1GAQA

Crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
296
structure length
296
Chain Sequence
ESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
total genus 81
structure length 296
sequence length 296
chains with identical sequence C
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gaqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gaqA02
4TMVA 4B47A 1VQ4B 4MYUA 4Q7JB 1KQSB 3QSYA 3OZUA 4F7DA 1G7TA 1M1KD 1VQ5B 1R5OA 1VQKB 2OTLB 4ACAA 4ZGQB 1QVFB 3AGQA 3CCEB 2XNCA 4G1BA 1VQ8B 4LBVA 2OTJB 1JJ2B 1EFTA 2BM0A 1E63A 1VQPB 3CCMB 2B7BA 1K73D 2QTLA 3OZWA 1IJEA 1DDIA 4RCZA 4ZGNB 1Q81D 3CXCB 1EXMA 1GJRA 4ZCMA 2DEUA 3A1FA 3OJWA 3AVVA 3AVTA 1W35A 1VQ6B 1JNYA 4FK8A 4ZCLA 2VNIA 4P3YA 2NPFA 1A8PA 2E1RA 2YWFA 4Y9UA 4K1XA 4IW3B 1FNBA 1HA3A 4ZCIA 1GR1A 2BN4A 1YIJB 3WXMA 4ZV4A 3P27A 1Q86D 3CC7B 4M0LA 3CRZA 1KK0A 3CCQB 3MMPA 3QFSA 4RD4A 1XE1A 3AVUA 2VNKA 4M53A 3CMAB 5HXBA 1W2BB 1TLLA 1CNFA 2VZLA 3JQPA 4FN5A 1G7CA 2CNDA 2DCUA 2QEXB 1R5NA 2BM1A 5JBQA 1G7SA 4C43A 3SJZA 3ZZTA 1W34A 1ZM3A 2FX3A 3WNCA 1H42A 1NJID 3VO2A 4YAOA 1BQEA 4YHBA 3VNVA 1QH0A 4Y9RA 1IB0A 4LBZA 3AGPA 1JA0A 1Q7YD 1N0VC 3FPKA 3QFCA 4YAWA 4B4DA 3E1YE 1S0UA 1ZUNB 1KJZA 1VQMB 3CC2B 1F60A 4RD3A 3CCVB 1I7PA 3AVYA 3V76A 1W87A 5KSWB 4YAUA 1B23P 1DARA 1D1NA 4PC1A 3LRXA 4EH1A 4BPRA 2XNJA 3CCUB 1G7RA 2GQFA 2D74A 3QE2A 3VMFA 4TMTA 4RD1A 1QFJA 3LYUA 1BX1A 4NCNA 1FDRA 4M4SA 3JQQA 1FNMA 2GPJA 3MHPA 2VNJA 1YJ9B 1IJFA 3W2HA 2C77A 3WNBA 2PIAA 1ZM4A 1EP3B 4H9GA 4PC2A 3OW2B 2DY1A 2EFGA 1YI2B 1EFUA 1WDTA 4NBSA 3LO8A 4UAJA 1QFZA 3W5VA 1N0UA 2BMWA 3WY9A 3VO1A 3G4SB 1TVCA 1JB9A 5EMNA 4LC0A 4DQLA 3ES9A 1M90D 2HCJB 1KTVA 3LVBA 1QGAA 1S72B 1QVGB 2YWHA 4PC6A 1QG0A 1YHQB 4PGOA 1XB2A 1KD1D 1E62A 4AF6A 3W2EA 1DG1G 3U2QA 2QDXA 1Q82D 1QFYA 1UMKA 3AVWA 2BV3A 3CB4A 1KRHA 2B5OA 2YWGA 1OB5A 3I1FA 3I55B 2C78A 5TR9A 4AF7A 1QX4A 1YJWB 2QA4B 1E64A 2AHOA 2OK7A 3G71B 2XEXA 4N3GA 2ZITA 4RCYA 2DETA 2YWEA 4M2LA 5AN9A 1OGIA 5THXA 3CCJB 1R5BA 1SKQA 3W2IA 5GV8A 4B44A 4C0SA 3W2GA 1F20A 3WYAA 5GV7A 5H5JA 1OGJA 3VNUA 1VQ7B 4YAFA 3FJOA 1CNEA 1QGYA 1D8TA 2RC5A 1VQLB 3OZVA 3J81k 2BGJA 2DERA 1EP2B 4PC3A 1GO2A 2VNHA 1EWYA 4QFMA 3U6BA 1DDGA 2BSAA 1KK2A 5DSZA 1QUEA 4RD2A 2B7CA 2X3UA 4QHYA 3CCSB 1EP1B 1K9MD 1N8RD 2RC6A 2BF4A 3ZBTA 2VYQA 3CD6B 1GVHA 2PLFA 4ACBA 4P6VF 3WNDA 1AMOA 3CMEB 4M1KA 4B48A 1JA1A 1FRQA 2OK8A 1BX0A 3G6EB 2BPOA 4N3NA 3PENA 1EFCA 3MCAA 4B3XA 1VQOB 3E20A 3ZZ0A 3W5HA 4YALA 1D2EA 1H85A 3CW2A 4RD0A 1U2RA 2BVNA 1OB2A 4RJLA 4WQMA 2R6HA 1KC8D 3CCRB 4B43A 1GAQA 3QFRA 3ZC3A 2QMUA 3CC4B 1KK3A 3CCLB 2BGIA 5TY0A 2PMDA 4HE5A 1ZM9A 1FNDA 1TTTA 4Y7CA 1FRNA 4TN1A 1K8AD 2HMAA 3WBKA 1CQXA 3JQRA 4J0QA 3B82A 1TUIA 3U6KA 1J9ZA 1FNCA 1ZM2A 4TMWA 3B8HA 4HE6A 1VQ9B 4LBYA 3W2FA 1GAWA 3ZZUA 3QFTA 2J7KA 3B78A 2HDNB 4DQKA 2CRVA 5TV2A 1QGZA 4PC7A 3W5UA 5FA6A 4LBWA 1B2RA 4TMZA 1KK1A 2QTZA 3I56B 1AIPA 4TMXA 4AC9A 2QN6A 3WBJA 3ZBUA 4MYTA 3CPWB 3OJXA 1BJKA 3AVXA 1YJNB 4G5GA 4FWTA 3P26A 1SM4A 1YITB 1NDHA 5H59A 1QUFA 1ELOA 4RD6A 4G1VA 4R71A 2EIXA 4U9UA 1VQNB
chains in the Genus database with same CATH superfamily
3EVAA 3WK5A 1O97C 2FSVA 3OTIA 4I14A 3PC3A 2VP6A 2AC4A 2QQGA 3AF1A 5IARA 5JTUA 1JSCA 3KSAC 3A11A 2SKEA 1Z5VA 4K9NA 3U60B 4FFSA 1GTZA 4XB2A 3SJCA 1XHFA 5K0TA 3QPAA 1G6KA 1Z2CA 4KSCA 5EUCA 1C0IA 3UPUA 4L8VA 2B1GA 2QA5A 4H27A 2FUCA 1MOZA 2X8BA 4INJA 2WVAA 4KIUA 221PA 4LW8A 4DABA 2HCTA 4LZPA 4HNSA 4TQGA 3OKPA 5LWHA 4FNAA 4R7ZA 1T5LA 1K88A 3FPJA 1GQOA 4OJMX 4GEKA 5JNWA 3QY0A 4LRYA 2V65A 2WT4A 2Y0BA 1GTMA 4YJ2A 2AMYA 1HT2E 4OSOA 4YRAA 2Q27A 2IFTA 3Q1KA 4KQ1A 2XNCA 4MEJA 2B6HA 1VQ8B 5HPYB 1D2RA 3NETA 3V4RA 3SQLA 1E2PA 1FSZA 2ZIXB 4OJTA 3ZQJA 1RU3A 1VQPB 1IQRA 4L72A 4NATA 4DAOA 3LC0A 4K2HA 4HQNA 2WWHA 2EX1A 2QRGA 3H2YA 3WLQA 3C7KA 4BNFA 3BIWA 1E1YA 5DBHX 4WZBA 1UM9B 2ZAYA 5JSUA 1VSBA 3MWDB 2CUNA 4I9HA 2DEUA 1P7YA 1B93A 1BRMA 1BS1A 1C30A 2I3BA 3E27A 3PGMA 1NM5C 4G5XA 2W11A 4MJ7A 3PHLA 3PVSA 4E12A 1I7SB 1ZNZA 1EDBA 2VBIA 4AY3A 3S81A 1YMUA 4BVBA 4WKPA 2HWXA 1BWPA 4KMRA 3V1KA 1GPLA 1OFGA 1YI1A 1OXUA 1YRWA 3R09A 4E03A 1WOOA 4IM7A 2DLDA 4MDHA 2O54A 5DX1A 1LRKA 1YDHA 2C3YA 3JZMA 4TLDA 2BTQA 3TI9A 1UBJS 2GFHA 1H2WA 3PTAA 5KC8A 3P9SA 1FNBA 1P7VA 1VHLA 4JSRA 4C6RA 2VH2A 4KE8A 4NHEA 1OZGA 3PQEA 2BN4A 3SYMA 4Z3KA 3I64A 1P4SA 2BEJA 5B1IA 4QTUB 1Z0JA 3IH5A 2H52A 5IVIA 2VJBA 3MIZA 1PQWA 4RV4A 5BMVA 1H4SA 3NH9A 5HG0A 3QX8A 4RK1A 4E08A 2BR4A 2QHXA 2V96A 3JQGA 3AI3A 3G85A 5HZMA 1QOZA 3LZDA 3Q2KA 4IXNA 3LHFA 4HAYA 1XJQA 3L07A 4LV6A 5EE3A 2ZXEA 1Q9SA 3FYSA 5BW4A 1R6VA 3ML1A 1W2GA 3PBKA 4MS1B 4WXMA 2O3SA 3HCBA 3LUAA 5F12A 3ZWDA 1GCOA 4R40A 4RA9B 4AJIA 1YMQA 3LTEA 1U7TA 2ZSBA 2AT1A 3PXBA 4FHDA 3BBPA 1DBPA 1NXWA 1TLLA 4D96A 3R23A 1A82A 5KTTA 2VZLA 4WCFA 1CFJA 2I1QA 1YB5A 3AVPA 4YCJA 2OORA 2QIPA 3EX7C 1EFVA 3EZ9A 1X7ZA 5TDHA 3WGNA 3ME5A 1FFEA 4PRYA 4G0OA 3MM4A 3CPJB 3LGXA 4YI5A 3QF4B 3A6JA 3AUKA 3EARA 4URYR 5E6RA 1CK4A 3BXGA 4GPTA 5TPWB 4DBZA 2NYAA 3O3NB 1WF3A 2VQ6A 4EHFA 4C29A 4JL6A 1C3LA 1W44A 1V3TA 4DQVA 1V1RA 2EFJA 3BIFA 2HV9A 