EA 1XMOF 1UA1A 4DPWA 4CYUA 1TTHB 2HMIB 2CFXA 2W7OA 4B3SF 4Z7YA 2D1CA 2RQKA 4A3LC 3V7AA 3GIJA 2FLOA 1WSRA 3AVVA 4QR2A 1VC5A 4OI0A 2IVFB 3AVTA 4C98A 4G1QB 3M2VB 3H5XA 4B9TA 1WC4A 3HOUC 1HFEL 2DHHA 2I8EA 1UD2A 3THVA 3D66A 1GR1A 4DLGA 4UUWA 3GTPA 1FRHA 3S1MC 2KHDA 4RBTA 1FNCA 3OPKA 1LOUA 3RZOK 4OX7A 5IYDK 4C3JK 5AXMA 3BREA 5A8RB 1T03B 2ALZA 4ZJQA 4A8QA 4C3HC 1NPPA 3NBPA 1X9WA 1E3ZA 1S6QA 4YY3J 3CMMA 2IPOB 3ILJA 4I68A 1Y1VA 1G7TA 1T6YA 5LJ5Y 3NGUA 3PTWA 4P2SA 3D67A 2G2YA 2JRSA 4HDHA 2M4MA 2M52A 2XCAA 3NXZA 5KFXA 1SMYA 3N6MA 5I3QA 3ET6A 2PSZA 3ZTQA 4MYTA 1NEEA 4H9GA 4MIBA 1KK2A 3AGPA 1EARA 1G7SA 1VQPS 3H25A 4ED6A 1F2GA 1TELA 2YVSA 1YG0A 3G82A 4GTDA 2EXUA 3KXDA 4DZ6A 1FNOA 4KO0B 3CMEB 4LBWA 3CCUS 2KDOA 4HDGA 2FZCB 2HWTA 1J5OB 3EQLA 1XXCA 2JA6A 3GLJA 2GK6A 2NXCA 5I42B 1RQPA 1KP6A 3E51A 4YP3A 4A3JK 1W9XA 3TUPA 3QT7A 1BMFA 5D78A 2JC1A 4TNOA 5J1EA 1JA1A 3JS9A 1S9GB 1U2FA 2VFVA 5D77A 1H3DA 3W9IA 7AT1B 5C2GA 2PA8L 3UDVA 1HI9A 4O0NA 4CNYA 3LH2S 1WI8A 4WZTA 1PC4A 1NKCA 3D0IE 4QWAA 3P45B 3Q8SB 4F4WA 5FO1A 1TVRB 3LQ6A 4QIWD 1LKZA 3IS9B 1SJFA 1SKUB 3K8VA 2VUGA 1R9TA 4YQWA 1FKPA 1PYSB 3X3UA 4BS2A 2A69A 2IFXA 1DTQA 1AZSB 3NKYA 4P10A 1FX0A 2R4FA 1YRXA 3H7HB 2VDHA 3HI9A 3M9OB 2MZRA 3VAGA 4DSJA 3UDCA 3TJAA 3EPIA 4YDDB 5ETSA 4B3OB 1JWWA 4CM2A 1XB2A 3NAIA 1KLMB 1TKDA 4DXLA 4CH1A 5LMZA 1NHUA 3EGNA 4S0MA 3HM9A 2AJQA 1QSSA 2HFZA 4NNJA 4JI4F 1SBRA 3DOMB 2WONB 1FNBA 1XIQA 3V4MA 3ILOA 3NS7B 4KGMA 4G6IA 3ZFVA 3FRYA 2CJYB 1YI2S 1HA3A 4OZ2A 1ZBSA 1R8BA 2V50A 2VG7B 2DGTA 5KFZA 3TEHB 5F0UA 4JI7J 5HP1B 2XSJA 3GV7B 4LF2A 1K73T 4ECRA 3HXAA 3HOYC 2Y0SD 3BGOP 3L09A 2F8MA 3I4PA 1X5TA 1Y00A 2R8GA 3G86A 3CPWR 3ZZPA 1B64A 4ZPVR 4LUBA 4G6VB 3GVLA 4GZYA 1S4MA 5CA5A 6FD1A 4TKOB 2ROPA 3S1MK 1U0HA 4RNOA 4X4TA 1RJJA 1QGYA 5GMEA 3LGNA 2UUAJ 7FDRA 4XSZA 3HHEA 2LA6A 4MKVA 2RVJA 4I2PB 4Q0BA 1NBMA 3R7NB 3M2RB 3OP1A 4QWEA 2CWKA 4OIRA 2Y3YA 2ZE2B 3OZUA 3FGVA 3KLEB 3OTOF 4RNHA 2GQFA 4B3XA 1MW7A 1WC3A 2RU9A 5KFDA 2BJ1A 2JA8K 2XC9A 5KFQA 4FPIA 3PO2C 3W2VB 4NLDA 3TTGA 2QG9B 4ALZA 4QIFA 2ZM6F 4I6AA 2UU9J 4RD0A 3WNCA 2XOKA 3NCRA 4IO1A 4DOZA 5H9FJ 1C1CB 4KKOB 3DI6B 1FDDA 4ECXA 1I6HC 5L38A 2F8EX 3AH6A 5KFOA 5JVHQ 1QAIA 3JAMU 4WQMA 3SMZA 3IG1A 1BD6A 2FTRA 1N54B 3B54A 2CNKB 3SFGA 3PCOB 4DV3J 5LMUJ 4BXXK 3N3YA 2NYIA 5FD1A 1VQ8S 2IAJB 3P96A 2BF4A 1JKHA 3OJUA 1VQNB 3EVOA 2VODA 2DNHA 4WFNQ 2MQOA 2BVNA 3BO3A 2EFVA 1F6TA 4LBIA 4X06A 3B6BA 5IQQA 1B0TA 1Y3KA 2UXDF 2Z6BD 1T94A 4RLZA 4N7TA 3I4NC 2W9BA 1U0SA 2OUGA 4RO0A 2HNDA 1XXBA 4NMLA 5DDQC 3W60A 2A6MA 2CQBA 5LM7E 5AXKA 2E5LF 2NV4A 2E1RA 1UJ4A 4C11B 1BHNA 1FNMA 4WZKA 1UZDA 3OTCA 1GXLA 2H3EB 4EWTA 2YQ3A 4LF5J 4NL5A 3M6WA 1IKWB 5KT7A 1BMQB 3AJ1A 1FD8A 1WELA 2JA6C 2HLDA 3GFHA 3OFNA 4O44A 5TMFA 3ETMA 1FI4A 2UUCF 3OXGA 3GTMA 1R6VA 