1GAQA

Crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
296
structure length
296
Chain Sequence
ESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
total genus 81
structure length 296
sequence length 296
chains with identical sequence C
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gaqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gaqA02
4G5GA 1F20A 1XE1A 1ZM4A 2HMAA 2GPJA 3SJZA 2RC6A 4PC6A 3G71B 1Q86D 3CRZA 4M4SA 3V76A 3AVTA 2OTLB 1K9MD 1QX4A 1SKQA 3FJOA 1BJKA 2XEXA 1VQ4B 1J9ZA 1FNCA 1H42A 5TY0A 1JB9A 3B82A 1QFZA 4MYUA 4YAOA 4ACBA 3CC2B 1EFCA 2R6HA 2BGJA 1FDRA 1NJID 2EIXA 3VNUA 3AGPA 2XNCA 3QFSA 2VNHA 4IW3B 4YAWA 3QFTA 4AF7A 3CCVB 1EWYA 1YJNB 1S72B 2PIAA 1BQEA 2C77A 2BF4A 5GV8A 2HDNB 3QFCA 3WY9A 4MYTA 3ES9A 3CCUB 2QEXB 3LO8A 4YAUA 4PC3A 1GR1A 5GV7A 4Y7CA 4RJLA 1JNYA 3OW2B 1JA1A 4NCNA 3W2IA 3CXCB 4J0QA 3CMAB 1N0VC 1OGIA 2QTZA 2BPOA 1VQLB 2DCUA 5TR9A 3JQRA 3PENA 1GJRA 4ZGQB 2QTLA 1CNFA 1KD1D 3U6KA 4M53A 1GO2A 3OZUA 4TMTA 1HA3A 2D74A 2DY1A 4TN1A 1R5BA 3CMEB 5JBQA 3ZZUA 4N3GA 2VNIA 1OB5A 2B7CA 2BVNA 1VQ8B 1SM4A 1FRQA 1ELOA 2DERA 1WDTA 4C43A 2BV3A 3ZBTA 3J81k 3QFRA 4QHYA 1D2EA 1QUEA 1K73D 1TVCA 1M90D 1R5OA 1G7RA 1U2RA 5HXBA 3VMFA 3OZVA 1XB2A 4M2LA 4HE5A 1KRHA 1CQXA 3LYUA 3W5UA 2NPFA 1GAWA 1G7TA 2B5OA 3VO1A 4FK8A 2CNDA 2QMUA 1TLLA 2DETA 1D1NA 2OK7A 2J7KA 4TMXA 4H9GA 1KK0A 1KK1A 2BN4A 2CRVA 5TV2A 4N3NA 4RD1A 1FNMA 2RC5A 4WQMA 3W2HA 1E62A 1BX0A 4DQLA 1AMOA 1EFTA 5DSZA 3W2FA 1VQMB 4M1KA 1QFJA 3AVXA 4Q7JB 1DG1G 4ZCIA 1M1KD 4B3XA 2HCJB 1YI2B 1KK2A 4RCZA 5H5JA 3AVYA 3CCQB 1KTVA 4LBVA 2OK8A 4YALA 3OJWA 4RD4A 4HE6A 3ZZ0A 1DARA 4P6VF 1QGAA 1UMKA 2YWFA 3VNVA 4ZCLA 1IJFA 3W2GA 2QN6A 4M0LA 1VQ5B 4AF6A 1QVGB 1K8AD 3ZBUA 3QE2A 4ACAA 4B48A 3CCJB 1VQKB 1QGZA 2YWHA 2YWGA 3A1FA 2AHOA 2YWEA 1EP3B 5AN9A 3AGQA 3CC7B 2B7BA 4PC2A 4G1BA 1DDIA 2E1RA 2FX3A 4B43A 4RD6A 4C0SA 1D8TA 1KQSB 2PMDA 3ZZTA 3AVUA 4U9UA 3U6BA 1VQ7B 1W2BB 3CPWB 3WBKA 1JJ2B 3U2QA 1VQOB 4G1VA 3E20A 1N0UA 2PLFA 1G7CA 3G4SB 2VZLA 1ZUNB 1N8RD 5FA6A 2OTJB 4PC7A 3CCLB 4R71A 1JA0A 4PGOA 3MMPA 1EFUA 1VQPB 4ZV4A 4QFMA 3CCMB 3WNBA 1Q81D 5H59A 1QFYA 3OJXA 4ZGNB 3WNDA 1CNEA 3I56B 1S0UA 4UAJA 1GVHA 1NDHA 3LRXA 4B44A 4K1XA 4FWTA 1Q7YD 4FN5A 4DQKA 4LBWA 3MHPA 1GAQA 1R5NA 3P26A 1IB0A 3W5HA 3VO2A 2BSAA 3WBJA 2QDXA 2VNKA 3LVBA 4AC9A 4YAFA 4RD2A 5THXA 2C78A 4Y9RA 4PC1A 1QGYA 4P3YA 1DDGA 4RD0A 2BM0A 1I7PA 1QUFA 5KSWB 2BGIA 4RD3A 1KC8D 4TMZA 3CCEB 3QSYA 1KJZA 4EH1A 3JQQA 1ZM2A 3G6EB 2VNJA 3W5VA 4TMWA 4RCYA 1E64A 1H85A 2VYQA 3P27A 1YJ9B 1OB2A 3CCRB 1YJWB 1YITB 1ZM9A 4YHBA 3MCAA 4F7DA 3AVWA 3CD6B 1TUIA 3B78A 4B47A 2X3UA 1EP2B 1Q82D 1VQNB 3WXMA 2DEUA 2ZITA 1F60A 3I1FA 1QH0A 1AIPA 1FRNA 1B23P 2BMWA 3I55B 3FPKA 3W2EA 1W87A 5EMNA 3WYAA 1EXMA 3E1YE 3ZC3A 2EFGA 4LBZA 1TTTA 1EP1B 1KK3A 3OZWA 4Y9UA 2BM1A 1QG0A 4NBSA 1BX1A 1YHQB 2GQFA 4ZCMA 1E63A 1A8PA 3WNCA 3B8HA 1YIJB 1FNBA 3CC4B 1VQ9B 3CB4A 1ZM3A 3JQPA 1W35A 1B2RA 1QVFB 3CCSB 1FNDA 1VQ6B 4TMVA 1IJEA 1W34A 4LC0A 2XNJA 4B4DA 4BPRA 3AVVA 3CW2A 2QA4B 1G7SA 1OGJA 4LBYA
chains in the Genus database with same CATH superfamily
4QXAA 3HEBA 1XE1A 1DL5A 1FLNA 1XTQA 2AOUB 4I55A 3U1TA 5JD6A 3KZCA 3JD1A 2JLUA 1JU9A 4XUCA 2IJGX 3CF2A 3BL5A 3DBHA 3GLGB 1OAOA 1N4DA 2C31A 2A5YB 2HBYA 2Q3CA 2XVZA 3FETA 4G25A 1OZHA 4A23A 1XF1A 4OI0A 1ZONA 4EGCB 4GBGA 4PC6A 4XLZA 5ARDA 4RO0A 1OD6A 3LO5A 1JJAA 1OX5A 1CUSA 1S7CA 5CT8A 4TRRA 1S7GA 4MQUA 1MV5A 1TVKB 2QLJA 1IULA 3QVMA 4RAQA 2QM8A 4S1VA 4UXIA 1QX4A 1E6LA 4EW1A 3O4JA 3HSKA 2G6TA 1Y7IA 3ORFA 3AOEA 2X9GA 3K2BA 3NBFA 3PEFA 4RV5A 3UW1A 2GD2A 3ORSA 1Y1LA 2OHFA 4FX5A 4RHTA 3D4BA 4E4TA 1ICEA 1HORA 1XEFA 4DV5B 5F9FA 2CHFA 5HZGA 1DZIA 1OWLA 5B57C 4YJDA 4K46A 3DWEX 5ENZA 3CNQS 4MP8A 3EEOA 2NO6A 4PFJA 3QY9A 2R8OA 2J3HA 4YRAA 2PBRA 4F3YA 5IASA 3PUWA 4TLDA 5DNYB 5LQKA 3DHVA 4IW3B 2FUCA 4F5DA 4UBLA 3CCVB 2Q1WA 4PHTA 2P9CA 5IP5A 5A3JA 5LJLA 3NIWA 2W2KB 4OQYA 2C77A 5WRFA 2WIDA 5AK6A 2FFRA 3OE1A 1Q77A 2QYOA 2NSDA 3GJ8A 1DLIA 3A11A 3MCTA 4ID9A 1DUIA 1PNQA 4WOKA 4BGUA 1P74A 4HFRA 1HRKA 2R87A 4AMVA 1IXZA 4TTRA 2ZJAA 5ESWA 2EW8A 4C2UA 3B36A 2YHIA 1T5SA 4IDEA 3EEQA 4LDAA 3KJXA 1JEYB 2JIRA 2OBRA 5EJ5A 4Y9SA 1EAYA 3ETDA 1ULHA 4HQFA 4WLEA 4YAUA 3LTEA 2PSDA 3FI9A 2YL2A 2HJHA 3M89A 3R3WA 4QQKA 4JL8A 3W8RA 5MDHA 1BDIA 4NZZA 1UT5A 3IERA 3MMSA 2VQ3A 4CMIB 4IIGA 3EXFA 4OI1A 4FOTA 4XD7A 4CDRA 4Y2GA 4GYKA 5LXTA 1Z4PX 4OQFA 2UVPB 3QIVA 4UOEA 1M1YB 1JNYA 4JLMA 2BJWA 4G0WA 1ESNA 2W8BA 2XGOA 3DMYA 3EULA 5DBGA 3S40A 4EHKA 5HVNA 2BUBA 3T9EA 4YRFA 2PKQO 1ADGA 1OFIA 1U0LA 2XB4A 3ZWCA 3ISTA 3NOQA 4HFMA 3VKFA 1JA1A 1SUPA 4JYZA 1A9ZA 2E4VA 3SQOA 4EYOA 2WUWE 1M0SA 3CMAB 1NW9B 1TTPB 3DT9A 5EY5B 3SXUA 1RXVA 1XDZA 3WWDA 2CLKB 1ORWA 5EESA 1N2OA 2DQ4A 3WRWA 1G2IA 4J2TA 4HUTA 2X2FA 1E9BA 1E92A 2OBLA 3LX5A 4U0KA 4DA8A 3PHHA 3QVJA 1XEAA 5FJIA 5KYGA 1ZBQA 4M87A 3A3OA 3KZ1E 3UANA 5CFLA 1J5EB 2VJCA 3S1AB 3OFNA 4UQLA 4M53A 1KQGA 2ASVA 1DCFA 1BRMA 2ORVA 2H1CA 1PG2A 2GR9A 2R86A 2NTEA 1NLYA 2RD2A 4OXRA 1MGOA 3PDIA 3GVJA 3RK0A 3QUQA 5K3DA 3A9UA 4ER6A 