3LH5A 4MP8A 1H65A 3DZHA 1Z18A 1DRJA 4XQFA 1O5OA 2FPIB 2V98A 3Q41A 2VDUE 2X6QA 3EMVA 4L0MA 2Q29A 4G41A 4WKNA 4ZC1A 3WGLA 3RSLA 4JSYA 1FJ2A 1A27A 4TV9B 3S8MA 3NXSA 4YDSA 4ZZ0A 2OBTA 3JAWB 1TF2A 3DGEC 3HO6A 2ST1A 1F6DA 4C08A 3AJDA 4Y2RA 1U9IC 5IPFA 3PXAA 5C31A 1H42A 2GJ4A 3K1AA 1B7GO 4HGOA 4ZT6A 1LQTA 3UJ7A 1KWGA 5JI3E 3WA6A 2IIPA 5DYGA 3RU3A 2GXSA 4LCEA 2WJWA 1DIGA 1W9HA 4Q4JA 3HU1A 4QLAA 5DHFA 4LJ9A 3SHQA 3LLCA 4QARA 3PDIB 1D2CA 2YC4C 1FXUA 1UEJA 3A4VA 4W9MC 4PLWA 1JFRA 2B20A 1CUJA 1VLJA 2C54A 3H8SA 2DUMA 4CNQA 3AM1A 1DWUA 5TF0A 2QN8A 4QVAA 2H4FA 3EOAI 1L7AA 2NVBA 2CNNA 4FR0A 4IUDS 2G1AA 2NV0A 4JBLA 4QFCA 1LSUA 1NF8A 2PKCA 5AW5A 2HCFA 5NULA 1NNLA 1F48A 1T2EA 3TJZA 4E5VA 2IYLD 5K3OA 1Z75A 5F2EA 4R01A 2CFTA 1MA0A 2WPDD 1GKYA 4KKVA 2VR1A 5DXAA 5KHOC 3ZGOA 3NNNA 2KX7A 5AFSA 2HNBA 4CM8B 5A4JA 5J4KA 5T67A 5GM1A 3PEUA 4X1IB 3C6BA 5AVUA 1ISJA 4D80A 4UQLA 2JLSA 4EDFA 2PKYX 2FWIA 3GLHE 4MUEA 3SM3A 1M1YE 3LRTA 2C4VA 2GPYA 3CVXA 3E58A 2GBPA 5G2OA 2B3TA 1VMKA 4G26A 4PZ9A 5TQ2A 4OI1A 4DLBA 5DSTA 3JQFC 2H57A 2UVDA 5AJUA 1NUUA 1MQ9A 5JOQA 1JYEA 3KXDA 5F3WB 5M3BA 2Y8EA 3A3OA 3NYWA 1PKEA 2QW0X 3VV3A 2DWCA 3FGNA 4YRBA 1ZOOA 2AMVA 5DOVA 3T1NA 4E4TA 3DHNA 3KSUA 3TO5A 5I47A 2OHVA 2QTGA 3ZVRA 4QJIA 4W8OA 3KLBA 2CF5A 5JATA 1JFFA 4BYMA 1XNRB 1QYWA 3KR1A 4GSKA 3T5CA 3IQHX 4KFSA 1U98A 1M66A 1WWKA 1VI6A 3W9UA 4EPXA 1JLLB 2Q46A 3BMQA 3IO3A 1CULC 4PQEA 2WWGA 4B7XA 2NTYC 1G5PA 4EBBA 1G291 3L43A 3ORRA 1QSGA 2IIVA 2H6EA 3PGKA 1JXQA 3M81A 4DILA 1E1DA 3OKAA 4GLLA 4Q4AA 2J0UA 1M2NA 3SLKA 4LDQA 3N39C 2GT1A 3NHAA 1RQLA 3H94A 1ONOA 2EFGA 1KOFA 1S8AA 3DV9A 3PLRA 3ZIAD 5DYNA 3R8CA 1ZLYA 5CVCA 1RPTA 4RDJA 2OD2A 4FSHA 4GYYA 3Q5EA 4O33A 3THOA 1KI6A 2FN4A 3CH7A 5HK9A 3HI6A 5E1OA 1E5DA 2H31A 4GLOA 2DPHA 3Q3VA 1GCIA 4PQFA 2YCLA 1P6QA 1CVLA 1GV0A 1Q3TA 5HM6A 2XMGA 3GJZA 5KSZA 1HOXA 4HS4A 4FP9A 3BA1A 4JVNA 3WYEA 4UTRA 1UPCA 2A7XA 5DK4A 2I78A 4A2WA 3GNQA 1OSNA 4A23A 2XNKA 3KKLA 1K3UB 1U9JA 1JVNA 5J5VA 3VDQA 1H69A 1HMPA 3FPHA 3CE9A 4GLFA 4UHFA 4B4WA 1WDKA 3FYHA 3X1XA 4DQUA 1FYXA 2VDWB 2ZROA 4GNRA 4CN9A 3FGPA 1PDWA 2GLTA 5K3DA 3ETDA 4F60A 4U9HS 4YRSA 4UM9B 1OZFA 3WQHA 4FEEA 2VQEB 3C3WA 1QTRA 1WHSA 1WV1A 3A31A 2DBRA 3VOAA 2HXSA 1K3FA 3BK2A 2NYVA 4BEBA 4EYQA 5BPFA 2J4FA 3F78A 2YOHA 4LN1A 4MVCA 3RVMA 3T9FA 2J6CA 2YWDA 4JH0A 4B7AA 1VIVA 1RWOA 4ZCSA 1GZ4A 1L4GA 4WUTA 2YV3A 4KYVA 4YWJA 5B57C 1M72A 2O8VA 3EAQA 2GZDA 3RABA 5MN6A 2V45A 1CQIA 1DEHA 3DBLB 3IP9A 3V3KA 1YVUA 2IYWA 2OTCA 3AKZA 3DWIA 3ISTA 3BWXA 1RABA 4AF7A 5H3LA 4EHIA 4WV3A 3HKBA 1ECCA 2FLKA 4NE9A 1NKSA 5AK4A 3AKEA 5JZMA 4ALMA 1B1AA 3SC6A 3RIGA 1YDEA 3TYXA 2VWQA 4AT1A 5EJ9A 2IBTA 1UDBA 3LBAA 1EVYA 2IZ6A 2DYIA 3KXPA 3M4ZA 4C4ZA 4E09A 1VLYA 1SD5A 2PG3A 1S3FA 4H7HA 5ALHA 2E7ZA 3G7SA 3JVVA 4KJXA 5C4MA 3C3KA 3HVIA 4O8ZA 4JFAA 1JHQA 1YL6A 3FETA 3QENA 3TVYA 1XZPA 5E7MA 2DETA 1E7SA 1LSJA 4FFRA 2D7JA 2QYHA 4JC8A 1X3SA 3GRUA 4RQAA 4V0KA 3KOYA 3U0BA 2EL9A 1R37A 3GH1A 5CVVA 3SSAA 3AY7A 5F77A 3NDBB 1BC5A 3F47A 3ZJTA 4MR7B 3CZRA 4CFSA 3W2GA 1U63A 1DOAA 1LVGA 5C8DA 4AY2A 1GG8A 1UKAA 4PWZA 2JCXA 2XR1A 4P4SA 1UM8A 2QVCA 5IYWA 1GKLA 1FMLA 5ALVA 1VDZA 2BONA 4YDQA 1QHHA 1AXEA 3ZDDA 2P3LA 2PSEA 1OGJA 3OTGA 3HJCA 1SXJA 3HN2A 4RKWA 2WFLA 1KMNA 2ZWOA 5ILQA 3TL2A 4M8IA 3RAEC 3W34A 3DD5A 4RORA 1UAYA 1LY1A 3PNOA 1XRNA 2IYYA 3NHJA 3H2ZA 2C8VA 2WZCA 1B2LA 4US2R 1E43A 1OAOA 3VUEA 3FG9A 3K4PA 4W9NC 3KPVA 2MMGA 4C5AA 3T7AA 3SMVA 5K2OA 4BATA 1H1LB 2JCSA 2WVGA 1SA0A 1R0ZA 1LJ8A 3TINA 3WO0A 2GN9A 1XEXB 4MA5A 1GO2A 3DMGA 1ESEA 1UUFA 2EF1A 4A9AA 1RC0A 4DIEA 5I7WA 4X06A 3K70D 2UXCB 4EP1A 2BUAA 2PH5A 3U6BA 1LNZA 4BPBA 2GPAA 4ZI5A 8AT1A 4C2UA 2GJSA 4YY3B 1XN4A 5DSZA 2CJPA 2EWMA 3BK7A 3G8DA 2C7PA 1V0FA 5JSZA 2I34A 1MQAA 5TQVA 4B3CA 1PZGA 1A2KC 4JT9A 4QBFA 3CQ9A 1K6JA 4RXTA 1HQDA 4WDRA 5EIWA 4LGMA 5FOVA 2GFQA 4ENRA 2H2FA 1QYRA 2VTDA 4OHUA 1XDGA 5C2JB 3JR7A 2Z4SA 1PJ2A 4G37A 1XLUA 1Y9EA 4GZLA 4E2YA 4F1JA 3M0EA 1QV6A 2HSGA 1DBIA 3TRKA 4QPPA 1KDVA 3ZBTA 3EIFA 3K8OE 4OP7A 2BBOA 3L1KA 1Q22A 3N2LA 4P6VF 1SVSA 1FXWA 1YHYA 3OPOA 2EG5A 3I5UA 3STVA 1E0SA 2W00A 4YR7A 2WYRA 4HDRA 4HEQA 3OECA 3FZQA 4CMGA 2EZUA 4PAGA 3CMEB 3ABZA 1JZTA 4ZKDA 3WAGA 1U5AA 2YWBA 4KQWA 3V32A 2SECE 1T25A 1HE5A 3DXZA 4YRJA 3TTSA 3TQIA 3IALA 1E32A 4RUKA 5HF6A 2WYVA 4HMOA 3EIEA 1N2CE 4HXEB 1C0KA 1KU6A 3WISA 3ZPXA 3D4OA 4J2OA 1T6XA 5K7SA 1P4HA 1PJ6A 3FROA 3FBTA 3ZZ0A 3ZHUA 2X8KA 1E9DA 5KNDH 3G79A 3GV0A 5CNKA 3B7PA 4UBLA 3KRTA 3OOCA 3EF1A 5I7SA 1O5IA 1P9OA 4TLEA 4TLCA 1TLTA 4DJFC 5J5AA 3TGLA 2Z5LA 1OVGA 2GBFA 1XUOA 1K4YA 1K7FB 3VTKA 4G1MB 3ANYB 4GEGA 3A1CA 5A4KA 4E32A 1Y3AA 3E53A 2JFUA 1KC8D 3ACCA 4L8YA 5DPMA 3WB9A 4H6PA 4N01A 1E6EA 1O1YA 3O4GA 3OT1B 4Q66C 1DOHA 4YJDA 1QYCA 4TTJA 4NABA 2HCBA 2YC2C 2PZMA 2NU9B 5AKLA 1XD2B 2G80A 2OG1A 2DKFA 1SQGA 2B21A 3EISA 3LQEA 2IBMA 2UZ0A 2WU0A 3OZDA 4Q21A 4BIMA 4BEWA 4UPEA 4DC0A 2ZPUA 3GDFA 4EZEA 3PQ3A 1LI4A 1K8AD 4UHJA 2HMAA 1J22A 2ILVA 2HU5A 3MJFA 3LTNC 1H8HD 1RYBA 2ID8A 2Q3BA 2ZSAA 4JOCA 1PGQA 4BV9A 3RC8A 3T41A 4JYMA 2I6SA 3AHCA 3QPUA 4XJVA 