3GIRA

Crystal structure of glycine cleavage system aminomethyltransferase t from bartonella henselae
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
361
Chain Sequence
SLKTLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALLKIGQSRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIALERVLLALQGPQAAAVLADAGLPGNELLFMQGFEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDITPDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFDGPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQRYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycine cleavage system aminomethyltransferase T from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 104
structure length 361
sequence length 361
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 3girA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 3girA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3girA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 3girA03
1V5VA 1VRQC 1XZPB 1XZQB 1PJ6A 3A8KA 1WSVA 1XZPA 1WSRA 4PAAA 1NRKA 3GEIA 3GEEA 3TFJA 3GIRA 2GAGC 4P9SA 3AD8C 1WORA 3ADAC 2GAHC 1VLOA 3AD7C 3TTGA 1YX2A 3A8IA 1XZQA 1VLYA 3TFHA 3GEHA 3GSIA 3AD9C 1PJ7A 1WOSA 1X31C 1WOOA 4PABA 3A8JA 1WOPA 1PJ5A 5L46A 3TFIA
chains in the Genus database with same CATH superfamily
1BHNA 4LRCA 3I4NC 3JQJA 1U1MA 4PXEA 2P2CB 1VK3A 3CJKA 3BQ0A 3RRKA 1XB2A 3FKIC 3CO9A 4HIZA 1YJ7A 4M5DB 3OJUA 2ROPA 3MTJA 5KFRA 1Y10A 2HFZA 5E2QA 1YHQB 3S6EA 5BR8F 1VQNS 5SZTA 3O2IA 3ILJA 4FK8A 2V6TA 4CO0A 2BSAA 2CIMA 2B43A 2IBOA 2ZZQA 4A3EC 3RB6A 2UUBJ 2XQCA 4CLTA 4GKJJ 2YNHA 2KRBA 3D6TB 1MSWD 1GAWA 3TZYA 2ZITA 3QT5A 2NS1B 2VPYB 4H9GA 1S7HA 2E1MC 5KFVA 2HVZA 4YR2A 3GFHA 3FJOA 4TY8B 2FY8A 1JX4A 2C77A 3PW2A 2DH9A 4MEYA 4B17A 3WBZA 3W2GA 1GAQA 4O4GB 3QAUA 2X6YA 4MKYA 4LJMA 2XLIA 3ONUA 4N56A 2MKCA 1YRXA 1TL5A 2FHKA 2VUMC 1T03A 3TQEA 2WR8A 2K8GA 2WSSA 2AQ4A 2IRYA 1FRQA 1WSVA 2EC2A 1I3QA 1T8EA 5IYRA 5GAGI 3BH7B 5F8IA 1TWFC 4DV3F 1DTQB 2CNLB 2PC6A 2DKOB 4CLPA 1AT1B 4ILLA 2GHVC 3WQZA 3TUPA 3KOAA 4RNNA 1KFSA 3NS6A 3MR2A 1D1UA 2ZL6A 1HHTP 3I32A 4YS2A 2GK6A 1F7UA 1LFPA 2ASLA 4DFJA 4GT9A 5ETSA 1CPZA 1YX2A 2MHEA 4E8UA 4N8OA 4X4VA 4UY8T 2CWXA 4X7CA 1MG7A 4NA1A 3R2CJ 2X7IA 2BANB 4ZA1A 3K8WA 4HACA 5CZVA 3IR7B 4N77A 5DG8A 2HFUA 4E98A 1BQXA 3T9NA 4WFXA 3ZNJ1 4DR3F 1K83K 3ET6A 2RMLA 1UV7A 2C5HA 3PY8A 3PFEA 4O3NA 2QSFA 3I56S 4ES2A 2KVIA 4U9UA 1RHRB 1LWEA 4RWXA 2IJRA 4BKWA 1JXEA 3AXMA 2BMBA 3PYDA 3JSMA 5DM7Q 1RP5A 3RRHA 5A8AA 3M2UB 4WFYA 5AE3A 1UTAA 3NWRA 1ZXOA 2DVIA 2X1GA 4WFNQ 1S6PA 4IW3B 3NGUA 3BP8C 4H4MA 2Z8QA 3KJVA 2JDIA 1K1QA 3P26A 4F4KA 2OFHX 4F0KA 1RT3A 4WJBA 4MFBA 4WQMA 3CP2A 2UP1A 2XNQA 2OLWA 3OFEA 2C2WA 1DARA 3R6KA 4P2XA 1DQ9A 2BOPA 3CCRB 1YNJA 3MPYA 4X62F 4G1PA 3S16K 1VOMA 2BF4A 1S1WB 3DDNA 1XZQB 2DYAA 1E62A 5DQIA 3CCVB 3P96A 5DSZA 3BQ1A 2GA7A 4Q43A 2RH3A 3BKTA 2E5GA 4ERDA 1J98A 6FD1A 4Z4YA 3B82A 1RT2A 3HKZD 3QFWA 3VQTA 4XR6A 1HW9A 5U47A 2LZJA 2QV6A 4DZ6A 2VKRA 3UO0A 1BQMA 1FX2A 4DU7A 3QIDA 2Q79A 4RD2A 2CQPA 3J81j 3RB3A 1Y11A 3FBEA 2ZL5A 2GQQA 2RF2A 1ROFA 3C16B 2V4QA 3CD6B 5D4OA 2ACMA 2CA9A 1BS2A 4X4TA 2WVBA 1PILA 3MEGA 2BABA 1QX4A 3K57A 2PO4A 1WC0A 1O6XA 2GREA 2XCPA 4C11B 2W2MP 1UMKA 2OH2A 3U1LA 3RYLA 1LWEB 3H59A 1ZA2B 1T5EA 1HQEB 1UFKA 1HI0P 1SJFA 3PVDA 2HPUA 2XI2A 4KDDA 4KMAA 3BC9A 4IOBA 4A8SA 3HOXK 5IYBC 1FE0A 1PBUA 4KBIA 4BBRK 1N8RD 2WAQL 4MYTA 1HBMB 4O44A 2YKOA 3UDLA 1VI7A 5HQ8A 2WJVA 5EN1A 2MB0B 3OVSA 2X1FA 3JTNA 1ZTTA 3VMFA 4BC9A 4G1VA 2VNKA 3A3PB 4IYQA 3JQQA 4NYOA 3KEWA 3JQKA 4CH0S 4J9SA 4D3GA 3S15K 4FZVA 2YPYA 4RLZA 3SBMA 1DTTB 4KATA 3CCES 4MT1A 3WDOA 3L4KA 1N88A 4Y7CA 3GQCA 1UA1A 3F73A 4QZVB 1IHMA 3KK3A 1VQ4B 3FRYA 4HR2A 3EX7B 3EXCX 1S49A 5HATA 1C0TA 2O66A 1KZLA 5GMKa 5E3QA 4QU6A 2J0QD 2J0WA 1R5OA 1HQUB 4B44A 3BKFA 4B3TJ 2HVIA 1F3FA 1SIWB 1FRHA 2HURA 1HI9A 1RWOB 4A3KC 2CZ9A 5IYDK 2RS8A 3T41A 1FJ7A 3CPWB 4ZH4A 1YSJA 1Y00A 3CB4A 2W6JA 4FKYA 4ECQA 5KFHA 1CJVB 2MXYA 1RUSA 1UL3A 2EKNA 3OP1A 4P1VA 1KC8D 4AE5A 1I3QK 2KYXA 1ACMB 3RBEA 1S1UA 1D1NA 1YKWA 2RKIA 3UNYA 3Q8RB 3FZBA 4Y7NC 1FKPA 3D54A 3PENA 2DRAA 2YKNA 3RJMB 2GIFA 4I56A 2J5AA 3FCWA 5DRKA 5K8NA 2VH7A 1XTZA 2B8PA 4CM0A 4O3SA 4ITSA 2RUSA 1NSKL 3HHEA 3DRYA 3M05A 2K3KA 4B43A 4WIIA 2Y0SD 2P3MA 2JA7K 2ZBUA 1HNZJ 3CCWA 4Y7NK 4M94A 3MR5A 4AF7A 3UDVA 3ASQA 1NDKA 4DV1F 4C3IK 5LMNJ 1XZPB 1VHIA 4RO0A 1S0UA 2MKIA 3AOCA 4ZKAA 3ZO7A 5I3UA 3FBCA 5HN0A 1UVJA 4YB6A 1PGZA 1IBMF 4BCAA 4Q4ZA 4RNOA 1RAFB 4WILA 3K89A 3HHLA 4RU2A 1TUVA 3K2YA 2CAJA 3C15B 3US5A 3ZC4A 5KFWA 1VQ5B 4DS5A 2JRSA 1VQ6S 5FD1A 1T9VA 2UVVA 2CZVC 4Y28C 4USHA 3FOEA 4L8JA 2E2JC 1ZPVA 4HL9A 3J7Z5 1U24A 2Y0SL 3TAMB 5B0AA 2KTQA 3PTWA 1VQ5S 1WTHD 3ILOA 2R9VA 4QUZA 2AX0A 2IVFB 2DIUA 2HS3A 4KAIA 2DJWA 3ONQA 3GEIA 1R8BA 3BR8A 1S9FA 3DXSX 1CNFA 2C4TA 1RT6B 2R7VA 1RU0A 4RNMA 1XR5A 3CJ0A 4FYYB 2C5BA 2JA8C 4LRAA 1O2FB 2HIQA 1HFEL 3BP3A 1UVIA 4DL4A 2V6AA 3DCAA 3EGVA 2UVWA 1LW0A 4JI5F 1ZAVA 4BS2A 5AE1A 3ZIAA 4GMKA 4P10A 3J80U 1Q8BA 4JI2F 4ZVQB 1DLOA 4KN7A 4FXVA 1WQHA 4BWMA 4JYAJ 3D28A 4QBUA 5H9EK 1ELOA 2GMJA 4RNHA 1GQEA 5C25A 4CT8A 3BYPA 4ECSA 1VRUA 9RUBA 4N3NA 