3GIRA

Crystal structure of glycine cleavage system aminomethyltransferase t from bartonella henselae
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
361
Chain Sequence
SLKTLPLYELHEKAGAKFGAFAGWRMPLTYPLGVLKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALLKIGQSRYSYLLNERAGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIALERVLLALQGPQAAAVLADAGLPGNELLFMQGFEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLGDSRVEWVGLAARDSLRLEAGLCLHGNDITPDTTPIDAALTWAVPKNVREKAQFYGAKAFLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFDGPVAMGYVPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQRYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of glycine cleavage system aminomethyltransferase T from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Transferase
total genus 104
structure length 361
sequence length 361
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 3girA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 3girA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3girA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 3girA03
2GAHC 3TTGA 3TFHA 2GAGC 1XZQB 4P9SA 3GEHA 1WORA 1WSRA 3TFIA 1XZPA 3ADAC 1WOOA 3AD8C 3A8IA 3GEIA 1WSVA 3TFJA 3GSIA 5L46A 1YX2A 3GIRA 1V5VA 3A8KA 4PAAA 1XZPB 3A8JA 1PJ6A 3GEEA 4PABA 1VRQC 1PJ5A 3AD7C 1WOPA 1XZQA 1X31C 1NRKA 1WOSA 1VLOA 1VLYA 3AD9C 1PJ7A
chains in the Genus database with same CATH superfamily
1E6YB 4DL6A 2YNHA 4ZKAA 1WDDA 3KUGA 4G1QA 1YDLA 2BXJA 4A3GC 1LW0A 1HBUB 1NAQA 1HI9A 1ZM9A 1XQIA 1CULB 2YVSA 3U6KA 1FKOB 4ICLA 1Y11A 3GIKA 4DG1B 3ZXWA 4A48A 1XE1A 5KFZA 1WEZA 1G7SA 2JC1A 1IXKA 3QAUA 1ZPVA 4OFZA 3CESA 3PIOQ 3W62A 3H42A 1EKRA 4KM8A 2ASYA 2B5OA 1VMBA 1S0VA 1SV5A 1IVZA 2YH0A 1F3FA 4TMVA 4TNOA 2NVTC 2F65A 3N28A 1Y1VK 3HOVK 1NBEB 3MMCA 1Q79A 3LAKA 4ED8A 1DD5A 2KWAA 3ET6A 4C3JK 4TU8A 2LDYA 1PG5B 3C6TB 3BQ1A 3V6HA 1M90T 1OS5A 1GO2A 2JIZA 3OZWA 3D1HA 1R5NA 4JP8A 1NJID 2NQPA 4WZEA 3O6QA 1D2EA 1RBAA 1P6TA 1VQYA 3M8YA 4O3PA 3KLFB 1GQEA 1EP4B 2XI2A 4BBRK 4NCGB 2W25A 3UCZP 4C6AA 5CYJA 1KEKA 3RRGA 1KOOA 4YELA 2CJAA 4ZCKA 1K0VA 2JA5K 2Y1JA 2LQJA 3H20A 4K2JA 4OI2A 2ADCA 1ZYQA 2KVQE 4WWSA 4FXDA 4UT4A 2E2JC 1HL6A 4NLVA 2IYIA 2DCUA 3IGVA 3HO1A 3CPWB 2BE9B 4Y9RA 5DN6A 3Q2SC 2OEJA 2GJKA 3TJ9A 3CJ8A 5F8NA 5CXTA 3JQQA 4F8RA 4WJ4A 1F9FA 1IJEB 3T1HJ 3QRQA 1UJ4A 5E3AA 3QFRA 4USIA 2M3DA 1UD5A 1W0JA 1K1QA 3P6YC 4LF1A 1RHMB 2NSCA 1NK8A 1CSJA 4DV7J 4EH1A 3WC2A 2B9WA 3R6GB 1NB2A 4DHVA 3HCXA 3RBZA 3P5TL 4ED7A 4Y00A 1LW2A 5M2RA 3NWRA 3X3UA 4ACBA 2ZNYA 4AXJA 3PR5B 4PYDA 1FX4A 1IBLJ 2ZFHA 5B0AA 3P3DA 1YJ9B 2Y3PA 2W9BB 2YQ1A 1JLQB 1NK5A 2I9SA 5IZHA 1GJRA 1IKYB 4DR2F 3KMSA 2OMOA 5B6IA 1DURA 1S6OA 4O0NA 3NGRA 3VR1A 1HD0A 5I4MA 1KLMB 2LXIA 2PGCA 4HHUA 2GMLA 4G3IA 5I42A 4DQSA 4HLBA 1N5SA 2G0IA 1RT3B 3T9ZA 4RW7A 4D3HA 3OL8A 1VISA 3FFIA 2A6OA 1VRTA 2Z2MA 1NDLA 4O3QA 2FHOB 2HZVA 1KRHA 3OFNA 4WE1A 2HYIB 4CLZA 3MUVP 4LRAA 5H9EK 3OPOA 3R9LA 1W9XA 4CO5A 1OPIA 1AIPA 1FT8A 2W24A 1U09A 1FJGF 3HHKA 2MKYA 2RS2A 1TVRB 3FEXB 2W6JA 5JVOA 1XNQF 3GTMA 3G6EB 4I2QA 1W2IA 4DCPB 5J1NA 3JTPA 4DPWA 4XN0A 4B3GA 4NA3A 1Q9SA 2J8SA 1UW9A 3SIPB 1YI2B 3VGVA 1TTTA 3ZZPA 4WZQA 3HX9A 4O4GB 3BSAA 3FGVA 5A8WB 2HSEB 1EFUA 1SFOA 1TL7A 3LW5C 2E5LJ 4DR3J 2GGPA 1G1XA 3W9IA 4DSFA 1Z2ZA 3M30A 3IA0A 2CNKB 2WZ1A 5A8KA 1KJZA 4X7CA 2JJ2A 1RT1B 3TVZA 1CJUA 5M5YK 4CLUA 5AJ3J 1NJXA 2CPDA 1VQ7B 1R8AA 3K8VA 1SMYA 2VPWB 4TKOB 4WIIA 1O2BA 3G4SB 5KFGA 3RZOC 3M6UA 3OLBA 3OJSA 3EWGA 3BBBA 2L9WA 4P7VA 3QZ7A 1ITPA 2DIEA 1XR7A 1B23P 1N34J 1KTVA 4WU3A 4ZVQB 3NE5B 1BGWA 2XSFA 3WC0A 1JLAA 2DGVA 4OI3A 3TUIC 2X51A 4CH1A 1UJ5A 4FYYB 5DS0A 3QSYA 1Y0HA 2CK3A 3OUYB 1U8SA 3NGTA 4D3GA 1B99A 2OBRA 3DHXA 4J9NA 2FJAB 4M5DA 3VWSA 3DLJA 3IMQJ 3MDFA 1PCAA 3P8BB 1Q81D 4WJBA 3TA0A 3MAHA 5F3ZA 3O2IA 4OI6A 4DX6A 4CT8A 2RC6A 4LF4J 4ZPDA 3W3SA 2OO4A 2XO6A 1SKYB 4TU7A 4I56A 4Z4YA 4NRTA 2AEMA 1TUWA 3AJ2A 1XZPA 2QG9B 4Q5SA 2Y0SL 2ZM6J 4ZLJA 4FVMA 3MM5B 2HW3A 1YCLA 1FJCA 1IR1A 4B3OB 2DXDA 3M7VA 4MIWA 1RYSA 2FC8A 5LJ5Y 1VC5A 2PE8A 4FKXA 1X5TA 2QE5A 2D3ZA 1SI9A 4C3HC 1KS2A 3GTPC 1BXNA 3OTOJ 4ED6A 1X31C 3QGHA 2MSSA 3MPDA 1EK8A 4FVCA 2NZCA 4L3KA 4OX9J 4ENOA 3D28A 4ECVA 4ZP8A 1FI4A 2YX1A 4OYMA 3PRBA 4F36A 3H5XA 2XCOA 3NL0A 2B8QA 1RT2A 3VAIA 2J7UA 3CCWA 3GTQA 3NY0A 2CQPA 1QX4A 4J9VA 4MMOA 1M5SA 3LAJA 1ZTWA 3FKIA 1WOPA 5C4JC 4ECQA 4NZ7A 1QGYA 3ENWA 5I3QA 4YHHF 4QU6A 2OD4A 2A1BA 3M3YC 5KFSA 1HNXJ 4TYBA 4WK3A 2QN6A 4Q0BA 3TO8A 4A8WA 2F8EX 2LVWA 5J2NA 3VHQA 2O5IA 4M5HA 1F9NA 1Z1ZA 1T3NA 3WNDA 4Q8EA 4FBTA 3AVUA 4DL7A 4LSNB 1M5OC 4DPXA 1U1MA 2VNHA 3TFJA 3SSSA 2NVYK 3IG1A 2Q1LA 1XNRF 1RCOB 1E6VB 1WCMK 4Y3CA 5LM7E 3GTJK 1R8HA 3ETOA 2O01C 2PEBA 4NLGA 2LQ9A 4XLHA 3K5OA 4B9SA 5LXYA 4IFVA 4JI6F 4LF2A 5A8RB 1EZZB 2HFNA 1SC4B 1N48A 2EIXA 1QSSA 4A93C 4ZVPB 2V7TA 3DRSA 2AQ4A 5C4XC 2JJ4D 1C0TB 1H72C 3F41A 4ED5A 2V6AA 4Z1MA 1TL1A 2PC6A 1AYEA 3T1YJ 4ZMMA 2F4FA 1RDRA 2XCAA 1VRUB 3GJRB 5EX3A 4DV4J 2UVVA 2E1RA 3Q8SB 2JA7K 2BKOA 1HWKA 2VJJA 1NLKL 3CO0P 1T94A 1VQ4B 5GAHU 5DETA 2Z4PA 1YHQS 4PG7A 3MPYA 1T0TV 2NXEA 2C2MB 1TTHB 2DNOA 3KK2B 4KY3A 4U8YA 3GSDA 4PR6A 2EKYA 2KU7A 