3GIRA

Crystal structure of glycine cleavage system aminomethyltransferase t from bartonella henselae
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
361
Chain Sequence
b'SLKTLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALLKIGQSRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIALERVLLALQGPQAAAVLADAGLPGNELLFMQGFEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDITPDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFDGPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQRYFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of glycine cleavage system aminomethyltransferase T from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Transferase
total genus 104
structure length 361
sequence length 361
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 3girA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 3girA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3girA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 3girA03
1WOOA 1WSVA 4P9SA 3GSIA 1VRQC 4PAAA 5L46A 1WSRA 3AD9C 1WOSA 1X31C 3GEEA 3TFJA 2GAHC 1VLOA 1WORA 3TTGA 3AD8C 4PABA 1YX2A 1PJ6A 3GIRA 3AD7C 2GAGC 1NRKA 3TFIA 1PJ7A 3A8IA 1V5VA 1XZQA 3A8JA 1XZPA 1WOPA 3ADAC 1VLYA 3A8KA 1XZPB 3TFHA 1XZQB 3GEHA 1PJ5A 3GEIA
chains in the Genus database with same CATH superfamily
1QVGR 3M1VB 3OHBA 1MLAA 3SJZA 1JIHA 1E3ZA 4C8LA 3N5BA 4DFJA 2UUTA 2HNYA 2DEIA 1O0PA 3S1RC 3CCZA 1NH8A 4HDHA 2B7CB 3LNNA 1EX8A 3ONYA 3KK3A 3SCJE 4LFAF 2V31A 4HR2A 2PGCA 3VAIA 2CFXA 4OYIA 3MWBA 3EPIA 3R5GA 3H4BA 3FPPA 4PXCA 1RBOB 2GIRA 2HKEA 4RW6A 1U2FA 1FRXA 4I7FA 2XMAA 2JLFA 3PO3C 3BO2A 2VUMC 4LRFA 4QQBA 2YQ0A 5HQLA 5F0UA 4PWDA 3G82A 2W2QP 4G1QA 3KJNB 1KVKA 2XGPA 1MROB 4MK7A 4FNIA 1RWMB 2CNNB 4IFYA 2BE5A 3BQ1A 5HP1B 3IWXA 2HFNA 4JI3F 1O5JA 4H4MA 1FRKA 2IMOA 2E5LF 3WNCA 1DTQB 4B43A 3DRRB 4AD6A 4JI0F 5HLFB 3AOCA 4FBTA 5GVQA 2HGLA 1RKIA 1NM2A 3PEHA 5LT5A 4OIOA 2XI2A 5KG4A 1JLQA 4K59A 4KBIA 3C66A 3MEDB 4ZCMA 3MPWA 2CC2A 2FQQB 1E6YA 4X6AC 4WJ3M 2Q79A 4DCPB 1HPZB 3C2PA 1K44A 3BREA 2IC3A 3DYAA 5GMDA 4XO0A 2R7TA 1SJ1A 1SKWA 4B3RJ 5LOQA 4DQQA 1OB5A 3ASPA 2BPOA 2M9KA 4X8IA 1R8BA 1NDPA 3RTVA 2FB0A 1GTEA 1FK9B 2DYIA 4B47A 2C3OA 3T41A 4N8NA 2E7VA 5DDRC 4II2A 1HHSA 4RZRA 2W8KA 3WQZA 1Y3KA 4DI6A 1QFJA 3DLGA 1C4CA 4CTAB 2AV5A 3VZHA 1T5EA 3BQJA 3ISND 5H9EK 5A6PA 3FOFA 4DR6J 2VF3A 4E8UA 1RBLA 4UT4A 2IM0A 2JIZA 2HEKA 3M6XA 3M8QA 2D41A 1JLFA 1JQGA 4A3KC 1T6ZA 4N47A 4C4WA 2HNYB 4RJVA 4E2FB 4OHWA 5J1PA 4ZVHA 3WBJA 4DU8A 5L46A 1VQ6S 2ZZTA 1VJWA 2AJQA 1QVFB 3MR5A 3ZZ0A 3VAHA 1VQ9B 1NMEB 3KK3B 2C77A 2QEXB 3UDLA 2VOPA 1WCMC 1B0VA 1R43A 2BDPA 2GQFA 3AXKA 1JKHA 4F4KA 2QA4G 2OP5A 4XLNA 1SJ3P 4RW6B 2ILYA 3NY0A 4I7FB 4C98A 3MD3A 1EKSA 3RZDC 4DV3F 4PRFA 2GIQA 2HBZB 3D0IE 4PWDB 2CZ9A 1KFSA 2DH8A 3EMTA 4C8NA 2ASJA 3PUNA 3G82B 4G1QB 3OTOJ 3QJPA 3Q2SC 4DV6J 4KHPJ 2GGPA 3CJ2A 4JI6F 4JYAJ 4IFYB 5IWAJ 3OTBA 2IM2A 2VONA 4BC9A 3RBZA 2X1GA 4RW4B 4H4MB 2VHGA 1RWVB 3V81A 4N3GA 2EFPA 2H54B 4ECWA 3CPWB 4X7EA 3VF0B 1WUUA 2LECA 4JB8B 5IC4B 4XLEA 5D0HA 4NRUA 4OX9F 1REVB 1RA6A 1LNQA 1U1LA 3CMAB 1U1KA 1JLQB 4G6IA 1V9OA 2MQ8A 1Z4UA 5AN9A 1E6YB 5IXUA 2VA2A 2HLUA 1SC6A 1SPBP 1LWCB 2DR8A 1K83C 4ECVA 1GXUA 2Y3YA 4P22A 3PRBA 4U7UD 3DYAB 3NEKA 2VD3A 1OGJA 2I1LA 2F4VJ 1YZ6A 4DJBA 1OIAA 4G1VA 3MZIA 3VR6A 3DLKB 5FLMC 4M2LA 3IG1A 1OJ4A 3UFCX 1V0FA 2UZAA 5HAOA 1TL5A 2EFNA 4I6WA 4A8WA 3HHLA 2FVCA 1G7SA 1UKUA 2DH9A 1VLOA 1K28D 5B0FA 3SKBA 2IBOA 4QR1A 1R6YA 4NLPA 1YJTA 4YN3B 3R6GB 3CJKA 4K8RA 1JLFB 4N8OA 1VQLB 3W2EA 5F41A 4C43A 1T9XA 1UAWA 3MUMP 1RU1A 1QAYA 2R93C 4LBWA 2I9SA 1A0OB 4JOUA 1RT4A 1IR0A 4YOEA 3IRXA 1ZAVA 4ZS6A 2UUWA 1GXTA 1SJ4P 5HI7A 3ZTQA 4IR9A 2LU2A 2CQBA 1EQ0A 2IMWP 2V94A 4DNTB 3ITHB 2GNKA 2NZCA 2R6HA 3WQPA 4O0IA 5LMUJ 3CQZC 4LQ9A 1W2BB 4X7FA 5LSLA 1X8DA 2D3UA 4K4VA 1TUWA 3T1AA 1Y1WC 3PNIA 3UDCA 1I94F 4TMZA 2OSQA 4G5GA 3GTPA 2R9VA 1I6HK 4F4WA 2RQKA 3UE2A 3AD9C 3H3VL 1F3VA 4XCHA 3LQVA 2D3O1 1RAGB 2A6MA 3RU0A 2HIQA 3LW5C 3IM8A 3GQCA 2GGPB 5TMCA 5CCMA 3FPKA 1QUEA 3ONQA 1N34J 2K7JA 4MK8A 3HJVA 3V81B 4LF8J 5L9XA 4DV5F 4PQUA 2E1MC 2CPYA 3DRYA 4ITSA 2CNOB 3PHEA 3S01A 1IM4A 1FDAA 4P7VA 5AJ3J 4OX6A 1YRXA 2HAIA 3AHPA 3MAQA 1JLEA 2XZWA 4CQJA 1ZPWX 5IYRA 2ROPA 3UI3A 3UVJA 6FDRA 1DLOA 2E2HA 3GP9A 3TNVA 1YITB 3IFEA 3MEKA 3JQKA 5DQGA 3HDSA 3R6LB 4L74A 1KNZA 1NO8A 3IG1B 3ENQA 2EG1A 4XLAA 4CO2A 5GMKa 3X3UA 1UVMA 4PC3A 2DRDA 3OP1A 7FDRA 3HHLB 1QGAA 2CQGA 3K5NA 1WF0A 4OYAA 1U1PA 4RDKA 1M5KC 3S1MC 4ID8A 1KTVA 3KWMA 3TVZA 1KMHA 1RHKB 2D3NA 3CJKB 4ICLA 3K5OA 1S48A 2UXCJ 4LJZA 5E3AA 4RMFA 2J9DE 4Q4ZA 2L9WA 2D7SA 2I8EA 4QW8A 4EU0A 2KXNB 3CP8A 4UQGA 4FNHA 4J91A 1LXJA 3IRXB 3OKXA 1B70B 3HOVC 4J9VA 3T51B 1NDHA 3LAJA 4WE1A 3OL8A 4HL9A 4LVOP 5L1IA 1BDFA 3E2EA 4A3CK 3WC0A 1SQEA 1BQMA 1Y00A 1AFJA 3CDAA 2M88A 3I0SA 1CSJA 1VHFA 1GX6A 4FXVA 3WDOA 2C28A 4Q45A 3TAQA 4XN0A 2F1LA 4BS2A 3PTWA 1TMJA 5IS2A 1Y10A 1ZYRA 1Y0YA 4CLLA 1AXQA 1X60A 2DNNA 2M3DA 2VQFJ 3NBPA 4ERDA 1FXRA 5KSWB 2XOKA 3NWGA 3D6TB 4KDDA 4BPRA 5KW9A 2FX3A 3PA2A 5JVGQ 3N3YA 4X4VA 4B3RF 3KLIA 4AL7A 2IDLA 3CCVS 2QFJA 3J81k 3HKZL 4JI2J 4ZPVR 1TWAK 