3CMES 1WHYA 4E0FA 4ZP6A 1DCOA 3QO9B 1HIYA 4IRDA 1WF0A 5IWAF 2NVTC 1P9YA 2YNGA 5HL7Q 5BR8F 1BLUA 1YJRA 4KMDA 1YIJS 1XZPB 4ECVA 5KG3A 2JA7A 1Y4ZB 5KOXA 2FJWA 4WYLA 1RHQB 4NLQA 2LQJA 2CK3A 4A3KK 3K7AK 4ZA1A 2OFHX 2ZOFA 2HFUA 3J7A1 2OGUA 1TWGC 1DLOA 3L3CA 4XOTA 3LF0A 1F7UA 5H9EJ 1ZPVA 4A8SA 1FEHA 2GZOA 2PDAA 3JSBA 1FT8A 5E41A 4ZLJA 3S1NK 4P71A 2R8KA 4YG2A 2LEAA 2A1BA 2VD3A 4R8UB 1SCJB 2O66A 1M90T 3G8TA 2ACMA 1IKYB 4F02A 5LXYA 4NRTA 3MF5A 1FWLA 3OUYB 3HVTB 3MAQA 3Q6QA 5TR9A 5L1LA 2DGVA 4QWCA 5MAOA 4Y34A 1C1BA 3K2YA 3RBDA 2PC6A 2NXEA 2W7VA 3JB9k 1N8RD 4LFCJ 4WZEA 3VAJA 2W9CA 4Q5VA 4HR2A 4P52A 4XLHA 2VJVA 1VCTA 1JLAA 2OTLB 1QVFB 3P5BP 2E66A 1VHFA 3R7SB 3HHLA 3QLHB 4FZBA 2PHCB 4QR0A 2GNKA 4TVAB 5IYWA 5KW9A 1NDKA 5KFWA 1U02A 3OXFA 2Z2ZA 4ZS6A 1EQ0A 2BE7D 1S4FA 1SH0A 4M0LA 1P6TA 4RLEA 2NZ4A 3OR2A 5C4JK 2VFTA 5KTQA 4ATNA 4OMFG 4C0BA 2B6AA 4GRSA 3ULHA 1R8HA 1OB2A 1C0UA 3CCVB 3IRWP 2EVZA 3J81j 1P9QC 3KJQB 4WZLA 3UD4P 3JYTB 2R7ZC 1SV5A 4USKA 4WK1A 3Q8RB 2ZJQQ 2KHCA 3AODA 4TKTA 2HS3A 2LQ5A 3C66A 1ZAVA 2CZ9A 2I9SA 4UT4A 5LSOA 4JB8B 3ASTA 2HAFA 2DGOA 1K73D 5HANA 4PWDA 4Z7CA 1N56A 1RAJA 2DNMA 4FDFA 1HQEB 4OPOA 2HIQA 2N82B 3TAMA 3HKWA 4Q2LA 4EGLA 3H3VL 1N07A 3CJ3A 3CRZA 3M30B 1I8DA 3N6LA 3GR1A 4L3KA 4UQTA 5ETTA 2BKPA 3N0VA 5J1NA 2HQFA 3RBEA 4L8JA 5HXBA 2OTJS 3SZYA 4CO3A 2DXFA 5TMCA 1IBMJ 5M2UA 3IPJA 3LNNA 2ZZEA 2P2CB 4QZVB 3RUBL 4NLXA 3W7BA 1INNA 1LWCA 3EGZA 1VJEA 2C2KB 3H3VD 5CYQB 3VALA 2VG6A 5DJBA 2XS7A 2NVTK 2QJ3A 5FDLA 5DG7A 5EX3A 2KVQE 4OIOA 2P5MA 2AGPA 5DG9A 1RKJA 3I9ZA 4CP5A 3Q23A 4UZFA 1U47A 1SC3B 1BC6A 3QSYA 3MR6A 1FRKA 1TL1A 3S17K 3CD0A 1FJGF 4ZN1A 4A3EK 4L72B 5GAHI 1UCNA 4LIWA 4TLQA 3TUJC 5CYMB 4TMXA 4DR4F 4O4GA 2HYIB 1S10A 4C43A 1NB9A 2GJKA 1E6VA 1S77D 3M05A 1T9TA 2FHKA 3M6VA 4WJ3M 5F4OA 1RA7A 1F5CA 4JI7F 2BR0A 3UD3P 1OQ3A 1JLEA 4M5NA 1RT6B 4JV1A 1N52B 2RF2B 2PI4A 4OL8A 2IBKA 1YJ9B 2CA9A 1VQKS 1QAJA 2PIIA 4B3FX 3RR8A 3I6PA 3MWBA 5AXNA 2CPDA 4DUYF 3AGQA 2EIXA 2OEMA 3OEEA 1XNQF 1N34F 3C6UA 2EWHA 4O44B 2YWHA 1PBUA 3FNNA 2W4CA 6AT1B 2E2IK 4JBCA 3MMJA 3RGIA 3VF0B 2FVCA 4II2A 3AA8A 4BLGA 2ASJA 3I0SB 3V4GA 5KFNA 1RXOB 3MCOA 2Z8QA 1IBLJ 3CQZC 3CJ0A 4C8NA 3HSGA 2VFSA 3LGMA 3JQQA 5KFGA 1R0AB 2OSRA 4XLCA 1DY3A 5DLFA 2I1RA 4G7WA 1QLNA 1GAWA 5GV8A 3OJWA 4BY1K 2COLA 5A8RA 2IC3A 3HAGA 3H20A 1U1MA 2YWGA 1WKJA 4CTAA 5J1EB 4KDDA 2F1FA 4ED5A 1VRTA 4IQXA 2V8VA 1S76D 4F4KA 4YFXA 1QAXA 2XYHB 4RNFA 2R7SA 2BANA 3AQPA 4Z4SA 2G0IA 4XR6A 3FQLA 1N5SA 4DNRB 3Q86A 1Q79A 2FZGB 5CAAA 3AH5A 3RZDK 5BYQA 1HMVB 3NE5B 4PQAA 3ISZA 4ITSA 3JSYA 3SCLE 3OD2A 2C28A 4KB2A 4KM8A 2DCUA 5A0YA 3BYRA 4ZIWA 4KMAA 2IA6A 1WG4A 3MM9A 3HOVC 3UN2A 2OO4A 3KUGA 2V9WA 1NPRA 3VGVA 2VASA 2BKOA 5GMKa 4HT7A 3V2UC 2YKOA 1SKQA 3K59A 5CDFA 4TY9A 2R8IA 5EUHA 4U96A 3SQOP 1B99A 