1GAQA

Crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
296
structure length
296
Chain Sequence
b'ESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
molecule tags Oxidoreductase/electron transport
source organism Zea mays
publication title Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase.
pubmed doi rcsb
total genus 81
structure length 296
sequence length 296
chains with identical sequence C
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gaqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gaqA02
4F7DA 4PGOA 4B3XA 4HE5A 4YALA 2RC5A 3CCEB 1CNFA 1R5NA 3WNBA 4K1XA 4P3YA 1TTTA 1EFCA 1YJ9B 4RCZA 4M1KA 1N0VC 3CRZA 3PENA 5AN9A 3CC7B 3WNCA 1VQ6B 3W5UA 2BGJA 1BJKA 1D8TA 2C78A 3CMEB 1E62A 4ZGNB 3LYUA 1M1KD 4LC0A 1OB2A 3CW2A 4B48A 3W2EA 3CCJB 3OW2B 2DCUA 1DG1G 3W2FA 1VQ9B 3CC2B 3JQQA 1NJID 4N3NA 1CQXA 3ZZ0A 2QA4B 4ACBA 1EFTA 4PC2A 4PC3A 4M53A 1EXMA 1ZM9A 5EMNA 4B43A 4ZCIA 1WDTA 1F20A 1EWYA 2QTZA 4J0QA 3LVBA 3V76A 5FA6A 2PLFA 1QVFB 4YHBA 3WYAA 1K9MD 1OGJA 4Q7JB 1D2EA 2B7BA 3MHPA 1GAWA 3OJXA 5TR9A 1EP1B 4LBYA 1KD1D 4TMZA 4NBSA 3AVXA 1GAQA 2XNCA 2OK7A 1VQPB 1W35A 1ZUNB 1VQMB 4C43A 4G5GA 1W87A 1H42A 3ZBTA 4RD1A 3OZWA 2XEXA 3CD6B 1FNCA 4DQLA 1N8RD 4WQMA 1FDRA 4ZCMA 4FN5A 1QGZA 1VQ4B 1ZM3A 4LBVA 1Q7YD 3LO8A 3AGQA 1E64A 1XE1A 3U2QA 3CB4A 4UAJA 4H9GA 2B5OA 2AHOA 4IW3B 1KK0A 4FWTA 1QH0A 1QFJA 3CCMB 2J7KA 2OTJB 3QE2A 3QFCA 2BMWA 2XNJA 4NCNA 4M2LA 1IJFA 5KSWB 2YWGA 1QVGB 2B7CA 2YWEA 3CMAB 1JB9A 1YI2B 1R5OA 1GJRA 4TMVA 4QFMA 4LBZA 3B8HA 2X3UA 2DETA 4HE6A 2QN6A 1VQ5B 4RD3A 4FK8A 4M4SA 4ZCLA 2BSAA 3AVWA 4AC9A 1TUIA 2HCJB 1DDIA 5H5JA 2BPOA 4PC6A 1OGIA 3AVYA 1EP3B 5GV8A 1OB5A 1VQNB 4U9UA 3W5HA 1YIJB 3CCUB 5TV2A 2VZLA 1YJNB 4LBWA 4RCYA 3AVTA 1Q86D 4EH1A 2CNDA 3B78A 2GQFA 3P27A 4ACAA 4Y9UA 4TMWA 1G7CA 3QFRA 1KJZA 1KK3A 4QHYA 2DEUA 1KTVA 3QFTA 2OK8A 1JA1A 4YAUA 4M0LA 3I55B 2BN4A 2QEXB 2ZITA 3QFSA 5GV7A 1FRQA 4YAFA 3B82A 3U6BA 3VNVA 4AF7A 1G7TA 3ZZTA 2HMAA 3G71B 2VNHA 1CNEA 2PIAA 4MYTA 3WY9A 2NPFA 5JBQA 4B47A 1TVCA 2D74A 2RC6A 3WXMA 4RD0A 1B23P 1S72B 1FNBA 5H59A 4AF6A 4DQKA 4C0SA 3A1FA 1QFYA 1BX1A 1QUFA 2HDNB 2EIXA 1B2RA 3JQPA 3MMPA 1KQSB 1FNDA 2YWFA 3FPKA 4Y9RA 4R71A 1W2BB 4Y7CA 3I56B 2EFGA 2FX3A 1KK2A 2OTLB 3ES9A 1TLLA 3AVUA 2QDXA 5THXA 2BV3A 2C77A 4TMTA 3CXCB 3LRXA 3J81k 3WBKA 1ZM4A 3JQRA 1H85A 1FNMA 2BM0A 1Q81D 1VQ7B 1KRHA 3VO1A 3G6EB 1FRNA 1R5BA 2E1RA 1U2RA 1IB0A 4P6VF 3OZUA 1SKQA 4MYUA 3ZC3A 2VNKA 5TY0A 3G4SB 1NDHA 4B44A 1JJ2B 1JA0A 3W2HA 3U6KA 3CCSB 3W5VA 3CCVB 2BVNA 1F60A 1K73D 1N0UA 1G7SA 1J9ZA 1SM4A 2VYQA 3VMFA 1JNYA 4TN1A 3CCRB 1VQKB 1ZM2A 3CPWB 1D1NA 4RD6A 3AVVA 1S0UA 1VQ8B 4TMXA 4PC1A 3QSYA 3E20A 3ZBUA 1DARA 3VNUA 4PC7A 1VQLB 1A8PA 2DERA 1I7PA 3WNDA 3ZZUA 3CCQB 3SJZA 1QGAA 4BPRA 1QGYA 1KK1A 2BM1A 2R6HA 2BGIA 2PMDA 3W2IA 2CRVA 1G7RA 1XB2A 4G1VA 1W34A 3CCLB 1YJWB 4RJLA 2QTLA 2VNIA 4ZGQB 1QFZA 4N3GA 4RD4A 3I1FA 1ELOA 2YWHA 1AIPA 1EFUA 3MCAA 1YITB 5HXBA 1AMOA 1HA3A 3OJWA 3P26A 4RD2A 4YAOA 3CC4B 1GVHA 1EP2B 1DDGA 1UMKA 1Q82D 1IJEA 3OZVA 3W2GA 4ZV4A 1BX0A 5DSZA 3AGPA 3WBJA 1QUEA 1QG0A 1K8AD 2BF4A 1M90D 2VNJA 1QX4A 3FJOA 3VO2A 1KC8D 1GR1A 1GO2A 4G1BA 1E63A 2DY1A 1VQOB 3E1YE 4YAWA 2QMUA 1BQEA 4B4DA 2GPJA 1YHQB
chains in the Genus database with same CATH superfamily
3BWDD 3KTFA 4WCFC 2AOTA 2VSNA 4BDSA 4EGSA 3DE2X 3L1JA 4PSAA 3JQ9C 2QMHA 4K1XA 2NZXA 3O4RA 1QHSA 1CB7A 1AK1A 5CTJA 3S4YA 3PNSA 1KFJB 2QJRA 4O2BB 3DDCA 1NL3A 3KVRA 1YRHA 5EE0A 3R7LA 4QEDA 4TTPA 1POWA 4KXQA 4QYIA 4OFBA 4QKQA 4ZZ2A 1T4CA 1BZYA 3AH8A 1EX1A 5JXWA 3HY3A 3SFVA 4OMFG 1R3DA 2RGDA 3PNVA 3WNCA 3WWDA 4KIFA 4NZNA 3OX1A 3IPAA 2AMVA 3U44B 1D8TA 4LQDA 1WJGA 3AY6A 2P1ZA 4IUYA 4TKVB 2FAXA 3UCEA 3I9V1 1JTFA 3QLUA 3RSSA 3TCXB 1ZL2A 5DGTA 3L4JA 2XVMA 3KOMA 1HFEL 1QX3A 4HIZA 3GVCA 3KSUA 2W0MA 1KDYA 4IDDA 1V8PA 2AZDA 2G63A 4YN3A 3GEPA 3C8MA 4XYBA 1EGQA 3EASA 1Y9JA 4KZPA 1UOQA 3H7IA 1AKEA 1W4BA 3PICA 5L9AA 3KD3A 1EUDA 3I5AA 1Q57A 2W0SA 1XWWA 3MS4A 4PX9A 4DZRA 2WHEA 4B2LA 1T1JA 3A7EA 5ALOA 1V1JA 1F2TB 4I5FA 1ZI6A 4WZBE 3WMGA 2G6TA 4R2MA 3QLTA 4OMDA 3AIMA 4ACBA 2Z09A 3EEIA 4P34A 3UMVA 2Z6BD 5TQVA 5K0JA 2E4YA 3B13B 1H2AS 1QDUA 1EG7A 3O26A 1QPBA 4U6NA 5GIPE 2DFKB 3MS7A 1WPGA 2VJAA 4PM4A 5TQ2A 1YU6A 1DKMA 1Q92A 2NYAA 4NTZA 