4QPTA 3JQJA 1JLEB 4Q5SA 2VBUA 1NK8A 3UVJB 3ZUGA 1DLOB 1V3RA 2CBXA 1MN9A 1Y4ZB 3NL0A 2K06A 2YH1A 3LAKA 1KHWA 1N88A 4R5PA 4DR6F 1TWHK 2QLXA 2H4YB 2YNIA 2CADA 2ZUAA 3SCLE 3GV7B 3L7OA 2B7BB 3OXGA 1Q81D 1N5SA 2DGUA 5KT5A 2DIEA 2RF2B 1F9FA 2PEHA 3OUYA 4DDQA 2ZE2A 3K57A 4NYOA 2WB4A 4K0KJ 3AY0A 4Z4TA 3I96A 4DPWA 5IT9U 4IRDA 4WIQA 2MZSA 2PI4A 2JFDA 1GNKA 3A3GA 2RHQB 4ECUA 4ICLB 5KTQA 2MLYA 3JSYA 2CZ4A 3OFNA 1GXLA 3KFWX 2CPEA 3VGUA 5C3EK 3OL7A 5A88A 2NYIA 3DI6A 1QVFR 1RBAA 4A3BK 2MLXA 3MR2A 4FS2A 2FY1A 3OW7A 4DPTA 4KGZB 4CH0S 1I5OB 4TSFA 4BBRK 2WCXA 1OWXA 1WEZA 1JJ4A 1K9MT 1WTBA 1BWEA 3OTOF 1HI0P 3G6XA 1BQMB 4DV6F 1VYAA 3MOZA 4KHPF 1S0UA 4N5SA 1S72B 3G71S 4JYAF 3I0SB 4OQJA 3GTPK 5ETVA 3PO2K 3V6KA 2WONA 3QMQA 3BH6B 2CQIA 1IR1A 3ZC3A 5C24A 3GG0A 3MMBA 3K59A 1TWFA 2B0GA 3D67A 3QGGA 4LF5J 4J9QA 1OPZA 1HIYA 4CDIA 4JBCA 3UO0A 3B8HA 5IK2A 3R5DA 1WEXA 3NBPB 2KVQE 1RB0A 4XSXA 3PW7A 1SFOA 2FJVA 2SXLA 2HFZA 3BB5A 1UA1A 2J6TA 2RB7A 4CLYA 1D9AA 3FMWA 1FESA 2F4VF 3S17C 3BP3A 2KT5A 2JLEA 1RT3B 1VS3A 2KFZA 2JHEA 3G86A 2YQ1A 3KLIB 2AMCB 3HXAA 4TY9A 2OELA 3BSNA 3OAAA 4I67A 3Q83A 1C0UA 4BLBA 3I9V9 4FF1A 1FNMA 4UQTA 3A8JA 5E41A 2BMBA 1RGVA 2AYGA 1RT5A 4ZPCA 5FO1A 4UOFA 2QGFB 3GTLA 4R5PB 3R7BB 4WK1A 2ZITA 1IBLJ 5F8NA 3I9ZA 3IPJA 2YNIB 2DKOB 2VICA 4FXWA 2DNYA 1UJ4A 2G0JA 2VJIA 4KPYA 1U2CA 2GO8A 4RCYA 4NA1A 2ZE2B 3R1LA 3IMQJ 1SJFA 2W9AA 2GSNA 4I64A 5J2NA 2WVBA 2QG9B 4OLPA 2WBMA 2RMLA 4ECSA 5J3OA 3SEJA 3CE8A 4A3MK 3PYEA 2V69A 2HNZA 4AH6A 3NAHA 4NNJA 2BANA 2HFSA 2C78A 4OHZA 1JLCA 3BF4A 3CCQB 3JXOA 3HLUA 3GVJA 4PR6A 3GJTB 3BH7B 4OJGA 2MY8A 2YWHA 4P25A 2DISA 2ZZEA 5LMUF 1RT2A 2HZAA 4DV4J 1KK0A 1XMQJ 5F3TA 3DI6B 2MJUA 2OKQA 4O3OA 5LJ3Y 4EMDA 1QTMA 4ZITA 4EBEA 1XMBA 3CTAA 2NUUG 4ED4A 2RE1A 4IR1A 4P26A 1FRJA 1W2BR 1E64A 1KONA 3BGOP 5GAEI 5L1LA 1Q16B 1MMLA 4KYZA 1F9NA 4LK1A 1YITS 2Q6LA 5KFOA 2MHNA 3NP5A 3DKDA 1BJTA 1CJUA 1LKZA 4OV1A 3W2FA 2WONB 1KQFB 1S9GA 4LF8F 5KG7A 3BQ0A 5C24B 1LWEB 3Q2TC 5CYJA 1AYEA 4G0UA 3MMJA 5KG1A 1EP2B 3W60A 1TK0A 5KFBA 3T00A 1BUXA 1X0PA 5AJ3F 4Z37A 3AQOA 4EK2A 3C6TA 2LXIA 4YHBA 1FXLA 3P26A 2F7VA 1RTDA 5KAKA 1DQAA 1WHXA 5KFDA 3HSZA 4DUTA 1WC6A 2UVUA 1U7LA 1VQOB 4DV0F 1L3VA 1H2UX 3H59A 1NSKL 4WJBA 1C0UB 2X1FA 2NQPA 1Q86T 2YY3A 2XNDA 4YHHJ 4IO9Q 1S76D 3GTKA 2C2RA 5KG0A 2QO3A 1RT5B 2OPQA 3M6WA 1HQUA 1P4MA 1V3SA 1S1TA 5BR8J 5L38A 4ETXA 1GT8A 2VG5A 1Q82T 3CCJS 3Q0AA 2VOOA 3PIOQ 4RD4A 5J2PA 2E1BA 1NHUA 1RISA 1YZ7A 2QE5A 4NZ0A 4Z7CA 2FJWA 5ETQA 1F7VA 4GC6A 2B4UA 1DCOA 1HNXJ 3E8OA 2UXCF 4WP9A 4A3CC 2DB1A 2CW5A 5J2NB 1IR2A 4BBSK 3MCOA 3PENA 4OI2A 4X65J 4F7DA 2GIFA 1XTZA 2C2DA 5F8HA 1RWUA 3MM9A 2HNZB 1XWLA 2CG8A 2BANB 1AUDA 2KJVA 3ASSA 2CQHA 1H8EA 2UUBJ 5A8KA 4BY1K 4OI1A 1X4FA 2LQJA 3UNYA 2JNJA 1RABB 2YKPA 1RT2B 1D9DA 3MAAA 4DV7J 4NLGA 3RJMB 1LXNA 2PN6A 2JRSA 3QAUA 1KTQA 2YNFA 4GO7X 1WG4A 4NEYA 3GTMA 4C2MA 2FHKA 4QIFA 1FKPB 3FUYA 4RLZA 4TU8A 5D0RA 3GJRB 3RBXA 4X2BA 1RU0A 1RTZA 1YJNS 1FVQA 4JI5J 1WQHA 3BZQA 1F1BB 1S99A 3K2YA 3Q8QB 3M05A 2PE3A 1SB6A 2VQFF 3ZIAA 2WB1L 1S9GB 4WU2A 1W7WA 4X7DA 4IOAQ 1A8PA 4J9PA 2OUGA 4DSJA 1TWFK 2NPIA 4LREA 4TLRA 2OMOA 3TJAA 4F8RA 2XMJA 3H0GK 3I82A 2O5JA 3G6EB 4ES1A 4CO4A 4DUYJ 1TWHC 3RB0A 4JI2F 1T03A 2FVQA 1FD2A 2R7ZK 2AU0A 3I6PA 4QWBA 5CAAA 3WYAA 3C6TB 1ZM2A 3AVTA 1H98A 3BQ2A 3ENAA 3HHLC 3H94A 1FRQA 4DN0A 2A68A 2KH9A 1N36J 5FDLA 4HTJA 4Z1MA 4QJVA 2QL9B 4M5NA 2DK2A 2FHJA 4ZGQB 2NVYK 3UN5A 3SLDA 4ES2A 5I42A 2DNLA 1Y9OA 4U95A 4AXJA 2XHCA 3T9NA 2DO4A 1AT1B 3IP0A 4CO3A 2OHDA 3W5UA 2CFAB 3GQBA 4R25A 1HQUB 3GTLK 1S1TB 3NG8A 5C3EC 4K0KF 1FNBA 4PC6A 2LEPA 4G6VB 3GCWP 1W35A 4YELA 1FKAF 1HWKA 2VG5B 1AA1B 3DRSA 3FCWA 3BUEA 3MECA 5KT3A 1NUEA 4BBRC 2HFOA 4K4ZA 4XDCA 4DEZA 2YU9K 4IQMA 1DURA 1CVJA 5A2QU 2VNKA 3TZWA 1FFWB 1YI2B 2CF4A 4FYYB 5TV2A 4ZPDA 4RWXA 2BA9A 3GTPC 4N77A 3PO2C 3MM9B 3C16A 2B5OA 4YFUA 4GTBA 1V5VA 5A8KB 1ACMB 3KHLA 2XYHB 3MMPA 3HMJG 1T3OA 1WSRA 3ILJA 1BD6A 4GVBB 3S14C 3AFGA 4CQ1A 4LIRA 4A46A 1PCAA 2KXFA 4RO0A 2YNFB 4DR2J 2P2CB 4Y0FA 1OY9A 5K8PA 4RDLA 2VODA 3PFEA 2ROEA 3AA8A 2V7XA 3OSPA 4CRJA 2EVZA 4PXEA 4R0JA 4AXIA 3PW4A 4QZVB 2VFRA 2NVQK 1ITPA 3PHTA 3EM1A 3S8SA 4M5IA 2E2HC 1S0OA 2VJUA 4K7QA 3DLLQ 2J6SA 3JYTA 1WI8A 1O28A 4M94A 2FVPA 3MGJA 1KK3A 4LSLA 4ZOSA 4TMXA 3SQOP 1PO6A 1UVIA 4A8QA 4DPYA 1T03B 2XCRB 1OS5A 4OHXA 2Q66A 5F4MA 5C4JK 2DITA 3MM6A 4USUA 4KMHA 1FJCA 4DR5J 4RU9A 4QJVB 2P6SA 3CC4S 1H72C 4K4YA 2H48B 1TELA 1SM4A 2IVYA 4OPSA 1IBLF 3KOAA 5I42B 2XC9A 4HACA 2KDOA 1N5TA 3C15A 2XLIA 3EVMA 3ZZYA 2JSXA 5A8WB 2IHR1 4LBIA 3EVWA 4W92B 3GV8B 3LQ6A 2G1DA 1P27B 3CO9A 1XZPB 5EWGA 4DFMA 3OJXA 4J7CA 2JFKA 3A3OB 2I1RA 1F6TA 5EGYA 1G7CA 1TAQA 4HH0A 2ZBQA 4GMKA 3DRSB 5D4LA 3KJFB 1B4AA 2FJXA 3MECB 2F8HA 1TWGA 2VJJA 4LFBJ 2YTCA 1RAJA 5LSRA 5SUHA 4FPRA 1JJ2B 4M5GA 2PMHA 3R8YA 3CMQA 4DV4F 4EZ6A 1Q1KA 4IH5A 1XMQF 1UETA 2R4FA 1FFSB 3OL9A 1JWWA 5DDOC 3HFVA 1O51A 3R5AA 1JXEA 2B51A 2V8GA 3WBKA 1VJEA 3C16B 2VBZA 3WIUA 1RYSA 3WX8A 2K2PA 4DL2A 4NYZA 1VQ4B 2GK7A 1VCTA 5K14A 1UJ5A 1Z2ZA 2R8JA 4ZCKA 5F4OA 1B2RA 2P9CA 1T94A 1R6VA 4C11A 2YX7A 1VQOS 4KN7A 4DFPA 4C2MK 1S4MA 2RD5C 4A3GC 3L4KA 5MAOA 