3OQ2A 1PO6A 2B63K 4V19X 5BXIA 3EZOA 4L74A 2ILYA 1P1LA 4X4PA 2V7TA 4F4YA 2UUCF 4LQ9A 2WBRA 2VA3A 2R92C 1SQEA 2XY7A 4QOTA 4W90B 3CULA 3R2DJ 2F43A 2HS0A 4K2XA 3GTJK 3T56B 4JI7F 2G0JA 2JIZA 5B0FA 3K58A 2GSOA 4O4GA 3NGRA 2FVSA 4WFAQ 2V2QA 1FHTA 1OQ6A 2RKIB 3MCOA 4G0UA 2OEJA 2AJ2A 2A6HA 3C19A 4OX9F 2KU7A 1CJUB 3NGKA 1N32J 1RYRA 5CYMB 4GFQA 2BKNA 4P6VF 2HWHA 5C4JC 2YX1A 4P74A 1CJVA 4DCJB 1LW2B 2ZVSA 2VFUA 4XAKA 3HO1A 1WTFA 2JJ4D 3IRXB 1H7XA 2A2DA 2ASDA 1B4AA 3TQ1A 4IQXA 3TI0A 2FHMA 2K3IA 3MEKA 1IN0A 1K0VA 2QEXS 3KJFB 3SEOA 1U2RA 1F20A 3F41A 3S2HC 1N5YB 2XBPA 1RSCA 2VHGA 1FXLA 2PD1A 2ZBVA 4M1KA 2HCJB 2L9NA 4ED8A 3G9CA 3FGVA 3ZZRA 1O26A 4F4XA 3AVWA 4ZVEA 2LLZA 4OHXA 4UW2A 2OBTA 3GTYX 2B56A 5CZXA 3BEGB 3QWUA 1YJWB 3OR1B 2PMZD 1I7PA 4WU2A 1S5ZA 2CQ1A 3NOCA 2XMMA 1NK0A 2Y8YA 3R1LA 2AYBA 2HHPA 2R2TA 1X0FA 1I50C 3ENVA 4QWAA 3PW4A 4KHPF 4XDDA 1VRTA 1HBMA 2IRUA 4WZMA 1XBWA 1Q4RA 4C0OC 1KBRA 3BY1A 1M1KD 1KWMA 2JEFA 2ILZA 1WUUA 4DQPA 4H4KC 4JI3F 4GZYA 1K73T 2HFVA 1YI2S 5TV2A 2F5GA 1WEZA 2HSEB 2H51B 5EWFA 4A3DK 1YZ6A 5THWA 4J9UE 4Z2XA 3LP2B 4A8YA 1N5YA 5E41A 4LSLB 2VJUA 1VC0A 1L3UA 4WXWA 1KSPA 2AYMA 1G7CB 4JMQA 3SDEA 4RW7B 4DV4F 4C45A 4LC0A 3PA2A 4XLFA 4GKKJ 1WWHA 3EGWB 4X4RA 4UAJA 1USMA 1VHEA 1IWGA 4PKDB 2M2BA 2DO0A 3FVYA 2RRNA 1O0PA 1SQFA 2FC8A 1WOPA 4PRFA 1NMEB 3HCXA 3GTMA 4NCNA 3MHYA 3ILLA 3D7SB 2FJWA 1O5JA 2PT0A 3V4MA 2PMHA 1OSCA 1BQMB 3GTGC 5H9FK 4I0WA 2COLA 4BHQA 2DXDA 2D3UA 3CCMB 3HJVA 3A1PA 1O2AA 2BE7D 4ZHRA 3S1TA 4G1QB 2F65A 4OYOA 4DL7A 3PM9A 2DBBA 3PKMA 4TSFA 3WIVA 3QIPB 4PAAA 2B4VA 5IK2A 2OTLS 3I0RB 4P3YA 4F26A 2J7KA 2N7CA 3FMBA 4CLLA 3VAIA 3MPDA 3CIMA 1GX5A 2PA3A 4FM9A 4P3IA 1HBNA 4DV1J 4WIQA 1RT5B 2DH7A 5M2RA 3GTKK 3BM7A 1K0TA 3GIRA 2CDQA 2ZHOA 2B5OA 1QAYA 2CG4A 3THTA 5DN6A 1WHWA 3H7HB 3BS9A 3SCKE 2MKJA 4NL5A 1SJ1A 2POKA 3MEEB 3NBPB 5BYRA 2Y1RI 3KLFB 1MMNA 4B3XA 2PN6A 4G0VA 3RUBL 3JQMA 1IR0A 2D9PA 3MM5A 2P5VA 2OPPA 2OMOA 2KT3A 2VPWB 2NSBA 1NSQA 1JKHA 1JLEA 5G0RB 4KV8B 1RKIA 4NRTA 4WK3A 1YIJS 4OL8A 2GJRA 3TNVA 5KAKA 1KDNA 4WP9A 3MD3A 1VIXA 2F4NA 6AT1B 4R0EA 2X0KA 3I9V9 3W65A 2P8TA 2FJBB 3A8KA 3R5CA 3ASRA 4KO0B 3ZPNA 1RT7A 2HFSA 4F8RA 3QT7A 1KOHA 1UW4A 1VJQA 3CTRA 5LXYA 4DQKA 1FF2A 2Z2MA 1H8EA 3VR6A 2NUUG 4RLEA 4NASA 4AF6A 3GVJA 4ECWA 1RTDB 4QIFA 3TJ9A 4DV2J 2OEMA 2P9CA 1E3XA 1A8PA 2AIRB 4B9SA 4LF1A 2J76E 5KFFA 1SL1A 2E2JK 1TL4A 1N56A 1LK7A 4G7OA 1HBUB 1E6YB 4ZVFA 1XFOA 2V8GA 3R6GB 4EZ6A 3OL6A 1XNQJ 3J81Y 2CQBA 1KC8T 1NZAA 4F7VA 2VDIA 3GONA 4KGZB 2CFXA 1TFYA 3S14C 4ELUA 3HHDA 1FJGF 1F60B 3E20A 4TY8A 3QPIA 1R9TK 1BMFA 1T9UA 4A4JA 1FK9B 1QAIA 2QMUB 2ACYA 1T02A 4IRKA 4KGVB 4XQFA 4C8NA 4IH5A 4A3LC 3JSBA 3CCSB 4EBDA 3DHXA 4DG1A 5FLMC 2W4PA 1FK9A 4WE1A 2NXCA 1SXLA 1HKAA 1V0FA 5CD4A 4EEYA 3HXMA 4ZCIA 1CC7A 2QA4G 3LGHA 3GG0A 1S59A 3DDKA 3NLCA 2FGOA 5E3RA 1RHQB 4IQMA 1HQUA 3VAMA 1VLYA 4YELA 2X3DA 4DSFA 1BGWA 1B7YB 4JI7J 2ZC3A 3K5PA 5IM0B 2VQFF 4UUXA 1M5PC 1WG1A 2AZ1A 3QBCA 1N05A 1VGXA 3MMAA 3ZTSA 2GJKA 1EIYB 1VQ6B 2DGXA 2CRVA 3ZXWA 3UN3A 5C25B 1FVSA 3G6YA 4Y52C 2GQ2A 3PX6A 1D09B 2A6MA 1VQNB 1I50A 3DGPB 4A46A 1NK7A 2YWEA 2EFVA 2CQGA 4IRDA 4GTDA 1OGIA 5KG6A 2RQMA 2O5DA 3T6BA 1JJ4A 4DNRB 4ZLNA 3OV7A 4WK1A 4B48A 1I50K 4C97A 2YPZA 2OPSA 5DZ7A 1GXTA 4WZKA 1V3RA 2CF4A 1TFWA 8AT1B 3IM8A 4P73A 1MLAA 2NXUA 3P8BB 3FSYA 3GIKA 2C42A 3OJWA 1KVIA 4FDFA 2ADBA 2R4FA 2BE2B 1EARA 2C1EB 3ETMA 4DBQA 3R9LA 2FGCA 4X8IA 2HHHF 1G7SA 2QTZA 4OI1A 5FDLB 4PUOB 4QV2A 5KT6A 1TVRA 3KK2B 1ZOTA 1J5EF 2LYVA 4NI2B 2MZ1A 2G0CA 1PYOB 4A3BC 2MDAA 1XERA 3C15A 3Q3AA 4G6IA 1FKOA 2C2KB 3W1YC 2QYCA 4QYZJ 2HAFA 2XYGB 1W2BB 4X6AK 2YKMA 4WJ4A 4DR7F 1CNEA 5HI7A 5B08A 1JB9A 1YJ9S 4LF7J 4LVOP 4DL3A 1DCHA 2XULA 5KFMA 2CNNB 1LWCA 3VNUA 1PC4A 4MAKA 1I3OB 3TRGA 4FF4A 1Q53A 2KWAA 2VZLA 3SFGA 2W2OP 1NB7A 4BY7K 4DPYA 2GHWA 4TT3A 1Q1KA 2WONB 2AHOA 2VOPA 2NYIA 1FKPB 2XMKA 4Q0BA 4M1XA 4Q45A 1USOA 4F67A 3KUGA 4RW9B 5CHCB 2J9CA 3RW6A 4DUYF 2G0IA 2KB2A 4RJLA 1RACB 1VQLB 1RAOA 4HH0A 3TA2A 2FHOB 4DQLA 3CCEB 1R6YA 4LOWA 1S77D 2E7VA 3E3XA 2QGFB 4XK8C 3WX8A 2WVEA 4LR9A 3UD3P 2YXLA 1A9NB 3MD1A 3OUYA 1Y3JA 4QPTA 5K8MA 3UR0A 5T14A 1OS5A 1JLGB 3KJQB 1IKYB 1VQ8S 1BWVA 3MPUB 1RQRA 5C42A 4M5HA 4A3MC 2MY7A 4O2DA 4ANEA 5HL7Q 4LRFA 2ZH7A 1TL1A 1VRTB 2FJXA 3SSQA 1B0TA 3KNGA 5JJBA 3BO4A 3M6WA 3UE2A 1Y9OA 1FI4A 1H74A 2ERRA 5LOQA 2M4MA 1UPMB 1V3ZA 2G4BA 3HOXC 4IO9Q 2X1BA 3RAXA 3MM9B 3M32A 5G0RA 4H4OA 1S99A 1N5TA 3AVTA 3BR9A 1RK8A 3DOKB 1NJZA 1NKBA 4OX9J 5HZAA 3T19A 1X5TA 4KHMA 3VGSA 3MMAB 4CDIA 4B9LA 5C2GA 4XDCA 4CT9A 4KM9A 2GAGC 3MUVP 4NYPA 4K0KF 5IP7C 4OIQA 2GCFA 1FESA 2CPIA 3QZ8A 4KGKA 4LUBA 1SC4B 1I3QC 3HFVA 2UV8G 2Q6LA 1REGX 2D74A 4QIWL 5ETVA 3VAGA 1CSJA 3MEEA 3L7UA 2H4WB 2OSQA 3W5UA 3WX4A 3BGLA 2B7CA 3DRXA 1LW2A 4DR1F 2ALYB 5CYMA 4A3FC 3CXCR 3IFEA 4CLWA 3GTMK 2B4UA 2HGNA 2CQIA 2E66A 3CCUS 1NK6A 3CQZC 4Z4TA 5G4DA 4P75A 3SSSA 2DEUA 3C16A 4DUTA 3S1NK 4X4UA 1QUFA 2AHOB 3W9JA 2BEFA 2BQRA 1FX4A 2L41A 3AGQA 5AJ3F 3SYZA 3P45B 5IYNA 1HNVB 1S6UA 4ED4A 4F4ZA 3LWLA 4QPXA 3C6TB 1IJEB 4JBCA 2KDOA 2V5HG 2H5IB 5B0EA 1UD5A 3GCXP 1RT2B 5KFSA 2NUHA 2C2ZB 5J2PA 3H5UA 5ADZA 4LFCF 3C6TA 