3G4SB 1TAUA 3RW7A 2E7WA 4UZUA 1KLMA 1W2IA 1ISEA 2KG0A 3Q3AA 1LWFB 1HQMA 3FZBA 3FKSA 3A4TA 1WTHD 1B0PA 1F3VA 1TUWA 1XZQB 4OHVA 3TAQA 2P6SA 4A3EC 3HJVA 3RAXA 4J37A 2C2ZB 3CCMS 3MXHP 1I3QK 4HLBA 5BR8J 2BXJA 3H42A 1GXUA 1HZEA 1N05A 2LXUA 3D6HB 2H5EA 3L4JA 5B0DA 1WOSA 4FPRA 3ASPA 4F3OA 5BYSA 1RKIA 2CKWA 2BA9A 3UDEA 4WZQA 4F26A 3DLJA 2B3TB 4WWSA 2UXCF 5LXRA 4CO4A 1PJ5A 1GXTA 3A8IA 3HHLC 4I4BA 3PO4A 1FA0A 4A3BC 4WWVA 3M8PB 4DQRA 2C2WA 2OAUA 1RUSA 2HFNA 4IFYA 4P1VA 1S5ZA 4DL7A 2RKIB 5SUHA 1Q8LA 4HH1A 5B09A 2FIUA 1KFSA 3QT8A 4M5DA 2D41A 3E3XA 4C2MC 4ZDNA 2QV6A 3DDIA 1OSDA 3N9UC 1IW7A 3PFEA 1S9GA 5CYJA 4JI1F 4A93K 3VV2B 3A3BA 4OX6A 2JH3A 2CNOB 4UAJA 4ZVHA 4J9OA 1HBMB 5FO0A 3GTLC 4GTCA 1FFGB 4RUBA 4XMYA 4L3NA 4C8KA 2QN6A 4Q8EA 5JXSA 3R8YA 3PIOQ 1M5KC 2OBRA 3C6UB 2AGQA 2K3IA 1Z2LA 1XNRF 4QYRA 2QTLA 4LQ9A 3MPVA 4G1QA 3R6KA 1OB5A 2JFKA 2QGGA 4ZCIA 1U0HB 5HKKA 3I56S 2GJRA 1XERA 4OYPA 2FD2A 3GFXA 2GJIA 1SI9A 2WOMA 8AT1B 2RU3A 2IRUA 2EG2A 3SCIE 3KK2B 3M9MB 4K4SA 2RMLA 4WU2A 2ATLA 2BSAA 3M8ZA 1RT6A 4ZGNB 3OVAA 2WTFA 1U1OA 2E5HA 2HHQA 1W2BB 1FWKA 2QA1A 3GTOA 4CLPA 3KLEA 1Q81T 4YAUA 3CF5Q 3G9CA 5KNLA 1RB0A 4LF9F 5I3PA 3EDQB 3OLBA 3W9JA 3CC2B 1OGJA 3MEEA 2V7WA 3WX8A 4B3RF 1FRXA 2V9KA 2CQ2A 2V7UA 1GVHA 1HNVA 4QYZJ 4HI1A 3DDKA 3DLKB 3W65A 3CSKA 4N41A 1AUDA 3KG4A 2IRYA 4NA2A 3EXYA 4J9LA 5LJ3Y 5TV2A 3BBFA 3LAPA 3JTPA 1RCOB 3SXLA 1WEYA 3D6MB 5AE3A 4HTIA 1NH7A 2V0NA 1G7RA 2AIRB 4OYWA 3T19A 2CJAA 5A8AA 3NCPA 4RD4A 4QW8A 2EC0A 1PJ6A 2ZFHA 1HNXF 2R92C 4A3KC 3I4MK 5A88A 4R25A 1RBLA 2AYEA 3RB3A 2BRKA 3HHLD 1HNZJ 1ZZFA 2R9VA 1IR0A 2DHAA 1U09A 3ADAC 5HVHA 5DM6Q 1KVIA 3NEKA 4RUAA 2QMUB 2EBEA 2QMXA 1U48A 4OYZA 2MKYA 3T41A 1OJ4A 3IWXA 3BSNA 2BABA 2GO9A 2VF3A 2V4DA 5J2NA 1S7HA 1FJGJ 1K83A 4MKBA 3FBCA 2Q79A 2GMHA 1O6XA 4G1PA 3FHZA 1X31C 2G1DA 5A0YB 5IP9C 1FX4A 5L46A 1YI2B 2JA7K 2LDYA 4Z37A 4P7TA 5GAEI 4A46A 4MEXA 2X3GA 1T6XA 1HI0P 3JQJA 1WPCA 1BXNA 3HP6A 4OX8A 1JJ2R 5K8MA 1RAHB 1N6QB 3CCLB 5EDWA 3ELHA 3QNWB 4NLVA 1GT8A 2HHVA 1AROP 4NWBA 2DRDA 1RU0A 4KHMA 1EFTA 5J35A 1CULA 2CIMA 1FJ7A 3TANA 5HZBA 3KEWA 3R97A 4JI5F 2XCOA 4LRAA 1LW2A 3LWMA 5L1KA 1NJYA 2EFGA 3EGVA 2MMYA 5G0RB 4RKUC 2DR6A 2ACYA 1ZAXA 2VC1A 4F3QA 5CD4H 2KFYA 2HHTA 3G2XA 5IS2A 2E9RX 3Q22A 4NXNJ 1JB0C 3B78A 5JMNA 3DOKB 4TY8A 1WKLA 2ZC4A 3CDWA 1TP7A 5FL7A 4KSEB 1TUVA 1T9WA 2R93A 1IKXB 4RJLA 4JI2F 1U8SA 5J3OA 1JLGB 4F7DA 3T02A 1KSPA 1UTAA 3MMAB 2QZ8A 4OYMA 4ZPWR 2E1BA 1XR7A 1MROA 1EH1A 3QMQA 3AJ2A 2FJBB 3TWZA 3SJZA 2V2KA 4FS1A 2MZ1A 2XLJA 4FF1A 2WAQL 4ZVSB 3CCRB 1LV5A 1RDRA 3AOCA 2OEJA 1V0FA 5K14A 2HBYB 4P2NA 4KPYA 4IFVB 4NLOA 2WBMA 2FLLA 5B0AA 2AYMA 1XMBA 3A13A 2IHR1 3PUMA 4HL9A 1RP5A 4I56A 4ZOSA 2AEJA 3MFIA 3LPXA 1KC8D 4DK1A 5E68A 2DHGA 5KFUA 2D74A 1SKRA 3N79A 4KTQA 3R9LA 2RIJA 3J81U 