3GIRA

Crystal structure of glycine cleavage system aminomethyltransferase t from bartonella henselae
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
361
Chain Sequence
SLKTLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALLKIGQSRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIALERVLLALQGPQAAAVLADAGLPGNELLFMQGFEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDITPDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFDGPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQRYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycine cleavage system aminomethyltransferase T from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 104
structure length 361
sequence length 361
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 3girA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 3girA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3girA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 3girA03
3GEEA 1VRQC 1V5VA 4PAAA 3ADAC 3GEHA 1PJ5A 1XZPA 2GAGC 3TTGA 1WOOA 1NRKA 4PABA 2GAHC 1XZQB 1WOSA 1PJ6A 5L46A 3TFHA 4P9SA 1X31C 1WOPA 1YX2A 3AD9C 1VLOA 3A8KA 3GEIA 3A8JA 3A8IA 3AD8C 3GIRA 1WSRA 1WSVA 3TFIA 3GSIA 1PJ7A 1XZPB 3TFJA 1VLYA 1WORA 1XZQA 3AD7C
chains in the Genus database with same CATH superfamily
1EI6A 2EBGA 3NNHA 1KVIA 3GEHA 3O2IA 4QQBA 2W2NP 4AXJA 1S5ZA 1D8ZA 4X62F 3CCVS 4BXXK 1D09B 3QFWA 5F8NA 2V2KA 4YB1P 1JLGB 2ZUAA 1D0EA 1NHVA 2XCAA 3ERED 1MSWD 1BWVA 2V6UA 1Q81D 4B3TJ 4GTCA 4DV3F 2WSSA 4IYQA 4IR9A 3E51A 4QOTA 3HD2A 3WBJA 1AFIA 3HOZK 4XLFA 1RWXB 3I9V9 2E2IC 4DFPA 3CAGA 3P45B 4DR4J 1PYOB 3LGHA 1XIQA 5HI7A 4C8YA 3MAAA 1VQ6S 3D54A 1JJ4A 4NZ0A 1FA0A 3KNGA 5C44K 3OZUA 3GP9A 8ATCB 3JU4A 3SKBA 2F8EX 1TL4A 4DZ6A 3LP1B 1NKCA 3GG1A 1RA6A 3HF5A 3CT9A 1EB0A 2BANB 3OHBA 4TN1A 2JDIA 2HFNA 5KG7A 2XHCA 3ZZZA 3OTBA 3CCLB 4A3GC 4GRSA 3VZHA 4NXMF 4X05A 5IS2A 2QLJB 5D4LA 2F4VJ 4FWTA 1S6PB 5IOTA 3TARA 1VQSA 3SCIE 3HHEA 5GVQA 2V2VA 3EM1A 5BR8J 5L39A 4WIIA 3KKFA 2VUGA 4CLFA 1X4BA 3H0PA 1RT4B 5DM7Q 5DETA 2YU9A 2ZFZA 3DOLA 1RDRA 2ZUGA 4R5PB 2JVRA 1IXKA 4P74A 2BPOA 4KH0B 4DPUA 5M5YK 3DU5A 4OI3A 1ZUNB 3DC2A 1NK6A 4UUWA 1XXCA 4WXWA 3V4GA 4M5DA 3W60A 3M2RA 1YSJA 2R93C 4J9NA 1N6QB 1WD6A 2NVTK 2OI2A 1GXTA 4IFVB 1N5SA 5EX0A 4IOCQ 3C16B 3V7AA 4OYBA 4HDGA 2R8HA 1I94F 1MU2A 5IYWA 1U0HB 4WE1A 4QWBA 1HVXA 2C3PA 3M6UA 4F36A 3NWRA 3RBZA 4AUKA 3ASQA 4Z4RA 3FSIA 1XNQF 3I96A 4JI0F 4O44A 4P6QA 4YUDA 2W4PA 4ZCLA 1H8EA 3K7AC 1BQXA 2BBEA 2FVCA 2PDAA 4PQUB 1NNDA 3R1HA 2MHNA 4X66F 2GMHA 2VG6B 4Y65A 1U6FA 4WJBA 3CDBA 4MK7A 3CD6S 4HHJA 2WB1D 4FVMA 2RB7A 1F5CA 3IXQA 2ZC4A 3I5CA 3MMBB 3BY1A 3D1OA 4X7FA 2FDNA 3DFEA 4XL9A 2DNNA 4YB7A 1C1BB 4F26A 2Q6IA 3L4JA 3HM9A 4RBUA 3NNAA 1RK8A 3NWGA 4WZMA 1WQHA 1VC5A 3MHPA 3SQGB 2A2CA 4NASA 1XXBA 3A35A 2RKIA 3LP2A 2FVSA 1HBMB 1ZAWA 4WPAA 1ZM9A 1V5IB 1FWPA 5K5MA 5IFMA 2CFAA 2HKEA 3M32B 3NE5B 2K1RA 2R7XA 4O3OA 4ZVSB 2E5LJ 4UY85 3ILOA 1RT3B 3OZWA 4QZVB 2BE7D 3LO8A 3LALA 3CESA 3OR2A 3DRXA 4TXSA 1Y1VC 1YDLA 4ZP6A 3HFVA 4CO4A 2N7CA 3THTA 4N7TA 5K8MA 5BYQA 1TVRB 4IDKA 3W65A 4LR2A 4RDLA 2W6IA 3DXBA 1FRQA 1I5OB 2R7VA 3PVXA 2L3MA 1Y0HA 1KQFB 3S6EA 4X4PA 3N6NA 4G1QA 4YAOA 2IMWP 3GFXA 2XNCA 5AXNA 1C0AA 4RU9A 1WG4A 2GSUA 2MQ8A 1WKJA 3GVKA 4NLRA 4JI2F 4RNFA 1N33F 4KJIA 1R8HA 4F3OA 5JMNA 4M5JA 1WHXA 1I3QK 2NCKL 2B9YA 2MZJA 6FDRA 5ITHA 2F65A 4OZLA 1KP6A 2C2OB 1QGYA 4I0WA 3NS5A 4DCOB 1SJQA 2ZM6F 3R9LA 2W4DA 1PYTA 4P9SA 3FFIB 3VGTA 1FD2A 2CG8A 4P5AA 4LBPA 4NYOA 1F9NA 3PYGA 1W0KA 2HNZA 3I4NK 1D1NA 1FJEB 3HCXA 2RQ4A 1N05A 3CMMA 3S16K 2CNNB 3KK1B 3QT8A 1R5NA 2U2FA 3CQZA 3W63A 3M30B 2OFHX 4K4YA 4J9PA 1SKRA 3PYEA 5ETSA 2WR8A 1ITPA 3BO4A 4LF1A 4DR3F 4A48A 1KTVA 1QTNB 1Z2ZA 4MIWA 1IM4A 1E1QA 1FRIA 4NLWA 1RHJB 1B7FA 1T94A 1BC6A 2HK3A 4A3EC 4BPRA 3FOEA 3L4KA 3UD4P 1VRUB 4NRTA 2YWGA 4PXBA 4X07A 2MKIA 2VBZA 3KLGB 3K7RA 3HXAA 1RB0A 3M4OK 3TAPA 4C6AA 1SH0A 1PILA 3Q2SC 1EX8A 1ZXOA 3RB6A 4HYKA 1FERA 5J2QB 3QIDA 1URRA 4USJC 3JTOA 2GNKA 5H59A 3MMBA 4UZEA 3A1PA 2BW7A 2FTRA 4DPWA 1W35A 4CIOA 2R6HA 2ADBA 4LF9J 3GTOA 3R2DJ 3KLGA 3B4DA 2V0NA 4CM2A 1WSVA 4DFKA 4JI4J 3FEYB 2DNPA 2XLKA 3M05A 3MF5A 4LUBA 1N36J 1M5SA 4QFMA 3HVAA 3UWTA 4NMXA 1VQ4B 3QJJA 2QZ8A 4U96A 1UPPA 5KFAA 3H98A 2BW2A 5KFHA 3JQRA 1S1WA 1ZH5A 5TJ3A 1Q5VA 1TKXB 1NU4A 4AL5A 2H3EB 3GEEA 2OPSA 1TP7A 4RJLA 3G4SB 1ZM4A 2HFVA 1Q8KA 1N06A 4ZIWA 1WOSA 4NI2A 2CNLB 1N4LA 4DR6J 1QH0A 4F3QA 1MN7A 3AXKA 6AT1B 4C97A 3VALA 4DI6A 4OOXA 1XJWB 1V5VA 1I3OB 3GFZA 1UWBB 3L7PA 1T3NA 2APOA 1UVIA 4QPTA 1LW2A 2YNFA 2C2DA 4ZVUB 1QSLA 3KLHA 3TUIC 2QYCA 2D7SA 1RTDB 1AZSB 5CH7B 2BRKA 2WTFA 1WELA 5KFJA 3PG9A 4YDDB 3TO8A 3Q83A 3TVZA 5KFPA 2V7VA 5IC6B 4FPIA 5KFKA 3C6UA 4XKWA 1S7HA 3NY0A 1RQRA 2OKQA 5M2RA 4YAWA 1TWHK 2IDLA 3K5LA 3T41A 3MEGB 3ZTSA 2WAQL 3GJRB 4PGOA 2RUSA 5F8HA 4M5GA 3T5KA 3H2UB 1RUSA 1RWKB 2D3ZA 1FHTA 3H2LA 1C0UB 4A3FK 1Q7YT 3S1MC 5DLGA 3PRVA 1RISA 3J81k 2JA8C 1KVKA 4LMZA 2ZITA 2L9DA 4YAFA 2X0KA 5J2NA 3ULHA 4DLEA 3MEGA 2JA7K 2RDJA 2HHPA 2GHPA 8RUCA 2RRBA 4XKVA 1Y5NB 1F3VA 3QIPA 1BY9A 1JVIA 3CCVB 4DPTA 3GTLC 1U0SA 1UD3A 2WSCC 1HNWJ 2MKHA 5HVHA 