1KY3A 2QN7A 5CCXA 2QL5A 4L2IA 4BPBA 4HDKA 1QFXA 3EGXA 4XORA 3MELA 5J5CA 4B7AA 5BNZA 5I9IA 3ZDDA 4YGXB 3KQLA 5K1ZA 1P91A 3FOAA 1Q12A 2CLKB 4CEIA 1D8AA 3UWPA 3C3JA 4LZWA 3UUWA 3HU5A 2DFLA 3W2TA 1I0LA 3T95A 2WSLA 4YHBA 4I46A 3BC9A 2V9CA 3HYCA 1U02A 5I4BA 2I6UA 3NRCA 4C3UA 2PBFA 3R4CA 3CH4B 4K3VA 4C2AA 5K0LA 2BR3A 3UH1A 1UJCA 1GG2A 3HJFA 3C5HA 3DV0B 3LX4A 1MNQA 4J75A 3U7GA 3QRWA 4OOXA 4YI5A 4ZAGA 1AV6A 1IY1A 2BIFA 2CHFA 2NO6A 3RUEA 1E6UA 3DL7A 3LLMA 3KQYA 3JD0A 4A5OA 1YF3A 3O92A 3FDZA 3P9IA 3T5AA 4E4RA 1XKQA 1FS6A 3F73A 3GWZA 3PLAE 1G1MA 1EEHA 3W3AD 4K05A 4P58A 2WR8A 3DT9A 3C87A 3JVDA 4HADA 3V46A 2J9XB 1O97D 1XYGA 3FI9A 1RP1A 2DPGA 2N0SA 4I8XA 4MQ6A 3WRXA 4TV8F 1J7JA 2JBWA 3P97A 3TNLA 2YXNA 3ZE7A 5A6VA 3VV3A 4BJHB 3N0WA 5ILQA 2O8FA 1R18A 4L4YA 4Q6WA 4XQGA 3ZWMA 2IYNA 3FHOA 1VPVA 5ULLA 2JASA 4FSDA 2CF4A 4WQMA 1BXZA 2CFTA 5T8KA 1LZLA 2AA3A 2PJRA 1BYUA 3HACA 3U9LA 1ZVJA 4YAKA 4QVGA 4XR6A 4NH0A 5CVVA 4D99A 1FNSA 3IPLA 2H59A 4HN4B 4JB0A 4PFQA 3O94A 3WQSB 1ZM3A 4CF5A 4PR0A 5HKOA 3NONA 4QOFA 2CLFB 3R7SA 3FZQA 4GPEA 4YJKA 5TPWA 1DBPA 5K5EA 3EF0A 4DQXA 1NTOA 2HLHA 3P2IA 2JHPA 4L9WA 2YH2A 1KWGA 2C2OA 3AUUA 5D87A 2Y1XA 3BMQB 3WK4A 2ID4A 1DRJA 4H9GA 1R0LA 2F1OA 4RKQA 5FADA 4OIMA 3V33A 1NW4A 5B6PA 2PA0A 3KFVA 5E9WA 3MGAA 2P0AA 1LDNA 2PD6A 2R11A 3MT0A 1GNSA 4L78A 4KB5A 2V3CC 5BSGA 1QFJA 1BH2A 4C6TA 5C32A 2ROQA 2FW8A 2JCBA 4W5RA 2VYVA 3RUDA 3TW8A 1UZAA 4RENA 1G9XA 3CH5A 4CN8A 3B6IA 3DTVA 3Q3EA 1OXVA 1OYYA 4M38A 2GAAA 4U7GA 1EFRD 1R0XA 1TCCA 5HZGA 1FDIA 4CETA 1KAOA 1WHSA 3CF6R 1ZC3A 1NNSA 3H8JA 3R6LA 4HN2A 1UT5A 3FHCB 4K0RA 4ZEWA 5FPKA 3BDAA 2JIOA 1Q3HA 3K09C 1CUVA 1JSCA 2QRVB 2J4DA 1XPUA 1MT0A 5K4GA 1PR6A 2ZSKA 2RKBA 2PHZA 1U3VA 4OB7A 4BO8A 4JJGA 2VJPA 2VBSA 3DFZA 4Z6KA 1U2ZA 2FX2A 1QYDA 1NVTA 2ZULA 4J0HA 1QGUA 1UAYA 4UARA 1J8MF 4KXUA 1TZCA 2HTEA 3D3WB 4FD3A 4PLCA 5HF9A 2AN3A 1HT1E 4KXFB 2GHQA 2IDJA 2G77B 2R6JA 2WM3A 2RJ3A 4G5OA 2AKAB 2W43A 4AY3A 1G8FA 2ZZNA 2ZI6A 4BKOA 1KBQA 3H9QA 1U5BA 1HK7A 1MXFA 1E8NA 3S6JA 2R97A 2ZSFA 3IP7A 4QYWA 4ZP1A 5GJCA 2H4JA 3MTGA 1PFWA 5SYAA 3VTKA 5F4MA 3QXSA 2EGGA 1RBQA 4FIZA 1ZCFA 3ECCA 3FFAA 1QRDA 4UEQA 5EOVA 5H80A 1P6XA 3TRDA 1PFYA 4K6HA 1O95C 4BFZA 3F6EX 1M8JA 2PGOA 1E79D 3I30X 1ESNA 3CS3A 4P83A 3SQDA 2HWWA 2MYUA 1OGIA 4LRYA 4YH1A 1JR4A 1NYTA 1EP3B 1RR6A 1K4YA 2VTDA 3KUXA 4FHFA 4MGIR 3WDLA 1WZ2A 2LTAA 5I7VA 1QYVA 2IYRA 3SHFA 3KE9A 3QKTA 1FP1D 4D98A 4L6IA 3OWHA 4KKTA 4LYDA 4ZDWA 4E5KA 2EBHX 1L1FA 1D04A 1NF8A 5D2CA 4A0SA 2GERA 1DINA 3MJSA 4B6SA 1O9HA 2H5IA 1COWA 2AYZA 2DYKA 1OFHA 2XZDA 1V6AA 3T3DA 1ZMOA 3CEPB 2OG2A 5C35A 1GAJA 1H9CA 5BN4B 3RK4A 4ZEMA 2WKWA 3NOQA 1FP4B 3BWYA 4ZQIA 4ZMSA 1IBSA 4Y9UA 5DHFA 1DWOA 3G5MA 2VKTA 4X7EA 4IIBA 1SUDA 1VXOA 3BDVA 1G17A 4PHHA 4WLUA 4X5OA 4X3OA 5JD4A 3LXMA 1N3YA 4PLTA 5LXTA 3DMPA 4JT9A 4QUGA 2FEAA 2HMUA 4KVFA 1WMEA 3EHDA 1TF2A 5FP0A 4PZ9A 5LSAA 1B42A 1TJNA 4L0MA 3W1WA 1U63A 1PNRA 5CCDA 3BIOA 3EXIA 1DC7A 3NIGB 3U4MA 1MX9A 1RBMA 1VMIA 4ZVUA 3KZMA 1CUIA 2V7QD 3PQFA 3VPHA 2Y1WA 3SN6A 2R65A 2BLNA 3TNDA 3GFVA 4GVXA 4P0PB 3VYVA 1GU1A 2DHQA 1Y5NA 1RXIA 4PABA 1FXSA 2G4CA 2XD9A 2XJ9A 4R05A 4W63A 4X0EA 3R5JA 3Q7PA 1OHHA 1E3WB 1PWXA 5K2OA 1U90A 2WU1A 1U6KA 1VLQA 3AF5A 2GI4A 3OU6A 4HQKA 4QBGB 3AUAA 4ZI5A 3RJMA 3ZWAA 2APJA 2ZT7A 3DLPX 3HA5A 2Q4BA 1JFFB 4XX0B 1WKBA 1KMCA 4EHFA 1TD9A 5ALHA 4FMCF 4XVQA 1L3BA 5H59A 4KBYA 1FYXA 1KJIA 3BXGA 2JFYA 3M9WA 4MIOA 5JMWA 2WDZA 3BMXA 4IXDA 3B85A 2D5IA 3NAGA 3AZQA 4BN4A 1ICEA 2GTIA 5I5EA 4GC5A 1Y9EA 5CT9A 2GA9A 1PIWA 3OJOA 4ZAFA 4BNLA 2WF7A 4MRVA 2AEMA 4P82A 4PQRA 4TSKA 4LGYA 2VP9A 1E2BA 1W4RA 1X9GA 1XG5A 2DH6A 4OGWA 2HADA 2VBCA 1TMOA 5GONF 4D41A 3PRJA 1IWOA 1VQ1A 2WF6A 4KQIA 3WMXA 4YUXA 1G8JA 3NEAA 1W2BB 2GTHA 2XADA 3CWCA 2KLBA 3TOXA 1JX6A 1VMKA 1BLIA 3O8QB 1TVKB 3KFLA 3RYIB 1EJ2A 1ODKA 2WYRA 1MENA 2V98A 3P2YA 3F8TA 2ZJ3A 1OYOA 3SSMA 3MTJA 4RPJA 5AUNB 5AVUA 4ZCRA 5EZYB 1NOKA 4HLUA 4U9HS 3ROMA 4EW6A 5BURA 2HSJA 4A23A 3UHOA 3IPXA 2GH1A 3ORSA 2P3MA 4MVJG 1ZK0A 1W8DA 3A3YA 5KOJA 2FVGA 4DT1A 2DUMA 3QX8A 3A4YA 5FWDA 4M83A 4W5WA 2B6HA 4UTNA 1YRBA 3LWZA 3QPAA 4YMUA 3LPDA 4EPXA 3VO1A 2ZANA 1MW9X 1IHXA 2LR0A 4B85A 1SB9A 3BKXA 3K1ZA 1DQPA 5SY6A 4AECA 5DASA 1DEXA 1HE1C 4L02A 1X1BA 4LOJA 4LQLA 1UBJS 1R5BA 3QA9A 