2RSQA 4AFFA 1G7RA 2VBVA 3MHYA 1JNRB 5D3GA 5LL6d 1SKQA 1YLXA 3TW0A 2N4DA 1YQHA 3LP2A 1UZHA 4KATA 3S1QK 1VQMB 1WC0A 1KDNA 1EQMA 2H1YA 4B9LA 1JX4A 4HH1A 3DDNA 3G9CA 4MFBA 4GKKJ 1TWCK 2AGQA 4I69A 3JYTB 1RQPA 4ECYA 1TL4A 4QIWL 4KJIA 4KE5A 1K73D 2BV3A 2RU3A 2FDNA 1FDDA 2JA5A 2GREA 3A3BA 1VHIA 3G6VA 3TX8A 1HLWA 4YS2A 1FDBA 3GB0A 1Q8KA 4WILA 4CT9A 1MMNA 4LOWA 4RKUC 4Y00A 3MM6B 2ZOGA 4YHHF 3FEYB 1KN6A 3LTOA 2YKAA 1N48A 1ZVUA 4FPIA 5BR8F 4LBYA 4TN2A 1M1KT 1VBXA 2ZWPA 2ZKTA 4KM9A 4M5KA 4P10A 4HACB 4DR1J 5ETTA 3C15B 3O8WA 1TV6A 3D6HB 4NOIA 5KFVA 4UY8T 1A9NB 1F7UA 2PEBA 1IS1A 1HNXF 2ZBPA 1Q53A 5HMZA 4LBHA 3I5AA 3BS9A 3HOZK 4USHA 3FRZA 4ZJQA 4X65F 3S2HC 4A8KA 3GLJA 1NBMA 3ASTA 3P4UB 2X6WA 1G7CB 3FBBA 1O8BA 3GTQA 3LP0A 4Q7AA 3AOAA 3IA0A 3TX0A 3CJ0A 1IXKA 1XNRF 2UUBF 8AT1B 1P8GA 2V9WA 1KQGB 3DDYA 4DV7F 2VDHA 1DCPA 3G6ES 5HMYA 2KI2A 1UVJA 2ZH4A 2J9DA 4H54A 1PYTA 3RAMA 2Y3PA 1TWFC 3TA1A 4TKOB 1J5EJ 4Q44A 2WSCC 4JI5F 2HQIA 1X5TA 5A89A 3KYLA 1FKOA 1PJ5A 2ZH9A 3PZPA 2HGNA 1JQWA 1OHHA 2DRBA 3CJQA 4DXLA 2R7ZC 1I6JA 2Z2LA 2CQ2A 2QMUA 2V6TA 2CJAA 2H51B 2O5DA 3QSYA 2VYQA 5D3GB 2FC9A 4BCAA 2BVNA 3VMFA 2XS2A 1SL0A 5DS7A 1ZBSA 1PKVA 1VI7A 1HBNA 2RRBA 3LP2B 3M9OB 3KLGA 3ES9A 3HXMA 2DGOA 2ZTNA 2NVYC 1LWFA 4Q2LA 2QA4S 2AYBA 1JXVA 3NGTA 1WTHD 3G87A 1M1HA 3CCEB 5HANA 2GHPA 4I2QA 2GW8A 1Z2LA 3HOXC 4NZ6A 4WYLA 1ZA2B 4DX5A 1N36F 3GTLC 4M5JA 2HVEA 3R5JB 4Q5VA 3CEDA 1YI2S 2VUGA 3ZZOA 3IN5A 4DZDA 1PJ6A 1WPCA 2EPIA 4QVAA 4JI8J 3BBBA 2RDDA 4OI3A 2R2RA 4F36A 1HWUA 2OLWA 3N9UC 3ZZZA 1YLOA 2BXJA 2JH3A 7AT1B 3AVYA 4G7HA 2VV5A 1TV6B 2CZVC 4ZJOA 2XEXA 1IE0A 4FZBA 3GG1A 3FJ2A 3NNCA 2XM3A 2QA1A 1HZEA 2EFOA 3K7RA 3MR6A 2C3YA 3OR1A 2X51A 1U0HA 1NB9A 3VALA 3SCKE 1T9VA 2HCJB 3L09A 1JLAA 1UMJA 4B9UA 3UD4P 5C4XK 1R3NA 1TWGK 5GV7A 5I4MA 3LP0B 1TK5A 1D9FA 4CCHA 2YBVA 1ZYQA 4OZNA 1O27A 2GMHA 4C9DA 1RA7A 2RGRA 1S1XA 1JA0A 4B3FX 3ZBUA 3G4AA 4ECRA 3NNHA 4ZVEA 2GPJA 4HDGA 2WZPP 2B8QA 3CT9A 1UV7A 2PHCB 1I3QK 1QE1A 2ZHAA 3W5YA 2LMIA 3M8WA 2JEGA 3OSNA 2NVQC 1M1GA 4GRSA 1XNQF 1B64A 1B99A 4DR2F 3D28A 3C6UB 4XN3A 1I7PA 2ZJQQ 3T6JA 3ELHA 1SL2A 2Z2MA 1AROP 3CCUS 5IFMA 2AW0A 2E44A 1FKOB 1W34A 5C44C 3OPOA 4YXWA 5IT4A 1S10A 3P8BB 2QMUB 3J7ZT 2GQQA 3QSYB 5C4JC 3PRDA 4J9OA 1UD2A 1O26A 5A2QY 3V4IA 4ACBA 3ILIA 2EIXA 1HBNB 3BBCA 2GX8A 3BSOA 2YWFA 1DAXA 1MMDA 4F0KA 1LWFB 4WFAQ 1W0KA 2AYEA 1R0BG 1QH0A 3CIMA 4FYDA 1YBAA 2LZJA 4NA2A 3ADAC 4CLUA 4DL0C 3W64A 4DR5F 5HJXA 2BM1A 3H8YA 3MTJA 4CO5A 1ROFA 3GPAA 4YMEA 4HHUA 4LLGA 3P45B 3X1LB 3RB4A 4KMDA 2MQQA 2Z30B 3L9ZA 2E5GA 2VUMA 2DY9A 1VRTA 5ETRA 2QLBB 3MM8A 4ZPWR 3TRGA 1FWPA 2D69A 4JV5J 2CQCA 5DG8A 4BXXC 1VQ4S 1PC5A 4FS1A 5DM7Q 2W1BA 1G4CA 1DCHA 4PC2A 2HK2A 5HXBA 4GTLA 2B9WA 1WHWA 4LC0A 4EUVA 4LRDA 1QSYA 2DHHA 3TVYA 2XMUA 1O2AA 2A69A 3WC2A 4LFBF 3HKWA 1Y1VK 2XSFA 1N4LA 2XBPA 5GAGI 2YWEA 1OYEA 1U0HB 3PUMA 4EFAC 4RL1A 2ZKUA 3EDRB 3CDBA 4YDDB 4K5RA 4LBVA 4H4KA 1Q8LA 2VDIA 4J5OA 3ZTOA 3GTMC 4C2MC 4UZCA 3BSAA 1U47A 4MIAA 1UD5A 3FKSA 3OE7A 3I5CA 5KG5A 1S1XB 1BHNA 4RBVA 4WK3A 5CCLA 4ZMMA 2V6AA 4FXUA 3FRYA 4NE9C 1QE1B 2F9JA 1W9XA 3G05A 3OVBA 2RKIA 4X4SA 1QGZA 1YIJS 2GSOA 3POTB 2QIFA 4CO1A 2JJ1A 4WIIA 3OVAA 4PYAA 1LK5A 1HNVB 2ZTGA 1HNIA 2HHTA 3CWJA 4USWA 4B3OA 1RT1B 3LF0A 1S1WA 3TZZA 4TQSA 2DGTA 4GKKF 2IRXA 4K4TA 2H5EA 2JX2A 3V4IB 3HZGA 1WP6A 1VK8A 4O3SA 3J81Y 3PFOA 1XK8A 4ZP7A 1TFWA 5IOSA 2CYYA 4LF7J 3GTGK 2D6FC 4ZLJA 5DZ6A 5E68A 1UD3A 4AL5A 3LPEA 1BGWA 3DHXA 5L8RC 2XNQA 2MB0B 1WCMA 2K8GA 2F65A 1UVNA 2V34A 2C2WA 2OAUA 1NKBA 2W7OA 3MMCB 4LF9J 5KT4A 5B7WA 1G51A 2IPOB 4UOHA 4K4SA 2QMWA 4DR1F 3FSXA 3RZAA 3QE2A 3QZ7A 1UZDA 4OZJA 1GMUA 4WTOB 2XWXA 4M5LA 4WPAA 2ZEJA 2P9GA 4KR0B 1X5OA 1NDCA 1RP5A 2VBTA 5IYDK 5DDPC 1H2VZ 3DOLA 3D0HE 1K47A 1UEUA 1W0JA 2NVTK 4TY8A 4QIEA 1N6QA 3OREA 4ZVGA 2Z57B 4GTAA 1I1GA 2Q6KA 1O6XA 3CC2B 2B6AA 3QBCA 1H6KX 1JLBA 3GSDA 2G0IA 3DN9A 4PG5A 5F8MA 1F3FA 3AVXA 2FJAB 2R9LA 2CWXA 4O4GA 1TL7A 4XONA 4I2PA 2ASLA 3DM2A 3BY1A 4DQKA 1LW2A 1YJ9B 4RUBA 3HFKA 2V4RA 4GQNA 1T95A 4TT3A 5ETSA 3CESA 3SFUA 1NSPA 4O44A 3GYGA 3V4MA 3Q3QA 1J5EF 4EO8A 2IJRA 2DGVA 3QRQA 2HIYA 3BPDA 4TLQA 3SDEA 3GIIA 4TYBA 1IUJA 2V50A 4F67A 5EGHA 5CJ9A 3FSYA 1FRNA 3S2DC 1KHVA 3E01A 3ISZA 3HP6A 1QDUB 1XR7A 3DLEA 3HVTA 1HNIB 1MWQA 2DYAA 1WHYA 2ZHOA 1WACA 2F63A 4DPXA 2AYMA 1TKZB 3TFHA 1WF2A 4RD2A 4C0BA 3ERED 3WZ0A 4ED5A 1LV5A 4UAJA 3KL9A 2KG1A 4LQYA 2UV8G 2JN9A 4CNYA 4W98A 2XWYA 2PI5A 1FXDA 3CXCR 1M5HA 1TK8A 4F0HA 4C8YA 3P96A 2AZ3A 2WSFC 4B3TJ 3ZZUA 6AT1B 4XKWA 3HSJA 1T11A 1RWOB 4JI8F 3N6LA 1DG1G 3DXSX 4HVZA 2B8PA 2J76E 3SSQA 2DEJA 4M5DA 4M95A 1BX1A 3CCTA 4NASA 3OZVA 3CDUA 4ES3A 1E43A 1NRKA 4C8KA 2QYGA 1IJEB 4HI2A 2C1EB 1KWMA 1AW0A 3QGHA 4PPDA 2YX1A 3D9BA 1KBRA 1R5BA 1CQXA 4RD6A 2MZTA 2E5LJ 1TWGC 8ATCB 2HFVA 4HHHA 3DOLB 1IBKJ 1U8WA 3OJUA 1Q4RA 3AH5A 4OJHA 3B82A 4BY7C 4NI2A 4TY8B 1KK1A 3GTOA 3JTOA 1N6QB 2ACMA 1K0TA 1I3QC 3MAHA 2LCWA 5HVFA 5KFSA 1N0UA 1U8SA 2B6AB 5D77A 1JLBB 1RT6A 3S1NC 4QU6A 2WOMA 5KFZA 2MKJA 1NH7A 2BR0A 1HW8A 3TUIC 2N7YA 4I2PB 3DM2B 1S97A 2OTJS 1YJWB 4WZEA 1IHMA 1GFWB 2Q3PA 5ETOA 1TVRA 1IKYA 3PM9A 2K3KA 3CJ8A 2R7WA 4O44B 1X5SA 1T05B 