1GNRA 1DAKA 2A1TS 5A4MS 2P6MA 4I50A 5KC8A 2EWVA 3AV3A 5LKAA 4L7VA 4P4NA 2OILA 5SY9A 4N3GA 5AJZA 4F4UA 1VBKA 4UFPA 5DNAA 4QEKA 2XZLA 2DKNA 1C30A 1LWOA 3HWSA 1WZCA 1YMQA 3NANA 1K2WA 4K6MA 4GOOD 3TSZA 5SY6A 3W5DA 1YU6A 1Y63A 5DHAA 2R8ZA 3E4CA 3RASA 1H4SA 3ICEA 3GVKA 4F0JA 3HU5A 4BRSA 1DHTA 2YCBA 5CU7A 4DQDA 4MIOA 4LY0A 2WILA 2AJLI 3EQ7A 2XODA 2G9ZA 3U09A 3OBIA 1ZXXA 4EUEA 3M33A 3IPRA 3D3WA 3RYFB 1P6XA 2JI6A 3OICA 3Q8LA 1I2MA 1I3CA 4HNHA 5HXBA 4ZT7A 3RIMA 1FPQA 1QLHA 5CNKA 2HJ9A 4QGAA 1HSOA 2QYTA 3SFZA 3TZQA 3O7MA 2B92A 2V7VA 1FOEB 3QMPA 2C4UA 3R7DA 4LC9A 3NHRA 3KOYA 4O2BA 4LSZA 3LUAA 3NHAA 2VJAA 1GV0A 3ZHQA 2H9IA 5IYPA 4HI0E 3A36A 1QCZA 1NY6A 1O97D 3HYRA 4ZOLF 1Q91A 5DF1A 1HURA 1EUQA 1IN7A 4G23A 5B1IA 3UMFA 3ZEIA 5HRUA 2YMLA 4XAQA 5KX5A 4MS3A 3A1NA 2OB2A 2QXYA 1G64A 1RP1A 4BHTA 2JC3A 5FOTA 3C5CA 4NYJQ 4IR7A 3BAZA 4KDEA 5BORA 1GTL1 3AT1A 3A9WA 3NHWA 1ZUHA 3O95A 3RJ5A 2OK7A 1SD2A 1Q7EA 2C0PA 2X76A 5SZKB 2WWGA 2GK6A 5JNSA 4PGFA 1P72A 1Z6YA 3GFPA 4P3IA 2OZVA 1QSGA 1W5AA 2C9MA 1RR6A 4PG6A 3GLFE 3M1IA 4OJYA 2HMTA 3FOBA 1EXDA 1OW3B 2O6HA 4EHIA 2R751 2ILTA 3C5HA 1DIOB 2HNKA 1ZR2A 4KREA 3UYKA 1HE5A 1DBIA 1GPJA 3GNLA 3N2GB 2HHCA 5IEBA 3LECA 4IJ5A 3RVBA 3VAZA 2EXXA 4F2PA 3AFIA 3UWMA 1Q1BA 4V1CB 3OQHA 3IAS6 1USWA 3EEFA 4ZZ1A 2QM0A 2GTIA 5GJCA 2QSJA 1T4BA 3WG9A 2WAOA 1YF3A 3ZWDA 1J8DA 1HLGA 1SCKA 1R9GA 2ZPUA 2BFMA 2YUIA 4NQZA 3N2ZB 4FINA 3MJRA 4O4LA 5K8UA 4NSNA 1KYQA 6PFKA 3EG9B 4EJ2A 2ZJ7A 4POOA 4MV9A 1NF8A 3E5MA 3IAEA 4RVCA 5REQB 2FVGA 2C4TA 3HO6A 1A97A 1YKSA 3OKFA 4ETMA 1AB5A 1PJAA 1FTSA 1ZDMA 1BWPA 1N7IA 2J87A 1YI0A 2ZJ6A 3CPEA 3HU1A 4NRDA 3ZHCA 2ZBUA 2NADA 3CZ9A 3D3KA 1DARA 1U0BB 3ICCA 4UDXX 2PX0A 3OCCA 2IEBA 3ZCVA 4ESOA 4TWAA 5J4VA 3A1VA 1L7DA 1UZUA 2YWFA 3UKOA 3ENZA 2OAQ1 2YRXA 4FKMA 2WWYA 1GZ3A 4EG6A 3EIXA 1T29A 4G4IA 1Q74A 2VR1A 1I6LA 1SZCA 3HA2A 1A2BA 1YZQA 2JCBA 2PLRA 2QF7A 4AO7A 1YC5A 3D02A 2NP7A 4NP6A 3WB0A 3STHA 3KB2A 5EXTA 1J5PA 4TQGA 5JWHA 1KE2A 3U31A 3KXKA 4AX8A 3UMVA 1FMCA 1SOUA 2H2GA 1TKBA 2Y68A 3AEUB 3GNTA 4MQ6A 4NBRA 2O4CA 1AQUA 3SVTA 3GJSA 3OT4A 3Q8XB 4JA0A 4PNZA 4BWYA 3GGJA 1U0TA 1I5EA 1MB3A 3F47A 3IAS1 1E5TA 4P0TA 3N0XA 2IU0A 4BKOA 1CS0A 1EP3B 1FBTA 3BL8A 5EMKA 3LYLA 5BQ5A 3FOAA 1JKJA 2G1KA 1U3GA 3QGMA 3QUTA 4G8JA 4LRSB 1JI3A 1JR3D 4QNNA 1BOOA 4JBIA 4DUGD 1CETA 5BWBA 3SEZA 4EYSA 4QVIA 1PDVA 1LPMA 4XOTA 4JB2A 5EIAA 5L53A 3RAPR 4HLNA 1XQ6A 3WYNA 2NM0A 1PT9A 1M3SA 1VLVA 3PLNA 4R8VA 5EZYF 1G19A 1ZAKA 4U9UA 5TRTA 3PJEA 5TEWA 1Z0KA 4NQRA 1Z5NA 1L7VC 2WQZA 1NXPA 3TQSA 1QE0A 2FMFA 4BUCA 3PGKA 3RYIB 2F3RA 3RC3A 3AHEA 1SOWA 4A73A 4ZAGA 4AJPA 3K31A 1XTBA 4CG2A 4YRLA 2X3FA 3QBEA 2JARA 3EZLA 3BXXA 1TVKA 4XARA 3L7OA 3FPBA 2P5TB 4MKXA 2PM8A 5CGZA 4H59A 4R98A 2AJBA 4OSPA 4EQZA 4C7OB 2AMJA 1H23A 2C98A 3T7TA 1JAYA 3HJAA 3P1JA 2LD4A 5KYNA 1W49A 2A86A 4GXTA 4O1MA 4JGGA 1BH2A 4WNAA 3NHMA 2B1RA 1N7JA 1L7AA 4JWTA 3P9YA 5K9ZA 4W99A 5DI3B 4HUQA 1EK5A 3AUSA 3CZCA 4QUHA 4L8GA 1NKVA 1KFCB 1LI4A 4MIEA 5DM70 1I8DA 1U0JA 2I76A 4IV0A 3ZNQA 3PF9A 1AF7A 2X1MA 5AI9A 4F4HA 4ZV4A 5T7BA 2XZPA 4BN5A 4XWTA 5LR6A 3PQ8A 1ZK3A 2H3EA 1ZZGA 2I33A 3GJ4A 1X86B 4YV2A 1B8NA 3PFHA 2QORA 3H7AA 1K06A 3BF7A 3DBVO 3U7IA 2ISCA 2XUFA 4IZHA 1TNDA 3CRVA 4EATA 5BWNA 5I4KA 5T57A 1B0AA 3EDCA 3GN1A 3KM0A 4LVCA 1GR0A 2A94A 4L85A 4LOKA 3G5TA 2J0VA 4CNBA 2IH4A 3CO5A 1N6HA 5JANA 1R6AA 2I55A 1DTWA 4PFQA 3WQQA 3BE4A 4JI6B 1M9NA 3AP2A 3WX0A 1MIOB 1DAEA 3CEMA 2J07A 3LK6A 4QDXA 2YHSA 3PB3A 3KETA 1EWQA 2QSYA 5B7NA 5FWNA 4LNUB 2GHQA 5ALVA 4I2NA 1JWLA 3SIWA 1EXVA 5FOWA 2BHSA 2PS1A 1F0NA 2X9LA 2CWDA 3QTTA 1X94A 2YXNA 1FUKA 1EE2A 2C92A 2C5GA 2PMBA 3L07A 5ALJA 4ARAA 1FRZA 2VF2A 5J1TB 4BATA 1UPCA 1JKFA 2NO9A 2QS9A 5IFLA 1T35A 3Q87B 1C1XB 4L4ZA 4BVJA 1B1AA 5AKGA 3TW0A 2EU8A 2VTKA 1ABEA 5CLFA 3JQAD 3CLRC 4TS1A 3B1XA 3IP7A 3LVBA 2CDAA 4XR6A 5EGNA 1WE2A 4L3WA 1YS2X 1RTKA 3L18A 3S1AA 3ZD9A 2ZFUA 5THXA 3TZEA 2C78A 2RGNA 4PC1A 2JFGA 4A1OA 3L0DA 4BMOB 4D45A 3D0RA 5EJ6A 3VPHA 2J3DA 1SIOA 3E05A 3IUNA 4X20B 5FTNA 3A04A 3NIFB 1CWUA 2PYDA 3FFBA 5IUNC 3IIEA 4TLLB 3DWGA 2IEYA 3OQBA 3UY4A 3N2KB 2KLHA 2YH2A 4JFRA 4JJZA 3ZVKA 1X77A 1RRGA 3SQMA 2X0EA 1NLZA 1J8VA 2ODBA 3L41A 1VB3A 4I19A 1XELA 3GFTA 4J7AA 1ZH4A 3O91A 1BA3A 1JQ5A 2HWYA 1R0LA 1Y37A 3MFYA 4NCXA 1QAOA 3VOAA 4D42A 1S9HA 5EA2A 1T5BA 4XD7D 3CNNA 3DP7A 4YV1A 3P0IA 3QKTA 1AA9A 3RYFA 1QE5A 3QFHA 3V4VB 1OLXB 1O9GA 3CVYA 1OH7A 1ZG3A 1BKYA 1YL7A 1KU6A 3DQZA 2ANCA 3PTZA 5AHOA 2C4HA 4XGRA 5C34B 2JVIA 5KVSA 1T9AA 3OKPA 1ESEA 2F3QA 1F6DA 2G09A 2PRJA 4AJ4A 3E61A 1PEKE 4JYCA 4CODB 4F7DA 2BEVA 4WY2A 4D6XA 1VHEA 4G89A 3G7NA 2V55B 3LT2A 4KN5A 4LOJA 4RANA 4B47A 3G85A 3GMIA 2ZYDA 1GZ4A 3V4RA 4GO1A 2VO1A 3B6KA 2P9FA 4GI5A 2QTBA 3ANYB 2UUOA 3KHTA 1WRBA 5JQGB 3KSMA 2AR0A 3KB6A 2CWWA 1SXIA 3M6WA 2VJMB 3R6TA 3QOYA 4KQFA 1WTHD 3RYHA 3V1LA 2GCNA 3WDLA 2ZZMA 2IDMA 3FVQA 4QO8A 3I1FA 5F2EA 4CM4A 1JHUA 4XJSA 1RSZA 2UZ0A 4EGAA 3VPGA 3U4IA 2IY9A 3ADDA 3FPKA 2OXTA 1IY0A 1NZDA 3ROTA 3TTVA 5J2UB 4KVGA 4OJTA 4C3OB 3L4JA 4WKNA 3D7RA 1DMSA 4H60A 3O5AA 5AKEA 1IHPA 