3RF7A 3NGXA 1U2RA 1K0UA 1LK5A 2R85A 1GV0A 4TKUB 2X23A 4RH3A 5DNWA 5K0SA 5LUAA 1Y63A 1S89A 2PCJA 1E9SA 3L93A 4BNHA 2DR2A 1KRXA 2BYTA 2DG2A 3ZWVA 3IOEA 1B1AA 1YOVB 2HEIA 3GMTA 3W5JA 2K7FA 2B8EA 2VHQA 1CZUA 4ZK2A 4P3IA 5EQDA 2JJYA 2QNBA 5KKNB 1JR3A 1NSYA 4MZDA 1PNOA 4CV1A 1SU6A 5EE1A 2NV4A 1R0SA 3GUUA 4X6XA 5AT1A 4DVGA 1CULC 3ROZA 3SLKA 4XJSA 3BGVA 3DBRB 3M1IA 1RJ9B 1M6EX 2QOEA 2WA2A 1KH2A 3HBLA 1QHIA 5EKSA 4BEBA 1ZM7A 3L0SA 2X0IA 3OF3A 4EYEA 3A9TA 4R8SA 2QE6A 3S29A 1Z2OX 4QQNA 5BQPA 5LWQA 1YRAA 5D85A 3BCUA 3LI2A 1KEWA 1K1EA 5B4VA 1X1SA 5F1PA 2C95A 5DTIA 1F17A 5K09A 2FDRA 2XRFA 5D1NA 1YB1A 3T53B 1FUKA 1K86A 3FFBA 2WWFA 3TPZA 2HSEA 1CEEA 1D3AA 1NX9A 4PX2A 4XQFA 1PYOA 1ZRNA 1D1NA 1C4KA 3VVCA 4FE4A 5IS2A 1J0BA 2EG5A 3CMCO 3FUWA 1UWKA 3B6MA 3DG9A 4IMRA 1Y3IA 2QD2A 4B87A 4ESOA 4L27A 2PX3A 4EW3A 5BR1A 4G0VA 2G25A 3SE0A 3B7GA 3WKDA 4HNGA 2C8JA 4ZYYA 1V16A 3GGPA 4RFSB 1R0KA 4CGZA 5AVZA 1VFPA 2ISSD 1XN4A 1PQWA 3JR7A 1TI7A 2KBFA 2FEWB 3NANA 2WMOB 4KLAA 4RK0A 1GYRA 3MJCA 4KQFA 1YASA 3QNUA 3U26A 2OGWA 3BB4A 4XDZA 1M34B 2FXVA 4WKPA 2PRKA 4DANA 3FYDA 3D81A 5F1KA 2CNNA 4MQFB 1X8KA 2XOXA 5HIIA 3PC8A 1VLHA 1WB6A 4XEHA 4C7OB 1WA5A 4P12A 3RGWS 4WXMA 4MA5A 1HURA 1U3GA 1VB3A 1ZVKA 4C6RA 3ROXA 5EKTA 2O8NA 1E20A 1TL7C 2B37A 3RNOA 9ABPA 4QO7A 1YS6A 1B73A 2CB9A 4FZRA 4BJ3A 3KFXA 1M6VA 2RIPA 2R62A 4XSHA 5COAA 4CIAA 1H8ED 4OI2A 1UDCA 1T3ZA 5DYIA 4CM4A 1ECCA 1U5AA 2VBUA 4J1TC 2HXGA 1WE2A 4S2EA 1NI5A 4PPFA 1D2GA 2CYBA 3ACDA 4RVUA 2EKZA 1L8AA 2CUKA 3O8LA 4K8RB 4TRJA 1XMQB 3KYCA 3JSXA 4OUDB 4YAEA 4RSMA 6ABPA 1IATA 2FZWA 3O74A 5F35A 2HT1A 2XMRA 3ZWPA 8LDHA 4UC0A 1LCIA 2YFHA 4B4WA 3K6SA 4B0OA 3NVAA 1MX1A 6REQA 2BM8A 5LIPA 3U16A 3EB9A 3G17A 1T43A 5AK3A 3Q6NA 5M29A 1AZLA 4MVJP 1SBIA 1Z0IA 3EUAA 2Y0BA 2Q6VA 4MYHA 4DMUB 1VBFA 4MVWA 4XLZA 3KLBA 3OKXA 4R8VA 1HA3A 1HG1A 2WTNA 2K5UA 4YJ2B 5AOBA 2W6CX 1ZD4A 4UEWA 4X85A 1RZVA 3V80A 3OZRA 4PCUA 3DE1X 4FYMA 5DNUA 2DQYA 5H4HA 4MO9A 5DTEA 4PTYA 4FOLA 2YXPX 4HGOA 3CVYA 4KX5A 1DE0A 3JALB 5A4DA 2JRLA 4U39A 4A92A 3E15A 1K5HA 5DCUA 1JJVA 3AGPA 1VDZA 1UZUA 5E9JA 5IG2A 3HEBA 1KHHA 4QUAA 3ZIDA 2FPWA 2A1UB 2CXXA 3C6QA 3DO5A 2UVPA 3AXTA 3HVHA 3RRZA 4CRWB 5A4MS 1A7AA 1AY0A 5KJEA 5KC8A 1NVAA 3OY7A 5HWSA 4M0FA 1ZA2A 3KT6A 2VJKA 3BHNA 4F5ZA 2V6BA 5C8YF 3UQYS 4FNGA 4GDFA 3OZ7A 3ONDA 3RS4A 2VUHB 4Q4CA 4IIXA 4JKIA 5EQJB 4YNBA 1P7YA 1Z6XA 3EVGA 4YAWA 1NLUA 1IXSB 2FA9A 1X13A 5ARDA 4CUZA 1P2UA 2QD1A 5A5EA 5FA8A 5BNTA 4DCVA 4EHKA 4YRBA 5KTRA 1DG9A 3KV3O 3R4VA 4CIDA 2JPDA 3QE4A 2UYCA 3H9UA 2J48A 3UNXA 3WNBA 1YKFA 3P2KA 5IAEA 4BE7B 2H06A 1UFRA 1Y4AE 2AXNA 2FE4A 4IMJB 2AFRA 1MNAA 4A8PA 5KWEA 5CD1A 2AK2A 5DM70 4DBLE 1NUPA 4F60A 2RK6A 4L5AA 3ZNNA 2P1RA 1YR1A 4DVJA 3F2IA 2Z9BA 1Q77A 1L6IA 1RHJA 4BXOA 3PYXA 3QBJA 2AIRA 2GEVA 3A31A 3H9JA 1YI0A 4BNFA 2Q3DA 4N8EA 3WK8A 1M7BA 821PA 3KHTA 1L5GB 1NMXA 4HS9A 3UAGA 2BP7A 2H1FA 1S3IA 4DRZA 2BCGY 2NO9A 3QFHA 1UBGA 4ZGNB 4C4TA 2ZIEA 3QPCA 3ZCRA 4BKRA 2PLNA 4EZIA 1W5EA 5DBGA 2IEZA 3FHLA 5BPFA 3ZVNA 4N03A 2C3MA 3KPUA 1ZWKA 4KR6A 1R1DA 5TRDA 2D1SA 1EI9A 2FN9A 2O0LA 1P5HA 2F59A 3ZD8A 1NUSA 1FVFA 5GJVC 1X7WB 2CMKA 5LBUA 1FFXB 4XLCA 2ZBEA 5JCJA 3CC2B 3L6OO 4UAVA 2AT1A 1NJID 1HYHA 1TM3E 2O1SA 2XAUA 1TUBA 3SYTA 5LP6A 5B2FA 3UC5A 3BFJA 9LDBA 5AD1A 3FCSB 5CG1A 3CZ9A 1ZX1A 4UPVA 5HJEA 5I4KA 3FMFA 4FPXA 1DCKA 1SVSA 2E87A 3C39A 3M89A 2M6RA 3MAGA 2V7XA 4E1AA 3LLVA 4CEIB 2XCUA 4M7WA 1PJCA 1H6DA 3ORHA 4YS6A 2DGDA 4NHOA 3THYA 4M1OA 5JAMA 2ZE8A 5BT8A 1E98A 2RAVA 1JG6A 1H2WA 3MAJA 2JIQA 5HRUA 5C8DA 1NM5C 5BW4A 3SFZA 3PEYA 4LW8A 2CC2A 4NPHA 3WDMA 2G1UA 2LZ0A 1KMHB 4BZQA 1QZXA 2IITA 1XDSA 1YBMA 3NAZA 3R20A 4YJGB 5DWVA 1EWYA 2XZLA 2QBYB 3I04A 3TOZA 1V8BA 2UYQA 1TEVA 4DR4B 4ZC1A 2C2BA 2RCYA 2IY7A 1D2NA 4NYMQ 1IOVA 1U6IA 3F1LA 1ZOOA 1RWWA 5TMEA 4HMPA 3S68A 1S9DA 1SUAA 1IDOA 1SZJG 1XZJA 2F2TA 2NO4A 4WAUA 1F4PA 4OXYA 5JW6A 1M66A 1K9MD 1V9CA 5DNCA 1M6HA 3EOZA 4BKUA 4KVGA 3RS0A 3GVPA 2FFQA 4OHKA 4BZPA 1DJLA 1FYEA 4EK9A 5B3KA 3UFBA 5IWAB 1EP1B 4LBYA 2LBPA 4S0ZA 1W19A 1REQB 2AG5A 2QI9F 4XQEA 5GY7A 2R2AA 5CFNA 2RGGA 4FB4A 1JSXA 4MDEA 1UK6A 3CCFA 1BDJA 1GPUA 1Y1QA 1VSVA 4Q9NA 2QE7A 1O9GA 3A7DA 3CPEA 2B20A 1YAJA 1BS1A 1GYPA 2WIAA 4G26A 4TWBA 1OCEA 4ENVA 1IAVA 2QROA 3QEOA 4G5QA 2I54A 1PZFA 