3SSSA 1XMOJ 4GTEA 3CE8A 3T3FA 2JA6A 4DF4A 5D0EA 1S57A 5KFMA 1S1TB 3NRBA 1U1KA 1SV5B 1V9OA 4FKXA 2AEFA 3GPAA 1GT8A 2Q3PA 2V9WA 1RACB 4XLNA 2UUAF 2W7AA 3OW2B 3B6BA 1VQMB 1O26A 2BE2B 3ZZRA 5HN0A 3MMCB 1UETA 2E66A 4ZVQB 2MJNA 1YITS 3BKFA 2COLA 2JLGA 2XNRA 1BGWA 4OYMA 3WX4A 1HIYA 1GJRA 4Y6IA 2AGOA 2LQBA 4AQYJ 2RGRA 1CJTB 3OJWA 5M3MK 3V76A 4ZP8A 9ATCB 1XZQB 5IYDK 2LP4A 1VQ9S 2RS8A 1T05A 1YI2B 2R42A 1ZYRA 2BE9B 3BGLA 3EDRB 3OUYA 4MKBA 4ZVPB 4G1IA 1VBXA 1R43A 4GVBA 4PYDA 2CADA 2B8PA 5J35A 3NBPB 4X0CA 4RPFA 1VJEA 1UPMB 4M2LA 3O3LA 1FI4A 3NXZA 1RI7A 2HSEB 2JL9A 5HMXA 4XM3A 3IRWP 1W9XA 1SB6A 2QFIA 2ZH4A 1UJ4A 3MAQA 2AEMA 3AH5A 3MM9B 2AW0A 1YX2A 4GVBB 1CG2A 1GMVA 1QLNA 3QATA 2JHEA 4II2A 2V8DA 4BBSC 3ZUGA 4IFYB 4EK2A 4YB6A 3QBCA 1COWA 4KYZA 4LRBA 2W7PA 1U6BA 2YNIB 3QE2A 5K14B 3AVTA 4X7DA 1EP1B 2KJVA 1RU1A 4P73A 4ED4A 2CPYA 1TK8A 1Q0NA 2IRYA 1MNEA 4OMFG 3HXMA 3NKYA 2OUGA 3OPKA 4OIQA 3T56B 4CLKA 4NWBA 3DGPB 3G9CA 3PA1A 4LF6F 3UDLA 5KT7A 3F44A 2YX4A 1FNBA 3BM7A 2UV8A 4KASA 4O23A 1E6VA 4YHHJ 1K0TA 3CCJB 4MFBB 1WQGA 4NOHA 1C2PA 1TKTA 1Q82D 4K4XA 1M5PC 1U2CA 4OHXA 3UR0A 2MGZB 1H2UX 2IAJB 3BGRB 1XMBA 2V2ZA 2YQ1A 2ZUFA 2LMIA 4P3IA 5D15A 2VOOA 4Z37A 1JLAB 2BUNA 1LV5A 5L1KA 1TWCA 4J9VA 3RRGA 3H4BA 4B3SJ 2QA2A 3CCSS 1NSAA 1FTRA 4LIRA 4M5MA 4MKYA 5DG8A 4Y0FA 4PWDA 3RAXA 3LA0A 3CO9A 3G82A 5B0CA 3CCSB 4FBUA 4OINA 5E3PA 3W5VA 4X6AK 3FCHA 2R2TA 2FHJA 3HOWK 1HNWF 9RUBA 3R5JB 4WFAQ 5ETKA 1VBKA 2L48A 2CDRB 3I5AA 3W2GA 1ZOTA 4YMEA 4KHPF 1JX4A 4HT7A 4Y2KA 3C15A 1HW8A 2WB1L 1OIAA 1RTHB 1ZBTA 3KYLA 4XD7A 2ZE2A 2CRLA 1MRZA 3GCXP 3IR5B 2V69A 3VO1A 3MTJA 1FNOA 3CCEB 4DV4J 1GNKA 3PUMA 1FNXH 2RT3A 3ZPNA 4NOIA 1IWAA 1H7XA 1K47A 1RQPA 3GTKC 1DRZA 3IM9A 3SFGA 4YN3B 3BQJA 4E0FA 4A8FA 4ZDNA 1PJ6A 1RT5B 3QGGA 5SUHA 1LWFB 3SQOP 1U49A 4MKVA 3FSXA 1WI6A 5KT4A 3HVRA 4ID8A 4FM9A 4DXLA 1X4EA 3S1NC 4ED6A 1ZPWX 3LWMA 5AJ3F 4UAJA 2W9AA 4DV7J 3QAUA 1HNXJ 2FY1A 2Q6LA 2Y1JA 5HKKA 3L9ZA 5C4JC 4USTA 3PYDA 4DQSA 3EXCX 5HQLA 5B7WA 1EFUA 1SC6A 1RWMB 2ADCA 4P6VF 5IOSA 4UQTA 1KHVA 3BJYA 4P2NA 4NCNA 4WFZA 4R5PA 3CF5Q 1VC6A 1BJTA 2ZL7A 2AHOB 1CQMA 4DR2J 3GE9A 2Q6BA 3LVBA 2JZ5A 3LQEA 1Q7YD 2GMLA 4N8OA 2JA6C 4QJVB 3TA1A 5B0FA 3GTKA 2AV5A 4X4OA 1FX0A 2CJKA 1CSJA 1ELOA 2ACMA 3PKYA 1BWEA 2J9DA 1HNIB 3T1AA 4C9DA 3CMES 3HOXC 1TAQA 3TQEA 4PPDA 5IZHA 3AT1B 3PO3C 2P6SA 4MK9A 1QFZA 4ANDA 2CRVA 1H74A 3MCMA 4U7UK 4CO0A 1Q82T 4HE5A 1IJFA 2F9JA 3C8YA 4I7FB 2J8SA 4F25A 3M9NB 1NJWA 3BP8C 1K1SA 4IO1A 4JUZA 2ZFHA 2DNYA 5C24B 2RNEA 3QFTA 2YY3A 1QAJA 2WVFA 1N8RD 5CXTA 2ROEA 4N3NA 2JN9A 1XMQF 3BUEA 3K8WA 3IGVA 3HK2A 3GTMA 2XCQA 4LFAF 2R7ZC 3HKZD 3M8ZA 3OJXA 3A4TA 2VODA 2C22A 2CQHA 2VUMC 3SIPB 2MQOA 1WC0A 2R2RA 3CCWA 2H51B 1TUWA 4X64J 1E3ZA 1VQNS 3DRPB 2B7CB 4JOUA 2D3NA 2RQKA 5J2MA 2X1FA 2HQCA 1GFWB 4MEXA 2K8GA 1I8DA 1R0AA 1RA7A 4GC7A 3RY8A 1IR1A 1KK1A 3OBIA 3MR6A 4TMTA 1LK7A 1OPIA 1N48A 1LW2B 2YNFB 2WONB 1IKWB 2HWHA 2DHSA 4QIWD 2WW8A 2VV5A 3KLEB 2DNMA 3QT5A 2V6SA 3KJQB 4DX8H 4LF6J 2Y0SD 2G13A 1FJGJ 2JC0A 3NMAA 1MMNA 4TMVA 4OPVA 5DGAA 1HD1A 3I32A 3I82A 1JLBB 4J9RA 2ZH8A 1TKTB 1DARA 1W7WA 4A93K 4OYOA 1YI2S 4IOBA 1UD4A 1VQLB 1QAXA 3H0GA 5JXSA 2PPBA 4I69A 4K1XA 3U6BA 1N5YB 4DL2A 1UZHA 4BY1C 4TY9A 4RNOA 5J1PA 1AUSL 3BB5A 2GQCA 3WQPA 5H9EK 3LQVA 3PO3K 1HYSB 2QMUB 2UXDJ 2OYNA 2QTLA 1TL7B 3BBBA 2QIFA 3CC4S 2YWKA 4TVAB 2YKMA 1NKEA 4Y2CA 4CO1A 1WSRA 2CDQA 3IN5A 4ZS6A 3BQ2A 1IBLJ 4DG1A 3IGNA 4F02A 2Q66A 5KFDA 2IDEA 2MPUA 4JI8J 4FKYA 5ETOA 4NZ7A 2PI5A 1VQ4S 3QIPB 1VIXA 1HZEA 3KK3A 1NZ8A 4EGLA 1NBEB 4WP9A 1GTEA 1VQYA 2UP1A 3HHDA 3NOCA 3LQ6A 4EBCA 1TV6B 1F2GA 1FKOB 3RAQA 3M8PB 1UD8A 1P6TA 2PEHA 2JA7A 2DR9A 2XI2A 4GZYA 1K9MD 4KV8A 3OEEA 3D3CJ 1OO0B 2VG5B 3CCJS 4WZLA 1VQOB 2UVRA 1KQGB 2QA4S 2D3UA 4X84A 1VQOS 4RCYA 1RKJA 3H0GK 4DLGA 1HWKA 1HPZA 1JWWA 3TX8A 2HIQA 5DG9A 4B44A 3DI6B 3HOUC 4ZGQB 2H54B 2XMUA 2FGOA 3HOVC 2WYRA 1R89A 4IW3B 4JI6J 4QWAA 1QFJA 2GSNA 1GEHA 3I56S 5T7LA 1EFRA 4PG4A 2ZNZA 1ZAVA 4Y28C 4ACBA 1NM2A 3KDNA 4WU3A 2JLFA 1KSPA 2HWTA 1K9MT 2JSXA 2GIRA 4YOEA 1S6OA 3C14A 2XI3A 2M8HA 2NVYK 5GADU 3PX4A 5HXBA 2ZL6A 3PKMA 4BKWA 3QFHA 2E5JA 2E7VA 2DISA 2GO8A 3G4CA 4M0LA 5I3UB 1UA0A 4O4RA 3DN9A 3W61A 2NYHA 1KFSA 5IP9C 2VQFJ 2GK7A 3EVMA 1A0OB 5I3PA 2C3MA 2VONA 3UQSA 3R7SB 5FO0A 2BN4A 2M70A 3O1LA 3G4AA 1KD1D 1FESA 2HFOA 2V9KA 2C5BA 1WACA 3CCUS 3DOLB 1S0NA 1FE4A 4KKOA 3K17A 4EFAC 1UWAA 2Q6CA 2XOKA 2RSQA 4DV0F 5KFGA 4CH0S 2OFGX 2MKSA 1R9TK 3VZIA 4XQFA 1PG5B 3AVYA 3HX9A 2DGSA 4HKQA 3P5TL 1JLQB 4B02A 3TZWA 4LREA 2V7QA 2LDIA 1ZS6A 2HS3A 3ISZA 2R2SA 4MK8A 2XM3A 2LQ8A 4J3NA 4ZVEA 4YS2A 1JIHA 5FJ4A 1VQNB 2MJUA 2GHVC 4DFJA 1R27B 4F67A 1M5KC 3R5BA 2F3JA 3D1HA 5J2PB 1Q86D 1WF2A 1S59A 4LQYA 2JEGA 3OXFA 2O5IA 2FJAB 1JLAA 6FD1A 2DKOB 2EEYA 3MCSA 5K8OA 4PQUA 4RD2A 3MMAB 2O1PA 1ZQ1C 2Y3YA 3MTKA 2VPXB 1NLKL 4ZV4A 3ILIA 1Z2LA 3GTOC 1JLCB 4DF8A 3N6MA 4M5KA 4K8RA 1IR2A 3CC2S 1NSKL 3CMAS 1ZAXA 4K4VA 1TWFK 1IBAA 1E62A 1HKAA 1YJWS 3CD7A 3R2CJ 2XZDB 1SUQB 2GPJA 4MQ9A 2DHHA 1RCOB 4H4OB 4NLQA 1Y0RA 4HHUA 4C3IK 1F60A 4ELVA 1WTFA 1R6VA 3JQKA 2CIMA 4KY3A 1CC7A 4AYBL 3I31A 3TJ8A 3CO0P 1ZM3A 3IO1A 1VGXA 1EKRA 