3DLGA 2IIHA 4AVZA 2J76E 2Y0SL 3UCZP 3R5GA 4DV4J 3A35A 4LR7A 4LVNP 4CZCA 2BDPA 2GS8A 4YHHF 4BWMA 2R8HA 2C3MA 3CJ2A 3DU5A 1N32J 3OV7A 3IRXA 1AW0A 2R92K 4LBHA 2EI5A 4RWWA 4QVAA 4O3NA 3CCTA 2CDQA 4MK9A 3BY1A 3BGRB 1X9MA 4L73A 4BDPA 4XLFA 5KFMA 1X4AA 2CADA 1RTJB 4RW6A 4LLGA 4G0VA 3HZGA 4LMZA 1DD5A 2PFDA 3UCUP 4CLWA 3V6HA 2DXEA 3PA2A 1N5TA 3ZTPA 3AT1B 1S72B 1IJFA 5CABA 4G3IA 2YKAA 3MM7B 4DX6A 3SV4A 5M3FK 3IR5B 2HHXA 5IP9K 3AOBA 4Y2IA 3A8EA 2OMLA 1GH8A 3PNIA 4BKWA 1DZ5A 2J8AA 2YPYA 1TMJA 2EPIA 3BGUA 1S4EA 1ZETA 3I56B 2F9JA 4ANEA 3RBXA 1WG1A 4P7VA 1FVSA 3NMRA 1BQMA 4X7CA 4WE1B 5LMNF 1EJ7L 1NDCA 1NJXA 2W4PA 1XMOJ 3NWGA 3DLGB 3LALA 2JN9A 4URSA 5AJ3J 2OD4A 1AYEA 4JI3J 3TFIA 1KNZA 4DV6F 2YH0A 3GU0A 5J2MA 2J9DA 1D1NA 3I9V9 5KFSA 4HACA 4ACAA 4Q44A 2B63A 5KSWB 4CQ1A 3BO2A 1WKKA 3GTJC 4AXIA 2XLIA 3KKFA 4ZJOA 4F7VA 4NEZA 4UOFA 1NLKL 2X0KA 1BE4A 2X7IA 5ETMA 4HIZA 3V76A 1RHUB 4QPXA 3CB4A 3PW0A 4QJVB 2G1HA 3U1LA 5K8OA 1FRJA 3AFGA 1MU2B 2VPXB 2FC8A 4PKDB 1FKOB 4RW9B 4PYDA 2FVPA 3I4NK 2B9YA 4A4JA 3NMAA 3SEJA 3V5RA 2B43A 1TFWA 2JEIA 1QM9A 2DBBA 3HPOA 1WD6A 1MWZA 2ZZTA 1G7CA 1UAWA 4X4PA 2BEFA 3PRBA 2Z56B 1KS2A 3K89A 1IKXA 3MAHA 4B9LA 2A2CA 1ZA1B 3DM2B 1HWLA 2EKYA 2VL1A 3TVKA 1BUXA 1U45A 3AVYA 1S1TB 1RAIB 2FJAB 5J2QB 1USOA 4PXDA 4USJC 2HQCA 3DMJB 4DG1A 1U49A 2ZD1A 2IC3B 3OW2R 2YX4A 1TR0A 4TMTA 1SUQA 3HX9A 4HACB 2D69A 2VOPA 4KKSA 4JI0J 1I50K 2JA8C 1SJ3P 4N3NA 4LF7J 5DQHA 4OYAA 3FMWA 4PGOA 2GPJA 4OYIA 4RPBA 3E01B 1I5OB 2ZWOA 3T6JA 2A0FB 2HLTA 3M4OK 2MYFA 2YKQA 1A9NB 2IVMA 4FXUA 4EZ9A 2ZH2A 4ACBA 2CQCA 3DYAB 2DNPA 4UY8T 3OPFA 4DQKA 2AZ3A 2Y3PA 4O3PA 3VGUA 1L0WA 5D4NA 2QYGA 5D4OA 5LSLA 3FRZA 1FDNA 4CLKA 1RWWB 5IQ6A 1A0OB 4DR7J 2NLWA 1TWAK 4DF8A 1JJ4A 2NVQK 4DX8H 3TARA 3BUEA 4P6VF 2ADCA 1VJSA 4PYAA 1HNZF 1RLDA 1SJRA 2YU9A 1WF1A 2N4DA 2DH7A 3L7UA 4FKXA 2VBUA 2AT1B 4ILMA 2OP5A 2HSEB 2SXLA 4NLRA 5IT4A 1MNEA 4J9VA 3NG8A 4I67A 2I0XA 1T0TV 2RAQA 1EFRA 2RJZA 4G7ZA 1ZTTA 4B9MA 2KRRA 1D9DA 2DGQA 4C2MA 3NNAA 4X07A 2BGJA 2MQNA 1ZXOA 4A8KA 4WF9Q 1IJEA 3UI3A 1U7LA 1HBOB 4HHHA 1EWYA 4DPXA 1PO6A 1LWCB 1RABB 3CCRS 2X6YA 4LSNA 1K8AD 1UL3A 3FDSA 3NLCA 1G7CB 1WJ9A 4KKOA 4OJGA 4OINA 5A2QU 4N77A 2CC2A 2F3JA 2CRVA 2XZLA 2MZQA 2QA4G 5HLFA 3ZZ0A 4G5GA 2FLPA 3KHRA 4OV6A 2OTLS 4YAFA 3LPYA 4WE1A 4XKVA 1C0UB 1Z1ZA 2M2BA 5E3CA 2NVXA 2XGPA 1H8EA 1P4MA 1F60A 2MJUA 3NCQA 3MMBA 5D3GA 1RAGB 4IR9A 4MYUA 2AJ1A 1RWUA 2M8HA 3M30A 4EO8A 3DLEA 4TU8A 2WHOA 3GJTB 1EFWA 4OOSA 2RGRA 3BP3A 4ZVRB 1RT7A 3LP0B 1VQ9B 2YKNA 1GAOA 2OFGX 4KGKA 4K59A 2XWYA 3N01A 2B8QA 4B44A 1FK9B 1O26A 2VG5A 1RWPB 3B8HA 3US5A 2DNKA 1O2BA 2PMZD 1TMMA 4PC2A 1XPPA 3QFRA 3CCSS 2V69A 2ZZFA 4CLFA 4AL6A 2B63C 2GGPA 1VC0A 5F4MA 2OHDA 2CPHA 3M1VB 3T5HA 1K0TA 3GSDA 3GCXP 2DNZA 2YNFA 2P9CA 5LMUF 2W25A 3WC0A 4ZLNA 