2MJUA 2PMZL 3EZUA 1C0UA 2D74A 1SH3A 3LALA 4YQWA 1AT1B 2VBSA 2MY7A 2KI2A 4E2FB 2D3OR 1SC6A 2XNJA 4HACA 4OPOA 3EM1A 1YK9A 2A3JA 4QIWD 3TR5A 1IBMF 5L9XA 2RSQA 2OEKA 4C0BA 3AVXA 2RU9A 2C5HA 4N5SA 3UNYA 3OPKA 1X5SA 4TKTA 3FMBA 3GCWP 2VG7B 3CDAA 2XZLA 4DR7J 4GT9A 4LRFA 5D77A 4WYLA 3D7SB 2EI5A 1D9AA 2EXUA 4OZ1A 3QWPA 3RR8A 2QA4S 1RWXB 3S1MK 2B5JB 1KHVA 5AXLA 2YNGB 1IR0A 1VGYA 4PC3A 1WG4A 1XMOJ 1PJ6A 1T6XA 3NWGA 2QYGA 3I9ZA 2GK7A 1SC1B 4GKJF 3CC7S 3IS9B 2K1RA 2BJ1A 1AUSL 3I31A 1D9FA 2X8KA 1W26A 4UW2A 5AE3A 2HGNA 4LF6J 3GYXB 2KG1A 3ISXA 4NA1A 3A8KA 2BF4A 4ZH4A 4Q7AA 2HAIA 2DNHA 1QGAA 3M1VB 4Y2IA 2HHSA 3OLAA 3KWMA 4DUYF 3WX4A 4LVNP 2W9CB 4O3NA 1RTHB 4TXSA 5HAOA 3RRKA 3OAAA 1I5OB 3F73A 4YEJA 3HHEA 4ZJOA 2DYIA 3JXOA 4DQIA 2DIVA 1MMNA 2DK2A 4J3NA 3UVJA 2HNDB 3C3LA 1DTQA 1KQGB 5A2QU 4Z4SA 5C42B 4F0HA 1HWLA 3CMAS 2FLLA 1S9GB 2KDOA 3OR1A 1M1GA 3V81A 1S1XA 2KZMA 4C9DA 2J0WA 4JI4J 3J7YI 7FD1A 3CMMA 1N0UA 4F4XA 1X4DA 3CD0A 1VQKB 1YJNS 4XOTA 4G1IA 5KT5A 4LC0A 1VQMB 1R0AB 3OKXA 3PKYA 3QT8A 1G51A 5D4PA 4HTJA 1RLCL 2UVRA 5K14A 1KK2A 4RW8A 1YWXA 1UA0A 3HFVA 4BC7A 2ZC4A 3NP5A 3H8YA 2YWWA 3HM9A 3CCMS 1RKIA 3QJLA 4PPZA 4X4UA 3MCOA 4OV6A 4RO0A 2DISA 3TAMB 4RUCA 4Z7CA 2NREA 3JQRA 3Q23A 1ZVUA 3RBXA 1RZMA 2E7VA 1S77D 4M53A 2QLBB 5JVHQ 3CC4B 3UCUP 4IDKA 1GT8A 2HFVA 4PKDB 2W9AA 1REGX 2GVZB 1RJJA 5L38A 4NLRA 2AJ2A 4OJ3A 2CFAA 2E2IA 2J9EA 3OTCA 1VCTA 1PKVA 4JYAF 3TNVA 4AT1B 1OGJA 3FCHA 1I6VA 3I6PA 3DI6A 5FLXY 1WEXA 4O3SA 2XOKA 2D69A 3NG8A 4ZHRA 2PN6A 2DRAA 3NMAA 4WFBQ 3WXMA 2PI4A 4Y52C 2RF2A 2OUGA 5HP1A 1TAQA 3UN5A 2GAHC 3OL6A 4KKOB 2Q79A 3GV5B 3THVA 2VQEJ 4DS4A 3I4MC 5LMNF 5F8GA 2IIHA 1HNZF 4A3GK 3PACA 1LEOA 4AUKA 1Y3KA 1AROP 2VC0A 4I6WA 1SKUB 4R0JA 1S6QA 5DG9A 2KJWA 1KQSB 1U45A 1NB7A 1U1QA 4ALZA 1JLEA 1JA0A 2R7ZK 1YIJB 4HEA9 2YTCA 2YNFB 3LUYA 4UUWA 1T9TA 3NS5A 4DV6F 2ZFZA 5IV3A 3HF5A 3MWBA 2GAGC 4NCAA 3SSQA 2CRVA 3DM2B 2K3IA 1MABA 3M32B 3DOLA 5F8MA 1V5VA 4U9UA 2ATCB 2M5YA 3AY0A 3B82A 4XD7A 3HD1A 5AXMA 3JSMA 1O2FB 5TV2A 3T6BA 1SCJB 1HIYA 1S76D 2MQOA 3EZOA 1S99A 2DNPA 3OTBA 2HVEA 3J7YU 2HHWA 2EG2A 2E5JA 4RNNA 2OPPB 2VB6A 4JI0F 2RUSA 2GSUA 5KFKA 3CJ5A 5J2MB 4K4SA 3KTQA 3D67A 3LQ6A 2L9DA 4LRCA 2CPYA 1IWGA 4ZN1A 1K9MD 4ERDA 4ECWA 4C3MA 3O5TB 4KM9A 4U96A 2PMDA 4CM2A 2KJVA 1JQGA 4XOPA 4KFBB 2HQDA 3TJ8A 2I2YA 3B54A 4AF7A 3RUBL 2E2JK 1XEZA 2ZOMA 3S1RC 2HHXA 4CRJA 2ZNZA 4JI3F 4F4YA 3ZFVA 2ZBQA 5THWA 5KT7A 3LGMA 3UPFA 4NYPA 1FK9B 3GFYA 4OLOA 4L3NA 4IO9Q 4KE5A 5EWGA 4ES3A 3GJQB 2XMUA 4R71A 1YBAA 1X4GA 3OXLA 3OBIA 2XGPA 2RH6A 1KK1A 1HNIA 2A68A 1W2BB 3DRPA 4OYBA 5B0BA 3D68A 3M8PB 1QFJA 3N5BA 4KC6A 3OZUA 1S9FA 5HMYA 1L5UA 3Q24A 4ANEA 1LWXA 1HBNB 3UCGA 2C2EA 1FRMA 2HBYB 3OTEA 1FRIA 2ZEJA 4LR2A 2QEXB 2ZH2A 3PO3C 2ZH8A 1F0XA 1VI7A 4Y7CA 1UA1A 4LF7F 2YWHA 2FJEB 2AWZA 3JQMA 2UXCJ 4X65J 4K4YA 4RR5A 1XXCA 3M2VA 3IR6B 2V94A 2WK4A 4YHBA 1FWLA 2KXHA 2RB7A 2EK1A 3NS6A 3D6HB 4F0KA 1I1GA 2F40A 4IFYB 3A3BA 4KHMA 2BJ8A 2YWGA 3PW0A 1OPZA 3MI7X 2O5DA 3F44A 2VBUA 5DSZA 5ETPA 3DGVA 3AHPA 1KK3A 2EBEA 1XJWB 2PMHA 3EXYA 3CE8A 3SDEA 2OK8A 1PYTA 4C11B 1RWWB 2V69A 2XMKA 4NYOA 1QVGR 4MKAA 2HCJB 2PO4A 4DFJA 3ZBTA 3V6KA 3CCEB 3AOBA 1W0KA 1ACMB 3P49B 4B02A 4JI8J 2KVIA 3IPJA 3I4NC 1WF0A 2IMWP 4NZ6A 2V63A 4HE5A 3I55B 1IBKF 2FJVA 4OQJA 3BGLA 4BDPA 3GONA 5F4OA 3HVWA 2HHHJ 2NXJA 1MWZA 1UD6A 1S4FA 4F67A 3FQLA 2XS5A 2A69A 2JLGA 4Q8FA 4PG8A 2CPFA 2K06A 2XNDA 2BMWA 4R8UA 3RG6A 1N5YB 3W1YC 1MMDA 1REVA 1WC1A 2GQ2A 2CA9A 3OW2B 2OPQB 1UWBB 3DN9A 2XULA 2H3EB 4ECRA 2HBRB 2CADA 3DOKA 2UU9F 3LANA 3VGTA 2AYGA 4DPUA 4EBEA 4ZK7M 2EPIA 4FYVB 4ES2A 3K7AC 3MM6A 5CQGA 2R6HA 3FCWA 3CF5Q 1UFWA 1T8EA 2UUWA 4A46A 2F5GA 2VFTA 4U7UD 2MHEA 1K8AD 2IYGA 4OIXA 3K5PA 3CCUB 4X4OA 4PC2A 4B3XA 2XZDB 2OD6A 3N0BA 3AD7C 2VNJA 3RW7A 2KXNB 2KM8C 2JJ1A 3V2UC 1XZQB 4H4KA 2FLNA 2ZZMA 5LJ3Y 3OZVA 3S17C 4JV0A 2XMVA 1QG0A 2HHQA 1FDBA 2HDNB 2YNIA 1YNNA 3CT9A 2NYIA 1VQNS 1Q8KA 4GTLA 4BY1C 2MZTA 3B6BA 1NMEB 3H5SA 1LFPA 1YSJA 4JV2A 2OI2A 1FO1A 2ZBIA 3M8WA 3ET6B 2ZOFA 1F3VA 3W5ZA 1RTDB 3M8QA 4ANDA 2RD5C 2V6UA 1P9QC 2LQ5A 2BQUA 1MWYA 2HWHA 2QYCA 4OYWA 1DG1G 1BDFA 4IW3B 4OX8A 4DV2J 4AL6A 5HKKA 4B3RF 4C8NA 2C2NA 4TVAB 3TVKA 4A3KC 4HDHA 1R9TA 3N6LA 3RW6A 5CYQB 2VJVA 1A0OB 1ZM2A 4EWTA 4M1XA 2IM1A 2R92A 1UCNA 3EE3A 1N33F 3WBKA 4ED4A 1VQLS 3KHRA 4IOAQ 2JA8C 1IJFB 2I0XA 2JFKA 5TY0A 4KASA 2DBBA 2IPOB 4A3BC 5CDFA 3KK1B 3ILIA 3QFCA 1HYSA 3GTPK 2VFVA 3R1LA 2ZDOA 2VKRA 3CGIA 4X05A 3ZTQA 2IC3B 1BMQB 2AU0A 2XB2D 4USTA 1S1UA 1NM2A 2D3UA 2HNYA 4WBFA 4HKQA 3ZPNA 1HW8A 2KTQA 2GJFA 2W2QP 4RW4A 3TA1A 1YJWS 3D26A 2VJIA 2CG4A 2HFZA 1NH8A 3DRRB 2V2QA 3UE2A 2QIFA 3U27A 3QE2A 4NOHA 3RZDC 5HQLA 4ZVGA 4FF3A 4P71A 1S57A 3TQ1A 2V50A 1FDNA 3FPPA 4KHPJ 2OSQA 4Y2KA 3VAMA 3VMFA 1JB9A 2OTLS 5DDPC 2KB2A 1KD1T 3D66A 4EO8A 4HHHA 5C4JK 2MZQA 3IXQA 2HGLA 5IORA 4J0QA 1EH1A 3BGOP 1K83C 2UXDJ 4DR6J 3SV3A 2X0KA 3TVYA 2B4VA 4Q7JB 1RUSA 4N76A 3CCSB 1UP1A 5CA5A 2BW2A 4OZ2A 1KC8T 3QT6A 3W8GA 4I2PA 1U6ZA 1UFLA 2BE5A 3QSIA 4NI2B 3UFCX 2P6SA 2DIUA 3L4KA 4JBCA 5KFPA 2KFYA 4WFAQ 1J98A 1A7GE 1GR1A 2IY5B 1AA1B 3JAMY 1ZPWX 3GTLC 3KLIB 2HK2A 1AZSB 5B7WA 4OHVA 1H2VZ 2W7OA 2MKJA 