4KR9A 3AF2A 3DCJA 1CF9A 1Z7BA 3UAZA 1NRJB 1S4MA 1H5QA 1NOKA 1U3TA 2CNLA 2RBKA 3ANTA 4CKYA 4Q12A 2O8BA 4WXPA 1XZQA 2R8EA 4MRAA 5MFZA 3FPPA 3ETLA 3HB4X 5D87A 4U7PB 1CIJA 2XLCA 1PT7A 5HKLA 3KKNA 1Q57A 3N2GA 4D0GA 4MMXB 5JAPA 4BYGA 1Q0UA 3DO6A 2HREA 1VCIA 3R40A 4ZEVA 4KHZA 4A10A 1NNUA 3TJZA 4V1CA 3C8ZA 5L3QB 2NVOA 1GPBA 2WJGA 3FVTA 3GLKA 3P9IA 3FGNA 3EEYA 5JNRA 3HA3A 5JTUA 2PGOA 4EYKA 2IHNA 4ZI3A 1EGVB 1CK4A 2YC2C 2IP1A 2QG4A 1FMLA 5E6RB 1SHZA 1CDOA 3AJ8A 3KWJA 4O02B 4ILEA 5K99A 4D3ZA 2XNJA 3MS4A 5B6PA 4EG4A 2I80A 4B17A 2C88A 2VHXA 4RHUA 4XIYA 2Q45A 1ODJA 4CIXA 2YMMA 2Z83A 3H83A 2EP5A 3QNMA 1S8OA 4M21A 3W34A 1BD3A 3ST7A 1QZZA 1ZMRA 1UDCA 4Q9AA 5FBWB 3K5PA 1E0KA 4GRAA 1N2JA 2CZGA 5LPNA 3N7UA 3K0FB 3G71B 5M34A 5H3CA 1Q86D 2ONZA 4GYWA 1H8HA 2AFHE 4PSCA 5F1YA 1F3LA 1JLMA 1L3IA 5ED4A 2A30A 4X8LA 1ZNYA 1WXHA 4LKRA 4AF8A 5A04A 4KO1S 2JFPA 4E1AA 3UGJA 1TB4A 3DV0B 3HP4A 5FWDA 4B40A 3GFFA 3RU7A 4X85A 2GZDA 2VHVA 1ZJZA 5JXIA 2EX0A 4JI2B 3RRZA 3QX8A 4Q01A 1JFTA 1SAYA 2KB0A 1QFZA 2DPLA 1PX2A 5DK6A 2A5DA 4U2KA 3SN6A 1PUJA 1S01A 2VH2A 1E7YA 5K7SA 2BL4A 3DD5A 4MQFB 1QQBA 1KI2A 4LRQA 3AEUA 3TTSA 5C1IA 3O21A 4N3AA 5DT9A 3B6ZA 4JHLA 5BSTA 3VR3A 4E5MA 1NOJA 2DBYA 4AF7A 2J4DA 1NUTA 3LUBA 3Q6NA 4AVYA 1TQ8A 2JH9A 1S72B 4FNAA 4KWIA 4PLCA 1VCMA 2GNAA 3I32A 4XQEA 5D5HA 3WIBA 4W5RA 2X9QA 4GM1A 1T34A 1P9LA 3QW2A 3TL3A 1LLUA 3WLQA 4DDTA 3SQWA 4H4DA 4MYTA 3EZ2A 4ITUA 4L8WB 5DI9A 3ES9A 3ITEA 3NWBA 2BFEA 1XVUA 2XBLA 3U17A 8LDHA 4R31A 1QYXA 2EKQA 1QV6A 4IFBA 4NNOA 4AJ9A 1U8YA 1T8SA 5F12A 3K6JA 1K1EA 3L3BA 1JIKA 2RH9B 2CZQA 3DWIA 3QXSA 5JJCA 4M76B 3KNZA 2A5GA 3AI1A 1TYCA 3N1UA 3R2JA 1BN6A 3L77A 1RPNA 2V97A 2JN9A 1S02A 3O90A 4PLPA 5H4GA 1IOLA 1FSSA 2DUJA 3IBFA 2OENG 4GE0A 5ERYA 4B3BA 3JYNA 4ARZB 4UHHA 1C7FA 3R7LA 1UPTA 2VFAA 3GBPA 4Q1AA 3UMGA 4C7OA 4NR0A 4TZ6A 4MWGA 2GZHA 1XPJA 3RADC 4DPLA 5E6TA 1R10A 3OQNA 1LCIA 3KWFA 3RFXA 1KEVA 1L5OA 2Q50A 2IY8A 4TWRA 2WFMA 4MQEB 4X8HA 2AXNA 4UBNA 1Z0IA 2PRZA 2WYVA 1GLNA 2H92A 4N7JA 4CIVA 2AOTB 4QBHA 2JANA 1WO8A 5LA6A 4YV0A 5JRJA 1XXHE 1CUCA 1T36A 2YZMA 4NZYA 4E6PA 2BZ1A 4G41A 5NLLA 5BMOA 1GU7A 3N39C 2XCLA 3NIBA 4E6EA 3R3XA 1QHSA 3RS9A 3A32A 3PWSA 4AKTA 5HGJA 3FMGA 4D41A 1PJBA 3PHIA 3UMYA 1Z8HA 4IEEA 3NETA 5A88A 3A6EA 4TN1A 1B3RA 3AIIA 1E6UA 3O2QB 4ZOQI 4BUJA 1O4VA 3QYJA 4ZPJA 2UZ1B 4OGGA 4BC1A 2YYSA 2C94A 2D0OB 1RI1A 2X4IA 1ULUA 2O54A 1U9JA 4XM3A 4N7MA 1Q6YA 3ZDYB 4N7RA 1ILEA 5LZ7A 2IPAB 2D5AA 2K2QB 3UJAA 3TS1A 1PKXA 3TVYA 3WK6A 3ZZ1A 2NMVA 3A1SA 2DY0A 3W1WA 1FRQA 2P3OA 1CUDA 1MIOA 4R9RA 5EE5B 4RZIA 3EA0A 5JE8A 4DNFA 5K0JA 2Q3BA 3CX3A 2EKBA 5CVEA 2INGX 4LNUA 4OOXA 4QHYA 1J23A 2F1KA 2FMXA 1SU8A 1SU6A 5EKTA 5HE9A 2OHIA 3E9ZA 4UUPA 3SK0A 2XCIA 3VTZA 2VTVA 3UO8B 3F4KA 4KZPA 1EDZA 3LP8A 4XDZA 4EO9A 1N6NA 2HK8A 4KU4A 4FFNA 1KPHA 2DTXA 3UTCA 4II7A 3MGAA 3LE8A 4KQ9A 1C1XA 1WNTA 4JD5A 4DC0A 2GRAA 4F97A 4NTZA 2DHQA 3CVXA 1H3EA 4ZOCA 1I1HA 3PRKE 2PQ6A 2XB6A 1L5YA 1PGOA 1TMKA 4CQMA 1C50A 1QGUB 3GJ0A 4MVJH 2IV2X 1OREA 4JUDX 1J1IA 2VT6A 5EIHA 1C2TA 2W00A 4OQ4A 5DW3A 2NSHA 5FLYA 2ZAMA 5HK8A 4HMPA 1KYIA 4XB1A 1ZYUA 3EOZA 4UEKA 3HCFA 5HIMA 3VO1A 1KHHA 1WXGA 3BQNB 4M49A 5AUQA 2FPIA 4C0LA 4E4YA 1FIUA 1DMRA 1N1MA 2E9SA 2RJ3A 5A7GA 1JAXA 1KSHA 2IUUA 1NTOA 1Z4QA 4MICA 4X20A 1IQRA 2KPOA 2DFVA 1ORIA 5E8JA 5C53B 3TDKA 3LHDA 1QB8A 1MC4A 3QA9A 4D6PA 1DEHA 1P1KA 1E7MA 1PHRA 4MPTA 4BJHB 4DIOA 1LLDA 2POCA 3TIFA 2NUTB 2IYZA 1KIFA 3DOJA 3OTHA 3WLEA 3SIRA 3UFXB 3WK4A 3GLFB 3MTJA 3V4SA 4O4IB 5DXFA 1C8LA 3AILA 2R3SA 4A8JB 3FRIA 4RESA 1QPZA 2CV2A 5JNWA 2HSDA 2VDLB 2ATEA 2XE8A 1C7JA 1DEKA 2JW5A 2RC5A 2XW6A 4N48A 3N7AA 1RHUA 5GGYA 4DXDA 1H93A 4FHGA 1Y8RB 3X2SA 3RROA 5I9SA 4WA7A 3K1ZA 3L1IA 1UJ2A 1ZVQA 3ZWVA 2C97A 1SPXA 1BMTA 2ZIUB 1G16A 1PS8A 1UIRA 3AI2A 2IBSA 1XF9A 3PNBA 5AH0A 1OLXA 5KOYA 2GPYA 3ISJA 5G02A 4BZPA 4P0QB 2EG9A 1ZL2A 5EGSA 1GGFA 5DISB 5JEEA 5DSZA 3G23A 4NYMQ 3SYTA 4XR9A 5HRCA 3R75A 5IWAB 4XYGA 2HCJB 3OKXA 1YI2B 2DPYA 2PJZA 2G9NA 4NE9A 3ZVRA 1NBMA 1U7TA 3B6IA 4WUVA 4XSVA 4X6XA 3ZJVA 1V96A 5DNCA 2UXBB 3JZFA 4FYIA 3BH0A 1W29A 3R9WA 5BRAA 3OJ0A 1U9YA 2ZZFA 1DBQA 2SHKA 4GPD1 2COKA 2PFKA 1WLSA 2VJQA 3MJTA 2EEZA 3TTTA 1EESA 3GLHE 2GGSA 1HDCA 2ZYRA 1BMDA 1XTIA 4PR0A 4K6KA 2NTJA 5E4YA 1NNLA 1NSFA 4MPPA 1JEOA 1GT6A 5LZ8A 2OV4A 4TS9A 5TGDA 3EVNA 4E5SA 4URXR 4J1NA 3QWIA 1L9XA 2AKAB 1UBCA 4HDNB 2OAGA 4FDUA 4M38A 5D1NA 5EIWA 1JZQA 4URVR 2OV8A 2RB5A 3ANLA 4HQNA 1MDFA 1FDSA 3LXUX 2ZUTA 4P6VF 2CJFA 4DSZA 1JKIA 5J2UA 5DS0A 3F8WA 4BBZA 4MHTA 1HUQA 2GYUA 4EYGA 3UM9A 3EGDB 4AJNA 2BFPA 2G0AA 2J9ZB 4PNEA 4ZCLA 2DLDA 1KY4A 1F12A 2AYYA 2XDQA 2ZU6A 2IZ0A 4TLEA 4XM1A 5EQFA 3W2GA 3U3OA 5ADWA 1SELA 2J3KA 1JS1X 1QVGB 3ANNA 4S1WA 3WLIA 4BTVA 1FX0A 4BLPA 4DSOA 2EP8A 2QVXX 1ODLA 4RTPA 1DWQA 1QORA 2FQXA 3JQDA 5A0VA 2H51A 1GIAA 3KQHA 5KYWA 5FBVB 2F1OA 3F97A 3NDJA 3CCJB 3OLQA 3H2GA 4R2LA 4TYMA 4XYLA 5L3QA 4MWDA 3ADOA 1EIWA 5E9QA 1H2HA 3T9CA 3LF1A 1W88A 4ITVA 5U4XA 3D26A 3NHYA 2XGSA 1C7QA 1VJRA 2XWQA 1OX4B 1GZHB 2FTKE 2XUAA 4FKZA 3RIEA 2BCGY 4KIWA 4PYMA 3RODA 