2VG6A 2QYCA 1OPIA 2GJKA 2V7UA 3M4XA 1SC3B 4B3XA 4OI0A 1FEHA 5HK4A 4Z4YA 5K8OA 1W2IA 3ASQA 4M0LA 3ZZRA 2GJPA 3QT6A 1VQNB 3SDEB 1HBOB 1T6YA 2HMIA 2A10A 2DHXA 4RW9A 2P6TA 2KRBA 4A48A 1D09B 1H0HB 3OJWA 3E01B 2MKIA 1FDNA 3JTPA 3GTJK 1D1NA 2C22A 3HVTB 5ETLA 3ZXWA 1CJTA 4KKUA 2QSFA 3F41A 1SBRA 5HVHA 5E5NA 4QU7A 1JOEA 3RYLA 1RLDA 2DNPA 5LMZA 3DCAA 4KT0C 2GAGC 2HQ3A 4KGVB 1HQMA 3T1HJ 1D8TA 5D4OA 2HHWA 2ZUFA 4WFYA 1VJSA 3TAMA 4C97A 3L7UA 4ZA1A 2XYPB 3D5MA 4TQRA 1VC5A 4M53A 3CD0A 4M5DB 2CJQA 2HNDB 1GQEA 3Q23A 3ISXA 4JV5F 2YKMA 4OZLA 2I6WA 1U25A 4WFNQ 4XIUA 2XB2D 3BR8A 3AVWA 2I5JA 2GHWA 2GA7A 3D1HA 9ATCB 4LR2A 3NNAA 2OO4A 3W5ZA 2ZD1A 4OX9J 2D3LA 4G7XA 3GFXA 1CS4B 3GYXB 4V1Ak 4HLBA 1A6LA 4P73A 1UVLA 4MH8A 2Z4PA 2PA8L 4A8FA 1ZM3A 2BMWA 3DLBA 2O3DA 2V0NA 1FD8A 4Z4VA 2WOMB 4C3JK 2DTJA 3JS9A 2NXEA 3P5TL 3ZZTA 3R97A 2MLZA 1EP3B 1F5BA 4GTEA 4OL8A 3SMZA 1MU2A 3O44A 3LAMA 2MQOA 3WXMA 5E33A 3JSRA 1IKYB 3QATA 5KG2A 2CQ1A 3SI8A 1Y3JA 3P49B 3SQGA 5A8RB 4B9VA 3VHQA 1KQSR 1DHMA 4IG3A 2ZNZA 4ROXA 2VG6B 5DN6A 5BJRA 2M52A 5GMEA 2WR8A 2W4PA 2HVIA 2GC8A 3H20A 3CF5Q 4B3SJ 1EXMA 4C0OC 3TP2A 1TP7A 4ENOA 4A8MP 1RKJA 2HMIB 4DF8A 4MAKA 4RW9B 2BJ3A 1GE9A 1NZAA 5LXRA 4H9GA 4OX7A 4C3KA 4PG8A 1I18A 3S6EA 3JQPA 4RUAA 3C14B 2Y0SD 2NZ4A 4B44A 1CJTB 3HM9A 4LF7F 3EPGA 3A1YG 5I3QA 1H74A 1N0VC 1XE1A 2AKWB 3J7A1 3BKTA 2HHHF 1HR0F 3CC2S 2WVFA 2W7VA 5KFHA 3QT8A 3HJFA 2F8EX 1FHTA 2WW4A 4ZCIA 4AT1B 4Z4WA 1D8YA 4LF9F 1C2PA 3PKMA 2HBRB 3TAMB 2HDNB 4WZKA 3CNQP 1QJHA 3IR6B 2X1BA 1CLFA 2KRRA 4ILLA 2YNHA 3QQCD 1VQ7B 2Q6OA 5GAHI 2LXFA 1EFWA 2C3PA 1IQ0A 3W1YC 4RPBA 1HI9A 2V6UA 3R6KA 3NS6A 3T01A 1MWZA 1A7GE 2PLFA 1K9MD 2I5JB 2WYRA 3IWLA 3HHEA 1HFEL 1PJ7A 1NLKL 2DBBA 1DQ8A 4UTGA 3D66A 1J27A 3V6DA 3UPFA 2ZD1B 4RWWA 3QFTA 4NX9A 1HL6A 3M4OK 3GTOK 1FWLA 3BN4A 2BJ7A 3LALA 3N6NA 1WQGA 3HX9A 4AE5A 2BKPA 2E2IK 2MQPA 5DQHA 3NGKA 4NLWA 5IQ6A 3HOWK 4ACAA 4NLOA 3ZZPA 3U6KA 2Y0BB 3MDFA 2GHVC 2GCFA 3N0CA 1EP1B 5F9NA 2HS3A 4OZ0A 1GO2A 2XQCA 2ZC3A 4F4XA 1JK9B 2G9OA 4ZHRA 1Q7YT 2QJ3A 4YAWA 2HSEB 3AD7C 2M5YA 1F60A 3UDEA 1MU2B 4USVA 3TI0A 2HYIB 2UP1A 2AX0A 3SV4A 4KGMA 4XLFA 3FBCA 2PDAA 4C8OA 2HGMA 3MPVA 1NCLA 4NZ7A 2COLA 4IG3B 3W62A 3FKBA 2GJIA 4BHQA 2DCLA 2XCOA 3ZFVA 3RAXA 1S4FA 1M5OC 2X7IA 3GFZA 1WOOA 2WK4A 2ZUEA 1TVCA 2AHOA 2JA7K 2VBXA 4LRAA 2DGWA 3M6UA 1XPPA 3FCVA 1N5YA 2VNHA 1BPLA 3V2UC 1GVHA 2QTZA 3Q8SB 4B3TF 5D0EA 4I4BA 1X4CA 3LA0A 4R0EA 4UZEA 5JVHQ 4NPOA 2B4VA 1RWPB 2DT9A 2UU9J 4ECQA 3FQKA 3UD3P 3T1YJ 1QM9A 2PA8D 1N8RD 2IM3A 4KAIA 2PFDA 4NMXA 4O2DA 4M5MA 5D8HB 3SFGA 4J9UE 3KK1A 4WZLA 1IQZA 1K8AD 4ANEA 1CBKA 1OY6A 3GVKA 3CGIA 4O3NA 2YNHB 5CZXA 2XULA 1M0SA 4Y2IA 1IBKF 2B4PA 1ZQ1C 3OTDA 3CPXA 2M8HA 4RM0A 4FZVA 4H4KC 3V6JA 1JB9A 2APOA 4P72A 3TFIA 2OPSA 3UCGA 5B0CA 3T5HA 1D8ZA 1PKUA 4HI1A 1Y5LB 2ZJRQ 4OHYA 3IR5B 1VQNS 3V6DB 1UW4A 1R8PA 4A3EC 4DSIA 3M30A 1N33J 3KK2A 3SZ2A 2BGIA 3AD8C 4KRWA 2MKYA 1SI9A 1NK5A 2XHWA 4B9SA 3KUGA 1IL2A 3NAIA 3AB4B 3CAGA 3OV7A 5BSXA 4ZIVA 3KNGA 1WELA 1C1CA 1F5AA 2BW2A 3CO0P 2YQ3A 5DS0A 4WJ4A 4YY3F 1L5UA 4N41A 2ZNYA 4Y52C 2CQPA 1COWA 1KVJA 1F60B 2BJEA 2C2EA 3BY2A 1FNCA 2GK6A 2AJFE 4L8JA 3O3LA 2XS7A 1IKWA 4B9MA 1XEZA 2JOQA 3U7JA 1QX4A 1Q86D 4PGOA 4FKYA 2J9CA 5D4PA 3QZ8A 2VNJA 1U1QA 1WQFA 4IH6A 1LK7A 1O2BA 2CPXA 1FX4A 1RYRA 3MD1A 5EX0A 4HT7A 2AHOB 2XY7A 1QAXA 2KO1A 4LMZA 2IA0A 2IJFA 4HE6A 2CQ4A 4AQYF 1N5YB 3LGHA 1HQEA 4HEA9 4F0MA 4LBZA 1BQEA 1Q82D 5EGEA 3R3TA 3T1HF 3H5UA 1OSCA 2V8DA 4C8ZA 1X31C 4Z7YA 1BGXT 1NJID 1M5VC 4ZP8A 4KM8A 4Z4UA 3FK4A 5IP9C 3G2XA 5IV3A 1X9WA 2XLKA 2NVXA 5EN1A 3CD6B 3PO4A 4ED6A 2IRUA 4Y7NC 3RG6A 4KTQA 2EKYA 1RAAB 3OXFA 1KLNA 3OXLA 3HT3A 1FJGF 2X0KA 4XOPA 4DU7A 3E1YE 4KKSA 4OYXA 3KK1B 4OINA 3KMSA 4OZ3A 1OO0B 3RRGA 2CK3A 2AZ1A 2WTFA 4QV2A 2GQ2A 4WCEQ 2MGZA 2E2JK 4DV1J 4HIZA 2F1MA 5E0OA 4C3JC 1Y11A 1RTIA 2DXEA 4DL7A 3CULA 3DFEA 4XM3A 5J2QA 4X64J 2OBSA 3PXGa 2JVOA 3ONUA 3SZYA 4NBSA 4P3IA 2ATCB 1KLMA 2OPSB 4U8YA 3HOUK 1TWAA 2W2MP 4PKDB 2IC3B 5TRDA 3TTGA 4B9NA 3M30B 4NLTA 2JZ5A 3UNGC 4ALZA 4DUZJ 3KK2B 3UCZP 5IOTA 2W24A 1SIWB 3RBEA 3D54A 1Y5NB 4KC6A 4A3JK 2RS8A 4PAAA 2A2CA 1C1CB 1TWHA 1GMWD 3SSSA 3VAGA 5F0WA 2JA6K 4NRTA 2XMMA 3DLGB 2ACYA 5M5WK 2MQLA 3GJQB 4EYHB 1D1UA 1VQKS 2E1RA 1PILA 3G4SS 5AXMA 4IUFA 4B3SF 2E1AA 3ICLA 3QJLA 2ZBUA 3VAFA 4B48A 4PABA 1IKWB 4FYVB 4DSLA 2LEBA 1HA1A 1N52B 3M8QB 3HVAA 2PPBA 1X4BA 3VGSA 2YWGA 4WKYA 4N7TA 5IYBK 4DZ6A 2ZH7A 2DNRA 1CC8A 3CC7B 1TL1A 2F3JA 3MXHP 1IN0A 4U7CA 1RXOB 3VVTA 2OEKA 5M3MK 2HLDA 1GTHA 1HQEB 4USMA 3BGLA 5KG3A 1S0MA 4Z4ZA 1JKHB 3K5MA 2XYGB 3DGPA 2YPZA 5DRKA 3IAS9 4E0FA 5FO0A 4M5HA 5KFPA 2R42A 2KZZA 4WU3A 4XTTA 2R8GA 1QGYA 4NXNJ 1J6XA 4LVNP 1TL3A 2W2OP 3SZZA 2OTLB 4N56A 2ZZFA 1VQ5B 1WD6A 2KTQA 3EGVA 3BKFA 3I31A 3F44A 3R7NB 4YR3A 2BOPA 2LU1A 1RAOA 1WC3A 2B43A 3FQLA 3M4OC 3GTOC 3N79A 3M8RA 4P7TA 1C0TA 5E6TA 2R2TA 2E2IC 3G4CA 3CCMB 3VNVA 4XQFA 3PW5A 2ZZMA 5G0RA 3MM5A 4DL4A 2D9OA 3IM9A 4DHVA 2H3EB 2MGZB 1N32J 4Q7JB 1RTIB 4IH7A 5U47A 2G1HA 1U6BA 2H5IB 1S9EA 1V3ZA 2W01A 1UL3A 3BYRA 2BE7D 5EX3A 3Q39A 4CI0B 5GAHU 4DCOB 1UEVA 2PIIA 4WQMA 2Y1JA 3I4HX 4MKAA 2ZHBA 2BE2A 3AB2B 1MW7A 