1O26A 2I5JA 3VAKA 5IK2A 1M1HA 2CQ4A 4A93K 2V7UA 3H5YA 1S6PB 5C4XK 2DXFA 2AKWB 1FF2A 1RQ0A 3GIJA 4CTAB 4K5RA 1X4CA 1TVCA 4PWWA 3J80Y 3HOUK 1DQ9A 1P1LA 5FDLB 4YR2A 2PLFA 2DPJA 1VFJA 3CCJS 1S1TB 1H2TZ 4KDDA 2CAJA 4MQ9A 4A3LC 2DD8S 1F9HA 3N01A 5IS2A 1B64A 1JXLA 1RQPA 4IYQA 3A3OB 2FQTA 4YUDA 2FD2A 2VFUA 3M4XA 4FS2A 3PW2A 1K47A 2AGQA 1TWHK 4A3IC 3BKFA 2NXNA 1UD8A 1FVSA 2DTJA 2CPEA 3Q8VA 4G7OA 1CJTA 2WVFA 3R5BA 3IM9A 2KH9A 3HKZD 3FCVA 4JUZA 1YJRA 5IXUA 4OL8A 4P10A 3CPWR 3SCKE 2PA8L 5DQGA 3LQVA 1EETA 1BC6A 1Q7LB 2BJ9A 2OPSA 2WSEC 1YBTA 2YXLA 3N9UC 2AD9A 4QWCA 1ZA2B 4FYXB 2IDLA 2IJFA 2HPUA 3L3CA 3FQKA 2XNRA 3LGNA 4TN1A 1FD2A 4CDIA 3FEZA 4YR0A 2Z58B 2ZHBA 4XNFA 1E6YA 1FNCA 3R6JA 3S2DC 4QYZJ 1IBAA 3DRYA 1KKHA 1HBUA 1WD6A 1QUEA 2J0QD 2F7VA 1CULA 1IUJA 4Y9UA 1C1CB 4E0FA 5AN9A 2Y0SD 4MTPA 3P45B 5ETTA 1FKOA 1NK4A 1B7YB 4DQKA 4DG1A 2LYVA 2C28A 2FIUA 2VG6A 3H9NA 3CDWA 1TLLA 1AXQA 1VQPB 2Z57B 3W8PA 4OYIA 1NK6A 4DU7A 2CPXA 3F0NA 5J1PA 4YB6A 1R6VA 4DFPA 1H7WA 2E1BA 2E5GA 1VJWA 2W2NP 3TUJC 3H40A 3VZIA 3NNAA 2HS4A 2XI3A 3QRRA 1TWGC 4C0OC 2YU9C 1YLXA 3A1YG 1LOUA 1QVFB 4DZDA 3RB4A 1I94F 1EJ7L 3CCQS 1APSA 3TARA 3QGIA 3KK3B 4J90A 2UZAA 3C6TA 3Q3QA 2R9VA 3CCRB 2G4BA 3G8SA 2OEMA 2R2TA 4DCJB 1TV6A 1G3OA 1E1QA 5C3EC 3CO9A 1Q86T 3KLFA 4K0KF 4B4DA 1EP4A 4LSZB 2KYXA 1B4SA 4NCGA 3AH5A 1OO0B 2DGSA 4E0DA 2D7SA 3UDEA 3I56B 1CPZA 3ZZYA 1PBAA 2W7AA 1R3NA 3FRYA 5K20B 4XLAA 1NU4A 4P73A 1S0MA 1B4BA 2FUG9 3W2VB 1WC0A 1HPZB 3HHLB 4HI1A 4K7QA 2IVYA 5DQIA 2D9PA 5J2PA 3IWNC 2DOGA 3ERED 2CNDA 3BQJA 2LQ8A 3ZZOA 3VQTA 4PQUB 2HHPA 1IJEA 2BM1A 3G82B 3K89A 1W34A 1QD1A 4RBVA 4FP9A 1M5KC 1QE1B 4LREA 3MCSA 1IKVB 5C44C 1FNXH 4Y52K 3WZ0A 1URRA 4G7WA 1MNEA 1RXOB 2RRBA 1WCMA 1VH2A 3CPXA 2UP1A 3CCVS 1TWFC 1WHWA 3M9MB 3CIMA 2CPHA 3LWLA 4I1TA 3I4MK 4ASUA 2BKNA 3G86A 4IFVB 2W9BA 1JLQA 2QC3A 3NAIA 2IAJB 1IKYA 3IR7B 2RC5A 3DLLQ 2R7SA 2PMZD 3O8WA 2E1AA 5FIUA 3H94A 2MQ8A 3RGIA 1NH7A 4CCHA 1Y1WA 1QM9A 1ZXOA 2FGOA 1C0AA 4WQMA 1GX5A 5KFBA 3QFHA 5CHPA 3GCXP 3TEGA 3LOUA 2ZE2B 5KT4A 1VQ9S 3KG1A 5A88A 4YMEA 1RT3A 2R7UA 4WILA 2B9XA 2Y1IA 1SJ1A 2HAFA 4FM9A 1J5EF 4WZMA 2D74B 3E8OA 1N6QB 1SL2A 1F5CA 1DBDA 3H0GK 2X1BA 2VA2A 3I0RB 1ISEA 1ZBTA 4DL4A 2JC0A 2OPRB 4WXWA 2BX6A 3OSNA 1HR0F 1YITB 5IYBC 3CJ3A 4A8SA 3GU0A 5KFMA 3VAFA 3S0XA 5KG1A 3IM8A 3W64A 3PM9A 3AJDA 5KAKA 1B3TA 1RWUA 1SKSA 1FJGJ 1TVRA 2M8DB 3BEGB 5E3RA 1DCPA 3E1YE 2YPZA 4LFAF 2A18A 4DSKA 3WIVA 3FKSA 4KC5A 4C97A 2DR8A 1WQGA 3U1NA 5KT3A 4IH5A 5F9NA 2FZKB 3QZ8A 4NXNF 5LL6d 1YLOA 4DBQA 4O4GA 3HDSA 5A8WA 5DGAA 1Q8BA 3I1FA 4QPXA 6AT1B 1Q53A 3ENAA 4Q5VA 2MPUA 3T5LA 5IV4A 4ZPAA 3S1RK 1K73D 4DR4J 5KFLA 2DT9A 1PYSB 1GFWB 4GVBB 3NKYA 4BY7C 1RT1A 4PC6A 1OQ3A 1K1SA 2QJ3A 3M6VA 1D3WA 4BS2A 2GSOA 2V7XA 2YKQA 3GEHA 1IQZA 2E1MC 2RKIB 4FXWA 4NLSA 3BCDA 2VKZG 2NPFA 9RUBA 3K58A 3TEHB 1RKJA 5DQHA 2XCPA 4DSEA 2OK7A 2R8HA 4RD1A 4YB5A 3MMAB 3ASRA 4AQYF 3CJ4A 1Q82D 1RHRB 3L4BC 4Y65A 3ZUGA 4HIZA 2ZTNA 3OUYA 3HOVC 1UFKA 3PJ9A 5C25A 3H2UB 4DV5J 1FDDA 4P2XA 3PO3K 3OR1B 1OB5A 2P9GA 5E3QA 2DR7A 3G6YA 3EGWB 2AP6A 1HNWJ 2CNLB 2WVEA 1HLWA 2HQIA 5HL7Q 2Y3YA 5GMKa 5DO2A 1JLGB 1HQUA 2B6AB 3BSCA 4RBUA 4ACAA 5E0OA 3BDEA 1R89A 3CJKB 3AT1B 4WP9A 2WVBA 3D0GE 3J81Y 1OMSA 1QUPA 1DCOA 1E63A 3GTGK 2GQFA 1S0OA 1B2RA 3QLHB 5HQMA 3S15C 5HVFA 1ROFA 4DDQA 1TWAA 4B3OA 4Y2MA 2NUUG 3UD5A 1WOSA 5HZAA 3PEJA 3HVTB 3TTGA 2CVIA 1DLOB 4ZVSB 1KFDA 2ZUEA 3I0SB 3GVLA 2CJ9A 2HMIB 5KFDA 2CDQA 2ZUFA 1O25A 2O67A 5AT1B 3AA9A 4J9PA 1VF7A 4P6YA 2QRRA 4FXVA 3MM7B 4GKKJ 1N8RT 1FX0A 4FF1A 3BYPA 2HZAA 3Q89A 2PMWA 1BLIA 2FLPA 1I3QC 1YVFA 4DQQA 3ZZTA 4IG0B 2ZH7A 2C3OA 5ETVA 2MZ1A 1USMA 4UY85 1HI0P 3GTMC 3PYEA 3GTOA 4G6IA 2BKPA 1WSRA 4W92B 1V3SA 4KGZB 3QMQA 2O66A 4KHRA 1HD1A 1O29A 4C3KA 3EZ5A 1F2GA 2C2ZB 5IWAF 1BGXT 4IH7A 1VGXA 2KKHA 4KGMA 3HOWC 3VO2A 1YRTA 4K50A 1UVLA 2AYBA 4GTDA 4ZVTB 4KN4A 2UUAJ 4MK9A 1QAYA 4P52A 3MAAB 3ZZZA 2J6SA 1EP3B 1JIHA 2XMWA 3HVAA 4JI7J 4CLKA 1Q8IA 2G1HA 3VAJA 4LSNA 2YWEA 1U47A 4ELVA 5B0GA 4HT7A 4L75A 1WTHD 2YQ3A 2UV8A 3HPOA 4KMDA 2MXYA 3S17K 4HDGA 1NSQA 2BVZA 1E6VA 2E44A 1FFGB 3PEHA 1DQAA 2KHCA 2N4DA 4NASA 3C14B 4BY1K 2DGWA 5A8RA 4JI6J 4F3QA 1WUUA 3NCQA 2MMYA 5KG3A 4TQRA 2IJNA 2YKOA 1TK5A 4NXMJ 3TAPA 4KN7A 1VRUA 4A8YA 2ZBPA 2Q6OA 1HWUA 1FE0A 2GV1A 4ED2A 3UQSA 4DEZA 3EGNA 1LXNA 4NEYA 2HG4A 4DUZJ 4X6AK 4NCNA 1YJ9S 2F8HA 4YB1P 3I32A 4TY9A 3KK2A 1CS4B 3GEEA 2DNKA 4N8OA 3BQ2A 2KT5A 4X66J 1X5OA 4YN3B 1T11A 3T5JA 2ZBUA 2JA8K 2WB1D 4J9QA 2AYEA 4CM0A 3NXZA 5BSXA 2NVQC 5BYRA 3LPYA 4A3BK 1WTBA 3R3TA 4TLRA 3OJWA 4OMFG 3ZC4A 4RDLA 4X4RA 4RNFA 3Q83A 1KBRA 4DWIA 1ZOTA 3M6WA 2VG7A 5KG5A 5ADZA 3SCJE 4FXUA 3Q6QA 4DV1J 4A3EC 2JA6A 4EU0A 4PXDA 1U7LA 3JB9k 1TQLA 1T9YA 8RUCA 4IG3B 2MY8A 3FEYB 2B5JA 2MQPA 4DNTB 4LFCF 4QW8A 3IBWA 2YNGA 2BOAA 3RZDK 2L48A 2QTLA 5HK4A 2JX2A 5H1SV 2K7KA 2WR8A 5CAAA 1XMQJ 2VZLA 3BUEA 3G6ES 3IS9A 3OHBA 2ZD1B 5F4MA 4UOFA 3A3GA 5C5JA 3BB5A 3KDOA 4DLEA 4K4ZA 1YI2S 1K83K 3GTQC 3S2HC 5ETQA 4F7DA 1S48A 1QTNB 5L39A 3M1VA 1RAGB 4ZLPA 4NE9C 3BSNA 3FKIC 3MECB 4M1KA 3VR6A 1OJ4A 4DQLA 3K2YA 2W9CA 1RQRA 1RHJB 3T6JA 2KZZA 1KQSR 1RTHA 2Q6BA 4PEOA 1RT5B 2JWNA 4ZVEA 