3N58A 3PGXA 2NUBA 5HIMA 4BWYA 3BIJA 1GZUA 1X1RA 3EFHA 4B3JA 4X65B 3R3WA 2YYYA 4WRRA 3NORA 1VKNA 4MHTA 4ER3A 4ID3A 2VYVD 3EJWA 2X9NA 1PK9A 1OR8A 1F2VA 3RD5A 3AM5A 3LYLA 2NQ8A 3CN7A 3DDWA 5LD2B 1ISSA 4ZCMA 2C29D 3L7AA 2VLIA 3P94A 2FKAA 3WL5A 2N3ZA 3HYTA 5G0TA 5B5SA 3IP1A 1N2CA 4LHZA 4OX9Y 3LO8A 1G6KA 2Y99A 5LU9A 4OP7A 2SCUA 4E3WA 2VK1A 4LYHA 2ZP1A 4B1FA 3K2IA 4R9SA 3A9WA 3AU9A 4I1OA 3R9XB 4ZCPA 3U2QA 3D6HA 4DA7A 2X6WA 2BRUA 1QQAA 1DEKA 1SULA 4LZAA 1LPAB 1M2OA 2PWZA 4CLHA 5AM3A 2OHVA 2NU6A 5CA1B 5CYGA 2B99A 5AVKA 1P61B 1SKBA 1X3SA 2Q49A 1OROA 1T1GA 3F5DA 4ZQBA 5ENZA 5K6TA 1QZ3A 2XCLA 5LP6C 5JVDA 1GSIA 2NUTA 5ABPA 1IBKB 1MB2A 3KKZA 3EGCA 2JAWA 3OG9A 4YAIA 2H2WA 5BYKA 4HDMB 3M5WA 3RNLA 2FPXA 3M7IA 4ZANA 3MLBA 3U44A 3N87A 1B76A 4XGIA 3DYVA 5DZSA 3I8XA 3JATA 1YZUA 4RDHA 4PNZA 1F2TA 3EVDA 2X0DA 3JTMA 3TQHA 4EUEA 4M6WA 4GMHA 3E82A 5E6UA 1VI6A 4WK4B 1KI6B 1X7ZB 2XB2A 3ZHRA 4OREX 1KY4A 2PRIA 2FOLA 4XSGA 4G0WA 4XVCA 3L7CA 2VVTA 3WLHA 3D6NB 2XCIA 1DMRA 4PQFA 4UAGA 1SC1A 3R23A 2G9ZA 4NV3A 4IMIB 3Q5DA 1P1CA 5EXDA 5EPUA 3DTYA 4M0CA 4BTLA 1HDIA 3KQNA 1FRVA 2JIPA 1AS0A 2JJMA 4NCJA 1ETUA 1XK7A 2X3UA 1TYDE 4REQB 3L05A 1DL5A 1EFDN 3REGA 3THSA 1HBJA 1CPYA 4U7HA 1AQYA 1F3LA 1DUSA 2ZXFA 3GI1A 3R5SA 1VOTA 3KDSE 4OAOA 3MSXA 3INYA 3CIOA 5HFAA 2Q9UA 3RAGA 4JR2A 4N5MA 3R3HA 2PSSA 2XKJE 4S1VA 3BK2A 4O4JF 1TK2A 3LP8A 4CF4A 3IVRA 1I7QB 4EFDA 1RQXA 1VHTA 4NU0A 4YMHA 3AVYA 4C0QC 1YVEI 1MQAA 1E1QD 1W0KD 2HFJA 2P40A 3EYWA 3OMWA 4BNZA 5ED4A 4JUBA 2WUGA 4NJMB 4UHFA 2WPNA 1YIJB 1I2CA 3HCBA 4I14A 2A88A 4OHCA 2SECE 3M5CA 4OTZA 1UODA 4DJFC 4P86A 3C8DA 1YJNB 1N6LA 2YFYA 3EDYA 4LBWA 2HLNA 2Z2ZA 1KMHA 2Z8YA 4CLXA 4MQBA 3L4KA 3BGWA 2YWBA 2VDNB 1QV6A 2CNDA 1G64A 3BX1A 4BVJA 1T9AA 3ZWDA 2V6IA 4KLZA 5KB3A 4N3CA 1V5FA 4DFDA 1KJZA 2A58A 2VRCD 2GETA 3HA2A 4JUFA 4YLEA 1NNI1 2W2MA 4QHYA 2X13A 2CLMB 4OK3A 5HM8A 3EZLA 5F3WB 4FFSA 2UXCB 2CDAA 2BTEA 3TZLA 3OCJA 2C4HA 2QPLA 3KT0A 1FW6A 1FRQA 1NFQA 4K6CA 2X41A 1V45E 5DX0A 3SQXA 3OIWA 1NYLA 3OC6A 3A4VA 3EIOA 1VE9A 1DC8A 2SBTA 4WK6A 5EVJA 3C3CA 1AUPA 5THQA 3TLZA 2Z2KA 4FGUA 3ZJ5A 1YCFA 2YN0A 2FZCA 2QTRA 3GFBA 4FHZA 4L6AA 5JMPA 4BEVA 5JQGA 3WAGA 1OLUA 1S3FA 2EZ4A 5EIBD 1L5MA 1W94A 4M8LA 2H0QA 1N75A 1M2HA 3IBYA 1G0NA 3LCCA 4KWTA 4PWZA 1ZUNA 4EA9A 2VJIA 3GL9A 4LXGA 1GQOA 4UD2A 5EZ5A 2VCEA 5AYVA 4BV3A 2P6RA 4OXQA 4BNYA 3PK0A 5A5GA 5JBIA 2ORYA 2X53S 1XVLA 4LX0A 3BRWD 3A04A 1KVRA 2CMGA 4AICA 1XRNA 4OHPA 1OC2A 2RSLA 3ZW8A 4BFLA 5AJVB 4V1CB 4E09A 5AI4A 2PYDA 2GXQA 1L4GA 1IOWA 2OAP1 4Z0NA 3G2QA 1GUDA 3U3RA 1F5SA 4QJIA 1KSHA 2PKYX 1B7GO 4KFRA 5ITSA 4HUTA 1OH6A 1TUEA 2ZPTX 3OZBA 3PHLA 2QI9C 2FR8A 1RHKA 2XTNA 3KVYA 3A3KA 1JEJA 3TYXA 5AMXA 3WIVA 3JQPA 4GPBA 4IG4A 2IHKA 4JLBA 3HKEA 1U8CB 4DQVA 1M0WA 5DBIA 5IJ9A 2AFHB 1EFVB 1H8EA 1GCAA 1UBFA 1VHLA 2A3NA 2PX0A 2QP3A 3QZUA 4LRUA 4LDAA 4YJHA 3UH0A 2A1IA 4R84A 3W9YA 1TJ3A 5ALZA 3A3BA 3I56B 3W5DA 3IBGA 1RJFA 4MWEA 2F8TA 2GK6A 1T5HX 2EFGA 4DKJA 2ZI9A 2I2WA 4Q93A 4FHCA 4W82A 1P0PA 4E14A 1AKRA 3H5WA 5LLSA 2YZGA 5K51A 2OTLB 2J08A 4WCFB 2GRJA 3GEHA 1SEPA 2W2LD 5BP7A 2V0GA 4KTVE 4V3CA 3OFND 5DGDA 4F1WA 3ZY6A 3MWKA 5JXGA 1U8XX 3X43A 3GRPA 1E2KA 1HLGA 4Q9KA 4WOCA 2J31A 5CFLA 1QU2A 1FFYA 2VPTA 3HADA 3E84A 3PXEA 4HH0A 2E4ZA 1FTSA 3HR8A 3K8YA 1O0CA 5AIAA 1JYFA 2ORIA 3OM8A 1CR0A 3FE2A 3FTEA 4BNGA 5EHZA 1BIFA 2YZKA 2XTMA 1MIHA 5LM3A 3EXEB 2G0AA 4QBIA 3N86A 4RWEA 4ZKEA 3GR6A 3Q6QA 4IIEA 1ENOA 5B2ZA 3USZA 1SKQA 3V8BA 1VDMA 4LCJA 2OXIA 2MYPA 4HRVA 4LGCA 1QS0A 5EWMB 1GGHA 2D54A 2X6QA 1U7UA 2E4XA 3DWGA 3RK0A 4BMPB 2ET6A 4GLJA 4MGHA 4ESHA 4OQDA 4ETMA 1N0WA 3IXQA 5JANA 2B0CA 1J6UA 2NU7A 5E7JA 1VLZA 1I3OA 3PI7A 4BMZA 4E0FA 1V95A 3ZXSA 1QP7A 1UQUA 2ZIVB 4JGGA 5CRIA 1XIVA 5E0OA 1RRKA 1GKKA 5AVXA 1K66A 4BX3A 4X41A 4EY3A 2XVYA 3T41A 1R27A 3DDZX 2MWMA 3C45A 5KX5A 3M3PA 1WCV1 5HJ2A 3RABA 3IEKA 4TM8A 1W36C 5D8DA 2O3TA 2IHTA 3KYDB 4JY7A 4WKCA 1AS3A 4JH0A 1WDKA 1UFQA 1OU0A 1WUJS 2IEAA 3NIWA 1N2HA 4PRYA 4ZXFA 1OC4A 1S2OA 3AUYA 3CNBA 3ZNOA 3RKRA 4US2R 2GZDA 4EG0A 3IBFA 1NI4B 2DT5A 1QB8A 2C9CA 2PSHA 1UBTS 3HR7A 4G07A 4EBBA 5ALXA 2CLIB 2I8CA 2VDVE 4HR7A 1Q11A 4RD6A 3P9QA 1T5EA 4U3JA 5DRTA 2NP7A 3JZFA 3KEQA 1W25A 3I92A 3TSZA 3ER8A 3AEXA 3IUQA 4UMDA 3VYTB 3MXOA 5CXQA 5CG2A 4P4TA 4PZZA 