4OPOA 2CNKB 2C4TA 1WTFA 3NCPA 3GR1A 1RQ0A 4DV0J 3HD2A 2E5HA 2FGOA 2LDIA 3I55B 4PXDA 2RRNA 2BUNA 4KHRA 4U7UK 3M6VA 2LDYA 1I3OB 4Z4SA 1M5PC 4OIPA 3O2IA 2FLPA 4LBPA 5CZVA 2D74A 1VC6A 3FBFA 4LF6F 3QFRA 1X4GA 2VFUA 2RIJA 2RNEA 3ETOA 1N5VA 4UW2A 1WJ9A 2X1AA 5IYCK 4A3DK 3RW7A 3J7YI 4LSZB 2IYGA 1IQTA 2EK6A 1MG7A 2FPHX 4IW3B 2BE9B 2XLJA 1MRZA 2E1CA 1BMQB 1NBEB 4LR8A 4D3HA 5ETKA 1TL1B 1REGX 4XDDA 4N3NA 4AF7A 3MUVP 4QR2A 4ZPBA 5IC6B 1HARA 1RT4B 2P3MA 4YEJA 1WKJA 2CIMA 5DM6Q 4G7WA 3KLEA 3L4BC 1S5ZA 2W9BA 1BE4A 2UU9F 4FK8A 3TR5A 2UXBJ 4KY3A 1S1UA 3T1YF 2ZDPA 3L3CA 2MKCA 3EGWB 4P2SA 3G96A 3PX0A 2RQ4A 2NVXK 3IS9A 2FJDB 1HMVA 2HZVA 3WNBA 2R2SA 2L3MA 1ZXOA 3MCMA 3PW0A 1WNEA 4YFXA 1NB0A 3L7PA 2M8DB 5HJYA 3VGTA 5J2MA 4USJC 3OLAA 1S12A 5KFEA 1AB4A 1C0TB 2NLWA 4DK0A 3Q22A 1N5QA 4A3FK 1LFPA 5DO2A 1KVIA 2UUCJ 5B0AA 5G0RB 3MM5B 1EZZB 2ZWOA 4QWAA 4PQUB 4PWWA 4F3MA 5L9NA 4M1XA 2HVDA 2MSTA 1H85A 1N33F 2E66A 5HZBA 1S9EB 5JFEA 3QWUA 4FXDA 3CJTA 4RW8A 5TR9A 2IAJA 1TUIA 2J8SA 4LR7A 3IXQA 1URRA 1PYSB 3KLVA 1B0PA 1VK3A 4WWVA 1VQ9S 1F93A 2BE2B 3NCQA 1IBMJ 2QEXS 2R7SA 4OZ1A 2HW3A 1BXNA 1QD1A 2UVWA 1R0AA 3Q6RA 4ATNA 1YK9A 4ZP6A 5E3PA 3BBFA 4DN9A 1YWXA 1S6OA 3MI7X 3N6MA 2NS1B 3BCFA 3NGRA 1SVDA 5ADZA 2MMYA 2XCPA 5THWA 1UFWA 4ZVFA 3QX3A 2D74B 4TVAB 3GSIA 4A93K 3CD6S 5KFNA 2WAQL 1YVFA 2R7QA 5A6WA 5TMFA 3M8ZA 5K9FA 1NHVA 3TEHB 2DNOA 4WBFA 4GKJJ 3NMRA 1E63A 2HVHA 4CLKA 3LO8A 1PG5B 4L75A 4P6YA 4R8UA 4LFCF 2V4JA 1ZOTA 2IFXA 1VF7A 4NLVA 1SCJB 4A4JA 2DGXA 3CMAS 2VH7A 3W8GA 3S1TA 4Y2KA 3KLEB 4WE1B 2EK1A 1P1TA 2W9BB 4ZVUB 1RHQB 1L3TA 1WC1A 2E2JC 1RLCL 2C2OB 4E0DA 1H7WA 4Y65A 4P5BA 4OI6A 2ABYA 3QO9A 4RX6A 2P5VA 3IS9B 3MEGA 5HN0A 3FEXB 3LOUA 5IP7K 1HMVB 4GVLA 1AZSA 4J9SA 3EWGA 2R92K 3VAJA 3BNWA 3CMEB 3M8YA 4DV1F 1Q78A 5J2MB 2XNRA 2V7VA 3H0GA 1FRHA 3DU5A 4UOCA 2QL5B 4OMFG 4X64F 4ILMA 2L41A 5M2UA 4KO0A 3CPWR 4A3JC 1RAHB 5IYPA 4QPXA 1V6HA 3DC2A 2R7ZA 1N54B 5IQQA 1X4AA 1QAIA 2RHSB 2AEMA 4FN5A 1C0AA 1B4SA 1GAOA 3QLHA 4DUZF 1E1RA 3T53B 1VQLS 2K7KA 4F2SA 3VGVA 2O1PA 1BJKA 1QUVA 4RW8B 2IAJB 3MTKA 1HWIA 3CC7S 3S15K 2NVYA 2JWNA 5DG7A 2Y1IA 1BWVA 3NGUA 1RWWB 3EICA 4AUKA 3LPYA 3GR0A 1ZTTA 1Q79A 1Y5IB 5J1NA 5F8GA 5E3QA 3W5VA 2B9EA 3LUYA 5IYBC 3W9HA 4ZPTR 2XGJA 4A3LK 4YB6A 2C5HA 3OTEA 3N28A 3W66A 4FKXA 3EZUA 1HW9A 2VPXB 4U9UA 3GFHA 3HD1A 1FNDA 3OZUA 4MJKA 1FF2A 4TYAA 3K8VA 2DNHA 3OUYB 4A3IK 3D0GE 4WZTA 1NPPA 2YU9A 2BW7A 1FTRA 2EW9A 1FCAA 5FLMK 4UZUA 4RPFA 2G4BA 5JJBA 2OBRA 4URSA 2ALYB 4MQ9A 3OD2A 1NK7A 1I6HC 1P1LA 2QDXA 1E1QA 4LQ3A 4R8UB 4DG1A 2V4JB 4X06A 4OYPA 3N5FA 4A8YA 3DDIA 5CA5A 3MEEA 4PWUA 2EFVA 2KT2A 3OVSA 4KC5A 4NXNF 3RGIA 1VC0A 1KSPA 5IOLA 2XGQA 3BH4A 4QWCA 3FGVA 4RNOA 3T6BA 1RAIB 4F7VA 3KJVA 4C0HA 4IQXA 3MPUB 2DCUA 1OGIA 3TA0A 2OJ3A 3QO9B 1MROA 2R93K 3SCIE 5B0EA 2NPFA 5H59A 5E2QA 3MEGB 4ILDA 3LANA 1Q95G 3NUHA 3AJDA 4EI2A 1QAJA 4B02A 1AZSB 1UEKA 1L3SA 1RSCA 3MMBB 4OV6A 4QIVA 1QSSA 2KYZA 1N32F 2IIHA 2OFHX 2WPDA 1VLYA 2RUGA 5ETMA 2ZL6A 1PGZA 1T9TA 5T41A 4DL6A 2ZL7A 5IYWA 4PG4A 4WXWA 2JEIA 2JDJA 4B17A 5DJBA 1Y1WK 4XLCA 3MEDA 2WAQD 4B9TA 2HMAA 3TQ1A 2R8KA 5T14A 4ZVSB 1UCNA 2EBGA 3FKIK 5HMWA 2IBKA 4WWSA 3WY9A 4XSZA 3QLHB 1IKXA 3W5XA 1DQ9A 2R7VA 4XLPA 5CHPA 4CT8A 4ZH4A 1NSAA 3UD5A 1EIYB 4A3DC 3A35A 4IRKA 1E6VA 1XIQA 2VIHA 4FF3A 1J98A 2LA4A 2UVRA 1X9MA 3OT9A 4DPUA 4UZBA 4LJMA 1L0WA 5D6GA 2ILZA 4RD0A 1NK4A 4G7ZA 1P9QC 1KD1D 4OFZA 4KQZA 1U4BA 1WKLA 3FJOA 3FBEA 4Y9RA 3VTIA 1O24A 1TU0B 4DK1A 1U0SA 1J6WA 1U2RA 2F8MA 4ZN3A 2AGPA 2CA9A 3OOCA 3OEEA 1AUSL 3A8KA 5KOXA 4L3NA 4B08A 5ETNA 2K3IA 3AVVA 1X4HA 2NVXC 1UVKA 4NCNA 1RACB 3I4PA 2ZBCA 3H40A 5KFUA 3GIRA 2VL1A 1JLCB 1XNRJ 1VJQA 4DDFA 2UXBF 3ZTRA 4DG1B 1R8HA 2EC0A 2QZ8A 4RDJA 1E79A 3J7YU 2BVZA 3MEEB 4BDPA 2HWHA 3Q8RB 3VCDA 2E1PA 1X4DA 1R27B 5LSOA 4A3FC 3S1MK 2MJNA 1LFWA 3SV3A 4WP8A 3KJVB 2GJRA 2DCUB 4L3KA 1F2HA 2C3MA 1UW9A 3UDVA 1I50A 2AIRB 4OZ5A 1CJUB 1WKKA 1FTCA 1TWAC 1B4BA 3HOVK 2UUCF 2DOGA 4RW4A 2CDQA 3HT0A 2B63A 1CQMA 2N4CA 2KU7A 1TWCA 3S7RA 1ELOA 1S79A 3WBZA 1REVA 4U6PA 2MXYA 2RH3A 4P2FA 4ZVRB 4CLPA 2QLJB 3PVDA 1XN9A 2BJDA 1YBUA 2O01C 4ELTA 3KG0A 5HATA 4DQSA 1LWCA 2CPDA 3W9JA 3A3NB 2BJ9A 4ZGNB 3R7SB 2UUAJ 1RTDB 2B56A 1IBMF 5C25A 1SV5A 1IKXB 4A93C 4PCQA 3TOQA 1X7VA 5KFIA 1JLGA 2XSJA 3MOJB 2CAJA 4DLEA 1EFTA 3DLKA 4KHMA 1DZ5A 1S4EA 1E6VB 3Q3AA 4U96A 3JSMA 2BEFA 2OPQB 5F3ZA 4MEXA 1U49A 3NRBA 1UD8A 2BM0A 4RNNA 4A3BC 1FEEA 3VA7A 1KS2A 1UD6A 4LF2A 1S72S 3KXDA 4GKJF 2OK7A 1KKHA 2EBBA 5J2PB 2ERRA 1CJVA 2PMZD 4OX8A 4FWTA 3V4GA 3EZ5A 3T19A 3PX6A 5JUMA 3G8TA 1CULA 2ZZGA 2BKOA 1NDLA 3NOCA 2X85A 3CMES 2D9PA 3CCVB 3PO5A 2WHOA 1YRTA 4X4RA 4RCZA 3W65A 3F73A 3DLHA 1R9TK 2RILA 4PC1A 1NK0A 1RADB 5IP7C 2VB6A 2VZLA 4AL6A 2Z6BD 5EDWA 2R92C 3LO3A 1KC8T 2DR7A 2X6YA 3T5LA 1U6ZA 2YKQA 1SH2A 1RWKB 2XCQA 2ROGA 2CWKA 1QLNA 3VO2A 3ITHA 1MABA 3MAAB 4IDKA 4QUZA 5KFLA 1U1NA 1XNQJ 2J0SD 1M5SA 2E9ZA 4XL9A 2DNQA 3VAKA 2Z0GA 3R2DJ 1DRZA 4ELVA 3HOYK 2ZUGA 3ENWA 2WVEA 2F9DA 2LP4A 4NCGA 4XAKA 4YUDA 3D1OA 2KJWA 3BYPA 2DIVA 2XMVA 2IYIA 5IT9Y 2XNCA 5L39A 5KFRA 3S15C 1NJZA 1FE0A 2BACA 4CLFA 2W4CA 3RR7A 2MZ1A 2WVCA 3GEHA 4P1VA 1J5OA 1Q0NA 