1E77A 2I3ZA 5JZSA 1C7EA 4IH4A 4GF5A 4B3SB 1VQ9B 4GSLA 4TVSA 2DUWA 3CLUC 3E15A 5FTNA 4UTNA 4GZMA 4UFOA 4U0KA 3JYOA 4QDOA 2OKCA 3HSYA 2QPLA 3PNQA 4BWVA 1JWLA 4XM3A 3VH2A 3WVNA 3OP4A 4FBMA 3GROA 1UJ2A 3E5MA 3MRVA 4HN2A 4MW2A 3U80A 4DXAA 1JIJA 1VHEA 3WZMA 3TE7A 3GRZA 1VG0B 4R9NA 3RT7A 1JFVA 4N03A 3NYRA 2HMYB 5BQPA 4HWKA 1WBJB 2JS7A 4O1MA 2P2DA 5A7HA 5A1JA 1S2LA 5K0GA 3BWYA 4ZREA 5K0NA 1KARA 1HPLA 2G7MC 3BQ9A 3R4CA 1BE1A 2VTEA 1GDHA 4YRGA 1YIDA 1Z2NX 1LPAB 1VFNA 4N8DA 4DJDC 4EA9A 3T6KA 2GJPA 4JNKA 4ZAYA 1QNLA 4K26A 4NFHA 1K92A 2GCOB 4QPCA 3GLVA 4WJZA 3NATA 3QEBZ 3LHIA 2BJWA 5ELXA 1J21A 4EY5A 3R0VA 1QMPA 3LCVB 1DP4A 4KH1A 3NIWA 1QB7A 4WNYA 1SM4A 5GAJA 4CG1A 3FWYA 1VIYA 4BQOA 2ZUTA 1E6LA 3GEPA 4MH0R 1WUHS 4N49A 5AVWA 1W6UA 1YJ8A 4QPNA 3ZH2A 3PGJA 4P34A 1TAQA 3KK0A 2G5GX 3MBOA 1ZR4A 1HYEA 2P69A 4ITUA 1HNXB 3GVHA 2HSZA 5EPOA 1CJVC 4O4IB 5FUVA 3QLUA 2DLCX 2P11A 2DU8A 4XAQA 1NFQA 2FFRA 3BEOA 4J75A 3CURA 2JZOA 5J2TA 1QCCA 3EVNA 3D3QA 3HRKA 2M1ZA 5KYKA 2YL2A 3R5JA 3RTAA 2R1TB 1A76A 3KZOA 1DV1A 1XDZA 2YUTA 4OXNA 3VDMA 3VNSA 5B2EA 1KMCA 2J6HA 3F98A 3LT5A 4DCGA 2H1RA 3MUEA 1MIOA 5KYXB 1NOJA 2VSYA 4YONB 3CKMA 2FVYA 1U7OA 5BN4A 5I7AA 2EATA 2FSFA 1U94A 2JFQA 3KE8A 5CPBA 4EF5A 5I5GA 3SOPA 1A9XA 1SVWA 2REBA 5JALA 4GE3A 2ZRHA 3G0CA 4RETA 1M6NA 4YELA 2P30A 3UT6A 2IS6A 2R7LA 4O0MA 4LBVA 1RXYA 2ZSHA 3CUKA 1W25A 2RB5A 3Q87B 1T4GA 3OMXA 4J1QA 4MW4A 3TBHA 4ER6A 4XDHA 4TTSA 1L5RA 5EXTA 1E63A 3NTQA 4QYSA 1YZ3A 2B7BA 2C9DA 1R9MA 2GYUA 1HDOA 1N9GB 2VDPB 1P0IA 2FA9A 2R1VA 3VKUA 4PG4A 4PYJA 1V7PC 1QTQA 2WG0A 3GLHB 5AXCA 3X1ZA 1M1YB 3JU3A 3O1HB 2ZM6B 2X7JA 2P5SA 3VR2A 2PZ8A 4FHFA 3B60A 2PU5A 2BDUA 3U81A 1TW3A 3H17A 2C2GA 2IYTA 2FW1A 2VBTA 4HV4A 1U0EA 3FVTA 3NDJA 2EGHA 2XUKA 2FSHA 2FXVA 4UUMA 2PUVA 4G1EB 4IDQA 4FCWA 3PDUA 2WOOA 1VBMA 3PDJA 4IHJB 3VPGA 1Z8FA 4C6SA 3CTMA 4LFCB 3F73A 1KH3A 1KETA 1ZA1A 2ABWA 2IHBA 1F0KA 3NEYA 1AHHA 1SGWA 3ORQA 3C2QA 4R68A 4RSGA 4KUHA 3L6EA 2RG1A 3PD7A 2IHVA 4ZAWA 3LL4A 5DHTA 1IG3A 1V4NA 1P61B 3H65A 4NZOA 4U9IS 4YRCA 1TUBB 4CKYA 3WRXA 1YIOA 3H7AA 3C7CB 1KDYA 2EDAA 3B36A 5C1PA 1NU8A 4CL8A 3K5WA 4DG8A 4L6IA 5L3VA 2D2IA 5B3KA 1BAPA 2C3OA 2KBFA 1PTJC 3OSUA 3Q8WA 4UNIA 4D9GA 4KXVA 4Q9AA 4ZHQB 3QK7A 5CLGA 4DIOA 1AZLA 3NNSA 2GPTA 4FQ8A 4LMBA 4QC2A 5CX1A 4FFPA 3O73A 3DUFA 5F5LA 3AZPA 4Z7OB 2AJCA 3QYJA 5C5CA 2FVGA 5AVXA 2AWNA 3GOHA 1PUXA 1QAMA 4HC4A 4LTNA 1CNFA 3K7EA 2OBYA 3R3VA 3GFRA 5B64A 3JQPA 3A9RA 1BYIA 3LIPA 4YO7A 2F1JA 3JVUA 4KITB 1ZPDA 4M1MA 2OCBA 2QD5A 2EL7A 4P12A 3CH5A 1OX6A 1T1RA 1JHRA 1EB8A 4F2PA 1BTOA 1JG7A 4KI0A 3HVHA 3ZBPA 4QGBA 5GGYA 5CFOA 1XYGA 2AK3A 2Y1WA 1M74A 2F17A 2VDLB 3QBJA 4M83A 4TLMB 5EUMA 1IZ9A 3I2FA 3E8SA 1DIAA 4AKIA 3IDFA 1E2DA 5DN6D 3A36A 1PSWA 1XU9A 1Z36A 2RJ3A 4WOPA 3TEJA 2TYSB 3LSTA 4Y3UA 4HWGA 4RPDA 4AO6A 2W2NA 3C8MA 3JRXA 3AVOA 4B32A 1NJID 3QU7A 4MRVA 1TNDA 4A36A 5E9WA 4NR0A 3NWPA 5D5PA 5FPSA 2X9QA 3WA7A 4EQ6B 1AGNA 2OHHA 2QU7A 5HP4A 1P2FA 1RW4A 4Y9RA 2O2IA 4IWXA 1VQ1A 3TKAA 1HX7A 4UEKA 2Y93A 1XI2A 3DM9B 5JXWA 2X2EA 3EA0A 4EG4A 5HOQA 1Q7YD 2FWJA 3QFCA 4M87A 3ZNOA 4YGXB 3FPBA 1QHFA 3E1YE 1OWNA 1A4IA 4ETMA 5B5SA 3THXA 3RBZA 2Z2ZA 1LX7A 1Y1KE 1U7PA 1U0FA 3A25A 2OSVA 2BLLA 3AJRA 3B5EA 3F6BX 3LG2A 1JDSA 3LP5A 4MVXA 4V24A 4ZO6A 3I01M 1PNVA 2ZBVA 2O4UX 1MPTA 2LZJA 4FMCF 3IT0A 4X64B 3NHFA 3WGIA 1M2WA 2V8OA 1OLXA 4Q48A 2YV5A 4U63A 3C1OA 3D54D 3M9WA 3PR1A 3HYCA 5EZSA 3RHSA 1C0EA 3QVGA 1XELA 4RMHA 1IXZA 2Q5LA 3G5AA 5CGQB 4WADA 1M0EA 1SPBS 3QJYA 5IJXA 5H3CA 3G2PA 2PRIA 2P78A 4MVJI 1U2DA 3OICA 2FGKA 2ZUSA 1LK5A 4J3JA 3ZE7A 4RH3A 1NPDA 1ZS9A 1JHAA 4L7VA 4MUKA 5ED4A 3CCUB 1W5SA 2ZRNA 1RKUA 4HK4A 4GZ5A 4OGLA 4R1UA 4RGQA 4XM2A 2O7QA 2G77B 3TZKA 3VTFA 3WYCA 1S1MA 3LLUA 3PZRA 3T4EA 1J2EA 4DEYA 1JIIA 2ZBEA 3SE7A 1KJJA 5ALSA 3TSOA 3T5BA 3HXKA 2Y27A 4E5PA 4K2AA 1ZM7A 3QVWA 1M83A 2IZ0A 5KYVA 1WO8A 3I9KA 3Q9SA 4F9GA 3JQQA 4PV7A 4WEOA 5IAEA 3LFHA 3TSAA 1US8B 2Q3LA 1EFRA 4OKNA 3TFWA 1DLIA 1XAJA 1EGHA 1VL0A 2ZJ7A 1X1AA 2VYCA 3EGDA 4IIJF 4DGSA 1NR7A 3F5DA 1RWWA 3H1EA 2OO5A 2ZJ1A 4LXQA 3HWRA 1HURA 5FUWA 1WDLA 1E7YA 1QLJA 2Q4DA 4PC2A 3F46A 1H2XA 2KSQA 1C7IA 4Q12A 2HXGA 1FDWA 3L8DA 4CQNA 1KMIY 2W2TA 1DS6A 2XNDD 4I3HA 4JYPA 3IUQA 1P4AA 3Q6MA 3HDYA 4MYSA 2JVIA 1BH2A 4C0BA 3K5PA 4DTIA 5IYNA 3G8CA 4GRIA 4OD0A 2IKQA 2I6FA 4PNZA 3O8CA 2CJWA 2GBIA 2HI0A 2B8NA 2P5YA 4GWLA 2P67A 2QTAA 4JP8A 1YB4A 3FTEA 3HS3A 1U8ZA 1XEWY 2GVZC 2ODBA 4LMPA 4YAJA 1F0YA 2I66A 3D6UA 3LPCA 4IO1A 5DK6A 4ZQCB 3U7RA 3DFUA 5DMHA 5E6SB 4D6YA 3K94A 3FPPA 1HDZA 2IS1A 2N3ZA 2VNAA 3P8ZA 3UC5A 3QU4A 2PS1A 3TEMA 3NIBA 2Q3DA 1CD5A 2PSHA 3K70B 2HMTA 5IDVA 2I7CA 1C9KA 2ZWVA 1JTFA 3IUMA 4Z4FA 4D0LB 1UR5A 2R25B 2V9ZA 4DSTA 3I83A 1CR0A 3U4DA 2OBMA 1N2CB 2HNKA 2QU8A 1LBSA 2OV8A 1E59A 4HXFB 5C1OA 4QYIB 4JBNA 1GEEA 2RGXA 3HMQA 3TI7A 5JIBA 3V6MA 3NEJA 4NYIQ 1T2AA 3AW8A 2GNOA 2X41A 4HGYA 4EF4A 1C4XA 4YJGB 5DYIA 3P2OA 4IIHA 4J7UA 1IJBA 4WOKA 3WL6A 1WEHA 3DG9A 2X53S 2H1LA 1LTKA 5EKDA 3KLPX 2AFIA 1IC6A 3L0PA 2ZXFA 2POCA 4ENTA 5AK0A 1KKLA 1NBAA 3IDOA 1U8XX 5INTA 4OPVA 