2WONA 4ZIVA 3AFGA 2Y0BB 3MCNA 5KFZA 4DR4F 2PFFB 1IW7A 3N5FA 1VIOA 1VQ5B 3T02A 4X7EA 4P7TA 2MHEA 4FS1A 4D3HA 1HQEA 3LANA 2K1RB 3FSYA 2K7JA 2KL8A 2GA7A 4GTFA 4DV2J 2A6EA 2WBMA 3DLKA 3QZ8A 5I42A 1GR1A 5IT9U 2G2YA 3ONQA 4RZRA 5HL8A 4AQYF 1QG0A 3CIZA 1RJJA 4X4QA 3I4MC 4PAAA 1Y10A 4B9LA 4OYAA 4L8JA 1N33J 2PA3A 2UVUA 3D3BJ 2Z58B 4WZEA 3L95X 1IKVA 2ZWOA 3CPWB 4ES1A 4DR3J 4XORA 2HZVA 1FNCA 3BY2A 1FNMA 2HDNB 1TFYA 4K4ZA 4C11B 4QYZJ 2DH9A 2JA5K 4IR1A 1QUFA 2W6JA 3UDCA 2IVYA 5LSLA 3V6DA 5GAGU 3QRQA 4DHVA 5KAKA 4Y2MA 4Q7JB 2IYIA 5GV7A 5GAEU 1UEVA 3D0GE 3EXYA 2HLUA 5DN6A 4ZLLA 2QGFB 1G1XA 1Q81T 4WKRA 3LO3A 4BXXC 2BANA 3IAS9 1UVKA 2D41A 3T1HF 2HHWA 2QT7A 1UFLA 4ED0A 1YLXA 2WOMA 2AIRB 1QVGR 1YNJA 5LL6d 2IVFB 3W7BA 2OELA 3D0HE 2IYGA 2QLFB 4X65J 4P71A 2XO7A 2L9WA 3GLJA 4NA3A 4A3BK 4I64A 2WZNA 4LQ9A 1J5EJ 2X1BA 3TUJC 1KMHA 4M1XA 2HHUA 2NVTC 2QC3A 3M30A 3NAHA 3QJPA 2BDPA 2CA9A 3LGMA 4KATA 1I50C 3FEZA 4DK1A 1WI8A 2VBXA 2JFDA 1YRXA 4BBYA 2N82B 3UCGA 1FF2A 5L8RC 3OL8A 4YEJA 4C3HK 3P5BP 1U2FA 2OEJA 1J98A 4LF7F 5KOXA 2UU9J 1YTYA 3BKTA 2ZXHA 3C16A 2WHOA 2A1BA 3K58A 2PMZL 3GTYX 2PIIA 4EU0A 2CPDA 5B0BA 3PR4A 3CRZA 1RE1B 4USKA 4FXDA 4LFCF 5IYBK 3HOYC 3VTIA 1UFKA 5KFYA 3PO2K 2KM8C 3I4PA 2E5GA 1B4BA 4FYDA 4XO0A 1MG7A 3JQQA 1T8EA 4KM8A 5F0WA 1U2RA 3QZ7A 3TVKA 4OX6A 4DL6A 3M8YA 1N32F 2XG8A 1EFCA 3NCPA 1W2BR 1CPZA 1L0WA 3OUYB 2C2WA 1F60B 3M2UB 4LFAJ 2LKZA 3KLIA 4C7QA 4LR9A 3IS9B 2EKNA 1H0HB 1U7LA 3DOKB 3W2HA 2KYZA 2LLZA 1QVFR 2UXCJ 1REVA 2AJ0A 3IAM9 3Q8QB 1WCMK 3PW4A 1HL6A 4DV6F 3SI8A 2OPSB 4Y00A 3ZZTA 2EBEA 3IR7B 1NK7A 3CDEA 2R7ZK 2Z6BD 4N8NA 3PRBA 3MECA 4QU6A 1HBMA 3CCMB 1Y1VK 5B0AA 3Q3AA 1JJ2R 1KK0A 1HMVA 2EKYA 3AB2B 5J1NA 4OJHA 1JJHA 4TN2A 2X6XA 2FIUA 1PSDA 1RT5A 2MQPA 2YH0A 1RP5A 3GQCA 3CW2C 4NLOA 1WCMA 3OR2B 1XC9A 3AA8A 4CO2A 5G0RB 2CF4A 2M5SA 2I1LA 4H4KA 3VAKA 3P49B 2ASDA 2UUCJ 4IOAQ 1UEUA 2DPIA 4ANEA 4OJGA 3A3BA 2XSFA 4BC7A 3KK2A 1VQ5S 1YNNA 4Q0BA 2M8DB 4GTDA 3DRSA 1T9UA 2WRMA 3MMPA 2KHCA 4DQPA 3BGRA 1TL7A 1EQRA 2M88A 3V4IA 1A8PA 2DXDA 1LW0A 3MM6B 4LF8J 4K0KJ 3ASSA 4ECRA 1BQMB 4WXOA 3CPWR 1YBAA 1X4GA 2D74A 4NLVA 5CJ9A 2PLFA 1IKYB 1IWGA 1FO1A 4LSLA 5DSZA 2BABA 1O29A 3W2WB 3DRSB 3Q6QA 2R2UA 1QDUB 4ETXA 4R8UA 3IRXB 3LF0A 1UV7A 2AQ4A 4DUTA 2ZH5A 4OOVA 2Y8WA 2C2RA 1I6HK 2HNZB 2P8IA 3IWLA 1OMSA 1UFWA 3S1TA 3H3VD 4CLUA 4ZVRB 3TUZC 3J7ZT 2XGPA 2MZ1A 1KVJA 1LOUA 3C2PA 1IM6A 2D74B 4USWA 2XB2D 3ET6A 2C77A 3HLUA 2P5VA 4TYBA 2VG5A 1H6KX 1Q86T 2DPJA 4J37A 2Q1LA 5F8GA 2XMJA 3SCLE 3EVOA 2OK8A 1SJ4P 3W5YA 2HAFA 3NGDA 1D3WA 1UEKA 1ZTWA 4J9UE 4ER8A 4Y3CA 4ECYA 4DCPB 3R6JA 3CCRS 3UNYA 1O24A 2IA6A 1IJEA 4YHHF 2E9TA 2IJRA 5AT1B 1TWGC 3DDKA 2J0SD 4O2DA 5EGEA 3MMCA 2ZHBA 3D26A 5KFEA 4BBSK 5JVOA 4O3QA 1KLNA 1TWCK 3P6YC 1IQ0A 2VU5A 5HP1A 2OMLA 3M2UA 1JLFA 3B78A 1XMQJ 1S4EA 1EETB 4A47A 1F7VA 1FFGB 4TY8A 3MM5B 2VNIA 2HBRB 2V8VA 4J0QA 1DY3A 2LFVA 3KHRA 4A3CK 5DO2A 4PUOB 2Z57B 1BQEA 4NBSA 2J6UA 2GVZB 2Y9HA 2HRYA 2DXEA 2RDDA 4A8OA 4TU9A 1TL3A 1E63A 5CYQB 4MEYA 5H9FK 4WTOB 4P7VA 2HQGA 2EWHA 4MJKA 1XR6A 3IG1B 1WC4A 1QVFB 3IPJA 3DDYA 4M63A 1QAIA 4OYPA 2CC2A 4RR5A 4M5DB 3PM9A 4ZGNB 4EYHB 4DUZF 3AY0A 3QFSA 1GAOA 2R7SA 1INNA 5IYCK 2CQPA 2YBVA 4CTAB 3KLEA 2BJDA 4RW9B 5EWGA 2NR0A 2JDJA 2XCRB 2GQFA 5F4MA 3PVDA 1SXLA 4Q8EA 1H42A 3T1YF 2B5JA 3KWMA 1FDRA 3WBZA 2KHDA 2HVHA 4I6YA 2XBPA 3POTB 2DHXA 1JNZB 4ZVOB 5IT0A 4DV0J 3GTPK 1JLQA 1AZSA 1PBAA 3Q86A 4WWSA 3CD6B 1NO8A 4GTLA 1IJFB 3OL9A 1OGJA 3W2VB 2YKPA 2HWIA 2PHCB 2EC0A 2CW5A 3K57A 2MQMA 3PDNA 1B70B 4II3A 1MW7A 2YKMB 2ROPA 3IRXA 2DY9A 4OX8A 1YJTA 1PC5A 5DQIA 1QUVA 4QIGA 2F9DA 4WP8A 3JS9A 1DDGA 3BR9A 3OTEA 3UE2A 1NPPA 2KXNB 4A8WA 3RAMA 3Q8YA 3CNQP 1AIPA 1S72S 1EP4A 4DV1F 5A8WB 2H5JB 3GTGK 4XONA 4LF5J 4FZBA 5FLXU 1F1BB 4W4MA 5HK4A 1NK8A 2W9BB 2LVWA 3I0RB 3BNWA 5AN9A 3OREA 4RBTA 1D8TA 3D5MA 2QO3A 4F0HA 2MKKA 2FLOA 3IA0A 1K8AD 4DS4A 1LK5A 2BE5A 3S8SA 4L74A 2A3JA 3NCQA 3FRZA 3A13A 2R8JA 1NDCA 3C15B 5B08A 4FP9A 1NAQA 1QSYA 1U24A 2KXHA 3CJTA 1SKYB 4Z7YA 5HP1B 5TMFA 3CJQA 4FVCA 4CP5A 2DD8S 3G71S 4IG0A 4LLGA 3U6KA 3EDQB 3R27A 3U7JA 5T7LB 1LWCB 2B43A 2NS1B 3PW0A 3MURP 3SMZA 2DNHA 1FFWB 5AXMA 1RBLA 2IVMA 3S7RA 1HI9A 3RRKA 2E1RA 3C14B 4GTBA 2ZL5A 2P6TA 1F9FA 1VLYA 3SJPA 3CCTA 2JNJA 3DMJB 2RUGA 1OB0A 4KGMA 3SV3A 3EPIA 4MKAA 3IG1A 1KD1T 2FLLA 1YZ6A 3VAHA 1K8AT 4X8IA 2VBYA 4CRJA 3MDFA 3GTLK 2VG7A 2VBVA 1KR4A 3C6TB 1U26A 4ZHRB 1G6BA 4LSLB 3S0XA 4Y9RA 4KR0B 4KRWA 4KB2A 3KFWX 4C0OC 5E5NA 3O5TB 2LQJA 1VCTA 3TFIA 4Q4ZA 2CYYA 4KKSA 2EVZA 3LP1A 4DR2F 1WHVA 3NS6A 4CNYA 3IFEA 2DITA 2MZQA 1JLEA 3CP8A 2NSCA 1L3KA 3TYTA 2E2HC 1VQMS 3ZZ0A 4GMKA 4NPOA 4R0EA 3ZZOA 1KDNA 2K3KA 3BP3A 1FCAA 3MHYA 3L7UA 3WZ0A 3NNCA 3TFJA 1XBWA 2VKRA 3H2VE 4TKOB 2PEBA 3S2DC 2CXEA 5KT2A 4E2FB 2B63A 2BMBA 2XY7A 4V19X 3V6HA 2JA6K 1JB9A 3LAMA 2H1YA 3EYZA 1WKLA 2VBWA 1RHMB 4DV3J 2LU2A 5DDQC 1TELA 2XSJB 4DQIA 1F20A 2HMAA 3W64A 2A10A 3TZYA 1TTHB 3H5UA 2ZZQA 4JV1A 5C4XK 5J2PA 3VR6A 5FL7A 3HFKA 3W8GA 3OHAA 3WY9A 3DGPA 1XEZA 3ISNC 5HLFB 3WYAA 2UXCF 2AWZA 1VMBA 4PG7A 2M4MA 1CJVB 2E5HA 4OX9F 4MFBA 2DGTA 1MU2B 2DJWA 1RU2A 1SC1B 4QW8A 1TKXA 1FVQA 1R0BG 4RL1A 