4LT6A 5LT5A 2R93C 3GPAA 3K17A 4NLTA 4LFBJ 5EDWA 3PFEA 2FHJD 4YALA 2XLKA 2HNDA 3NGKA 1VQ7S 4L6V3 4WIQA 2YX7A 3GTLK 1UL3A 4OYPA 3PNIA 2JEFA 1C4AA 5K8OA 1S9GA 1WC6A 2IRUA 2B7BB 4F2SA 4M4SA 1WI6A 4WP3A 1ZM3A 3G4CA 2DKOB 2XO7A 1R0AA 4GFQA 1RLDA 2R7OA 1S4EA 1Y5NB 2A10A 1GK8A 4LF5J 2ZL5A 1J9ZA 4A3LK 1FD8A 5ETOA 4IQMA 1NRKA 1RAJA 4OI4A 1X4HA 2ZZFA 4CZCA 5D0HA 1S49A 1REVB 3TAMA 2AIRB 4NLYA 1ZM4A 1EFWA 3P27A 2MLZA 3DOKB 4X62J 1X0FA 1LQ9A 5IOQA 1DRZA 1KVIA 2BEFA 2LP4A 2OP5A 2ZHOA 2GVZA 1OY6A 3IO1A 2XBPA 4Z4TA 5B0CA 1T7PA 4XK8C 4OYOA 4F3OA 4URQU 3Q3AA 2H4WB 2HFSA 4Q2MA 2J7KA 4KO0B 1HKAA 4DSJA 4YFXA 3A3NB 4I64A 2XCRB 2BA9A 4P3YA 1I7PA 4C8OA 3S01A 2ZITA 5HMZA 2OLWA 2FB0A 2HHVA 4I6AA 1RT7B 4DX8H 3TQEA 1NDPA 1E79A 3GJTB 4QHYA 3T1HF 3DCAA 4AF6A 4KKOA 3H7HB 4H4MB 1RB0A 3S2DK 3DDIA 3HOZC 4IR1A 1K44A 4ITSA 1E43A 3PR4A 5KNLA 1FERA 1LWFB 1S0NA 1IBLF 1VBZA 2DGQA 2RHQB 3JTOA 3W5XA 2D3O1 2OH2A 2RMLA 3HSDA 2YNFA 3AGQA 2GC8A 4WZKA 4AXIA 2UVWA 1RWMB 2WONB 3E51A 4P1VA 5B0DA 5KG6A 3IN5A 2HQGA 4FS1A 3LTOA 1IN0A 4TSFA 5KFOA 2Y1LB 1OHHA 5GADU 3M32A 2AT1B 5K5MA 1TWGK 2OSRA 4TMTA 4XORA 2YU9K 2GA7A 2FQQB 3QT7A 3R2DJ 3GIMA 1DTTB 2DNMA 4F3MA 3BGUA 2AZ3A 1VYAA 1RK8A 4QIVA 1EWYA 2E1PA 5GMEA 4BCAA 3W9JA 3GVJA 4RNHA 2OPPA 1AFIA 1G7TA 4LRDA 3I96A 2QL5B 1YBUA 3MPVA 4JI0J 1N54B 3KHGA 5J2MA 9ATCB 4RNOA 1NB0A 4ZVUB 4A3CK 1W35A 4RCZA 3PO5A 3A12A 3BSOA 3T5KA 1FCAA 4U7CA 4C8ZA 1S12A 3S1MC 2V2VA 2BE2B 4KFBA 4KKUA 4JI1J 3CC7B 1DDIA 3J81k 2V9KA 3KLGB 4KRWA 1MN7A 2VASA 2JH3A 4GTAA 1T05B 5HANA 1IWAA 3MUTP 1YZ7A 2QLXA 3T00A 4P2SA 3OVAA 5IYWA 2VQFF 4F25A 2B3TB 3G2XA 3OW2R 1BQMB 1FK9A 2E5LF 4DR3F 1YX2A 1NJYA 3N6NA 2C4UA 3GYGA 1V6HA 2RILA 4CYUB 5KFCA 2V8DA 4I2PB 5IOTA 3RB0A 2XWXA 3TZZA 2E2IC 4N56A 2LEBA 1WF1A 2MGZB 1VK8A 2WHOA 3PRVA 4CLPA 5C44K 3E20A 3M8PA 3MHYA 2W2OP 2MQMA 5E7OB 4K4UA 1H38A 3NOCA 3Q6RA 4ZOSA 1FEHA 3CMAB 3EX7B 1HBNA 1N34F 4URGA 3HT0A 2VH7A 2WVCA 2F63A 1MROB 1X9SA 3WX8A 5KFRA 2LMIA 2MDAA 3I87A 1UEUA 1Q5YA 4G0VA 4RW9B 3D6FB 3Q8PB 3S16C 3U1MA 1X7VA 4KQZA 2PEHA 4FZVA 4PRFA 5I3UB 1BQXA 3N5FA 2BM0A 2GNKA 2CUYA 4OZJA 4IFYA 5B0EA 2P8TA 4IR9A 4LF4F 3SSRA 3G8TA 2W6IA 3R27A 3HP6A 5HATA 4ELTA 1X4AA 4OOVA 4YFKA 1XERA 3SV4A 1KTQA 2ZH5A 1OY9A 3GEIA 3DXJA 2V8VA 3DKDA 3PIPQ 4C11A 2DHXA 3T01A 2AV5A 2LA6A 1UV7A 4ZLLA 3R1HA 4K1XA 3I5CA 2E1CA 5IYBK 1FKAF 4C7QA 3S1QK 4FYWB 3M05A 2E7XA 1DQ8A 5JJBA 2NVXA 1DY3A 1IBKJ 4OOXA 2CNNB 2GVDB 1U4BA 2FJWA 1HZEA 4W98A 3OTOF 5KFYA 2PPBA 2AX0A 1WC3A 2LECA 3QBCA 3GE9A 2QTWA 4OX9F 2W7VA 1D0EA 3A8JA 1HVXA 5KG0A 1AFJA 1Z2LA 5MAOA 2MSTA 1QH0A 1UWBA 3ENQA 2BYCA 2HVHA 2AW0A 3V6DB 4CNZA 3FOFA 3PUNA 2C3YA 2VBYA 3EDQB 2FZCB 3IBFB 3ONQA 1H8EA 3GDZA 2WPDA 2B8PA 5ITHA 1HBOB 4ZJLA 1M5VC 2O1PA 1TKTB 4AH6A 4BY7K 3H25A 4M5MA 1R8BA 4BXXK 2VG6B 3SMZA 1VHOA 1NJWA 2R7ZC 3S1NC 2VPYB 4Y34A 1P1TA 3CC4S 1YZ6A 1HNXF 4QVJA 4ZPBA 1IE0A 3BY2A 5RUBA 1XZQA 2QDXA 2FJXA 1NBMA 4DFKA 1HI1A 1OB2A 2NLWA 1RWNB 3TX0A 3FJOA 2DNGA 4B9VA 1NHUA 1R0CB 5D6GA 1COWA 5IC6B 4Z4UA 2L9NA 2MKHA 1T3OA 2V0NA 1RTDA 1SXLA 1PYOB 2ALYB 3ASPA 4DL0C 2UUCJ 2WCXA 1KK0A 1TV6B 1VQ5S 1M90D 1KZLA 1S7IA 1KQ4A 1ZBSA 3FDSA 4Z4RA 1XC9A 4ZIWA 4JB8B 5CYQA 2ZUGA 3ILJA 3R6KA 1RU1A 3VGUA 2ZZQA 1VHFA 4WFZA 2WZNA 3T1YF 3BDPA 2IJRA 2CWXA 3M2RA 4DV4F 3H3VD 4Q2LA 1UVMA 3S15K 3BM7A 2F9DA 1X4EA 3ZNUA 2KT3A 3Q22A 1RADB 3V6JA 1UVJA 1YIJS 1IJFA 2ASJA 1SQGA 4DK1A 1ZZFA 1TUIA 1GAQA 3HZGA 3KK1A 4ZCIA 1B7FA 4WFYA 2Z0GA 2PIIA 4O23A 2D9RA 5J2PB 2IC3A 4LF8J 3CP8A 2XGQA 3NGDA 1RHQB 1GMUA 3IFEA 2GMHA 3T51B 2A6MA 4N41A 1RE1B 2A2CA 2DR9A 3OPFA 3DRRA 1I3QK 1LV5A 2JZ5A 1XTZA 3J7Z5 1BX0A 2V8PA 4NLXA 2R8GA 5GVQA 4EI2A 2FC9A 1S7HA 1J5OB 4I7FB 1IB0A 1RISA 4KB7A 2MYFA 3C6UB 3GTMK 3BH6B 5H59A 1L3VA 4P2MA 4DN0A 3JSTA 4HYKA 4J91A 2WAQD 5TMFA 2X7IA 4OJGA 1MU2B 4ECXA 4NMLA 3HZEA 3CD6S 3I82A 2EC0A 2J5AA 3G96A 4USMA 1S1VB 1D1UA 1XMOF 1QAIA 5C2GA 1DAXA 3W2EA 1SKQA 3AJ1A 2R7RA 4BWJA 2AX1A 4XSXA 3HOWK 1HNVB 5IFMA 5FLXU 4ED3A 4K8RA 2OFHX 5DDRC 1FRLA 4NI2A 4UZEA 1X9MA 2V8HA 4NL5A 4OI0A 4LBHA 1G7RA 2DNZA 1U49A 4DPTA 1N4LA 1D8YA 4CLLA 5A0YB 1WELA 2HLUA 1QGZA 3MEDB 4B08A 5DM6Q 3BH7B 3KLIA 1UTAA 2R7XA 1LWEB 1NPKA 1AZSA 4O0IA 1EI6A 2UUBJ 4L8JA 3CWJA 3KJFB 3BC9A 3EVWA 1RGVA 4KYZA 1L3SA 3BPSP 3T3FA 2Q3PA 1S6PA 2R4FA 3N4WA 1CNEA 4EZ6A 2DGXA 3BJYA 1QVFR 2CQCA 2HMAA 4CTAA 4O4RA 1QLNA 3A3PB 3EXCX 5FDLA 2RRAA 3QAEA 4YOEA 4NA2A 1KRPA 1S1TA 3QFSA 4JI4F 2QEXS 3N3YA 3Q0AA 1F9EB 3QYYA 1TMJA 3HXMA 3SI8A 1R5BA 1T03B 3SFUA 4EO6A 4RZRA 1HWIA 1RTIA 2WYRA 1KVKA 3PY8A 2RUGA 4LBYA 3EYZA 4OX6A 2J9CA 1H0HB 1R9TC 2KFNA 2KN4A 4JV5F 3PKMA 3O44A 2YKAA 2BRKA 2NVQK 4C2MA 4ANCA 1VC0A 2XG8A 2PDAA 3FKBA 1RBLA 5C2CA 2ACYA 3GTKA 3HHDA 5KFHA 4LK0A 3LNNA 1JLCB 5IP9C 2CPIA 3CJTA 2E29A 4G7ZA 2Y9HA 3FOEA 3VNUA 2R2SA 1CVJA 4DR5J 4A3EK 5G4DA 3VGSA 3SEJA 1QUFA 3E3XA 5TMCA 1YJ7A 1SVDA 3HKZL 4IOBA 1FNOA 2LKZA 1IR2A 4ZN3A 1KFSA 2KXFA 4V19J 2SXLA 2ZBCA 1TKZB 4NLWA 2DY9A 2RDDA 3S14C 3FRZA 3PHTA 3DLHA 2N82B 2FVSA 3DDNA 5CZVA 5C25B 3WNCA 1WWHA 1C1CA 3UW1A 3VAHA 3JSBA 4LUBA 3GTQK 4ZJQA 3S2HK 4ILRA 2VQEF 3FKIK 1U1KA 1JNZB 1L3KA 4NLOA 1KSPA 4DJBA 2AGOA 1HQUB 3MCNA 5LOQA 2ZKTA 4DR1F 1RTJA 