3GIRA

Crystal structure of glycine cleavage system aminomethyltransferase t from bartonella henselae
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
361
Chain Sequence
SLKTLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALLKIGQSRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIALERVLLALQGPQAAAVLADAGLPGNELLFMQGFEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDITPDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFDGPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQRYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of glycine cleavage system aminomethyltransferase T from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Transferase
total genus 104
structure length 361
sequence length 361
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 3girA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 3girA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3girA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 3girA03
3TTGA 3TFIA 1WSVA 3A8JA 3AD7C 2GAHC 1YX2A 1WOOA 3GIRA 1WORA 1XZPA 1WOSA 1X31C 1XZPB 3A8KA 5L46A 3AD9C 3ADAC 2GAGC 3A8IA 1NRKA 1VLYA 4PABA 3AD8C 1XZQA 3TFJA 3GSIA 1VLOA 3GEHA 1PJ5A 4P9SA 1PJ6A 1XZQB 4PAAA 1PJ7A 3TFHA 1V5VA 1VRQC 3GEIA 3GEEA 1WOPA 1WSRA
chains in the Genus database with same CATH superfamily
3K89A 4HDGA 1VJWA 4DN9A 2CJYB 3FPKA 1XR7A 2E1PA 1WCMK 1W2BR 4YHHJ 2AEMA 5AN9A 2FJVA 2E2HC 2G0IA 1ITPA 4KH1B 4KGKA 1LWCA 3TEGA 2ZWPA 2ZDPA 2DBBA 1P4MA 4DV5F 3SI8A 2AYBA 3PVDA 1WKKA 1YJTA 1HNXF 4HR2A 5KG3A 1M5VC 1RTJA 3K7AC 5EN1A 4C11A 5J2NB 2DNGA 3W2WB 3NG8A 2HG4A 2VHGA 2GVDB 3SQOP 2J8AA 5JVGQ 4B3TJ 3H42A 2ZL5A 1VYAA 3AOBA 2O5IA 1DTTB 3DMJB 3KL9A 3KJFB 4K5RA 3K5NA 3TUJC 2IA0A 3NGKA 2O67A 1EP4B 3QRRA 1SM4A 5H59A 2F1LA 4O3RA 3BPSP 1QVFB 2XZLA 2VQFJ 1OPZA 5GAGI 3CC4S 5M2UA 2XMTA 2XC9A 4JBCA 4RZRA 2I1RA 1T9UA 4JI4J 4WK1A 3ICLA 2FVPA 4WFYA 3M4OK 1VHEA 4QIVA 1YK9A 3O5TB 4ID5B 2MQOA 1F5BA 4ZPDA 1RBAA 1EX8A 1SPBP 4J9OA 3GTMA 1UD3A 3MM7A 1R5OA 4CLYA 2HAFA 2EEYA 1QSYA 2BM0A 4P22A 2W4DA 1F0XA 1S4EA 1JLFA 2OD4A 1HQEA 2YX7A 2VONA 2W9AA 5K20B 1QM9A 2NXEA 4O44B 2WOMB 2NCKL 1RWOB 4GT9A 2CJ9A 1RWKB 3I5AA 5B0FA 2EXUA 4ZHRA 2VBWA 3S14C 1N5TA 2HSEB 3R6JA 2X7IA 3SJZA 1K73T 2HVDA 4OYZA 1FRXA 5L8RC 1CVJA 4GTDA 2Y8WA 4WTOB 5DDPC 2WB1L 1TKXB 3QFTA 4RD4A 4A8SA 3TA2A 1ZM2A 1T6ZA 3CCJB 3S01A 3HHLA 2IYIA 2DYIA 1F3VA 2ZL7A 3S2DK 2C2DA 4G65A 5HVHA 4X4UA 2QMUA 4XDCA 5AXKA 1ZTTA 2H9ZA 2FVSA 5K14A 1GXLA 5K8MA 2QMWA 1UD2A 1S9GA 4X07A 3NLCA 4HTIA 1BMFA 1U1KA 2XEXA 2P8IA 5E3RA 3GTQK 1JKHB 4A8MP 4WYWA 2IJFA 3TA1A 2ZM6F 1RT4A 2DH7A 2EC2A 2NYHA 4CRJA 2R7ZA 4DCOB 3I4MK 1WTHD 1URNA 2IFXA 1I6HK 1KOHA 2JA6A 3M9NB 4RBVA 1FJ7A 3GLJA 3CMES 3FEZA 1UVLA 1NK9A 1FD8A 4TMWA 2R7UA 2DEUA 3PX6A 2LXUA 1TK5A 1OGIA 1RAHB 1NUEA 4R0JA 4B47A 4DK1A 4CNZA 3TARA 4P2FA 4DQSA 1HBUB 3G9CA 4EO8A 3JTOA 1REGX 1YJ9B 4G7OA 3I0RA 2FTRA 1IKWA 3IR6B 3WX4A 4ICLA 4UQTA 3BSOA 2ZBUA 1IR2A 3TANA 4LF8J 4UT4A 2HBYB 3GONA 3M8QB 4RCZA 2OHDA 3F0NA 5C4JK 2UUAJ 4KMDA 4ECRA 3KLIB 3DU5A 1H2TZ 3W5XA 5HN0A 3KEWA 3CMAB 4F0MA 4M63A 1KLNA 2ZZTA 5EUHA 3KLFA 1QAXA 4C6AA 3KLVA 5K8OA 2DXDA 3VZIA 4WZTA 3KG0A 1CULB 3HJVA 3UI3A 2K3KA 2J0SD 1NK4A 2YX4A 5T7LB 2E7VA 3TVZA 4U8YA 3OJUA 3SZYA 1YZ6A 3P49B 4AFFA 3BN4A 2VPYB 1FF2A 4ZPCA 3OPFA 2UXBJ 1O0PA 1FK9B 4DPTA 1VQ4B 2K06A 3S1NC 4HHHA 2FLPA 3OEEA 2C2EA 5C24A 3MCNA 1VHOA 5E33A 1VLYA 1C1BB 4DN0A 2VDHA 3DNCA 1SKWA 5EX0A 3DLJA 4WBFA 5H5JA 3W5ZA 1YKWA 4JI8J 3CF5Q 4A3BK 2BQ3A 2ZD1A 1JJCB 4KH0B 4F0KA 2G1HA 2DR8A 4C48A 2JWNA 2R92K 1U48A 1NJWA 3M8PB 3N5FA 3GTJC 2XS7A 3UPFA 2R7SA 3AJDA 4ZCLA 1QLNA 2JVRA 1JNZB 5C3EK 2COLA 1BQNA 2HQDA 1EAYC 1JJ2R 1I18A 2HS0A 4Z2XA 1TWAK 3MEKA 1UVNA 4CLFA 5IORA 3G82B 4YDDB 2QGGA 1Y5NB 3J7Z5 3NNHA 4XLEA 4UZBA 3KHLA 3AFGA 3ZZ0A 1F3FA 1HFEL 2VFVA 1EI6A 2VJJA 1TKDA 4Z4YA 2BYCA 3I55B 1FTCA 3R2DJ 4JI7J 1N06A 4YB1P 2V63A 4ZV4A 1ZBTA 1IL2A 1ZA1B 4G1IA 4J7CA 3VAHA 3S16C 4G1QA 1GH8A 4TLQA 3GV5B 3H7HB 5KOWA 2YNHB 1JA0A 4CI0B 1OSDA 1Z4UA 1I5OB 4TY8A 4GTEA 5GV8A 6FDRA 2JH3A 3ZC4A 2RNEA 1MMDA 4Z4VA 1JLQA 1Y1VA 1R9TK 5HROA 4ZP7A 1KLMB 1QVGR 2XGPA 2W7PA 2UV8G 2B6AB 3OPKA 4DV0J 1Y1WK 5C42B 3TVYA 2AZ3A 1DURA 4OV1A 2CPZA 1LWEB 1FNXH 1OY8A 3BH6B 3KLEA 1XB2A 1QFZA 4L8JA 2PMDA 2ZEJA 4RCYA 1WTFA 4PC7A 2QN6A 2D3NA 4DV3J 3BZQA 4KGMA 3I0SB 4OYBA 4ES2A 1S48A 2VNIA 4JYAF 3DDNA 2ZH4A 2W9BA 2FGCA 5D0EA 1HNVB 2AEJA 3BF4A 3LQ6A 1R0AB 3VAJA 3GZ7A 4DR5F 4ITSA 4PQUA 1FJCA 3F41A 3CT9A 1HWUA 3FQLA 4WJ4A 2GSOA 2HDNB 2G4BA 4DEZA 3BGRB 4N8OA 1YNNA 3BQ0A 3CP8A 1XMQJ 4KGXB 4Q8FA 4XCHA 2XI2A 1DDIA 3IN5A 3RG6A 3G8SA 1AYEA 2K7JA 1EQRA 1S1UA 5A8KB 2OELA 4Y7NK 3VGVA 4V1Ak 4Q8EA 4C8LA 1EP3B 2HNYA 1SFOC 1QX4A 3JQMA 1N56A 3TUIC 2B8QA 2ASJA 1TUGB 4LFCJ 1LWXA 1FXRA 3SDEB 1DHMA 2ZKUA 3T00A 3KJVB 3IRXA 3QJPA 2OSQA 3LP0A 3OFGA 2RC5A 1HWKA 3VWSA 3NGDA 2HGLA 4P3IA 1RT1A 1Q8KA 3TFJA 5C25A 3BP8C 4CT9A 4A3DK 3TP2A 4OX9F 3BKFA 3PO2K 4A3LK 1HVXA 1TAQA 2D41A 3ONUA 4CO4A 5M2RA 4DXLA 1W87A 1L3VA 1WI6A 3W5UA 2M5SA 3CDBA 2HFUA 2BMWA 2N4CA 1E1RA 1ZA2B 2HGMA 3LTOA 2ZUEA 2WSSA 4FVMA 3MR7A 4IQMA 1YBUA 1J5OB 3US5A 3WIUA 1FWPA 