3UXEA 3ZV5A 1OY1A 4OREX 3D6HA 4J4HA 2NU9B 1U02A 2Z9BA 3HPQA 2JFOA 3CT4A 3FPHA 2WY2D 4D4LA 1JHOA 5JQGF 3D5QA 3TINA 3ODGA 4RNDB 4JEUA 5L3RA 2OCYC 4YP6A 2BY4A 1BAPA 4BDTA 4BRZA 1VKOA 3C7DB 3FMOB 2PMDA 1JFVA 3GEEA 4AMZA 4MJXA 1THZA 2K4MA 3LOQA 4RKQA 4CLEA 4BCCA 5IMSA 2G8LA 1DIAA 3DKRA 3VH3A 4C1NA 1V5VA 4BB9A 1WTCA 3CPWB 2P2DA 2JI4A 3K0FA 2F7SA 4HR7A 4YIKA 4BNIA 1E59A 5DM2A 4C2AA 3QF4B 4OK3A 3AMVA 1AY0A 1EU1A 1RMQA 3K09C 5EHGA 4GXRA 5IDQA 2FV8A 1EHCA 3A7DA 2G88A 3F4BA 4E08A 2PX3A 1EJBA 4RORA 3WRYC 3CO0S 1IWPB 4QUKA 5BN3B 4RKYA 3FKSA 3DV0A 4G63A 2TMDA 4CV2A 3HJNA 3I8SA 1NM5A 1DQSA 3K0BA 1KJ9A 5KOJB 1UJBA 5FCDA 1ZUNB 5JZSA 1YJAA 4WNCA 5LQNA 2NZJA 2A3RA 4ZV9A 1U0EA 4L9AA 1O0BA 2BFAA 4MQFA 2A1UB 2IW3A 3BXZA 2IIVA 3MBOA 2PNJA 2JH3A 1JEEA 3L0PA 1G42A 1VLHA 5HJEA 1XPUA 3HJBA 1EFDN 3K32A 2PFGA 4Z4SA 5U4QA 4YV7A 4Z4YA 3ZGNA 2AE2A 5CD1A 2VQFB 3MMPA 1PP4A 3DZCA 4AURA 4WT7A 4YUYA 1E1DA 4BE9A 4P5DA 1HT2E 1LSUA 5EE0A 4BQPA 3WNBA 4FGKA 2Z58A 3EVBA 2BFCB 3NJ4A 3SHVA 3BZUA 3W5IA 3HJCA 2PD3A 4UASA 1E9RA 2FMKA 5CT4A 3RFTA 3ZWNA 2ZJ0A 3BFJA 5KDOA 1TZ2A 4XLAA 2OWDA 3ZBPA 5T67A 1K3UB 1KZ4A 4US0R 5ICMA 1XWIA 1FXWF 3H8SA 3L0BA 2FB9A 3AIMA 5DYNA 3SC2A 4AUKA 4I9GA 1AKVA 4X8MA 4MUIA 4P5EA 2BGUA 4FBGA 3QVVA 2BDUA 4C7JA 2VATA 3V97A 2B36A 1Q12A 1L8LA 1FSFA 2WHYA 3JQCA 4HAVA 4JBXA 3D81A 2Y9MB 3EZGA 3LRXA 4KO2S 5AMXA 3EDRA 4R1LA 4GYYA 4FJ1A 1NVFA 2JFWA 2X2OA 4GC5A 1MPTA 4QEZA 4Q4HB 4U3JB 4Q9HA 1KBQA 1X1CA 2HSEA 3UFBA 1MA0A 2D3WA 4O4HB 2FR8A 5F77A 3WJ2A 1X9IA 3K9HA 4WZ6A 2ERYA 1ACJA 3KOXA 3MZ0A 1ZD4A 3BULA 3EFOB 3AINA 3MTIA 3G88A 2HA0A 3QELB 5K05A 4TUYF 4S1OA 1Q7RA 1P0FA 1MQSA 3EGVA 4ZCRA 3TQOA 4IUYA 5KTMA 2IXDA 2AOTA 4Q21A 1T4MA 1X7ZB 1Y7LA 3E3AA 3L8MA 3X1DA 3RUDA 1A8IA 3EWNA 1RXWA 4S12A 1JL3A 4G67A 4C89A 1WXXA 4RC9A 4PG8A 3HCDA 1Y8AA 5E1MA 3JQ9A 3TCNA 1DXQA 1SURA 3CTAA 1E1CB 3GELA 3ZKWB 4OG2A 2AFVA 4G9GA 4PTLA 4MQ4A 1NQOA 2NPIA 6Q21A 3QX7A 5K0EA 3MFQA 3HP1A 3UJCA 3RK4A 4FGUA 2UZ1A 1XL1A 1RW4A 3LX8A 2GKOA 3LXRA 3T4EA 4DMRA 5JTTA 4KQIA 1NKTA 1PR5A 2H8GA 1HC7A 3EPRA 1ZOLA 3NTOA 3QWHA 2OFXA 1ZD5A 1EFHA 2E48A 3MUOA 3BY1A 1ZD9A 3Q1LA 2E1BA 3I09A 4ZOEA 4B3DA 4BX9A 1JH8A 1RKXA 1OGYA 1NJ6A 2PKCA 3K73O 4FCVA 4UKDA 1BEUB 3STTA 1N2HA 2BFFB 2QZ4A 3E3MA 4A0HA 4LYFA 4MGKR 1QTNA 1YQGA 3G6EB 4FOLA 2AC7A 1JQ3A 2LCQA 3SJPA 2A4MA 4WJKB 5EJ7A 3E5NA 1QR2A 3RS5A 1DJOA 1BFKA 4KGXA 3MJFA 3TLGB 5CDUA 1W93A 3B89A 2FUG1 2VYQA 2HWWA 3U62A 1V16B 2ES4A 2HJWA 2A8YA 1DO0A 3GR6A 1L7PA 5KYXB 1YITB 1LVGA 4LZOA 2E4XA 5GGXA 1M6VB 1HMPA 3I9FA 3LWBA 3VGJA 4OJNA 4HUJA 5IM5A 3JVDA 5FTWA 4DR2B 3PYLA 2QN7A 3FVVA 4WUTA 1QGUA 3LA8A 2YS6A 1NP6A 3AV0B 1WX1A 5AJHA 2Z2YA 1KHTA 1UBGA 2FLKA 1HNWB 2B4YA 4QT0A 2XB2A 1R12A 4S0ZA 3WXMA 1W94A 4N5NA 3UPDA 1DEXA 2ECOA 3W90A 4MW2A 2GKGA 2OKCA 2XQJA 4ICIA 2ECPA 3G3EA 2H9YA 1NX6A 3JYPA 1N57A 2I7DA 1ESMA 5AK0A 5IAKA 4EJSA 4TRMA 1BRTA 4Q4AB 3WDSA 5I7WA 4OLHA 4YB8A 2FMIA 2JIZD 5F2OA 1SBQA 5EQTA 4DN6A 1GGJA 3TG2A 3KE8A 5AUOB 2FPKA 4XGKA 2JCXA 3VC2A 4KMRA 4RGVA 3GLFA 5HRAA 1BXZA 1ZRHA 4PPGA 1TYDE 2XGMA 4O4IA 2VHJA 3TO5A 4V0RA 3DDNA 1XK7A 1U6KA 1FYDA 1USGA 2PL5A 2ZYIA 4R2WA 2R96A 3UB4A 2IIQA 5DNWA 3VDNB 1Q1NA 3K1YA 4ZYVA 4YRMA 1KXJA 3EA4A 5FUMA 3AF0A 3DVAB 4Q34A 4PNPA 1UMCB 1Y8RA 3NJRA 1BX1A 2ONCA 2GQFA 2QVYX 1Y1RA 1IK4A 2L19A 1GPNA 1NASA 1QKJA 4RDCA 3WB1A 4NABA 3I2GA 1R0YA 1X1QA 3M8KA 2I4LA 3E7DA 3GAFA 4EFDA 2BZSA 1QS0B 4IUCS 2QUIA 4NENB 1T3HA 3WS7A 1W35A 4YMIA 1T0UA 3DQPA 3ONNA 2WIKA 5A4IS 3UMSA 4YELA 2X5KO 3IQIX 3MG9A 4A4DA 3QVOA 3HO1A 3FCOA 1GTRA 2LBPA 1H2BA 5H81A 1IJEA 3UJ7A 1JHMA 5C46F 5JZ9A 4Z4FA 2HHAA 1X19A 4X3OA 1NHGA 3NUGA 2ZT5A 2XXAB 4R5MA 1C7EA 4C4OA 2ZL5A 3FFWA 5LL6P 2X41A 2QA4B 1WD5A 3O93A 1OT5A 5HDBB 5K6RA 4MA0A 3SNKA 1YU9A 2X86A 4J7UA 4B8WA 5E7QA 4UHDA 5KYKA 2CJWB 2ZSBA 5B30A 4NJEB 3KHKA 1WEKA 2DFKB 2GPJA 2B8TA 2AFHB 2H06A 4I8IA 4MWZA 3W9BA 3GEGA 4IDNA 2HF9A 5IKPA 2I1WA 1PV4A 1RFGE 3CRZA 3BTUA 3JVIA 4IL5A 3V76A 4NXMB 3RB8A 2GEUA 2QOEA 3EGDA 5AJYA 4E22A 4KE6A 1K9MD 1HR0B 2WVHA 2Q21A 4PCAA 4EG0A 3IMEA 2P6RA 4I1IA 2PV7A 1Y6ZA 5K4HA 2VJKA 3Q10A 1JLSA 4GRIA 4IJWA 3L82B 4YRSA 3R0XA 4DRYA 4OUKX 2HA7A 1EFVB 3B38A 4KDRA 1YSCA 3ZWWA 4DIUA 1XTZA 2W6NA 5AM4A 3PA1A 3G05A 3I01A 1G98A 4XKWA 4AM8A 4J49A 4CFZA 2WZDA 3C2QA 5IEJA 4F45A 2UYGA 1WA5A 1ND6A 2XVYA 3DZHA 1MX1A 5HZBA 4GI3A 4CMHA 1KORA 1A3CA 1U9IA 2XDWA 2H2HA 2QPTA 1R4AA 2YWDA 3BWMA 5TS2A 2XNCA 2GJ4A 2NX2A 1OX4A 3EWSA 3WL5A 4B75A 4CIDA 4UTRA 3OIDA 5LD2B 4KXLA 1OJLA 3BWEA 3TFQA 2NU9A 2BMEA 4RKRA 4DLNA 5KYYB 1U2SA 4Q37A 5ALQA 2HTFA 1OR8A 1UC9A 2HDNB 1IHMA 4PO9A 1TADA 3X3HA 1YFLA 1LDEA 3ZE6A 1LQTA 4YX9A 2UXDB 4CMGA 3I6YA 3T5AA 1FJXA 3TXXA 1V1MA 1X0VA 3PICA 3OA2A 1JEQA 1N3BA 1G1AA 3NFYA 2GA9A 3Q2IA 4X60A 4Y18A 4BQRA 4QTYA 5FAKA 1SBCA 3UK1A 3PVDA 2W2PA 2WT4A 2CD9A 1ZJ6A 3TRIA 5EUMA 3B6MA 4RVFA 1V3UA 4C06A 3LCCA 4CF3A 1ISPA 1XKLA 3GARA 3U4QA 3STWA 4IBOA 3ZHVA 4NFYA 3L7MA 4QOSA 3E48A 4KLAA 2RIPA 2EJTA 3E9NA 3V2IA 3U5TA 2G76A 2FJ0A 1J20A 1H0HA 1Y0BA 1YB7A 4X41A 2X19A 4GM4A 2NVBA 4NLLA 5EPUA 4MW9A 4K2AA 