1LWCB 1WPCA 4LQ3A 4Q44A 4N47A 1XZQA 3G6EB 1X4GA 4YP3A 3UW1A 3CJ8A 4MFBB 1H38A 2AT1B 3GJSB 1QD1A 4WWVA 1N54B 2LXUA 4CCHA 5D8HB 1YRTA 1DURA 1XIQA 1MROB 3JQRA 1NRKA 1F5CA 4B3OB 4LT6A 4OFZA 3W5HA 1SQGA 4W98A 1K83C 4GO5X 2WJYA 4NXMF 1RTIA 3HVWA 3TJAA 4P71A 5HVGA 3R6LB 4A3JK 2BUNA 4P52A 3CMMA 1UD4A 1U4BA 4B47A 1YZ7A 4TXSA 4F3QA 1KEKA 1Q5VA 1FEHA 3W60A 4KFBA 5DQGA 5D6GA 3WY9A 2C4UA 3M2UA 4XOPA 3CESA 2JFKA 4YN3B 1KN6A 1YJNB 4KFBB 3IS9B 1AIPA 2L9WA 2KFZA 3BUEA 4ZPWR 1HQ2A 4C8OA 4XN3A 1HD1A 1NO8A 4G1BA 5IP9K 3I82A 3ET6B 4PQUA 4WP3A 2DR6A 4ECVA 4A3LK 1U8WA 3CCVS 1S10A 3IRWP 4ECXA 1OSDA 3DLLQ 2R2RA 2UVRA 2F1LA 2RH6A 1URRA 2KXNB 2UVUA 3OR1A 1NB0A 1X60A 2GGPB 3JS9A 4RUCA 3JAMU 4B3OA 4CLSA 1TP7A 3V4IB 1TR0A 4L76A 1GNKA 3MECA 1KK0A 3E1YE 1ISEA 4HHJA 1UKUA 1W35A 1IE0A 4YFUA 2IA6A 3MAHA 5H5JA 5C5JA 3OW2B 4MKAA 4UOHA 1FDNA 1N4LA 2HNDA 5A8WA 2GVZA 1FRNA 1XXAA 1JLGA 1LWFB 3PW0A 1RWVB 4DPOA 4WKRA 4IG0A 4PC2A 1HNVA 3QRPA 2VG7B 5E0OA 2M7SA 4DEZA 1TL7B 3W2HA 3NCRA 2IM3A 2YQ1A 4Q8FA 2QE7A 4C48A 3D6FB 2FD2A 3CJ5A 4QIVA 3S1MK 3KLVA 4X4NA 1ZYQA 4YB1P 2KFYA 3TARA 3AY0A 5EWEA 3LTOA 3TFJA 2AX1A 1VQ8B 2GO8A 4K4VA 2VJJA 1NNDA 1WCMC 5TJ3A 4X2BA 4B3RF 1S76D 3TFIA 1VIOA 1NPRA 3FKIK 3U27A 3HD1A 4ZJLA 4KKTA 3V6KA 2D74B 4JI4F 2WSEC 1R31A 2V4RA 4F3OA 2PHCB 2FPHX 4OOVA 4X64F 2EG1A 2GPJA 5L1KA 1PJ7A 5DG9A 3OEPA 4NOHA 2BKPA 3IGNA 3TANA 2FZCB 4LVNP 5KG2A 1NK8A 4AC9A 4DPUA 2FJAB 3D3CJ 1T6YA 2E1AA 1BE4A 4DR4J 1W34A 1J27A 3DOKA 2VB6A 4XCHA 2I38A 4LSNB 2DTJA 3M8PB 2PLFA 4D3HA 1IBLF 3M32B 4KSEB 1K73D 2J6UA 4KO0A 2V8DA 3N9UC 4ED3A 2YKMB 4RUBA 3HOWK 1JLBA 2F4VJ 2XS2A 3CCQS 3CC2B 1L3SA 2BW2A 3LAMA 2ZFZA 3JAMY 4LF8F 1E64A 2AP6A 5M3FK 2JL9A 3CJTA 1DLOB 1YJTA 1OYEA 3EGNA 4F4WA 2GQFA 3FBFA 1GO2A 1NHVA 2ZDPA 4L75A 1X4BA 4PG6A 2ADCA 3MM5B 4PUOA 1RT6A 4YXWA 2DH8A 3LPEA 4O3QA 4OV6A 5M5YK 4Q7AA 3T1YF 3QGHA 1WCMA 1HQEA 1CEZA 4ILMA 1R0CB 4GTBA 3B6BA 1KQFB 3H20A 4USVA 4XKVA 4AL7A 3TAMA 3NNAA 4USWA 5BJRA 1OYDA 2YH0A 1IBLJ 2QMWA 4Q5VA 1YIJB 3K5LA 2VBZA 3Q2TC 4YG2A 1RHJB 2V2ZA 1O27A 3UI3A 2XZOA 2IM2A 2W9CB 3SCJE 3G96A 3GTOA 1FRXA 1W7WA 1IBAA 3KLIB 2ZJRQ 5E3CA 1TVCA 3FKSA 3QFTA 3W62A 2HIYA 2BW7A 3MFIA 5ETRA 4AL6A 1HI1A 3PYFA 3PUNA 3J7YI 1W2BR 1D9DA 1JK9B 3IXQA 8ATCB 4UT4A 4GVBA 2LQBA 1M5KC 4OHVA 4FNIA 5A8KA 5F8HA 2FUG9 4DU8A 1FWPA 1WDTA 2CJBA 3A3NB 2YQ3A 4F04B 3MMCB 4RR5A 1ZYRA 1SC6A 1FNDA 1D8ZA 1HIYA 4FVMA 2H1YA 4GTAA 4FYVB 4QJVA 5K5MA 1X4HA 1YRUA 2JLFA 3SCIE 2LECA 1S1XA 1LEOA 4G1IA 3MMPA 3D1OA 2JC0A 2UUBF 1I6HC 2MHNA 4DX8H 3PO3C 1RWPB 5T41A 3TA0A 5DETA 3KLIA 3BNWA 3NS7B 4A3KK 4DSIA 1Q81D 1NK9A 2RSQA 3NOGA 2ZZGA 1GVHA 4OHWA 3L4JA 1UPPA 4U7UD 3AVYA 4RW6B 4JUZA 2FVPA 4IFVA 5GMEA 5IOLA 3GTJA 4PQAA 1EFWA 3DLKA 2DD8S 1N36J 2V7XA 3GTLA 1RWUA 2DNZA 5E7OB 4A8MP 2EIXA 4AYBD 3T5HA 1TWFK 1UFLA 4CLYA 3OL7A 4LSLA 1DTTA 3OXLA 4U96A 4B3MJ 3KYLA 1Q95G 2C2NA 2ZH1A 3CJQA 4XSXA 3KNAA 2EK1A 4DR6F 2GSUA 2BANA 5A89A 2BACA 2QJ3A 2I5JA 2HNYA 2QLWA 3DRSA 4DMZA 3TVZA 2KG0A 1SL0A 2ZBPA 1SJRA 5DGAA 3HLUA 4QVAA 3PA1A 3CF5Q 4CZCA 4FXUA 2W8LA 3ZZTA 3N4WA 1JLBB 2NLWA 1C1CB 5D0GA 3MGJA 1H42A 4FPIA 1RADB 4FF1A 4X64J 3OVAA 1PKVA 3NGDA 2VBSA 3W66A 4PABA 4OZLA 3EPIA 3S1RK 3O1LA 3EVOA 4NMLA 3CC4S 4Y9RA 4ATNA 3E2EA 4NLPA 3Q39A 5F4MA 3K0JA 4LF2A 2AKWB 2XMAA 1RWWB 1U6ZA 2J6TA 4DX5A 2ZH4A 2OPRA 2MEWA 5GAHU 1S1VA 4KMUA 1UWBA 4IDKB 2LEAA 2MQOA 2BBEA 4DL2A 2QMUA 3W61A 1KLMA 3Q8UA 2X8KA 4UOFA 4ELVA 4LR8A 3PIPQ 2RIJA 2AJ4A 1S97A 2ZH8A 1JLQA 5AXMA 4P25A 2QA4B 4A93K 2W1BA 1UD2A 3S8SA 1O8BA 4QFMA 1WF1A 2JEJA 1BQEA 3BBFA 2N3LA 4AXJA 5DDPC 2FC9A 5FIIA 3OXFA 2FJDB 3M4OC 2FIUA 2LXFA 1NJIT 4LBIA 1KD1T 4BBYA 3H2VE 4LSZB 3M9OB 2XYHB 1QSSA 2YY3A 3P3DA 3PJWA 4RDKA 1YJRA 4ID8A 4KC6A 2VBVA 3BB5A 3WNCA 2IM0A 3KKFA 2HHTA 4TYBA 1SL2A 2ZZNA 2V50A 2QLFB 4YAUA 1SKWA 2OSRA 2DGSA 5ETPA 4ECTA 2YKQA 4RD3A 4PWDA 1YHQS 3T5KA 2JA6C 1SKYB 3KLGB 1LNQA 5KW9A 1H3DA 1Y5NB 3QE2A 3GZ7A 5CJ9A 1UW9A 1ZPWX 3VWSA 3D1QA 1N34F 3BSAA 3FQLA 1XEZA 3M6VA 1SJ4P 4KV8A 2I8EA 2YNGA 2IAJB 2ZTNA 4NNJA 4ELTA 1T9TA 2HAIA 4UF4A 4PC1A 1S7IA 1IKWA 1RAJA 3ENQA 4M5MA 1MWQA 3HZGA 4RMFA 3PJXA 3AJDA 4LF9F 1ULRA 4P5BA 3LP2A 2DIVA 4MK8A 3EGZA 2VNJA 3FZ2A 1WSRA 4Y00A 4XLPA 2RD5C 3TZWA 2VQEF 2C28A 1EX8A 1TAQA 1RBOB 2HW3A 5JUMA 3Q38A 3W64A 2CJXB 2GS8A 4CO1A 2KM8C 2LQ9A 3M2VA 1G7RA 2YNGB 5IS2A 1N32F 2IC3A 2IM1A 1TK0A 3KLEB 4X06A 2AMCB 3GJTB 4DLGA 5H9EJ 3KUEA 2RF2B 3G4AA 2D3O1 2KVOA 3MF5A 3KHRA 1IW7A 3BN7A 2CJYB 2R8JA 1B0VA 2C2RA 4RD6A 5FLXU 1JVIA 2HHHJ 3AT1B 1RBAA 1HBNB 3MAQA 2ZD1A 2HQDA 1MMDA 4K4SA 1ITPA 1SPBP 4DX6A 2PDAA 3MZIA 5D4PA 4AXIA 5H1SV 2JHEA 4ZV4A 1KQGB 4DN0A 1FRIA 4C8KA 4QWCA 3G4CA 2GJ2A 4F4AA 1KNZA 1U48A 3DI6B 3G4SS 1MWZA 2ZZTA 2MLYA 4PYAA 1D3WA 2RQKA 4C3JK 3ONYA 3LWMA 3AFGA 4OJHA 4AUKA 3I4PA 5IT9Y 1EETA 1X9MA 4OI4A 2B5JB 3BV8A 5DQHA 2QFJA 1V3SA 2E2IC 1FWKA 3RZOC 5I42A 4Q5SA 3CMEB 1BMQB 1EP3B 3VALA 2M0GB 2V69A 4P2NA 3C66A 3SV3A 1HA1A 1KLMB 2ZL7A 3THVA 4BY7C 1S6PB 4IFYB 1INNA 4B9UA 1U45A 4DK1A 1P27B 2N4DA 4R5PB 2FB0A 3R3TA 1UFWA 3I4HX 2KFNA 3W2EA 3VA7A 4LF8J 2ZH9A 3GTPK 2NVTK 1RAHB 5KTQA 4O3OA 2E1CA 1F0XA 1E6YA 2J0XA 2K7KA 1RISA 2L08A 4M5DA 