2GVZA 4I68A 2IBKA 4K5RA 5H5JA 3EZUA 1KK2A 3SJZA 4X4VA 5BSYA 5HLFA 4DR5F 5IYNA 3KLIB 4CM0A 3GILA 1XMOF 4N41A 2CJBA 3QLHB 1NRKA 4A3FC 2KVQE 2IJFA 3QNWB 1UD5A 4DL0C 2RAQA 3GWCA 3A3OB 4BWJA 4DWIA 2BRLA 3BCFA 2VB6A 4PWDB 4LIWA 4DUZJ 1QE1B 4F4XA 3D9BA 2K3IA 4PC7A 3RGIA 2VFVA 2L41A 4RUAA 4RD4A 1TWAK 1MLAA 3G6VA 2WVBA 3FMBA 3NLCA 2ZVSA 4USMA 5DRKA 5J2MB 4QVAA 2XMMA 3K0JA 4EH1A 3J7A1 1ZVUA 2OHDA 3Q89A 2NPFA 1X9MA 2RKIB 4C48A 3HP6A 2RHQB 5ETTA 1KOOA 3JSTA 4U7UD 3MM7B 3HSZA 3QSYB 3NP5A 2UUBF 3RZOC 2YNHA 2NSBA 2CFAB 4RO0A 3CULA 4CLLA 2LQ9A 5C2CA 3NGUA 3M3YC 4I1TA 2YKAA 1KKHA 3HULA 1TLLA 4HACA 2F63A 5KFNA 1RWWB 3KK2B 1JXLA 3QWPA 2XS2A 4QHYA 4OJ1A 4Y9UA 4KE5A 2FLPA 4CYUB 2W7VA 1HR0F 4Z4VA 4H4KC 4KO0B 1FKPB 2R92A 4L75A 3MI7X 4G7ZA 2UUAJ 3ZXWA 4JB8B 3RTVA 3H5XA 3TVYA 4WZQA 4B3OB 4HACB 3Q8PB 2VIHA 4ECWA 3CJRA 5A8WA 4DV5F 3JSRA 4F04B 2PT0A 1P9QC 2Z4PA 2ASYA 1U8SA 4X62J 1FRXA 1SV5A 1YJUA 4ICLA 1WG1A 4KBIA 1O25A 3GVLA 3MD3A 2FHKA 2VFRA 2ILYA 5KT6A 2DT9A 2XC9A 3BF4A 4JBCA 4C98A 2CQ1A 3BCDA 2GV1A 3E01B 5ETNA 4TMXA 1FDBA 1SFOK 3GV7B 4AF6A 1TU0B 4ECXA 2H5EA 1IE0A 2NYIA 2ZBUA 2ZEJA 3KLFA 4Y2AA 4WTYA 3MPYA 3P96A 3M9MB 1OHHA 2D6FC 1RLCL 1CJTA 4DV4F 1I50A 4CWBA 1Y9OA 1SM4A 3WHIA 4K4WA 1N08A 4F2SA 3BS9A 3LPEA 4Q5VA 4DR7J 3DOMA 2Z2YB 1RYSA 4DR6F 2CPEA 1A7GE 5C44C 1M90T 1YJ7A 3DNCA 4FF1A 3QLHA 3A8KA 3GTJC 3HHLD 4I6WA 2LEAA 2R8GA 4OI2A 4YR0A 4LVNP 3FVYA 3VAIA 5ETPA 3JQJA 4ID5B 2VBTA 4LBIA 4NLGA 2A6MA 3JSYA 2M3DA 4DN0A 1Y1WA 2W8LA 1L5UA 3W2IA 4R25A 3T6BA 4CH7A 4CLZA 4HIZA 4M8LA 1RAIB 2IC3A 3MM8A 5F8LA 3OE7A 2RHSB 2D69A 3CCLS 3VGVA 4CZCA 2MSTA 2GAGC 4N77A 5CZXA 4QR2A 4R0JA 4ENOA 1OSCA 3NGRA 2UVVA 4XLHA 5KFLA 5A0YB 2RMLA 2JEIA 3HOXK 1JNRB 2CQ3A 2G1DA 3L3CA 2QDXA 3HVWA 2NQPA 2CPIA 1O2FB 1NMEB 2Q43A 2KDOA 4O3SA 4K4UA 4A8YA 2DNGA 5MAOA 4RCZA 4ILLA 1S1WB 3IBCB 3WXMA 4OL8A 1YBUA 1VQPB 1L3UA 2ZVIA 3W9HA 5DM6Q 1U47A 5G0RA 4KB4A 3BREA 2XSJA 5F9NA 3GFHA 4LFBF 4DN9A 3RB4A 1TWFA 4ZPTR 2VKZG 4O4GB 4CT8A 4M5HA 1WUUA 3CEDA 4U9UA 4KHPJ 2NREA 1S4MA 3P27A 5IK2A 4QPXA 2H9ZA 1MWZA 1U4BA 2CQDA 2VFUA 1MWQA 1QUPA 1XXAA 1SQEA 3PO2C 1DZ5A 3S1RC 3OJUA 1I1GA 4K4SA 2JLEA 1T95A 5HL7Q 1VQ7S 2MZTA 4OHVA 3M4OC 1O27A 2RF2A 4YB5A 4ICLB 4ETZA 2FD2A 1IBCB 2E1BA 4A3JC 2PC6A 3OL6A 3CMEB 2WVDA 4M5NA 4I7FA 4HT5A 4RUBA 2W25A 4DV5J 4EEYA 3EJMA 1A9NB 2K2PA 4L6V3 1APSA 4MTPA 4RW6A 5K20B 3S14C 2QL7B 2NXJA 1LKZA 3MD1A 4DX5A 2KRRA 1NBMA 2ZE2B 1G7CB 3CB4A 1QUEA 4LF5F 2ZJQQ 4X64F 2HURA 3I9ZA 3OW2R 1VOMA 2GHWA 2O66A 2RD5C 3UFCX 4A8XA 1R8PA 5EGHA 3T9ZA 3KXDA 4DK0A 3KDOA 1RHQB 1URNA 5D8HB 3VNUA 5C42A 4KC5A 4A93C 2ATCB 2C28A 3PFOA 3SEJA 1LWFA 4A3KC 4ZCKA 2FHOB 4O3NA 3Q8SB 1HFEL 3T6JA 1UTAA 1CS4B 4I2PA 3K5NA 3EGNA 1QVGB 4LBYA 2KJWA 3UD3P 4QWCA 2WSFC 1RAEB 4IH5A 5C25A 1FDAA 1HWIA 5RUBA 4A3DC 2VD3A 1Q1KA 4HH1A 1SQGA 4RU2A 3IWXA 4WQMA 3T53B 3PZPA 1O51A 2I6WA 3W5ZA 1BX1A 2NLWA 1S9GA 3BGOP 1HNVA 4PG6A 3NCRA 3NGSA 1YKWA 5BYSA 3EZOA 4DQLA 4AF7A 2FYXA 4URSA 2NXCA 3OFEA 4LSNA 1N56A 2QE5A 4F3MA 2EC2A 3BN7A 5B0GA 2C4UA 5CDFA 3MEEA 1N5VA 5A8KB 3V6DB 2B4VA 2BQ3A 5HVGA 4P6YA 2NXUA 1FWLA 2KN4A 1VF7A 5F3TA 4J9OA 3OPOA 2V7XA 1W0JA 4W98A 1IKYA 3S15K 3RR7A 4LSNB 3ISND 1S72B 2KKHA 2HRTA 4RW9A 1VRTA 4GVLA 3GQBA 4LC0A 2AJFE 5LMNF 4AD6A 1OWXA 2ZKTA 2JA7C 3ZIAA 1NSPA 2XYPB 2WVCA 4KDDA 1K1QA 1QX4A 1VBYA 4XLAA 3M8SA 3PIPQ 1T7PA 3OV7A 1K73T 1FJGF 1FJCA 1GVHA 4KQZA 4EO6A 2ZH1A 2J76E 2CWKA 2E2HA 5D3GB 4UT4A 3OAAA 1Y1VA 1T5EA 3S14K 1BUXA 3KMSA 4LF2A 4XMYA 3RZDC 2FGCA 2XTJP 1SFOA 2C5HA 1IKXA 2FX3A 3BSOA 1J9ZA 3UVJA 3OW7A 5KFOA 2LEPA 1VRTB 1RABB 3D66A 3AODA 3PACA 2Y1IA 2DNKA 4DJBA 3RB0A 5D4DA 2W8KA 2FQTA 1UCNA 3TNVA 1N34F 4RDJA 4CO3A 1IN0A 1TMMA 4K2XA 1E64A 4J9QA 5FDLB 4UW2A 3DLJA 2VNHA 1YHQB 2F8MA 2Y0SL 3N0VA 1FXDA 4WK3A 1FK9A 1LEOA 4PEOA 1KJZA 1VJWA 2BMWA 4A3MK 2AGQA 4XOTA 1SVDA 5J3OA 1WIHA 4CLPA 5K8PA 4PRFA 1G7CA 2E9RX 4P3YA 2LXUA 2IFXA 3GMGA 3ILJA 3JYTA 4QR1A 1K83K 5EGYA 1PCAA 3N28A 4RD6A 4M53A 1P8GA 1KONA 3VCDA 3PJXA 3CCUB 3PJWA 3MFIA 5IYBC 3HOYK 3D6TB 3LP2B 2HPUA 2QA1A 1TL3B 5AXLA 3MR2A 1XTZA 4A3EK 4IKAA 4TYAA 3OJSA 1RLDA 2LXFA 3VMFA 4FNHA 4KGVB 1D2EA 3UN3A 4LK1A 1UP1A 2PSZA 4HR2A 2YTCA 2V7WA 2A2DA 1RT3A 3J81j 4G0VA 2BJ3A 2QLBB 1T02A 4OP7A 2DNQA 3H59A 3QFRA 4RWXA 3GTLA 1B7YB 5D4PA 3TEGA 1DCOA 5LJ5Y 3MEDA 4O0NA 4J91A 4NCGB 1G7RA 2BKOA 1RAFB 3EGWB 3POTA 3E2EA 1HQUB 4ED2A 3J7YU 2Q6KA 4E0DA 3FGVA 4G6VB 1HBNB 2NVQC 2XMVA 5CD4H 2FHMA 3HJVA 4FPRA 1RTJB 3IP0A 1IUJA 3H0GC 3CPXA 2QL5B 3GTGA 1GMWD 2MEWA 3FJOA 4Y52K 3HMJG 4ED8A 2HIYA 2NUUG 1QY7A 2V67A 4Q0BB 5EN1A 4RNNA 1TMJA 2HK2A 3LPYA 3KEWA 3UCUP 4DSJA 4O44B 3RR8A 5LMUJ 1IBLF 4A8QA 1A6LA 3PW2A 1JJ2B 2XYHB 4ZJLA 4ES3A 3CCQS 3ZTOA 4B3SF 4AVZA 1IBKJ 2YPZA 3CCQB 4ED5A 3RYLA 3R3TA 3CGIA 4AYBD 3PX6A 3U2QA 1YWXA 4UZBA 5D3GA 3KK1A 4OHWA 2R93A 1AT1B 2ZBIA 4ZLJA 1I94J 1LFWA 4RD3A 5L46A 1VQ7B 1RADB 4LRDA 1KC8T 2KU7A 2CPJA 3QGIA 2CJ9A 3G8QA 2PO4A 3G8TA 5C5JA 4TMWA 1JQWA 2ZZGA 3MMAA 1MMDA 5GMKa 3LAPA 4QIEA 2VL1A 1IB0A 1DFDA 1HNXF 2JA5A 4LR8A 1EAYC 2W1BA 4DSIA 3ONYA 3QQCD 2YQ3A 3MUVP 3I4MK 3QJLA 3PEHA 3T19A 3VF0B 3ENAA 5C3EK 2CNOB 1QM9A 4A8MP 2AX0A 2F4VF 3D6HB 