2JA5K 1LK5A 3UQSA 4J9QA 5HZBA 4LSNB 2VNHA 2AW0A 1ZVUA 4WZQA 1B0PA 4KSEB 1PAEX 1IBMF 1Q81D 3DRXA 3RUBL 2WPDA 2MPUA 4E0FA 3M32A 2Z4PA 3IMQJ 2CQ4A 2DXEA 1SL0A 4MQ9A 2AYGA 5LMZA 1ZPWX 4LRBA 1GT8A 2Q6OA 3C16B 3N9UC 4M5HA 4LRAA 2VFUA 3OVAA 1NDHA 4Y65A 4R5PB 3TQ1A 4BBRK 4M5MA 5A6WA 4YB6A 2HIYA 1Y0HA 2I8EA 4P25A 4OL8A 1BX0A 3Q8SB 4NASA 4OIOA 2VG5A 1AUDA 1S9EA 4K0KF 4ZPAA 4P2SA 4AQYF 1S0UA 3MF5A 2FY1A 2GNKA 2OAUA 2ZBIA 4MAKA 3MAAB 4TMVA 1ZM4A 2AJ0A 2Q66A 3OFNA 4DU8A 1NRKA 5ETLA 1V3SA 3QFSA 1U45A 2B9XA 1D8ZA 3LAJA 1GAWA 2J0XA 2HRYA 1NK6A 5AT1B 2L41A 4LR8A 1F5AA 2E2IK 2VPWB 3PO4A 3MEEA 2GHVC 4OI4A 5F8JA 1FNDA 1WORA 4XKVA 4XTTA 2W9CB 3CD6S 3ETOA 3F73A 2BKPA 3OL9A 1GTEA 3N0BA 1S6QA 2B7BB 5KG5A 2XNRA 4USUA 1KVJA 2BSAA 4Z4SA 3PCOB 5B0CA 4DFPA 2LEPA 1YJ7A 4ZVOB 1P1LA 1XFOA 1QAIA 4USHA 5DS7A 1WG1A 2AF6A 1HBNB 2R2UA 2WAQD 1WCMC 4OZ5A 5F4JA 1UWBB 1GMUA 2FLOA 1K83A 3KHRA 3UCUP 4DPXA 4ANCA 2WSEC 3LAPA 3R5GA 4X64F 3IBCB 4LF9J 2MKKA 4L3KA 1NZAA 3CJKA 2CFXA 4ILLA 2ZOGA 1CNFA 2DH8A 2HCJB 4HACB 1M1KT 1WHVA 4RU2A 3M2RA 1EFRA 3HOUC 3RB3A 3WQPA 4Y2AA 3GTPA 2M9KA 5GMKa 4C0HA 2D9RA 3GCXP 1REVA 4GMKA 1GMWA 1RU0A 2DHAA 2K8GA 1XWLA 2NZCA 4B9UA 4H4KC 1U1RA 4P5BA 2NVXK 4XLAA 2IJRA 2LA4A 4QVJA 2QTZA 3SZZA 3R5BA 5E3PA 4Y7CA 1RHMB 1XR5A 2UUTA 3G05A 2HS3A 2A68A 5IYBK 4QIEA 1VQSA 1Q7YT 2GIRA 2PI4A 4KAIA 5H9EJ 1PSDA 4H54A 2LYVA 4LF5J 1HBMB 3WNCA 4X62J 2WB4A 4Q2MA 4OZLA 3MUMP 4LSLB 5AE1A 2XZOA 2RT3A 1EFWA 3H8YA 2VYQA 3MDFA 4CTAA 5KT4A 2WZNA 2BANA 4DV1F 4FF2A 4BXXC 1QGZA 1JLEA 3CTAA 4KMAA 4QU7A 1WHWA 3M8SA 4KMHA 3WDOA 3M3YK 4BLGA 2ZH9A 4IH6A 2FPHX 5D6GA 4FK8A 4TYAA 3LP1A 2DPJA 1KRHA 1IQTA 4WFNQ 4LIRA 1EFUA 5CYMB 3UN2A 3KYLA 2XZWA 1MW7A 3HX9A 4CQ1A 4TKOB 3GJSB 3ELHA 3FOEA 3UO0A 1X5TA 2AJ2A 2KXFA 2C1EB 1SH3A 4JI1F 1RSCA 2IYGA 5GADI 3GG0A 4OI0A 1K8AT 1W0KA 4ZPTR 4RW6A 2H65B 3UDLA 3A8JA 3QLHA 4DWIA 5ETOA 4C8YA 3R8YA 3UNGC 4I0WA 5DJBA 4C3HK 3K7RA 2YWFA 1NZ8A 2BM1A 1S59A 4K4TA 1HHTP 1H3DA 1QFYA 2OP5A 4UF4A 3RB0A 1HARA 2K2PA 1NJIT 2DPIA 3GTQC 1MNEA 1DLOB 2L48A 4LK0A 3CNQP 1K28D 2Y0BB 4ZVUB 3PA1A 3CD0A 1C0UB 3ET6A 4DZ6A 3AODA 2RB7A 3OVBA 1MWYA 1WSVA 1T03A 1VCTA 4P2XA 4A4JA 5EMNA 2F4FA 3CDWA 3GJTB 5KFOA 1QUFA 1DDGA 3DOLB 3EZOA 4YB5A 3GV7B 2HGNA 3P4UB 4L6V3 4A8FA 4DS4A 4JMQA 4CLKA 4B02A 1X5PA 2V68A 3D54A 2HQGA 2XNQA 5BJRA 1TR0A 2IBKA 4PC3A 5TMFA 3L4KA 1S1WA 3S1MK 2V8PA 5J1EA 4KKUA 4TU7A 5EGYA 4HKQA 5KFWA 3DRSB 1YZ7A 3JQJA 4OPVA 5C4JC 1QY7A 4UZEA 5TV2A 4Y2CA 1OS5A 3EJMA 1M90D 3W3SA 3S1TA 3RRHA 1HI1A 2M5YA 2KXNB 3DI6A 5E5NA 4GTFA 2E7XA 1H72C 2VQEJ 3JQQA 2DNMA 4RNFA 2ZUFA 4CO5A 1XMOF 1U8WA 2G13A 1BD6A 1S1VA 3OLBA 1IKYA 4YALA 3VNVA 3HSZA 1EKRA 1LW0A 4QJVA 2AJ1A 1CLFA 3CSKA 5IYCK 4JV2A 1HNIA 2BMBA 4DNRB 2M8HA 3POTB 5GAHI 4K4SA 2B9WA 3L09A 5KAKA 5F3ZA 3V4IA 2MTLA 3TAMB 2P6SA 3G8QA 5HJYA 3WHIA 3DLEB 5B0BA 1R31A 1ZZFA 2L9NA 1SKYB 3HVTA 2GQQA 3UR3C 2ZTNA 3ENQA 4NXMJ 3CCVB 2FJAB 1I50C 2VZ9A 2PD1A 5E68A 4DX7A 4AYBL 1KOOA 4CLTA 5A76A 2H5JB 3IA0A 3TJ8A 5F4MA 4WF9Q 5EWGA 2R92C 2V6TA 4A3CC 4NLQA 2V31A 5IYPA 4I6WA 3M8RA 2KVOA 3IR5B 2WTFA 4KY3A 1NSKL 2V4RA 3T5JA 2C2NA 2DGWA 3SFGA 4CNYA 3PHTA 3HI9A 3G6ES 1K9MT 3V4MA 5F4OA 2QC3A 3M2UA 2QZ8A 1TKZA 3A4TA 2VV5A 2B5JB 4ETZA 2FHJA 3FFIB 4DCPB 2HHHF 5FJ4A 4RL1A 2N3OA 1RAOA 2OPQA 3OR2B 4RM0A 1ZAVA 2LU1A 5TR9A 2ZNYA 4B3XA 2UXCF 4ENOA 3FKSA 2VFRA 2X3GA 2CW0A 4NEZA 4C8NA 2W2OP 2DH9A 1X7VA 5HATA 3SMZA 2CJKA 1OY9A 3BKTA 2ZZNA 1I3QA 4C2MC 2XCRB 3JQKA 5DZ6A 3HOVC 5GAEU 3T1HF 2O3DA 3TO8A 5LJ3Y 2JA7K 2BE2A 1IBAA 2Y8YA 2QLJB 2KG1A 1RHQB 3HFVA 3HAGA 3H94A 5M5WK 1RTDA 3VQSA 2RU9A 5BYRA 2E1AA 5D8HB 1NU4A 4P5AA 2I5JB 2F8EX 1FFWB 4CH0S 2BGJA 5BXIA 3IM8A 3AQPA 1RT7A 3GTGK 2JVOA 4LFAF 1Y1WC 2PFFB 1VJQA 3I4HX 3R5DA 1P1TA 2W7VA 3WC2A 1LWCB 1MWQA 4XSZA 3O6QA 4YR0A 2GS8A 1YJVA 2WVCA 4RDKA 5C44K 2MY8A 2R7RA 1HNXJ 2JIZA 2BE9B 1GXTA 4F67A 3QAEA 1Y10A 1RTJB 3RBEA 2CFAB 3GSIA 2Z8QA 3FSXA 3PHEA 4C11B 2YQ3A 2JA6K 4K4UA 5AJ3J 3ZNJ1 4F3MA 2I1LA 5IS2A 4BDPA 4KN7A 2GO9A 3G8TA 2F4VJ 4DLEA 2BE5A 2DGUA 4NWBA 1G7TA 4X2BA 1DY3A 2HZCA 2DT9A 3D0HE 4MIBA 2IVYA 1OQ3A 4OHZA 1VI7A 2ACMA 4A93K 4R0EA 2N7YA 3AD9C 5I3UA 4Y7NC 3MOZA 2Y3PA 3T01A 5LMNF 2DNYA 3HJFA 4DDQA 2VFSA 4WJBA 4U96A 4M53A 1AW0A 3IBWA 4RUBA 4EBDA 1SC3B 4ASUA 1TV6A 4X4VA 2B63A 1JQWA 1QUEA 3UWTA 3CCES 3GPAA 2R7TA 2X51A 4AL7A 3AGPA 4DZDA 4PYDA 3MPYA 1NAQA 2WJVA 2QTLA 2XLJA 7FDRA 4BWJA 1R6YA 4DSLA 1KMHA 4HHUA 3H40A 4IO1A 1FRLA 3MMBB 3T6BA 2KDOA 1TWCC 1JLFB 2QA4G 3R27A 2UP1A 1HQEB 5LJ5Y 5KFUA 4A3LC 1JLBA 2K1RB 4NL5A 3ASPA 2QEXS 4DQPA 5B6IA 3CVKA 1RWWB 4FM9A 4JI5F 2WR8A 2BACA 3ZZPA 4K7QA 4ZHRB 4DLGA 2NVTC 2CG4A 3ASRA 2IRYA 4FDFA 3K5MA 4IR9A 2SXLA 3BB5A 3M9OB 3THPA 2OPPA 1H74A 5LSRA 2JA5C 4A3IC 1HL6A 1TWGC 1ZBSA 3TRGA 4N8NA 4A3EK 1VQMS 4RD3A 1TWFC 2QMUB 3PG9A 1N8RD 1KD1T 3QFHA 4KDDA 5C7PA 2O5JA 3I56S 4YEJA 5K14B 3PW0A 3CO9A 1S9GB 3MURP 1GJRA 5KFEA 3R1HA 2QV6A 3PENA 3E3XA 3RRGA 4IH7A 1H7WA 3CC7S 2PE3A 2QLWA 1UETA 4QCLA 1AMOA 1M5HA 3QMQA 3AH5A 2CZ4A 4XLHA 1Z1ZA 3KKFA 2MY7A 2C3UA 4QYRA 1K8AD 3VCDA 3KLHA 3MPUB 3RZOK 1XNRF 3FDSA 4E98A 1JMTA 2YNGA 1IB0A 3VAKA 3OREA 4Z7CA 1YRTA 1GR1A 2HVZA 1VR6A 3MHYA 