1MW7A 2VFVA 4K4XA 3SIPB 1TELA 3V4GA 3BGUA 5I3PA 4KMDA 2MZTA 3T5LA 1X5SA 1YJWS 4EK2A 2Z2YB 1M5SA 5KT7A 1WIHA 4XM3A 5IYCK 1U7LA 4NWBA 3PVXA 2XLKA 5GADI 2EXUA 5EGHA 3EDQB 3CD7A 4USMA 1RBLA 4B4DA 2NVXC 4J5OA 1KOOA 2LCWA 3QO9B 4ZITA 3W5VA 4YR3A 3HP6A 2FZGB 2BGJA 2NQPA 2HGLA 3H5XA 4KRWA 4JI4J 2I6WA 2QX0A 2AW0A 1JKHB 1YITB 1SV5B 1ZA1B 3GP9A 1QUEA 2VODA 2HBRB 1VQLS 5IC6B 2KZZA 2X6XA 4U9RA 2DPJA 5M3MK 1WQGA 3A4TA 4Z37A 4CLZA 3S1QC 1IR2A 1RAIB 1E63A 3I5AA 3HF5A 1T6ZA 2DOGA 3UDCA 1E1QA 4IFVB 1IKYA 2XNDA 1M90T 3W9HA 2EKYA 4F0HA 4L73A 1LOUA 2MTLA 1HL6A 4LRDA 1ZM3A 1SB6A 2LFVA 3UR3C 1Y5LB 1XMOF 5CABA 2RAQA 4C98A 3IM9A 2CG8A 1OY6A 2R7UA 2HK2A 4WZLA 2A2CA 1Q7YT 2VFTA 1TWGC 1OWXA 2PIIA 2W7PA 1TV6A 3P5BP 1IBKJ 2UV8A 4AT1B 2F8EX 4TMXA 4DR5F 2E1BA 1WORA 3VO1A 4LBPA 1NPPA 1TL7A 3OBIA 3A8JA 3T53B 5L39A 5J2PB 1UVLA 4RU9A 1H73A 4K4TA 1EXMA 4B3FX 3CJKB 4DS4A 4PGOA 3CMAS 5IORA 3QQCD 1VQPB 1I5OB 1FFSB 5KFIA 2GVZB 3P5TL 4DNTB 4Z4UA 1JIHA 4DSLA 1NBMA 4B3SF 4QWDA 1RQPA 4I7FB 3FPPA 3M8RA 2D3ZA 2P6TA 2UU9F 2QA2A 2XZLA 3TOQA 3CCLB 1TWCK 5KT3A 1OGJA 2E7XA 4ZP9A 1SJQA 1KQSB 1NCLA 2YWWA 1S9EB 3AOAA 2VG6B 1G51A 1FNCA 1RWMB 1Y7PA 5F8GA 1KTVA 1V6HA 4J9MA 2ZBCA 4C4WA 5E5NA 3DRRA 2IC3B 5IYQA 4GVLA 1JJ2R 4N5SA 2GJIA 2HRUA 3NWGA 3A3OB 1EFUA 2JA5A 1P8GA 3CVKA 3QNWB 4BXXC 4HHUA 1C0TB 2DIEA 2AYGA 2WB4A 2J7WA 5J1EB 1ZM9A 1FDAA 4OYXA 1SUQA 4BLGA 4A3BK 1Y0HA 5HK4A 5C3EC 2HWIA 5HAOA 3SKBA 2WVFA 3S1MC 1S72S 1UJ4A 2OPSB 1VHOA 3DOLA 4MH8A 1BC6A 2DEJA 3A13A 2Q6CA 1F2HA 2ZE2B 1ZETA 1JLCA 2MSTA 4N8NA 1X0PA 1QTNB 4TMTA 1H2VZ 4DV0J 1TWAA 3OVBA 1KK3A 3CE8A 2WK4A 4DR2J 2WOMB 4HKQA 2LDIA 3GTPA 2NPIA 4LSNA 1K83A 3QT8A 1SIZA 3VR1A 3QYYA 1F1BB 2RT3A 4X84A 2D3OR 3IG1B 4KKSA 4CTAA 2R93A 4MK9A 1HNXJ 3CD6S 4A3IK 4DR1J 4X62J 1H7WA 2B9WA 2VF3A 1HHSA 3SSRA 1E6VB 1WCMK 2DHAA 1V9OA 2YKNB 4R5PA 2OUGA 1IJEA 1Q82T 4YAFA 1VRQC 2R7TA 4IFYA 3ISND 4DQQA 2LXIA 3OLAA 4KB2A 3MR6A 3DXJA 3GDZA 1HPZA 5A2QU 3CC7B 4F36A 3I5CA 2Z56B 4X7DA 2ZBIA 1JLFA 3DLEA 3GR1A 1DQAA 3NP5A 3WC2A 3M3YK 4DHVA 4QR2A 4B3SJ 2RDIA 2EFNA 2B5JA 1QSYA 1QAXA 3PG9A 3HSGA 2D3LA 3OHAA 3TAQA 3BDEA 3G8TA 3BH4A 1E6VA 3ISZA 3SV4A 2N7YA 4CO5A 4C3JC 4HLBA 4YUDA 1BY9A 3DI6A 5HJYA 3J7AN 4K8RA 1H85A 2P9EA 3WXMA 3FEZA 2DNMA 4TQRA 2X3UA 3ZTRA 2A10A 1EFRA 4OOXA 2DHHA 1VLOA 1RHUB 3CT9A 3J7YU 2ATLA 5C3EK 2GHPA 4A8FA 5ETQA 2QC3A 1TWHC 3GTOK 3RZDK 1EKSA 4U8YA 2HZVA 5AXNA 1OY9A 3CPXA 4EH1A 1WC3A 2D1CA 2HBYB 2XWXA 2CQ2A 3S15C 1KRHA 3OTDA 1RT3B 1FKOB 1U1NA 1LW0B 2G2ZA 4WZQA 1WOSA 4WTOB 4IKAA 4ZPDA 1PBAA 4CIOA 4MIAA 4IR9A 2BV3A 3WZ0A 2I5JB 2W9AA 3OL8A 3H2LA 1LWXA 2BE9B 3BYRA 2HMIB 3O6QA 1VQ9B 1XN9A 5DGBA 3CDAA 4WBFA 1TMMA 1RABB 3VV2B 3W63A 2OGUA 2W2NP 1F5BA 1G1XA 3GVKA 1KQSR 2YWKA 4HT5A 1YITS 3KLFA 2DR8A 2F7VA 4C8ZA 4USJC 4ZPAA 5AN9A 3BPDA 4TMVA 4HI2A 3W8PA 2EEYA 1U02A 1S12A 3D68A 4XIUA 3TTGA 2C3YA 2QDXA 2E5JA 2DNYA 4KPYA 3T01A 3GJQB 4ZVSB 3MEGB 3FSXA 2L9DA 1FRLA 3F44A 2U2FA 2BM1A 4OYZA 5HJXA 4Z4ZA 5AXLA 5KFUA 5ETOA 4MYUA 3TX0A 3FFIA 2NVYA 3L7PA 2WRMA 1GMWA 3IR6B 4ZVRB 1FNMA 2DY1A 3QIPA 3OFNA 4XONA 4PWDB 3JSRA 4YFKA 3HOUK 1GT8A 4I7FA 2E5LJ 3Q2SC 4KC5A 2WZPP 4OYAA 4WP8A 2K06A 2RU3A 2EBBA 4JI6J 4U7CA 2DXEA 4NZ7A 2IY5B 1D2EA 3G05A 1S1XB 2Y3PA 4WZEA 3DYAB 1Y1WC 2M9KA 3UVJB 4CM2A 4ZDNA 4ZCKA 2XOKA 2VC1A 2JX2A 3E8OA 3MMCA 3MEDB 4ZN3A 2E9ZA 1BPLA 5BYQA 1NBEB 5L9XA 4FBUA 5JVGQ 4NCAA 1ZBSA 2XNJA 3IA0A 2E2IA 5J2QA 3K5NA 2HDNB 4CQ1A 3FEXB 3GILA 2XNCA 3FC9A 4EBCA 3MDFA 2X85A 3N28A 2B7BB 3SDEB 3U1MA 5D4NA 2MZSA 2OBSA 1NEEA 1U6BA 1WU8A 1TL3B 2OI2A 1MMLA 5HSPA 4QW9A 2NSCA 1FRKA 2JH3A 4RX6A 1IM6A 3JSMB 2VIHA 1AB8A 2E7WA 1RQ0A 2LA6A 4TY9A 2CPYA 2MY8A 1VGYA 3M8QB 3SQGB 4A8QA 3ZTQA 3R27A 3EDRB 2N82B 1Q8KA 4URSA 2ASJA 4O0IA 2CW5A 6FDRA 3GTMC 4WFZA 4KM8A 4BLAA 5F3ZA 3VZHA 5F8LA 3FQKA 4YHHF 3AJ2A 3HOVC 5DDRC 4JI6F 1YDLA 3OPKA 1KK1A 2QL5B 3D0GE 2QL9B 5CAAA 2PEHA 3DU6A 2F1FA 4X4QA 2JDJA 2XCOA 1R9TC 3C14B 1S4MA 1IUJA 1U1QA 4KB4A 2AYEA 2BKOA 1NAQA 4F7DA 4CH1A 5HL8A 5CYQB 3CTAA 5CDFA 2FYXA 3LP1A 3OTBA 5A6PA 1QFJA 3T3FA 5M2UA 3CDUA 2H54B 2NV4A 3AAWB 4KKOA 3N3YA 3GSIA 4GRSA 4XPEA 2GC8A 1DTQA 2I2YA 4OZ1A 4ROXA 1CJTB 1WHYA 3I4MC 2UXBF 1Q86D 2R93C 1JJHA 4CO2A 2ZH5A 1EK8A 3SQGA 1HMVB 5D3GA 2EFQA 5F4JA 1IXKA 2DHGA 5A76A 3SQOP 3OSPA 2DGTA 1IQTA 3QSYA 3GV5B 3CRZA 3CAGA 4LIWA 2HVEA 3E01A 1AW0A 4ER8A 5LJ5Y 5GVQA 3WC0A 2XMUA 1N34J 3BQJA 1RB0A 2PSZA 3W8GA 3WQPA 5D4LA 3S2DC 2NYHA 2BN4A 1RTHA 4F25A 2DT9A 5KFAA 5EHHA 1VQ9S 5LSRA 3OPFA 3KLHB 1IQ0A 4JV2A 4I2QA 4YQWA 5IOSA 1YVFA 4DUYJ 5L46A 2C3MA 2IVMA 3OHBA 2VPZB 2WONA 2HNZA 2PGCA 5I42B 1OHHA 4OX6A 4G7ZA 2MPUA 4Q0BB 2NXJA 4C2MK 2CUYA 1NB2A 1EFTA 4RD4A 3RW7A 4HYKA 5GAEU 2HGMA 3M30B 2W6IA 1YLXA 4C3IC 1SC1B 3IBCB 1APSA 2HHVA 5IV3A 1LWFA 2W7AA 2XM3A 2BM0A 3H42A 2V7WA 5B6IA 4MTPA 2OMLA 2CXEA 4V19J 3ERED 3MM6A 3IAS9 4P22A 3K17A 1SI9A 3BCDA 2EPIA 2DNRA 1WTBA 3SJZA 4DR7J 2RB7A 3ICLA 2ROEA 4TMWA 3MCAA 5DDOC 3F0NA 1DDIA 1K9MT 5HMZA 3H5YA 1XNRF 2M88A 2R2SA 3MHPA 2E9RX 2VBTA 1UD6A 5HVHA 1ZS6A 2HZAA 3T02A 2XMWA 2PA8D 5D0RA 4CNZA 1KTQA 1S1TB 3OFHA 3DN9A 1TVRB 5MLCV 3ZUGA 2P6SA 2YU9K 3V81A 2CPDA 2GNKA 3EJMA 5A88A 3CEDA 