2P3MA 2H4YB 3HHLB 3WBKA 3I6PA 3FCWA 4DPXA 1USMA 2ZOGA 2LEBA 4J7CA 5A8AA 4ZN1A 2M5YA 3RW6A 3GYGA 3T9NA 3FJ2A 3IR6B 1R5BA 2GIQA 4P12A 2QSFA 3D28A 3PJ9A 5FA6A 4G7XA 3I5BA 2DIEA 3OFHA 2DVIA 2DGQA 3MGJA 4NZ6A 4B43A 3CDWA 2P5MA 3DMJA 2GJIA 1RKIA 1C1CA 3ES9A 3GCWP 3DLEA 3NG8A 5F9LA 1SJ3P 4OHZA 5E3RA 3EPGA 3LWLA 5IP7K 1T6ZA 1HWUA 1U1OA 1N52B 4WKYA 2V6AA 4Y7NK 2IA0A 4C3JK 1NDLA 1FRNA 2F43A 1YRUA 1JQGA 4P25A 4Q8FA 5JFEA 1F2HA 1F9EB 1TUIA 1M1KT 1CBKA 3BDPA 2XWXA 2GGPB 1BQNB 1S79A 4KKOB 4RW7A 3A8EA 1CLFA 3ZTPA 2JH3A 2XQCA 2DERA 1I50K 3M2VA 3Q8RB 2WSEC 3AVWA 1O8BA 4GKKF 5BSXA 4ATNA 4NCAA 5A8RB 2VQEJ 2EXUA 4NA2A 3M7VA 2E9ZA 3KLHB 2B56A 3D6MB 4ECTA 1RGVA 5IWAJ 1KEKA 3TWZA 2V7UA 1YCLA 2XZOA 3CD5A 4NLTA 2ZDOA 2YNHB 2UUBJ 5DS7A 4FF3A 2V6TA 5F8JA 4CLYA 3SZ2A 2CNKB 1M1HA 4LRCA 4OZ0A 4J9MA 3M2VB 2NXEA 1P27B 3W2FA 2KG1A 4ZCIA 1R0AB 4DV1J 2KTQA 1YVFA 3FZBA 1XERA 5IYDC 2MDAA 3F73A 5MLCV 4CNZA 2JJ1A 3N0BA 4F4YA 4DQQA 3EGVA 4ZLNA 3UDEA 1N54B 3DRRA 3GR1A 1R9TA 3VAMA 2V8HA 3C3LA 1JA0A 2EG1A 1HI0P 1Z4UA 4F4ZA 3D4JA 3CJ3A 1DG1G 3O8WA 1JXVA 4Z4WA 1ZPVA 4XNFA 2EIXA 5A2QU 4A3IK 2BVNA 2LQ5A 1RTIA 3V6JA 1RT1B 4DSKA 2DEJA 7AT1B 4HEA9 4NMLA 4LF4J 2N4DA 2ZZTA 2V8GA 1RAOA 4ZCMA 1LW0B 4ACAA 2H5IB 2IY5B 3FKBA 2R8KA 2N3LA 3QX3A 1XWLA 1TFWA 2X3DA 3H90A 2M7SA 4OZ1A 3AVVA 3AOCA 3Q22A 3JAMY 1T6XA 5CQGA 1YZ7A 5BYRA 1RT1A 2OD6A 2DH7A 2GMJA 1F7UA 1RTHA 4XR6A 1C1BA 3G6XA 4ZJOA 1FTCA 1QE1A 2AT1B 1C0TA 2ZBRA 3ENWA 3FUYA 1VQ8B 3PY8A 1SKQA 5E33A 3DLKB 5GV8A 2ZZEA 3GYNA 1SL2A 2ZH7A 4F50A 4DBQA 2F7VA 3RB3A 3RBEA 5D4OA 3UN5A 3V81A 2PD1A 2D9RA 2X8KA 1F6TA 4WYLA 5CAAA 1RZMA 3M32A 3J7AN 4RW4A 4KN4A 2OBTA 2QV6A 2WBRA 2IJNA 4Z4TA 1DTTB 1H73A 1PAEX 2RS2A 3R5AA 3CCRB 1Y5IB 3CTRA 3VQTA 4NEYA 4DV7F 3GR0A 2J0QD 4OZ2A 1GQEA 3GTQC 3V6KA 2VNJA 1VISA 3GTMC 1NKBA 3R5GA 1Y11A 2OPPA 4DMZA 2GW8A 4C8LA 3QPIA 4Z1MA 4WK1A 1DBDA 2FPHX 3MUTP 1GXLA 4UUXA 4JV5F 1B64A 1KFDA 1DQ9A 1JLFB 3BQ0A 4TLRA 5ETQA 2JVOA 5FNZA 4DOZA 4LJZA 4IUFA 5D78A 1O0PA 4X6AC 3HOWC 2ABYA 1WTBA 1YJNB 5DG7A 1LXNA 5DQHA 3FKIK 3MM5A 5T41A 3FHZA 2XY6A 4TMZA 1P1LA 1NSQA 5DGBA 5LXRA 3HHKA 1YITB 3R7NB 2JEJA 4K7QA 2RC6A 1VQ9B 4XDCA 3PIOQ 1S9EA 1BE4A 3SLDA 1VI7A 2QMWA 2ZBQA 4XPCA 1M0SA 1KK3A 3KG0A 2M9KA 1LWEA 3FKSA 5AE2A 1L3TA 3I0SB 1FFSB 5KFUA 5A2QY 5IXUA 1NHUA 4GTAA 1DAXA 2XGQA 2I8EA 1R9TC 5LMNJ 2KVOA 2J9CA 2YNIA 5IWAF 4TQRA 4YHBA 3CMAB 4KGZB 1VQLS 4YP3A 1R7IA 1WC5A 3W2WA 1ICEB 2GAHC 4R8UB 1BDFA 1WP6A 3M2RB 1RWNB 1KZLA 3Q24A 3A8JA 1W26A 2B5JB 2MTLA 1OB5A 1F93A 3BO3A 1S7IA 3KLFB 1WDDA 4TKTA 2FVRA 4ZA1A 3DLBA 3Q3QA 1B0PA 1Q8IA 1FX2A 2CJXB 1F5AA 3HKWA 5FIUA 3HDSA 4XN3A 4DR1J 4H54A 2D9PA 2KVIA 1HA3A 4A3KK 3BZQA 1FK9B 2ZH9A 3KOAA 2BQRA 2WB4A 4Q43A 1X4DA 3T00A 3BN4A 4FN5A 1W2IA 1TL1B 3RZOK 3WX8A 1NXIA 2R8IA 2R92K 4DNRB 4DFMA 2Q6OA 1VJQA 1OY6A 3BSNA 1CJUA 4AC9A 1D9AA 2DTJA 4N5SA 1XNQJ 5I3QA 3QT7A 1YBTA 1ZZNA 4KAWX 1MWYA 2P9GA 3DRPA 1OGIA 1ZA2B 3RW7A 1CNEA 2F1MA 4EZ9A 2HLTA 4EMDA 4G1VA 3BPSP 3BC9A 3SZYA 4KKTA 3P26A 4B9MA 2MSSA 1LWXA 2LA4A 2RH3A 1AB4A 2O01C 2HHQA 5A0YA 4A3CC 1UVJA 5DLFA 1KQSB 1EQ0A 1K44A 2X7IA 4RNMA 1SMYA 3GTPC 3VAGA 3SLNA 4JI7J 1VQ6B 1RWPB 4KTQA 1OSDA 3CDUA 3DYAB 2AX1A 1DQAA 2SXLA 1YJWB 2ROGA 1I6JA 5J1EB 1JNYA 2GFFA 1R0CB 3D6FB 3CIMA 2UXBJ 5GADI 1S0OA 5M3FK 1ZA1B 1OQ6A 4LRAA 5L9NA 2HFZA 3TAMB 1HQEB 4OHYA 1T9YA 4J90A 2CPHA 3G6ES 2VPYB 4F7DA 2YX1A 2QMUA 3UPFA 4I67A 1W87A 1D9DA 3BV8A 1RT7A 3GTGC 3MAAB 2GZOA 1J6VA 1TK0A 2FC9A 1U48A 1BGXT 3D0IE 4DG1B 2F1LA 4URQU 2E1CA 2O5JA 3AVUA 2K06A 5LMUF 3ONUA 2MY8A 4RD1A 5HQMA 4FXVA 4HL9A 2R7ZA 4B3MJ 2FHJD 4YG2A 4NYZA 1FE0A 4DV2F 2ZZMA 1I3QA 2HHHF 1WCMC 1PKVA 3FPKA 4UOCA 4FF2A 4Y52C 2DK2A 1VYAA 5KFCA 2B3TB 4DUYF 3BSCA 3G05A 5CYMB 5M2UA 1BMFA 1RQ0A 1EP3B 2DCUA 4NLYA 2R92C 3MR7A 1S12A 2H48B 2QRRA 2VDHA 2XZTB 3ZBTA 1WF1A 4QWDA 3RRHA 4QIFA 4B3TF 1IJEB 1IHMA 1LXJA 2OPQA 3UD5A 2Z2LA 2C1EB 4YFUA 2BKPA 2R4FA 1KN6A 1N32J 5THWA 4BS2A 2BOPA 1AA1B 1EK8A 2PA8D 2OTJS 3DI6A 2GK6A 2W9BA 1S77D 2HNDA 2R9VA 4GFQA 3M6WA 2DRAA 4TSFA 3PHEA 2DHGA 1WC1A 3CP2A 1S10A 2L08A 1EHWA 5IM0B 2EW9A 2IM1A 3VAFA 5HMYA 1T03B 4FZVA 2ZHAA 4JI5F 1YJ9S 2AD9A 3M6XA 4JV0A 5CZVA 1OJ4A 3EUNA 2R7RA 3CMQA 2V8PA 3CQZC 1S9GB 2OLWA 3OKXA 2PMZD 3FOFA 4P75A 2W2PP 3I55B 4MT1A 3OT9A 1FRHA 4IRDA 3TJAA 4PR6A 5I3UA 4L73A 4ZKAA 4KAIA 4G0UA 1OY8A 5HO4A 1RU0A 1HNZF 3ZNUA 5DZ6A 2VG6A 4QU7A 3GJTB 4V1Ak 1UMJA 1CJKB 1HWJA 2R7UA 2D9OA 4QYRA 2VOPA 1XNRJ 1GX5A 2E2HK 4IRKA 2XCOA 2IC3B 3MM8B 5E2QA 5GMEA 2W2OP 3LOUA 4OYWA 1NDKA 3BPDA 2BQUA 2XMAA 2HBQB 3G86A 3GIKA 4P1VA 5SZTA 1EZZB 5E3QA 3NBPA 3AD7C 4LT6A 3PO4A 5KG0A 2XNJA 3KG4A 2XNQA 1CJKA 1O2AA 2RILA 3MEDB 1S6QB 2VICA 4JI7F 4DSEA 1UMKA 3B8HA 5EUHA 4GKKJ 1SKUB 1SJ1A 1VQKS 2YKNA 4NEZA 1H38A 1BS2A 1N88A 2NVYA 3QMQA 3BR8A 3I87A 4G0WA 2FY8A 2A69A 1RTDA 1O6XA 4LFBJ 1HNIA 2P9CA 2NXNA 1MABA 2J7KA 3MOZA 4OI4A 5BR8F 3WQZA 2W4CA 2HNYB 3BQ1A 3IMQJ 2RVJA 1G2EA 5KW9A 3AA9A 2XLIA 2AJ1A 3MM7A 1GX6A 2BJ1A 2C2ZB 2YWEA 3DRRB 3CJ4A 2KWAA 2Y8YA 1SH3A 1YGYA 2LZJA 3OOCA 3ENVA 2V63A 3AVXA 4JI1J 1BMQB 2I0XA 2HQIA 2UVWA 1AYEA 3T1HJ 1X0PA 5H1SV 3FKIA 2P2CB 5LMZA 1CJUB 3TOQA 3OTOF 3GTOK 1UVNA 