1B4AA 4J37A 1VC5A 4N7TA 4OYAA 1OPIA 1KHWA 4DR4J 2KZMA 3J81j 2E2IC 2AHOA 4XSXA 4KHMA 5IP9C 3I0RB 1IKWB 3DXSX 5F8HA 1S12A 3D1HA 4ICLB 1TLLA 3E01A 4NLRA 2XI3A 3GR1A 3I6PA 1IM4A 1SJFA 1HNWF 4LF6F 4DF8A 4TKTA 3CUNA 1H73A 1UA0A 2RQ4A 3N0CA 1JJHA 1VHFA 5DQHA 5HMYA 1U1PA 4N3NA 2V8GA 3IP0A 1U1OA 5KFAA 3CDAA 3KLFB 1HLWA 5JFEA 4M0LA 4IUFA 2E9TA 2V6SA 1NDLA 4FKYA 1WC0A 1W34A 3DDYA 5DDQC 2YU9C 5KG2A 2QE5A 3HFZB 2XYPB 3CJRA 2D6FC 1Q5VA 5I3QA 4CO1A 1N08A 3HK2A 3ULHA 4UUXA 1J5EJ 4X84A 1WEXA 1JQGA 3AD7C 5GMDA 3CMEB 5C24B 1DTQA 2MQ8A 3K58A 4Q7JB 2G0JA 3T41A 1PIEA 3WBZA 3M8ZA 2XGQA 2J7UA 1QGAA 3GCWP 4RW4A 5M3FK 1D0EA 3C15A 1TK8A 4UQGA 1SCJB 2ZH3A 4NCBA 2CXEA 2ZD1B 2MGZA 2NVXC 2XSFA 3T5HA 1UW9A 5HJXA 4G7XA 3G87A 3WODA 5J2MA 4JI0F 3Q6RA 1KC8T 2GVDA 4C0OC 4DPUA 5IYBC 2XLIA 3W5HA 1EB0A 1FWLA 4RKUC 1V9OA 1BQNB 1DTTA 3DMJA 3LGMA 2QO3A 4YXWA 2ALYB 2NS1B 4X05A 2MQNA 2CA9A 4BHQA 2LLZA 5KFYA 4J9MA 4LT6A 1EKSA 2CJAA 5CHCB 1FNCA 2VC0A 1C4AA 3N6LA 4KTQA 1JB0C 2X1FA 3M3YC 3F56A 4ZP8A 5CDFA 4C7QA 3S1QK 5CYJA 5CD4A 1O51A 2QG9B 2DNOA 2VASA 4G1QB 2B7CA 1UD5A 3Q6QA 1K9MD 1Z2ZA 2YNFA 4TY8B 3SKBA 2Y0SD 5IT9U 5E7OB 4C3IK 3PW2A 3MFIA 3CPWB 1VHIA 2JA8K 2C42A 5ETTA 4RU9A 2MQQA 1JLQB 2PEBA 4XKWA 5IM0A 5HROB 3BCFA 4G0VA 1SMYA 4FF3A 2RRNA 4YAUA 2W2NP 4WWSA 5HBMB 1L3UA 1O2FB 4ZLPA 1UWAA 3SXLA 2B8PA 5KFHA 4QU6A 3KLEB 3H4BA 3EVMA 2OH2A 1E6YA 3V76A 3BQJA 2QN6B 1KBRA 4NI2A 2PI5A 1BGWA 1OQ6A 1U2FA 4JI2J 3D66A 2W9BB 3IC1A 4C3JC 1IE0A 4IOCQ 4AD6A 1FCAA 3IWLA 5TY0A 2LQJA 4DR5J 3VGTA 1WKLA 4PQUB 3LALA 3V6HA 1V0EA 1M5PC 1URRA 3CMAS 3AB2B 4YAWA 3T56B 3VR6A 1SI9A 5J2PA 2OK8A 2FQTA 3G6XA 2CQGA 3M6WA 3GFHA 2J6UA 3A3GA 4ECXA 1G7CB 5BYSA 3R5AA 1S1UB 4J91A 4A48A 2H5EA 4FXUA 3UR0A 4IG0B 4RJLA 2JRSA 4USJC 2HNYB 2YNIA 4Z4WA 4II3A 4P6VF 1EP2B 2U1AA 2Q6CA 4XM3A 3NNCA 1VQ4S 3PW5A 2CQCA 2Y3YA 4RPFA 1FDAA 2WAQL 4UY8T 3IRXB 3H25A 1FX0A 3LP0B 2KFNA 3S1RK 4EEYA 1RT1B 1VQPS 5C25B 2UU9F 1HBUA 3A1YG 1KQSR 2EG1A 1K83K 1TKTA 1JOEA 3HHKA 4C8OA 1R27B 2BOPA 1N32F 3T6JA 4WQMA 3CE8A 3CC2B 5CCLA 2GZOA 3BNWA 3KNAA 3AVWA 1W2BB 5HMXA 3W9IA 3CCQB 3KLIA 4O3SA 3GTPK 1X5OA 4HE5A 2VICA 4RWXA 3J7YU 1HNZF 3PO3K 3L95X 4G6IA 4Y9UA 5HO4A 4B3OA 3LPYA 3HPOA 3UW1A 4AH6A 1YJNB 3ENVA 4OHYA 4MK8A 2W1BA 3ETMA 3M32B 4FN5A 4OZ2A 3I55S 4Y52C 3T19A 4MEXA 4DQKA 1FDDA 4MK9A 1FK9A 1WP6A 2VBYA 3CCSS 2BPOA 3M8WA 4EWTA 2VUMC 4C43A 1FESA 1UV7A 2VBZA 2CJQA 1SQFA 4WTYA 4B3RJ 5E2QA 5HI7A 4O0NA 3AVUA 3C3LA 2OIHA 2NREA 3MCMA 3GTMC 3D9BA 2PT0A 1S9EB 4KHPJ 4OJHA 4RNMA 4BY1K 2E9ZA 4AQYJ 3DXBA 3PA2A 2WB1D 4MIWA 1OSCA 2CZ9A 4LF2A 2CNNB 2M2BA 3BSNA 4YHBA 2DJWA 1HQ2A 1RT6A 4J90A 4YMEA 2AX1A 4OZJA 4X4OA 4ILDA 2X53S 4WYLA 1FT8A 2BVNA 1SL2A 2GCFA 1EJ7L 2PDAA 1H7XA 3LF0A 1Y0YA 1HQMA 2PE8A 3N79A 3BQ2A 4EU0A 1UJ4A 2XZPA 2Y1RI 4J9PA 1S6QB 4P10A 1LW2A 3LGHA 4Q7AA 3NOGA 5H9EK 2CPEA 4DSJA 2ZUGA 3HHLC 2PMZD 4FF1A 1N54B 4A8YA 3BGOP 1Q0NA 1YTYA 3OW2R 1BLIA 3OXGA 3BGLA 4HL9A 2BDPA 3OJXA 4B48A 4DBQA 3HOYK 2NVYK 2PHCB 2DR6A 2EI5A 2HEKA 4ED3A 1WC5A 1QTMA 5JBQA 4A3KK 2FQQB 4X64J 2DGXA 1Y3KA 2RMLA 1RAGB 5C44C 4QPXA 1QFJA 2KU7A 3CJKB 1R0CB 3A3OB 4NX9A 3WY9A 2J9CA 2QL7B 4M5NA 3BO4A 4LBIA 2R7ZC 1KLMA 3KLGA 3BSCA 2VBXA 4AXIA 1VMBA 2GGPB 3RB4A 4W98A 3CW2A 1IQZA 2C2RA 5CCMA 3LA0A 3L7PA 4ELTA 2VL1A 4LF4F 1REVB 5LXRA 3TAPA 2LQBA 2X6XA 3KUEA 2R8HA 4LBYA 3OFFA 1TAUA 3UD3P 2FZKB 3X3UA 5IV4A 2XTJP 2ILZA 5HP1B 3GTKA 2KHDA 3CD6B 2LFVA 1UVKA 5HXBA 2M4MA 5KFIA 4CO2A 2HFVA 4P2MA 4C98A 2OBTA 4PQAA 2A1BA 1SXLA 2CQ2A 3GDZA 5F8MA 1UD4A 2DNLA 1KHVA 3QNWB 4A3FK 3Q2TC 2R9VA 2VF3A 3QGIA 3ZTRA 1J6WA 2OMOA 3FVYA 3Q38A 4HI1A 4ES1A 2RIJA 4LBPA 4ED0A 1COWA 1MMNA 5A8KA 3C2PA 1LOUA 4V19X 3J81Y 4GTAA 4PXDA 5BR8F 4CTAB 1V3RA 2BANB 4OIPA 2VC1A 3CO0P 4JI6F 4J5OA 3PVXA 1RAFB 3FKIA 2V2KA 3GFXA 4NLDA 1Y9OA 4NMLA 2FVGA 3EQLA 2RRAA 3DLBA 3LP1B 3SDEA 2MQLA 5E6TA 1R8HA 3D68A 2HHUA 2CYYA 5C4XK 3E2EA 4PGOA 1GE9A 1TWAA 3D0IE 4JI1J 4PAAA 4BPRA 3D1OA 4BC9A 2EKYA 2KVIA 2HFNA 4GVLA 4RW6B 1PILA 1SKRA 3QLHB 2UV8A 2DY1A 3I82A 4OYMA 4DV6F 2KL8A 1NDCA 3ILIA 5KG7A 1D1UA 2BN4A 4I6YA 1UAWA 2YKOA 2M88A 3PR5B 2AU0A 3LGNA 3MMCA 2ASDA 1IKVA 2JFKA 4RMFA 3B78A 3R2CJ 2H4YB 1FVSA 2XMWA 1U24A 2M7SA 1ZPVA 2ZFZA 3EPGA 5ETKA 2L9DA 3CMQA 1F5CA 4YFXA 3ET6B 1JNRB 4ZDNA 1R9TA 4F4YA 4NRUA 1JA1A 1QGYA 2F9JA 5ETVA 1T03B 4GTBA 1YX2A 2IRUA 3EVOA 2QMXA 1P9QC 2AMCB 1C0TA 4RPDA 2ZVIA 3N6MA 1J9ZA 1JJ2B 4CWBA 1ZAWA 4A3GK 1FJGF 3CJ2A 2R8JA 5IT9Y 1F9NA 4GC7A 5KFTA 1B7YB 1TL1A 4B9TA 1N88A 4RUHA 3P3DA 3VHQA 4L74A 1S1WB 3ILOA 4KIAA 5HL7Q 4B43A 1PYTA 5J1EB 4NPOA 1MN9A 3H20A 3IAS9 1HWIA 1VOMA 4QWCA 1G1XA 4G1PA 4OX8A 1Y1VC 3MUVP 3DRRA 3Q89A 3NBPB 4ZVRB 2XMJA 4N56A 4FZVA 2UXDF 4KO0B 3L7OA 5F8LA 2CC2A 3DI6B 4DUYJ 4F36A 4IW3B 3R3TA 3GU0A 3SEOA 4LR7A 3NAIA 2JJ1A 1QVGB 2ZJQQ 3PRBA 1S1VB 3OL7A 3CXCR 2MKJA 1IKYB 4AXJA 1BUXA 3H98A 1LW0B 4QJVB 4MT1A 4NCAA 3M2VA 3DGPA 3GEIA 4ED8A 2GSNA 3M6XA 3GVLA 1WG5A 3HSJA 3VAGA 3IPJA 3IXQA 4I2PA 3V4IB 3U1MA 4GC6A 2R93A 3VR1A 3K5OA 3TZYA 4QWAA 5IYNA 2IBOA 2LEBA 1VBZA 3VVUA 3HVTB 5FLXU 2NPFA 2DHGA 3TUZC 2OKQA 2IAJB 4P75A 1DRZA 2JJ2A 3ZBTA 4YOEA 3GTLK 1P27B 5B09A 1M5KC 1KRPA 1RB0A 2GQFA 