4Y30A 5KOHB 1YVPA 2ATIA 1LFAA 3EIWA 2ZZQA 1UBTS 1BMFA 3DEIA 3FMOB 4LKRA 1G2PA 3UH1A 4X8MA 1F2TA 4K81B 1F8XA 4LNUA 4M89A 2R2GA 2YXDA 3FMPB 3O1LA 4J91A 2LKDA 4NAVA 4BNXA 3FF1A 2IYVA 2OR3A 3A04A 1AXGA 3GAMA 2OVFA 4RCYA 2EWWA 4MKFA 4AG3A 2XQVA 2QP4A 1PKXA 1IHOA 5F64A 2IRWA 3WAKA 4DCSA 5AVSA 3MUFA 1T0IA 4TTTS 4B44A 4QAJA 4D56A 4R51A 4L5CA 2B6NA 3WYAA 4KBFA 4I50A 4ZKEA 1XDWA 1OXVA 3CNNA 3RUIA 5J2TF 1T36A 3FMGA 2BZ1A 2I7XA 2IUEA 3A6ZA 4QBGB 2Q2NA 4CRWB 4LZLA 4IS3A 3GEBA 3B89A 3VH1A 1CUZA 3JQAD 2QN2A 3GEDA 1G8MA 2P2CA 3BN3A 3A8IA 1VE5A 2G40A 4P26A 1QIEA 2G63A 2HQBA 4R1NA 1JSRA 4IVPA 1WBDA 3SZUA 3E9CA 1QZTA 5C5IA 2PLRA 2CVFA 2Y2UA 4EGJA 5FTMA 1COWD 4I4NA 1I94B 9MHTA 1DZ3A 1ORVA 3GDGA 3HM2A 4URXR 1KY2A 3OFSA 4FGWA 3CLTC 5CFMA 2GBCA 4S1TA 4Q1EA 3D6NB 3N2ZB 1EUCA 1UOPA 4P36A 3BZWA 4IG4A 2FMFA 2FQWA 1H23A 2JFOA 2VZ8A 1KO4A 4MO2A 2A57A 3K0CC 1S4MA 4R2MA 4K9OA 1CRWG 3VC2A 3KDSE 3FUXA 3KT3A 3MCUA 3OIUA 3OZSA 1LDMA 1UC8A 2RHWA 3ZWCA 1IXRC 1YK1A 2CF4A 1PFVA 1X15A 1CRZA 5L4LA 1VZ2A 2CXNA 1GTL1 1OX5A 4KHZA 2XTJA 4LHZA 2W2LD 2OBRA 1F06A 3FB1A 1AQNA 2VRCD 3NPAA 4M6WB 3MSXA 3H3JA 2B37A 4NCJA 4ENQA 1NONA 2FW8A 4DCUA 4BJ5A 1M2OA 2VP3A 4R41A 3D1LA 3BIOA 1DQSA 1TW2A 5AXDA 1E9SA 2C4WA 1BN7A 2PO7A 3GGDA 3UMCA 2BFWA 2DLNA 5F35A 1CUUA 1USGA 3DDHA 1ISSA 3VPSA 1MAWA 4DCTA 4DN6A 2OCPA 3SR0A 1J8DA 3E0XA 3FWHA 3F7NA 3JATB 1SCQA 3S2IA 4AX4A 5EKUA 3B6IA 4UE2A 5HGJA 1LDBA 2Q7OE 3AM3A 4PGFA 2G08A 4N39A 2VEDA 2QAGB 3IAHA 1MABA 1Q3KA 3FFTA 4AJEA 3PPXA 3E82A 6ADHA 4RF2A 1PV4A 2W6JD 3H83A 3WGOA 4DR3B 3DZ8A 4F9EA 4DXHA 2D1FA 2H1SA 3VV2A 4L3WA 2Q4RA 4P54A 2L2QA 4AZWA 4HLNA 1T2UA 2QRUA 5G1NA 3VX4A 3ZE2B 1D2EA 1CSEE 3GIWA 4X62B 3WMGA 4Q3OA 5IZ4A 2GH1A 2HUPA 3TW8B 5FPPA 3I9V6 1U2PA 3FSGA 1U2RA 2W6ZA 5K3FB 3V4FA 3VRHA 5C32A 4DSOA 3RC3A 1H6DA 1LFDB 1T3ZA 1ZD1A 3HBNA 1WRBA 2PANA 2AE2A 2Z3VA 3S28A 4WQMA 4OBEA 4N0MA 4XSHA 3UKJA 2SNIE 1DT3A 3OPQA 5FD8A 3ZD9A 4BFTA 3UAGA 1MC4A 1VJTA 2QL7A 4RZ2A 3QBDA 4PX2A 4BFSA 3DMTC 4BLSA 1IAQA 1ZVKA 3JS5A 4X85A 4KAFA 2AVNA 3X1WA 5LSAA 2RKWA 2WM8A 3P5SA 3ZZNA 4YUXA 5LQAA 1NQTA 4NCIA 5ILOA 1LVUA 2CCJA 3M3DA 1C3OA 1YOVB 5KVVA 2HPVA 5TY0A 4ZOAA 1EA7A 2BHRA 1CJCA 4KVAA 3HWWA 1SQ6A 4XQ9A 1IY2A 1FNDA 2C2KA 3N6VA 4NOKA 4EEKA 3K6SB 1Z37A 2P5UA 4IDNA 3R7LA 3FUTA 3VVMA 1YQTA 1M1XB 3ELBA 3KE9A 2J41A 3V9PA 5JPDA 5FHRA 1J9EA 2J08A 4D4LA 2JJYA 2FPUA 2Q3CA 1HVXA 4L8LA 4YFVA 5AOCA 4KNVA 4AY4A 2XAAA 2VF2A 1GYPA 1SCNE 2QRKA 3H6KA 2ES4A 2HFKA 4LHXA 4NEGA 4XB1A 4EGQA 1ADGA 2QM3A 3UK0A 4C4XA 5D6NA 1WMDA 3IODA 3RIHA 1UFQA 3QIAA 1B0PA 2J5QA 1WCIB 3Q40A 4DDKA 3R0IA 4D3YA 2XD9A 4MULA 3I6ZA 4KQHA 2J33A 3A1SA 4X91A 3BSSA 3IPRA 1Q6ZA 2ZETA 1J8YF 1NF9A 1UPTA 1V4BA 4CM4B 1QRTA 3LKZA 3EFHA 4IZIA 3CRMA 1KKMA 3GUVA 2XGMA 4UD2A 3LQYA 4DUYB 4Q93A 4QELA 4CI9A 4XLLA 1IN8A 3H9JA 3UOAB 4PYRA 5K4GA 3GNTA 4JLPA 1ADCA 2A5JA 2EP8A 4KWTA 5EPUA 1SJ9A 1EE9A 3R41A 5JJIA 2CNKA 4Z7NB 1CE8A 4KGXA 3RYFA 3BRSA 5KINB 2UYCA 1JPJA 3KVOA 4HH3C 5BWCA 1I2CA 1OBFO 3LNTA 3TNDA 4HB3A 3REQB 4LOLA 4F4DA 1LTHR 3N2KB 4O08A 2IPMA 5D3MB 4ZZIA 2WUGA 3Q0TA 5CNMA 3VNBA 2F9FA 3PEEA 1TQ2A 4OFBA 4AJ4A 3KKZA 1BJTA 2D3NA 1XTZA 3FKSA 3D4LA 4HDAA 3CY6A 2A94A 1YITB 1UD6A 2JFHA 5B36A 1J8VA 1JVSA 5IN5A 3WL8A 1DXHA 1Z7WA 2FH5B 1BCSA 4MMZB 4JLOA 4R71A 2Y1KA 1O0SA 4M21A 3SU8A 2ZG6A 2ETXA 2AJLI 3MWJA 4QKQA 1QTIA 1IHDA 3VSEA 4MYUA 2DXIA 1WOMA 2W0MA 3KG2A 2ZUWA 2NN3C 5DN9A 5LA6B 1S2GA 4HWSA 4WUVA 4A0HA 3ZTWA 2J9YB 5JMTA 4AS2A 4BB9A 4MVJE 3IPLA 1E6WA 3VHXB 1NN0A 3G0BA 4F7DA 3H9BA 3TD2A 4P08A 3GLKA 4M1YA 4RHCA 3UHPA 3UW3A 3FCOA 5ARDA 5EIBD 3O4RA 1U28A 5CT4A 2D59A 1E6MA 3CGGA 4B84A 4D3DA 4DV3B 2F1RA 4NOJA 1ZX1A 4NMLA 4YXFA 3BY2A 1U8AA 1FYEA 3PQ5A 1YZNA 4Y67A 3QTLA 1CDOA 2G36A 4K86A 4F2HA 5HRCA 1I3NA 5HM8A 3IUYA 1FIUA 2HRDA 2N9UA 2PBZA 3DLIA 5BSVA 4BX2A 5DM70 3D43A 4WN3A 5DXFA 3L77A 1RYNA 3KV3O 4X20A 2QG9A 4Q15A 2ZIVB 1LPPA 2E3JA 2XKJE 4GUDA 3U3KA 3NJ8A 2ZUDA 1IPEA 2XXAB 5CFZA 1FTQA 4NYMQ 5CVUA 3WQBA 5BV0A 3SXUB 1Z6QA 2HHJA 4URFA 1VM6A 4N1AA 3TLKA 4EKGA 2WJ3A 4R2WA 3HQ4O 3AVVA 5ALWA 1NZJA 2J5BA 1W35A 1FUYB 1TJ4A 1TMGE 2VXBA 4FD2A 4HLCA 2J5KA 4Q7LA 4YO8A 4XLTA 5AI5A 5AKJA 4ZVNA 4GOMD 4PNHA 1Z2EA 4Q3EA 4WI1A 1PWYE 2QG6A 1QIMA 4RTJA 4NOMA 2LIVA 2Q4BA 2B4KA 3C39A 3QMVA 4XYBA 1GEGA 2Q7DA 1O94C 5J47A 1P3JA 2C9YA 4DWVA 2C42A 2FX5A 1HEYA 4ARZB 4F85A 2BGGA 2XBMA 4BNDA 3E3OA 5DJ5A 4GKKB 1NLMA 1MTOA 1JJAA 4FSDA 2Q5IA 3SG0A 1YIJB 1K27A 3EYAA 3LU1A 3OCZA 4OQEA 3X1KA 3AR6A 4K6GA 2NXNA 1QX3A 1FFXA 1C29B 3CM0A 2DJ5A 4CKEB 4D4MA 3V80A 1Q86D 1OWPA 2PZGA 1DCFA 5KMGB 1IY0A 2ZCJA 3DVSX 3CRZA 3GVPA 2CD7A 4JGIA 4S1PA 4X7FA 1JDUA 2QQ5A 2Z83A 3QE4A 3NTUA 1YB7A 5FYQA 3KOMA 5KX5B 3DL7A 1CB7A 2PBLA 5KNCH 1B8OA 3FHTA 1XP8A 1WQ4A 4E5SA 1RLIA 1QJCA 4O4HB 2ID9A 4FIDA 1ZJYA 4OHZA 2ATEA 4JOQA 4D42A 5IJ0A 2BI4A 3EG9A 2GUGA 1VL1A 7REQA 1NUAA 3KYDB 3W9SA 3GQBB 4NCAA 4YXWA 2J1LA 5I9IA 4BO3A 3CO5A 1RZUA 5EZYA 3WLJA 2XZOA 4WBNA 3DYVA 4CKWB 3NM5A 1EVIA 1U0RA 4KQIA 2VCEA 2DR0A 2A86A 3I5YA 1UXJA 3BX1A 5AK6A 5E4TA 2XZLA 2I6QA 3GQVA 4GBMA 4OFWA 3CUWA 