2JA5C 1WDDA 2B9YA 4ZP6A 5BSXA 4OMFG 4HT7A 2RE1A 2V8HA 3DGVA 2AEJA 2KZMA 5AJ3J 2YU9A 3Q6QA 2AJ0A 4F02A 3HDSA 1QE1B 2HMAA 1C0AA 1U1KA 5IC4B 3GEEA 5F8JA 1NJID 1QVFB 3FK4A 5C44K 2VG5B 2DITA 1RLCL 2MZJA 5E3PA 1GX6A 3FKIA 3Q3QA 2UXDJ 4Y2KA 2DCLA 4M2LA 3OEHA 1H72C 4MKBA 2KN4A 1RU2A 1EP1B 1VR6A 2IDEA 1SVDA 3CCSS 1OO0B 1H98A 4II3A 4X07A 1HWLA 3CCZA 1FRMA 3I31A 2A18A 1RXOB 4L6V3 2HQFA 2ZOGA 2OPQA 1VJEA 1CQMA 1RWXB 3PHTA 4AH6A 3GTLC 4I69A 4ILDA 5IP9C 1S79A 4F2SA 1T03B 1A0OB 4JV5F 3U6BA 1FKAF 3LQVA 1N36F 4DG1B 1N5SA 1I94J 1BX1A 1AUSL 5F4OA 1K8AT 1YBAA 1NU4A 4LBZA 1PAUB 3CJ3A 4A8WA 1R6VA 2FTRA 4UZBA 1X7VA 1QFYA 4EZ9A 1T9XA 2M70A 2V7UA 1SM4A 2KHDA 3SZYA 1JLQB 4KTQA 3C6UA 3LNNA 4LLGA 3AGPA 1RTZA 3UDEA 2KVQE 4TYAA 1RGVA 1FEEA 4U95A 4TU7A 2DK2A 4PC7A 1VYAA 2JNJA 1FERA 4OP7A 4KY3A 1T0TV 9ATCB 3A3BA 4HTIA 1S0NA 1F9NA 3ETOA 2IMOA 4OI2A 1H8HA 1HNWF 1F93A 3ENAA 3TR5A 2ZXHA 3Q24A 4CYUB 2PIAA 5EUHA 4ZLJA 3IG1A 3MMBA 1CJKA 1N33J 1W0JA 1UCNA 2WPDA 4MIBA 1IBMJ 1Y1VK 4Y0FA 3FKBA 1DDGA 3R8YA 3M6UA 1BUXA 2NZ4A 3GV8B 1OIAA 1P9QC 3D5MA 4I1TA 1YJNS 1DQ8A 4ZJOA 3NMRA 4DWIA 4X66F 5TMFA 3CJ2A 2HRTA 1XXBA 1CQXA 5KFQA 1Y1VA 4X4OA 2AEFA 2WTFA 4PC3A 4WPAA 1ZAXA 1KD1D 5IOQA 4QYZK 4G7WA 4ZGNB 2V6UA 5IQ6A 1KJZA 1F7VA 4B9NA 3EVWA 4CP5A 3QATA 1EKRA 3TVKA 4DV5J 1Z1ZA 3OR2A 5KG7A 5IWAF 4XORA 2Q1LA 3OAAA 1RWNB 2FHJA 5CXTA 2OELA 2F9DA 4CO3A 2XSFA 1RTJB 3GIJA 3C2PA 3T1HF 2G2OA 3UN2A 3Q83A 3LPXA 4AQYJ 4ENOA 2ZJQQ 4TKTA 1GMWD 1U26A 2NVYK 3ZTPA 1KQ4A 2GO9A 4LF7F 3H0PA 2KT5A 3L09A 2C78A 3DRRB 4MMOA 1IR1A 4OPOA 4M5IA 2XY5A 3ZBUA 1Z4UA 1TKXA 4S0MA 3UCUP 3HX9A 4UOGA 3M4XA 2ZOFA 2LEBA 3PO4A 5KFDA 3DDIA 1X4DA 2DISA 3N5BA 2QSWA 3OPOA 1VJWA 1W26A 3LA0A 4OHZA 5KFLA 5KFNA 1N0UA 4JI0F 2PI4A 4JI8F 4PXDA 3VVUA 3RBZA 5B09A 3B54A 1CBKA 4DCPB 1J2VA 4K2JA 3J81k 1NUEA 2IJFA 3IGVA 4PG4A 2QRRA 4NLRA 3VTIA 2IFXA 1IQZA 3GIIA 5AXKA 2FLOA 4C3LA 4GKJF 4WZTA 3L3CA 1Q7YD 3KJNB 2ZHAA 4AVZA 1RHMB 1WC6A 1NK4A 3CJ4A 4BPRA 2R7WA 1CS4A 1XJWB 2DXFA 2B4OA 4FVCA 4EYHB 5EX0A 2NPFA 3U2QA 1X4AA 3RTVA 1JLAB 3H94A 5IYPA 2G2YA 3N6NA 1TQLA 2Q66A 4A3GC 5H9FJ 5D0EA 3VF0B 3PX0A 2CJAA 1AA1B 1X4CA 4M5NA 3HJFA 1S4FA 2FDNA 4EI2A 5IV4A 1GTHA 4JI1J 3PO2K 3AQOA 5KFTA 5HZBA 1IVZA 1XE1A 1NDPA 3TUZC 1FJEB 2RS2A 3U7JA 3CCLS 4PZVA 3G8SA 5J1NA 3GWCA 2IIHA 3CSKA 1K28D 2R92K 1ZH5A 2MQMA 1V5IB 2CQDA 3I6PA 3KK3B 4KGMA 1AZSB 3OKXA 1FNBA 2ZZEA 3QZ7A 5LMNF 2XYPB 1UA0A 1Q8LA 3AH6A 1VBXA 4DFKA 1NM2A 3PO2C 1D8YA 3IAM9 2ZZMA 4RBVA 3W2VA 1HWIA 1SBRA 3AVXA 3I9ZA 1WI6A 3NCPA 2KJWA 4Z4WA 3CIZA 1EQ0A 2WZ1A 2QLXA 5ETKA 4I64A 5IOTA 3QAEA 5DDQC 3RR8A 1BD6A 1DHMA 3DGPA 2BZ2A 2R7ZK 3Q0AA 4C3MA 3V2UC 3FPKA 2VUGA 2QFIA 2WSFC 3R7NB 2R3VA 2LKZA 3A1YG 4OZJA 2UU9J 2P5MA 5J2NA 4BBSK 3D3BJ 5IZHA 4WF9Q 4CI0B 1DG1G 4ES1A 4LF4J 3NKYA 1GH8A 1T6XA 1FTCA 2AWZA 4DDQA 4XO0A 3RGIA 2YNIA 4J9KA 4PG7A 1S0OA 2CC2A 5LMZA 4NLUA 4TLRA 4K4ZA 2DNPA 4LF9J 5CA5A 2M52A 3HSDA 3GTOC 1Q86T 1TUGB 3GTKA 3QX3A 1ZUNB 1GFWB 3OT9A 1GEHA 2DETA 2YNFA 3QSIA 4YMEA 2CQCA 2BYCA 4DR5J 1ZM2A 1QTMA 2CPZA 4DXLA 3PW5A 1JJCB 5C24B 2PFFB 4J91A 2XCAA 4RW9A 1T3NA 3HVTB 2MLXA 1ZM4A 2BDPA 1FE4A 2BPOA 3QJJA 2D41A 1RI7A 5EX3A 3NNCA 2W2PP 3X3UA 3DFEA 4C43A 4Y2MA 4Z7CA 1X31C 3HSZA 4LREA 2CNKB 4LF4F 1B4BA 4XNFA 1PJ6A 1L3VA 2VYQA 1B4SA 2R9LA 4IG0B 1TL3A 2CPEA 1U6FA 1VQPS 1JOEA 2YQ0A 3AHPA 4B9MA 2XGQA 1VRUB 4I4BA 4YAOA 1WKKA 3HFKA 3HMJG 3NE5B 3N6MA 2DNOA 2HHSA 1UWAA 3QLHB 4QIGA 1F9HA 2ZXIA 3WBJA 4Y2CA 4C9DA 5B0GA 4UOCA 2ZZFA 2DNHA 2Y1IA 5DO2A 5GAHI 4FZBA 2WW4A 3S7RA 3GTKC 4BY1K 3DOMB 3KJVB 3DYAA 2DGVA 3BJYA 5KOXA 4URGA 3ISXA 4IRCA 4KT0C 4DOZA 3MCMA 1A6LA 3POTB 1UAWA 1N07A 3L9ZA 2J7UA 4PPDA 2VQFJ 3BSOA 3TO8A 2CJ9A 3T9ZA 1HA3A 1Y3KA 3GQBA 4AL5A 2BJ7A 4JOUA 3A8IA 8RUCA 4J0QA 4NLSA 2UZAA 2JVOA 5HMYA 2HLDA 4CH7A 1RT4A 1TWHK 1G6BA 1C0UB 1JJ2B 3IMQJ 3NBPA 2KRRA 1TK8A 4KN4A 1S57A 4X65J 1TWAK 3V5RA 1PYTA 1TK5A 4E2FB 1R5BA 1C1BB 5KFEA 3M2VB 3HHLB 4A3CK 1N48A 3VGTA 5FNZA 1N52B 3AQPA 3MM7A 5IYBK 3CPWR 1TWGA 5I3UB 1G7TA 3BGOP 1C4CA 4XL9A 3GE9A 4DL0C 4K5SA 1WI8A 4JV5J 4ZP7A 2H48B 2OAUA 2VPXB 2VBUA 5KFCA 3S1NC 1XNQF 3FUYA 1IKWB 4RJVA 4OI0A 3L4BC 2BJ9A 3HK2A 3X1LB 3MXHP 1DY3A 4TNOA 4JI8J 4ZVPB 2XNRA 4RL1A 1FNXH 5D78A 2JA7C 4PWWA 2IMWP 1JA0A 2MSSA 2WYRA 1SFOK 1U1RA 5DS0A 4NCBA 4LFBF 1L3KA 4P5AA 4ZN1A 3DRPA 1VQKB 4RD1A 5KFOA 3PRDA 4RW4A 5AE2A 1T05B 4YR0A 4DUZJ 5F9LA 2QYGA 1NXIA 4ZVOB 2NXEA 1XXCA 4OINA 3M1VA 3IR5B 2V68A 2C2MB 1N5VA 2H5JB 2OTJS 3I5BA 3B8HA 4FXDA 3W5ZA 2NVYC 4XLHA 3BO2A 2AGPA 2QT7A 2O5JA 1GXUA 1XWLA 3W2IA 1HBUA 4XMYA 5L8RC 5IWAJ 1VQSA 1NJXA 1SKUB 3PHEA 3L7OA 4C2MA 3SFUA 2V94A 2B0GA 2KL8A 3PR5B 3CD0A 3EQLA 3GR0A 4C3HK 5TRDA 3OW7A 2LQ5A 4U8VA 1B0PA 1DCPA 4FXWA 3AB4B 1QGYA 1EP4B 2QO3A 1BJKA 2VZ9A 1R8AA 4FPRA 5CYJA 3MM9A 4DL5A 2FZKB 1W9XA 5LSLA 3PYEA 3DRSB 4MK7A 4HI1A 4JB8B 2YNFB 5B7WA 4I6WA 4TKOB 4LR7A 2GW8A 3WYAA 3S1QK 3TFHA 3LP0B 2ZVIA 4JV1A 1O2BA 4G7HA 2V9KA 2ZH2A 1G4CA 1CJTA 3I0SB 1HNWJ 4DUZF 1I6HK 4NYZA 4YHHJ 1WG5A 3QWPA 4C11A 1LXNA 2CKWA 3GLJA 4Y2AA 2GQCA 3MR7A 4F50A 3G71S 5KFBA 3BH6B 2DNQA 2BRLA 2XI3A 5KNLA 2XHCA 3ITHB 3GMGA 2JEGA 2FHJD 5J2MB 3TUJC 3CDBA 4RW6A 1PIEA 