4P8RA 4EG7A 3W2IA 1QCCA 1T15A 3L4KA 1EB9A 3ONEA 1O5OA 1N0VC 5KOJA 1NJ8A 2B82A 4JI8B 1Z38A 2XQFA 4P1VA 4A8JC 4L3VA 4AZVA 1U2TA 2ZQZA 4WZZA 1XXHB 1NZJA 1T2VA 4U7TB 1EVQA 3KQSA 3X44A 3TLBA 5JS8A 5B7PA 1M8JA 2YJ6A 3OD1A 4LHSA 4UPEA 5FHRA 5AM0A 2IHUA 4CKCA 2A5FA 4ITRC 4IGEA 1MCZA 3B2QA 5JH7F 3AVOA 3DE5X 2IBMA 2PT7A 5A5GA 1PK8A 4LVUA 4TRJA 3KFVA 2Z8YA 1GRCA 5D1HA 3R77A 4G8BA 1B8VA 2ZS7A 3ROQA 2BFCA 4YMLA 2HA5A 2X77A 1KH1A 1SUFA 2Y71A 5HMMA 4H0FA 4BBAA 2F59A 1MU0A 3CKLA 1RWVA 2IXFA 1HG0A 2O8DA 3K0AB 2QRPA 3VJLA 4X45A 4TKUA 4DWVA 3S2FA 4PQRA 4FD3A 1W6UA 2OE2A 1TEXA 5A89A 2C96A 4X54A 4EGJA 2HRZA 3TH5A 1U8UA 3T5PA 1ELOA 2DRIA 2W2LA 3B20A 1QG6A 4LS3A 4RZXA 4KLRA 1X7XB 1Q15A 3WGMA 2IU6A 1XQ9A 4U00A 3GJQA 2AN3A 2PWZA 1T26A 3WHPA 3CZ4A 2P5SA 2QRZA 4G0XA 3T5BA 5F7JA 1QHHB 2Y76A 4C4TA 3QLUC 4DHWA 5EWMA 3T1NA 4I1YA 5E2AA 4RDJA 4MYDA 3UMMA 2GBLA 3HY4A 5EE1A 2ZUWA 2L0XA 1XB2A 1SUCA 1Y7TA 5JSFA 2ZTMA 2QY9A 4ZO8A 2IWRA 4N8SA 2DX7A 4RPKA 3EPJA 2FSVC 3GWZA 2WJ4A 4BB6A 4IIHA 1BYUA 2FW6A 4MV5A 4O2RA 1MIHA 1R16A 3EC1A 4XZ3A 5FJJA 3WGKA 3O3MB 2NPFA 1WMSA 3T7AA 2ZBFA 3U39A 1E2HA 1FP1D 4IILA 2F67A 2P4EA 1E1CA 2WV7A 2H18A 2R44A 1ZCFA 3IVGA 3KG2A 1YJXA 2CUNA 2C84A 2CNDA 3RC1A 1SK8A 4BLQA 1F48A 3JQFC 4AZTA 2GTPA 2H4YA 2O23A 5DK4A 3TQQA 4TTSA 2A9JA 3KLPX 1M2WA 3PXGA 4P82A 3F7NA 4P08A 1JR4A 3PGVA 3G6KA 4HL6A 3K30A 4BNZA 4ALKA 4ZODA 2Y0BA 5FLKA 1P77A 3WYFA 4Z54A 4KC0A 5G2OA 5JD4A 5AOVA 3STYA 3OF3A 2D0DA 1TTHA 2VT2A 4YBZA 1VG9B 4CNQA 5H70A 4C7VA 4D7AA 3F6RA 1KI9A 2HV8A 4ID3A 5DDIP 1Z2PX 1UZAA 2C42A 2CXXA 2C4KA 1J42A 2P9YA 3LBAA 5JD3A 3JPYA 1OI3A 1N0IA 4W6QA 4C7XA 3AF4A 4UBJA 4DJEC 3FKJA 2BFFA 1AKNA 1TT5B 2C9DA 4G85A 1U2QA 2ODEA 3FWYA 4G97A 1SVUA 2HL6A 4O4HF 5CCXA 4XOPA 1VJ0A 2F3TA 3OUZA 3DL4A 3VV3A 1P73A 1XGKA 4QDTA 1QANA 3RV3A 3TLGA 1QNFA 2ZI7A 2PZEA 1CDEA 1CQIA 1V16A 2XUDA 3OT5A 3GFBA 3S7ZA 4OHMA 3RYCB 3RVDA 3I4LA 2N3ZA 3C3CA 4B45A 4G09A 3QKSA 1ITZA 1M6VA 3GNSA 1FUIA 1VHJA 4HKTA 3MWDB 2DU8A 3VOBA 4KV7A 1SD5A 2RCYA 3BCRA 2IYOA 2JFHA 4L0CA 4O0LA 1OI4A 1YS9A 2G0NA 1YDHA 4ARCA 4RDKA 4XVHA 3GLHB 3PC8A 1A7JA 1T5HX 1KI3A 4EY3A 1JN0A 1QAMA 4EHDA 4QPJC 4MA5A 1NP7A 3KQYA 3GVHA 4MV6A 3BMCB 4QNRA 2P4UA 1ZNQO 1X80B 1Q9SA 2R8XA 3VFDA 4LYDA 4Z4IA 2RG1A 1IRIA 3H9UA 2A9RA 3LDAA 4D9FA 3TAXA 3PFGA 2OSBA 3EHDA 3X0DA 2NUBA 7MDHA 5HUHA 3I0ZA 2IDJA 4WLFA 1GY8A 2JDID 2YNMC 3HYNA 3MJHA 1QRSA 1JVNA 3UZUA 3PEYA 3KVRA 4UUQA 3BICA 3VNVA 1IMOA 4MV7A 3TNJA 5BVGB 5KQGA 3ENNA 4DYHA 5AW0A 3H87A 5TT1A 1QRRA 1PFVA 3DUWA 4G0YA 1ZNXA 4P5PA 3UOWA 1UMCA 3DTVB 4JI1B 3NHPA 1CLUA 1UK8A 1VDZA 2WVAA 3D4OA 3GLUA 4LCBA 4QTUB 5D85A 3PEUA 3I45A 4LIPD 3IOCA 1VLQA 3ZBQA 3QYPA 4N7BA 1IATA 4C4ZA 3H5IA 1DJMA 2FPGB 2FP4B 3HC7A 4FP9A 3WXBA 4X90A 3UNXA 3II6X 5ELMA 1PQWA 3Q3EA 1HYGA 5HR5A 4NENA 2R6GA 3E82A 5DZSA 3OCUA 1GAEO 5I7SA 2W43A 3BQJA 2PT6A 2Z1NA 4NBTA 4KOAA 1PF7E 4FMCF 4ZRMA 4HMQA 5J5CA 1ZIPA 2II6A 1WMAA 1AK1A 4PC2A 4QYTA 4Y2PA 1VPTA 2QP4A 2ZK7A 3DR3A 3I9NA 4OYHA 3TTWA 3H1AA 3ISXA 3Q98A 4F5YA 5BV0A 1D8TA 1KQSB 2YMPA 4EA9A 2G5GX 4D8VA 5J4LA 4J7CA 3IVCA 4QXOA 2PE3A 4ZO4A 3OLYA 1SIBE 3T12A 1FYEA 1T4CA 7YASA 3HM9A 3I9V6 2CJWA 3K4PA 4QE3A 6ADHA 1UD3A 1WW8A 2FH5B 2MR5A 3KKEA 4FSHA 4R40A 3D4IA 2I3GA 2IDKA 3NCTA 3I83A 3DFMA 4RJTA 3WBKA 5KNDH 4Z7OB 3ROEA 4ERNA 3WAGA 3HJHA 1RXIA 3B8EA 3QLTA 1SOMA 3OEYA 1QOPB 3O3OB 4NG4A 2PLFA 2W2QA 1W46A 2ZRDA 3DM5A 2C82A 4FNOA 4AJ2A 4DCPA 3A2KA 2OBXA 1ZRNA 1EFVA 1P4MA 1XLUA 1Z2EA 2QB5A 1WIWA 2OCAA 1XCJA 4IWYA 4UZSA 1E61A 5CR9A 3WI7A 2V7EA 3Q7QA 1HI9A 4DQXA 3ZI7A 3ADPA 1QHIA 4FR2A 4R1QA 4BJ6A 3ASVA 2V65A 2E85A 4HATA 3V3TA 3V9AA 4D02A 1P6UA 3SNHA 4LJ9A 2X13A 1IFXA 4QD3A 3KJHA 4M7OA 1CUWA 2XOKD 3CM0A 3KBBA 1JZSA 4NH0A 1KE1A 2A0WA 3ROMA 2B35A 1VHOA 4FFLA 3RT7A 4W1PA 4KVAA 3J7AC 2VHUA 3EIOA 2DAPA 1QYDA 5JS1A 5IH7A 2OO5A 4V0LA 4TTTS 4BFVA 1E9FA 4M3NA 4NJMB 3RE1A 2HBZA 3K7EA 5DGTA 3GJ3A 4BZWA 4MRVA 3DOEA 2TMGA 3FCUB 5JW6A 3B1JA 2IS2A 4U7JA 5JPCA 2Q1UA 3WYEA 2QKYA 4YBRA 2YVKA 1P2DA 3KE9A 4II3A 2Q46A 4X94A 4AN4A 2GNPA 2VCEA 5LWQA 3T52A 2P7HA 4AROA 1RJ9B 4LXUA 1G5TA 4MNTA 1CT9A 2XZDA 1G8FA 4X7PA 4EY8A 2VNSA 1Q21A 4UAJA 3DOUA 3UGTA 4J3JA 2VQEB 3O4FA 4LDQA 3R7FA 2ZE7A 4WN9A 3C4VA 3PNVA 2FI1A 4E2ZA 2V7TA 1M8FA 4ZVNA 3R7BA 4K1XA 1CUEA 1F4VA 2J67A 3H2BA 5MGNA 2Q7DA 1M5RA 1EP9A 3FDZB 4JOBA 3N9IA 4ISBA 1W0JD 1M6WA 2FKAA 2OBNA 1OAKA 4MPRA 4URYR 1XXHA 3D8UA 4O6VA 3ZV4A 3S28A 2P3SA 3FPAA 4HBGA 4Q9NA 3KAKA 1KYYA 2O1SA 3B5IA 4L08A 1RHQA 2GCPA 3PD0A 4IQFA 5GWXA 3TX6A 2GPAA 5ARCA 4BXOA 4FHZA 4HZUB 5IC5A 3H5LA 3ZDXB 4BO4A 5IVHA 3GFGA 5TGZA 4B3MB 5JLJA 3GBSA 1HDGO 2XX3A 4DV6B 1OXXK 2WJJA 4W5OA 2AZDA 2FZWA 5KCZA 4R9VA 3FD8A 3ASRA 4RPJA 1RI2A 1T10A 1DKPA 1T9CA 2PMWB 2NVUB 4LXQA 2ZRHA 2FAXA 4IRMA 2WU0A 3R9KA 2VYCA 3USES 1ZESA 3CA8A 1OFGA 4KIGA 4BNXA 4W5JA 2C2GA 3KQNA 4OMDA 1GTJ1 4JI0B 3DPSA 3TBHA 5CLJA 2QT9A 4RQUA 3VPBA 1L1RA 5EXSA 2YYAA 5F3DA 3ZCQA 2AXQA 2HDOA 2OCDA 4ND5A 3FYSA 4CMKA 1OTYA 4L73A 3VNSA 3E7FA 1UD2A 4EH1A 1IAQA 2W0SA 3L8EA 5CNJA 3A3YA 2EZ4A 2Q0SA 3T34A 4DIBA 5JAMA 2C3PA 4DCVA 