5KG4A 5TV2A 2OIHA 2E1PA 3FQKA 3MMJA 1QSSA 4K4TA 2BV3A 2HHHJ 2O5DA 3DDNA 4KHRA 3WNDA 4XN0A 1TWAA 3FNNA 1YJ9B 1H72C 1UL3A 7FDRA 2XZLA 4Z4SA 3ASRA 1CC8A 5C2GA 1FNDA 1S1XA 2PN6A 3G71B 5IP7C 1F5BA 3U1MA 3ICLA 1BQMA 3CSKA 2KH9A 4QWEA 3MPDA 2FVQA 4Y7NC 1C0TB 1UZDA 5EMNA 4A8KA 1M5OC 2J8AA 5TRDA 3BO2A 2A0FB 4KFBB 3AH6A 2IM0A 2RJZA 4JI3J 4IH6A 1X8DA 2UU9F 3UR3C 4ZVTB 4TT3A 2CQBA 1S1TA 2PI4A 1EQMA 4H9GA 1ZM2A 3V81B 3IM8A 3CW2A 2DEIA 2MB0B 4Z4YA 1CQXA 1AROP 5C42B 1D1UA 3AOBA 1QD1A 4OLPA 3ET6B 3M9OB 2CWXA 2V4DA 2GIFA 3D67A 3AD8C 3L7OA 4ZP9A 4IH7A 1EKSA 1FXLA 1SPBP 4LRFA 3GVJA 2KZMA 5IQQA 3MCAA 4ZLPA 1LNQA 4X4SA 2JA5C 3U1LA 4PKDB 4O3PA 3DM2A 2YU9C 1EH1A 3VV2B 3SXLA 4JYAJ 2KT2A 1ZETA 2X3GA 1HNVB 2XWYA 2K7KA 4WWVA 3EZ5A 4O3RA 5C4XC 3QSYA 4YXWA 4BY7K 2CAJA 3H40A 2BJ8A 4LJMA 3M4XA 2A68A 2IHR1 3KLVA 4GQNA 1QAYA 4A8SA 3PHTA 2G2ZA 1E43A 1S9EB 2VA2A 4KGXB 2JJ2A 3A1YG 2M52A 1Y1WC 4BCAA 1X5OA 4JI2J 4FXWA 4JI4F 2C78A 1ZYQA 3BGUA 2QX0A 4I2QB 1N07A 3MM9A 2DGXA 1N36F 1RHUB 2HVZA 1V0EA 1TV6A 2E7WA 3M8PA 4LF7J 4BLGA 3KJVA 3MZIA 2B5OA 1XZPB 1VGYA 2R9LA 4ECUA 4AL6A 4C3MA 3U1NA 3W8PA 4DV6J 2VA3A 1SIWB 1S76D 1IKXB 4WIQA 1TL5A 4RJVA 3HVTB 4NXMJ 1H85A 5FJ8K 2CPFA 3VVTA 3A3GA 1MN9A 4B3RF 1B4AA 3H5SA 2YH1A 1D9FA 1T0TV 5CCMA 4LF8F 5AXKA 1NB9A 3JB9k 2YX7A 2MKJA 2MKYA 2HHTA 5E41A 1TK5A 3HHLA 2GC8A 3PO5A 3E01A 4NE9C 1NJXA 4ECVA 4ILRA 2XY5A 1RT2A 2J0XA 2VBUA 1VRUA 1IBMJ 5TMCA 4G65A 3PTWA 2IAJA 4ZMMA 1FRKA 1N8RT 2EFVA 2J6SA 4ZP7A 1J5OA 4M5IA 4GKJJ 5EWEA 4DS5A 1NDHA 4C43A 1R31A 1TUVA 2RF2B 1IL2A 3H5YA 4AFFA 1B0TA 3JYTB 3GIRA 5AJ3J 1HI1A 3PW5A 2KI2A 1T6YA 3ASTA 2DNRA 1LQ9A 4LSZB 2DXFA 4H4OA 4D3GA 2X1AA 4K59A 2MLZA 3TW0A 2LU1A 2ASLA 1J5OB 4F4KA 3RG6A 2X6YA 4RW7B 1HQ2A 1GK8A 1I7PA 3CTAA 2RDIA 2GJPA 4B9VA 4L76A 2F8HA 4GC6A 2DR7A 2KFZA 3DYAA 3BBFA 3HZEA 3SQGA 2CK3A 1AW0A 2Q79A 1RCXB 4MIAA 2HGLA 4CYUA 4XDDA 5DDPC 2RIJA 2AU0A 1F3FA 2OPPB 5THXA 2KB2A 3HOZC 1UAWA 1Y0YA 2LECA 1JMTA 2E7XA 2ZJPQ 3N9UC 4NCGA 4K2JA 2BE2A 4OI6A 1SI9A 3TANA 1NHKL 3TAMA 4DL4A 3AXMA 4OJ3A 4A3IC 2DYAA 3C19A 4ERDA 2QJ3A 3ILLA 4IG0B 4WFYA 4KSEB 2IBOA 2DRBA 3OLAA 3FQLA 3F41A 1KBRA 5C3EC 2VF3A 1RWVB 2OTLB 2Z0GA 1SKSA 4OIRA 3V2UC 2LDYA 4O4GA 4ANCA 2L9NA 3TP2A 4U8VA 2QTWA 3MOJB 2FZKB 4A4JA 5L1JA 1XFOA 2VZLA 2BJ7A 4K50A 3BYRA 3M8QB 1E79A 1I6HC 1VR6A 4OI1A 5A8KA 2VJUA 3WDOA 3GIMA 1USOA 2AP6A 2UUTA 5HBMB 1HHTP 1NJYA 2E44A 1Y3KA 1ROFA 2VQEF 2BSAA 1ZBSA 5IYPA 1H98A 5J2NB 3TRGA 1GAWA 4YDXA 3HOVK 3L4BC 4PWWA 3DOMB 4EZ6A 4RNHA 2YVSA 4F0MA 2B4PA 5GAGI 3R5DA 4RDKA 5KFRA 2EPIA 2CQIA 4HVZA 2UUWA 3MFHA 5E7OB 1DD5A 4OZ3A 4OIOA 1JOEA 3K5OA 4OYZA 4RW4B 1BPLA 2M0GB 3GFYA 1WG5A 2DB1A 1HPZB 2B51A 1PJ7A 3JAMU 5F4JA 4EWTA 3DM2B 1FJ7A 2WZPP 2QG9B 4XAKA 1G7SA 1VC0A 3K7AK 1E6VB 5FDLA 1NK5A 1NPKA 2GQQA 3LAJA 3E20A 2QN6B 1Q78A 1RT6A 3K89A 4C4WA 4PYAA 2BXJA 2BJEA 1HBOB 4LVOP 4ZPCA 4OV6A 5IP9K 3TJ9A 1TTTA 5KTQA 4M94A 2MGZA 1K83A 1WJ9A 1W2BB 3UCZP 3S15C 4UZFA 4CLSA 3R6LB 1S1UA 3BH6B 5JVHQ 4NA1A 4CLWA 2ZC3A 3DLEB 3THVA 4DL3A 5J2QA 5IT9Y 3S1RK 1C1CB 5CYQA 2ZUEA 4A3DK 1R5OA 2CQ0A 5KT3A 2V4QA 3T01A 1TR0A 3CJKB 2V31A 1REVB 1PGZA 1S6PA 3DXSX 5JUMA 4C2MA 2OD4A 1XZQA 2VDIA 1MMLA 3ZTQA 3IWNC 3CCZA 4P22A 1RT4A 4X06A 3U27A 4QCLA 4UOHA 2VHGA 3PXGa 2AYBA 1BLIA 1CQNA 2PFDA 2HVEA 3MEEB 2GX8A 3OXGA 4XIUA 4QVJA 3I1FA 2GREA 2E2JK 2IIHA 4DSLA 4U6PA 3OEHA 2CG4A 1XZPA 4IG3A 3G96A 1PAUB 4LF4F 4OYXA 2HQDA 4KPCA 5E0OA 3MPVA 5IV3A 4Q5SA 3IBWA 4DR5J 1DQ8A 3Q8VA 5FLMC 3BH4A 4X66J 2YPYA 2QLXA 5IC4B 2YNGB 2VZ9A 2HFUA 3W9IA 3FBCA 1RT7B 2FQOA 2V34A 5CYJA 4YAUA 4BWMA 1U09A 4GT9A 4JK1A 1KC8D 3VNVA 5B09A 2HMIA 4FDFA 2FVGA 2DHAA 3KUEA 3KHGA 4PXEA 3N01A 3SZZA 2VPZB 2YQ0A 1HWLA 3CCMS 3GJSB 4XK8C 2YKQA 1Q79A 4L72B 1IVZA 4EBDA 4OOSA 3RZAA 2EK1A 2KYXA 1FEHA 2HAIA 4KHMA 1FRJA 2DCLA 2HQ3A 2B8QA 4XTTA 1HBUB 1KHWA 3VVUA 5HROA 3CC4B 1HHSA 3FRYA 1RAAB 4A3LC 2Y1RI 4ZVHA 2XZPA 3DU6A 2YWHA 4PCQA 2AYEA 4MMOA 2VFSA 1NZAA 3QGHA 2ZBVA 2RQMA 2JC1A 3CC7S 3O44A 2DR6A 4CI0B 2KFYA 1FWKA 2OPQB 2WVEA 1T9XA 3TR5A 5F8IA 1FKOA 1RBAA 1CEZA 2BM1A 1S0UA 1R6YA 1UJ6A 1CS4A 4I2PB 3WNBA 5ETRA 4ZITA 3M8WA 1DCHA 2NVQK 3D1QA 3J81U 3LUYA 1DLOA 2ZH3A 3N79A 2QN6A 2Z8QA 5JVGQ 3HAGA 1N5QA 4WJ4A 4GO7X 4FS2A 1TAUA 5LSOA 5KFXA 4OQJA 4X4TA 2VYQA 1N0UA 3UI3A 1S0VA 3GIIA 1M1KD 1TWHA 3ASPA 4I6AA 5JJBA 3A12A 5DDOC 2B7BA 5I42B 3CD0A 1WKKA 1SH2A 1AFJA 3UDVA 4U8YA 3GTPA 3GYXB 3S01A 2IMOA 2ZBCA 1NK0A 2OEMA 2HS0A 3FMWA 1SC4B 3AGPA 3BBCA 4QR0A 1BXNA 1N5TA 2DBBA 5HATA 5KOWA 4Z4ZA 2HS4A 5D0GA 1Y3JA 4FF4A 3FFIA 4I56A 2I5JA 5KSWB 3KMQA 4XLPA 2P8TA 3ADAC 5HZAA 2VPWB 4DQRA 1RTJA 1OYDA 4LF9F 2FJDB 3AQPA 1OQ3A 4G5GA 1NJIT 3OVSA 4OX9J 4PWUA 4IG3B 4ID5A 2IM2A 3MPWA 2C3YA 5KFBA 1UA1A 2QL9B 2AJQA 3FKIC 1AMOA 4CTAA 4FYWB 1B0VA 3S17K 5H9FJ 1HHQA 1R8BA 4WYWA 2YKNB 3SDEB 5CYMA 2Y3PA 3QFCA 3OEPA 2YNGA 2FJWA 1RHRB 3OXLA 2EBBA 2AYMA 4BBRC 4LBVA 4XPEA 1B23P 3ZZUA 4B4DA 1U1LA 3HPOA 1N34J 1NH8A 2NVXK 1CNFA 4CCHA 1RYRA 2M2BA 5HJXA 3HVTA 1X5SA 2JX2A 2ZOFA 4KARA 5H9EJ 2WCXA 3RBDA 3ZC3A 1EARA 3QRPA 4FYVB 4NNJA 2BEFA 3H4DA 5ETMA 2V5HG 4YFNA 1SFOC 1MROB 1RAJA 3A3PB 4JI8F 3FBFA 4PG8A 4YR2A 1G4CA 2ZM6J 4PG5A 