2BJEA 4AYBL 3S1RC 2CBXA 3I4NK 1M1KT 1WKLA 1YBTA 2MMYA 2Z2LA 4B9TA 4KIAA 4OLOA 2HWTA 3R5BA 1SUQB 3GTGA 1HBOA 5F8MA 5HBMA 2HHUA 2RNEA 4NZ0A 3VNVA 4Q2MA 1W2IA 2VJVA 2E29A 5FLMK 5IP7K 4CRJA 2IYIA 2O67A 2D9OA 5JVOA 4RDJA 2UXBJ 3GU0A 4QQBA 3FJ2A 2U1AA 4WTYA 4JI1F 1S1WA 4H4KA 3AH5A 3QJPA 5I3QA 2XY6A 2ZUGA 2PA8L 2BJDA 3FCHA 4QCLA 3PJ9A 4QYRA 1DCOA 1AXQA 2HYIB 3NGSA 1TWHA 5MAOA 2E44A 4RW8B 1VC5A 3LAJA 1BQNA 3HFZB 1J5OA 3ASTA 1JMTA 4H54A 4NLXA 5L9NA 3CCJS 1WC5A 3PYGA 4UZCA 2MJUA 1Z2ZA 1YTYA 2UUTA 1H2TZ 3I4MK 3D6MB 1SCJB 5HKKA 3ZNUA 1H6KX 4B3RJ 3WIUA 3GYNA 2PMDA 3CJSA 4TU9A 1BQNB 3HOWC 3J81U 2DO4A 3OREA 4H4MB 3IWXA 3W2WB 2LU1A 3VZIA 4HDHA 3DXBA 3S16C 2IYGA 1G7CA 1EQMA 3W9IA 3DLBA 4YDDB 2ZDOA 3KG0A 3SMZA 3NS5A 4X05A 1WEXA 1JNYA 5D15A 3EXYA 4NA2A 3CUNA 4K1XA 3G8QA 4C8LA 2RC6A 3HPOA 3UD4P 3DKDA 3NXZA 2KI2A 3V6HA 2H5EA 2B63C 2Z4PA 2HS4A 4OZNA 2XZDB 4YALA 1BLUA 1QSLA 1U47A 5A8RA 1FCAA 2GAHC 3KTQA 1PCAA 1H2UX 2XGJA 4OPSA 3RG6A 1J6XA 1FDDA 2XSJA 5KT2A 2ZM6J 4UUWA 3OZVA 5HP1A 5DM6Q 1FXRA 1HR0F 3ZBTA 1R8PA 1YCLA 5GAGU 4DR3J 4QVJA 2Q6BA 4HVZA 5KFKA 2CRLA 1WNEA 4LQYA 3CCJB 3H9NA 5HXBA 2HBQB 4R8UA 3VHQA 3T5JA 1J6VA 3HOYK 2GJFA 3HVAA 1AYEA 5C44C 3DLGA 1U0HA 3OR2B 2R7RA 3M6XA 2W25A 4OQJA 4LFBJ 3O5TB 4DV5F 1VQKS 1Y1WA 3GIMA 1N5QA 3MWBA 5HLFA 4MEXA 3QGPA 3RAQA 1Y1VC 3BSNA 3MAAA 1YLOA 2XO6A 3NAIA 3ZC3A 1Y1WK 3M8YA 1SJ3P 1N33F 2JA6K 2JLEA 3TJ8A 4KJIA 2FVCA 1S9GB 1UVMA 2YNHB 4NPOA 4JI2J 2Y1LB 1UETA 1TU0B 3Q86A 4OV1A 1S1UB 1WQFA 2BA9A 4EUVA 4ZS6A 2OK8A 4BBSC 2HQIA 4ZLLA 2MZQA 2W8KA 4WKYA 3AB2B 4GC7A 5RUBA 3CDEA 3P6YC 2A3JA 3GFYA 4QIWD 1XR6A 3KK1B 5JXSA 1SKRA 1MU2A 2R8IA 2VG7A 4NEZA 3DMJB 3MMBB 2NREA 4ZVHA 3IN5A 1WF2A 5B0DA 1WHXA 2JZ5A 1AROP 2HHWA 4LFCJ 1HNXF 1FT8A 2IA0A 1M90D 2XWYA 2J0SD 4PPZA 2B63A 1Q82D 4TQSA 5BR8J 4GO7X 1QY7A 1M1GA 2MKSA 3MECB 1RTDA 1FDBA 3JB9k 1UP1A 2V0NA 4ES3A 4DV0F 1LKZA 1U1OA 3D2WA 2BX6A 1RT7B 1NJWA 2MLZA 2HG4A 3QRRA 3O44A 3M2RB 3PZPA 1H0HB 4AFFA 3ZZOA 2JJ2A 7FDRA 5BYSA 5LSOA 2OTJB 2OD6A 4ANDA 4DX7A 2XHWA 3W3SA 4OIPA 1GAOA 2E2HA 3LVBA 5F9NA 1KONA 2VBXA 3W5XA 1QLNA 3ISNC 5HROB 4IH7A 1RHKB 2MYFA 2FVQA 1IKVB 1TTHB 3SXLA 1JLCB 2QA1A 3GTGK 4J9LA 3LF0A 1K9MD 3N79A 2GGPA 5IYDC 2HHQA 2D69A 2FVGA 4Y65A 1CULA 4A8XA 4B3GA 3EYZA 1NDCA 3LO3A 4J9OA 4LF5J 1FFWB 2K1RB 4NXNF 2CQ3A 1YGYA 3FRZA 3M8ZA 5M5WK 5ETNA 2ZJPQ 4FS1A 1F6TA 2ROGA 3MR3A 3BBCA 5A2QY 1HD0A 1TAUA 2X53S 1QE1A 1FJCA 1HARA 1B64A 5JMNA 4DL6A 1NSPA 3BQ2A 1VBKA 2DR9A 3NEKA 1XZPA 5ETLA 1XNRJ 3KFWX 5C4XC 5A6WA 1WG4A 1RJJA 3CCUB 4PXBA 3BGRA 1R5NA 3SLNA 3BO3A 1KMHA 1RAAB 4OZ3A 4FYWB 5T7LA 2ZOMA 3FMWA 2ATCB 3KUHA 3UFCX 2EC0A 1W25A 4DSJA 3GSDA 1WD6A 5C2CA 2VUMA 3SLDA 4AQYF 4UZEA 3I1FA 3DLJA 4DV4J 2R7OA 4NX9A 1Q16B 1J5OB 2VJIA 1XK8A 3PDNA 1A7GE 4KR0B 1IKXB 3FEYB 3VAJA 3SI8A 4ZCMA 3T00A 2MQLA 4W92B 2PMWA 3OTEA 1WELA 3AA8A 1LV5A 2MQNA 3I96A 3OW2R 1T3OA 4RW8A 4RZRA 4L72B 1Q8IA 3M30A 5IQQA 4Y34A 1Q81T 2DHSA 4FKXA 3OTCA 3NGTA 1GJRA 4G3IA 3CXCB 2WB1L 4EO6A 2CFAB 1Z2LA 4KGXB 3JYTB 2VNHA 3E51A 3MTKA 5FLXY 3S14K 5C24A 2HQGA 4C2MC 2YU9C 5KOWA 3MCNA 1EQRA 4M4SA 1JNRB 2KO1A 5M5XK 1QDUB 4ED0A 3HVTA 2R42A 2GIRA 5KG0A 5IT4A 3DM2A 7AT1B 3CCRS 4IDKA 4XLNA 1PKUA 4DLEA 4LFAF 2B4PA 3I56B 1TKZA 4I2PB 4NXMJ 5C4JK 1NZ8A 1U2FA 3N01A 1UVKA 3OTOJ 2EW9A 2HFOA 2LMIA 2CZ4A 1G2EA 2CNOB 2HEKA 4L3KA 4ETZA 1VF7A 2HVHA 2ZEJA 2J9DA 4DN9A 2V34A 3IWNC 3HI9A 3RU0A 2WOMA 4MIWA 5D3GB 1Q7LB 3LOUA 1EP2B 4USIA 4I67A 4OZ5A 1D0EA 1C1CA 4ZGQB 5IFMA 3MCSA 1KVKA 4X65F 2MGZB 3DHWC 2DR7A 1U2CA 2OP5A 5JFEA 3B4MA 3OD2A 5HP1B 2LDYA 1AFIA 1UJ6A 1DD5A 3OUYB 2EFPA 3TW0A 4PEOA 2GJPA 3NL0A 3O3LA 3QO9A 4ZJQA 2ZHBA 2EK6A 2V63A 4OX8A 1S48A 1WHVA 3UN5A 2VFRA 3HM9A 3IRXA 3OOCA 4A8OA 1TUWA 3A35A 3GV7B 2XMVA 1UVNA 3CWJA 2A1BA 4A3GK 2NVXK 3ADAC 1JQWA 5CCMA 4WFBQ 2NVTC 3UD5A 4TVAB 3AVVA 4PWUA 3V7AA 4YOEA 3MM8B 2GSNA 1OB2A 3A3GA 3DMJA 3CMES 4OIRA 2X3GA 3JYTA 4IH6A 4M63A 5B0BA 2W2QP 1HNZF 2OEKA 1Y0YA 2KXHA 2XB2D 1EHWA 1KRPA 4HE6A 4ZP8A 2RJZA 2Y0BB 3SCLE 3GTPC 2UUWA 3HOZK 4ZPBA 4A8KA 4ED7A 2KM8B 4LJZA 2D9RA 5J35A 1OPZA 1TWCA 1EWYA 1S9GA 4K0KJ 2GMHA 2NVXA 3G6ES 2BJ3A 2AD9A 2Q6IA 4QWEA 2H65B 2W01A 1K8AD 1S0VA 4ALZA 5EWGA 2D6FC 3GTQC 1HYSA 5TR9A 1JWWA 1RA7A 4O23A 1D8TA 5DLGA 3BGRB 4OI3A 3CQZA 3NCQA 3AA9A 2VFSA 1X4FA 3KK2A 4PYDA 4G6VB 2JA5K 2RGRA 1TWFA 2R7XA 3ILIA 1N06A 2QZ8A 1REVB 2ZNYA 4OYBA 5ETTA 2JA7A 2W4DA 4K5RA 2C2DA 1YNNA 3V6DB 1R0AA 4DV3J 5L1JA 2E5LF 1I18A 3RBDA 3Q23A 4P2FA 3LPYA 1K1SA 1Q9SA 4I2QB 2CYYA 4EFAC 1D9FA 3HULA 4OJ3A 5K8OA 3G4SB 2CQHA 2NR0A 4ECZA 1N08A 2IJNA 1RWKB 2VICA 3BREA 1G3OA 2MQQA 1XMQJ 1B2RA 5E33A 4O3PA 4KMHA 1RKJA 3SEJA 3PO5A 2I9SA 1QGAA 3JTOA 1NKEA 3OLBA 2K7JA 3D0HE 3MFHA 2K1RA 4B9VA 2ABYA 1NKCA 5GV8A 3ITHA 4R71A 3CMQA 2W9CA 2J9EA 1UJ5A 3MM7B 4LBHA 4ZOSA 4A3DC 2PMZL 2LQ8A 2YWFA 3FOFA 1WC1A 2WCXA 2X6WA 1KHWA 3JXOA 1IKVA 2VNIA 1WC4A 2RUGA 4ID5A 1R8HA 4CWBA 1HNIA 3MPWA 1R3NA 1CVJA 3ZZ0A 2HKEA 2OFGX 2BE2A 2MGZA 2CJKA 4IOCQ 3M9MB 1LFWA 4HHHA 3G82B 4RM0A 3H40A 3R5DA 2HFNA 2F40A 2IAJA 4Z4VA 3V6DA 1KFDA 3HZEA 2WAQD 3EPGA 1OJ4A 1BGXT 4BWJA 1NHUA 4IG3B 4GQNA 2PFDA 1OQ3A 1VQ7B 4HDGA 1BJTA 1WF0A 2MQ8A 