5DSZA 4PPZA 2A6HA 3H9NA 1T0TV 2DR6A 3DXJA 3EGZA 4ZV4A 3EZOA 3U27A 4A3LC 2I38A 4F02A 5TY0A 4P6VF 2LEAA 1CNEA 2DGQA 3I4NK 4C3HK 3LWMA 1KQKA 2MZQA 3JQQA 5AT1B 4NLXA 1EK8A 4K4UA 3AT1B 5C25B 4TU7A 1SV5B 2ADCA 3H5SA 3G71B 1TUVA 1UWBA 5FDLB 4A3IC 3CCQS 3HSGA 3DGVA 3UN2A 4C3IK 4XPEA 1JLGB 1FDRA 5HKKA 3OZWA 5CYQA 2XSJB 3NMAA 1FE4A 5AXNA 2NXNA 5M3FK 3VWSA 4A3MC 2HWIA 4MK9A 4V19X 4HTIA 2IA6A 1IBAA 3RUBL 2RQCA 2A6OA 2Q6CA 4KIAA 5IYQA 1ZZNA 1S6QA 3S17K 3JSMB 1W25A 3IWNC 4F3QA 4JI1F 2LLZA 2UV8A 2XY5A 2FJEB 4DQLA 1NEEA 2CNLB 3LGMA 4D3GA 2MSSA 3ET6A 4JUZA 4GC7A 1VQ8B 5KFYA 1CJVB 5AXKA 1ZTWA 2ATLA 1HNZJ 2F5GA 4CH1A 1CULB 2C42A 4ZK7M 2YWWA 3Q89A 1BQXA 2VPWB 1YHQB 2AEFA 5ETPA 1E3XA 2Y8YA 2RT3A 3BEGB 3Q8PB 4OOXA 3H90A 4J9MA 1I3QA 2BN4A 5HL7Q 2KVOA 3D3CJ 1QY7A 5C5JA 4WFBQ 3S16K 2FC8A 4RD1A 2QV6A 5C7PA 2KHDA 4KMUA 4WP3A 1YCLA 4IDKB 1MN7A 2DHAA 1O29A 2AQ4A 5AE2A 2O5IA 5KG6A 4OOVA 4DL3A 1HHQA 1UPMB 2Q1LA 2R7RA 4M4SA 3CD5A 2ZH6A 1MSWD 3GTYX 4X66F 3FKIC 4A8OA 1WC4A 2DPIA 1BLIA 3W9IA 1I50K 5FJ4A 4NCGB 4G0VA 1INNA 4U8VA 1S57A 1YDLA 4CH7A 2W2NP 3R1HA 4K5SA 4YFKA 3QRPA 3PW2A 2B63K 5GAEU 3W63A 3TUPA 3GWCA 2VNIA 1J5OB 3B4DA 1GMVA 3U2QA 1XXAA 3U02A 4ZVPB 4ELUA 2ZH1A 2EXUA 3KG1A 2HHUA 4DR3J 1BQNA 5E3RA 4LSLB 2EFGA 4XR6A 2KZMA 3D6FB 5G4DA 4A8XA 3Q8UA 1RTHA 1UTAA 1EFCA 3NKYA 4B4DA 1V5IB 1DTTA 3IBFB 3R27A 3GMGA 3QFCA 2AF6A 2VQEJ 4X4NA 1UWBB 4CM0A 2HQCA 3W7BA 4BBSC 4J90A 5CYQB 1MNEA 5AE1A 2ZFZA 4DF4A 2V63A 1JJHA 3W3SA 4PG7A 4YQWA 4JV1A 1VHEA 2QTWA 3ULHA 2B7BA 1AMOA 1OQ3A 2HQFA 4OYBA 4J3NA 3K0JA 5IT0A 1UPPA 2LQ9A 1S6QB 2RF2A 4BY1C 1EJ7L 2XTJP 4IYQA 4RBUA 4KV8A 3KLHA 2CDRB 1OQ6A 1NDKA 4KKOA 2AJ0A 1Y1VA 4JV0A 4F4YA 1U6FA 3PIPQ 1RJJA 1EWYA 1TAUA 2NUHA 3V76A 3ET6B 4NCBA 4X0CA 4KAWX 4J9KA 1GEHA 1C1BA 2DERA 5KFXA 3DRXA 3SXLA 2D3ZA 1VBKA 3ZTSA 4DX8H 5IOQA 2G0CA 2NR0A 1F9HA 1YTYA 5CDFA 4OPVA 3PEJA 1U24A 2CKWA 5CD4A 1R89A 3D68A 4XORA 3I5BA 3KTQA 4GTCA 3U1MA 3HSDA 2O67A 2PT0A 3P5BP 4JP8A 4EGLA 4KMAA 4WZMA 3H0GC 4J9LA 1NJXA 1CNFA 5K14B 1OY8A 3OLBA 1WHVA 2MZJA 3I56B 4OHVA 2A2DA 2RJZA 3FFIA 5IZHA 1NK9A 3GVLA 1NKCA 2B5JA 4C11B 3QYYA 3CCJB 4LF4J 4WF9Q 1UA0A 2DXFA 2YVSA 3QT5A 1JJCB 2XCAA 3AAWB 4P2XA 3NGDA 1TFYA 1EI6A 1WIHA 3AGPA 3KLFA 3NS5A 2M4MA 3HVWA 1RE1B 1P6TA 4Z2XA 2BBEA 4CZCA 3CTRA 3W2IA 3UR3C 4MFBB 2A1BA 3GTGA 2HRUA 3N0BA 2QLWA 1VGXA 2R3VA 4IFVA 2POKA 1SKUB 2UUAF 4NLYA 4P74A 2W6IA 3O6QA 3RRKA 1BQNB 2DNMA 2V6SA 1TUGB 2YWKA 4A8SA 1SH0A 1EETA 1RT3A 2PSZA 4ZLNA 5F9LA 3PA1A 5KFWA 1RK8A 2BYCA 1JVIA 2PMWA 5AXLA 1S9FA 4NLUA 1RTHB 1WORA 1SL1A 1DTTB 3CD7A 1NK6A 3CRZA 3HAGA 1EKRA 3AJ1A 4OYWA 2AP6A 2Z2YB 4Q8FA 2WSSA 4CO0A 2EFQA 4OOSA 1YJNB 2ADBA 3O5TB 2FY8A 3EGNA 1LQ9A 2YU9C 3KNAA 1DBDA 2FQOA 1R0CB 3IGVA 5MLCV 2EBEA 2DR9A 1RQRA 2MTLA 1H38A 3QT7A 2WW8A 1R9TC 2M5SA 4DQPA 4ID5A 3OHAA 4YB1P 5I3PA 3QIPA 4ZJLA 2ZVSA 4KV8B 3KLHB 2GVDA 3NS7B 4L73A 3H98A 3BO4A 4KKOB 4URGA 4CNZA 3SEOA 1KFDA 3CP2A 2BKNA 5K20B 3H3VD 4ZLLA 1RTJA 2FLOA 1KQ4A 1HHTP 5DLFA 1L3UA 1KZLA 1JNZB 1C1BB 1F2GA 3W2VA 1VOMA 1SC1B 2GVZA 2BSAA 4DFKA 3R9LA 5KFKA 2MY7A 3MUTP 3HOYC 3GYNA 2X3DA 3HI9A 3BSCA 1IWAA 4YAUA 4UY85 4LRBA 9RUBA 2R8HA 5M5YK 2N82B 3AA9A 1QSLA 1JNYA 3FC9A 1GMWA 3OR2A 4BKWA 4OIQA 3MPYA 5TJ3A 2MKHA 4XD7A 2JVRA 1TLLA 3A13A 3BV8A 2RH6A 3H2VE 2X3UA 4KARA 1HA3A 1NJWA 4KB4A 3FFIB 3RZOK 1H42A 3K5PA 2J8AA 2B5JB 5IWAF 2E5JA 4GO5X 4X4QA 1VQYA 1U1RA 3AOBA 2FVRA 1Q7YD 3BN7A 2J6UA 5LMNJ 3C3LA 3I4NC 4C3HC 4PQAA 1LWEA 4QBUA 4YR0A 2X3GA 1M90T 3KLFB 1FO1A 2E5IA 5C2CA 3EDQB 4UUWA 3DOKA 2C2NA 3S14K 3KLGB 4C3IC 3BGUA 3MFIA 2DNGA 2KB2A 4KGXB 2QTLA 3UCUP 3ETMA 5DG9A 4I2QB 4LIWA 4O23A 4IFVB 3GJSB 3EXCX 1VQ8S 1N05A 1HBUA 3EVOA 3JQMA 3JSBA 4NLQA 4G1IA 1EETB 4ED0A 2LQBA 4F4ZA 5E3CA 2BQRA 3PR5B 1YHQS 2E2HK 2L9NA 1IKVA 5B08A 4X07A 3GU0A 5DDQC 1H73A 2D1CA 3E20A 4KN4A 2DY1A 3MHPA 5IORA 3N01A 3VV2B 3HPOA 3VR1A 2F43A 3QFHA 3OQ2A 3B78A 4NL5A 4EBDA 4P2NA 4RW7A 2R8IA 4KKTA 3M2VA 2M0GB 4ID5B 4R71A 2HWTA 3MFHA 1SQFA 3QIPB 1CC7A 1HNZF 2VC1A 3S16C 3PJ9A 3KDNA 2GVDB 4AYBL 2DGSA 3OR1B 1B7YB 1JLAB 1RTJB 1YBTA 1SH3A 2PC6A 1VQMS 3P3DA 2HBYB 1JXLA 3OEPA 2MEWA 1N8RT 3F56A 4NYPA 5IYNA 1VFJA 2GAHC 1JJ2R 3W2VB 2GVZB 2D3OR 1HD0A 3TYTA 4I6YA 2R7OA 3EQLA 2CPHA 1EHWA 1WG5A 4QWEA 1K8AT 3CC4B 1I50C 2ZJPQ 1UD4A 4Q2MA 3D3BJ 4CLWA 2JEJA 1WOPA 1G3OA 3S1QC 2W9CA 4OJ1A 1HNWJ 1XJWB 2BRLA 4DX6A 2QT7A 3M32A 3K89A 3CCSB 4ZCLA 3OR2B 1S6UA 4FYXB 2B63C 5LM7E 1VQSA 4RU2A 1TWCC 1TKXA 2HRTA 4AVZA 4K4WA 3HKZD 1KRHA 3D4JA 2QL7B 1FKPA 4XNFA 2RDJA 4F50A 4QYZJ 1Y7PA 3VO1A 2ZZQA 4EYIB 2YKNA 2IVFB 3J7AN 4PZVA 3GTJA 5B0BA 1N34F 1RAFB 2B9YA 2G2OA 3DMJA 4C45A 4B3GA 4EWTA 3T3FA 2OH2A 5B0DA 1HD1A 4WXOA 3M8SA 3P6YC 3TJ8A 4DR3F 3ILLA 3OTCA 3DOKB 1VQPB 1UP1A 3FHZA 2DNKA 3CCRB 4P12A 4YP3A 4ED7A 2A18A 4KGKA 3F0NA 4AF6A 2OPRA 4X84A 4A3GK 1DDIA 2M70A 3I87A 2HHHJ 1HR0J 4Y2AA 3QPIA 4QFMA 4ED2A 4KB2A 3EX7B 1VRQC 2D9RA 4ED3A 1HBUB 3NWRA 3NXZA 2VQEF 2DJWA 3BR9A 3DLJA 3HOZC 3J7Z5 4YR2A 2LVWA 5THXA 2VJVA 2VU5A 5CH7B 2H65B 1FX2A 2OIHA 1DD5A 4FVCA 3UW1A 1IKVB 2YXLA 2PO4A 3RAQA 3ZPNA 3CMMA 1VRTB 4C3MA 1NPRA 3MM8B 4G1PA 2CFAA 4L6V3 2HAFA 4MYTA 2XY6A 3VZIA 5KFTA 1FFGB 