1HBOA 4P26A 4PPZA 5IV4A 3R6GB 2OH2A 4ED3A 1EFWA 4NLUA 4ZJQA 5HQ8A 1J5EF 3DRYA 4KMUA 2ZZNA 1IQZA 2G1HA 1PYSB 4GO5X 4HLBA 3QSIA 1Q5YA 2DOGA 1EWYA 3G8SA 4C0BA 3D7SB 1DJ0A 4C2MC 1U0HA 4WE1B 4V19J 1YHQS 2DH8A 4G6IA 3FBBA 3VHQA 2N4CA 3VO2A 1VFJA 2VFTA 3PCOB 2DNOA 1SJFA 5KFTA 3M1VA 2HHXA 3AGQA 5LSRA 4DDFA 3AB4B 2C2EA 3CJ5A 2N7YA 2DEUA 1UWBA 1JXEA 3Q39A 1RXOB 4C3JC 4B9NA 1S49A 3PYFA 5F0UA 1HBNA 1XPPA 3NS7B 4PC6A 5C4JK 3MAHA 2VJJA 2NPIA 3HKZL 3GU0A 1M1GA 4H4MB 3M3YK 1VLOA 1X4FA 1CULB 1YG0A 2UUCF 3BYPA 4TU7A 1E6YA 4Y34A 1KLMA 4CQJA 2VNKA 4F7VA 3J81Y 4JYAF 4J9KA 1KS2A 4BBRK 1T9VA 1DTTA 5AE1A 3H7HB 2ZTGA 4XLCA 1UKUA 2E1MC 4KO0A 3ETMA 4Q2MA 1GTHA 4OI0A 3W66A 4B3GA 3LW5C 1WEZA 1LFPA 3LGNA 2XGJA 2U1AA 3BKUA 2ZZFA 2IRXA 2YXLA 5K9FA 1Q8LA 1T11A 5M5XK 2H4WB 2QE7A 1I51B 4C11A 4TQSA 3CJ2A 4DEZA 1NJZA 4A3GK 1U25A 3AJ1A 1VS3A 2D3OR 3S1QK 1WORA 2BGJA 2QEXB 2E29A 2KT5A 3KTQA 3LP0A 4YY3J 1U45A 2R7OA 5A89A 4AH6A 3SYZA 5CHPA 5L38A 2J9EA 3DLGB 1U1MA 3OVBA 2WZ1A 1JLEB 4URGA 1VQPS 1KOHA 3S1NK 1GAQA 1D8YA 2FVPA 4W90B 4WZTA 4ZN3A 4LOWA 1QGAA 4Q44A 3PEJA 4C8OA 4QV2A 4DU7A 2V68A 3GZ7A 4OX7A 4KMAA 2CVEA 4DZDA 1SL0A 1UVMA 2GJRA 2R93K 5FIIA 3H3VL 4OPSA 4Y2IA 1MROA 1PO6A 1HD0A 1X0FA 3DLGA 4CLTA 4HTIA 4XOPA 2AKWB 2AHOA 1BJKA 3OZVA 4ZPAA 2MLYA 3CJ8A 3HT0A 5T14A 2GO9A 7FD1A 5LJ3Y 4F0KA 3L09A 1FVSA 3EVWA 2MZRA 1RT2B 4C45A 4MAKA 5HANA 2EFOA 3G87A 3QRRA 2RC5A 1WEYA 1U8WA 2CKWA 5HMZA 5IM0A 2MQQA 4A3BC 2D1CA 1T03A 5EHHA 2CVIA 3ZZYA 2ZD1B 4KMHA 2A6HA 3EICA 2HYIB 4NXNJ 4OZNA 3M6VA 3H8YA 1S9FA 1JB0C 2D3LA 2I5JB 3JSMA 1BQNA 2PMDA 1TKZA 4FYYB 4WCEQ 1EETA 5D6GA 1X4HA 1E3XA 2KG0A 1WC6A 3CCES 4C3HC 1XNRF 1TZ0A 1R8CA 3ITHB 4LR7A 4HE6A 2OSQA 4FBTA 3IS9A 1EP2B 3HSDA 3R6KA 5FO1A 1OYEA 1OY9A 3S1MK 3JSMB 3DKDA 1WPCA 4MYUA 4P2XA 2XULA 4PQAA 4M1KA 4X4NA 2GJKA 1M90D 2DGWA 1IQTA 1U6ZA 4WFBQ 3ZFVA 3ZZPA 4ECQA 3MR3A 2BVZA 1KLMB 3CXCB 3VR1A 2B0GA 2MZSA 1QGZA 3SSQA 4G7HA 2WK4A 2VASA 3GTJA 4QYZK 1VQKB 4B9SA 3H94A 2NZCA 2LYVA 1Q8BA 1VH2A 3KJVB 1GH8A 3CJ0A 4ECZA 3GTJK 3N3YA 3N4WA 2W2MP 3E1YE 1DTQB 4DDQA 2CQ2A 2FLNA 2C2MB 1VHIA 1HR0J 2E5IA 1DDIA 2PE8A 3GB0A 3ENQA 2JEFA 2FJEB 4RD0A 1REGX 2C2NA 3MUMP 2CW0A 3FBEA 5G4DA 3FC9A 2QGGA 2I9SA 4KKUA 3T5JA 4IQMA 1Q4RA 2O3DA 2HW3A 2XNDA 4C0HA 4Z4UA 1AUDA 2VC0A 3US5A 2YWFA 4ZPVR 5FLMK 1IKVB 3OTOJ 4B3XA 3G2XA 2PA8L 2CFXA 2R3VA 2FJXA 3GTMK 3EE3A 5LM7E 2G0JA 2R7TA 1HBUA 3AHPA 3VA7A 1VQ8S 1ZZFA 2WW4A 4A3MC 4K5SA 3HHLC 1X9SA 4P5BA 1N5YA 2ERRA 5GMDA 1WQFA 5CCLA 3UNGC 5DDRC 2WPDA 2OPRB 4WP3A 3CC7B 4BC9A 1TL1A 1K83C 2ZH2A 1DURA 1KQ4A 1EP4B 2WOMB 2UXBF 1X5PA 2UXDF 1SC3B 3I0RA 4ASUA 3HJFA 1JLCA 3Q38A 4ZH4A 5DQGA 2EG2A 4X4RA 2B4OA 2AJ2A 4ED1A 2J9DE 4YEAA 4Z7CA 4H4MA 2Z30B 3ELHA 4ILMA 2DY1A 2HCJB 2ASJA 4Y7CA 2KO1A 3N0CA 4NLPA 2J6TA 3QO9A 2E2JC 4AXIA 4ZK7M 2XO6A 1SBRA 1O28A 4YQWA 2CQ4A 4HTJA 5U47A 2RRNA 4ELUA 4S0MA 2BGIA 4FXUA 4OYIA 2QA4B 4UY8T 4RUCA 3Q6RA 4QBUA 3G4SS 4B9TA 5D0RA 2JA8K 3VQSA 3SFUA 2OBRA 4C8MA 1VJSA 1QFYA 2XYGB 2ZHOA 3W5XA 3K59A 4PZVA 4NCBA 2DGUA 2XMKA 3CJSA 4I4BA 3DHXA 2I1RA 3AAWB 1RAGB 4PUOA 4ALZA 1BX0A 4P2FA 2DO4A 3GTKK 3OSNA 2VUMA 3FEXB 1TWGK 4NYPA 3U02A 2DO0A 3C46A 1O5JA 4A46A 3M8QA 4USIA 1J27A 5B0EA 3GTQA 2AGPA 1B4SA 4L3NA 4LBZA 1AB8A 3RU0A 1WNEA 1H2TZ 2AMCB 3ISXA 1DTQA 3RZDK 3R5CA 1IBMF 4RLEA 1HI8A 3UVJB 4I2QA 3BH7B 1I6VA 1V3RA 1WHWA 1AXQA 1S6QA 4LQ3A 1WEXA 1BLUA 1ULRA 2EFQA 1HMVB 3C6UB 1X9WA 4OV1A 3FDSA 3NUHA 5K8NA 4JP8A 2OBSA 5F3ZA 4P10A 3OLBA 2ZNYA 2XLJA 2XCPA 5A8RA 3UN2A 4NX9A 4JI6F 4XSZA 1N6QA 4QW9A 4J9SA 2B63C 3NGTA 3GONA 4E8UA 2ALYB 3K5PA 2CJYB 2JJ4D 5JBQA 4RW8B 1OB2A 2CNDA 1FT8A 2WAQD 5IYCC 2C4TA 4RPBA 1HQMA 4XSXA 2QEXS 2OMOA 2H65B 4IFYA 2HNDB 2GJFA 1RT6B 2Z2MA 3DCAA 1S99A 2DR5A 2C42A 2X6WA 4RW6B 3TEHB 1XQIA 4LBWA 4JI0J 2B9WA 1NK4A 2FC8A 2DIVA 3K2YA 4RW8A 4YR3A 1PC4A 1TWAC 4F4WA 3MMLB 4RM0A 3OP1A 4X4UA 2VJIA 3K5MA 3CC2B 1T9WA 2V4RA 4PC1A 5KG5A 1QTMA 3WC2A 5CA5A 4C0SA 3MR5A 4UQGA 2B9XA 4DPYA 5IT4A 1NK9A 2Z56B 2I2YA 1S1XB 3HSGA 3FPPA 2QLWA 3KHLA 3QAEA 1FEEA 2LA6A 4C2MK 3DOKA 2DNLA 5L1LA 3MPUB 1NB0A 4XLEA 1JKHA 2HBZB 4OZJA 3S17C 3KHHA 2XS7A 3GV5B 1KRPA 4UOGA 3S2HK 2GQ2A 2OEKA 3KUHA 2JIZA 4ZVGA 5AE3A 5KFFA 3JSBA 1ZTTA 5F4OA 3TAQA 1JLGA 1GO2A 1HA1A 2E5LF 3MECB 4USHA 4IRCA 1LWCA 2X53S 1KWMA 1X60A 2W24A 4NLDA 5KG2A 4F4AA 5D0HA 2FZGB 2HVDA 5ETVA 1XK8A 3ETOA 3V4MA 1CVJA 4CDIA 1IBKF 4BY7C 1T9TA 4R71A 5L9XA 3WODA 3AQOA 1XN9A 1HYSA 1U02A 4HI2A 4Q2LA 4DX7A 2XMTA 3MEKA 2V94A 1I18A 2ZBPA 4TY8B 3PNIA 2PGCA 1UW9A 4EYIB 4HH0A 4PABA 4USVA 3UW1A 2AEJA 8AT1B 2ALZA 4B9UA 3C6TA 4MYTA 3HT3A 3PA2A 4G7WA 4BLAA 3I4NC 4NLSA 4XCHA 4N47A 3SDEA 3QT6A 4CT9A 3QYYA 3JTNA 4B48A 4P72A 5FD1A 1F9HA 5B0DA 4ZPWR 4C8ZA 4U7CA 1UJ5A 5HBMA 4N76A 1NH7A 2ZXIA 2UV8G 5K14A 1JK9B 5GAEI 2BA9A 2MY7A 1EIYB 1VHFA 3BGFA 5A6PA 1LWEB 2CQCA 2MLXA 2MXYA 5B6IA 1DLOB 2OP5A 4KN7A 2KT3A 2J7WA 3HD1A 2YU9K 3C66A 3F56A 1KQSR 4IFVA 2PMHA 2F4NA 5ETLA 1SL1A 1GE9A 1Q7LB 4GKJF 4QJVA 4E98A 4X65F 5D4NA 2FJVA 3LH2S 2CZVC 1P4MA 3J80Y 2BZ2A 3J7YI 2VJVA 4HHHA 2VQFF 1S1VA 4K0KF 3OR1B 3W5HA 1RSCA 2X85A 4PXCA 1CJVA 3OPFA 1JJCB 5DJBA 3TUPA 4UF4A 1TKZB 2J0WA 5DS0A 3DXJA 