2XS5A 3OL9A 1FX0A 4XOTA 3PR4A 2EFGA 3LANA 3R5AA 2HHXA 1S6QA 1XMOJ 1FNOA 5K14B 2BJ8A 1FXDA 2ZM6F 3S2HK 1Q0NA 1UZHA 2XTJP 2YWGA 2RU9A 4LF6F 4JP8A 2GK7A 4A93C 5IM0A 3LH2S 1BX0A 1T7PA 5IT0A 4LMZA 3O8WA 2BRKA 4EYIB 2UXDF 5IT9U 3IBFB 3OFFA 2GVDA 1SH3A 4G7XA 3BSCA 2VL1A 4DCOB 4DF8A 3S17K 3VAHA 2B7BA 4I6YA 2DNNA 2FX3A 5M2PA 3EMTA 4GTLA 5FO0A 4KQZA 3W5YA 4RBTA 2AZ3A 5HBMB 4N3GA 4ZK7M 1VH2A 1X5PA 3K7AK 4ZVUB 1W87A 3HOVK 1YJVA 2JOQA 5K8PA 1CC8A 3CCMS 2XZTB 1IM4A 4RW4B 2EG2A 4USTA 4Y52K 5D0HA 1F60A 5K14A 3H8YA 2Z6BD 4O4RA 4NLVA 4O3RA 1S6QB 2QN6A 3TP2A 1S6OA 2VASA 3LQ6A 4QWBA 1S1VB 2K2PA 2B9EA 2V6SA 4ZPCA 4XTTA 2B6AB 2CPXA 4YAWA 3IWLA 4F0MA 2UUAJ 4JI0J 1I51B 1F9EB 1GMUA 5F0UA 2XGPA 1F5AA 1JLEB 3VO2A 1OMSA 3PXGa 1PSDA 4CO4A 3LW5C 3H3VL 2KT2A 4K4YA 2E9TA 2IVYA 3G82A 3C46A 3ELHA 4U7UK 4J9RA 3G6VA 3V4IA 1U0SA 3QFCA 5CHPA 2ZWOA 5KSWB 3ULHA 4FP9A 1T9YA 3KLEA 2V2VA 2AV5A 4EGLA 5EDWA 2KYZA 3MMLB 3TUIC 3S2DK 1IBCB 1OY8A 2F4VF 4OOSA 2Q6OA 3NG8A 3RZDC 2M5YA 4Y6IA 2UUAF 1AZSA 3L95X 3QFHA 4E0DA 2I1LA 2DYIA 2XMJA 1RT4B 1R0AB 4NRUA 2ZH3A 2XCQA 4A3EK 3F56A 1UMJA 4Y2IA 1REVA 2OPPB 1R9TA 4K59A 4C8YA 1TKTA 2R8HA 4QIEA 3DDYA 2F63A 2VUMK 2M5SA 4UZUA 1VQYA 1RCOB 2W24A 3V81B 3BBBA 2A0FB 2AJFE 4X66J 4DJBA 4XD7A 3R97A 1MWYA 2A69A 4X7FA 3V76A 3D6HB 5LM7E 3KLGA 1TWCC 2WSCC 3W2WA 3EWGA 1RT5A 1Y0RA 1SKSA 4ZLPA 4J9VA 2CVIA 4DFMA 4ZPTR 3RRGA 1B70B 2ALZA 1KLNA 2V4DA 3NY0A 2HLUA 1GXLA 3PW7A 3W7BA 5AT1B 2QL7B 4U6PA 2XC9A 1O29A 2DRDA 3CJRA 2PE8A 4DV6J 1VBYA 4OIXA 1M5VC 4CNYA 2H4YB 1XR7A 1RT1A 4XSZA 4V1Ak 3MM6B 4ECUA 5E68A 4FWTA 4NCGB 3JSYA 3G87A 1NHKL 4USKA 2R7SA 3HXAA 2CW0A 3G86A 2KXFA 4J37A 3HT0A 2IDLA 1RZMA 4DV7F 3T1HJ 4WXOA 4KE5A 3GB0A 3QJLA 3D4JA 3Q8SB 2R8KA 3CDWA 4NLGA 3VGUA 4ETXA 3UPFA 3DLHA 4EWTA 3H4DA 3J7ZT 4ED6A 4N7TA 2ASYA 4PCQA 3NNHA 4QR0A 1V0EA 3HD2A 2RRBA 2RILA 3KLHA 2F8HA 1VMBA 1SH2A 1YG0A 3JU4A 2Y9HA 1U1PA 2M3DA 2C3OA 1RTHB 3CO0P 1U1LA 3TAPA 2FLPA 1DJ0A 1TZ0A 3MAAB 2H9ZA 5HVFA 5J2MA 5D77A 5LMUF 2EVZA 5J2NB 2AGQA 1VQ7S 2P9GA 4RPDA 2KHCA 2LU2A 2EI5A 5DLFA 1KHVA 3LO8A 4DSKA 1QM9A 2WHOA 4UZFA 3GCWP 1XQIA 5FL7A 3GTJC 7FD1A 1L0WA 1PG5B 3HOZC 4RCYA 2P8IA 3HOUC 1PAEX 2HMIA 4WYWA 4X0CA 2JJ1A 1R0BG 4JYAF 4H4OB 5CCLA 4C6AA 4FF2A 4Z7YA 1SFOC 5HMWA 3M2RA 4GTFA 4DPWA 3LP0A 5JVHQ 3D1HA 2AJ1A 3LP1B 3OFGA 4OYIA 3D9BA 1VQMB 5LXRA 5CYQA 3VGVA 2Z57B 3NUHA 2VD3A 1HVXA 3QFRA 2IPOB 3KDOA 2Z0GA 1QVGR 2L48A 1IS1A 4YFXA 2XSJB 3BCFA 4NLYA 3LQEA 3CW2A 1HLWA 4DZDA 4M5JA 2E1RA 4EBEA 4IUFA 3EM1A 3P27A 1CLFA 1U09A 2CPJA 4J9QA 4M53A 1COWA 4LBVA 4FS2A 3GFXA 1DFDA 3WNBA 3BF4A 2NXNA 4YY3J 3I55S 1CJKB 1VHFA 2CFAA 3PIOQ 4XN0A 2UXCJ 4RNFA 2OJ3A 4N76A 2E2HK 2GVDB 1I94F 3DLKB 2E2IK 4WU3A 3T6JA 5L38A 3PNIA 4DDFA 3W2FA 3OTOF 2PI5A 4XLCA 3KHGA 2V9WA 1S4EA 3M8WA 2GX8A 3GJRB 1ICEB 2ZUFA 2BGIA 1JLFB 4GKKF 3Q6RA 4NLDA 1U25A 2V67A 3PX4A 3AXKA 2NCKL 2OYNA 2AEMA 1U49A 2DPIA 3MEDA 1X9WA 3DRPB 4ACBA 4LK1A 4IG3A 2JN9A 1HQMA 2EBEA 5J2QB 2ZUAA 4IR1A 3AJ1A 4YB7A 1ZTWA 5GMDA 2RDDA 5TY0A 1RE1B 4ECRA 2AU0A 4QJVB 1HWUA 1NH7A 2JFDA 2HLTA 3BPSP 2EFOA 1HHQA 5KFXA 2WVCA 1EETB 4J9PA 5T7LB 2J8AA 3N0CA 1W0KA 4II2A 3H98A 4PG5A 1IJFA 2V4JA 1M5HA 2R93K 2HNDB 2HZCA 1FDRA 3NAHA 1FFGB 4NZ6A 3TEHB 3R7BB 4OYPA 1IL2A 2G13A 4N41A 1HNIB 1C4AA 1KK2A 3MOZA 2E1PA 4YB5A 1R89A 1JXLA 4LR2A 3KHLA 1O25A 1X4EA 1SFOA 4RUAA 1HBOB 4Y9UA 1NDLA 5EGEA 1NH8A 1QVGB 4ID5B 4B08A 4P6YA 4EU0A 1C0UA 1TKXB 3FNNA 2HBZB 4A3FK 3FHZA 1GMVA 2QTLA 4CLUA 3KHHA 2JA6A 1GE9A 3PO3K 3EVMA 3K7AC 1CULB 3H0GA 3U6KA 2Y3YA 4M5LA 1RA6A 2OBRA 3OZUA 4ZCLA 2BE5A 1NK5A 1RYSA 3Q8VA 3ASPA 5HROA 1RTJA 5KT5A 3N6LA 3UQSA 2V8VA 3OE7A 4QW8A 3AD9C 5GAEI 1VK8A 2DCUB 2BOAA 3PRVA 4LIRA 2DR5A 3D66A 2CJQA 2L3MA 1YBUA 1T94A 2A6EA 2ZUEA 3QGIA 4OX7A 2KG1A 4NE9C 1QJHA 3CD5A 4K7QA 3G71B 4NLOA 2XCRB 3BKUA 3ES9A 3PACA 2QIFA 2FVRA 3EICA 2ZFHA 4NLQA 1RT1B 4ZIVA 1HYSB 1QUPA 2FLNA 2Z58B 4MKVA 2OHDA 1IB0A 5E6TA 2B9XA 4C0SA 2YWHA 3VAFA 2RC5A 1Q78A 5HMXA 5D4DA 1R8CA 4OJ1A 3HAGA 4Z1MA 1DAXA 1B7FA 3P4UB 1T95A 1WOOA 2JA8K 2C22A 2YVSA 4OPVA 3WBKA 3RR7A 2FJVA 1MU2B 3K5MA 5LL6d 3CC2S 4ED5A 3OSNA 3Q22A 3D67A 3N0VA 3IP0A 2LP4A 4K50A 2PEBA 4P2MA 3VVTA 1K47A 5F0WA 3PCOB 5I4MA 3NRBA 5CQGA 4ACAA 2VOOA 2VU5A 5EGYA 4UQTA 4RWWA 2ZH6A 2F8MA 3G6XA 2V7VA 3BGFA 5DG7A 2HVDA 2HRYA 3PKYA 5F8NA 2BVNA 3AOBA 3HHNB 2Q6KA 3C6UB 2FQQB 2V2KA 4Y3CA 1WJ9A 5DZ6A 5KG3A 3CGIA 3R7SB 4C8MA 1YJ9B 5TMCA 2FY1A 2W9BB 1DBDA 3RZAA 4I6AA 1J5EJ 2M8DB 4E0FA 1E1RA 3U1NA 4UQGA 2YNIB 3B4DA 3JSTA 2J8SA 2GMLA 3U02A 2QA4S 4O44B 2OPRB 4I68A 4R8UB 3GTLK 2XO7A 1MN7A 1O51A 4NXNJ 4DPTA 1RLDA 4ZVGA 3AD7C 3BY2A 4LF5F 5JBQA 4ED2A 2XZPA 2RQ4A 2RHQB 4C0BA 1E79A 4WCEQ 4A48A 3PEJA 4UTGA 3G2XA 3GFZA 2CNDA 2PPBA 1KP6A 1UEVA 2HNYB 5CH7B 4B3MF 4L3NA 4LBYA 4KB7A 1EAYC 3JTPA 3QRQA 2DB1A 1L3TA 3B78A 2IBKA 1KQKA 3UCGA 3TYTA 2QN6B 2R7QA 4KAWX 4RD0A 4BLBA 4IO1A 4LF6J 4G0WA 1IWAA 2MKYA 2J6SA 2A6OA 4WJ3M 4OHYA 2OO4A 3M3YC 2IHR1 1YWXA 2QEXB 3H25A 4WYLA 3OJXA 1S1TA 3A8EA 3WNDA 1YJUA 1D9AA 4DV7J 2WVDA 4CQJA 2XG8A 3AD8C 4FYXB 4X4SA 1MNEA 1O28A 4QHYA 2C3UA 2DRBA 4DI6A 3MPVA 2V8PA 2CQ0A 4JV0A 2E2HC 5KG5A 4BY1C 2V31A 3LAPA 3RY8A 1RAEB 