1AU9A 4GOMD 5CCEA 1IY2A 3C4JA 4UBIA 4XIJA 1UUFA 4IDGA 2VNJA 3W5VA 4GR5A 1VLLA 5AFSA 2WOOA 2GN9A 3IT1A 3C3EA 1E64A 1SCDA 2WSLA 1YDWA 3LUKA 4HB3A 2GPWA 3PXUA 1CUBA 5A5FA 3FUWA 4LGMA 3UF0A 4P36A 3CW9A 4KPEC 3V1YA 3HADA 1W4AA 2B20A 3P9XA 1QIHA 4YVFA 4YUVA 1Q1AA 2HQRA 3CWCA 3R1IA 4K9PA 2NTNA 1LDBA 1RQ2A 1ZM9A 1V41E 3FDIA 5FUWA 1A5SB 3IBCA 4XUDA 1KJJA 2NZUG 1QK4A 2HBRA 1Q44A 3OLCX 4P2NA 3FSJX 3BRCA 5FBKA 2X0FA 2WHPB 4HCJA 4HS9A 2YJ5A 3FZYA 5F64A 4HYYA 2PUJA 1D9ZA 2F1RA 3V7UA 3Q2KA 1ZAYA 5FA8A 3NLLA 3ZPNA 1ENYA 1XYYA 2DG2A 2N47A 5EP1A 2I4RA 4W7HA 4DLSA 1ST2A 3FLEA 2WSBA 1U1EA 1F60A 4Q4LA 4UULA 2HQ1A 3E9EA 1KJWA 4D0LB 3DSRA 1BLIA 1YKGA 2H0RA 2HCTA 2I6FA 3OE5A 4PLGA 4QG7A 4RHCA 4C6TB 3DVRX 5LZ9A 1YQ9A 4LXXA 5DB4A 1Y4ZA 3PE6A 1SUEA 1ZGGA 3FMFA 2ZJ3A 5A3QA 1XJ0A 2J6IA 2CDRA 4PAOA 1EK1A 3HI4A 1XNGA 4M83A 2PGIA 1GKYA 4IWNA 3WGUA 2YVAA 2D0PB 1OFHA 1ECFA 1JVBA 1EE1A 1JFFB 3DLAA 3P0RA 3KHUA 2Z8XA 4UXJA 3TWOA 4C22A 3S8EA 5GJBA 4XCQA 3VPSA 1XWFA 4UHFA 4IF6A 5D3ZA 5FADA 4I6JA 4D9HA 3OCXA 3ZHXA 2B1GA 2W2LD 1ZCJA 4FMDB 4LECA 3CT6A 2GD6A 2Q4RA 3LY5A 2QLBA 3HA7A 4LXHA 1BE0A 1QGED 5CEFA 1YMVA 2IYTA 1TOAA 1VQ9B 1VPEA 1G20E 2GEJA 1RIFA 2QVGA 2WUDA 1CZLA 3C5EA 3HACA 1NLMA 1P4SA 2P1ZA 2WNHA 3QW4B 4H27A 4HWPA 4UZUA 1YHNA 2R6AA 4YMGA 5KNBD 3A4VA 3INGA 4GX1A 1CC1S 3LKZA 3HVHA 4R6WA 5HPYB 2G63A 1OYOA 4G6IA 3GOHA 1PE0A 1RBYA 4RIHA 5TARA 1FFGA 1Z0FA 3D6AA 3E70C 3VR6H 4DPMA 2O8EB 3FSEA 1G8YA 2P40A 3AUAA 2QGZA 3H9BA 1DIGA 3KTAB 1TEHA 1R0XA 5K6AC 3L6CA 3MINB 4BWFB 2ZJBA 4RPGA 5JCOC 1ESCA 2BHLA 2IIPA 1RQXA 1GSIA 1X1SA 4RSHA 3QX9A 1IUNA 2EKDA 1M8KA 3PIRA 5IULC 1CRZA 4JP5A 1TJNA 4WD3A 5DM60 2BHRA 4QBFA 3DDWA 3QPBA 2OTLB 1QYCA 2G5TA 1TAHA 2ZZGA 4DJ5X 3NNSA 1SUAA 3NRBA 2CY0A 5FPKA 3A14A 1RPJA 3A3GA 2PE5A 4DV0B 1M1NB 4XPIB 1NAHA 2PG3A 3M1LA 4UC0A 1FNCA 4D99A 1DTSA 2MINB 4AKEA 4AO8A 3G7UA 1RXSA 4XGNA 7GPBA 4N12A 1ZI8A 3TDNA 5KX5F 1EH5A 4GC9A 6YASA 2CNKA 5DTEA 1NI5A 2IHVA 2WTAA 4RVDA 2FPGA 2AD1A 1XVVA 2FP4A 3N2IA 4TTIA 4CL2A 3KSBC 4DNXA 4ZAVA 5ETJA 1H94A 1T6BY 3GEBA 3OOHA 4GMDA 3EIHA 4IGFA 4WGGA 5CW2A 1ORDA 5IMBA 4M9SA 3OQIA 2WG2A 3UIEA 2IPLA 4XVQA 1IMJA 4DLLA 3IDAA 1EAMA 2X8JB 1FMJA 1A8SA 2O2XA 2I4OA 3C1TA 3IKLA 2H2WA 4G8DA 3V34A 2X1VA 2PUFA 1XJ5A 1AMUA 1BGVA 1GDTA 2YV2A 2IU4A 4QRDA 1KMNA 4JU8A 3UOGA 1Q3HA 1Q50A 1YQTA 1G55A 1FQWA 2AB0A 3AHFA 3EYAA 4YPVA 5JOQA 2ZM5A 2I4IA 2DPMA 3P9RA 3IAFA 4JVMA 4ZAXA 4IHQA 3UJBA 3WSVA 2XTMA 3A3PA 4DA0A 5F4OA 3HE3A 2O14A 4QUEA 4YEDA 4MJ3A 2JLSA 2L69A 1AO3A 1YCFA 2WB4A 2WU8A 3Q3HA 1QIJA 1EG7A 3L1HA 4LWQA 5AOCA 3LBFA 2PT9A 2QD5A 3HEMA 1XAHA 3TL2A 5CPBA 1XFOA 2CJXA 2PUTA 2X7JA 1EG2A 1VM6A 3ASYA 2H57A 2X5OA 2B6HA 2R7AA 3GAZA 4LSMA 4N9QA 2UUPA 3A35A 4OM7A 4OSEA 1O08A 4UNPA 2Z8YM 5JS7A 2QIPA 4PQEA 1CUFA 1KQNA 4DB4A 4LJRA 1B41A 2V6IA 2WHRA 3RNLA 4W9NC 1PL0A 2B30A 2OESA 4FFBB 1A98A 4HTAA 1J21A 2RHGB 2BPOA 4G86A 4W5NA 5JYCA 5JRZA 1VCHA 2B1IA 2VPWA 4F4DA 3SLDA 3CR8A 4LDJA 3Q6RA 2JFFA 4RF3A 5EE3A 2C2XA 3QX3A 2RJNA 1NXTA 3QMMA 4MS4A 3Q9NA 4ZREA 2BKEA 4R8SA 5K01A 3FTDA 1DAOA 2BRUA 1IG0A 2ZAIA 1UXHA 2H1IA 3D64A 4F86A 1UPXA 1HZEA 2BR3A 4OIFA 1SUBA 2AQKA 2OMEA 2ZYHA 3W7AA 1VHTA 2AN4A 1GGVA 4GU5A 4QOJA 4QECA 5IJXA 4MARA 2FRDC 5THQA 1P17A 4CMJA 5JBQA 1NONA 1TCAA 4AIRA 1YULA 3JU4A 3LYAA 1R27A 1NQAO 3IALA 4UPDA 2WV9A 1HDRA 1QO0A 3FNHA 4Q19A 2AD5A 1M7BA 4URWR 1MX3A 5TJ9A 4J4TA 3G13A 4QASA 3TE6A 4DA6A 1LJ8A 4RWZA 2YIJA 1QGOA 4TL9A 5AKYA 3OTWA 3HDGA 3ACDA 4PONA 3W05A 5FFMA 4QUDA 4LHZA 5IX8A 3LCMA 2C7PA 2MMGA 1WDTA 1AKYA 1GV1A 4BVBA 1V7QA 2VAPA 1T0BA 2JAXA 2NWQA 2RH4A 5J58A 1R9JA 1V7ZA 4JJ8A 3MBKA 4WCFB 2CNNA 4BTEA 2QGNA 1M90D 3G1UA 1FZTA 2GK4A 5DHRA 4L9WA 1T2AA 1V39A 4W7IA 4A0RA 5JVDB 5IJ9A 1H1LB 1J06A 2CLIB 2ZP1A 3FDZA 4UTXA 4AJKA 3OOEA 1CIPA 3CIOA 1BZYA 4RK6A 1YA6A 2GYYA 3TLZA 1DC8A 1CQXA 2B37A 2DWOA 4C0WA 3N8DA 1QVAA 3JR7A 1OLSA 1QP4A 1OTXA 2V8BA 3D6JA 3DAYA 4HK4A 3OZSA 2LVBA 1R9MA 3KYDB 1ZGZA 1HQCA 1K89A 1JT9A 2PQ0A 4FOPA 1UPBA 3PQEA 3R8XA 4GXNA 3IQHX 5F78A 4ABYA 3BZBA 2RK6A 1YOVB 1GAWA 4TRNA 4X44A 2LDBA 1SQ6A 2GVDC 4GF5A 4IQ8A 3JAMA 2IOQA 3RVQA 4YAGA 2FKNA 3RPEA 2Q3EA 2PAFA 1NBHA 1EYZA 3E8MA 3OKAA 1Y7HA 3PKJA 4OL9A 3OM0A 4MS1B 4TWBA 1H6BA 2Q6LA 3GCWA 1TLLA 2BI4A 1IXSB 2JVKA 2NVUA 2V3VA 3A9SA 1ULTA 4OOSA 3BH6A 3WJ1A 1G1MA 1P2FA 3U9SA 1LPAB 4AU1A 1U8FO 5ADUS 1GA4A 4KRGA 3T53B 2V3WA 4PX9A 4TMXA 5B5SA 3HTXA 3TNDA 4H9GA 8ATCA 1IVYA 4B6QA 2H2AA 5LDGA 1KK1A 1JJIA 1GVNB 1ST3A 3G79A 4QBKA 1GUYA 1RWOA 4RD1A 1QGDA 2BGMA 4MGIR 2JGMA 3CKMA 3E4DA 3KJGA 2VHZA 3B2NA 4TKVB 4ZO6A 1U28A 3HLYA 1Z5PA 4NZ9A 5HZMA 3EMDA 3I4CA 4DCCA 3HDQA 2VA9A 1DSSG 5EJMA 1GCUA 3IPCA 1E62A 2YWJA 3QLVC 2XCTB 3I0MA 3ZU4A 1W5SA 1IUKA 4DIMA 2Q6IA 2PGJA 4HFJA 2WAAA 2D5IA 4KX3A 4PGGA 2O6LA 3RK1A 3SBDA 4AULA 4MP6A 1R6UA 3HRIA 3PPYA 4BP8A 4I9UA 5AVJA 5CRIA 1U1FA 1Z26A 1TK3A 3D4LA 3BWCA 3K15A 3L0CA 1DZ3A 1KKMA 1VBMA 2P7IA 5K2MA 1XLTC 3C3MA 4RCZA 4I5DA 2YV4A 1KGSA 3NM6B 1H0SA 3NWEA 4QOFA 5EMMA 1DCMA 2WHPA 4QUZA 1D2GA 2E4YA 2K5UA 4P38A 1PRYA 3W5CA 4BQQA 4BCBA 4ZEXA 2FW9A 5ALPA 