2VUMC 1BWEA 3Q89A 2Y0BB 1LFWA 1B4AA 4PUOB 2X8KA 1YJVA 2GCFA 3KFWX 4OZNA 3BYPA 2E44A 3M2UB 3O3LA 2YXLA 5GADI 1YJWB 4Z1MA 4C3KA 4IH5A 2KZMA 1H73A 1VQ7B 3HOWK 2R7WA 3OZWA 1T02A 1WHXA 1N5VA 4RW6B 5L8RC 4C8ZA 3QYYA 4O4RA 3TNVA 2HRYA 2HRTA 1ROFA 4MTPA 4Q7AA 5HL8A 3Q83A 1F5BA 2V2ZA 1J2VA 3GTQC 1N32F 4NOIA 5C3EK 1O2AA 2UP1A 2CJKA 1M1KT 2R7ZA 2LVWA 4WFBQ 4NA1A 2B7BB 4ED8A 2MY8A 2C22A 3BKUA 5K8PA 2K06A 4TMVA 1N88A 3OVSA 1AUSL 3D6TB 4NCGA 3MHPA 1R27B 1V0EA 1W87A 5IOSA 2GMLA 2CPYA 5KFTA 1YTYA 4RD1A 3CEDA 5LL6d 4C0HA 2O5IA 1FFSB 1S1UA 2IJNA 3GTGA 4QBUA 4XKWA 4KASA 1BQEA 3VHQA 3TA1A 2JVRA 2HNYA 5KFCA 1JLQB 2HVZA 4HI2A 1I3QA 2GIRA 1H2TZ 3DLEB 4X7EA 1MG7A 2C2MB 3MM8B 3GVKA 1VQNS 2UV8A 1U25A 2QTWA 2WYRA 4AT1B 1VQSA 3CCSB 1FJCA 4DR3F 5LMNJ 1TWFK 1UW4A 3FFIA 5DQIA 3LP1A 2OPRB 3J7YI 4CH7A 5DQGA 2LEPA 3PX4A 4DV6J 1B23P 5J2PB 2WB1L 4BY1C 1VRTB 4YB6A 4K4WA 1EETA 4WPAA 5D0HA 2HHHJ 4X84A 2RH6A 1GX5A 1GMWD 4FYXB 4ED0A 2NVXC 3DLHA 3EDRB 1HYSB 3I0SA 2EBBA 4K5SA 2XWXA 4ZMMA 1QAYA 1UEKA 1TKZA 1FK9A 3MPYA 2NYHA 2MLYA 1QJHA 2RC5A 4TMZA 3H94A 1QSYA 4OZJA 3LTOA 5HBMB 2YPZA 4LFCF 3SEOA 2IMWP 4K7QA 2Q6BA 3B82A 4B02A 1C1CA 2V7XA 3L7PA 1VHIA 3DLBA 1HNWF 4KAWX 1QUEA 4N8NA 3NOCA 2RHQB 4P6YA 3VGSA 4YB1P 1OMSA 3HOZC 2O01C 2WVBA 1TWHA 4KE5A 4GKKF 4CT9A 2HMAA 2VFUA 1W0JA 1RT4A 2DIVA 1CEZA 3M9NB 4CO5A 4KFBA 1URNA 4USTA 2FY8A 3RW6A 3OSNA 5JFEA 2E2IC 4Z4WA 1PSDA 4OOXA 5H59A 4GVLA 2QGFB 2VZ9A 3IMQJ 2I1LA 3Q8QB 5KFEA 3QO9A 4PXCA 5KG7A 2Z2MA 1YJNS 1BS2A 2YQ1A 4LF7F 2E5GA 3PYFA 2IDEA 2VU5A 5FJ8K 4PABA 3R6GB 5F9LA 4K4ZA 4KPCA 5DM7Q 2HNZA 3K0JA 4FXVA 3RY8A 3FFIB 5C3EC 2U1AA 1Y11A 4BY7C 1WDDA 3MHYA 4MH8A 2L3MA 1RACB 4YB5A 3DHXA 2XMKA 3I82A 1RT1B 2VPYB 3H90A 1FE0A 5DLGA 2C2NA 2EFOA 1B70B 1USMA 2H5JB 4ES3A 5TY0A 3P49B 1WG5A 4H4MB 2MZJA 4AQYJ 3JSTA 1IBMF 4L76A 2YX7A 3GEIA 1YDLA 3EJMA 2N4CA 4C8YA 4YOEA 4A3FC 1O27A 2X51A 3BGFA 1KTQA 1COWA 2OPQB 2O5JA 4DI6A 2XI2A 1W0KA 2HHUA 1SL2A 3GTGK 5CZVA 3ENQA 4GTLA 2ZDOA 4C3IC 1X0PA 3SBMA 3JSMB 1GE9A 5HATA 2J5AA 4WIQA 2PIAA 3C14A 1SPBP 3DXJA 3G4AA 4XCHA 4F4XA 2LU2A 4M5MA 2DY1A 1TTTA 1PYTA 4QCLA 1G3OA 2YU9K 1W25A 2VQFF 3CW2A 2ZH3A 5ETOA 1TFYA 1SL0A 1AIPA 4H4OB 1RWVB 5IOTA 1M5SA 2APOA 2GA7A 1XEZA 3MDFA 2MQLA 4N47A 2M3DA 3A8KA 1HQ2A 5KG0A 2NXUA 2OK8A 1D0EA 4NLUA 3UD5A 3GQCA 3HSJA 4LFBJ 1VS3A 3BV8A 1EZZB 1JX4A 1BGWA 2ZXHA 4YDXA 2RD5C 2NPIA 3U1NA 1XQIA 1VRUA 2UUTA 2MQPA 2PEHA 4DQQA 4Y00A 1UWBB 2JLEA 2O5DA 3UVJB 4F4YA 1FKPB 1MABA 4EI2A 3Q24A 4EH1A 1OQ6A 3CJKB 3R6LB 2YTCA 2CQGA 2VG5B 4QPTA 4PG8A 2N7CA 2V4JB 3BP8C 2XZOA 2ZBQA 3CNQP 3TW0A 3QE2A 3TZWA 4U9RA 5HK4A 4JI8J 2DNRA 3TP2A 2WAQD 1IBLF 3QIPA 1BQMB 1P1TA 2ZNYA 4OHWA 4DR2J 4MQ9A 4RWXA 1IBCB 2R92A 1RWXB 2RRNA 2ILYA 5JJBA 3GYGA 3G6YA 3CUNA 2HK3A 4PPDA 2W4DA 2B9WA 4NYOA 5IYPA 3SZ2A 