1AFIA 5T7LA 4KH1B 3I56S 1WC5A 3T9ZA 1MWYA 4RW7B 3M2VB 1T7PA 1JB0C 1PAEX 3OBIA 5H9FK 3VQTA 2M7SA 1CJKA 3PJWA 1NJIT 4PUOA 1S7IA 3DU6A 2AGOA 3CCWA 2C2MB 5B0GA 4WFZA 1W87A 2ZC4A 4C48A 4FP9A 5K5MA 3QRRA 3MMLB 3KJQB 3RBDA 2IVMA 2WVDA 2VPZB 1Y0HA 2MZRA 1S6PA 3CCES 1J9ZA 2DEUA 5JVOA 2PFFB 1I51B 2V8VA 5A0YA 4BLAA 3S2HK 4GVBA 2MYFA 2W9CB 2H5JB 5KNLA 2RVJA 4LF4F 3M32B 4LSNA 3QNWB 2RKIB 1FX0A 2CPIA 1BY9A 1QG0A 4DWIA 1TKXB 3G6YA 2J7UA 5H9EJ 3CW2A 2Y1LB 1UJ6A 3PJXA 1N07A 2G2YA 2LYVA 3M2UA 5EMNA 3U1NA 3A4TA 2YKNB 1USMA 2JDIA 3PYGA 4FDFA 1SMYA 4B3OB 5DGBA 1SUQA 4X4PA 1S1WB 1KK2A 4B3MJ 3DMJB 3AVUA 4DSFA 4P5AA 3G8SA 2FLNA 4BC7A 5D4NA 3W2WA 3K8WA 1YKWA 2C5BA 2ZBIA 1TKTA 1HI1A 2K1RA 3FMBA 3NGSA 1QFYA 3FEZA 3FZ2A 1PYOB 4TN1A 3TUJC 4AYBD 3ILOA 4ANCA 2OPRB 1SFOK 2CQDA 5M2PA 2IJNA 3L4JA 3PR4A 1RCXB 4GFQA 1R7IA 4F4AA 3OPKA 3HHDA 4JI4J 4K4XA 3LGNA 2VZ9A 4GTFA 2J5AA 4KH0B 2OK8A 2OSRA 1PBUA 3NOGA 2ASDA 3GV5B 1EFRA 5C4XC 2E29A 4O3RA 1VRUA 2Y0SL 5A8WA 1X4EA 4OYZA 5BYRA 3TAPA 2V2ZA 3HOXK 1T3NA 1EQRA 2PIAA 1XZPA 3JTNA 2QA4B 2RUSA 5T7LB 4IG0A 1DDGA 4DOZA 3EXYA 2V2VA 5KFMA 2RRAA 2E2IA 1WDTA 4RUHA 1ZBTA 2FLLA 3MM7A 2FTRA 3DHWC 2R2UA 3DXBA 4ANDA 1CJKB 1RHMB 4PUOB 3KKFA 4ILRA 3UQSA 1YNNA 2VFSA 2CQ0A 1PAUB 4EO6A 5GADI 4O4GB 4H4OA 1TL7B 3AQPA 2KM8B 3RZOC 4JMQA 2W4DA 1LW2B 1TTHB 3Q38A 2QN6A 4JI7J 1NZ8A 5KFCA 1D0EA 1GX5A 1X0FA 1S6PB 4YY3J 4XOTA 3DNCA 4RNFA 4ZKAA 4USIA 5A0YB 1VH2A 2DVIA 2V8PA 4NLRA 1ZAXA 5FA6A 2DD8S 2EKNA 1OYDA 3PVXA 4LSNB 1ZM9A 1SXLA 2BRKA 2UXDJ 1FJEB 1RHRB 4LF1A 3WIVA 2YPYA 2E9RX 2N3LA 5LMNF 3GILA 3U1LA 4GZYA 3LP1A 1T9YA 2JA7A 1K1SA 2VC0A 2IRYA 3PYFA 3PACA 1VMBA 2HK3A 3ZC4A 1EAYC 4X4OA 1F0XA 1NKEA 3M2UB 4WTYA 4MT1A 2ZDOA 3US5A 4LF5F 3DLEB 3M9NB 1OMSA 4I68A 2CJ9A 3H7HB 1SUQB 1P9YA 1FRLA 3H4DA 3JQRA 4TMWA 2AJ1A 2IDEA 3G8QA 4AQYJ 3PKYA 4OLOA 1SQGA 4PC7A 1FRMA 4ZLPA 1FRIA 2CRVA 2FD2A 3FOEA 2Z58B 4LUBA 1U09A 3W2WB 2ZH5A 5F4JA 2NXJA 1TKTB 2K1RB 3M7VA 1WI6A 2Y9HA 1URNA 2GQCA 2AWZA 5C44K 3W8PA 1RWXB 1YJRA 3HHNB 1FI4A 3L95X 1Q8IA 1ZA1B 3GONA 3KEWA 1X5PA 1Y1VC 4PEOA 2ZBRA 3CCUB 3HK2A 3RRHA 2H9ZA 1FJGJ 2YNGA 2B3TB 3DRPA 2AX1A 3D1QA 2F4FA 2E7XA 2OEMA 4L72B 5A8AA 3UR0A 1XXCA 4YDXA 2V8HA 4Y2MA 4CLZA 1RT7A 1VRUB 3GTKK 3CCSS 3OFHA 3TQEA 1CG2A 1EH1A 2JJ2A 2VG7A 2V4DA 1R5OA 1BMFA 1FERA 4MKYA 1IW7A 4Z4RA 3D26A 2ZL5A 4NI2B 3V6HA 1RWNB 2DNZA 2Y1RI 4IG0B 3IBCB 4P75A 3PV8A 2E9TA 2CG4A 2VBYA 2RS2A 1GAQA 2BX6A 2GMLA 4MKBA 2HURA 2GJ2A 3KUHA 3MM7B 1RT6B 3CDWA 4KPCA 4DQIA 5F8IA 1YGYA 3FDSA 2WB1D 2DHSA 4LR9A 3OW2B 4CYUA 1RAEB 1WEYA 4H4OB 4BXXK 1WF1A 1S77D 1VBYA 1B3TA 3FZBA 2W7PA 2FVSA 3J81U 4FYWB 1HNWF 1VQPS 1USOA 2QN6B 3M9MB 1TVRB 3CCRS 1XZQA 2WJVA 2IY5B 2LKZA 4RPDA 5GAGU 2H4WB 2L08A 4ECXA 2CW0A 2DO0A 1KP6A 1XFOA 2XG8A 4QWDA 1S0NA 2PD1A 3HHKA 4MKVA 3GTGC 4S0MA 3GTMK 1FT8A 3K7AK 3Q8YA 3PDNA 3LP1B 4X4TA 4WFXA 4KB7A 4OIXA 1APSA 3QFSA 1WU8A 2AJ4A 4RUCA 3GDZA 1R8CA 3M8PA 3M3YK 4E98A 4TNOA 4P6QA 2J7WA 3VQSA 1N56A 2GFFA 5HQ8A 1AB8A 4OYMA 1L3KA 3BKUA 3EUNA 4Y9UA 3GEEA 5LXYA 4ZPAA 4QVJA 5IYDC 1U45A 1YRUA 1UFKA 3PX4A 2B9XA 2NVTC 2CJBA 3CUNA 1Q81T 3TWZA 3MMAA 3DDKA 1LEOA 4IRCA 1JMTA 1YJ9S 4M8LA 2A3JA 1YIJB 3H0PA 2XMTA 3QJJA 3ASRA 2XZLA 2G13A 5HL8A 1Q7LB 2YKMB 2YNGB 3DRPB 5KFAA 3HHLD 3A8EA 3LWLA 3E51A 5B09A 1HQ2A 3BP8C 2V7QA 3CIZA 3PYDA 1RT7B 2Z8QA 4M1KA 2CJXB 2OD4A 4C3LA 3OL6A 2VG7B 3IAM9 2KHCA 2XI3A 2NSCA 1YG0A 1GAWA 1RHJB 4IKAA 3FCHA 1O2FB 2AT1B 3BCDA 1XBWA 2ZH3A 1LOUA 3IRWP 2BZ2A 5DGAA 5DETA 4GTDA 1KEKA 2HHQA 3THTA 2QE7A 3JU4A 3LAPA 2FIUA 1FVSA 2ALZA 2C4UA 3OPFA 2GZOA 2VA3A 1LW0A 2QMXA 4XKVA 4CYUB 2YX4A 2JA6A 2JC0A 2FQTA 2CNDA 3TZXA 3RB6A 5KFGA 4NEZA 2C2ZB 1XZQB 1UWAA 3JAMU 1S0VA 2JL9A 1OB0A 3SQGB 1B7FA 4XMYA 4BWMA 3TEGA 1RZMA 3WX4A 3C6UA 2V67A 5F8JA 1Q9SA 3U6BA 2QGGA 2MPUA 4LF6J 1FNOA 2Q6BA 1ULRA 3Q86A 2VFVA 4Y3CA 2P5MA 1S7HA 3JSTA 1FNXH 4B3MF 1SFOC 1JA1A 3UWTA 4F2RA 1YJVA 2CPZA 1SJRA 1GR1A 1YX2A 1U48A 3HULA 2BQ3A 2BABA 3M8PB 4I6AA 4LRCA 5F8LA 5BSYA 4DUYF 5D4DA 2FUG9 4C6AA 1FJ7A 2JLGA 4MTPA 1RU2A 3CXCB 2HG4A 4QW9A 4ED1A 3RY8A 3SYZA 3OFEA 3S2DK 2OD6A 4U9RA 2WBRA 3GFYA 4JI4F 1ZUNB 1IJFA 4Y2CA 7FD1A 4FF4A 3BPSP 3MMAB 3ZNUA 1CPZA 3H25A 5M5XK 2OI2A 3HFZB 5BXIA 1YJWS 4CP5A 4NXMJ 1ZH5A 4K1XA 2BOAA 1F20A 3R5CA 4XPCA 3Q8VA 2CPFA 2R7UA 4YAFA 3W2GA 1W26A 2ZM6J 2X53S 3B54A 4C8MA 2XMWA 4MEYA 3Q6QA 1G2EA 3MR7A 1IVZA 4ZIWA 5L1JA 4EBCA 3V5RA 3P27A 1HWLA 4PYDA 3TFJA 1DJ0A 4UOGA 4F3OA 2CVEA 4DR4J 1Z1ZA 5HVGA 4DL5A 4JI7F 2HS4A 3PG9A 5E7OB 3CJ3A 3THPA 3QWPA 3BC9A 1H2TZ 2VPYB 4QYRA 1PBAA 2JA8K 1RUSA 1LW0B 4ZHRB 1SKRA 3EYZA 2J0WA 1DARA 3C8YA 1G1XA 2RQMA 4BY7K 3GTJC 4WKRA 3H2UB 2JC1A 3CCLB 3TA2A 4QIWD 4LK0A 2UXDF 3DOMA 2HZCA 1ZS6A 5GADU 3HVRA 1EFUA 2QFIA 3S1NK 1BX0A 2CQ3A 4CLTA 2CPJA 2R7XA 3POTA 1NXIA 1HNVA 2OPPA 1SKSA 2XMKA 5HROA 4YFNA 3OFFA 1RT1A 1WWHA 3BGRA 2KFYA 2XZPA 5HMXA 4DPOA 3H42A 5CXTA 2WRMA 3CJ4A 2JEFA 4CIOA 3CB4A 3B4MA 4LFCJ 2DETA 1BLUA 1YNJA 4G65A 2OTJB 2EI5A 4X4UA 5FLXU 4DSEA 3ZBTA 5C42A 2KYXA 3KHHA 1CEZA 2HS0A 2VBSA 3D6MB 3MCAA 5KFJA 4ZN1A 1F9EB 5FIIA 2DPJA 3IC1A 3AJ2A 2N7CA 3RW6A 3NCRA 3GTKC 1WG1A 1FWKA 4IO1A 3UN3A 5DQIA 1CQNA 1KD1T 2F1FA 