4YAFA 4QIFA 2ZUAA 5CABA 3SQGB 2HBQB 2DGTA 4G0WA 4P25A 5GAHI 4HE6A 2R93K 2ZH3A 3SZYA 1SJ3P 1WKLA 1H3DA 2CQ3A 4B3MJ 1CBKA 2OBSA 3R6LB 2JHEA 3SZZA 3LH2S 1N88A 2C22A 3K0JA 1VJEA 2RQCA 4CIOA 4A3JC 5L1KA 1BS2A 2OTJS 3KK3A 4DQPA 1O0PA 2PFFB 4LBWA 3BCFA 3EJMA 4MKBA 1MLAA 3UO0A 4XONA 3RBEA 3ITHB 3KHLA 4OIRA 2FYXA 1BX1A 4M8LA 4XL9A 4B9LA 1Y0YA 4Z37A 4R5PB 2E2HA 4K0KJ 1GXUA 3GFZA 5BYSA 1SM4A 2E5HA 1VQ8S 1EARA 4USWA 4LSLB 3OJUA 1O2AA 4OPVA 3QJJA 3PFOA 2HBZB 2VUMA 1OIAA 4OLPA 3FMWA 2OTLB 4MYUA 2MEWA 5D0GA 2N7YA 2C1EB 4K4VA 3W2VA 1HPZA 6FD1A 3HHLA 2DRBA 4TMZA 5E41A 4DS5A 4GZYA 1FXDA 3BS9A 4RNMA 1ZAWA 2X53S 2WJYA 4GO5X 1IW7A 5IT4A 1TFYA 2V31A 1SUQB 5HBMB 1ZETA 4A3MC 3BN4A 2RH3A 4PQUA 3UD4P 4O3RA 3RAXA 3G82A 2HGMA 1XB2A 2WVDA 4NLQA 4WTOB 1QE1A 1P27B 2VONA 1IKVA 4F0MA 4QWAA 4UZUA 3S1TA 2Z6BD 2RIJA 4QYRA 4G1PA 3PYGA 3QQCD 1EFRA 5HXBA 2X3GA 2YBVA 3PYDA 4RPDA 4PGOA 1QUVA 1GMWA 1E3ZA 4Z2XA 3CCLB 4S0MA 5BXIA 3DLKB 4ZPTR 5GMDA 1B4AA 5DZ6A 2QFIA 1Q7YT 3HOZK 2UXBF 3MPUB 1XQBA 2IAJA 2CQBA 2APOA 4FWTA 2HQCA 5CYMB 4ID8A 5CCMA 5JUMA 1S9EB 2CW5A 4J9UE 5L9NA 2XY5A 2ZWOA 3BV8A 2DO0A 3HOUC 4KGKA 1N5QA 2KYZA 4A8FA 2DNYA 5LMUJ 3SEOA 2UXCF 4RJVA 3JYTB 3IWXA 2ZE2A 3BGFA 2DGUA 4BC9A 1UEKA 1N6QA 1J5EJ 4XDDA 4DI6A 4II2A 3R5JB 4QW9A 3I0RA 1TWHC 3VVTA 2OPRA 4DPYA 2BJEA 4MFBB 4IKAA 5CD4A 2XGJA 4LVOP 1TKDA 1HR0J 1VBYA 3ZTSA 1M1KT 3QIPB 1CLFA 3BKUA 4MK7A 3NMRA 4LR7A 2A2DA 1O24A 3J7ZT 1T95A 2J0SD 4XLNA 3W5VA 4JI8F 3GILA 3RTVA 3QO9B 3D2WA 4FF4A 4LF9F 1ZUNB 3QGPA 4YB7A 2BV3A 3KLEB 4B3FX 2BANB 4OZLA 2VU5A 2VFSA 4F2RA 2AJ0A 2HHHF 3CJSA 5FJ8K 2B63A 3QFTA 4XSZA 2D3NA 2C3UA 1HQEB 2ROEA 2ZJQQ 4RDKA 4K4WA 3DGPB 4GVBA 5CCLA 5L46A 1I51B 2GJ2A 1NZ8A 3BBCA 3CUNA 2RKIA 3FK4A 2ZVIA 3CNQP 2EWHA 4P72A 4B9MA 3ETMA 2E2IK 3TZYA 2CG8A 4A3DC 2Q66A 3A35A 1NHVA 4MIAA 3LPEA 1UKUA 3MMAA 2XZOA 1EQRA 1O51A 1PILA 3WYAA 4AQYJ 4ATNA 3DNCA 3TI0A 3I9V9 3GTLA 5T7LB 3CCQB 1FWKA 1TFWA 1PKUA 1WQFA 1ZAXA 1VR6A 1RT6B 2A0FB 3R7NB 1KWMA 4HHJA 1RSCA 1KDNA 2WW4A 2OELA 1WPCA 3QIDA 3CMEB 4M5LA 3CXCB 2KRRA 3S16K 1JLGA 2GK6A 4XLEA 2B6AA 2ZZNA 4ZCLA 2J7WA 2QFJA 2HNZB 3R5CA 4WFXA 3MMLB 4N7TA 3OEPA 4QFMA 4DL3A 5KFTA 3CJKA 1UVNA 3W5YA 3DXBA 1XN9A 4DF4A 3RRHA 2R9LA 4WPAA 3GFHA 2HFUA 2YX4A 4J9OA 4DV2F 3QLHA 3JAMU 3CD7A 4XKWA 4OP7A 3TUPA 1TK8A 2MKKA 4F4ZA 4KARA 2DB1A 2DETA 3UN2A 1VQPS 3HVTA 4ZCMA 3US5A 4DNRB 5L8RC 1DLOA 3CQZA 4DLGA 4KGVB 1MW7A 1NKEA 4QVAA 1VBKA 3I0SA 4RD6A 2HMIA 1UAWA 5BYQA 1TUGB 3HJFA 1G6BA 5LMZA 2WSFC 2DGOA 4NEZA 1TELA 3MM7A 3J80U 2XS2A 2G13A 3CD5A 1HHSA 2OJ3A 4ECTA 4ZP7A 5D15A 4ECSA 1I8DA 1RT4B 3D6MB 4LIWA 2GQCA 4UQTA 4IG0A 1UMJA 2MHNA 4QU7A 2C2WA 1U1LA 2RQ4A 2YWKA 5J1EA 2X3UA 2BACA 3GSIA 3CCRS 3K5LA 2KFZA 4PXEA 2KG0A 2ZBRA 5KFWA 2C78A 4J7CA 2R8IA 2MZJA 5KFJA 1FRXA 3M8SA 3BPDA 2DR6A 4P5AA 5LSLA 4YXWA 2HHTA 5M5WK 3N0VA 1VQOS 2NR0A 2P6TA 4PAAA 2G0JA 3VAGA 1BD6A 3MUMP 2OKQA 5IWAJ 4KHPF 1TWCA 4QWDA 2MLXA 3OD2A 3AD9C 4ID5A 2G1DA 4UF4A 2JVRA 3PO2C 1WF2A 3BZQA 2QA2A 3OXFA 3MAAA 3MURP 2UXDF 1KMHA 1VQ9B 3S1NK 2IRYA 3WBJA 4FK8A 4WFNQ 3CJRA 4RDJA 2G2OA 3FBCA 1WC4A 2LQBA 3BGRB 2QE7A 4CO1A 1X4FA 3GR1A 4FDFA 4QJVA 1GH8A 1INNA 4I68A 1QY7A 4A8XA 2Q6LA 4ECZA 3R2CJ 4ZPVR 1U24A 3H0GC 3Q39A 1VHIA 3C14A 3MGJA 1C4CA 5U47A 4JOUA 2ZH1A 3ZZRA 2R7VA 2ADBA 4MJKA 1JLFB 4JI5J 3GR0A 1HMVB 4ED0A 3GV8B 2ILZA 3MOJB 3ZZ0A 2G9OA 3H98A 4F4KA 3GG0A 5D3GB 3ZC3A 5D4OA 4ZVOB 1I50A 4YAWA 3OW7A 4B3TJ 1NDCA 3DXSX 3MFIA 4RUHA 5EUHA 4WXOA 2Y8WA 1S72S 1CS4A 2B4PA 4DPOA 2BPOA 4ZGQB 1JVIA 3MMBB 3PHEA 4ECUA 3MF5A 3VCDA 3TWZA 2WSCC 3M2UB 4FKYA 1N0VC 4N77A 5D0EA 3VO1A 3HMJG 3HXAA 2DITA 1GVHA 4GTCA 3SZ2A 1FDAA 4QIGA 3BO3A 1N06A 4KMHA 2IBKA 2ATLA 2HZCA 3NUHA 2VV5A 3CB4A 1TWAC 2J9DE 2VHGA 3SXLA 2F9JA 3HAGA 3RAQA 1H7XA 3TA2A 1RU2A 2NCKL 4CO2A 2FVCA 2WB1L 1FRHA 2CRLA 4IG3A 1YITS 4EYIB 2BRLA 2HQFA 1EB0A 3C19A 4KAIA 3CJ2A 3X1LB 3AGPA 3PENA 5T14A 3D6TB 1NPPA 1TWFA 1S0UA 2LDIA 2Z2LA 1LXJA 1Z4UA 2ZD1A 1TL3A 5GV7A 2DEJA 1D8ZA 2AJQA 3L7PA 4X7DA 3T9NA 3GTOC 4GC6A 4YAOA 3EGVA 1R27B 2JDJA 1A9NB 4BBSK 3KKFA 4C8MA 1NSAA 4M5NA 4UAJA 3MECA 1RP5A 3M4OC 2GREA 2RS8A 1SL0A 1Q78A 4BBYA 3VTIA 2M70A 5J2QB 3HSZA 3BNWA 1RT5A 5LXRA 1VLYA 1H74A 2Y0BB 1XWLA 3PDNA 3GTGC 3MCAA 4C4WA 3A1PA 3RYLA 2VC1A 4CLWA 3FBEA 2R8JA 4NOIA 2CDRB 1JX4A 4XPEA 1BJTA 2ILYA 3QATA 4P6QA 3BR9A 4RPFA 5KFXA 2B7BA 2QL7B 4B48A 1JMTA 2HEKA 5C24B 1XPPA 3CDBA 1DDGA 3D5MA 5DG7A 3QJPA 1S4MA 2YH1A 4ILMA 5EGEA 1F60B 2HFOA 2WB4A 5K9FA 4NNJA 5K8NA 1NJIT 2F4VF 3EQLA 3SLDA 4K5SA 4BPRA 3TZWA 1XXAA 2GIRA 1BPLA 1ZTTA 4UOGA 4P12A 3NS7B 2UV8G 2F1MA 3AVWA 5HROB 1QSYA 3MM9B 5AXNA 2C4TA 1S1WB 3ILLA 3WHIA 4ZVFA 5IM0B 4W4MA 1Q0NA 1G7CB 4IQXA 1F5AA 3DOMB 1R9TK 4EK2A 2EEYA 3M8ZA 2V7VA 4TT3A 3T02A 1Y5IB 3LP2B 3AODA 2R92K 1YG0A 4GRSA 2CFXA 4XQFA 1DARA 3BH4A 3IRWP 3K59A 3QNWB 2ZH9A 3NGSA 5KG4A 4TQSA 4QWEA 2F43A 4KO0A 2DHSA 5IP9K 1WC5A 4N3NA 2Q43A 4F02A 2Q6KA 5F8HA 2RJZA 3B4DA 4R0EA 3KDNA 1TL4A 1SJ4P 4OIOA 4JI2J 1RT7A 1HI8A 3B78A 3I4PA 4K4XA 5ETRA 4XLPA 1N32J 3AXMA 3C15B 2M52A 1S10A 1I3OB 3BF4A 1FWPA 2JA6C 2GMJA 1W87A 1Y1VA 3KJNB 4A3FC 4PWUA 3S14K 4H4MA 4O44B 4KMAA 2HRYA 3GYNA 5KFNA 4B9NA 2VG5B 3BP8C 3VVUA 