3OKXA 3F41A 1XXAA 3G8SA 2HBQB 3TUZC 4F4ZA 2FGOA 4ECYA 4OJHA 2XI3A 2JEJA 4AL5A 2XSFA 2FJVA 3VWSA 1VQPB 4DV0J 3BH7B 2BJEA 1S6OA 4DU7A 1IBAA 3KG0A 1C0TA 4IG0B 4WP3A 2BRLA 2E2JC 1OYEA 1FD2A 1Q81D 2VBYA 1EKRA 3GTLK 2DPIA 2V6UA 4M5DB 5JVOA 1VQ4B 2AWZA 3I5AA 4EFAC 1JJ2B 5A2QY 2WVDA 3W2GA 1K9MD 4OX9F 1MWYA 2CQIA 4PZVA 2KWAA 4NXMF 2MSSA 1VQ6S 3DXBA 5G0RA 2JSXA 4WYWA 4EK2A 2GHWA 2V6TA 2J7KA 4KH0B 3NBPB 4RW4A 3M8QA 4DL4A 4BBRK 2V67A 1P1LA 2DKOB 1CULB 4ZCLA 3V4IA 1UMJA 2ZFZA 5EGEA 1ACMB 3CCES 2GVZB 1RAOA 5CH7B 4KT0C 4UUXA 2UVVA 4YHBA 3H0GK 4HHJA 1F5AA 3QGIA 1N6QA 3IC1A 1HNIB 2M88A 2CFAA 5IYRA 5JUMA 4C3IK 4PQUB 2JFDA 3D2WA 3ASQA 1IL2A 3DHWC 4K8RA 4ZPDA 4P72A 5DZ6A 3FKIA 2KRBA 4O4GB 2C3UA 4MFBB 1RA6A 2Y1RI 4J91A 2NR0A 4DWIA 2RRAA 3UQSA 3DOKA 1Y0RA 2WSCC 5K20B 2YU9C 1VHEA 4USIA 3PVDA 3CCEB 3C6TA 4LSLB 1SIZA 2HAIA 4X8IA 3KLFB 2VJIA 5IM0A 3MD1A 2KFZA 1BPLA 1D09B 2JOQA 2D6FC 3U7JA 1NU4A 1VRUB 2XZTB 5F8GA 3JQKA 5KFPA 4IW3B 3OXLA 2NXJA 3TEGA 3UCGA 4Y52K 4M5HA 2FHJD 4NI2B 3PRVA 2DD8S 4DS4A 2DNLA 4Y65A 3ISND 3H98A 4ECZA 1RWMB 4ZCKA 5IC4B 2WSFC 1NBEB 1T7PA 4C3LA 1OSCA 4AL7A 3LQVA 5HO4A 2P9EA 4K0KF 4CT8A 2YWEA 4A8WA 1FRNA 3QRQA 3SDEB 4JYAJ 2QL9B 4FVCA 2IA0A 4X6AC 4OLOA 4ECSA 4Y6IA 3BCDA 1RISA 1EP1B 1KDNA 4W90B 4HT5A 1TK8A 2CPFA 1X60A 4LFAF 5C4XC 1T9XA 3KMSA 5FLXU 4FNIA 5F41A 1RBOB 1VFJA 1GMUA 3E8OA 3FEXB 2HQGA 3FOFA 2NCKL 3OL9A 2CQDA 3EM1A 2NSCA 1H42A 4J9RA 4NZ6A 4BC9A 2X53S 4F0KA 3OL6A 1UMKA 4URQU 2B8PA 1FF2A 3GTGC 2XMAA 4B4DA 2DRBA 5IP7C 1NSKL 1X4BA 3CJ4A 2GQCA 1E43A 3M1VA 1HWKA 3NNCA 2F40A 4GKKJ 1FWPA 2ASDA 2QEXS 4ZHRA 3SSQA 3SQGB 4LIRA 1HD1A 5HLFB 2F1LA 4FN5A 4BPRA 4MT1A 1TL7A 1QGZA 4IG3A 4PG4A 4FYDA 4RCZA 3AD7C 5ETKA 2D9RA 5DZ7A 4KKTA 1F60B 1KEKA 4M95A 2XS2A 1H85A 3CJTA 1SFOA 3QRRA 3BBBA 3VNUA 3GTMC 4B9UA 1NJZA 3PIPQ 1GFWB 1ZM2A 5M5YK 2N7YA 4TQRA 1WC6A 2HHPA 5B08A 1WNEA 4RUCA 5LSRA 3TJ9A 2MKJA 2KM8C 5LOQA 3K5MA 4DL2A 4YR0A 1NSAA 1DTQB 1M0SA 3L4KA 1NKEA 2VYQA 2RDIA 2PMDA 2AW0A 5D15A 4G0WA 4G0UA 1EB0A 5J2MB 2F5GA 1S1VB 1WOOA 3M32A 5DG8A 4J7CA 3ES9A 1DQ8A 2O3DA 2H4WB 1KQSR 2OJ3A 4KQZA 4USHA 4EU0A 2DISA 4OHZA 1C4AA 1A7GE 3Q38A 1ZYQA 3M8YA 1WI6A 4MJKA 1QVFR 4F2SA 4KM9A 2BE2A 3MEDB 4PC6A 4OV1A 1D9FA 3V4IB 4X4QA 5CD4A 2CUYA 1VISA 2ZUFA 3MAAB 4I7FB 4M94A 2GVDB 2HGMA 3OHBA 3N6NA 4DV2J 5F0WA 1HBMA 3J81k 1YJUA 3KLHA 1T6ZA 4NCBA 1YZ7A 3D7SB 2VQFJ 4BCAA 5FJ4A 1EETB 2MPUA 1EAYC 1RGVA 4ZP9A 4WKRA 3U27A 4DV7J 3UNGC 3PW2A 2GSUA 1JLAB 2QL7B 4AC9A 1RT5B 2VHGA 2GQ2A 4MIWA 4HYKA 3W62A 5E33A 2VKRA 2HNYB 1Q86T 4CLZA 2B7BA 3WC2A 2OH2A 3ET6B 4C9DA 2ZBPA 3FC9A 3PO3C 3BB5A 3G96A 4V19X 5J2QA 4B43A 4NLYA 1FERA 1URRA 4RU9A 4RM0A 3HKZL 4F2RA 3GMGA 1VDHA 3HO1A 2AQ4A 2V31A 3ISNC 4X6AK 1B7FA 3BQJA 4ETZA 2DR7A 2IMOA 2ILZA 1NB0A 3V81A 3WQZA 1KRHA 2CQ3A 1TWGK 