1G4AE 1CDOA 1FTNA 3FAKA 4LNHA 3P0HA 2J6CA 4FNMA 1I7PA 1NJFA 2BGUA 2BFBA 3DOOA 2VP2A 4M9UA 4V0QA 5CW2A 1CTQA 1E9VA 3M49A 4B9AA 4C4PA 4NABA 2WD7A 2ZDQA 1DQZA 1PG2A 3O8DA 3PQ7A 4DR2B 3E23A 1SHLA 2O06A 4UTRA 1WZIA 1YB7A 3OBIA 1V48A 1CRQA 3O31A 3QITA 2FFJA 4EB8A 1ZY2A 3MINA 1DAGA 2A9VA 1OJ7A 3NBZC 3UJDA 1V7QA 5FOSA 1QGYA 2R6ZA 4IX1A 5FUXA 4AROA 4EG3A 4IVNA 1JQLB 3ELWA 4LJ8A 3VU9A 4TVSA 3BC1A 5J3JA 2FPLA 2C7RA 2VCYA 2QMZA 4EB6B 2GXAA 4H6PA 2XIQA 1QNLA 4U2FA 2I65A 4JKOA 2PNJA 3KKNA 4PZLA 4TKUA 4KREA 3D4NA 3R44A 4ZJUA 2NWQA 5JV5A 2ID9A 4MLCA 4OOEA 1FIUA 4TWIA 2QTLA 3ENWA 3HSYA 3EZ7A 4KRGA 3ZVMA 2OC9A 4G25A 1NUQA 1HYBA 5ALGA 3EIFA 3DYBA 3I39X 3JZDA 3JD2A 3UXEA 1SUWA 1YMVA 4KV7A 3HU3A 3PR1A 1BVUA 3SZ3A 3MTBA 3U1BA 2OOKA 3FOZA 1YI8A 2QV7A 4Q02A 1F9AA 5AW2A 3L6BA 1AA9A 3Q40A 3K73O 2QTHA 5P8WA 3ZI4A 5AQ1A 1ZUWA 1X42A 1OBCA 3I1FA 2IUSA 2YIVX 2Y4NA 1M1YA 1NVXQ 3HWWA 3NTVA 3ZU3A 3R8XA 5FIUA 1U9IA 2Z83A 3WQBA 1JQJC 1UINA 3IPCA 3OE7A 1JFRA 3A4LA 3LUKA 4R1UA 2ZI3A 4LF6B 5I45A 3EXG2 4G8DA 4XDYA 3R9WA 3A8TA 2HOQA 5KAPA 2GNPA 4D4KA 5M2QA 2ZRPA 4PLYA 3G7NA 1OUMA 4IJWA 4R16A 4GYWA 1K8QA 1KS2A 4GRDA 1GVHA 3VAAA 2I2CA 3PDIA 1P7ZA 4G63A 3FNFA 1UMKA 3A3GA 3A27A 5FNVF 3RAPR 2VTEA 5TARA 2JFVA 1PTJA 2H2AA 2ONZA 2PFKA 3QLUC 4JOSA 1C7QA 5IKXA 2E49A 2OO5A 1KS9A 1I6MA 3ASQA 3BB1A 3DEKA 3PTLA 4I9UA 4WCDA 5JNVA 3M6LA 2Q4OA 1WCIB 2FR8C 4C4OA 1PE0A 1RWQA 5KYUA 3OO1A 4A8HA 2BJHA 3JD4A 4PQGA 3VVBA 3GA7A 4FD2A 3U5ZB 1MIOA 3NUGA 3IXLA 2XMSA 2BH9A 2BGRA 2Z6VA 3Q1KA 4O6VA 4YCCA 3IE1A 3EQ2A 4AIIA 4DSZA 3H2GA 1UJ2A 4ISCA 1E4OA 1KQ3A 1SC6A 2AV6A 1QHGA 4M0EA 3REFA 1JHDA 2B61A 2O23A 5JD6A 4BECA 3NTOA 3CW8X 3OPMA 2DWPA 3EXFB 2I6QA 4B4DA 3BL8A 1UDAA 1H4VB 4F7DA 2ZSDA 1AMUA 5TGDA 4KE8A 3E3LA 3R5FA 5FPTA 3OTGA 3KJFA 5BO5A 3QI7A 1WOOA 5JAQA 4D81A 2JF0A 5DP1A 4KXWA 1L7QA 1E94E 1OI2A 1JKFA 1GUYA 1SK9A 4OQNA 2D0IA 2HV8A 4AKEA 2Y1OA 3RW9A 1W1IA 3C24A 5CNMA 2Z9DA 5FJJA 1E4EA 1N2CE 1T9CA 2PBRA 5AICA 2AFIE 2BMFA 3R9IA 5B7GA 5DGHA 5I47A 3OPQA 3QVVA 4OI0A 3KSDO 3EPRA 1RWMA 4NZOA 1O6ZA 2V58A 1S3SA 3QPVA 4WKBA 4MK4A 3RYCB 4OI4A 4UVHA 3PVZA 1ZLYA 4XGNA 2L18A 2Q1WA 4IOJA 5JLJA 3CW2A 4GF5A 4PGAA 1ORVA 3C1UA 1ZWLA 4Y1FA 3MW8A 1T2DA 3WKEA 5IF3A 1UP4A 1CWUA 2RGWA 4FW9A 3CRNA 4PLVA 4F5DA 4W8OA 4WNAB 3UB3A 3BWBA 1ABBA 2EQBA 2JAOA 1ORDA 3QBVA 5KSOA 4GYKA 2ZBPA 3KZKA 1QIJA 4PQYA 2IOFK 1YB4A 3ZZMA 4WFJA 4LTNA 4CFYA 4HLCA 4HWRA 1EWQA 5IASA 5HOQA 3QX3A 3PI6A 2W6MA 4M53A 1Q1GA 3BIXA 4B17A 4RVCA 2H1LA 2VK2A 1U8YA 4KAJA 1GZ7A 4MCHA 4MVYA 3TG2A 3DLAA 4RLFA 4BNDA 5LYJB 3D0OA 1YAHA 1D5WA 2ZYTX 3FVTA 3IAS1 1IE3A 1MO5A 5HCIA 1WNFA 4GS5A 2J8ZA 3GRFA 3L40A 1FFEA 4ND3A 3RR2A 2NO0A 3MCWA 4F5EA 4OHWA 3IP8A 4MO2A 5DT9A 5JZVA 1WM1A 3ZHCA 2WK1A 5LA6A 4FT2A 2JHFA 1PNQA 4XX1A 3JPWA 4PAWA 3UVEA 3VC7A 4Q9JA 3F5SA 1S96A 3HDVA 4MV5A 2OV6A 2JFFA 4MUXA 3PA2A 1TZKA 2X8WA 2HLDD 3X2SA 1W2WB 3QUBA 4CL8A 5LQDA 2HLDA 3A6JA 2E82A 4IIJB 4JLNA 5KYXB 1FSPA 3Q7RA 3MHPA 1LI5A 1OVMA 4M0PA 3UA4A 4DDUA 1JHYA 1TCBA 2P9TA 3BRSA 3PS9A 3LWNA 5KEIA 1SUFA 3EZFA 1FP7A 2E9SA 2UZ1B 2LWIA 4ECEA 1LV7A 2OBFA 4JMQA 4FFVA 4J8PA 5DXAA 2GN2A 1H4SA 2FMTA 1EHCA 2JLBA 1EK5A 1R37A 3IDQA 2V9ZA 3O1JC 5JY6A 4L8GA 3UV3A 1BC5A 2BFFA 4KJZA 4KN5A 3ULKA 1C80A 5LL6P 1XZEA 4WGGA 5TVGA 1MVLA 4KACA 4F21A 5BQFA 1CR6A 2XEXA 3IA7A 2J5XA 4Z5XA 2CVFA 3CD6B 2H1IA 1X15A 1TMKA 3NYWA 1UMCB 5AQEA 4M36A 4F4CA 1O9BA 1XZBA 5AI9A 2OXEA 4GM4A 5KDLA 4X95A 2YYZA 3F3YA 4X3PA 1FDRA 2GAIA 1Y8AA 2C96A 2JB9A 3KAKA 4PLFA 5HGXA 1FTQA 3NKFA 4POOA 2PGLA 1Z7BA 1HF3A 1WHTB 2ZUWA 4XUCA 3RHTA 4DBZA 1VQ4B 1BRTA 2P6MA 3VOAA 4MP6A 4F4IA 4C7XA 1Y7LA 1GPH1 3E9CA 3KQQA 1PUJA 1Y6ZA 4YCBA 2Z2JA 5CDFE 1XA0A 4RHUA 4C2BA 2TMYA 1GZ5A 1J8QA 2CLHB 5AW4A 1HEUA 1K9VF 2Q4RA 2BFEA 3V1LA 2NPOA 4TV9B 4ZAWA 2H08A 4ZYXA 3PX2A 5BW5A 1DT5A 1PHPA 5A4JA 3H83A 1F2UA 2Q1TA 2PE3A 3SG0A 1SD1A 2EX1A 1E6EA 1E1YA 2IJGX 4G3XA 4QEKA 3Q41A 1X9IA 2EQAA 3VOTA 4DBLC 1A71A 1DKQA 3NRJA 2ZDGA 1KI2A 3FRIA 4XVHA 1UJMA 2OR3A 4RTOA 3LPNA 3H4MA 3FKJA 3F3KA 5A4AA 3D4OA 2H29A 2YHSA 5I7UA 3KQKA 1TAUA 3CCMB 3CH7A 1M9NA 1TKCA 4R5HA 2GPNA 2KYRA 5DHPA 2P9JA 3EGDB 1OF1A 3EBPA 4CG3A 3RTGA 1TIPA 1O97C 3NU1A 3RRYA 2FG7C 1PKEA 1C0EA 8ABPA 1FSSA 1RLUA 4AMGA 5DMXA 1VCOA 1UAGA 2LP4Y 3CG0A 3DMDA 1H2FA 2O8DA 2WV9A 