4IV5A 1GADO 3I42A 3NEAA 4JUFA 5C7YA 2BLNA 4XKWA 2ZRAA 1NVWQ 3IT3A 4UW9A 621PA 4KR2A 4WIAA 2NP6A 1E79A 2BM1A 1J5PA 4KQ9A 4MWOA 3IAXA 4ES6A 5HS4A 3UF0A 4C43A 3O9VA 4OYLA 5DHPA 4DCJA 4Z0HO 2HWKA 2J7PA 3CZAA 3FHCB 3NM6B 4LRSB 3EWSA 1KE1A 4ZYUA 2VBGA 3ZTTA 4BJ1A 5TIIA 4DNFA 3RAFC 2ZU6A 2UV8A 2XZPA 3NPMA 1CVRA 4K6CA 3U26A 2R79A 1N0WA 1PJ8A 3SF0A 3VVCA 5HQTA 2W37A 3PX2A 3P9RA 3SBOA 1QGOA 2XMQA 1HLDA 4P5PA 5TT1A 4DYDA 4J1TC 2PUWA 3DV0A 3PIRA 4LBZA 3FNIA 5FBHA 5ICEA 4ZTZB 4ND8A 2R00A 1NF3A 4MP6A 3FOWA 3KT6A 3UY4A 3K1YA 1A97A 1JPVA 1JR2A 2QE6A 2W8BB 3HH8A 4FYPA 4RQTA 4Q9HA 4C7VA 2YZMA 2X9LA 3GP3A 4MW5A 4PZ0A 5KSPA 4XMYA 2Y1GA 3ZGVA 2NV6A 1IN7A 1XVIA 3NAQA 2RHRA 1KP9A 4EL5A 4NXNB 2CB0A 1H4TA 1FFBA 2ZBPA 1ZCBA 3EUWA 3O2JA 5BYAA 4CEIB 4NZMA 1AKYA 4H7PA 2ZR7A 4G6IA 4G2NA 2D1SA 5AOVA 4IUCS 3RUAA 3OESA 1ODJA 2P5TB 1Y0RA 1NA5A 4BMCA 1Y4SA 2HU7A 3RVKA 1DC8A 1J70A 1T0HB 4BFWA 5DRTA 3ROEA 1PR4A 1W75A 3KZMA 4UTZA 3VNAA 4QWMA 2ODWA 5KSWB 2N75A 4WY5A 1V1MB 3F49S 3PNLA 3MWYW 2GKSA 2JATA 4RKQA 3O9MA 4Y2UA 2MTBA 4XQCA 1VOTA 2R6ZA 2FZCA 1DMRA 1BIFA 1OXXK 2Q4EA 3IQGX 4IINA 4P4NA 4RVSA 1GNLA 4TPKA 4EUFA 3UGTA 2JLAA 2W6QA 3DAGA 3MT8A 1DC5A 2Z5VA 3RYIB 2CK3A 1QDLB 1VCHA 4W8HA 3FAZA 4AIIA 3I4FA 1A8IA 2LCQA 4EPWA 1ESZA 1CR4A 3KKQA 1A5ZA 1KDTA 2VJJA 3RCBA 2DBVO 1T5SA 1TZ2A 5J59A 1MO5A 3GD5A 4UEJA 4PX3A 4CMKA 3IFSA 2VJYA 1T5BA 2ERXA 4KZPA 1MOQA 4F86A 3F5QA 4IVRA 1YDFA 2PQ6A 3HP1A 3PJEA 3H9UA 3TPFA 4NOLA 4NG4A 4URWR 1F6BA 5IWCA 1RYFA 1YJ9B 1E98A 1WTAA 1SBYA 2ZIXA 1NVDA 3KPJA 4B6EA 1J0DA 2H5IA 1AKUA 4IRMA 1FLDA 1JFLA 3G17A 3OF3A 5GM2A 1PYDA 3RVDA 4CG3A 2J0SA 4FXOA 2CJFA 1E4EB 3UH0A 2RGRA 1UM9A 3H5IA 1JAZA 5ADVA 2PCLA 3LUDA 3MWDA 3TWOA 4TWIA 3ITDA 4C0WA 3CNQS 4LSZA 4C07A 3HLTA 2OT3B 4I4TB 4NL4H 4N54A 4N6OA 4YCSA 3K35A 4LYYA 3COZA 1T10A 2AA3A 3CCBA 3V8QA 2C5BA 2BFEB 3OAAD 1N78A 4B79A 2NT4A 3LVFO 2B4AA 1JB9A 5TMDA 1NSYA 2I33A 2D00A 4WZTA 1E1CB 4HQOA 5FUXA 3E1SA 3OOJA 4LDAA 4B09A 3D7LA 5EHZA 4LVNA 3IAAA 3LQRA 2W6NA 3H6HA 1MX9A 2OUIA 3R7DA 3GO4A 3RKUA 5JY6A 5ALNA 4LK2A 3C6ZA 2R60A 4AKGA 1O5TA 3EHEA 1ZJZA 1IZ0A 2FSVC 3KSRA 4JUBA 4LXYA 3EC7A 4MIKA 4MW7A 4O25A 4YRFA 5HMMA 4ENUA 5ADHA 2FY8A 1U3GA 2O7VA 3WE7A 1ECGA 3GC6A 1YZHA 2XODA 2HK6A 3PF9A 4HVAA 4JFRA 4ZTBA 1B0ZA 2C07A 3T8YA 2ZYVX 3HXTA 4PYIA 3KUDA 5EE5B 1VE3A 2IPLA 2UXDB 1J2YA 4FCVA 1HGXA 3C3YA 4ZEXA 1XMSA 1CIPA 4HLQB 5B55A 3MFYA 4MS1A 4TZ6A 2CXXA 1KRHA 4KKUA 2GYWA 3ZU6A 3F96A 2BFCA 3ASRA 3AEQB 4MQFB 4I5GA 2DR3A 1AUVA 1B6TA 1RBZA 2D13A 2V97A 1RVDA 4KXWA 4IO0A 4IJQA 1ZC4A 1EAMA 2EX0A 4FYIA 2Q1UA 1PEAA 1V5EA 2OOKA 3FPLA 4KO1S 3TAXA 5KWEA 2CVZA 2PKXA 1SK9A 2Y0EA 3I9NA 3KUXA 5EEGA 4IJ5A 3TZLA 3CWQA 1I9GA 2WF9A 1Z2DA 3N0TA 4BNYA 2OPHA 4EJFA 3VISA 5U1PA 3QF4A 5EXXA 4INZA 3O26A 5TPWA 4XEHA 4DNOA 1C7JA 2KPOA 3GCDA 1KNQA 2Y4OA 2PT6A 4N6NA 2GLXA 5JAHA 4I1YA 2AYYA 5TJHA 5LQNA 3E5RA 1X3LA 2EJWA 2R86A 3R0ZA 4IQGA 4XUEA 4CGZA 2HUNA 3LQ2A 1H2EA 2FPIA 3OC6A 1ZH8A 2O3QA 2I4LA 4L6AA 5CVEA 1WR8A 2LTAA 1NW4A 4UARA 4TV9A 1BKYA 2H48A 3E7WA 1EINA 1PT5A 3GZJA 3HP4A 3DLTA 3J7AC 1VJCA 3NU1A 3STUA 3QEMB 4EYOA 1BKDR 2XUGA 3JAWA 4KLRA 1TX4B 3WWZA 4P1ZA 3K71B 3LBIA 1KXZA 1XNHA 2F67A 2PV0A 2Q1SA 4IG9A 3RS5A 3CN9A 1Y48E 2SKDA 2WICA 3GJTA 4O2RA 1ZD8A 1ISGA 1OR8A 3I2KA 5KZMB 3MMSA 3ZGXA 1VCMA 4LXUA 3DCIA 4EUHA 5IVPA 2KI5A 1CNEA 1LPBB 1Y1SA 2GARA 2YMQA 4ZQFA 2WUEA 2JIZA 5LD2C 3VR5H 2MYNA 5CVDA 3AW9A 3OEHD 2RC5A 1PHRA 1TF5A 1C50A 3G9UA 3KEFA 5GJVC 1YS9A 3ZJVA 1JDZA 4QDTA 1YDMA 2AG0A 2JB9A 2XMBA 3UWMA 1HRDA 5B12A 1X8JA 1RLMA 3K15A 3KSDO 1F12A 3KL2A 3NGMA 1L8QA 2JZNA 1RM4A 4NICA 5A4AA 4YAIA 2XRYA 2ZRCA 2GVNA 3DTNA 1XT6A 1QGED 2E0IA 5CK5A 2QUIA 5IABA 1A8UA 4KH0A 2R8XA 1CZNA 1Q92A 2B25A 3ZWPA 2G7ZA 3HJGA 1NMXA 4QNNA 2GN2A 3OZGA 1P31A 1UQTA 2F6RA 1CWUA 4MP3A 3HHEA 2XDQB 2AKYA 3HYRA 4U02A 4X1IA 1RR6A 2AQIA 3K6KA 4QHYA 2JDIA 1KAEA 3GCWA 4ZANA 4B8YA 3IE0A 1JN0A 2EV9A 3O8DA 2OORC 3SEZA 4Z4YA 1NLYA 3DOOA 4TTPA 2X0RA 4AUEA 4ZCRA 1JAHA 5D7NA 2BOVA 1CU1A 4BMDA 1QP4A 1FTWA 3HG7A 4PAOA 2H06A 4EO9A 3EWAA 3BJRA 3SC2B 2XIQA 5HFAA 4RMNA 3CUEF 3LPNA 1Y1QA 1L7QA 1G5HA 5LOVF 4ALIA 1HDIA 1J07A 1TK2A 3ZGZA 2B94A 1QIHA 3JXEA 1MB4A 3G3EA 4U2FA 1AMOA 1JZSA 1JEQA 2JH8A 2P79A 3ER6A 1T5EA 4Z7QB 5JFOA 4JBXA 5J4LA 9ATCA 4XLAA 2HY7A 3GVKA 1U3CA 2OP1A 2G4LA 1JA1A 1N2XA 3T4UA 2IDJA 1F3OA 1SUPA 2P9TA 3WSVA 3NKLA 1JR3D 3WICA 2RD2A 4DV6B 1D2NA 4DA4A 5HCNA 3EBOA 1P1BA 4EUEA 4CKCB 4G4IA 5EKSA 2F4VB 1MQ8B 3R4VA 3BFPA 4JLVA 1IJKA 4ND7A 2VSNA 1U65A 1Y6ZA 3GRYA 4ROSA 5ALFA 3KWMA 3ZEIA 2WM2A 3D6HA 4DREA 2LDXA 2NZVG 3L0BA 1M7HA 2H1IA 4C01A 2JLVA 2RGGA 4L4SA 5HF8A 2GZAA 1Z39A 1LLQA 2BGKA 3U7QB 1RI1A 2BL4A 4JLWA 4D8VA 4ALJA 1BE6A 3UYLA 3L7BA 5L95A 2J5RA 1G3QA 1QHSA 4C05A 4E0FA 2XE4A 4XYEA 4JLUA 2HK9A 3L4SO 5I3ZA 4X7EA 1E1QA 4CTJA 3ZI7A 2C1EA 4H35A 3HJNA 5HFJA 3UJDA 4GPD1 4PS1A 4J0KA 4IHAA 3C3JA 4I5FA 2F1LA 1I2BA 3ITEA 3GLIE 2JEYA 4UTPA 2VDKB 2VDWA 3I4LA 1JR3E 4LUCA 2DOKA 3IELA 1Y5LA 2WIJA 5H68A 2R7AA 4D98A 1NQOA 1WZIA 2O0JA 1RYHA 3MTAA 4O6VA 2DFNA 3T1TA 3EC1A 4UAUA 4XE5A 4FUTA 