1VQ9S 4PPZA 3RTVA 1AB8A 4U7UK 4RD2A 4HACA 2MYFA 1UD6A 2ZDOA 4O3OA 3CGIA 2CQ0A 3MPVA 2BKNA 4B3SF 1B99A 2PIAA 2EK1A 5A6PA 1GMVA 3KUGA 3K5LA 3FBBA 2KFZA 2P8TA 3OEHA 3FCWA 2M70A 2C3YA 1RBOB 5KT3A 1K0TA 3OLAA 2CF4A 2E5LJ 1FD2A 4GKKF 4IO9Q 3UCGA 3M2UB 1TKZB 4PC1A 3VALA 3EDRB 1YITB 4KPCA 2RAQA 3PM9A 2HHHJ 1TVCA 1U0HA 2OPQB 3VAIA 2EFVA 1VC6A 4IR1A 2UXCJ 2QLFB 4XMYA 1D09B 4CZCA 4OOXA 2KWAA 4GVBA 3GIMA 4ECTA 4MK7A 4QQBA 2BE2B 4DV7F 2V2ZA 1TVRA 1RGVA 4FXVA 2VBUA 3W8PA 1RTDB 2UVWA 2DHSA 1SC4B 3MXHP 1KDNA 1OMSA 3TR5A 5L1KA 1FFSB 5A8WA 2WBRA 3TEHB 3BH4A 3CJQA 1VIOA 4URSA 1F9FA 3J80Y 2QLBB 3RZDC 3SJPA 3H0PA 4ZA1A 5JJBA 4RNNA 5M2PA 4KN4A 4Z7YA 5EWEA 2LP4A 4CLPA 1E63A 4OLPA 2CKWA 1MROA 4AT1B 3S15C 3GFZA 1YSJA 4BS2A 1B7FA 2XNCA 1E64A 3HFKA 5KTQA 3CCTA 1NKCA 1VH2A 3G6EB 3BC9A 1D3WA 4WFZA 2GQCA 4DV2F 2MZ1A 4X65F 1S0MA 5KG0A 1DARA 2D3UA 3IWXA 1W9XA 1TWHA 4KRWA 1H8EA 5IYQA 1FDNA 5L46A 4QR1A 3MR5A 3I4NC 2IDLA 3VVTA 1D9DA 2HHTA 1KNZA 3SCKE 1UVJA 2W2QP 4AF6A 4V19J 1DLOA 5I3UB 5ADZA 3HHLD 2AWZA 5KFLA 1PG5B 4A8QA 3TVKA 4RW8B 1CJVB 3DN9A 4ZVSB 1AXQA 4A8WA 1RABB 3GTOC 2V2QA 1T9YA 1VJSA 3AOAA 1PO6A 1TV6B 2HLDA 1RWNB 3B4MA 3A8IA 5F3TA 4HE6A 2HNZA 2RF2A 3SZ2A 3TX8A 4AVZA 3H5SA 4Q4ZA 4PWUA 1B70B 4M94A 2NZ4A 7FD1A 8AT1B 1G3OA 3KJQB 3BDPA 2CPYA 4DUZJ 4U7CA 2KI2A 3RZAA 1K83C 2HQFA 4P1VA 3Q8PB 2JC1A 3AVTA 1XXCA 1TUIA 1FTRA 4UOCA 2C2WA 5L1IA 1JLBB 4X6AC 2GSUA 4J9RA 4YAFA 1KTQA 3QWUA 4NZ6A 3DRSA 3BY1A 2LQ8A 3L3CA 2CJXB 4A8XA 3ZIAA 3U6KA 1RLDA 3I5CA 1FNOA 1NDPA 3GTPC 2BW7A 1F1BB 3MEGA 1O27A 1EH1A 2UUCJ 2OPPB 5FL7A 4PUOA 4URGA 2E5GA 3QX3A 2ZOFA 4RDLA 1AROP 2AV5A 1JX4A 4ZITA 1S1TA 1TFYA 1TL7A 3BGUA 1V3ZA 5H1SV 3PX4A 1RCXB 4P74A 3CCEB 4ELVA 2W4CA 3FJ2A 3PO5A 1QG0A 4H9GA 2VBVA 4M4SA 4LREA 1U7LA 3KLHB 5DLGA 4TU8A 4L76A 1XNRJ 4ZN1A 3MPWA 2YNGB 1UL3A 4BY1C 2FIUA 4NZ7A 3C14A 4C8ZA 1WKJA 4P6QA 1GQEA 1PYOB 5CD4H 3GR0A 2QEXB 2D7SA 1IN0A 2YQ0A 3IR7B 2CDQA 2G0CA 2ZKTA 4P7VA 1G6BA 2NV4A 3W64A 1S72S 5JVOA 2AHOB 4ZH4A 3OZUA 3OEPA 2E44A 1FRKA 3AD8C 3E01B 5D15A 1O28A 2HS4A 3I4PA 3L9ZA 1HMVB 3FFIA 1H2UX 4NLUA 4OFZA 4UOHA 2OGUA 1HNWJ 1WD6A 2H1YA 2YTCA 3EXCX 4D3GA 2W6JA 4I4BA 5THXA 2JNJA 3VGUA 3VQTA 2B4OA 2AX0A 4JV0A 3V6DB 3DFEA 3PR4A 3T1AA 2ZH5A 4JI4F 3GEEA 4LLGA 2I0XA 4DL3A 3ISNC 5KFNA 2GAHC 3LO3A 1SC6A 1NPRA 2DXFA 4DQIA 3K57A 3PYGA 2D3ZA 2BJ9A 2QSWA 1IJFA 4PG8A 2I5JA 1F2GA 4NCGA 1IXKA 4BY7K 1FRJA 4FXWA 2DTJA 2AGQA 2KXHA 2HBQB 5U47A 4NA2A 4DNTB 1NK0A 2ZZGA 1DTQB 4QIGA 1VQ8B 1WDTA 2WONA 2HAIA 3HXMA 1VIXA 2F1FA 4RW4B 2HMIB 4A3JK 3C15B 5LOQA 1OJ4A 1C4CA 4IRDA 2WBMA 4DX8H 2ZBRA 2VBTA 3TZXA 2CFAA 2IC3A 2MGZB 1TK0A 4K1XA 3G4SS 2CZVC 2GV1A 4FXDA 3MI7X 5J2MB 2ZE2A 1NSQA 2RQCA 1IBKF 1NKBA 3Q83A 4ZJOA 1NHVA 3WYAA 2EFQA 4IG3B 2A3JA 2QJ3A 1SB6A 2V0NA 2QYCA 4FNHA 4N47A 2ZBQA 3R7NB 3T3FA 3MM8A 4TN2A 2DO0A 3IO1A 3JSTA 2V34A 2XZTB 4IQXA 3S2HK 2PC6A 3NS5A 1TELA 3GIRA 2CJBA 4PYAA 4AYBD 1CJTB 4I6AA 3AVYA 3FPPA 4ZP6A 4NXNJ 2HHQA 4USWA 2FVRA 4CDIA 5FLXY 3OL8A 4UTGA 2KM8B 1BXNA 3MM6A 1T05A 2B7CB 4B08A 1SKUB 3NRBA 1FJEB 2VJIA 2YNFB 2E5HA 4B44A 2OFGX 1H98A 4WXOA 3IM9A 2LVWA 2PPBA 1M1GA 3MMBA 5IM0B 3SV3A 2OMLA 2YVSA 3QQCD 1VGXA 2K1RA 3B82A 1N33J 1KONA 2NR0A 5MLCV 2HRUA 5IOLA 4OI1A 1IBLJ 2GMHA 1R8BA 2ZNZA 4LF8F 2HBZB 4RBUA 3IWNC 2Z2LA 1VQ6S 4M8LA 3CCMS 4WZLA 1XNQJ 2HRTA 2JA7A 1O2AA 1E6YB 5ETNA 4NI2B 5KT2A 1FKPA 4WFAQ 2RQMA 2YXLA 1HQUA 4M1KA 2FVCA 3BGFA 2MJNA 3FGVA 2HBRB 4NYPA 4DPYA 3T02A 1T0TV 1GX6A 1VC0A 3BYRA 1D8YA 5GAEI 4FWTA 5SUHA 2AKWB 5ETSA 1IQ0A 3GTGA 2CQPA 2R2SA 5F8NA 4BWMA 4P12A 4RUCA 3FOFA 3JAMU 4LIWA 2FB0A 5J2PB 2J5AA 4NEYA 3ONYA 1MSWD 3R9LA 3BBBA 4UOGA 4C8KA 1UP1A 1LKZA 2MHEA 1FA0A 1Q82T 3SCJE 2VKRA 2DY9A 3NAHA 1I3QC 3K8WA 1DCHA 2AGOA 1U0SA 2V5HG 5F9LA 1V0FA 1R0BG 2WZ1A 2YNIB 4ED4A 4MIAA 2PMZL 4Y00A 2E5JA 4NYOA 5CZXA 1VRQC 3MR2A 3TZWA 4TY9A 4JI8F 3SCIE 3EGVA 1H8HA 1L0WA 3TWZA 2NSCA 3WNDA 4ID8A 2RVJA 2MLYA 2AP6A 1QUPA 4I69A 5I4MA 4F26A 3K59A 2LKZA 3S8SA 3T1YJ 3AA8A 4XLPA 4N5SA 1TKTB 5L38A 1LEOA 4J9LA 1N32J 1E6VA 4USMA 1TUWA 2FVQA 2CPFA 1GFWB 1FRIA 5FO1A 2P6TA 4C3KA 5DM7Q 1LFWA 4DK0A 6FD1A 4XR6A 1KN6A 1NPKA 1BGXT 3GVJA 1OYEA 3OJSA 2P9EA 3QE2A 1S6PA 4USIA 2IPOB 3RW6A 1D9FA 2XZDB 3GEHA 4B3OB 3ZZRA 4B4DA 2MZSA 3GJQB 5KG6A 3GTKK 3R5JB 2E7WA 5DGAA 2HURA 3ZC3A 1S0NA 1FKOA 1KJZA 2F8MA 3U27A 2H51B 5KFKA 1OY6A 3J7ZT 3R6KA 2DIUA 3TFIA 4YUDA 4N77A 4DV0F 3OKXA 1I94F 2R8KA 2E2HK 2B63C 3AVVA 2ROEA 2I38A 1VQPB 4A46A 3EX7B 4OZ1A 3TFHA 2A0FB 4BKWA 2RRBA 1N5YA 2HLTA 3UD5A 5KOXA 4DR2J 4DV3F 3FKIK 2GMLA 2O1PA 1OB5A 3BUEA 1I51B 2POKA 1RT6B 4WILA 2DVIA 3QRQA 4ZJLA 2EKNA 5FLMC 2R7WA 1GMWD 5LMUF 3QBCA 1TL3B 4X8IA 1SJ1A 4F04B 4QYZK 2FUG9 3A12A 1XMQF 4BC7A 2JZ5A 4DR3J 4RPBA 1I50A 3TZZA 3KK2B 1LW2B 4HI2A 4ZCKA 1NH7A 5GV7A 1YRUA 3A8EA 4EYIB 4DDFA 4DCJB 2IDEA 4OZ3A 2VJUA 2XG8A 4IKAA 3OJWA 4OHWA 2CWKA 2D3O1 2XCOA 4HLBA 4ZVTB 2V7TA 3HOXC 3NCRA 4LFCF 1ZH5A 1T3OA 5LT5A 4N41A 3CCSB 3HP6A 2VDIA 1A8PA 1R89A 3HZGA 5F8IA 3ZXWA 4OHVA 2GVZA 1J6VA 2BW2A 4CH1A 1LFPA 2HWHA 3BEGB 3UNYA 4OJGA 3LVBA 1E3XA 1MU2B 5KFMA 1RDRA 3KLGB 4KFBB 2EFPA 1RA6A 2GMJA 1T9WA 5HBMA 3VV2B 4AF7A 3WBJA 5D77A 4BCAA 3QGHA 