3OQHA 5A3RA 3OLQA 4WWVA 4OVKA 5AJHA 2P9HA 5CX1B 4CQLB 3HPQA 1YDWA 4YROA 3U40A 3IPYA 2R1VA 3HZRA 4FFDA 4EL5A 2CXOA 3MJVA 4ZHQB 2G76A 1AB5A 1POXA 1FMLA 4CG1A 2OHHA 3BCFA 4MUGA 1ONNA 4WJKB 2JH3A 3OFNA 3TWOA 3BHIA 4F96A 1HFJA 1R5OA 3JWPA 1P0CA 4NK4A 5MGNA 5AHWA 3AR6A 2FQ1A 5HRCA 2M6KA 4UFNA 3D54D 4FHGA 1G1AA 1T9BA 3JZIA 4YP5A 4TL9A 2QBYA 5JYBA 4E7OA 2DETA 5AJXA 5E6SB 4F6CA 3E2MA 3AXSA 3K0FA 3KK0A 4V0LA 2P5TB 4YDRA 2ZWAA 5KMGB 4M4SA 3AM3A 4BUCA 4DB4A 1EDEA 1U0FA 3CZ5A 2HJ9A 4N8SA 3BD6A 4P4LA 2WLTA 5IYNA 2QN3A 3QVTA 2ALJA 4KWCA 4ZJYA 1FTWA 1JTVA 2DF8A 4LHYA 3D26A 5IKOA 1FFSA 3JRXA 5H5JA 1BDHA 2WJVA 1L4FA 2OZLA 3F8SA 1MJ5A 3QMVA 4F8YA 1JF8A 5DHQA 3A8IA 2R84A 1SUEA 5HGJA 1XTRA 2C31A 3PC3A 2W8ZA 1XYYA 4QXPA 3EMVA 1VQNB 3TDKA 1C3OA 2ZT8A 3GCZA 3CUEF 5IBRA 2YRXA 5F76A 1JKJB 1ODTC 1RFLA 3ORRA 4PYQA 3RUPA 4EPYA 4AJJA 3EQ6A 2JGIA 3UJ8A 1E77A 4F2GA 4D82A 3CF4G 3R3YA 1ZXLA 1OFGA 5CYPA 2WIKA 4FDLA 4H1TA 4NEHB 4AS1A 2ZRDA 1P39A 4X05A 3IR6A 1BXGA 5DNYB 3Q8LA 1Q6ZA 2IHVA 2QTMA 2ZJ1A 4YDSA 2J9RA 4Q7LA 5JFGA 1S2DA 3BAFA 2ECPA 4JR1A 1KK3A 3LHFA 5HK8A 1LNZA 3MWDB 3LHKA 3QWIA 2PZFA 4OOSA 1DRKA 3ST7A 5E8RA 1RC1A 4JVSB 3WL7A 4BMSA 3GC6A 4FYVA 4BVKA 1N2CB 3ZE1B 3TSAA 4M1TA 3EQ7A 4QJ5A 3TX2A 4GG1A 2EW2A 2IYAA 4REMA 1NONA 4LYJA 2D9RA 4G37A 3V7FA 3TRIA 5CB8A 2IE0A 2ZCUA 1MRZA 1EU1A 5AVJA 2PXXA 1L1RA 2G4VA 3I4LA 1K5DA 1YS4A 3PC6A 1SH7A 3P7MA 1OOEA 4D8VA 4F4HA 2PIAA 2NPFA 1LLQA 3GLUA 3MWDA 2GYWA 4XFKA 3S2IA 5J2UB 1LJLA 1MG5A 1RRPA 1Z4QA 4G01B 2ZRLA 2O2XA 5A5FA 3WXMA 4H7JA 1MLDA 3EVAA 4M60A 4UM8B 5ALFA 1ZMBA 4DILA 1AC5A 2AN5A 2Z8YM 3KZ1E 1J07A 2HMVA 1YIAA 5KPDA 4UTZA 3BUSA 1OFUA 1MQSA 3NDRA 4QLOA 2XWSA 2TS1A 4ZYTA 2HJHA 1FNBA 1F8UA 4KOAA 3CEJA 4MV1A 5BWMA 4NPAA 4N54A 1YS7A 3QYPA 5EYPA 5F7JA 5IBPA 4IV0A 1YVDA 3SJPA 1YA4A 4I9HA 3MOSA 1W9HA 2ZYAA 1O89A 3TM4A 2UVDA 4D4JA 2FWIA 3ICCA 1K5PA 3RJTA 1B2RA 4FFPA 3TZEA 2CJWB 3I04M 2GUWA 3SF8A 1JUDA 4U4AA 2NMVA 2P9CA 3I83A 4XA8A 4Z7OB 3HWSA 4G5FA 2D2EA 4KQEA 1LXCA 1EDZA 3C70A 4FOPA 5EY5B 1UBRS 1DTEA 4RPHA 1CJTC 4EJ6A 2FUG1 2P9FA 5CXUA 2QRUA 1WPCA 1K8ZB 4X3CA 1JI3A 1O03A 1XZQA 3QOXA 4N0MA 4EOGA 4B2IA 3W6OA 3TIFA 3SXUA 1JDNA 2A84A 1J8DA 1MMFB 2O3QA 3HJRA 1RWKA 4J7UA 4GMDA 2BKVA 4RANA 4UNQA 1FLNA 4X24A 1IPEA 3HY4A 5FWYB 1D5CA 1G18A 2BV3A 1NRIA 4O33A 1N2IA 3CO0S 3IVMA 2HHHB 4OL9A 1EJBA 4TL8A 5BOVA 3JQRA 3CP2A 3W6UA 2Q4EA 4LUCA 5E3IA 4D74A 1BGXT 2WJPA 1K27A 2GCOB 4WUVA 4AWXA 4URWR 2QSYA 3SS7X 5B4UA 2IXBA 2RG1A 1M1NA 4KE9A 1HTBA 3BQMB 4BFCA 1YE8A 1EM6A 4NU8X 4O5OA 2VF5X 3LY9A 2DB3A 3ZU2A 1QH8A 3KDAA 5DNDA 5JJIA 1ZK1A 2E1RA 4XWKA 4G84A 4X7MA 1SUSA 1UZLA 3UK1A 4ARZB 5HP4A 2X2FA 2C9MA 1UFOA 2OBXA 1ADFA 1KQNA 4Q7QA 2ZJBA 1MAVA 1GGJA 2JGFA 3R0XA 4N49A 4BTEA 2ZSBA 1YR7A 2FN8A 3ND5A 4MYUA 2E1PA 5K2MA 2Q7DA 3B8EA 4LK2A 2YS7A 3IQGX 1J33A 5B1DA 4OM8A 2FP4A 4QDXA 3Q3AA 4ZT5A 1WV0A 4Q47A 3KYDA 3I61A 2ZW9A 1EK0A 4H77A 5JPCA 4QEZA 1D03A 1JLHA 2L82A 5JADA 3CCSB 1WF6A 1C50A 2X1HA 4PR3A 3BIWA 3W5VA 3UO8B 1PG0A 3DQPA 2JA1A 1GCUA 2C8KA 3HPRA 3QKRA 3SM9A 4FHDA 2JFWA 1NJSA 4QLAA 1M7GA 3IFSA 3SHQA 5JTTA 2O8BA 1ID1A 2IP2A 2VYQA 2GD0A 3PFCA 4R2IA 3WV5A 1FA9A 3RAFC 3OT1B 4J2TA 3HYNA 2EX0A 3A9UA 2HWXA 1A1SA 4FLMA 1HDXA 2W6IA 2XYPA 3T7AA 1ZJWA 2I2BA 2I29A 3G8BA 1D6NA 3L04A 3X1MA 1N5OX 1ZEJA 4UUPA 4YCDA 2VP4A 4YBRA 4DHWA 3AEYA 5AVTA 3ESZA 2GYYA 4XMYA 3PC4A 2YZ7A 4I8IA 4RF2A 1CS0B 3KT8A 5H0IA 3D6UA 5BOSB 3GUZA 4RHEA 5AXAA 3OZIA 4ZRMA 2OP0A 4INAA 3VR6A 2YZNA 4L9RA 3I6QA 2ZSUA 5HNKA 4C87A 3CLHA 1WPRA 3F3MA 2GSWA 3BE8A 4DPKA 2QKYA 1T9HA 4N0EA 3N53A 4PFJA 5EKUA 1L4MA 2X6XA 5EWJA 5JC1A 1KI1A 4JV5B 4R1LA 2Z5GA 1Z2CA 1ZI9A 3NOXA 3HHPA 5J58A 3PEWA 2NX2A 2QLNA 2R1UA 1XDBA 2E2WA 1WQ3A 3E8SA 2GJ8A 3GGGA 4Q16A 4LF8B 3KRTA 1AE1A 1JQDA 2OZVA 4PBSA 5ICCA 2Y6UA 4BNUA 1ZW6A 4UHCA 3O8QA 2H16A 1JKMA 1HZZA 1HXHA 4FP9A 3H84A 1TEXA 3OAAD 4H1VA 4ICIA 2O8CB 3EVZA 4RVNA 1ZUD1 1EJ0A 3HB9A 4JI8B 3KNZA 1N25A 3E48A 1KMNA 5IJ0A 1MU0A 3I0MA 3HZZA 3QVUA 1Z5NA 3G8YA 4GLFA 5FLYA 4DM4A 2RE8A 1A96A 3KX2A 4NICA 4C7MA 4WBNB 1NVKA 4JL6A 1LDMA 5L7WA 5DS0A 2A0XA 3E9DA 3SAJA 2PQ6A 1XCLA 1MO6A 1H5QA 4AZ3B 4Q4HA 1RCUA 1X7XB 3ZHBA 1O08A 4RACA 1DQYA 5JUWA 4UOEA 5C18A 2XB4A 2YMMA 4ZVQA 2RBEA 2B3TA 1TD1A 1XLWA 2QMEA 1TZ2A 3NOOA 1ELOA 4J0EA 5G2OA 