2XDWA 4BKOA 4WY8A 4GKBA 4ER5A 5LMUB 2WZNA 1JVBA 2GNPA 5DGTA 3F2IA 1FNCA 4PAMA 3Q3GE 4X6LA 1XPJA 2PYDA 3W1EA 2OC4A 2ROQA 1SU6A 1WNTA 4GP7A 2C1ZA 1JIUA 1TF7A 3K8ZA 4OB8A 1BQ3A 1JJIA 3INNA 4A2QA 4ARSA 1PLKA 3DBLA 4N8SA 4TX1A 1MDFA 2ODAA 3WIBA 1M6EX 2H65A 3HDHA 3NHKA 4JBWA 2UDPA 4M8LA 1X0VA 4KXXA 1LV8A 1AQUA 5FPYA 2AE1A 1N9KA 3FRHA 4DC9A 4RVOA 3GRVA 5CHEA 4DWOA 2GHQA 4N7RA 2OMKA 3H42B 4QUZA 1OE0A 2I62A 1Z5GA 1RYZA 3FPGA 4GD3Q 3BCSA 4WOCA 4CTOA 4TT8A 3WDKA 2CUTA 2OMEA 2LDBA 3M70A 1B8VA 5ALGA 4KQ6A 5FA6A 5C80A 2AN5A 3SIRA 4XWKA 2IP2A 3M2TA 5FDFA 1J99A 2ZRPA 3CJQA 1ZN7A 2YYSA 1HXHA 2FU5C 3BWMA 2OENG 1YJCA 1PYOA 2PD4A 1NRJB 2XWSA 4JN6B 3RGWS 2RK4A 2FP4B 1BX3A 4AUKA 4ZDIA 1MFZA 3MS2A 2H9AA 1MAUA 4P3IA 1SKYE 4D9EA 3CBQA 1WMFA 1P2GA 4LDZA 4RLFA 1PYGA 2WV9A 1FFGA 1XMVA 5DLPA 4V02A 5HIKA 4H3VA 3KJHA 2GCPA 2GF2A 6YASA 3WB2A 2M6RA 1V9CA 2VJQA 2ARKA 5JCJD 1G3IA 3IAM1 1H2ZA 1ZQ9A 2X4GA 3KT0A 4FDUA 5GVRA 1DVRA 1NURA 1ZOLA 2HNAA 2O8FB 4BBJA 3KQMA 3ONNA 3Q88A 2WT8A 2FUNB 4Q47A 4AJ9A 2DQYA 1RRPA 2I8AA 3BORA 4TWJA 3U7FB 3DXXA 1CY7A 3T0IA 1L1EA 3UN1A 1H1LA 3JX9A 4ZCPA 3O82A 4DLWA 2IV7A 3BSFA 1N1MA 3ZHYA 2C2MA 1F6WA 1YR7A 1XEXA 2D62A 2AKAB 3GPDG 3PUXA 4H2DA 3HB4X 1MBZA 3L84A 1PJCA 4ZGGA 1W36C 5DWVA 1QU2A 1EG2A 1O87A 4CE6A 2GXAA 3Q0IA 1ABEA 4FNGA 1L3BA 3V4LA 2HLDD 3ZJYA 4CF5A 2GEFA 1GYRA 3MAJA 4QYXA 1A7UA 2NXJA 2ZB2A 4KZKA 5ULLA 2UYYA 1M1KD 2H1CA 3NT2A 2EAUA 4KIJA 1SVUA 5MGBA 10MHA 1KY5A 1P1CA 1O6GA 3JYPA 3OX1A 3FUVA 5FYDA 5FWAA 2C7OA 1Z6TA 4ZGQB 1I24A 1K2VN 2FJ0A 2QF7A 3ZLUA 3RRFA 1TA0A 1P4MA 2WHPA 3MLAA 4H77A 1ITZA 1YZVA 1YA8A 2ZQYA 1TEHA 3EMKA 3ZNQA 4BQQA 1BA3A 5KI6A 4GLBA 3TLYA 2FMUA 2IPXA 2RH9B 5KNCD 5DFAA 5SYNA 3OQ6A 2J3MA 3PNBA 1FDUA 4K9MA 1Y6FA 3LIIA 4E07A 2GHRA 3IA2A 3VU1A 1DSSG 1PK8A 4KLNA 3ANTA 4EJSA 4EFKA 1K73D 3MGKA 4HH4A 4HT3B 1TAUA 1P4JA 2QMZA 2OKGA 3B5IA 1S01A 5DNAA 2FPRA 1MB0A 1CFZA 1QB8A 1T9GS 1TC1A 1DDIA 4BLWA 2FZ4A 3A70A 4Q37A 3VSDA 2BKUA 4HH0A 4ZCMA 2YHBA 3CSDA 3A1FA 4X5OA 1NBMD 4EY6A 3FTNA 4NE7A 1LBIA 4HTFB 3FFBA 1SXJC 3NGLA 4TYMA 4REQB 4KFRA 4K87A 4CF3A 3R9XB 4TXLA 2W71A 2YBEA 5KWIA 1PFWA 1ORDA 1IN1A 4XSVA 5DN6A 1U80A 1R0SA 4L9RA 4DT1B 4CT0A 2H0RA 1QM5A 2VUTA 4IHQA 4LJ7A 1JQJC 2PH3A 1OAOC 4UMVA 5DGXA 4BJ3A 5B1HA 2O1SA 3ZBQA 3ST7A 3AT1A 4E33A 1N7GA 4EJ0A 3U3RA 521PA 4UM5A 3RV3A 1XGKA 2YV2A 1G17A 4J7AA 2BDTA 1JSLA 1Z4KA 4BNIA 3SLRA 6ABPA 1OASA 4WGFA 5JWHA 1GU1A 1KHHA 1GGJA 2DWPA 4QNMA 5LP6B 3OT1A 1OIWA 4HFMA 1M1NA 2EZ4A 2FAXA 4UVIA 2J87A 2EOAA 3LJKA 4KKSA 4GGPA 4KIFA 5A05A 4ZDJA 2AF4C 2JGDA 4FW9A 4HAWA 4RH1A 1Z25A 2Z6UA 2NU9A 3GIRA 1W85A 1NBME 1XD2A 1P2BA 3GHYA 1HDRA 3OY7A 3QSGA 4LYEA 5LL6P 1QQAA 2OXFA 4BKRA 3SY8A 2IPOA 4BV8A 4DDMA 4ZT2A 3PL5A 2QSJA 3A3NA 3U4QB 5FO0A 1KF0A 1QK3A 4TV9F 5HWSA 5A89A 3L82B 1KI1A 1KQFA 2NOAA 2Q3FA 1HSZA 1GUFA 1I3MA 3PC7A 2O3JA 4NBWA 2CNBA 4PPGA 1D4FA 4G0XA 1GDTA 4YDRA 4RA6A 1CB0A 1RXUA 1RQPA 3NHYA 3MLEA 2P9CA 3VOSA 1YVDA 4DLXA 5JQGB 5KO2A 5AJTA 2ZKLA 4O4JB 1VYTA 1R0RE 1WA5A 5D2CA 1QK5A 4PANA 1QTNA 3WGHA 1O4VA 1EKXA 1CJTC 4K05A 2UVQA 3IHTA 3M3HA 4LZWA 2JANA 1Q15A 1MKYA 4OGWA 4RM2A 4I4IA 1RYDA 3C5HA 3RIXA 2H2AA 1S89A 3KR9A 1S9HA 2ZW9A 2DECA 3EJWA 4B3JA 3IP1A 1D0SA 3WNCA 1YKSA 1W4BA 3KSMA 1MIHA 2I67A 5J5CA 1Z4MA 2AMJA 5UKDA 4C76A 1RHQA 5GOTA 4CQLB 3IYLW 4JKIA 1YHNA 1E1KA 3O3OB 5EJ4A 2GPWA 1XZJA 4RS4A 1OJLA 4NU0A 5AHKA 5F4JA 1ZMTA 3RVRA 1ZI8A 3C4VA 3GY0A 4LFAB 1H3EA 4PZUA 2FN9A 3CC8A 3TLCA 5DP1A 3VTAA 5DGHA 1B6RA 3PFKA 3FPKA 3I8OA 2GCOA 1V6AA 3OIGA 4TWBA 5I9SA 3SE0A 5J2UA 1TKAA 1QE5A 2UYQA 3SHFA 3PA2A 1XF9A 2DPLA 3NXKA 4H6VA 5A3SA 4BNHA 2FWNA 2ECQA 1DOZA 1V5WA 3K31A 5FH9A 2PN1A 3R40A 3T7JA 1T6ZA 4JLBA 5AJXA 3GR6A 3QXXA 2OESA 2PY6A 2B34A 2JNWA 3HJRA 2D3WA 3UG6A 2PZJA 3WWEA 4CMAA 4IGAA 4O4IA 5E38A 5IEBA 4DEVA 2HGZA 3HYLA 1NUTA 2RGNA 3E0QA 1WM1A 4CDGA 4LF5B 2E48A 1R4NA 5AKHA 3A4IA 2NPOA 4G6ZA 2R1TA 3GCZA 4II2A 4AI6A 1COZA 2GSWA 3Q3HA 3R8XA 3UW1A 1PZHA 1C3VA 4BNLA 2FW6A 2QJTA 1CX9B 2RCYA 4DVJA 4TZKA 3AOGA 3Q6RA 1WUKS 3B2NA 4YJ3B 2C84A 5TRTA 2RJNA 4MR8B 1EAYA 2GYVA 2VK1A 4MRSA 5G1PA 1Z35A 5KYXA 5AVKA 2NZ8A 1I3KA 2FRXA 4OBWA 4RDHA 1GZSA 3AXTA 3FLEA 5CHYA 2G17A 2H2HA 4LZZA 1RC8A 1LJUA 1H4QA 1NJ1A 1U8TA 3I8XA 1KSGA 3D8UA 1NASA 3NALA 1H94A 3F71A 2PSSA 3NBAA 4MKHA 3CXUA 4C4OA 3AESB 1KAQA 1SUAA 4GMDA 4XWTA 3ZHVA 3L7LA 3M6VA 4NH0A 2CL6X 4MWZA 1Q7EA 4AZ3B 4I4CA 4ZQGA 3U17A 3DDYA 1H5NA 2R6FA 1N9GA 3LECA 1GSHA 2GDJA 2JAOA 1GUDA 4IKPA 4B4UA 3E61A 4M9UA 5KYTA 2CW5A 1Z6XA 3GLHA 4OA8A 4AXXA 3ER8A 1N4DA 3EDQA 3TLZA 2XYGA 3VR3D 3LO8A 3PUMA 4E13A 4B3IA 1YS4A 1FDVA 5CIQA 3LD9A 4JMQA 3TM4A 3EIUA 2AYXA 4POOA 1Y6GA 1DIHA 3WI7A 2ZRQA 1N75A 3LO5A 4EENA 1RCFA 3EEIA 1UPAA 3CNBA 3KX2A 3PJDA 5MN5A 1ZRNA 4CM8A 2BTOA 2F8LA 3TVTA 1UDRA 4X8HA 3T3NA 2J3DA 2G67A 4IHJA 4RDIA 4DA7A 3HJAA 1W5BA 3KVYA 3O95A 1R74A 4KQXA 4NBLA 1HFKA 4W1SA 4YCBA 3U3JA 3TIIA 4JDUA 3T1OA 4E2XA 2JGNA 3MCZA 3QLUC 2WPDA 4II3A 1Q95A 4WH0A 5JRZA 5G0TA 1JXOA 4LQ4A 4QGFA 2QORA 1SU8A 4CKBB 1D2MA 1ZY2A 4EHJA 2OGUA 3P0JA 2HHHB 4BXOB 3LDFA 1OTYA 2XB8A 