3CDEA 1HBMA 4GT9A 2NV4A 1IJFB 2JA5K 1GH8A 1HI8A 1TR0A 3MMCA 1SC4B 4FF2A 3IR7B 1R8AA 5FJ8K 1DY3A 4UUXA 4F26A 1PSDA 5HO4A 3IBWA 3PY8A 3I0RA 2LQ8A 1G6BA 5D15A 1T8EA 4DMZA 1T6XA 4U67Q 2OFGX 4ASUA 3K58A 4YB5A 2KM8C 4YEAA 2FZCB 1NJYA 5RUBA 5JXSA 4ZVTB 2FVGA 3IGNA 5I3UA 2VASA 2GJFA 1KR4A 1TTTA 2KN4A 2RAQA 5K8MA 4UZFA 1C4AA 4O3QA 2B4OA 2PA3A 1PC4A 4DS4A 2EEYA 1ZPVA 3CSKA 1KRPA 4CM2A 4G3IA 3GTQK 2HHXA 2VFTA 2HVZA 3QAEA 1TKDA 1KOOA 2ZZNA 1F5CA 3K7AC 3CW2C 2DHGA 5KT7A 3OW2R 4W4MA 1IBCB 2V2QA 1KQSB 3BGFA 2MHEA 4DSKA 3M3YC 4RBTA 4OIRA 1OB2A 2VKZG 1VIXA 5EWEA 2F4NA 5B6IA 3MURP 4NA3A 2QX0A 1QTNB 2DIUA 4YAOA 3SSRA 4YB7A 3DOMB 2DR5A 3K5LA 3RB3A 2HHVA 2NREA 1XMOJ 1EP4A 3J80U 2QLFB 1GK8A 2V7TA 1VQ7S 2O66A 2MKKA 4TKTA 1NPKA 3LQEA 1V0EA 3O1LA 4ZP9A 2OPPB 2CXEA 5H9FJ 5HROB 2OYNA 3QFWA 2ZBVA 5EWFA 3GE9A 5HBMA 3W2HA 3BGRB 1TKZA 3AH6A 3BM7A 4ETZA 5HQMA 3I4MK 5A76A 1H3DA 4IOBA 1NHKL 3V7AA 2XZOA 4TMTA 3PRVA 4OZ2A 5C42B 1S1VA 2NCKL 3T5KA 4G0WA 1U26A 2A0FB 4PG6A 2PE8A 3QGIA 4RR5A 2WZNA 2XO7A 4ER8A 2GO9A 1HWJA 1N06A 3QIDA 2KXHA 3BDEA 2R92A 2HLTA 4DQRA 1KJZA 5EUHA 4N76A 3I32A 1HBMB 1VDHA 2BGJA 1R5NA 1IJEA 1WDDA 2XZDB 4LT6A 1KC8D 4OP7A 4YG2A 2G2ZA 4P3YA 4KFBA 2ZH8A 3HOWC 5JBQA 4O4RA 3TO8A 3I0RB 2GS8A 1T9WA 1H7XA 3RR8A 5GV8A 3CJ5A 5IM0A 2CJKA 2VKRA 4FVMA 4MIWA 2GMJA 5J2QB 3TVKA 1ISEA 5CQGA 4KSEB 4NLSA 3D2WA 2MQNA 3N4WA 4NWBA 4QHYA 1IWGA 1KLMB 1IM6A 5I3UB 4X62J 1SKYB 4I0WA 4DNRB 1B0TA 3Q24A 2LXUA 2ZVIA 5H1SV 2RU9A 3LPXA 3TANA 4DV2J 3TZYA 3J81j 3KHRA 2EC2A 2IM1A 1O25A 3WODA 2E7WA 3GIKA 2JA7C 4BBYA 2HHSA 2WJYA 4URQU 3SJPA 1K83A 4ZDNA 2WZ1A 1QVGB 5DZ7A 1T05A 5CABA 4MIBA 1YJ7A 1Q5VA 2CVIA 5H5JA 2V5HG 2F40A 2FGCA 4DR7J 2JJ4D 2DRAA 2KT3A 3KHGA 1ICEB 5KT2A 3MR3A 4QCLA 3HCXA 1HBOA 3B6BA 2X8KA 3A1PA 1U1MA 5DLGA 5L1KA 1EP4B 5FD1A 4JV2A 4I56A 2I0XA 1J6VA 4UF4A 2MQMA 1ZETA 2DH7A 3SLNA 3PCOB 4BLGA 1TQLA 3H5XA 1LWXA 3M2RA 3E3XA 2ZXIA 1S49A 1YSJA 4TMVA 2HHPA 5HBMB 2A6EA 4LFAJ 3GCXP 2NXUA 3TARA 1G7TA 3ZTPA 1EARA 2BJ1A 3MF5A 1SIZA 3DGPB 3S1RK 3SBMA 2BF4A 4X7CA 4Q0BA 3LH2S 3JB9k 4JK1A 4L76A 5KFQA 4BWJA 1S1VB 3R2CJ 4RNHA 2I2YA 4RLEA 3JAMY 2CRLA 2R93A 1XR5A 3OFGA 3T56B 1FA0A 1TL3B 2YH0A 2V68A 4I1TA 4QR0A 4DS5A 4NXMF 4V19J 1Y0RA 2ZOMA 2LQ5A 2HNDA 1U1OA 4K2XA 5J35A 1H8HA 3GZ7A 4IOCQ 4PXBA 1VHOA 3OJSA 3CQZA 5KT6A 2ZM6F 1D3WA 3PO3K 5JMNA 1GJRA 4KFBB 2VUMK 4JI3J 3CCLS 1Y1WA 1KOHA 2J9EA 2W25A 5D78A 4JI0J 4G1BA 4DLGA 3FKIA 5IM0B 3A8IA 2JA8C 4Y28C 1CS4A 5BYQA 2AJ2A 2L48A 4J9RA 3H5YA 1I6VA 2ZFHA 4DR4F 5FNZA 3W5HA 4HE5A 3A12A 1D2EA 3BO3A 3KDOA 2BJ8A 5FIUA 5FL7A 4EZ9A 1NU4A 2M2BA 4J9NA 2LA6A 2RC6A 2N3OA 4X6AK 1RHUB 2ASYA 4USKA 1E62A 2J0QD 5A8RA 1QFZA 3VAMA 4A3EK 2J0XA 2RDIA 4Y34A 2FZKB 1X9SA 1RI7A 6FD1A 2XO6A 2Z2ZA 3ENVA 3C46A 3AGQA 4NOHA 3S0XA 2P8IA 5M2RA 1NSQA 3WNDA 4YALA 3GIJA 2C3UA 2U1AA 2OBTA 1K73T 4FBUA 1M1KD 1VR6A 3FVYA 4Y52K 3T02A 4K2JA 3C14A 4HHJA 4DX7A 1I8DA 3OEHA 1BS2A 2JA5C 3M2RB 2C2KB 2HBQB 2FZGB 2UVVA 3R6JA 4K50A 3KUEA 4A3KK 2QC3A 1S1UB 4HT5A 2W2PP 3MCNA 4Q0BB 4Y6IA 4P71A 2CUYA 2P8TA 1DFDA 2FHJD 3HO1A 3WHIA 4DV3J 4X05A 3HOUC 1WCMK 1IB0A 2KWAA 2Q43A 3HZEA 5LJ5Y 3BDPA 1RCOB 1S59A 1VQ6B 5BYSA 4JI6J 4O3PA 3VVUA 4HYKA 2GV1A 3FSIA 3RZDK 4P9SA 2XS5A 4MYUA 2U2FA 1J2VA 3GTQC 4RD3A 4QOTA 2EG2A 5IP9K 1T02A 1RDRA 2OMLA 1NAQA 1K1QA 3LVBA 2KVIA 4Y7NK 4EH1A 3FNNA 2JA6C 2MDAA 5FLXY 2RC5A 3A3PB 2ZOFA 1NB2A 5SZTA 5CHCB 2GSUA 1WOSA 4DCJB 5CYMA 2CJYB 1VBZA 4M63A 3NE5B 4ZVOB 2FYXA 1BC6A 1OSDA 2Z56B 2V9KA 3R5BA 5J1EA 2BQUA 1HYSA 1U02A 2EWHA 5HSPA 1R0AB 4G7OA 3ISNC 4OJ3A 3QSIA 3I1FA 4OYOA 3KMQA 4QIGA 2HPUA 4RJLA 5C2GA 1XXBA 4F25A 1K83K 2V7WA 1T9UA 4Q43A 4MMOA 1PIEA 4XK8C 3M1VA 2AD9A 1XMOF 2QRRA 2OTLS 1VGYA 2FHOB 4AC9A 1XQBA 4C0SA 3I4MC 1VQ5S 4ZVQB 2W8LA 4JI1J 3CJSA 2VBWA 3NLCA 4W90B 4FM9A 5IV4A 2OGUA 5KOWA 2B7CA 1TZ0A 3D7SB 2YKOA 2DXDA 1AIPA 3CJRA 1R9TA 3W61A 2NXCA 3CCMS 1XC9A 4CWBA 4USTA 3VNUA 4P2MA 2ZXHA 2W7AA 4Y7CA 1K0VA 2LFVA 4RNMA 1HKAA 3C19A 2MKSA 1TMMA 2QA2A 3MCSA 5K8NA 1WSVA 3IO1A 2P9EA 3TUZC 2HQGA 1HVXA 2L9DA 1NB7A 2XNJA 3ZO7A 1VQKB 2HQDA 3G4SB 2HFUA 1R31A 4ED8A 1ZAWA 2NYHA 2PMZL 4KASA 4WYWA 2XZTB 3AODA 4NMLA 1UMKA 1XB2A 3QGPA 2KG0A 2KL8A 5HP1A 1I94J 3CVKA 4NCAA 1B23P 3I55S 3J80Y 4X66J 2QSWA 1Q5YA 3BJYA 2W6JA 1DTQA 2FHMA 3DRRA 1VISA 5HLFA 1XR6A 3KG4A 1YJUA 5AE3A 1ZM4A 1Q8BA 3CQZK 3GEIA 2HRYA 1ZZFA 5HZAA 1QUPA 4DBQA 1XERA 5ITHA 1VIOA 3T5JA 4ECTA 5D0GA 4TU9A 4KO0B 4Q8EA 2KKHA 4X62F 3GIMA 4XLHA 3SIPB 1XQIA 1HPZA 2J7KA 4DV5J 4P52A 4J0QA 4ECZA 3TJ9A 4DV2F 4WZQA 4HKQA 2KFNA 2NSBA 3ZNJ1 4EEYA 2AEJA 2FJBB 3H2LA 1QUFA 5CYMB 2ZH2A 1NNDA 3EJMA 3THVA 4II3A 4A47A 2Q6IA 5EHHA 1EB0A 1SJQA 4OI4A 4CLSA 1FK9A 1M90D 5IYCC 4NLDA 5CD4H 2OEJA 3EE3A 3HF5A 8RUCA 5J1EB 2PMDA 1UFLA 3K17A 1HYSB 2V4QA 2X6XA 4J37A 3MPDA 5KFFA 3AXMA 3N0VA 4CTAA 1N08A 4TXSA 4DR7F 2V2KA 2WSEC 4C7QA 2Y8WA 4O0NA 4QYZK 4F04B
chains in the Genus database with same CATH topology
1WOOA 1WSVA 4P9SA 3GSIA 1VRQC 4PAAA 5L46A 1WSRA 3AD9C 1WOSA 1X31C 3GEEA 3TFJA 2GAHC 1VLOA 1WORA 3TTGA 3AD8C 4PABA 1YX2A 1PJ6A 3GIRA 3AD7C 2GAGC 1NRKA 3TFIA 1PJ7A 3A8IA 1V5VA 1XZQA 3A8JA 1XZPA 1WOPA 3ADAC 1VLYA 3A8KA 1XZPB