3DXXA 4UCFA 2WM2A 5GAJA 2JG3A 5K8VA 4R1QA 2B78A 5E2AA 5CK4A 3D7LA 5E4FA 4A2CA 3FYCA 1EFUA 3AU8A 4TQGA 3MCAA 4B3GA 1XHEA 3MGBA 3RWMB 3VAZA 3L6EA 4B3SB 1MIOB 1AQ6A 3CZMA 4ZOEA 1E1QA 3ZWKA 4YRFA 4AZ0B 5JAHA 1JHAA 3EC7A 4HD8A 2F55A 4C1BA 1QH8B 1Q82D 1ODLA 2I78A 3VISA 4MRRA 2XYQA 3DHYA 4EZBA 2HR1A 4B0PA 4E94A 4ZV4A 1U2DA 2E4AA 3KQWA 2QU7A 2C8LA 3IO3A 4GZLA 4QLBA 3GDGA 3ROQA 1UIRA 1NSFA 2YJTD 3KB6A 4LOIA 5K6AC 1Z08A 1KJ9A 2QQ0A 4YQEA 3CESA 1A0OA 1AX9A 1K4KA 1LTHR 2SHKA 1GTMA 2D0OB 3CWQA 3EWSA 3C7KA 1O6GA 1IQUA 3KC2A 2XOEA 2D1RA 4J4TA 3UHFA 4QGSA 2XBMA 2ZI4A 621PA 1SVUA 2FZ4A 3LCVB 2GT1A 4DEVA 3ZZNA 2I6FA 4AZVA 1E9DA 1EFKA 3BTVA 5HW0A 5J2TB 3T5GA 1WMBA 3AYZB 4NS4A 2C7GA 3FH0A 2I9KA 1A7UA 2HJSA 1UM8A 4HV4A 4PYNA 1CNFA 1UJNA 1WD7A 3EXIB 3MINB 4H1HA 1W29A 2P9GA 5AJWA 4II2A 3U7JA 2JLZA 5JCPA 5EKDA 1MEJA 4BU0A 1UBUS 3VV2A 3TB6A 4PG7A 4P4UA 3E7WA 2GN4A 1X7DA 2R79A 3JWIA 1N0VC 4YJFA 5H83A 5TPWB 2C5SA 3FKSA 3PFBA 2X7HA 1QCZA 1PGJA 1XCPA 5G3ZA 2PUDA 1JEDA 1RTKA 3A6EA 3R41A 4IBOA 5AFSA 4IH1A 1LPNA 4G5RA 3INRA 3FLEA 3WYFA 4UDYX 3GT4A 3VR5A 2Y71A 1IAQA 3SEZA 4EUNA 2AKEA 2ZSJA 1V37A 4K9QA 4PX5A 2VBFA 3DS8A 4S1OA 3T9FA 5JVDF 4MWZA 1URPA 2HPAA 5HS4A 5KVCA 4Z53A 1YDEA 5EUBA 1ZINA 5LR6A 3UJCA 3PLRA 1X80A 4OFXA 3TIGA 2CCGA 5GZ3A 1J09A 3T7CA 5EZYF 3RTCA 3WYGA 1SXJA 2WFMA 1ZGZA 2ZOSA 3K0CA 3MEQA 4GQAA 2MCFA 2VLBA 4Z4SA 5C1OA 5IM4A 1OV6A 1Q3TA 2AWOA 1Y42X 1F6BA 2GKSA 2CWDA 3DXYA 4DY6A 3TNJA 3FWHA 2HA2A 2XVZA 5HE8A 5CDGA 4WJZA 4M86A 5A6SA 5K3SA 5C9ZA 4MUIA 4IXMA 3DZGA 1C7JA 3I6MA 3I6YA 1Y1RA 2R5WA 2PMWB 4JENA 1SVMA 1VMDA 3QUCA 2BC9A 1XU7A 3TKLA 5GONB 3VQTA 1XTBA 4J16A 3DLCA 4NAHA 3LOUA 4BAGA 3HSKA 2EZ9A 4QO8A 1XMOB 2ZYUX 1N3LA 1PSZA 1RRMA 1VPLA 3O73A 5DPMA 1B8UA 4FGLA 1P44A 1VBNA 3BHMA 2FQYA 1GN9A 4FQ5A 5AM5A 4RKWA 1W8IA 4S3MA 4WADA 3A06A 1HDOA 3OTQA 3EG9B 5CM8B 3LDGA 1M8FA 1DLIA 1P9WA 1KMQA 2R6R1 4QAQA 3WS7A 1GTRA 3DHNA 3TEFA 1XAGA 4OLJA 1SBYA 3DE7X 3M34A 2OBSA 2GCGA 3OQ6A 1QVFB 3IAAA 3SQNA 5AVSA 4EDFA 5IAGA 2WWTA 4HWOA 4RO0A 5IN4A 5FF9A 5G53C 3WLRA 3GPBA 4OJKA 4R8RA 4ARAA 4X71A 4ATNA 3ZHTA 3ICVA 3VGPA 4D80A 3I8SA 5DHSA 2WG0A 5INTA 2FLWA 4MR8A 4GRIA 3N7UA 4E46A 3DMTC 2CDCA 2OQRA 3I52A 4B83A 2E6KA 2OYCA 3ZV3A 1XTPA 2XNCA 4O2AB 2OK7A 4AZ3A 4ZDIA 3MGCA 3BXEA 4EF5A 4R7TA 3RROA 4H15A 4ERNA 5J43A 4M1EA 5ADVA 2XD4A 3KL9A 3C3WA 1QKKA 2KBEA 4UM9D 4X8LA 1RFGE 1Z8FA 1SOVA 2OORC 4RIHA 5JJ5A 3N8HA 4UXIA 2PMFA 3PUIA 4Z4WA 2H3HA 1N05A 2IUUA 4TV8B 3SDSA 2O3UA 4HQNA 3GMIA 3RH0A 2YJ4A 4HZGA 5I9BA 5LJIA 3IAUA 2NOAA 3PD0A 3EXG1 3EYAA 3U49A 3SDBA 3CLSC 3UAVA 2X5KO 4ZZ1A 2Z30A 5JQWA 1NQVA 3BA6A 2I80A 4UHHA 1NVFA 2ZQ5A 3QVLA 1TZBA 4LIPD 1G60A 2J0VA 4R1MA 2F7SA 4ZA2A 5HKBA 4QDZA 2GXUA 2PEYA 4YIHA 4XPZA 1ZYUA 1GNPA 1EDBA 4QQ8A 5LQJA 2ZWOA 3CGGA 2X0RA 3OJFA 5G0VA 4TGLA 3WG9A 5KYWA 4RV4A 3BD9A 2EJBA 2N1BA 2O3RA 1IK6A 3AR3A 4DCTA 1Y98A 5C2JB 2WHQA 4DM3A 1ODSA 1Y3FE 2YWJA 3AIKA 1VJTA 4V02A 2FNAA 4O02B 3BGDA 2WP8J 3U37A 2ZUDA 4OJMX 5MHTA 4QDKA 4MUMA 5ALEA 1D6JA 4O25A 5BSHA 4QM6A 3QA3E 1RM5A 4EKYA 4PYMA 2UUOA 3DMGA 4BLTA 3GG9A 3VVMA 4PG8A 2AHOA 1KK0A 1COZA 2RH9B 5JZSA 3CB2A 4F9FA 3EAGA 2CZGA 5KNCH 1NBEA 2BEUB 4P7FA 4YTEA 4ZQCB 2EF0A 1KQFA 4ESVA 4YMLA 3MJ4A 1G16A 1HDEA 2I03A 4L0DA 1DIAA 5EP4A 1IFXA 2D8MA 3DT8A 4E6EA 3G7UA 2CKDA 3GDOA 3CY6A 3PQ2A 4C89A 5KYNA 1JHUA 2IIPA 4C76A 4NJEA 1IJFA 2X8LA 4TX1A 4UXJA 1PNTA 2PKRA 5EMJA 3RC3A 1U7DA 1C0LA 4IRMA 4KDFA 4O4HB 4EG4A 7REQA 5SZHB 2JH8A 1SOUA 1YJAA 3DE4X 4PO3X 4WSOA 1VG9B 3S7TA 2G9VA 1AT1A 3C5EA 4Q4JA 1IZYA 2OSVA 1Y1KE 4FOTA 1JIXA 4OFWA 4DMFA 1OH8A 4MV4A 1RABA 3IOCA 3AEQB 4Z9AA 3NTQA 3VOSA 4DREA 4BVHA 1R66A 5TNXA 1E9AA 3QHPA 2W2OA 2DHRA 4HYYA 2QN6A 1JMYA 3IJEB 1VQ5B 4GI7A 4RPIA 1TU3A 3KR0A 2IZ1A 4DG5A 2A6PA 1QWOA 2Y0CA 1J2TA 1W59A 1EA5A 3FYUB 3DPIA 3GNQA 3P0JA 4AC9A 3PR2B 5KOHA 4FFBA 1ZN7A 3N3BC 1L8QA 4P26A 3TIXB 4PLWA 2OESA 5KYKA 3BREA 5A4KA 1XV5A 2OBNA 4DNRB 5CH8A 4F9TA 4XGQA 4WN9B 4DYVA 2V7PA 3R6KA 3HN2A 1FSZA 3GVXA 1GQQA 2IPLA 4HZUB 3RTDA 4EUFA 2V7EA 3MCUA 3MTDA 4LWPA 1Z9BA 2J41A 5TJ9A 3PHBE 1FC0A 1ZG3A 4GXRA 4XQCA 3SE7A 5CLGA 4DNFA 5D5PA 1HNXB 5FX2A 4TPKA 5DKFA 4KU4A 2AUNA 2AC2A 4RZQA 4DA9A 4KWIA 4L95C 1E0KA 4CIYA 1MQ8B 3NAMA 3KOOA 4MJXA 3PYMA 2ATXA 1J0XO 4GSKA 5BSFA 5KS2A 2B5VA 