2CRVA 4PABA 3JU4A 1KK2A 4IFYA 3H5XA 2BF4A 4C2MA 4CLWA 3D6FB 4A3MC 4AE5A 1U1NA 3OSNA 2JLFA 1SL1A 1SJRA 1VQKB 2RDJA 2J9DA 3CC2S 3QT8A 3FRYA 3OUYA 3Q22A 4GKJJ 3RRKA 3ZTQA 3CCQS 4X7CA 4RLZA 1FEEA 4MKYA 1NPPA 1YDLA 2DHXA 4Q0BA 4HYKA 1YJUA 3L4JA 5EDWA 5ETQA 5FO0A 3ISND 1G7CA 3HOWK 4G1VA 1YJNS 2JEFA 1OYDA 4EI2A 1NJXA 1AIPA 5DRKA 1F20A 4IG0A 4IH5A 3UCZP 4JB8B 2MKCA 4LJMA 4CYUA 2B51A 1VBKA 4JI6J 3PV8A 3M8YA 2N4DA 3QWPA 3RR8A 2GA7A 3BR8A 1VDHA 2P9CA 1KZLA 1NB2A 4DUTA 3GTYX 2AZ1A 1T9XA 3QZ7A 3CESA 2JX2A 4TXSA 2V94A 3F44A 5B7WA 2R93K 2VFTA 1NSAA 3QT7A 3W8GA 1F9HA 3BS9A 2B9EA 2K7KA 3W61A 4GTLA 2B56A 1NHUA 5IP7C 2FHKA 4MTPA 2O01C 4XLNA 2R8GA 3Q8VA 5JUMA 3FCVA 4Y28C 2X0KA 1YIJS 2DB1A 3SLDA 4C3LA 4WIQA 1LK7A 2X6YA 1HPZA 2NPIA 1SBRA 2V69A 4R8UB 1WDDA 3BSAA 1FERA 3I9ZA 1FDRA 3TYTA 3DOMA 4EZ6A 2BX6A 3SEJA 4WP3A 4Z4ZA 3O2IA 3MMCB 3RAMA 1IKVB 1J27A 3EPIA 2HZAA 4WPAA 4Y6IA 5KT5A 3V6JA 4ZVGA 4XN0A 3H0GC 3M9MB 2AYEA 1RQ0A 4TMZA 1K44A 4ECSA 4EYHB 1HHSA 4E2FB 3LQVA 5IOTA 2GFFA 1FVQA 1WELA 4RDJA 1T6YA 4QIWD 3VAMA 1X4FA 1C0TB 3NGRA 2UUBJ 4CQJA 1EETA 5EWFA 3S1NK 5M3MK 4WKRA 4KT0C 4ZVQB 3C8YA 1K73D 2WRMA 3GMGA 3D26A 2P5VA 1TL1B 4ACBA 2Z2ZA 4DX6A 5HLFA 4F0HA 4II2A 2KYZA 4F3QA 2DRDA 2YKMA 2JFDA 3OAAA 2HKEA 4QW8A 3A3NB 2APOA 1F7UA 1X0PA 2I6WA 4NMXA 4IRCA 1K0VA 1EHWA 3HHDA 2NXUA 1W2IA 3DRRB 3DCAA 3GTJK 5DLFA 3HOZC 3VMFA 2JDIA 2GJKA 3R1LA 1GAQA 5KFXA 5D3GB 2IHR1 5KFFA 1WQHA 4PG7A 2QSFA 4LF5F 4OOVA 2A2CA 2XQCA 3GYGA 1JVIA 1F7VA 4X62F 3HMJG 1WJ9A 3OHAA 2VBSA 3SFUA 1LNQA 1NKEA 1YHQB 1U25A 3HVWA 4RBTA 3BREA 1ZTWA 3M2VB 1WACA 3DGPB 1B0TA 1VRTA 4OYPA 1FRHA 1TWHK 1S79A 4I2PB 3DLGA 3HM9A 1HA1A 1UEKA 2F43A 3NUHA 4O4RA 3SYZA 2CBXA 4OI6A 5L9XA 4U67Q 3D3CJ 2DHHA 1N48A 1IS1A 4OIRA 4GZYA 1B4SA 4HEA9 2HYIB 5DZ7A 1N0UA 1CS4A 2VPXB 4IDKA 2BQUA 2F5GA 2HFSA 1H38A 4BBSK 1RT5A 4NLOA 3ILJA 3MR3A 5D0GA 2GGPA 2ZZEA 3NWGA 3EDQB 3JYTB 4FYVB 5GMEA 1G51A 3EYZA 4XQFA 5FIUA 4B3SJ 1UMKA 3HO1A 3V5RA 4OYXA 3JTNA 1I6VA 1HD1A 3OTDA 4ANEA 4DMZA 5IV3A 4FPRA 2G2OA 4FPIA 2LCWA 2E2JK 2GK7A 2H3EB 4PC6A 3HVAA 1AFJA 5HP1A 2LZJA 1RTZA 2HWTA 3D3BJ 1U0HB 2GAGC 3J7YI 4FF4A 4Y3CA 2W01A 3DGVA 1KVIA 1IR1A 3I32A 2W6IA 1QH0A 2JSXA 2MZRA 1PYSB 5E3QA 4DL2A 4JUZA 4GVBB 2JDJA 3Q0AA 3JQRA 1KQSB 3M4OC 1TVRB 2RC6A 2QDXA 2U2FA 2V8DA 4B3GA 5IOSA 2KT5A 1ICEB 2WK4A 2F4NA 1SH0A 4X4SA 2YX1A 3DDIA 1PBUA 4WIIA 5A8WB 4BLAA 1RKIA 4XLFA 3QIPB 1SFOK 1Q7LB 2MLZA 4PG6A 1VQ9B 4NNJA 3QSYA 1Y11A 3HVRA 3WIVA 4J9SA 2V9WA 1WWHA 1MLAA 4L72B 3GIIA 4UOFA 3TJAA 5EGEA 1CJKA 1XE1A 3NEKA 3DLHA 5HL8A 2Z0GA 1RU1A 2FDNA 2G9OA 3B6BA 3TOQA 2HVIA 2ZZQA 2PA3A 4MKAA 1MROB 1XZPB 3A8KA 2KB2A 3Q8QB 2W4PA 2DNHA 1C0AA 3M30A 4X65J 2B9YA 1U1MA 4K4XA 2KT2A 3HKZD 3ZZOA 2CAJA 2LDYA 4F2SA 5DG9A 3EUNA 4DSFA 1KFSA 2D9OA 4QZVB 4Y34A 3S2DC 1AFIA 1H85A 4NLSA 5E3CA 5L39A 1J98A 2DR7A 2K3IA 4URQU 2NVYA 2L3MA 2XBPA 4OX7A 3HZEA 3MEDA 4OIXA 5KFRA 3RW7A 2Q79A 2JEGA 1T94A 5FIIA 3H4DA 3MPDA 4K4YA 4QR2A 3GIKA 5CJ9A 3I4MC 3O44A 1I6HC 3FC9A 1BPLA 3QFWA 1HW9A 2X3UA 4KYZA 3B4DA 3H3VL 2QGFB 3HT3A 2EFGA 3AJ2A 4M5DA 2HNZB 2RF2B 4LRCA 2ZBPA 1RISA 4Q43A 2XGJA 4ACAA 2OTJB 3CCRB 3FUYA 1JLGA 1BE4A 1XIQA 3QJLA 2OEJA 4MEYA 2BRLA 1BWVA 5IYDK 3T5KA 4LOWA 1ZQ1C 4CO3A 5K9FA 3SQGA 1SIZA 4J9NA 5E41A 3OW2B 3LQEA 1N5SA 3BO2A 5DGBA 1B0VA 4NLWA 3NBPA 2XULA 1WI8A 1WF0A 4CO0A 2XNJA 2LEAA 3KJNB 4KO0A 1S49A 1T95A 3MEGB 5IC4B 1BQEA 3RJMB 2R2TA 4PUOB 5CXTA 4NLGA 1YITS 5DSZA 4EO6A 2UUWA 3MCOA 1R3NA 1UZHA 1BQMA 2CIMA 1RAEB 4DR1J 3KMSA 3HXAA 1S99A 3LPEA 4F4WA 3PNIA 3KXDA 4KB7A 3UN3A 2NUHA 4ED1A 4OPOA 1JLAA 1S1TB 3X1LB 3T9NA 2IM3A 2FLLA 1TL7B 3CJ0A 2CQDA 2HNDA 3D4JA 1XBWA 4RD0A 1S7HA 2XMAA 2ATCB 1SV5A 2HPUA 4LR9A 1RK8A 3N28A 1F60A 2IAJA 4X7FA 4OJ3A 3AAWB 4YR3A 3O8WA 2BE7D 4XO0A 4F4KA 2IA6A 4A3BC 4OX6A 3A13A 2NXNA 2VB6A 3C14B 3ILLA 1NBEB 3CEDA 3GWCA 3FKIC 1P6TA 3O3LA 5M5XK 1RXOB 2B43A 3QZ8A 1BX1A 4P52A 2W8LA 4YP3A 3HOUK 1RT2B 3QAUA 3GJRB 4DR7F 5CQGA 5AJ3F 2AJ4A 4FYDA 2RS8A 2V67A 4E8UA 5KG4A 2YWEA 1Q8IA 4K4ZA 1AT1B 4DR6J 5C3EC 3DLLQ 2F4VF 3NGSA 3AQOA 4ED5A 5LSLA 4WKYA 2DETA 1CC8A 2F7VA 1TWAC 2V6UA 2WVEA 4HH0A 4C4WA 4RD6A 4LFBF 3LAKA 4N76A 3CCUB 3C66A 2ZJRQ 2XOKA 2CPIA 3W63A 1VQLS 2X6WA 1HBOA 2DGQA 3BO3A 3TUPA 2VUMA 4ROXA 3GG1A 1NB0A 4RWWA 5KT6A 2DYAA 2B0GA 3VZHA 4U9RA 1WIHA 1XMBA 2J76E 2HQ3A 4X4PA 3W65A 3ASQA 2RHQB 2CW5A 2J7KA 1ROFA 1HW8A 1IJFB 4ZPWR 4B9MA 5HANA 4NCGB 4BXXK 2WVBA 1Q81T 1R9TC 2YKNA 1VBXA 5K8NA 1IVZA 1XERA 2M8DB 1E62A 5KFGA 2BJ8A 3AOCA 2WONB 1SJ4P 4OI2A 4XK8C 4I68A 1N36F 4O4GA 4A47A 4DV5J 2J9EA 3MD3A 2CVIA 1Q5YA 4PEOA 1S72B 5HVFA 3G6YA 1QAJA 1NBMA 4NLXA 4RUAA 4G7ZA 2IC3B 4EK2A 2XM3A 1PBAA 1W26A 1E1QA 4G6VB 1KQ4A 2ZE2B 1VQNB 1RA7A 7AT1B 3S7RA 4PR6A 4H4MA 2DRBA 2D1CA 5E3AA 4MKBA 1IBKJ 2VG6A 3VTIA 1DQAA 1P9YA 1X0FA 4F7DA 1JLCA 2AD9A 4K2XA 3LOUA 2ERRA 3BPDA 2J6TA 3PEHA 3ZZUA 2GK6A 2YKQA 5JMNA 2MMYA 2WVFA 2Y1LB 3W2IA 2GJRA 3MM8B 2OSRA 4QFMA 3QATA 1KTVA 3HOWC 3ITHA 2ZC3A 2E1MC 2DEIA 2C5HA 3GTLA 2BV3A 1RU2A 5HMZA 3BH7B 2PN6A 5J3OA 1CJVA 4RW8A 1ZYRA 1M1KD 1I8DA 3P5TL 2XNDA 1PJ7A 5GVQA 1DJ0A 3FK4A 5B0EA 2V6AA 1R7IA 1FKAF 4ATNA 5F0WA 4NRTA 1XTZA 3MM6B 2ZHOA 