1ZN9A 1U3FA 4QVJA 5ER6A 1E5DA 4K6HA 1ZOIA 2QG9A 1NURA 4JLBA 3ASQA 4L27A 4NU0A 1GFZA 2YRWA 1NXVA 3F1LA 3LUGA 4J2HA 2ZZNA 3SKYA 4UUMA 2ZE8A 5CA1B 2I4NA 2H85A 2PL3A 4PFSA 1ZW6A 4H7IA 5JXJA 4JLJA 3FIJA 1F0YA 1ZITA 3SM9A 1KZLA 2CW5A 4A82A 5HTOA 2GO7A 1QGAA 2VZ9A 3UOAB 4NFSA 3EFEA 3BH4A 1QLJA 2FK7A 2RGBA 1E2GA 1JFFA 5KIAA 3L7CA 2WI8A 1AD2A 1U5BA 1VP3A 2OP1A 3RYTC 3GCDA 4E32A 3ER8A 2QAGC 1AQNA 2Y1GA 5F76A 1WR8A 3CEHA 2H17A 4GW3A 4IRXA 5I5GA 3TR0A 1ORTA 3ZBUA 4P58A 5C51B 4PWYA 4JXXA 1JF8A 1NA5A 1BHQ1 3MOIA 1UEXC 3IPAA 2AZTA 1U8AA 4RHEA 4FQ5A 3RUAA 3V8BA 3C7CB 4N6NA 4ZJUA 2XF8A 1D4ZA 1NJGA 2HSGA 4OFZA 1UQTA 3LG2A 4ARUA 4B4VA 4FFVA 3U3MA 2XQKA 4L4XA 1HSZA 4YDRA 1J4AA 2ADFA 4BN0A 4JJ4A 4YRIA 3BTVA 1CRPA 4J29A 3MC1A 4QJBA 2QR5A 2Z5GA 1AKRA 1T8PA 1UKVY 4W5HA 2YN0A 4PX3A 2QQ5A 1RI5A 3ZR4B 3O7WA 1MKYA 3OLWA 1K9SA 5IYZA 2V4ZA 4QUBA 2AG6A 3W3AA 2OFFA 2VYNA 4BNGA 1N4AA 2O8EA 1Y8ZA 3LLUA 1XD2B 3MNFA 1CP2A 2P67A 3Q8MA 4YRKA 3JW8A 1GQYA 2SECE 3JD2A 3IO5A 4JYPA 4PF1A 4CDNA 1VJ5A 3VC1A 4NL4H 4FM9A 1CY1A 2RHBA 3BRWD 3KYJB 1DRWA 4QDZA 3PQ4A 1XLVA 4EEKA 1HFKA 2F90A 4DMLA 1XMXA 2AUTA 3H11B 3V1KA 5KJ6A 1KR2A 1SZPA 2OO7A 5IH3A 2HQSA 1N33B 3PD1A 3VKWA 3MPOA 3H05A 2NU8B 1II8A 1Y3HA 3PUHA 4JK3A 3IP3A 5IC4A 4HBZA 5L3SA 4C05A 1KOJA 5ECDA 2J3QA 4IXWA 3AEQA 3PFNA 2BE9A 4M86A 1R0CA 4FMDF 4IFTA 1JG4A 1E2PA 4XPIA 4NS4A 2G9QA 3SJUA 5I8ZA 5CIQA 5TEVA 5A6SB 5FA6A 2HUNA 4UNNA 5GQSA 5DCYA 1YZVA 3NWJA 4HNAA 2O5VA 3LH5A 5DMHA 3HGTA 4J16A 3ZWQA 3P9KA 1QQ7A 2ZSEA 1CE8A 4C76A 1NOIA 2GS9A 2ABWA 2IVZA 1FU4A 2Y8EA 4ZEOA 3TM4A 5KTSA 2P5UA 4X00A 3HJFA 3LA6A 4PGAA 3R7WA 2HFJA 4QOHA 4Q18A 4NCHA 2Y0DA 3T6KA 5H83A 4EB6A 5HS6A 4BB5A 2ZJZA 4CM9A 5LQMA 5BSRA 2HWUA 4PQYA 2ZTNA 2D1QA 4ZT5A 1E1KA 1ICIA 1EK6A 5HSGA 5JCPA 4CQNA 4ROSA 5AJTA 6ABPA 1MAAA 1Z8FA 4NMXB 4DR3B 3IIJA 3W9UA 2BFBB 3GEIA 3C3AA 4H3VA 5JSYA 1GTZA 1DQRA 1GCAA 3GRRA 1KP3A 4MCIA 2D62A 1RRPA 2D2XA 2ZTSA 3WNDA 4FOSA 4KGDA 2Y2UA 4QU8A 5BSGA 4L5CA 1G6HA 1Z62A 1ODKA 1N6PA 1TA9A 1MEEA 1GNVA 1F14A 1NMEA 4PM4A 3SF0A 4ZTUB 3ND6A 3W8FA 2OAP1 3P9NA 2O3QA 3AEXA 1F5SA 1NW7A 2C5FA 2GEDA 5DYWA 1DKNA 3WBFA 5BNFA 3O2SB 2GERA 4QDOA 1XG5A 3MYRA 1PBTA 4IIEA 2CVFA 3TZLA 4PYJA 2HH9A 2IYYA 2IIBA 3I73A 5EWLB 3VYRB 2AK3A 3ZV3A 4PZEA 1II9A 2QN2A 3PSAA 3VJRA 1PS0A 2Y6UA 4FFBA 4QWMA 3CLTD 5FFFA 1I2DA 4EPYA 1DQZA 2QT1A 3WSTA 3EA5A 4NMWA 1QCDA 3AUKA 1Z2NX 4F5EA 1E3IA 3MWEB 1NXOA 2MWMA 5CDSA 1B0ZA 2DM6A 3RJZA 5DP1A 3ZE8A 1J2RA 3N6XA 5BQOA 3V2GA 3FTFA 5BVHB 2XMGA 3TJRA 2V03A 1Q17A 5I4IA 4BLWA 1TDJA 3I6BA 4P26A 1C41A 1MO3A 2I2FA 4EHBA 1NLUA 3JCZA 3ICVA 2JAPA 2VAXA 3PJRA 5FQNA 1U4SA 1WQ3A 4OPMA 4INZA 3NI2A 3KT0A 1E1YA 1YRQA 1HFJA 3RABA 2PGNA 3F6BX 2BR5A 1MOPA 1XFDA 1AC5A 5SY4A 1YO6A 2QP3A 5KW9A 2WZBA 3ND8A 4K6CA 2VP4A 4MKFA 4FZJA 5AO9A 3RBVA 1M34A 5JC8A 4KR3A 3EGWA 5DTRA 1ZGAA 4WVLA 3BC9A 2W7TA 2YXBA 2CFRA 1BWRA 3K0CC 4M22A 4P4TA 3LHIA 3QUBA 3IEVA 4YJFB 1RABA 1V47A 2O4UX 5IDWA 2Y9PB 1N25A 3VX4A 1FSZA 4RACA 3MWFA 1IBKB 3DD1A 2W2XA 4U2EA 1KEEB 3FHOA 2XBMA 4LSWA 1FP7A 4FFOA 4JT8A 1X6VA 3K9WA 4WCFA 1M74A 1KOGA 3BFKA 3C6QA 3TNFA 3ESQA 3L8DA 3Q3VA 5DLYA 3NVAA 2DBQA 2FPOA 3K4QA 3BY2A 4H31A 3RRFA 4GQAA 2GYWA 1YJ9B 3M3DA 3ROKA 5DVZA 5AW4A 3OQMA 4WBXC 2Q6VA 1HFWA 3EHEA 4KKVA 3PC4A 1HNNA 1L9KA 4OIMA 3KZMA 4F9FA 2OCPA 5BXQC 4AYXA 1E7SA 4YI3A 4I5IA 1U98A 2OTCA 3C97A 4CE6A 5BRJA 2E0IA 3F3MA 4IS3A 1MNQA 4JLNA 3ZTYA 4QPNA 3ZPXA 4GQIA 4ML3A 1L7QA 2X3UA 3MN1A 4Q66C 3E9QA 2UU9B 4KKUA 1AKEA 3QEMB 5B4UA 1GPKA 3I5AA 4YYZA 5F4JA 3QWAA 2ZITA 5ALDA 5F3RA 1D4AA 1WHTA 3Q0TA 4HAZA 3W5JA 4UTPA 4MS1A 1FNSA 3CF4G 3ELYA 1Q1ZA 1MGPA 4WV3A 4CR8A 1MEJA 2JJ8A 3Q12A 4XB2A 1KWKA 3WIOA 5KYUB 5BSVA 4KN6A 5KSOA 1CZHA 2JEOA 1U0OC 1S1MA 1STOA 3LL7A 1V6AA 1JMVA 4ZYZA 2H07A 2VHQA 3AF1A 4B3CA 1XALA 5LA6F 4BEVA 2Y1DA 4TVBA 4F5WA 5G1NA 4CCWA 1QR6A 2GLUA 3BD6A 3EZ6A 4UJ5A 2YZ7A 1D3AA 1TM1E 3HR7A 4HH0A 6NULA 3CH6A 4N03A 5JVDF 1TMOA 4JR0A 3FR7A 4ALNA 4U9IS 1VYHA 4MYHA 3C3PA 1PLKA 1U7ZA 3B1YA 4R7TA 1PJRA 4GPIB 1T9BA 2WAMA 4JSYA 4ER3A 5AESA 1KWGA 2IH5A 2ZXUA 4M0KA 2FOXA 2MSKA 3A1DA 2JHCA 1QONA 2ZUCA 1U6IA 3CC4B 3CRQA 2ZDGA 3DMDA 2WU1A 3L02A 5DM4A 1GG8A 5AW3A 3N2LA 2HT6A 1M2OB 1E9CA 4MVJE 3WTCA 5FIUA 1Z6TA 2RGDA 4QUGA 2HRRA 1B2RA 1XN4A 4KH0A 5I47A 4EMUA 3LQ6A 1VE1A 3FPJA 1I6WA 4N8DA 3I9OA 3OKCA 4DRZA 2BMFA 2WKPA 5IKXA 1PR4A 1IDN1 3GDOA 3H0EA 4RM0A 4H17A 5JMOA 3VR5D 4L5JA 3QKRB 1NYRA 2NXEA 1K86A 4RPIA 5K3AA 1D6JA 3H86A 1TLTA 5MHTA 5H0IA 1PJCA 4DJJA 2RK4A 4WOBA 5CW1A 4QHTA 1Z07A 2VP9A 3NTLA 1H9BA 3IEUA 5CA0B 2HQBA 1V0FA 3OUUA 2OXIA 5CA1A 4JVNA 3A3BA 3PITA 4JKYA 4OQXA 1C9MA 4PLVA 1V5FA 4RLHA 3ASZA 4FDVA 4DG5A 1LPSA 1R9NA 2WYHA 3PNMA 3QOFA 5EVCA 5CH5A 2EKLA 3IUSA 3NJ8A 4FSDA 3BC1A 3LPMA 3TIXB 2CYAA 4UXHA 1VQ1A 2H5LA 3SOPA 5JATA 1PTJA 1U7WA 3H2JA 5IHXA 4GL2A 3NBQA 2R62A 3GRZA 3CMMA 1I14A 3U1VA 5IAOA 2DPXA 1ADFA 3KL2A 3IA2A 2D4AA 2QUZA 2YIDA 5CDFA 3BKWA 3BS4A 3GH1A 3O03A 3OOYA 1T6ZA 4FB5A 1XEXA 2AEMA 3B3AA 4S35A 2CHVA 4DM3A 4IHJF 2BUAA 2OGWA 1FVXA 3L7IA 4XWGA 1SJ9A 4UNQA 1CNMA 4WPGA 4FDAA 