4NXNF 1W25A 1FKAF 2F40A 5KG6A 1T05B 4EBEA 1W34A 1FXRA 3ITHA 2OO4A 2UZAA 2JOQA 1S1UB 3M1VB 4OFZA 1EXMA 4WJ3M 4KGKA 1UD6A 5KFIA 3OR1A 5KFQA 2HGMA 1HLWA 3CJKA 2F5GA 5TR9A 4RWWA 1WC3A 4DR1F 1WOOA 1Y4ZB 2B4UA 3A3NB 3GSDA 3TQ1A 4OLOA 3DDIA 4DX6A 3WNCA 1FD8A 4F8RA 3ZC4A 5IYRA 3CWJA 3N6LA 1H2VZ 2QSWA 3H25A 3PENA 3QGPA 2KZZA 1J6XA 1E1RA 4RLZA 2VC1A 2GSOA 3FCVA 4ECSA 1PKUA 2J7UA 5TY0A 1H3DA 4DU8A 2E2IA 3GV8B 1H7WA 1VK8A 2GJ2A 1TVCA 2ZTNA 3X1LB 3MXHP 2X1GA 5KG1A 4KH1B 1XB2A 2XHWA 1YJNS 1EJ7L 1SQFA 4RKUC 1WU8A 5LOQA 1YIJB 3D2WA 2N3OA 1B99A 2ILZA 3NAIA 3VWSA 4UOFA 3BEGB 3WIVA 1V0FA 4O0IA 3R8YA 1RTIB 3Q23A 3PW7A 3Q2TC 5D77A 3DLLQ 3RBXA 3GJQB 3W3SA 3ZTRA 4DR7F 2EFGA 4RUHA 4B3MF 4J9LA 2YWWA 2BYCA 5KNLA 3IBFB 1C0UA 2XZWA 1TWGA 3B82A 3W5UA 1RTZA 2V50A 1VK3A 4IO9Q 5C7PA 5BJRA 1PJ5A 4C3KA 2NZ4A 1Y7PA 2VG7B 4KFBA 2NV4A 2AYGA 1NJID 3W62A 3DLHA 4WZKA 1NCLA 1JLBA 2OGUA 4PC2A 3OL7A 5KG3A 1KRHA 5A88A 4BDPA 2A18A 4WILA 5EDWA 2ZOMA 1SUQA 3R7BB 2JRSA 2BOAA 3J80U 1XR5A 1IS1A 2C3UA 4KM9A 1Q9SA 2CUYA 1C4CA 3I55S 3KUGA 3JTPA 2HZCA 4ILDA 4EI2A 3JQMA 3CDAA 1JKHB 1B3TA 3O6QA 5HVFA 4ZVFA 4P52A 4CH1A 2PIAA 3JQPA 4MIBA 2B6AB 2CZ4A 3NMRA 4ZOSA 2DCUB 3F0NA 3KNAA 2E2IK 5IORA 3S16C 4M5LA 3CQZK 4TU8A 2FB0A 1VRQC 3QO9B 4ELTA 1IR0A 1TKDA 1CULA 3AJ2A 1Z1ZA 2ZD1A 1X4CA 1RWOB 3OVAA 1HQUA 2W01A 3P4UB 4P2MA 1G51A 1WDTA 2W2QP 2B7BB 5M2PA 2WJVA 2XEXA 3TI0A 1NEEA 3AJDA 2KFNA 3J7Z5 1TVRA 4IDKB 5LXYA 2F4FA 1F0XA 2EFPA 1VHOA 2BM0A 4YFKA 2Y1LB 4ZPBA 2KRBA 2AF6A 1NUEA 4B08A 3THPA 4AL7A 4B47A 3T5LA 1OS5A 1TWCC 4DNTB 5HJYA 2D3O1 2QFJA 1ISEA 4PC3A 2B7CA 2RU9A 2ZWPA 3KJNB 1V3ZA 4JMQA 1NB2A 4DUYJ 4KC6A 4L3KA 3DGVA 3HO1A 3OFFA 3VGSA 2A6OA 2MMYA 3I4HX 2G0CA 5EX3A 3AOAA 2OK7A 2W9CB 4OIPA 2G0IA 3EX7B 4ZHRA 3NGKA 3GDZA 2G9OA 3TZXA 3N5BA 3NL0A 4UZUA 2RQCA 1R8AA 5GAHU 2BJ9A 5LT5A 5E6TA 1L3VA 4C8KA 3GTQK 1KNZA 4MH8A 1BD6A 2JFKA 4DQKA 1TWFC 4EO8A 5IQ6A 1TUGB 1Y5LB 3OQ2A 3RJMB 2FJBB 2NUHA 2WJYA 4WF9Q 5KFVA 5M5WK 3HI9A 2MQNA 2BACA 2VH7A 1B2RA 4Q45A 4Z2XA 2E1AA 3SV4A 1X31C 2CPXA 3W1YC 4JI3F 1QJHA 4JI1F 4KIAA 4HDHA 3FK4A 4U95A 4TNOA 3G6YA 2I38A 1I3QC 2OAUA 1O2BA 2HNYA 4DCJB 4ED7A 3OTDA 2P9EA 5CD4A 1Y00A 4KMDA 5F41A 5DZ7A 5CABA 1T3OA 2DGOA 2B63K 1RBOB 2FUG9 5HAOA 1YIJS 1TWHC 1Y1WK 4WFXA 3W2VA 4WBFA 1J2VA 1FX4A 5IYQA 5BXIA 1FDDA 1VHEA 4Q7AA 5A76A 3D68A 3NEKA 2DGVA 1U1PA 2HLDA 1KTQA 1K28D 2DIUA 2V4JB 4N3GA 1X4AA 3PRDA 2ACYA 4JV2A 2OTJB 1S4FA 1UVLA 4UZCA 4KV8B 2R7WA 2B6AA 3PV8A 4ITSA 4BY1K 1FRLA 1EFTA 1UW4A 2GGPA 3B4MA 1S97A 2POKA 1YJVA 2HZAA 2AJ4A 3EWGA 4UTGA 4A3JK 1GMUA 3R1LA 2IPOB 3HZGA 1V3SA 1SIZA 4P2SA 1XE1A 2FQQB 1J6WA 1IKWA 2CJAA 2CJQA 3OTCA 1XQBA 3BDEA 1U1RA 3K8VA 2G4BA 3OSPA 1RHKB 2R7QA 2ZJRQ 4LFCJ 5E3AA 3EGZA 4G1BA 5C25B 3W2EA 2EK6A 4RMFA 2IM3A 4WU2A 1WOPA 4EUVA 1R3NA 1E6YB 1ACMB 2GCFA 3P3DA 2OTLS 2QMXA 2GVDA 2EI5A 2OJ3A 2OSRA 4X2BA 3EMTA 3V4IB 1M5HA 2J5AA 1PIEA 4QIWL 2YKOA 4N56A 1HW9A 2KXFA 1GXUA 4G1QB 1N0VC 3R97A 1PBUA 3TZZA 5I4MA 1YLOA 2W9CA 4KT0C 4YY3F 1P9YA 2BR0A 4B3RJ 2XMWA 4TLQA 3P8BB 4QIVA 1VDHA 4YFXA 3GG0A 3LP0B 3I0SA 5HZBA 2EFNA 1FKPA 1G3OA 2BX6A 2HQFA 2HRUA 2V2QA 1RWUA 3S1QC 1FRMA 2GS8A 3IC1A 3JXOA 4B3OA 4C3IC 2JWNA 2OPRA 5F8MA 2HEKA 4FNIA 2HHVA 2O67A 5ADZA 5E3CA 3PUNA 3HFZB 3WC0A 4C3LA 3KL9A 3H20A 2NVYC 1S48A 2NVXC 2CQGA 2LXIA 2AZ3A 4PXDA 1SKWA 4RX6A 4JI5J 1OPZA 3SCKE 2PE3A 4OPOA 4CQ1A 2HBYB 3H42A 1K73D 3SBMA 2X3UA 2RU3A 1RAHB 3AD9C 5E68A 4LBHA 3A8IA 5A6WA 4QUZA 2QTZA 3I56B 1TQLA 1VBZA 5FLXY 2RH6A 1BHNA 1Q16B 2W7OA 2KM8B 2DRDA 1YQHA 2HGNA 5IOQA 2FZCB 3MWBA 4YALA 4FK8A 3TFHA 1SJRA 1S0MA 1HNZJ 3EQLA 2DNZA 1Q95G 2HVIA 2XS5A 1FDNA 1S1VB 1V6HA 4J5OA 4F2RA 3E3XA 5C24A 2BF4A 5KT5A 3T5HA 2CBXA 3LAKA 3OFGA 2X51A 3M8RA 4CO5A 3OD2A 3LNNA 1NDPA 3HOUK 2AZ1A 1JA1A 2G2OA 3CUNA 1P1TA 3LPXA 2VUMK 1WTHD 1U1NA 1YJRA 3ZBUA 4WFNQ 2NVXA 1SCJB 1WHYA 2MQLA 3V5RA 4HI1A 2MKCA 3TTGA 3X3UA 3PX0A 4KB7A 3TA2A 3G6EB 1YK9A 3PR5B 1S6UA 5IOLA 3GEIA 3T51B 4B17A 3SCJE 3TA0A 3LTOA 2PMWA 3PFEA 2QA4G 5HSPA 3G82B 2ZKUA 3HSJA 2QYGA 4A3LK 4NRUA 1HARA 3UO0A 4ZPDA 2DYIA 3Q0AA 3VAJA 3SSRA 4IQXA 3TX0A 4B3FX 2C2KB 4BHQA 4JV5J 3H9NA 2ZH6A 4FYXB 4NI2B 3SEOA 5J1EA 2DR8A 5EWFA 3WIUA 1NPRA 2HMIB 2GVDB 4W92B 4M95A 3Q8UA 3VGUA 3DHWC 5KFSA 3BSAA 3GIJA 2DETA 3QWUA 2RE1A 3HHNB 4ROXA 4C8NA 3E8OA 1C4AA 1M5VC 1GMWA 2VBSA 2LCWA 5KFWA 3T1YJ 2CPZA 2IRUA 2HFSA 2ZDPA 2CZ9A 4YELA 4LK0A 4RPDA 1U1QA 5HROB 4DL7A 4U67Q 1Q53A 1L3SA 2B9EA 2Z2ZA 4AT1B 4M4SA 4U9RA 1K0VA 3CVKA 2HHSA 5CHCB 1H8HA 1DCPA 1YRTA 3KJFB 1XR7A 4G1PA 4ES2A 1KQKA 1NB7A 1DHMA 3B54A 2F1FA 2HG4A 2V4JA 4G7OA 4NLXA 5L1IA 4DL5A 1WF0A 3KG1A 4BLBA 2BKNA 5GAHI 3CXCR 4USUA 3MCOA 3NOGA 4NL5A 4DPOA 4X7CA 3ZO7A 4OIXA 1X5TA 1WWHA 5HMWA 3KK3B 4DSFA 4G3IA 3FZ2A 3OFNA 4RBVA 2C3OA 4AE5A 2MYFA 1G7TA 2V7TA 1UD2A 4OZ5A 3MM6A 3S2HC 3S2DK 2ATLA 4KPYA 1X7VA 3GSIA 3W9JA 3RUBL 3ZNJ1 2RRAA
chains in the Genus database with same CATH topology
3GEEA 1VRQC 1V5VA 4PAAA 3ADAC 3GEHA 1PJ5A 1XZPA 2GAGC 3TTGA 1WOOA 1NRKA 4PABA 2GAHC 1XZQB 1WOSA 1PJ6A 5L46A 3TFHA 4P9SA 1X31C 1WOPA 1YX2A 3AD9C 1VLOA 3A8KA 3GEIA 3A8JA 3A8IA 3AD8C 3GIRA 1WSRA 1WSVA 3TFIA 3GSIA 1PJ7A 1XZPB