3OJXA 4KPCA 4ECYA 4U8VA 5EHHA 4YY3J 1MWQA 3UN3A 1LWFA 3Q8UA 1IM6A 3MD3A 5A6WA 1QAJA 5IQQA 2XMMA 2XZPA 4EZ9A 3G05A 3K5NA 1RAEB 5KG2A 2JVOA 1P9YA 2WONA 2CJXB 3FBFA 4ZV4A 4X6AC 5CH7B 3OV7A 2F1FA 3N0CA 3KXDA 4Y7NC 3ISZA 2W4CA 2JA5A 4ZA1A 3M2RB 1XMBA 3MTKA 4DZ6A 4YP3A 2G2YA 3E01B 4JK1A 3KJQB 5BR8J 1FRJA 1KNZA 2IA0A 1DTTA 3RY8A 4A3JK 1R8PA 2HURA 1HFEL 5IC4B 2DEUA 2U2FA 4AE5A 4QCLA 2V4JB 1VJQA 4DMZA 2EFPA 3ILOA 4B3SF 1GXTA 3RU0A 4LIRA 3CC2S 3OEHA 3IP0A 2R7QA 2CQ1A 3G8QA 1I3QA 2H5JB 4AVZA 2YKNB 3J81U 5E2QA 4USKA 4X7FA 4IO1A 4DV3F 4LQ3A 2EKNA 2DYAA 2M2BA 1S6UA 2BE2A 4AD6A 2VICA 3KLGA 3DYAB 1LWCB 5FA6A 1T05A 1UETA 7FDRA 1YJUA 1XR6A 5L1LA 5IOLA 4J9RA 2DVIA 2VQFJ 2XNQA 1BQMA 1KR4A 1KD1D 5CJ9A 1O6XA 2POKA 2DRDA 4CYUA 3KNGA 4NPOA 4CNYA 5IYRA 4A3MK 4DR4F 3VNVA 4OHZA 1NZAA 3PA1A 2XZTB 2MGZA 1E62A 3KLHB 4OHYA 1TP7A 4YDXA 1KC8D 1YRUA 3Q2TC 2EFGA 1O5JA 3CCZA 2B43A 2ZWPA 3D4JA 1C2PA 2LU2A 1VHEA 1YJTA 2ZDPA 3TOQA 2AJ4A 2J6UA 3KNAA 1NB9A 1Y7PA 5IYCC 1WG5A 2JSXA 5KTQA 2BGIA 4QZVB 1JLBB 1JNRB 3R7BB 3JSRA 1K0TA 4F4AA 4KATA 2IM3A 3CTAA 3U7JA 1MROA 1IKXA 1NK9A 1B0PA 3GIIA 4RW9A 2K7JA 3MR6A 1Q81T 3HOYC 3LP0B 1EIYB 4HH0A 1VDHA 3T41A 5HMWA 3EVOA 3MM8A 4DV5F 1Q1KA 2JN9A 5I3UA 2HQ3A 2H4YB 2XHWA 4WKRA 1HNWF 1NK0A 1MN9A 3MR5A 4JV1A 1R5OA 1IM4A 2HRUA 3QGGA 1BMFA 1SPBP 4I4BA 3GJSB 1RTIB 3DMJB 1RWKB 3U1LA 3FZBA 2DH7A 1F7VA 4I67A 3CVKA 2HVIA 3T53B 5MLCV 2XTJP 4XLFA 5EGYA 4B47A 3SQOP 3DDYA 4WCEQ 4GTEA 3WODA 2B4OA 5F3TA 5KFIA 1VQ6B 3MEGB 3MD1A 4XR6A 2RDJA 3C16B 3LGHA 4K59A 1XFOA 1QSLA 4G7XA 4CO3A 3R5AA 1OB0A 2M4MA 4M0LA 3DLGB 3AB4B 2GVDA 4E8UA 4ZGNB 1CG2A 2B51A 4OHWA 3GG1A 4RMFA 3EMTA 1RA7A 4KPYA 4GKKF 3T5HA 4C8KA 4H54A 4YFUA 1GE9A 1WP6A 2CQ0A 5FL7A 2VBVA 4PG4A 3V6DA 4PABA 4UTGA 2DHAA 5FIIA 5B08A 4XLCA 2HWTA 1PC5A 1JXEA 4KKSA 1V9OA 2BW7A 2RAQA 3CW2C 1HBOA 1FRQA 4E98A 3PCOB 4OZ5A 1TKTA 3W2WB 1TK0A 1CJKB 4DN9A 1XK8A 4UQGA 1QFYA 1GTHA 4TLQA 2DR5A 2F8MA 3WIUA 3V7AA 2XEXA 4FPIA 1QTMA 2BSAA 3MHPA 1N07A 1X4BA 3RB6A 2FJBB 1RTJB 3W7BA 3KUHA 4HTIA 2J76E 2DXEA 2QLWA 4A3DK 3L7UA 2LXUA 2XC9A 4GVLA 2R93A 2CJYB 5M5XK 1VRQC 1GMVA 2UUAF 4H9GA 1KLNA 4CQJA 3K8WA 4JI7F 3LVBA 5ETNA 4Y2AA 1NPRA 1QFZA 4CLYA 1NXIA 2M8HA 3OREA 3EUNA 2CQGA 3N79A 2NZ4A 3UD3P 2HKEA 1JKHB 1KQKA 3OR2B 2C2OB 2EVZA 5DDQC 5EWFA 1BHNA 2QV6A 2V7WA 3HI9A 3DLEB 3OFEA 5HVGA 1CJVB 3L7OA 2AGPA 4DV0F 3D54A 4A3CC 4NXMF 5AE2A 1QAXA 5F0WA 1Q86D 4C8LA 2D6FC 4MYTA 3FSXA 4KSEB 1T6ZA 1Y1WK 1JB0C 4Y28C 5IT9Y 3GLJA 4DUZF 2C3MA 1ZA1B 1JJ4A 4RW6B 4DX7A 2J8AA 2A6HA 2V4DA 1VBXA 3IRXB 2C2RA 2CJQA 3EPGA 3ZNJ1 4X66F 3V4IB 3OL7A 3H3VL 3HOXK 3ULHA 1NK7A 1U0SA 3HHLD 3GWCA 1U1NA 2FGCA 1FRKA 4A47A 5DLGA 5J35A 2NVXC 3G71B 2KM8B 1J5OA 4I7FA 1V3ZA 2NVYA 3MZIA 3C6UA 5IYQA 2M0GB 4DV1F 2GJIA 4EYHB 2VOPA 2ZJRQ 3HVRA 5F9LA 3GTJA 2J6TA 5HI7A 1MU2A 1PGZA 2PE3A 1U02A 3CAGA 1DCHA 5IYPA 2RQMA 2NV4A 3MCMA 1U0HB 1IKWB 3TW0A 2YKMB 2BQ3A 5AXKA 1DHMA 1OSDA 1S1VA 4KR0B 2GO8A 2GPJA 1XMQF 5DG8A 3KOAA 2CQ2A 4O2DA 1HNVA 4DR2J 3B8HA 1GMWD 3PO2K 1LKZA 2WAQL 2JDIA 4DU8A 2JA7A 5EX0A 2BJ3A 4MEXA 3Q86A 3MR7A 3C46A 3HK2A 5HLFB 1T5EA 1EFCA 1UJ6A 2M7SA 3LP1B 5HQ8A 2HLTA 3PG9A 1EP2B 1JJ2B 1ELOA 4RD3A 5A0YA 5M3MK 2NYHA 5KOWA 2V6SA 4OJ1A 3MEDA 3QRPA 4TY8B 3SFGA 1LWEA 4ZDNA 3VQSA 1PAEX 4LFBF 3M8RA 2LFVA 3MR3A 2FHKA 4PUOB 3MEEB 1VQSA 2R7WA 3W5UA 3OEEA 2LEPA 4MIBA 3S1QC 4Y2CA 3KJVB 3CDUA 4BLGA 4X64F 2ZZEA 5A76A 1XNQJ 3QFWA 2H5EA 1UD4A 2OIHA 4MK8A 1T9XA 1T03A 1XBWA 3LO8A 1TKXB 1RAFB 1NO8A 1O8BA 3FC9A 4DXLA 2PD1A 3P5BP 2IM0A 2RDIA 4DX5A 5HJYA 4M5JA 4NYZA 2HK3A 4LF5F 1AB8A 5KFUA 2CWKA 4XAKA 1VIOA 3H4DA 5SUHA 4JV5J 1HA3A 2AJFE 4NLUA 5C7PA 1XIQA 4F4WA 4QBUA 1JWWA 1TWAK 3HJVA 1U1RA 3AOAA 1JLCA 4BXXC 1WKKA 4X62F 2QMXA 3NNCA 5E3CA 4QUZA 2KHDA 1U1PA 1DFDA 1VS3A 2H51B 3QX3A 2HVZA 5E68A 3VALA 1UD3A 4PXCA 1ZZNA 1RWVB 3W66A 3S8SA 3CTRA 4YFNA 4Q45A 4X0CA 2VFRA 1TR0A 2RE1A 4NWBA 4LK1A 5A6PA 1TKZA 4ZPWR 3Q8QB 3LA0A 1SQFA 1SJQA 2RT3A 3NCRA 3PYFA 3I5BA 3S7RA 1HBMB 1GTEA 4QR1A 5IQ6A 5HZBA 4X07A 2I38A 1FA0A 3VZHA 1FE4A 8AT1B 4DL2A 3GTOK 1F6TA 1SKRA 1VQ5B 2WOMB 2DPIA 2G0CA 3M4OK 3TYTA 4J37A 2ZOGA 1C1BB 1WIHA 2H48B 1LK7A 2N7CA 5M3FK 3IGNA 4DR1J 3SQGA 3PX6A 1FEEA 2XY7A 4WZLA 4M5GA 4EGLA 3H2LA 2E9RX 3PVDA 1WEYA 3ZIAA 3QT5A 2C42A 1BUXA 1VK3A 3H4BA 1D1NA 3I5AA 4X2BA 3R8YA 3A8EA 3AQOA 2D9OA 1RI7A 2F3JA 4DQRA 5ETLA 4LJMA 2L08A 3JQPA 1T9WA 4UOCA 3POTB 4X4SA 2QL9B 2QLFB 2V2ZA 1N08A 4LBVA 1QDUB 2NVTK 1E3XA 3L4JA 3TX8A 3ITHA 2JLEA 2CBXA 1ZAVA 4RLEA 3Q8YA 2WZPP 4R5PA 3L95X 2LEAA 4GTFA 2VUGA 2XYHB 1N8RD 2V68A 3ELHA 4LSLA 2MKSA 5K8MA 5F8IA 5J1EB 3GQCA 4AL5A 4P6VF 4KTQA 1K9MT 3MXHP 3TAQA 5HO4A 4A8QA 4IH6A 3CD6B 3SJPA 2B7CB 2KO1A 1CC7A 2OGUA 3PV8A 1FNMA 3OE7A 4N3GA 4LR8A 2Q6IA 2JLFA 4H4OB 4WTYA 4JI1F 1U2CA 4DUTA 4YHHJ 1DZ5A 1SFOC 2V9WA 4KAWX 1Y4ZB 2N4CA 4I6YA 1U6BA 1SUQA 5HBMA 2P9CA 3D1OA 3OQ2A 4C3LA 3C66A 4ID5B 4CO0A 3KL9A 4PG6A 1Y0RA 3FNNA 2R7ZA 3ZTOA 4C2MC 1EXMA 2QMUB 4RBTA 3WQPA 1F2HA 1N05A 5IYNA 3G9CA 3GTKC 3J7AN 3TRGA 4WKYA 2Y1RI 4TN2A 4ED1A 5DGBA 2C77A 4QJVB 3W2HA 4J9KA 1T6YA 1XNRJ 3OVBA 2JA6K 3KG0A 4A3FK 3DLKA 2LZJA 3BYRA 1LNQA 1VLOA 3VV2B 5JBQA 4RU2A 4CH7A 1RWOB 4ILLA 