1TUBA 3LF2A 1TT5B 3KWFA 4MUIA 9ABPA 4LJAA 1JQLB 4TGLA 4ZI7B 5HKOA 5ALUA 4BFZA 4HD8A 3PFWO 1O95D 2PD6A 3KZKA 2RI0A 2PM8A 2OCYC 5DLEA 2C3PA 2DIEA 4KKXB 4ZHQA 3M5WA 2LGJA 2CVHA 2K87A 3M5DA 4F9TA 4IV0A 4UREA 1EM6A 3LW8A 1S2IA 3A9WA 3BBLA 4Q4LA 2JW5A 2ZL5A 2HWUA 1MAVA 1N1EA 1JMKC 4HDNB 4OX9B 3AF4A 4L1KA 5HZAA 3HVRA 1NYRA 1XRRA 2ZYAA 2RSLA 3DNMA 3G71B 1Y4UA 3CZ9A 4FFBA 1YBHA 4ALLA 4ENSA 4C2AA 4C0AC 4E70A 1GY8A 2ZUFA 2XEXA 2ECPA 1A9TA 1C9NA 2FLVA 2V4ZA 4CLOB 3AHDA 1IU9A 2IEZA 3DS8A 1PTKA 4B31A 5A5GA 3QE3A 5EERA 2IT1A 2HPHA 2Y71A 3AEZA 5DIZA 4Z6KA 3OJ0A 3GLIB 1T6YA 3C87A 3CLHA 3HJTA 5SY4A 3VX3A 5GTDA 2XV1A 2V7UA 1I7QB 5AN9A 5THXA 1NIJA 5LPNA 1VGVA 3W2IA 3RIYA 4MLPA 3ZIAA 3G2IA 4WFIA 3G0GA 1QHNA 4CIDA 2TECE 3QVXA 4B2IA 2HBZA 1OI7A 3BFJA 4PCAA 2LCFA 4FOTA 4RTRA 5BNWA 3DZCA 3ETLA 4JDPA 3WFIA 3AP2A 3H8VA 3H5TA 4LXGA 1SIBE 1USUA 2V03A 2Z2XA 3H5OA 3RYCB 1NY5A 2V6GA 3HCAA 1AZSC 4ZT5A 1IDOA 1V2GA 2CXOA 1DX4A 3ET5A 3KAKA 3BAFA 1RMYA 3NORA 4OLFA 4EQ6A 4QDJA 1K5GA 1WZCA 5ABPA 4IGFA 1YL7A 1Z62A 3BGDA 1OTXA 3TCKA 4N5LA 3KM0A 3ZN2A 4C0HA 4PSKA 2WD8A 4NNJA 2X0DA 1CZHA 2Q3JA 1GSIA 3TB4A 1SXQA 2ONYA 3OZVA 1USVA 2GEDA 2F1IA 5LQMA 4WL0A 2OFFA 3IP8A 3PC4A 1FX1A 5FBKA 1F2UA 1YMVA 2QUZA 3R6DA 5C0OE 3M7IA 3KAPA 4XVCA 2OVBA 3WJ7A 5H16A 2WWXA 3RUCA 2P9JA 4K5QA 5CB4A 4QJ4A 5H4GA 3DOJA 1EFHA 3C8UA 4G5YA 3O8RA 1EWYA 2V7PA 3L8MA 3UWDA 1AA6A 1UXIA 3PUHA 1PNRA 1KK2A 1XN1A 4HSGA 2IQ5A 3TOZA 4QUJA 3OPNA 2HQOA 2HADA 1V9LA 3H5LA 4ZT4A 4TZ0A 4TKUB 5TARA 3TMYA 1ENZA 2X76A 2CSXA 2PE3A 1SKYB 2A0FA 1GGHA 3S2EA 1OBVA 1PT7A 1XDDA 1A9OA 4X63A 1P4GA 4HDKB 3FI9A 1I1NA 3V8PA 3CLVA 4R05A 3I5AA 3VR6D 1KJNA 5KNBD 3T1QA 3HABA 5KOYA 3VPXA 4AKSA 3VFDA 2XVYA 4BP8A 1G8JA 5EIOA 1SHZA 1ABBA 5FA5A 3U31A 4UCFA 4MMXB 3TFQA 1YX2A 1E2MA 2D8AA 2HA5A 4M1KA 2WAAA 3F6PA 4WN9B 3K9FC 5IDYA 5K6AA 2CV0A 4ZYXA 4I4LA 1VHTA 4IY1A 5DZSA 1US8A 2DHRA 3MILA 3O4VA 8GPBA 4GVPA 3MJTA 4U6NA 4OX9Y 1GA4A 1XTIA 2G04A 4E30A 4NH4A 1F1BA 1TAGA 1UANA 2GEVA 2QRQA 5E3JA 3V4PB 3VBEA 3SQMA 3E1GA 4WHMA 3GFVA 3GP5A 4O4LA 4B3XA 1PF7E 1BU5A 2YNMC 3AY6A 3DLAA 4Y1FA 4DFDA 1T8PA 3UGQA 2ZIAA 4YALA 4M3NA 2QTMA 1XX6A 2D5IA 3ETGA 1P2UA 5G4LA 5E0OA 4IX9A 2J07A 3AUXA 1GZUA 1E4YA 3T7SA 3CXRA 4R1QA 1F17A 4AN1A 1QHIA 4D9FA 4Z0NA 2B4YA 3E03A 1D5CA 4I9UA 4OUKX 5LDHA 4YRPA 4WKGA 4AIRA 2CYAA 3LX6A 2X8LA 4BLQA 4FKZA 1JKJA 1KJIA 1P60A 4GUAA 3QFRA 3NFYA 1THGA 3COJA 2GWHA 3QQ5A 1UBKS 1K8RA 4RYDA 1B0AA 5E6SA 5EXPA 1AHIA 2C83A 1NV8A 2E21A 4W5WA 4BO6A 2I4IA 4N0QA 4XTCS 4AJOA 4MI1A 5L4NA 1I5RA 4IOMA 1GZVA 4HJXA 3ND6A 3IO5A 4U2EA 4ZEVA 1RJWA 4KB5A 1N2OA 4NV1A 1JQAA 4JEHA 4TQ9A 2IC5A 4UC0A 4ZO8A 4S04A 4Y7CA 1KNXA 5B53A 1U2DC 1Y8AA 1JG3A 2HAEA 2JFWA 4GWGA 4LVUA 4D4IA 1MRSA 4UHHA 5KYUB 1E3MA 2GAOA 1SO8A 1J9ZA 2A3RA 5GP1A 3QV2A 1U1EA 5BN3A 1NB9A 1W4ZA 5T4EA 4YJGA 1MRNA 2X13A 4LTMA 5SZHB 2BH2A 1OX4A 1TYCA 1VHDA 2W5UA 3TTVA 4MRMB 3COVA 2ZVPX 3FIUA 3RAPR 3LWZA 4ROXA 1NYTA 5SV2A 3BDIA 1VSTA 4S1WA 3DHEA 3UFXB 3C4QA 4CIXA 1N7IA 2ZPTX 3CPXA 3LX4A 2HSWA 3BZBA 1A7JA 5KOHA 5E8JA 3ANXA 1GIAA 1OQAA 1T3SA 1YB6A 2PR2A 4R81A 3TK1A 4DV0B 4P6YA 1AQ6A 2OO5C 1TXGA 5DBFA 4LY6A 5CA0A 5J2UF 4NCBA 3PPIA 1JHDA 3W9YA 4ZJYA 1R18A 3BHIA 1MPXA 1I9CA 1AZTA 2IHJA 4U6SA 1E89A 3JD4A 4HKTA 5BSMA 1UFVA 3GJYA 1B2RA 1KJQA 1U1GA 1KQOA 2DFDA 4CMCA 3TGPA 3L8HA 4IJMA 4UUQA 3I56B 2PUGA 2ISQA 4YLEA 1GUYA 1OFIA 1WUJS 4R1SA 2TSYB 3M6XA 1NFRA 1FX0B 3QVSA 2AR0A 4EMSA 4ARCA 3WBJA 2YYZA 4GRAA 1R00A 1H8ED 2E5FA 2HREA 5EJ6A 2JEZA 4JVLA 2YQ4A 2GCGA 2UUPA 3DAHA 4I9FA 4PYKA 1EFLA 3HDTA 1G5RA 3HKDB 1AF4A 2JLQA 5DTJA 2HV8A 4FWTA 4DJEC 2CE7A 3B6ZA 5AMXA 5I01A 1Q91A 5HUQA 4P3OA 5LMCA 4GOKA 3TRJA 3EQZA 2FNAA 5HZGA 2HIAA 3RSOA 2QJOA 4XWOA 4MGKR 4CWAA 1MVOA 3NBUA 4GX5A 4YVFA 2W0SA 3WOHA 1AN0A 1R0YA 3WNZA 4CJXA 5LXTB 3NVAA 3NQ41 1G63A 1BDBA 1HT0A 2QZZA 1WIWA 4F21A 4TLBA 4OTZA 1UBNA 2ZBRA 1HFEL 2QSZA 2XVXA 4KW7A 3D3KA 3IBFA 1Y7TA 1NI3A 2V7XA 1R4MA 4OHVA 5TMPA 1Y8CA 3AMVA 1L6IA 4FOLA 5JADA 4X6YA 1ZI6A 1NRXA 3N9IA 1NBWB 4LOHA 1H8HA 1UC4B 2A9VA 2C0PA 4FE7A 4GU5A 5JS8A 5ALKA 5FOXA 3TLJA 1X7YB 3TZHA 4B45A 4A6EA 2FB9A 4GI2A 4OATA 5EXSA 1L4YA 1JDPA 2C29D 2BGTA 2ZZNA 3UK7A 4RL6A 5G0WA 1KYQA 1DQNA 4K8OA 2QT1A 2I2FA 2JJQA 3I2JA 3L7CA 3IDZA 2J30A 1R8XA 1NUSA 1EX9A 1VE6A 1VIMA 1X8KA 1U04A 2NPIA 2QZ4A 5ECWA 2ZIFA 3SLNA 5DTMA 1GLNA 1Y1RA 3QM1A 1LLUA 4FS8A 3IPCA 3UMJA 1V3VA 4KXMA 5JCZA 5T4FA 3BDAA 1HKUA 4FMDB 1PJQA 1CV2A 3ZPNA 2PGNA 3T06B 1WNFA 4F45A 1GTRA 5A8AA 1ILWA 1K0FA 3M9XA 5CYOA 1RXCA 2P1ZA 4DTCA 1MV5A 1JHVA 3NFRA 4IIXA 4HTAA 2IF2A 1CUBA 1FQWA 1JIQA 4KVGA 2IYPA 3EG5A 3PU6A 1C4KA 4CNBA 4W7IA 5AM5A 3UUFA 3VOTA 1W59A 1XTRA 2QAGA 2Q8PA 3S2FA 1U2EA 3K2BA 3AJAA 3QX9A 4FSXA 4WLOA 5C1BA 4PY2A 3KQVA 3F6YA 2QP3A 1EH5A 3BSWA 4H0FA 4M1ZA 4MYRA 3QWBA 1GZ7A 1Z3CA 2X3YA 2WJPA 3C3EA 3TUIC 2NPFA 3IQXA 4ZJUA 3DCNA 4R8SA 5K3FA 2IYXA 2VLIA 4K1XA 3MJHA 3T95A 4CHTA 1TGYA 2W2KB 4JJFA 3AR2A 3BRCA 3WRYA 1LLFA 4YJFB 5FJJA 1PFKA 2ZBDA 1ZD4A 3R3YA 4H4CA 3U3MA 2YV1A 4DARA 1NSFA 3ZU3A 4EA7A 6LDHA 3CVJA 2YY6A 2AGVA 2BZGA 5KWSA 