1WP6A 1AUDA 5GV7A 1P4MA 1O24A 4ECYA 2V7QA 3PRBA 3ENWA 4DV6F 4NMXA 3DOMA 3HOYC 2ZTGA 5IYWA 1S9EA 4KPCA 1ZBTA 2R6HA 3DU5A 2X1AA 2RRAA 3EE3A 3I0RA 2VKZG 1NDHA 2HK3A 1VQ4S 2DNLA 5E3AA 1MABA 3UVJA 1M0SA 4RKUC 4RDLA 1CG2A 3M9NB 1NSAA 2DEIA 3GEHA 4GTEA 1F3VA 2BXJA 3Q8YA 2B51A 4G1QA 3CNQP 4ZHRB 2NZCA 2Z30B 5A0YA 1GR1A 4Q8EA 3KG1A 1FWLA 4LFAJ 2Y8WA 2DGWA 2YKAA 1KS2A 4RCZA 3ZFVA 3LGNA 2QLJB 3J80Y 3HKZL 3GPAA 4PR6A 4X6AC 2BQUA 4PXCA 1TV6B 2RHSB 1LK5A 5EMNA 3CCQB 5A8KB 1R7IA 3M8SA 4GVBB 1BDFA 2KKHA 3H0GK 2O01C 4P6QA 1ZQ1C 2YH1A 4XPCA 3WODA 3CC4B 4C3HC 3H90A 3T1AA 3C3LA 2EBGA 5FJ8K 1SMYA 1TWAC 4P7TA 4ZPVR 2DY9A 5K9FA 4A3CC 1KKHA 5FJ4A 1NPKA 4XKWA 4RBUA 1HMVA 1SH0A 2VA2A 1QAJA 5J1PA 4OYWA 3QSYB 2FLLA 2DERA 4RUHA 1MN9A 5F3TA 3GYGA 1AFJA 1TLLA 4KKOB 3VAKA 3EZ5A 4P9SA 4FF3A 1NB9A 4J7CA 5DS7A 4C3KA 4DQRA 2A68A 4KH1B 4NA3A 1V5VA 3RB0A 2UXCF 4KH0B 4YHBA 1S72B 2Q43A 3R1HA 1TUIA 1I1GA 5LT5A 1TTTA 4YY3F 2OIHA 4HACB 5IXUA 4M5GA 1TMJA 3POTA 2OTLB 1Q79A 1VS3A 2QGGA 4TN2A 1QFZA 1BWEA 3R6JA 1RU1A 3OZWA 2VDHA 2H3EB 2W9BA 4TU8A 3RAMA 1T9WA 2MKHA 4Q2LA 2CPFA 3C14A 4OYMA 3TVYA 3IBWA 4HEA9 3MUMP 3J7A1 5F41A 2WW8A 4YEJA 2SXLA 2YKPA 3VQSA 4ICLA 3UNGC 2R2UA 3SZ2A 1J9ZA 2ZKTA 4HE5A 1B99A 2YBVA 3VCDA 4UY85 4JK1A 2CK3A 3DC2A 1LXJA 3QFSA 2ZC4A 1R27B 2G1DA 4M8LA 3QT6A 2APOA 3V6JA 5KG1A 1C2PA 2XLJA 4G5GA 4ASUA 2O5IA 1HI8A 1XMBA 1F9FA 4P26A 4RPBA 2E5HA 5ETMA 2GFFA 1N0VC 2HQCA 3TZZA 5KFGA 4G65A 1KVJA 2W7OA 4DR2F 4EO8A 2C2EA 3LUYA 3H3VD 1CJUA 1EI6A 4ICLB 4QU7A 5C4XK 2W4CA 1PJ5A 1JLAA 2CQ4A 1U8SA 3K5OA 2WB1D 5CD4H 1IKXA 1T05A 3ZZYA 1MRZA 4A47A 3CMAB 2OD4A 1TWGK 1AB4A 1NJYA 1FD8A 1VQOB 2IRXA 1VCTA 1M1HA 3E01B 1CS4B 2C2OB 2WBMA 4Z4SA 1HWJA 5HLFB 2JC1A 4M5KA 3HHKA 1WKJA 1IBKF 5HO4A 1AMOA 4C7QA 2DCUA 4FNHA 4M0LA 2HQ3A 2JLGA 3OJSA 3PFOA 3ZTOA 1P6TA 2ZD1B 1GTEA 2ZNZA 5KFYA 2OPQB 4JI3J 2DGQA 4CTAB 4ILRA 4C0HA 3TA1A 2QMXA 5THXA 4J3NA 3KWMA 2WZNA 2VV5A 4FN5A 1YQHA 2LEPA 5FIUA 3FCVA 3Q89A 1XQBA 3M4OK 2CDRB 3QMQA 4K4WA 4A3IC 3CQZK 4MQ9A 1JQGA 4ZVTB 2ZE2A 2VBYA 3FFIB 1GK8A 2W7VA 2QE5A 5A8RB 5SUHA 1C1BA 2O3DA 4GC6A 2G1HA 1ZVUA 2ZBRA 4Z4RA 3MI7X 4R0JA 3S17C 2R92A 1QH0A 2MKKA 4MJKA 4LRBA 4USUA 2LQJA 5J3OA 4PQUB 2Z2ZA 1QUVA 1VDHA 2GIQA 3KG4A 2GZOA 3K8VA 4PG8A 2RQCA 3PUMA 5J1EA 4KASA 2FJEB 3IS9A 4JI5J 4YFNA 2AF6A 2D3NA 4A3JC 2QTWA 1XMQF 3CC7S 3T51B 3MMJA 1VC6A 3ZZUA 2JEIA 3MURP 1IJFB 2V4JB 2VG6A 4IOAQ 2YTCA 3N0BA 1R43A 1N8RT 5A0YB 1JNZB 4NCGA 4OZ2A 1UZDA 2OKQA 3TEGA 1HW8A 1UEKA 4ED1A 4ZMMA 3D0IE 4BXXK 5K20B 4M95A 4LK0A 1E3ZA 2F3JA 1WEYA 4HTJA 3LALA 2D7SA 3KMQA 3RZOK 3CW2C 3M8PA 3BDPA 3DNCA 3HHLC 1TKDA 4NOIA 3T1YJ 3GTQA 2CWKA 3AVUA 2RDJA 1UD8A 5KFPA 1YK9A 3JQPA 3GYXB 4R25A 1HR0J 4DPXA 3HKWA 1QG0A 3SZZA 3BZQA 3AODA 1B3TA 3S01A 3GTQK 2VC0A 3FSIA 1PYSB 3MM8A 2OK7A 4DSEA 1N6QB 2R7ZC 1Y4ZB 3GG1A 3H5SA 4WE1B 3KK1A 1OB5A 4P72A 5LMUJ 3EUNA 2Y1JA 4P2SA 1X8DA 1HWKA 5KFJA 1JA1A 3QGGA 4BBRC 3DLEB 5LJ3Y 1T11A 2F4FA 5GADU 2MQPA 1QGZA 2LVWA 1UWBB 4FBTA 4BDPA 1FD2A 4DFPA 5KFZA 5DJBA 4RW7A 3SJPA 4KHRA 3Q8QB 4KHPJ 4FYDA 4LBWA 4XLAA 3TWZA 2VONA 2B7CB 5A8WB 4NEYA 3R5GA 1LQ9A 3OXGA 4NLTA 2BR0A 2YX7A 1BXNA 2BJ1A 2N3OA 4QR1A 1DRZA 4Q7JB 5H59A 4J9NA 1KR4A 2YX4A 4OI6A 2DHXA 3FBBA 2I1RA 1VFJA 4J90A 2CPHA 2NVQC 4NLWA 2BVZA 1TKZB 4I2PA 4OLPA 2X51A 3W2VB 1L5UA 2GV1A 3KMSA 1XC9A 1RDRA 1JXVA 4PC6A 1SV5A 5L1IA 5HANA 3OEEA 2MJNA 3I55B 2F1MA 1P1TA 5L1LA 3DOLB 4OZ0A 2AJQA 4OIOA 1FJGJ 1EZZB 2RVJA 4KARA 3IO1A 3TX8A 3DM2B 2DNKA 4OJGA 3UWTA 3TZXA 2ZWPA 2BQ3A 3NMAA 4O0NA 3GVLA 3H0GC 2VBWA 3H4BA 4DF4A 3UCZP 1PC5A 1TL1B 4DR6J 1NLKL 4CYUA 1I8DA 1EH1A 1VQMS 3K59A 3KDNA 4YDXA 1VJSA 4XLEA 4F3MA 2O1PA 2KJVA 3FDSA 1F2GA 4CLKA 5C42B 1N6QA 3M8QA 1EFCA 3Q8PB 1RTIB 4DV2F 1VQOS 3CP8A 2ZBQA 2LA4A 2MZRA 5FA6A 2NVQK 5FO1A 3WHIA 3BN4A 3CCTA 1MROA 4W4MA 3KL9A 3IPJA 3HSJA 3C8YA 1QVFR 3RB4A 5KT4A 1HPZB 3M1VB 4WWSA 1URNA 2F9JA 2J9DE 2XS7A 4KKUA 2PE3A 3D26A 1I6VA 3P49B 4NBSA 4AD6A 2E5IA 1SC3B 1FTRA 4RPFA 4CLFA 1ZAWA 1FO1A 3S0XA 1FA0A 3IC1A 1Y5IB 2ZKUA 1DZ5A 1CQNA 3MOJB 4KYZA 4B3TF 1YI2B 1I6JA 2N4CA 3HHLD 2VQEJ 4GTCA 1OB0A 2JWNA 1J6WA 4P7VA 1VBZA 1RAGB 1UD3A 1FVQA 2I0XA 4B02A 1TKTB 1U0HB 3DLGB 3HVRA 5BSYA 2B3TB 3PEHA 3N5FA 3PV8A 1RCXB 2HNZB 1Q5YA 2VG5A 2M8HA 1HZEA 4DR4F 2QG9B 1EJ7L 3LGMA 1EB0A 4U67Q 3KXDA 2XEXA 2BMWA 1FRJA 4TN1A 3THPA 1VISA 4DQSA 4F2RA 3M7VA 5FDLA 3ZZZA 1M5OC 4K4UA 2R8GA 1WACA 4X7EA 4URQU 3LAKA 4A3MK 1E43A 4NI2A 5ITHA 2QLBB 2CVEA 4HH1A 3I87A 2C3PA 3ASSA 4P12A 2KH9A 2XZWA 1SKQA 4DK0A 2B8QA 2G9OA 1S0MA 5B0CA 2UUCJ 3RBXA 2FQTA 2JSXA 2AGOA 2DGOA 1XPPA 4YEAA 3K7RA 1P9YA 2JVRA 3I0SA 3MUTP 2DGUA 2EWHA 1ZZNA 2R7ZA 1JB0C 5HQLA 1BLIA 1B23P 5KG4A 4ANCA 2B6AA 2XMTA 2CADA 3HT3A 5IYCC 3EZUA 1X9SA 1OPIA 5C7PA 4TMZA 3ZZPA 4ZIWA 3A12A 1UEUA 4BC7A 1X5OA 3QLHA 1K44A 2FQOA 1EP4A 2Q3PA 1ZZFA 4EMDA 5HQMA 4DQIA 3H2UB 4TLQA 3R5JB 2DNGA
chains in the Genus database with same CATH topology
1V5VA 1VRQC 1XZPB 1XZQB 1PJ6A 3A8KA 1WSVA 1XZPA 1WSRA 4PAAA 1NRKA 3GEIA 3GEEA 3TFJA 3GIRA 2GAGC 4P9SA 3AD8C 1WORA 3ADAC 2GAHC 1VLOA 3AD7C 3TTGA 1YX2A 3A8IA 1XZQA 1VLYA 3TFHA 3GEHA 3GSIA 3AD9C 1PJ7A 1WOSA 1X31C 1WOOA 4PABA