4BEWA 2B7LA 1UBHS 3D5TA 1QVRA 2VDJA 3PZBA 1P62B 2A0XA 2R5FA 3QFSA 1P2SA 3V1MA 4YY3B 5BR4A 4O3MA 5J4KA 5KNCH 2JLCA 5CP8A 1JDTA 1PFWA 3QEAZ 4D8UA 4DDWA 4R1UA 5BXYA 4O5OA 4RPHA 1VDMA 1SCQA 1GN9A 2QPAA 1LPBB 3OX3A 4B33A 4LQCA 1HF3A 2BHTA 2V5UA 4HLUA 2ECQA 1K4YA 4P31A 2RMKA 4IHKA 3SP1A 4Z3KA 4KI0A 4DV3B 4QX6A 2GF2A 3LUPA 3ZOZA 5JJIA 1H2ZA 1JMYA 1L8QA 3C39A 3T35A 3CVVA 3HBLA 2O3TA 4QUIA 2TYSB 4UFNA 1MOSA 3V4LA 3IIKA 2QSZA 1GPMA 3GGCA 1HOXA 1OWPA 5K45A 3R7AA 4ZU6X 1KYWA 1HT3A 3PYXA 5TNXA 1N05A 3X2FA 2VTEA 3B9BA 4R2IA 4ND6A 1I9CA 2B1JA 1ZSVA 4X65B 3ODPA 1MVLA 4KN8A 1GADO 1D5WA 3HZZA 3KYIB 3KQVA 4O5AA 3CP8A 3OOCA 4H3KB 4DPKA 1UT8A 1KMMA 3N53A 1QZTA 3DQQA 3TOZA 3AL3A 4IIJB 1IZYA 2A9KA 3JQRA 3RIGA 2G4CA 1OIWA 4G5SA 4NAVA 4HLQB 4ZZ3A 5HYVA 4KTVE 2ZWOA 3LOPA 3N75A 4CEIB 1B1CA 4Z9BA 4LYEA 3BE6A 4CL3A 4DJDC 3GJ7A 3U6KA 1F2DA 4Q9LA 4BTLA 4Y1RB 4N18A 3MHTA 1CZUA 1MH9A 4F3TA 5K1ZA 1U9ZA 1F8XA 2XYPA 4JL6A 3TSYA 4BMDA 1L4NA 1PSZA 3A6FA 3NV7A 1KMHB 5FL7A 3B1WA 2BFBA 2QX9A 2VYND 3KUUA 5EAIA 4PE5B 4GLOA 4AXXA 1NI4B 2VP5A 1MV8A 3E9YA 3NC4A 4BMXA 4BX0A 3IODA 5BN1A 2Y2VA 4XQFA 3Q85A 3GLTA 2EW2A 1W73A 4AMGA 3B9PA 4JH0A 4PIVA 2V4DA 4AIIA 1G59A 2QE7A 5HXAA 4WZTA 1FFAA 2FGKA 2XVMA 4H35A 1TQHA 4EF4A 5K09A 4W4TA 1CEQA 4P4SB 4BP3A 2ZI9A 3V6LA 4J6EA 5JECA 3VDMA 4KL8S 3CZPA 3N0RA 5DLEA 5DWQA 3RREA 2BBWA 5BUSA 1CJCA 1UT6A 2R00A 4JGIA 4RPCA 4KK3A 5EWLA 1WZ2A 1QO7A 2OLJA 4WZEA 1LZKA 4HF7A 4OHXA 1DUVG 1NQUA 3S68A 2RAUA 2O2DA 4ENUA 2X0IA 2VDWB 1ZU4A 2GD0A 3IGFA 2OFPA 1KJQA 3MWEA 1UWCA 3U7RA 4XTCS 1TF2A 2JLAA 3IUEA 1SU4A 9ABPA 4YS6A 1L7OA 2EOAA 1OVGA 1VG0B 5EP3A 3ZK7A 5ISMA 4OPVA 2FSUA 4CBVA 2WAYA 4DV4B 5J5AA 1V4VA 5HX7A 1DBPA 3FFTA 2LTAA 4YCMA 2FE4A 3BVPA 4OHZA 5F4ZA 2B1QA 2EIHA 2HMUA 3EE6A 1OKKA 5CJJA 1KR5A 1Z8DA 3KO8A 1JIIA 2ETVA 3IQGX 5F1PA 1BCRA 1CYEA 1SQGA 3MXOA 3JWIA 4YUAA 4BVEA 5EINA 1ZRSA 5GVSA 1H3NA 1NBOA 1OBFO 2WWVD 3B6EA 4RJ2A 4B3JA 4EG5A 4F56A 4M0UA 3E2MA 1KK0A 1KPGA 2WU3A 4G07A 4PR3A 1I6MA 4CKWB 5B3JC 3S5UA 1I4EB 1UBOS 3NEYA 3ZQKA 1BKDR 3T7SA 1V71A 1OASA 4JOQA 3OURA 3Q7TA 3BGSA 2VP6A 2IYRA 1C4WA 1P9NA 1UM8A 1NLFA 1XZLA 2NOAA 3FXAA 4OSOA 1NVWQ 3W2HA 3QLJA 4G5RA 1KEEA 4C29A 2H00A 3EODA 2Y77A 4MUAA 3COWA 2RI1A 1KZ9A 2AW5A 2P4HX 4HN9A 2KQUA 4S1TA 4TKLA 1JSCA 2PNFA 2J5RA 3SEFA 1PFYA 4GP7A 3DLCA 9ATCA 4CKZA 1LPNA 5I7AA 3RI3A 3VYUB 2ZR0A 4I4TB 1EFTA 5HJ5A 3HBFA 3K5IA 4XGIA 5TMEA 2ZCVA 1EWTA 4GLLA 3NR2A 3EVTA 3BJRA 4EX6A 4NBLA 3V46A 4CLDA 5E6SB 1TJ3A 2PUWA 3NFRA 3C8HA 3F49S 3O9ZA 2QM7A 4XQGA 4ZA2A 1EK0A 1H5UA 3REQA 1ZWKA 1KTVA 3RF6A 5AJUA 4X5OA 2J7PD 2O0MA 1MJGA 3CSDA 3OZCA 2AWNA 4J91A 3AU8A 3DXZA 5AKJA 5FNVA 3NTVA 3ZE7A 1R15A 1L7RA 4OLFA 4YLYA 4FE3A 1N75A 1C3OB 2C5HA 4UAVA 4HSGA 4EFLA 1ZJWA 5BWLA 5CVCA 1O95C 3DZBA 3CPJB 4AKHA 3DPIA 3CNEA 1CBUA 3QPVA 5HA5A 4V1CI 1RWPA 2C2YA 1NU8A 5KYUA 2YXPX 1YL6A 4U2BA 3DV9A 1W4ZA 1Z5UA 2D3NA 2CVZA 5JNLA 4E31A 3W3ZB 5I45A 2E5WA 2RGUA 4Z4ZA 2WRZA 3RIXA 2P3MA 1ZK4A 4AX4A 1HY3A 3I39X 3DEIA 1RE1A 3WIVA 4MEJA 3ZDCA 1PSDA 4KBYA 1W85A 1EE9A 2NU7A 4PHHA 1T1JA 2CUZA 4MYRA 2I7CA 5AD1A 1OLUA 3LXXA 5FULA 3OTOB 2UYHA 4XX1A 1UFKA 5IDYA 1VSUA 2XT6A 1XZDA 2VUTA 4CLRB 3PFKA 3R6DA 4UMVA 3U48A 2GHTA 5ELLA 1DE0A 4J0JA 3UHPA 4MP3A 3LDFA 3EZNA 4PG5A 2OGSA 2DB3A 2C5AA 5DIFA 3HXQA 4GECA 5AHKA 1TM2A 5ES3A 3A6JA 5AHRA 1QRDA 3K35A 1BDMA 1ZINA 2QTVA 4ZU1X 3CJTA 1KJYA 2JBHA 4DDKA 1L7BA 4W82A 2KS6A 1Q5PA 1B8UA 1UXOA 1QC5B 3A9TA 3F4LA 5TMDA 1VL8A 3AIKA 3HV2A 2ZAGA 1WHSB 5IXSA 3OHSX 4HVCA 2E3JA 1REQA 4AY2A 4R83A 5E4TA 4P12A 4K5QA 4O25A 2FLWA 2OZKA 1QDEA 3QKRA 4KFUA 4UCFA 2ZKLA 2FZEA 2G71A 5DOVA 2A2ZA 4X8OA 4YUZA 5C1PA 2YHUA 5GMOA 3ESZA 1PN3A 1RRVA 2AUNA 1FFEA 3SSMA 3G2JA 3O9VA 1IE3A 2NSYA 3OWXA 1J1UA 3COVA 3FTPA 3CLSC 4LCEA 2A9PA 3SVLA 1NVEA 1TKAA 4N40A 2Z09A 3DCYA 4CUJA 1SZDA 1SCJA 1LK0A 2H1WA 4M60A 3TQCA 3WMGA 2ZWAA 3FF4A 3IKMB 3RC9A 5MN4A 1XQ1A 2GFHA 5KDLA 4B3FX 2DZDA 2I2AA 1D09A 4HQ0A 2ZTHA 4ZHSA 1UH5A 3D0OA 4RVOA 1TC2A 2CFTA 2WINI 5DX8A 4Z9FA 1V35A 4O2LA 2OBTA 4RXTA 3UAVA 4IQGA 3WGHA 4B8YA 4QPPA 4KJZA 2QHXA 4RIEA 3VVBA 1OBCA 1FRFS 1X0XA 4B34A 5GOTA 2YHAA 3G68A 3ZIAD 2B3DA 4IZIA 1RXYA 3HAGA 3H3JA 5IBPA 1OV6A 4BGEA 4GRDA 1YA8A 4BAGA 3HKEB 5CBKA 5FI5A 1SKYB 1EFUA 2IYPA 3FPCA 5JISA 3B2EA 1VQPB 3Q7PA 3ETCA 2O2SA 4IP0A 2G4LA 2KLBA 3OAAA 1GCOA 1PZXA 1G4HA 3G9TA 3ORQA 4JP2A 3V7YA 4RFVA 2V8OA 3USZA 1YIOA 4MVWA 4Y0AA 3PQ2A 3WLPA 3R6KA 3Q3IA 4D26A 1OI7A 1J7JA 3BEDA 3BORA 1F5NA 2QZPA 4LHXA 2DKOA 5CA0F 4NVRA 1GAXA 1UBMS 1NRXA 1UOPA 3OJXA 3CE9A 3ZGZA 1A7KA 2WA1A 1WBBA 3O8DA 1CQJB 2XUIA 1Y5RA 1XQYA 1E4OA 1ONBA 3RTAA 3WB9A 1RAAA 4FPXA 4EFMA 2O8FB 4EUNA 5LCXA 2KX7A 1L5MA 3AEYA 4J0FA 1C0KA 4DL9A 5KTKA 1NR1A 3B53X 3HUFA 5DMXA 3T7CA 2N9UA 3MVEA 2NT4A 1UKBA 2CEKA 2F1JA 3D8TA 4JX9A 4KYIB 2AQ8A 3HHEA 5JJBA 2D1RA 2VJNA 4LKOA 1R5JA 4LW8A 5G53C 4ER5A 4YXWA 2I2DA 1KC1A 1BEZA 3LYHA 1M72A 3ABOB 1VP9A 3L7LA 3PU6A 1H8EA 4MTLA 1IZ7A 2GXSA 5K0LA 4WRRA 1SVKA 1MX9A 1XXLA 1ZBDA 5ABPA 3F6CA 4DQKA 4ZQEA 4CKEA 4MRMB 3ZLBA 3RKSA 1GAQA 1BMQA 1TQDA 4M7WA 1DV2A 3LFTA