2UXBJ 2N3OA 1WI8A 1FNBA 5CYMA 4YG2A 3ZO7A 1O28A 1GAOA 2XZWA 1S9EA 3Q8RB 3SLNA 1DJ0A 2AHOB 1V0FA 1N36F 2VBZA 1OSCA 1PC4A 2VNIA 2CQIA 2I1LA 5EN1A 1UPPA 2AEJA 3CXCR 1QJHA 2W8KA 2EFNA 2YQ0A 1Y5LB 1RACB 3JYTA 4G5GA 2QSWA 3GFXA 2I8EA 1YRXA 2FHJA 3CSKA 4Y7NK 1N5TA 2AJ1A 1XXBA 1R31A 4IUFA 4NZ0A 1HHQA 2HVDA 3PJXA 4R25A 2V6TA 4OZ3A 4QPTA 4UOHA 1NKBA 4CLTA 4MFBA 3THPA 1BQNB 3LAPA 4DSIA 3OHAA 3P26A 4FYDA 1IBMJ 4J9LA 4ZITA 3EDRB 3QIPA 4WU2A 2ZC3A 4C43A 2V4QA 2GHPA 1NHKL 4PC7A 3R5GA 1G2EA 1X60A 2H65B 4HH1A 3T56B 3QO9A 4PWDB 2WSSA 1GX6A 6FDRA 2XQCA 5GAEI 4LF9J 3NBPB 3KLEA 2BANA 1SB6A 4ZS6A 3FPKA 1R7IA 2WW8A 5G0RA 3OOCA 3MPWA 4LJZA 2E2HC 4C3IC 2DNRA 3D9BA 1GXLA 5F8JA 3NOGA 4LOWA 3Q38A 5FLMC 3W2FA 3OXGA 5BJRA 1HQEA 2MKIA 1TL3B 4GKJJ 1Q5VA 3DGPA 2VUMC 4FBUA 4NBSA 4MAKA 3ZZUA 1B0TA 4YAUA 4AYBL 2BN4A 1RAHB 4U6PA 2YNHB 3HHLC 4C48A 2BDPA 4B9UA 4DK0A 1RHUB 2AF6A 4G1QB 2BMBA 4DUYJ 1LW0B 4U67Q 4Z4WA 1JQWA 1BE4A 1K8AT 4Z7YA 4TU9A 2IBOA 1FKPA 3V4GA 1SIWB 4ICLB 2YPYA 2ZBVA 4C0HA 1U1OA 3AXKA 1HWJA 2GQQA 1NDHA 5H5JA 3NNHA 1U48A 3RZOK 2ZXHA 5GADI 2HLDA 1H73A 5IYCK 5T7LA 4F26A 1RT6A 1T02A 2OTJB 4RX6A 1HA1A 3ONUA 3G4SS 5JXSA 4RWXA 2XY6A 4G7HA 2HWIA 4RWWA 3RZAA 3MAQA 3UI3A 1SV5B 5F8LA 2W8LA 3CJQA 2ZXIA 2M88A 3HOYK 4G1BA 3MMCB 2VJUA 3JS9A 2HNZA 1VQ8B 1RYRA 2H9ZA 4DL5A 2R7TA 5A8AA 1KQFB 1YNJA 3DFEA 5HN0A 1J6VA 2UUCF 4EUVA 3RAMA 1EQ0A 5D0RA 1EQMA 1UWAA 3BR8A 2MTLA 2X1AA 2XCQA 4B17A 2DEIA 3CRZA 1NEEA 2X1GA 1S79A 2IVMA 4TYAA 2LXFA 3MMPA 2QTZA 1YTYA 4V19X 3PX0A 1W7WA 1Q16B 1SIZA 2R2RA 1FNDA 2W1BA 4Q4ZA 2P2CB 2VPXB 5FO0A 3PXGa 1P4MA 2ZZTA 4G65A 2L41A 2BJDA 4JYAJ 2DCUB 4P75A 1EX8A 4PQAA 4C3HK 2D1CA 1RT4A 2RU3A 2J9DA 4LF8F 3CMQA 5GAEU 2NXUA 4EMDA 2O5JA 3PRDA 3OP1A 1HQMA 3ADAC 1JJHA 1Y9OA 1RU0A 2GHWA 3EPIA 2NXCA 4BKWA 3F56A 3HHNB 3M9NB 1W2BR 4FF2A 4EBCA 2B56A 1RABB 2CPZA 4KKTA 2EFQA 4DV7F 5E6TA 3H0PA 1PJ7A 1KP6A 3HFKA 4QIEA 5LMNJ 2ZJPQ 2ACMA 1HNZJ 2D3LA 5JFEA 5TR9A 4OI1A 1LW2B 2YWFA 4RCYA 2ZZGA 2CPJA 3THTA 4QYZK 2B63C 2ROGA 5KT2A 3E2EA 4XDCA 1YGYA 3KEWA 4KV8A 1YHQB 4RD2A 5A2QY 2P5VA 3DU5A 3M3YK 3BGRA 1M0SA 4DV6J 4HT5A 5KFAA 1KVJA 1OY8A 2Z56B 2GW8A 3C8YA 2EFOA 3FZ2A 4X84A 4QWBA 5I42B 1P8GA 3QPIA 2EBBA 4ZP6A 3WDOA 1LFWA 1Y10A 2DH8A 3G87A 4RW7B 2V5HG 1Q95G 5DLFA 3KYLA 4M94A 3GTPA 1JLFA 3FFIB 1VRTB 1FFSB 2P8IA 1HMVA 1WQHA 1SJFA 1NSPA 2OMLA 1UVKA 3G4AA 2KL8A 2UUBF 5H9FJ 1Q4RA 5D3GA 5EGHA 4WE1B 2GJPA 2B9YA 3MTJA 4ES1A 2ZH4A 2BR0A 4ZVRB 4X4TA 1WSVA 5IYDC 1I6HC 3CCLS 4UY8T 2QA4B 1SH2A 3WNBA 2ZL6A 1TUVA 1R8CA 3BP3A 1FXLA 1N52B 1EP1B 2XMTA 3DLBA 3MMBA 2MKCA 3L09A 4I2QB 4LRBA 3M2UA 2LLZA 2DJWA 3KUEA 4U95A 4UZCA 2C5BA 3UDCA 3V5RA 1TU0B 2WBMA 1VQ4S 4JI3J 4LQYA 2XS7A 4P74A 5HSPA 2V7QA 3OFHA 2Z8QA 4NLPA 5DDOC 4P5BA 1TL7B 4KH0B 2PA3A 3BREA 3UR3C 3CQZC 2MQNA 2GGPB 1ICEB 1NNDA 1F5BA 3M30B 3U6BA 2BJ7A 5BSYA 5A8KB 3IC1A 5JMNA 2BBEA 2GFFA 1CJUB 5AJ3F 2NVXK 3OFFA 2C2DA 5EWEA 4CLSA 4DR5F 2K3KA 2ZHAA 2W01A 2BZ2A 2XSJA 1IQ0A 2HS0A 1O27A 4ELUA 4MKYA 2I6WA 4X8IA 4A8MP 1JLAB 3FJ2A 4N47A 1IKXB 4M5KA 4OOSA 1YJNB 3QSYB 1CQXA 1V3RA 2FHMA 4GMKA 4LF7J 1UPMB 2ABYA 4UZFA 3MM8B 4M5DB 4RD0A 3HT3A 2JEJA 5J2QA 2CVEA 4LR9A 3CCMB 1TWCC 2FVPA 1EKSA 4EBDA 3ZTRA 1WU8A 2R3VA 3PX4A 3GVKA 3WY9A 1TWHA 4WP8A 1XZPB 1RTZA 4NMXA 3TANA 2DCLA 1JA1A 2ZM6F 3T19A 1F1BB 2CW0A 2QO3A 4B3MF 2QSFA 1U2RA 5C24A 1A8PA 2R42A 4FNIA 2XWYA 1S5ZA 2DNLA 1F60A 2F1LA 4C0SA 1VJSA 2Z30B 4II3A 5DJBA 2DHGA 2QX0A 5FO1A 1YJVA 3SJZA 2VODA 2F4VJ 3FBBA 2R8KA 2GIFA 3CP2A 3G6VA 4MT1A 4KB4A 3ES9A 1H2UX 1FDRA 1S59A 5HROA 3CMES 3MM9A 1S1WA 5CHCB 1I50C 5IM0A 5M2UA 1VQKS 1G7CA 3DOMA 2AEFA 1H85A 1IBCB 3O3LA 2H5IB 3OTDA 1VQMS 1VQOB 3CIZA 5IP7C 5F4JA 3BBFA 2UU9J 3AVVA 4XCHA 1CQMA 1RT2B 1AB4A 1B0VA 1SBRA 3LP2A 3DRXA 1U6FA 1L3TA 5CZXA 4CP5A 4RPBA 2QT7A 3LQEA 1VIXA 3W61A 1V5IB 4RLZA 1UZDA 4CWBA 2XLJA 2MQLA 2E9TA 4EFAC 4PPDA 4DSLA 3KLVA 2W2MP 1F20A 4KGXB 3H90A 2CJKA 5I3PA 3M6XA 4XM3A 4RD4A 5ETSA 3MMJA 4TMXA 2QN6B 4Q0BB 5ETMA 3C15A 3DU6A 2FLOA 2G2ZA 2LU1A 2IHR1 5B09A 4X7EA 5J2NB 1WHYA 2FTRA 4QV2A 2IM2A 2ROPA 1AW0A 4O44A 4XMYA 4RKUC 1NJZA 1RWPB 3AVTA 2VG5A 2ZTGA 2IA6A 2X6WA 4WZTA 2R2UA 3IG1B 3SCLE 3IWLA 5GV8A 2UVUA 1VOMA 4P7TA 3G6XA 3EGZA 2VOOA 4RM0A 1FESA 3AAWB 2XM3A 1WKJA 4P2FA 1S72B 4GTBA 1AUDA 2EK6A 4B3RJ 3DRSB 2CZVC 3GTYX 2XHCA 3D3CJ 1H8HA 1L0WA 5L1IA 1TL1B 4DDFA 1H98A 1HHTP 3M9OB 1KLMA 2IVFB 5LMUF 3IAS9 3E01A 1PJ5A 2U1AA 1N33J 3JQKA 4WWVA 2BE7D 4ETZA 2DERA 3BKTA 1X5PA 2OYNA 3PA2A 2V4JA 4PYAA 1C0UB 4PCQA 2FX3A 2BQRA 4PC1A 2GX8A 4KT0C 3S6EA 4LBPA 4M95A 4USHA 4ZIVA 4B3SJ 3VF0B 4HACB 3GMGA 4AC9A 2RRNA 2OFGX 2YKNA 2LCWA 3PVXA 1LK5A 5THXA 4OX7A 3J81j 4DV3J 2GHVC 4C8YA 4DR7F 5M2PA 3DYAA 1LWCA 2GCFA 3TJAA 5SZTA 3JTNA 1KOHA 2NUHA 4P26A 2P9EA 2FPHX 3W65A 3ISND 4KMUA 2CQDA 4OV1A 1RCXB 4DOZA 3RJMB 4BBSC 1K73T 1SFOK 5D8HB 2X3DA 2CZ9A 4BLAA 1PSDA 4OZ0A 4YS2A 3H5UA 2CF4A 2XMJA 2RGRA 3R97A 2K1RB 2VBXA 4KB2A 4C2MK 2PFDA 4LF6F 3KLHA 1SKWA 3BY1A 3GTKK 1U8WA 1G4CA 2WBRA 3EVMA 5B0FA 2HS3A 4F7VA 4NRUA 4K2XA 4DF8A 3LO3A 3H0GA 5KFVA 2QGFB 2DNQA 2BOPA 1JLBA 2VNKA 1SL1A 1IS1A 1Q82T 3HKWA 4LMZA 3PUMA 1T9VA 4H4KC 4NX9A 1WG1A 4Y6IA 2CQHA 1BWEA 2B4UA 4MH8A 