1T05B 3KDOA 2R93C 2Q6BA 2FJWA 1UKUA 4MH8A 2NSBA 2R8IA 1QSSA 1I3OB 3FMBA 3PYFA 1NCLA 1H2VZ 2XLKA 1M5SA 4OOSA 2ZHBA 4WZMA 4WZEA 3CXCB 2LU2A 4A8OA 3FBEA 3QSIA 1S97A 4DR4F 5AXNA 1UFLA 3Q24A 4A3DC 4DU7A 1UJ5A 1X9SA 1X8DA 5C2GA 3V6KA 3PO2C 5ETRA 1N6QA 3ZZYA 3G4SB 1Q7YD 3LW5C 3OTBA 4CM2A 1A7GE 2DCUA 5LSOA 2F8HA 5LM7E 1B3TA 1WSRA 2BBEA 3CD7A 2ASLA 4TN1A 4JP8A 1HZEA 2OJ3A 2MJUA 3OTEA 3BM7A 1FKPB 1HR0F 2E1BA 1HQUB 2FZGB 3UDCA 5KFVA 3G71B 3AH6A 2VUGA 1WOPA 3D6MB 3DU6A 2Q6KA 2EW9A 4DF4A 4CLSA 4K8RA 4ECQA 2KH9A 2GJPA 1O29A 4F25A 3AXMA 4P6YA 2OPRA 3PW7A 3V81B 3H2UB 4DHVA 3RGIA 3VO2A 1H42A 2MSSA 3D6TB 1CEZA 1J5EF 2JLGA 1DFDA 4TMTA 4BBRC 1KFDA 2P3MA 3EGWB 2MKIA 1RJJA 2ZM6J 2DCLA 3IBFB 4MJKA 4X7EA 1I50K 1IWAA 3TI0A 2MXYA 2VG7A 2MSTA 1KVKA 2ADCA 5DO2A 1U2RA 3Q86A 1KSPA 3CJ3A 4PXCA 1VK8A 1VQ8S 2QL9B 2V7VA 2WW4A 4Q5VA 2DNQA 1QTNB 1PKUA 4A3CK 2ZHAA 4NE9C 5IT4A 4IOAQ 5G0RB 1VQ6B 3CCMB 2ASYA 3BN7A 1NJID 4DPOA 4XIUA 1RHKB 2DR5A 1QD1A 3G96A 1E6VB 1QE1B 3NMRA 3OHBA 1IJEB 2KZZA 2QA4B 5CH7B 2D74A 1BQXA 2DGSA 1ZXOA 5I3PA 1HMVA 2ZC4A 3UE2A 4XL9A 1ACMB 2LQ9A 2DNNA 3CIZA 2GJFA 2C22A 1DQ8A 3EGZA 3FCHA 3UFCX 3W5VA 2IM2A 1C2PA 1TWHC 3V6DA 4QWDA 1S6PB 4Q5SA 2GQ2A 4C2MK 3HOVK 3R6LB 3AJ1A 2UVVA 4M2LA 3O1LA 2WHOA 4K4WA 1RLCL 4KPYA 4YAOA 2C4TA 5FD1A 1FKOB 1N52B 1Q1KA 2HMAA 3FZBA 3D2WA 2XY6A 4BBSC 1T9TA 3T5LA 4XOPA 4AUKA 2ZXHA 3ZO7A 3C19A 4CIOA 2MEWA 2NQPA 1R8PA 1I94J 2B4VA 2ZUAA 2GIFA 5HK4A 1NNDA 1X9WA 4Y2KA 4FS1A 3U1NA 3TW0A 3SCLE 2HMIA 4IFVB 2XWXA 2MQMA 2IIHA 1X4CA 4H4OA 2XCPA 3TTGA 1N5YB 2OBRA 1JXVA 4X0CA 1NHKL 2E2JC 3CCLB 4ZS6A 1Y7PA 1R43A 4DS5A 4JI2F 3GFYA 4ELUA 4TQRA 2F63A 3BV8A 3N5BA 3G86A 3NOCA 2YPZA 4N3GA 4IG3A 2V4JB 2XS5A 4GO7X 5LMUJ 1FRQA 3W7BA 2CRLA 1NDKA 1UCNA 2BZ2A 4DFJA 2J7WA 3H5UA 4FP9A 3H59A 1M90T 2YQ1A 2R6HA 2V7UA 3P45B 1F2HA 3FKBA 3PRDA 2MDAA 4ES3A 1CJTA 1RQRA 4ZGQB 3RBXA 5FDLB 3A35A 1WEZA 1DBDA 2RU3A 4P71A 5IZHA 2V8VA 3PX0A 1M0SA 1T8EA 2VD3A 3W2HA 4C0SA 3FEXB 3EXYA 2ILYA 2CQHA 2CNDA 2GVZB 3M1VA 4ZLNA 2HHWA 1U1QA 2CVEA 2WSFC 4JI3F 2MB0B 4LRDA 4QIWL 4FYWB 5DN6A 3IGNA 3OTCA 3AHPA 3JQPA 2E29A 1TWCK 2KKHA 2GHWA 3NCQA 3ZTOA 3P26A 1X4HA 1S1XA 3GE9A 1O26A 4F4ZA 2CQIA 3FZ2A 1DG1G 4YEAA 5DG8A 2KFYA 3KG4A 4C3HC 3NWRA 3J7AN 4IFYB 1QUVA 2NVTK 3OFEA 4DL6A 3HD1A 1YG0A 1XXAA 4PWDA 3KOAA 3OQ2A 3R5CA 4FNIA 3W62A 2VZLA 4IRKA 4IYQA 4JYAJ 3NY0A 4A3IK 2C3MA 1TWGK 4P2NA 3AT1B 4ZVFA 3OUYB 4RD1A 4NOIA 4ZVHA 1GVHA 5CZVA 3FSIA 2PA8D 3PKMA 3DRYA 1RTIA 1WTBA 2V8HA 1TWFK 4Q0BB 3DXJA 1OGJA 2C78A 4JK1A 1X4GA 2XHWA 3MMLB 2YKAA 1HI0P 5CYQA 2QIFA 2WSCC 3VGSA 2KN4A 1FE4A 3TNVA 3GILA 3VO1A 4KB2A 2X1BA 3C6TA 1EARA 3M6UA 1RHJB 1VQYA 4CYUB 2DNPA 4EH1A 2Y1JA 3GVKA 4Y0FA 4B3RF 1WHXA 4ED7A 4XNFA 1HKAA 1WF1A 4O3NA 5IYDC 4KHPF 4X06A 2XY7A 3S1MC 1N05A 3PXGa 2X85A 1LWFB 3R7SB 3FHZA 4CLUA 3WQZA 2JC0A 1YLXA 5RUBA 1YGYA 4QUZA 1KQKA 1NLKL 3N6NA 3FMWA 3FJOA 1U09A 1YQHA 4F4AA 2DIEA 1N5QA 3UD4P 5IP9K 4OX9J 1S5ZA 5IK2A 2N3LA 5C5JA 2XMKA 4TT3A 1HPZB 4XN3A 3RR7A 3MOJB 1D9AA 2EIXA 2RJZA 2FZCB 4HTJA 2XY5A 2VPZB 1S9FA 3GTOA 4YY3F 4OYOA 5IYCC 3DOMB 1HA3A 1ZZNA 4U6PA 4G5GA 4QHYA 1L5UA 4FS2A 1CJUA 5F0UA 4PC2A 3QT5A 1XR6A 2YU9K 3DM2A 1IBMJ 5KG1A 2JHEA 4WJ3M 4FBTA 4DL4A 1NXIA 2YPYA 9RUBA 2XMUA 3LWMA 3MMPA 1S10A 2CQ3A 1YLOA 4KC6A 4RJVA 4P73A 1EETB 3W2GA 6AT1B 2A2DA 2C2KB 2WVDA 1BLUA 4TSFA 1S6OA 5D4DA 4B3MF 1Y00A 3IS9A 1HWJA 1FRNA 5D4OA 3CQZA 4OQJA 1RWVB 2KT3A 5F9NA 3UDEA 4WZKA 1A9NB 3DKDA 3U7JA 5HLFB 4RLEA 4K0KJ 3OE7A 1C1CA 2AGPA 2YKMB 1QAYA 3W5YA 4B9VA 1YIJB 3QIDA 3H2LA 1ISEA 1KD1D 3DYAB 3T9ZA 3BBCA 1T5EA 4YB7A 2EPIA 1NM2A 4WWVA 5IYRA 3PYDA 3AXKA 4DV4F 1VLOA 5J35A 4A8KA 1IKXA 1WHYA 1LXJA 2JOQA 1Y4ZB 1I1GA 4DPWA 1U6BA 1GNKA 1VQKS 1TL3A 5KSWB 4L75A 2JA7C 1TZ0A 2B3TB 2LA6A 4RW9A 3HKZL 3JSRA 3CD5A 3ZUGA 3MM5B 3KK2A 2KJWA 3CULA 1RYRA 1JWWA 2G2YA 5IWAF 2XWYA 1KEKA 1VRTB 3V7AA 1UTAA 3N4WA 4QR0A 3DLGB 1PKVA 4UZCA 2X1AA 1N8RT 3GTGC 3DRPA 4DSKA 2RUGA 2J9DE 3CB4A 4YELA 1MABA 4ZMMA 4TU9A 4Z1MA 1BY9A 5A8AA 2BABA 4ECZA 1YRXA 3HF5A 1CS4B 3BBFA 5H9FJ 4OYIA 4IDKB 2FHOB 5AE3A 1RP5A 3RAQA 1RT5B 5A89A 3MCAA 1MU2A 4DG1B 1NO8A 1VQ5B 5BSYA 4KFBA 2C2MB 2RKIA 3HSGA 1LV5A 2JA6C 1CSJA 4USKA 1T7PA 2OPSA 2NXCA 5EHHA 4JV5F 3MECA 3ISXA 4DQRA 4OPSA 3K5PA 4CM0A 3OBIA 4UZUA 3Q3QA 5I42A 2CQBA 1O6XA 4LK1A 1CQXA 1WOSA 1RT3A 1YBAA 4P72A 4F50A 1UVMA 4A93C 4C3JK 3HLUA 3KMQA 1WQFA 4KARA 4QYZJ 2N82B 2EC0A 4PG4A 4LQYA 1MN7A 3ERED 4DL5A 2E2HA 1YI2B 2YY3A 4I7FA 3KK1B 2RSQA 3MMJA 1VQ7S 4GFQA 2DD8S 4LQ9A 3VF0B 4RW7A 2KTQA 2FQOA 3OV7A 3BQ1A 4DV1J 4ETXA 2CNOB 5IFMA 1T6XA 3G6VA 2WYRA 1ZS6A 3QSYB 1YCLA 1KC8D 3W60A 1XZQA 2JN9A 2HK3A 1QVFR 1S77D 3P96A 1Q86T 2KRRA 2IM1A 1CJKB 2Z2MA 1I6JA 2BGIA 3MCSA 4LJZA 3MM9A 1KQFB 3G4CA 4B9SA 2V2VA 1G7RA 4F2RA 3MMAB 2Z57B 3L4BC 2AJFE 1FHTA 1W0JA 3SSSA 1PJ5A 1R6VA 3M30B 4YFUA 2ZH1A 2Q43A 4DUYF 2E9RX 3ZTPA 2B5OA 1WC1A 3CP2A 2IMOA 4A3EC 4R8UA 1N34F 3TQEA 1QSLA 1DQ9A 1WC3A 1UZDA 4OZNA 1CC7A 2LXFA 3A1PA 5GAGU 3Q23A 4F4XA 1ZAXA 3MEDB 2QFJA 1RYSA 4DSEA 3JB9k 2BXJA 4KKOA 3JSYA 1R5NA 2BRKA 2CUYA 3CTRA 5T41A 5A8RB 3I31A 1YHQS 4WE1A 4GO5X 3LUYA 3SSQA 2CG8A 1SVDA 3HKWA 4AL6A 2OI2A 1XQIA 3RZOC 