2BX6A 2JIZA 5D0GA 4Y2MA 1LWXA 4P5BA 1F20A 1LW0B 1NMEB 1R0BG 4X4RA 3Q8UA 2F4FA 5C2CA 3ZPNA 4DV5F 4IFYB 2H48B 4JP8A 3ITHB 2RQCA 4CQJA 1RT3B 4DFKA 1WEZA 1VJWA 1KVKA 4MKYA 1FEEA 3OTOJ 5FA6A 4NXNF 2YNGB 3I96A 1Y1WK 4RX6A 3G6ES 3CC4B 1NHKL 3H2VE 2VPWB 5M5WK 4A3CK 1YZ6A 4LR8A 2UU9F 1G4CA 4DHVA 4CRJA 3G82B 1KQSB 1BQNA 1SKYB 4A3LK 4A8OA 1CC7A 3GR0A 1A8PA 3HULA 4AD6A 1UZHA 2AJ2A 4DR1J 1NRKA 4OZ5A 1YLOA 4YXWA 4ZK7M 3VQTA 3BM7A 3T56B 2IJRA 1JLFB 5THWA 3QWUA 3R5JB 1O51A 1KR4A 1IKVB 3CC2S 5L9NA 3KHHA 2HKEA 4YELA 4BLBA 3PHTA 1TL7B 2R6HA 4XOPA 1TKZB 2ALYB 4Y52C 4N5SA 5CHCB 2BW2A 2NVXK 2EG1A 5KFJA 3M3YK 3H0PA 4YFUA 4LF4J 2V4RA 4HEA9 2B0GA 3R7BB 1X9SA 3TI0A 2C78A 4K4XA 1YWXA 3N5BA 4IDKB 3OFGA 2VQEJ 4QR1A 1O25A 4F3MA 1NB2A 4ED4A 1NK4A 2FGCA 1T03A 5IYBK 1MSWD 4XQFA 1IQZA 2DK2A 2ZH4A 4WKYA 2KKHA 1UJ6A 3RJMB 2VBZA 4ID5B 2RKIA 1RHJB 3DDNA 2WONA 1JK9B 4B3GA 2H9ZA 3U6KA 2OBTA 4WK3A 4LF5F 4X66J 4Y2AA 2CVIA 3GEEA 2CBXA 2FQOA 3IWLA 5A76A 2UUBJ 2OTJB 3SYZA 3CJQA 1QH0A 4ED7A 3LAMA 3GV8B 3GWCA 2FHMA 2C5BA 3GZ7A 5BSYA 2YNIB 1KONA 2ADBA 3T53B 2VUMA 3T1AA 4EBDA 4DQLA 4H4MA 2ERRA 2WRMA 4U9UA 5KOWA 5J2NB 3EICA 3ZZOA 1YX2A 4Q7JB 5EGHA 1Q95G 4A8XA 5C24B 1QSLA 2W7AA 1AXQA 3OOCA 2QA4S 4GTBA 1KBRA 1NCLA 2K7JA 3S01A 5KFIA 4URGA 4XL9A 2M0GB 3JXOA 4M5KA 1KVJA 1E3XA 2YQ0A 1IS1A 4HTJA 3VAFA 5JVGQ 1DURA 3MEGA 1IM4A 1HBNB 3D0HE 3L4BC 3F44A 1I94J 2MKHA 1FJEB 3S1TA 4IRCA 4KB7A 2MQQA 2B56A 4PPZA 3R3TA 3DFEA 2HPUA 1H72C 3G05A 3OBIA 3JSMA 2G2ZA 4X2BA 1EP2B 9RUBA 4C45A 3CCMB 1RWOB 3POTB 1JLCA 3S16C 3E20A 3I55S 4KN7A 2ABYA 3OFFA 1KMHA 1JKHB 3DN9A 2FJXA 2BM0A 4M1KA 2DVIA 2DEJA 2RNEA 1X4EA 2B9EA 5FDLB 2X1BA 2VB6A 5A8WB 4ETXA 1N08A 2J6SA 1VQOB 4ZH4A 4NPOA 3SI8A 3I0RB 4DL0C 4ES1A 4ASUA 3G71S 2F1MA 1UVMA 3DI6A 2W2OP 3J7YU 4J9SA 3BN4A 3H2LA 4DR6J 2PT0A 4OJ1A 3FCVA 3T1HJ 2J9EA 5E6TA 3UFCX 2K8GA 3X1LB 1BJTA 1RHKB 1RU2A 3CDEA 4DPUA 4KN4A 3PEHA 1S7IA 4YEAA 3FPPA 3ZBUA 2LMIA 5IXUA 1X5PA 4TY8B 2WSSA 4A3DC 1NH8A 3ZZZA 4U67Q 2ZWPA 4Z4ZA 1QDUB 3SFUA 1SM4A 3R1HA 4KHPJ 5ETRA 1R89A 1L5UA 2MB0B 1WC5A 1TWGA 2GW8A 2Z58B 1NJWA 1I3OB 9ATCB 2R42A 3OW2B 3NS5A 3KG1A 4OZ1A 1Y10A 1E6YA 4P22A 2OIHA 3QIPB 4OYBA 4A3MC 2R7RA 2ZUGA 2AYGA 3KJNB 4ID8A 5BXIA 1RSCA 1PAEX 1SJ1A 5GAEU 2LECA 1FESA 5K14B 1UD8A 1HBNA 3UW1A 4Y7NC 1V9OA 2YNFB 2NS1B 2A3JA 1H6KX 1S9EA 5GMDA 1B4SA 2VNKA 1VQ8B 2VH7A 4GFQA 4JV5J 1YKWA 1RT4B 4WIIA 1VQMB 5KG5A 1Q7YD 4GO5X 1TL4A 1IR1A 1VBYA 4O3OA 3MCNA 2ASYA 4UOCA 1GTHA 2RRBA 3GVJA 3CJ5A 1NO8A 1UD4A 1VLYA 4RD3A 4KB4A 4ID5A 1DG1G 1UPPA 2QYCA 4DN9A 3BKFA 4OYXA 2B4OA 3LUYA 2XQCA 1TZ0A 3D1HA 1ZAWA 4XDCA 3VTIA 1IHMA 1VQMS 2MEWA 1DCHA 1IKYA 4LQ3A 4W4MA 3MGJA 4XLAA 3NGTA 2HZAA 2HFVA 1T3OA 4H54A 1WEXA 3QGPA 1PKUA 3KHLA 2ZH6A 3AOAA 4LBYA 3GTQK 3GTLA 3RR7A 3GTKA 3CWJA 4WTYA 1VRQC 2BE2B 