3UVJB 4QR2A 4LBZA 1Y1VC 2GSNA 3LP0A 4ZP9A 5FJ4A 4KJIA 1DTQB 1WACA 5ETKA 3KFWX 4P3IA 1PIEA 3WQZA 1H42A 3HD2A 4XPCA 3AFGA 3ONYA 4C3JC 4PXBA 3V81B 1S1XB 4RL1A 2VA3A 3TZXA 3OL9A 2COLA 2H54B 3P96A 1AMOA 1U2FA 1CNFA 1IHMA 2XYPB 4F04B 3FVYA 2V8GA 2OBTA 2JFDA 3DMJA 1WNEA 4V1Ak 1TAUA 1HQ2A 4BBRC 1JOEA 2WTFA 1YKWA 5K14B 4RW8B 2OAUA 3PW5A 4L73A 2PHCB 4A4JA 3MFHA 3MM5A 2YKPA 2JA5C 3H2VE 1D9DA 3V76A 4Z4ZA 3GIRA 3MEGA 2R92C 1SQEA 3HSJA 2N3LA 3C16A 4A8OA 5DS7A 3DLGA 2EG1A 4IDKB 3AA8A 1CQNA 7AT1B 2VDIA 1D09B 1E64A 2ZVSA 2CFAB 1JNYA 3I4NK 1R0BG 3CCES 5KW9A 1BLUA 1CC8A 3JQJA 3DI6B 3ZTPA 4J5OA 1EFTA 1VQNB 4YDDB 3I55S 2E2HK 1WOOA 3ASTA 4C3IK 5DZ7A 2MZSA 4ZHRB 5FLMK 4JMQA 3GQBA 2VF3A 2W4PA 2H1YA 4HI2A 3FSIA 1J2VA 4URSA 5T41A 4UUXA 2DO4A 3PJWA 5D4DA 5IOSA 2VUMK 3FHZA 3K5MA 3W2IA 2RF2B 3W2WA 2V2KA 1CJKA 1I6JA 1WORA 5HP1B 2CYYA 3FUYA 2RVJA 3HSGA 2HIYA 4L72B 3PW4A 3AOCA 2QA4G 2P3MA 2VIHA 3UNGC 2F4NA 3K7AK 4MKVA 4UZBA 1NSKL 1OYDA 1S6QB 1WJ9A 3WBZA 5HL8A 4CH0S 4XTTA 3GTGA 1UD2A 3LAMA 3GV7B 1JLEB 1VQLB 2GS8A 2MB0B 5K8PA 2QZ8A 4Y0FA 2WRMA 4KH1B 1OWXA 4CI0B 3CCUS 3U2QA 5KT6A 2W2PP 1JJ2R 2JEGA 1Q8LA 1I94J 4J9SA 5H9EJ 1JKHA 3CC2B 2JNJA 2HHUA 3OR2A 3CULA 2FDNA 3UDVA 3K57A 2ASDA 3DOLB 1YJWB 2DH9A 3A13A 4QR0A 1U26A 4L74A 3JSMB 2X6YA 3N6MA 2XLIA 3DLEA 2ZKUA 1CJVA 3CDEA 2B9EA 1C0TA 4JI5F 3NLCA 4DV0J 2BVNA 1UEVA 3K7RA 2D41A 4QOTA 5KSWB 3MR2A 1WTFA 4LBIA 3JSYA 3PO4A 4OYAA 4B3TF 3IR5B 1ZYRA 1M5PC 3W2GA 3LWMA 4KIAA 4A3KK 1A6LA 3AD8C 4O3OA 2K2PA 2PSZA 4WK1A 4RW6A 1MSWD 2I1RA 5EMNA 4PZVA 1MRZA 3IRXA 4CT9A 3EICA 1U25A 2GIQA 4P2NA 3OFGA 1BY9A 4U9RA 3V4IA 3R5DA 4P22A 3DC2A 3TUZC 2JL9A 5D4LA 2VBTA 1F93A 1ZH5A 3CJ0A 2BGJA 2DNNA 4M5IA 2EC2A 2C3PA 1R6YA 1RAAB 4XO0A 2PIAA 2RQKA 3UWTA 2ERRA 2VZ9A 3RB3A 3UR0A 4USUA 2HIQA 1E1RA 4FNHA 1BWVA 1J6WA 4B9TA 4QIWL 3OSPA 1S97A 3ENVA 4BHQA 1U0HA 1HNIB 1IKWA 3DRPB 2YKMA 2KVOA 1RAOA 1WDTA 2FVQA 4FPRA 5JVGQ 4ZLNA 2GJRA 2NS1B 2IMOA 1URNA 1FHTA 5F41A 3PW7A 1Q7YD 2B63K 1X9WA 1MMLA 2M9KA 5HJXA 1I18A 3CCJB 3R7SB 4GC7A 4USJC 4GO7X 5A89A 4K4TA 3TFIA 5J3OA 5KFQA 5E3PA 4RJLA 4X65F 3RR7A 5HLFA 3LP1A 3M2VB 2E9ZA 5IT0A 2XMAA 5TRDA 1BJKA 3BO2A 1JXVA 3HULA 3IBCB 3CCSS 2L3MA 2LA4A 4TY8A 4A8KA 1N56A 5FD1A 2GO9A 5KFFA 3I4HX 3GB0A 2QLJB 3NAHA 1CEZA 4PG5A 1FVQA 3MOZA 4XKVA 2FVGA 4PUOA 3VA7A 3MEEA 5TJ3A 1VC6A 4XIUA 3JU4A 1F7UA 3KJVA 1FXRA 2HRTA 3SDEB 5C42A 2MLYA 4X64J 2ZL7A 4LFAJ 1M1KD 3MEKA 5IYDK 1I6HK 2K8GA 4NCBA 4HL9A 5D78A 5H9FK 5HMXA 4USVA 4G1VA 5GAGI 4OINA 1TKXA 2Q6CA 3C2PA 4NXNJ 4X4NA 4AYBD 3HLUA 1OYEA 4BWMA 5FNZA 1SJRA 5LSOA 3ASQA 2CZ4A 5G0RB 3L9ZA 4G0UA 2CJBA 4YR3A 1FRNA 1HW9A 2VL1A 3U02A 4R8UB 1KONA 2MZRA 1K83A 3AQPA 1USOA 4J9MA 1FX2A 2VYQA 3P4UB 1MG7A 4A3IK 3ZBUA 1TMMA 3NEKA 3CQZK 3BN7A 4GQNA 1M5HA 3ICLA 3DDKA 4QQBA 8ATCB 3OT9A 3KHHA 3MM6B 3D0IE 3KMQA 4Z4VA 1FKPB 2E66A 1TZ0A 1VQ6S 2XNCA 1KN6A 5LSRA 4WF9Q 1KHWA 2O3DA 3W5HA 1SH0A 2C2KB 1T9UA 3NRBA 4JI2F 1HBMA 4P9SA 4NLDA 2W7PA 3A4TA 1N32F 3ISNC 2IFXA 2E5IA 3A8IA 1J27A 2NVYC 2QA1A 4YEAA 1WCMC 4HVZA 3GTJC 2VDHA 2WOMA 4RUBA 4N8NA 2YNIB 2NSBA 4B43A 2XYGB 1Y3JA 1WHXA 2V67A 1C1BA 4F50A 4YY3F 1N5VA 2MJNA 2QMWA 1UVIA 3W63A 3M8QB 4CQ1A 3NGUA 1TWCK 4OIQA 1WHVA 1HARA 1RA6A 3LF0A 3PTWA 1JJCB 4BLBA 1BQEA 3BQ0A 1Y1WC 3O1LA 2JA7C 2GZOA 2EFVA 1XR5A 2X6XA 5DM7Q 4OPSA 4HR2A 2J0XA 3CEDA 2FVRA 2Z2YB 3QWUA 2Z2ZA 4ZPCA 4LQ9A 1QVGB 5KG7A 3KG4A 3DM2A 3POTA 2E7WA 4ETXA 2JOQA 4Q44A 5BR8F 2M5SA 3HOXC 2Y8YA 2V34A 1FFWB 5KFEA 1H6KX 4RUAA 1Y00A 1GNKA 1V0EA 4X4VA 4LLGA 4OZNA 1HYSB 2P5MA 1W25A 3AH6A 2IRXA 2JRSA 3W9HA 5GAGU 2KT2A 1UZHA 5D4NA 5CD4H 4OIPA 1S1UB 2HNYB 3CCVB 4RW4B 2B0GA 5C3EK 1I50K 2AYMA 3CCTA 4L76A 2B7CA 4RU9A 1J6XA 4C98A 2ZH6A 2KRBA 2A6EA 5IP7K 4CO4A 3RBDA 2FJDB 3W60A 4TMWA 4B44A 4DFMA 4H4OA 3CW2A 3PZPA 1B70B 3B4MA 1X0PA 4MEYA 2CIMA 4G6VB 2CXEA 1ULRA 3BO4A 4IOCQ 2BUNA 3SYZA 2ALZA 1ZQ1C 3I56S 2DHHA 3GP9A 1NDKA 2QMUA 2VPZB 4KV8B 2JEIA 4I69A 1IL2A 3GZ7A 4I0WA 3H59A 4DR6F 4WJ3M 2FQOA 4OYXA 1NCLA 2RHSB 1FJ7A 2YY3A 2UUTA 3TFHA 4X4QA 1SC3B 4OYZA 4W90B 1L3UA 2RNEA 1TWGA 2PI5A 4AL7A 2YU9A 2X85A 1GAWA 3HFZB 2VD3A 5E5NA 4C45A 4AFFA 2PT0A 2AZ1A 3G71S 2BABA 1OQ6A 1TWFK 2AHOA 1OGIA 4DCOB 1N36J 1X8DA 3IAM9 3ASSA 4FN5A 3SKBA 1D8TA 2V4RA 2I5JB 4OHXA 4IRKA 5L1JA 2FY1A 3J7A1 3NCPA 4ROXA 3D0HE 1EAYC 4U7UK 2OHDA 1IQTA 1YQHA 2X1FA 4ILDA 5KOXA 3AVYA 5DRKA 2FZGB 3AB2B 4WYWA 4M63A 1UW4A 1PO6A 4EEYA 2AMCB 2FY8A 2IDEA 1PBUA 1BQNA 4OJHA 1K28D 5E33A 2QGGA 1GEHA 2CNOB 2CC2A 4ZVHA 1UMKA 1RHKB 1PAUB 4XN3A 2WJVA 3LPXA 4FZBA 4CLFA 2PA8D 4X06A 4KBIA 2DY1A 4IRCA 5AE1A 2NPIA 4X4PA 3DHWC 3SBMA 2MQQA 2ASLA 2EBGA 2W4DA 4M2LA 3SCIE 1EHWA 1CJTB 3D1QA 4PWDA 3UDLA 1FTCA 3NBPA 3D3BJ 1NUEA 3OVSA 3FSYA 1FJEB 4LFCJ 3V4MA 1ZS6A 5IT9U 1EETB 1R43A 2CKWA 2OPSB 3T1AA 1TL5A 2XSJB 5HVHA 1RAIB 2EW9A 3TP2A 1NKCA 4Q43A 4ER8A 4IRDA 1N5YA 1RBOB 1FTRA 1JK9B 5F0UA 2OPQA 2VBWA
chains in the Genus database with same CATH topology
2GAHC 3TTGA 3TFHA 2GAGC 1XZQB 4P9SA 3GEHA 1WORA 1WSRA 3TFIA 1XZPA 3ADAC 1WOOA 3AD8C 3A8IA 3GEIA 1WSVA 3TFJA 3GSIA 5L46A 1YX2A 3GIRA 1V5VA 3A8KA 4PAAA 1XZPB 3A8JA 1PJ6A 3GEEA 4PABA 1VRQC 1PJ5A 3AD7C 1WOPA 1XZQA 1X31C 1NRKA