2RDDA 4Y52K 5A2QU 1U6ZA 3W2EA 1QJHA 5CA5A 2R42A 1SUQA 5D0HA 3PW4A 4M5DB 3QFRA 2VOOA 1WC6A 5IQQA 2VUMK 2KYXA 3JSMA 2ADBA 2P2CB 1JLGB 4S0MA 3VA7A 2E66A 2R7QA 3GTMK 1PC5A 2E5LF 2XYGB 4LQ3A 2O66A 1E3ZA 4U9UA 4XORA 2YKPA 3KK3A 2PSZA 3SQGB 5FJ8K 4ZN3A 2XCAA 4D3HA 3NS7B 4UUWA 1PCAA 4DSIA 1BJKA 2LDIA 2QX0A 1I7PA 5D3GA 4KQZA 2IY5B 4I67A 4C9DA 1WC4A 4ZVEA 2FJEB 4WCEQ 3H2VE 1M5OC 4I2QA 4G7HA 4ZGNB 3V4GA 1WOOA 5DDOC 2Q1LA 1BQMB 1XMOJ 1IHMA 3HCXA 4LRFA 2HVEA 3D5MA 5HSPA 4C0BA 2PEHA 2AJQA 2OFHX 1RZMA 4WXWA 3QJJA 2OEKA 1OIAA 2GREA 3MAQA 1JLAB 1JIHA 2MKSA 2Q6LA 5KT7A 5K8PA 4HH1A 2BA9A 2HHPA 3ASSA 1TU0B 3PTWA 2F3JA 4P7TA 4F8RA 1RTHA 2HNDB 4LBHA 2OTLB 3CAGA 3U1LA 1SV5B 2RQKA 4PXBA 2DEJA 1F60B 1KKHA 3DOKA 1KS2A 3E20A 2A18A 1CNEA 2DGOA 1KQGB 3QO9A 4M5GA 1B64A 4LVOP 2D69A 2H5IB 1MRZA 8RUCA 4XPCA 2QE7A 2X8KA 2GO8A 2Z6BD 1K1QA 1ULRA 1CBKA 2H48B 2HVHA 1NK5A 2R7ZK 2M52A 4CCHA 1TMJA 4HIZA 3DC2A 4ZLJA 4WP9A 4Z4TA 3SBMA 3JYTA 4EUVA 3T51B 2C77A 5L9NA 2CPDA 4DR7J 4ZPBA 2FYXA 3KUHA 4M5KA 3IG1A 4PXEA 5B0GA 3GQCA 1MMLA 1J6XA 2VJVA 5IYWA 4MKVA 1VQOS 1YJWS 4OYWA 1D1NA 2AEFA 2CWXA 1GX5A 1JXEA 1FEHA 1UPMB 4LFBJ 1G4CA 3W2VA 1N07A 3OTOF 5J2QA 1XN9A 5HQ8A 3Q3AA 1WPCA 2CPJA 4KJIA 4MFBA 2JJ4D 2BJEA 2NVQK 2VA2A 3H5YA 1VK3A 1HBOB 4KV8A 1FX4A 3T1HJ 1B23P 2AYMA 3FSYA 4FYYB 2PFDA 3WZ0A 2MZQA 1DCPA 3S1QC 2UVUA 4Z4UA 4R71A 3FBCA 2W7AA 2ZBVA 1R5BA 1DZ5A 3MM7B 2LMIA 3FRZA 4DUZF 4C3IC 2EVZA 4OJ1A 1HYSA 1HHQA 3ONQA 3QIPA 5JVHQ 4NLTA 2JA8C 4CH7A 2Q6IA 4WP8A 3U02A 4W90B 4ED2A 3MFHA 3GTJA 1BJTA 2YKNB 4LFAJ 1O2BA 2OTJS 1O25A 2FD2A 5AXLA 4KR0B 4K2JA 3CCRS 1IM6A 3D6HB 1N36J 3LPXA 1YBTA 2D3OR 1T9VA 4O4GB 1G7SA 4KHRA 2IVFB 1XZPA 4RNHA 3QT6A 1X4AA 1T3NA 2PLFA 4DQQA 4KASA 1EWYA 4C3MA 1VRUA 2UUCF 3JXOA 4Q44A 4X66F 3PKYA 1RWPB 3THTA 4M95A 1OO0B 4H4MB 2FHMA 3HHLB 1F9EB 2VG6B 1JLCB 2ABYA 1NEEA 3CC4B 1PC4A 2V7QA 4J0QA 2QA1A 1VQLB 4Y2IA 5A0YA 2HIQA 1GXUA 3S0XA 3QYYA 2XO7A 5ETPA 1X9MA 3ITHB 2DISA 1NJZA 2J6SA 4Q2LA 3SV4A 3DLKA 2DNZA 4O3PA 2VA3A 4FYXB 5CABA 4EFAC 5LMNJ 3KTQA 1KK1A 2UVRA 3EM1A 1RT4B 4P26A 2XSJA 3OZVA 3P27A 4LF7F 1AZSA 1GAOA 1SKSA 3U6BA 2BJDA 3NCPA 4WU2A 1LXNA 1NJYA 4L73A 3Q39A 2ROGA 3QGPA 1CG2A 1GK8A 4ILMA 2R9LA 3OR1A 1J2VA 4NA1A 1XXBA 2XCQA 2R7VA 3S1RC 1KK0A 3JS9A 4KBIA 2AT1B 4ALZA 4USVA 1Z2LA 2HHXA 3K8VA 3SIPB 1FWKA 1SC1B 1SH2A 2BQRA 1N6QB 1RWUA 5KFBA 2R7OA 1Y1VK 4JI5J 2BJ1A 2DCUB 3CJ5A 4X4NA 2P5MA 1NH8A 1TMMA 2W25A 4LSZB 5AXMA 1S4MA 5D4LA 3E8OA 4LMZA 3AVXA 1Q79A 1QDUB 3UVJA 1RHRB 3QFCA 1HR0J 3C6UA 1EXMA 2FY8A 1P8GA 3PO3C 5D4PA 1UPPA 3QRPA 5HZAA 4NYZA 2HW3A 2XMMA 4FZBA 2VNKA 3RBZA 1UA1A 1BHNA 3CCUS 4ZCIA 1SFOA 3PEJA 1HI9A 1U49A 1S57A 3NXZA 4O23A 2OK7A 1GO2A 4NA3A 1Q86D 1O5JA 4RX6A 3EE3A 5B0AA 2BJ7A 2DNKA 1T02A 2OPRB 3J81U 4CT8A 3HHEA 2JEIA 3LP2A 2FLNA 2X3DA 4YQWA 3OP1A 2WJYA 3BDEA 2AQ4A 2IRXA 3SSRA 3G2XA 2MZJA 1X31C 2XYHB 4YHHF 5G4DA 5EX3A 3I1FA 3RYLA 3PIPQ 2RGRA 5B08A 1D8TA 1RWMB 4Y2MA 1TL4A 2E1CA 1RHUB 3G4AA 2VG7B 4HT5A 2R7XA 4BLBA 3M7VA 3K17A 4PG5A 1S0OA 2XHCA 1SIWB 3GSDA 1U1LA 5J2NA 2O5DA 3W2WA 3CDEA 5FA6A 3K0JA 1RT2A 2MQPA 4EBEA 1BDFA 3DHXA 4B3TF 4K50A 1YVFA 4C45A 3RAXA 2WZPP 4ZCMA 3W9JA 4NCNA 1B2RA 2F65A 4Q45A 1EFCA 2D74B 3H0GA 2A6HA 1NB9A 3RBDA 1VQNS 1EP4A 3JTPA 1N4LA 3CCJS 1Q16B 4LF6J 2IJNA 2VQFF 4ZP9A 4W92B 4PCQA 3TX0A 4GRSA 5LL6d 3LAMA 1Q95G 4NXNF 3H3VD 2V4QA 2RD5C 2VNJA 4XDDA 2FGOA 3GB0A 2KO1A 4MYTA 3HOYC 2NVYC 2DITA 4ID5A 1WQGA 4L3NA 4CP5A 1E79A 4A3KC 3PFOA 2PA8L 5L1JA 2YWHA 5A2QY 9ATCB 2YWGA 2Z58B 3OFHA 1NB7A 5M5YK 2NXJA 3RZDK 4IOBA 1W7WA 1N33F 2QA2A 4AL5A 1A6LA 4O44A 5C2CA 1IBLF 2WOMA 2ZH8A 3MTJA 4P9SA 4CLZA 4QIFA 1X4BA 1JJ4A 3S15K 1XNQF 2VOPA 4H4OB 1YJ9S 4PRFA 1OB0A 4B9LA 2W24A 4FVCA 2JL9A 5FNZA 2W8KA 4WFXA 3VNUA 4QVAA 3PFEA 1AA1B 2R4FA 2IMWP 1G2EA 1TKXA 2DGVA 4JI0J 3CJTA 3FNNA 1WEYA 5DG7A 3PRVA 1TTTA 1K1SA 3J81k 4XPEA 2ATLA 3I4NK 1U6FA 5HQMA 1WCMA 2HQIA 2RS2A 4YFKA 2C4UA 4A3FC 3G71S 1FNBA 5KFDA 5KFSA 3AY0A 3GYNA 1BC6A 1FXLA 3THVA 2WCXA 3UN5A 4U8VA 3NNAA 2W7OA 1JKHA 4EZ9A 4ECWA 4E0DA 1XPPA 2DKOB 2C2ZB 2NLWA 3GV8B 4KAWX 3JSBA 3GTOK 2HWIA 3PJWA 1B4BA 4O3QA 4DL7A 1S6UA 3R7BB 2DRAA 3M1VB 2MLXA 5C4XC 4JI3J 3I87A 2HHVA 2BR0A 1BS2A 2V7XA 4H4KA 1XQBA 1RACB 5KFPA 2FJXA 3QGGA 4X7DA 3T1YF 4TNOA 3PY8A 1FNMA 4PPDA 3ZTSA 4HHJA 1PAUB 1S1XB 4X6AK 3MTKA 3D67A 4YFNA 3I9V9 4I56A 1TL5A 3LNNA 3MWBA 2IM0A 2JEJA 3M8QA 3FBFA 3CJ4A 2UUAF 4O2DA 1YJRA 4QWBA 3I96A 4PWDB 1PGZA 3CQZK 2PO4A 1JNYA 2KJVA 2QA4S 5K5MA 2DERA 4X4QA 4Z37A 3A3BA 1CULA 2HZVA 3KNGA 4G3IA 1ELOA 4M5JA 2OO4A 1RBLA 4YR2A 3KFWX 1RTIB 5T7LA 4NOHA 4K4VA 4C8MA 2V7WA 1IW7A 2VODA 4UY85 3OSPA 4J9VA 1V5IB 5J1NA 1L3SA 4B9NA 4ZIVA 3W66A 3V81A 4J9UE 2UXBF 3M6VA 5CYQB 2Z2YB 3RB6A 3P6YC 4O0IA 3T53B 5JXSA 4A3GC 4ZLLA 1U47A 1VISA 2ALZA 5IOQA 1W35A 4I64A 3L7UA 5KW9A 3J80U 1EIYB 3C6TB 2GJIA 1IWGA 3BCDA 1C1BA 2I2YA 4UZFA 1V6HA 2VG5B 2PGCA 1INNA 1UEVA 2GHPA 4DX5A 3Q8RB 3CDUA 4DR2F 3ES9A 2NUUG 1EFTA 4R25A 3EZ5A 4GTCA 3M8PA 5GADU 5G0RA 2UU9J 4X4RA 1SJQA 3ISZA 1UEUA 3CCLS 4YN3B 4P3YA 3MEEB 2PIIA 1BWEA 1QE1A 2V9KA 4WK3A 3S6EA 1IJEA 3GTQA 3OXFA 3PJ9A 1E43A 5IQ6A 4DFKA 4DR3F 3WNBA 3KG1A 3G82A 4YY3J 