2WZ1A 2MLXA 1T05B 1K47A 1Q5VA 4J3NA 4ZITA 3QJPA 3C6TB 1SQFA 5B6IA 2XY5A 4RW4B 2PI5A 5KFHA 2K1RA 4XN0A 3CTRA 1Q4RA 4DU8A 2AJFE 3T51B 2FLNA 2V34A 4C11A 4X4UA 2R2SA 3ZC4A 3GJRB 5DGBA 2DNYA 1YGYA 3DRRB 3H0GC 3RZOC 2JHEA 2XS5A 1S48A 3H59A 2D3NA 3VQSA 4RCYA 3NAHA 1YBAA 4IQMA 2LXIA 2CFAB 3IBCB 3OFEA 3D5MA 1J5OA 1WIHA 1CC8A 4CCHA 2ZVIA 1VBKA 2QFJA 2KFNA 1TV6B 1RCXB 3UO0A 5IYCC 1OY9A 2OPSA 1S79A 2NVYK 2J0QD 3H5SA 3K7AC 2ZKUA 2RILA 4CTAB 1L3TA 3OTEA 1WC1A 3JYTA 4EZ6A 3TJ8A 1CJKA 1LXNA 3NP5A 3WX4A 4PRFA 1V3SA 2ROEA 4IOAQ 3W64A 3MM6B 2HNZB 3SCJE 2AU0A 2Q6CA 2VBXA 2XY7A 4K2XA 3PFOA 3S2DC 3G6VA 3TUIC 2FJDB 2AP6A 3PX0A 2JVOA 3U6BA 2OPPB 1S6PB 1IQTA 2EFQA 2HHWA 2V7TA 4ZVEA 1X4CA 1OWXA 5KFLA 1J98A 1DTTB 1BWVA 4ER8A 2GMJA 2PO4A 1TUGB 4B3MJ 1NDLA 3GTQA 1Q78A 2A10A 2XMJA 4UOGA 2GK7A 2MZSA 1TWFA 3OTDA 1YK9A 3NGKA 3GB0A 3A3NB 1SXLA 1Q0NA 1JLQA 1M5OC 2AKWB 2EW9A 1Q8IA 1VK8A 3N0CA 1R3NA 2WZPP 4NYPA 4ZKAA 3KWMA 1UD6A 1J6XA 1U1KA 2B5OA 1S99A 3SLNA 2JA5K 1S1WB 3A3PB 4X4SA 1VIXA 1NDPA 2BPOA 2BMBA 2RC6A 1Y0YA 3K5PA 4IH7A 4QIEA 4MKAA 3DOLB 4C4WA 5HQMA 2BACA 1WQHA 3VCDA 4J9KA 4U7UD 4C3HK 3BKTA 4K5RA 1VOMA 2R7OA 3NGSA 1CJTB 1R43A 4CO0A 3O6QA 3CJKA 2UUBF 4Z2XA 4LBPA 2DR8A 3OREA 2DITA 4EYIB 1T9YA 3P26A 2R7ZK 2HBZB 4C97A 3KLGB 1OHHA 5KT5A 1K28D 3JQRA 2XZDB 3GONA 3W5XA 1KFDA 3VVUA 3MI7X 1FRIA 1XJWB 2AEFA 1VHOA 1Y9OA 5A6WA 3KLIB 2ASLA 3BQ2A 1QG0A 2ZJPQ 2F4VF 2I2YA 2UUCJ 2VOOA 2OYNA 4ZPBA 3MUTP 5F4JA 3MAAA 1Q7YT 1SJ4P 3PJXA 1HHTP 1OGIA 4RW7B 3AHPA 4YMEA 3H4BA 4PXBA 4ECQA 1H7XA 1VQ5S 4X4OA 1I94F 1VQLS 2RT3A 3VNVA 1MWQA 4A3MK 1HQEA 2GAHC 3TAMB 3MTJA 4DFPA 3CMQA 4B3SJ 2CAJA 3J7AN 3GILA 4QIVA 4OP7A 1R9TC 1LXJA 1P27B 2HQDA 7FD1A 1F2HA 2HHHF 3ZZRA 5D6GA 1UWAA 2MZTA 3ZTOA 2Z2LA 2D3OR 3B4DA 1CS4B 4Z4TA 3KK3A 2X3UA 1DQ9A 1R0AA 4LT6A 3PO2K 1GJRA 4DUZJ 2DB1A 2UVUA 2IJFA 2FVSA 1WC0A 4AXJA 3KMQA 1N48A 3FCHA 3CO9A 4B47A 2C5HA 2O1PA 2ZTGA 4DL3A 1OY8A 4DZDA 4B3OA 2EKNA 5D4DA 3PEJA 5T41A 3T6BA 3AVUA 5T7LB 3CC7B 4B9SA 5C42A 1WORA 3PYEA 2XB2D 2ZZGA 4XSXA 4ES2A 1DDIA 2DPJA 2UVRA 2WSEC 2PMZL 3IRXB 1TVRA 2XGJA 3M3YC 1DTTA 1W2BR 2LQ9A 4PWWA 2GSOA 3ETOA 2ZOGA 3W5ZA 3OJXA 2XBPA 2OI2A 5F9NA 5EGYA 3RB0A 3S1QC 3MM9B 2LDIA 1X5OA 2AEMA 3A12A 5A89A 1Q8KA 1M1GA 2V8PA 3ZUGA 2HS0A 3KLGA 1FXRA 1HMVA 1MU2A 5HJXA 5AN9A 2OK7A 3DRSB 1RTDA 2Q6LA 3HHLB 2DIUA 3IS9A 1QUPA 3ZNUA 3MCAA 4QWDA 2ZZMA 3KNAA 5GADU 4A47A 4C8OA 5CXTA 1UV7A 1U8WA 2MKSA 4PC1A 2JLFA 1WOPA 2UUWA 4A8FA 1LWEA 1I1GA 2AZ1A 4BBYA 1N0VC 3P6YC 2HW3A
chains in the Genus database with same CATH topology
1V5VA 1YX2A 3AD7C 3GSIA 1X31C 3ADAC 1WSVA 5L46A 1WORA 3TFIA 1PJ6A 1XZQB 4P9SA 3GEHA 1XZQA 1WOSA 2GAHC 1XZPB 3AD9C 3GEIA 3TTGA 1VLYA 1WSRA 1WOPA 1PJ7A 1NRKA 3AD8C 4PAAA 1WOOA 3TFHA 3TFJA 4PABA 3GIRA 1VRQC 3A8JA 1XZPA 1VLOA