1X86B 2NIPA 4W1RA 2NU7B 5HZKA 2DFPA 5IMSA 2FYTA 3VHQA 4TMYA 1FYDA 2PS0A 2OV1A 2WZPP 3TTYA 4BQNA 3R6KA 3GDOA 3D4IA 5D6OA 1YOVA 1SVMA 3PHBE 5CNJA 3UT5A 5ICMA 3AVUA 3MPUA 4RTOA 2GWRA 4C03A 4GBJA 4M53A 4GL4A 3ZZ1A 1YBFA 1OF1A 4XD2A 3ZCRA 2VJMB 1T5IA 3DHWC 3JWJA 4GQAA 1QVVA 2HU8A 4OL0A 2XLCA 1YU6A 2C95A 1IH8A 1RXEA 1RI2A 1Z7BA 3AFMA 3G82C 1YJBA 3E05A 1E9AA 4JXJA 5PGMA 1BXRB 2PWPA 4WRRA 1Y8RB 3QXSA 1PEDA 3F74A 2WFAA 2F64A 5KCZA 3GJRA 2XRMA 5IMBA 4F11A 5JVDB 2W2VA 2WBLC 4M46A 4QA9A 3IVMA 2C9CA 2NV4A 4X93A 1SUWA 3BMOB 4DYVA 5K20A 1WCIA 2H63A 5CBPB 5L3SA 3S5JA 4WKOA 3AM4A 1X7XB 3QKSB 4AKHA 1MJFA 1EUQA 1ZVMA 1R5NA 1TCAA 2OZLB 3PGVA 4LV8B 2ZAOA 5DU2A 5L9AA 1QVAA 4CM4A 5LQJA 2VP5A 1Z26A 3KLOA 5B6PA 1MX1A 3ZHCA 3PFNA 4G4GA 4D1YA 2YS6A 2FZKA 2Z3ZA 1D4AA 4Q9JA 3WBBA 2EQ5A 1PSZA 3ILXA 3CESA 4ZJZA 5LN1A 3EPHA 3LC7O 1MZVA 4RK7A 4YP6A 1NP3A 5CB4F 2MINA 4JMLA 4URVR 3A8TA 2ISSD 5LU8A 1KOJA 3OY2A 1P91A 3V2HA 3VNVA 1DBRA 2H9YA 2N1MA 5HF5A 3V7AA 3G9TA 4QIHA 1LLCA 5D1NA 3UICA 5A4DA 5F4MA 3VJRA 4I9NA 5CH3A 1IVYA 1H22A 4JIGA 1M3SA 4M0DA 1CUAA 1D9ZA 3OQHA 3GN2A 1N0VC 3N2KA 3PQ7A 4WBSA 5D3MA 4Q1FA 3FOFC 5A0TA 4HWTA 4J3FA 5C81A 1MC8A 3ROMA 2CHQA 2I3AA 4KNYA 1VLLA 2I4OA 4MA4A 1F38A 2FRDA 2A4KA 1BHO1 1KI9A 3SEJA 1UT5A 2ZR0A 4EG5A 4AMYA 4ERNA 2V0GA 1ZWKA 1KVTA 2GAAA 1Z4NA 2W90A 4M88A 4A5OA 5IULC 3T3HA 4EDHA 4CIYA 2OD9A 1KL7A 1WXQA 3KOOA 4W5HA 1T1IA 1DTWB 1NVKA 1MNQA 1GG9A 5L51A 3ND9A 5F5XA 4BFUA 4ERXA 1KP2A 3DJFA 4M99A 5DI9A 1JLRA 3SVZA 1BA2A 5LA6A 1HDYA 3UWKA 4BTLA 1ZD2P 2O2EA 2ZK7A 1XVUA 1CZOA 2MSKA 3T35A 4NJEA 3S8YA 2O7RA 3P32A 3PYLA 3GUUA 4HQ0A 3SF8B 2ENUA 3VHXA 3BXPA 2JARA 5EWLB 3NX4A 1NDUA 1AO0A 1RRMA 3MJVA 4H6XA 1ZAYA 4UQOA 2I87A 4U4AA 1POWA 4O4LF 3EQ6A 2QGGA 2NQ8A 4ND3A 1AB6A 1ORWA 3I58A 5FFFA 5BRJA 1SUCA 4JODA 4YIKA 4OKSA 1ZWLA 1H9AA 2F8SA 3IOBA 1JEAA 4NCNA 4WAUA 5DBEX 2HF9A 3MINB 5G4KB 1WVGA 3IUSA 3PLAE 3GZTB 3A3GA 3LWNA 1Z5NA 4DMMA 2GPJA 2X5NA 4AVZA 4EX7A 4G8CA 2PT5A 1JHUA 2X2FA 5K0EA 1IM8A 1C0PA 1JDBB 2QLFA 3M33A 3ZXUB 3TG8A 3W2HA 1J23A 3QJ5A 4KQ2A 4X54A 4XXHA 4URUR 1G3UA 1E3DA 3GLQA 1YI2B 1Z0DA 4FBLA 4QVGA 4TVOA 1NQVA 3UAXA 4FYWA 2PUDA 5JC1A 4EL0A 4IIDA 4OY3A 4X00A 1EHYA 3SXUA 2R8BA 3FHOA 4KP7A 1OLSB 4GNKA 1A8HA 4Y6OA 2YZGA 4Z4QA 1S8NA 1EVLA 1L4UA 2NSHA 3LDUA 2O07A 4OK5A 1QYIA 3X43A 3B6JA 3HA2A 3MWLA 5CG2A 1MO2A 4X6UA 3BY1A 3O74A 1PR9A 1XXHE 1JB1A 4HUQA 5DNWA 1GHTA 1Z68A 2AW3A 2HQRA 3FDZB 4NENB 5BUSA 4LC0A 1JS1X 3IMGA 5FAKA 1N5LA 5D3KA 2CF6A 3SZMA 2UYOA 1NXPA 4ARZA 2ZZKA 2AI2A 3UENA 3VZDA 1MP0A 4RLSA 4PQGA 1USWA 3EQ2A 2O0HA 2J0QA 1FTSA 4B6JA 1JG6A 1S2NA 4RJKA 1Z5ZA 1GTSA 4G36A 1BVRA 1GZ3A 3KZXA 2G1UA 3WL4A 1YZKA 1E20A 4CKEA 3GX1A 1UL1X 5FTWA 4GLJA 3TEFA 1RD4A 5ICSA 2CV2A 2QZPA 2WNSA 1H6CA 1UBFA 4UCXA 4EWLA 5CA0F 3FYTA 5KX5A 3B9PA 1F3LA 3M5CA 1EUYA 2BV3A 2P2SA 1U28C 2GPSA 4J1NA 1N0HA 3A0RB 1RXSA 5IKPA 4DDHA 4URZR 2EBWA 4KJZA 1UBSB 2C0CA 4MV8A 2PH1A 4O4HA 4NDNE 3FFWA 1LS6A 2ECFA 4Z4WA 4JQCA 5COBA 3QXJA 2Z3WA 5TEWA 3KYDA 3GQBA 3ZQ4A 4YI3A 1GL9B 1V7CA 3WLMA 1ZEJA 1ZMRA 4MYCA 4PM4A 4W7SA 1EFKA 2XIJA 2L19A 3O8BA 2IUTA 4C20A 4NHOA 4WNIA 5JDCC 3ITKA 1YZFA 5KNDD 4GPAA 2H11A 1L5VA 2HC9A 5IJ9B 3ONFA 1MAHA 1U2GA 2WU1A 1TM2A 1SCUB 3BD7A 1G1MA 1T2VA 4M2LA 3WLHA 5A9RA 3OM9A 1BW9B 3CH6A 5GV8A 2P6PA 3G02A 1EQAA 1BEUB 4RK4A 4MHSA 2XNDA 4XL9A 1KIAA 2PAAA 4LJLA 3ZCPA 3LQ6A 2F4NA 2EXXA 3R0QA 3NTRA 4NCKA 2ZYDA 3ODGA 5A06A 1YKGA 4QU0A 1DADA 2P3OA 4F8EA 5JD6A 4YAFA 3FJOA 1PR1A 3AL3A 3CWCA 3CFYA 3R77A 1QGYA 4WFQA 4YQEA 4RPIA 1RLJA 4DLAA 2H85A 4RIHA 4M1EA 3RGGA 5A9SB 1L2TA 1U9CA 2R6JA 1MO3A 1MTZA 2YDYA 2BMVA 5EKXA 1VQLB 2A1TS 4L4XA 4Q9DA 4KQGA 5TS2A 3S1SA 1YZQA 2PQMA 2NZXA 2VTKA 4DSUA 3HCRA 4LX0A 3B1JA 4Y2YA 2W8BA 1JUDA 2QEQA 1A50B 3VZBA 3JQBA 2PL5A 2JIMA 3MYRA 1UPXA 1EBUA 3IE1A 4J8PA 1IK4A 5ALOA 4CXMA 2REQB 3FI0A 2YXNA 4OP1A 3ZCUA 1IUOA 2WF6A 3DD1A 4BFVA 1XZGA 4LRQA 4D0GA 2WSLA 5AW6A 1SBCA 2ZS7A 1GFSA 3P71T 5AW9A 3QOWA 1I5OA 4B6GA 2DPGA 3LXXA 4KNWA 1EE2A 1JT9A 4HDCA 4GMGA 3LUPA 3ESDA 4EW2A 4G5HA 1LRJA 2NZJA 3KOZA 5IUKC 4WZAA 1KS9A 1WDWB 3ZWVA 2KMLA 1IULA 1CUGA 4HI0E 1YR9A 4XX0B 4BB0A 4NX2A 1LLDA 1KEPA 3GP8A 4MNTA 4MZXA 1XTTA 4YAKA 5CAEB 3M2PA 1V1MA 3WQSB 5FV4A 3RADC 2YJGA 3ASVA 4ALKA 4EI7A 2PUEA 4XB6B 2F48A 2ON6A 1GITA 4QU9A 3TOCA 3PJRA 4WSOA 3FVRA 3ABSB 3OW7A 3MF4A 3RHZA 3V34A 4YLYA 3SQXA 2W4IA 3P2MA 5CA1B 4HADA 3JAKB 5B58C 1YBVA 2V1XA 3ZHTA 1UEXC 5BUCA 3H9GA 1HC7A 4WEQA 2XGJA 1I7LA 4B87A 2RHJA 3PWZA 2IUYA 4DBVO 3LQFA 1XE3A 4XQGA 4HWOA 4QBIA 5DISB 2O8CB 3AKYA 1TVEA 3D2CA 3OJOA 3RJZA 3UNXA 4CKXA 3TR5A 4JI0B 1XZLA 2CCKA 2NGRA 3WP0A 4PRKA 1ZEMA 1FRQA 2BP7B 1UP7A 1ZZGA 1CIJA 3B3AA 3MCVA 4K9QA 4OLHA 3WNVA 2C04A 4OU4A 5K09A 3PENA 1AT1A 1HSOA 1W5AA 2R3SA 2HJSA 2AI3A 3R5KA 1AKNA 5JASA 3HXPA 1XKTA 3QUTA 4YJKA 1KOLA 1XMJA 1CYEA 2PGIA 2Q1WA 4D3SA 1E4EA 1SOVA 2R00C 4BQFA 3TJRA 1N5IA 3RS7A 2X2PA 3TQHA 3GRFA 4JVOA 4WK0B 4INPA 4I4TA 1UT8A 4C30A 4YRDA 3TUJC 4YFYA 1UEIA 5F51A 2OGZA 1L4FA 4ZZ3A 3LYLA 3ZVNA 2BVNA 2QYOA 1P6XA 4HB2A 3JQAA 2GZHA 3IJ5A 1JECA 1FBNA