2QL5B 3AGQA 4F7VA 3S17K 2J8SA 1RAIB 3ZZTA 1FX2A 1HNZJ 1VJEA 2EBBA 1MG7A 4WFBQ 4LF1A 1EZZB 2A6EA 1CJUB 4JI7F 4KGZB 1TQLA 1BMQB 2NYIA 4OIQA 3GP9A 3DM2B 4MMOA 2EBGA 4GQNA 2YNHA 2W2PP 3V2UC 4F3OA 3OT9A 2QYGA 4NLVA 3GTLC 3TAQA 2BVZA 3E1YE 1FRMA 2ZOMA 4KM8A 3EZUA 5IT0A 4HVZA 1Y0RA 4ECUA 1H6KX 4TLRA 2C28A 3M2RB 2B6AA 4B3MJ 2UZAA 5C42A 5H9FK 3IS9B 4DQLA 4LC0A 2YH0A 2V4DA 2OBSA 3BR9A 1CQNA 3Q8UA 5THWA 1LWEA 4IFVA 2C3OA 2KG0A 1DCOA 5DQIA 2HFZA 1X60A 4J3NA 1C1CB 4F02A 3M05A 4ZK7M 3CCZA 3I0SA 2E1RA 1WUUA 3K7AK 1Y5IB 3GIJA 2WW8A 4OZ0A 1OHHA 3AB4B 2RDIA 2L08A 4ZPVR 1R8AA 2BUNA 5L1LA 5KFCA 1HNVA 3PDNA 2FJBB 2H4WB 4DV4J 3ENAA 5MAOA 1EP1B 2DK2A 1R0AA 4GKJF 1IKXB 4C97A 1TP7A 1VS3A 4NBSA 2NVQC 2V4JA 2YWKA 5F41A 2RHSB 4KMUA 4JOUA 3N3YA 3BGRA 2OLWA 2VIHA 4RW9B 2W2MP 2Z30B 2DR9A 1X5SA 2P9GA 3NMAA 3BYPA 5GAHU 5BYQA 3KHHA 5IWAJ 3MR6A 3W9HA 4OMFG 3BP3A 1VBYA 2CK3A 5DS0A 1JLEB 4XOTA 2HFOA 5FDLA 2OEMA 4YG2A 2R92A 2YBVA 3DRPB 5DETA 1UFWA 3ZZZA 4KKTA 3KJVA 3HDSA 2VU5A 2PMWA 2V50A 1IBCB 4ZIWA 1EK8A 2N7CA 2GIQA 1RUSA 2F1MA 1RE1B 3NL0A 2ZJPQ 3WXMA 4W4MA 2BOAA 3CWJA 2RKIB 3TA0A 2R2RA 5TRDA 3AA9A 3BKUA 1YWXA 4B17A 1RI7A 2OPSB 2EFOA 1OWXA 4JV5J 2G2ZA 3LWLA 4KKSA 4LF4J 3NS6A 3S14K 4G1BA 4LUBA 3MD1A 3MECB 4FBUA 1UFKA 4DJBA 1HD0A 1J5OA 1TFWA 5I42B 1X4EA 1XK8A 4EMDA 2QRRA 2HQCA 1JK9B 2I9SA 3FQKA 1RT3B 2CPHA 2ZXIA 2B4UA 4DI6A 4TQSA 2C5BA 5DQGA 4LSNA 5LXYA 2BJ3A 3OZWA 2Y1IA 3OVSA 4AC9A 4I1TA 3OPOA 3CCWA 2BEFA 3MUTP 5HKKA 2ZWOA 2DO4A 4NZ0A 1Y1WA 5HVGA 1L3TA 3C16A 3ADAC 4NLYA 2UUBF 4I7FB 1S4FA 2H54B 4R5PA 1UMJA 4QPTA 1I3QK 3I5BA 1IR0A 4ZOSA 3CMMA 4RW7B 2CPXA 5BR8J 1UVIA 2XO6A 2C2OB 5AE2A 3PIOQ 5HQLA 3BJYA 3Q2SC 3D1QA 1X4DA 1U26A 1XZQB 3U2QA 1JXLA 1NK7A 3H90A 1LWFA 2DOGA 3RY8A 4PZVA 1F6TA 3MAAA 1NSPA 1WF2A 4BBYA 3MM9B 2OD6A 1UD8A 1KWMA 2XB2D 4XD7A 4TYBA 3PUMA 5CAAA 5J1PA 3PUNA 1IUJA 2A69A 1CQMA 3GYXB 2YH1A 4PWWA 2J0QD 4OINA 1Q9SA 2W9CA 3IGVA 4KM9A 1VF7A 5DDRC 4ZJQA 2Y9HA 2RUSA 4EBCA 2ZZMA 2EK6A 1ZOTA 1Y3JA 2B7BA 4UW2A 1ZYQA 5TJ3A 1N34J 4DV6J 2A6MA 3HT0A 1F93A 1HNIB 3PACA 2A10A 1KP6A 3C46A 2ZH7A 4M1XA 2QFIA 3CIMA 2C3PA 2CNLB 1HBNA 4KKOB 3OD2A 4PKDB 1SJ3P 1RAJA 1UWBA 4WE1B 4ZKAA 3CRZA 2VKZG 1VQ7B 2GX8A 5TMCA 3EICA 2FX3A 3BY2A 1Q53A 1TWCA 1U8SA 5D4NA 4LF9F 1S7IA 2MKHA 4J9KA 2RH6A 1SQEA 3FEYB 3OXLA 2B4PA 1ZUNB 2OUGA 1S76D 2IVMA 2CADA 5B0DA 1FFGB 1SUQB 4LVNP 4KB4A 1FJGJ 1NK8A 3JSMB 5DM6Q 1VGYA 2B63K 5SZTA 2FC8A 5HAOA 3B54A 1Q4RA 2KM8C 3PJXA 1AB4A 1Q8LA 3M4XA 2JA5A 1TWGA 3D28A 4CLLA 1VQ5S 1XJWB 4ED6A 3KK3B 2L9WA 1WG4A 3D0GE 1FO1A 5F8GA 3DYAA 3NGTA 2ZFHA 1TWFA 3B8HA 3ZPNA 4K5SA 3OOCA 2M3DA 5E0OA 2UXDJ 2EG2A 5HMWA 4YDXA 2AIRB 3RU0A 1Q82D 5FLMK 1N0VC 1AUSL 1HIYA 4K59A 4G7WA 3D7SB 1K47A 3HULA 4TVAB 4RR5A 3PYEA 2EFNA 4I2QB 3P8BB 1HBMA 3MZIA 5ETMA 4ANDA 3HSDA 3MM5A 5BSXA 2FHJD 4ECVA 1SKQA 1O8BA 2GW8A 4LSLA 2ZITA 2LECA 3JAMY 3IAM9 2GJ2A 1VFJA 1FE0A 2A6OA 2X1GA 4LBZA 4BY7C 1YI2S 1RT7B 3HOXK 2ZL6A 1RTHB 3K2YA 4KC5A 1OB2A 4OP7A 1L3KA 3DOKB 3S16K 1T11A 3CJ8A 2LXIA 4KGVB 5CYMA 3QO9B 2QT7A 2E2IA 4XONA 4A3JC 3ZNUA 3MHPA 4LR2A 4OV6A 1A0OB 4XLCA 3CPXA 4DG1A 3TJ9A 1DD5A 4OHXA 5D0RA 2ROPA 3PZPA 4JV1A 2RE1A 2QLXA 1GEHA 1TUVA 3IG1B 4GKKJ 3OW7A 4A3MK 3KHGA 1HI8A 2BKOA 1USMA 4QOTA 4UAJA 1ZM3A 1NMEB 2YU9A 3LH2S 1D2EA 4KATA 3NKYA 1U2CA 3W2VB 3OTOJ 5CHPA 5J2QB 1S0VA 3EGNA 3S2HC 3EVWA 3ASTA 4XAKA 2OYNA 1USOA 3N0VA 3KDNA 4MFBB 3NE5B 3NGUA 1C0UA 2F9DA 1FI4A 3Q8YA 2ZBCA 4B3FX 4KV8B 4ERDA 3WC0A 1GTHA 4KE5A 2R3VA 4DV7J 2EWHA 1SQGA 4Y9RA 3DOLA 3KK1A 1FXDA 1XC9A 2F40A 4OLOA 1RWXB 3CCVS 2GPJA 2EBEA 2MKYA 2XMVA 2ZTGA 5KFJA 3OL6A 3A3PB 2DIVA 1W25A 3WX8A 3HD2A 2LQ5A 1HYSB 3IRWP 2NVXA 3HHNB 4OI3A 2KRBA 4U7UD 2QTWA 4QV2A 2RH3A 3ZBUA 4QBUA 1DAXA 5T14A 1EQMA 1MWZA 4M5IA 1YNJA 2FJDB 3MGJA 4HT7A 4G0UA 2CDRB 2RILA 4DOZA 3EMTA 3MMAA 4ECYA 5IP7K 5D78A 3CQZC 1HWLA 3UDVA 3IFEA 4DV2J 1VRUB 2E5IA 2CQ1A 4X66J 1VQOB 1YJWB 5IC6B 1ZETA 3N01A 4TMXA 1H0HB 2VQEF 2Q3PA 5IXUA 3ZFVA 1Y5LB 4DR1F 3CPWR 3R6GB 4Z4RA 1KK3A 3NP5A 4M5LA 1N5VA 3VAFA 1RCOB 1R8CA 4NLPA 5A0YB 1Q8BA 2PMHA 4DFMA 3QPIA 3POTA 1APSA 2ZVSA 2Z56B 3SLNA 1LQ9A 3TAMA 2KHCA 2HK2A 2CNKB 3R97A 1U4BA 3DLEA 1Q78A 1O24A 3P5BP 4G0WA 4DL0C 3DLKB 3H0GK 5A8RA 2GC8A 1PJ6A 3H9NA 4NXMF 2XSJB 4HDHA 3W1YC 4RNOA 4ER8A 1V5VA 4LF7J 1AZSB 2ZZFA 4YS2A 1CPZA 1ZM9A 2ACYA 2D3LA 3LO8A 2OTLS 3OR1B 2JLEA 5KFQA 1FDBA 2ZH2A 5EGHA 2ZH6A 4USTA 1UW4A 1TTHB 3E51A 5KNLA 2Y0SL 2HLUA 4DR6F 3EWGA 3DDKA 4QWEA 2DNRA 2YWWA 4U95A 2G1DA 2B5JA 3CJSA 4LBVA 4EGLA 3W2FA 5KFZA 4FKXA 4LBWA 1RQPA 4RO0A 3OR2A 3HOZK 3CW2C 4ZVPB 1JB9A 3S17C 3J7A1 1VQMB 1WU8A 1UJ6A 3UVJB 4MYUA 2VH7A 3KWMA 3C6UB 2XS2A 3I56B 1RKJA 4X4TA 2D9PA 1RAAB 3GQBA 1WNEA 1M1HA 5A88A 1KR4A 2MZTA 1RADB 2HHSA 2M0GB 3WBKA 1EQ0A 3MAHA 2J0WA 3GTKC 8ATCB 3CC7B 2MHNA 1XEZA 1U02A 3DHWC 2FC9A 3ENWA 2KVQE 4ILRA 3LANA 4WU3A 5ITHA 2DGTA 4QW9A 3LP2B
chains in the Genus database with same CATH topology
3TTGA 3TFIA 1WSVA 3A8JA 3AD7C 2GAHC 1YX2A 1WOOA 3GIRA 1WORA 1XZPA 1WOSA 1X31C 1XZPB 3A8KA 5L46A 3AD9C 3ADAC 2GAGC 3A8IA 1NRKA 1VLYA 4PABA 3AD8C 1XZQA 3TFJA 3GSIA 1VLOA 3GEHA 1PJ5A 4P9SA 1PJ6A 1XZQB 4PAAA 1PJ7A 3TFHA 1V5VA