4TSFD 5JXHA 1F1BA 3C4JA 3TLMA 3AJAA 4PEVA 1BWSA 5AHKA 4XIFA 4ML3A 5JJLA 1SQ6A 3TUIC 1VBKA 4LSGA 5ELLA 3AERA 3TCNA 4KW7A 4UULA 5FTWA 3U09A 1NIJA 1EE1A 3ITNA 1VHOA 4IFEA 1RC0A 1YZ3A 2IX9A 3N28A 2AZ4A 2O54A 4H31A 4UMEA 2H2HA 4TZ6A 3VTZA 4S1TA 4OHBA 1C0IA 5LOVF 5CA0F 5F9HA 4ZYLA 2IS4A 3ZV4A 2VAPA 1E8MA 4K9LA 3WOHA 1KSJA 5FV4A 5IK2A 1XF9A 3QW4B 4QHSA 5MGBA 2FW9A 3IA2A 1BEUB 2B6NA 1RCFA 2FF7A 2HSGA 3QF4B 5T6MA 1WG8A 1QDLB 1U7PA 4FXUA 1WDMA 4M76B 3KL4A 2NSYA 4NYJR 5CM9C 5DULA 2LVBA 4KFTA 2KHZA 2VA8A 2FY8A 4KR9A 2GCPA 3HB4X 1VRVA 4ZO7A 3VNRA 4FOOA 2GLXA 4GR5A 1Q7TA 2VUTA 1ZUIA 2C7VA 5K3DA 4F2WA 4XI9A 1G2PA 3GJYA 5D00A 1QPGA 2QMQA 4ZPXA 2PSDA 3SEFA 5LU8A 4MR7B 3DEIA 4XUGB 1SG0A 2ZETA 1WZUA 4B46A 4CM1A 3CPXA 3CXUA 4UVEA 1QFYA 4RDKA 3PDJA 3RQIA 3SS8A 5A3QA 1P19A 3PA1A 3OEED 3UCXA 2V4MA 4HWGA 4G1MB 1AF7A 2JKZA 4IDFA 5L46A 2QGGA 1IM2A 2I55A 4OO3A 4Z7NB 4MW9A 3I62A 5FWYA 3I9V6 1CQPA 3CONA 1U2GC 1WSDA 2WU0A 3DBLA 1E3JA 4MCAA 3HVIA 3BWEA 5F1OA 9GPBA 3PX7A 2AFIA 1BN6A 4ZVVA 3W8RA 2LIVA 3C4VA 1XTSA 4OH7A 1VJGA 1T2EA 1JEEA 5K03A 3GIWA 1KU6A 4XTCS 3SZLA 1SRRA 2Z58A 1SJ9A 2EJVA 4CM9A 1WRBA 2B2XA 1JMVA 4JI5B 1QHNA 2NTVA 1XFDA 4PN3A 3RKSA 1AKYA 1H2EA 2DJIA 3I53A 3FD8A 4MJLA 1AN9A 2GNAA 4U00A 5IKEA 1QM5A 4PHFA 3J81k 1O96B 5L7TA 1CFZA 3A6LA 1A88A 2UDPA 2YQ4A 3SLGA 4CGYA 2HXYA 4BKPA 4FS3A 4Z4GA 2YC2C 4AMYA 3RFCA 1Z4PX 2IYLD 2BM0A 3CV3A 4GE3A 3ZTTA 1QLWA 4NS1A 1RXYA 2REXB 3JQAA 4Q19A 4IFTA 3F1KA 4YRLA 4W5NA 2ARKA 5FHQA 3VI4B 3IQIX 4MHOA 3AP1A 1TO1E 3SC3A 2VH2A 1R4NB 2QPOA 3ACBA 2NSJA 3M70A 4GOND 4YP1A 2DWCA 4E03A 4IJMA 4WXHA 1JKJA 1RLJA 4C0KA 1E3ZA 2XRMA 1XZIA 1V4BA 3JQ8B 3V6MA 3X44A 2ZZFA 4Q00A 2H1SA 1WOYA 1JLSA 2AFVA 4OBWA 3ZGXA 1XZLA 2XAAA 1AA6A 2ONKA 1Q0RA 4J91A 1GFIA 5DM2A 5LDHA 4MEBA 4W7SA 2HREA 1PJQA 3QEKA 2AN4A 5J4YA 3GT3A 3T06B 2KLHA 2ADFA 2YW9A 2VQ3A 3EZXA 4LC1A 2ZM6B 4OLAA 4LXXA 5EMLA 4LJAA 2VHZA 1JA0A 1JZQA 3D5TA 2BFDB 3BWXA 4Y2SA 4F3YA 4Q1FA 3HBJA 3TR5A 4JJAA 5DTMA 1QHXA 3HNOA 2ZAIA 5D84A 2OC4A 2AOVA 4DGQA 1SXPA 2GEFA 3JX9A 1N78A 4TN1A 1G8PA 4AUNA 4YEJA 3C3KA 3SX0A 4LG1A 4CL2A 4TN5A 3SD7A 1BW9A 4TLAA 1NBOA 3LECA 3ZJUA 3GZNA 4Q3EA 1FX0A 5IW8A 5K0FA 2FEMA 3WWYA 3B6KA 3LQYA 4IS3A 4RHFA 3TOVA 3JPYA 4GL4A 4KVZA 4ETIA 2RAFA 1EXWA 1KO8A 2BFEB 1P1IA 4O2RA 1O8CA 3OCUA 3RU9A 4F12A 2W11A 1LQUA 2YXBA 1M2OB 1GGMA 1RXVA 2HYIC 2FCAA 4MMZB 2BUAA 4RPBA 3FCUB 3FVQA 4UUMA 5ADUS 5CT4A 3BZWA 1L7AA 4OKIA 3M4NA 4D3YA 1U0HC 2P4UA 1PZHA 2A4MA 2I3DA 4Y1EA 4XJXA 4KV9A 3AT1A 3ZQ4A 4HWKA 5AKXA 4HFJA 3WO0A 3L77A 4RGYA 3FMIA 5IAOA 4W1RA 2Q46A 4GMFA 4UE6A 4AKSA 4RY0A 2W8BA 4R1SA 2ETXA 3PHCA 2XUAA 2OSBA 5HVNA 1SHUX 4LISA 5JMOA 5KTMA 1SXJD 5ALUA 1E2DA 1T13A 1UPAA 4ZI3A 2F4VB 5H9VA 5JAUA 1EQUA 4DQ0A 2JARA 4MJ7A 4XL9A 3FOEC 1OA0A 4M1WA 5KBYA 1SXGA 2B1RA 3OUTA 2BBSA 3B9BA 2R68A 3ZIUA 1JIIA 1YOBA 2FJ0A 1QG6A 3IQDB 4CDGA 3IL2A 1WU7A 5CB4B 3GLGA 1U7OA 2JJ8A 2H0AA 1L7PA 4YXWA 2O1EA 3R24A 1DGQA 4M9RA 1HDRA 2VSOA 1V0EA 4HNRA 2BGMA 1MJNA 4ABTA 3GRYA 4GXNA 5BQOA 4J90A 1U3CA 1QSGA 3IHTA 2YHBA 4NYJQ 2WYIA 5M7EA 4GGOA 1QHFA 1R6XA 1Z0DA 5A3JA 2V7GA 3AETB 3NZEA 4F86A 1PFUA 4KBGA 1KEVA 2VH5R 2Q3CA 4WD3A 2C2MA 3ZHSA 1V3UA 1E1RD 3HQ4O 4UBOA 1UP7A 2G08A 4JS0A 4MQEA 1E7QA 7MHTA 3PTZA 2DLCX 4DMKA 4HQRA 4LTDA 4II3A 1L5YA 4CCSA 1KL7A 4CM4B 3G05A 2AXEA 3DEYX 5K3CA 4B45A 2QJOA 1N06A 1P2FA 1QZTA 2CD9A 3CLSD 3RSOA 1ADBA 4Y2RA 1Y3BE 4DY4A 3WI7A 2ZL6A 3GQBA 4JA0A 3KAPA 5FRDA 2AVDA 3RGGA 5E6RB 3DXFA 3NJ4A 2HK7A 2VWHA 1RYZA 3E27A 1Z2PX 3RPEA 3LY5A 1QMPA 3B1VA 2WIFA 3II6X 4OQ4A 3U1TA 2VDUE 3P9KA 4KC0A 2PYIA 5EERA 4US0R 3DFUA 3NBFA 2AN1A 4L57A 4K87A 2R1TB 1K6XA 4ZGGA 2ZVDA 1QUEA 4YRIA 1RDFA 1HZEA 1K8AD 1OXSC 3OOWA 2X9GA 1IPFA 2I7TA 2WWRA 1YZYA 5B3AA 4D4LA 2JGEA 5CITA 4NPCA 1BS2A 1KYYA 2H57A 2WHPB 2XIJA 3IV6A 5KREA 2JBAA 5FUVA 1KJ8A 3FY4A 4Z4ZA 2HIMA 5C8YB 3O2SB 4UM9B 5LLTA 4XD7A 1GR1A 1K28D 3HXPA 4MWTA 2CXPA 5FQNA 3EF1A 3L6CA 1VQOB 4MRNA 4FC6A 1BX3A 1MF7A 1UWLA 2PLAA 3HBMA 1R0ZA 2VPZA 3VUFA 3H4VA 1PGOA 1OFIA 4ON9A 1OIVA 4YALA 1LLUA 2RC5A 1AUVA 4YMSA 3CCEB 3OHMA 2ZYDA 1YD7A 2Q21A 4YMIA 2F1KA 2IF2A 1Q14A 2ZS7A 4J1NA 3DZIA 4KAAA 4LXYA 4BNKA 3GP8A 4U6SA 1FMFA 1PDOA 1MHTA 1FMCA 5F1YA 3VR3A 1PT7A 1MOSA 1VYUA 4JSYA 2WZCA 3HVUA 1H2HA 2J6HA 5EWMA 3T1NA 4M1KA 2PG3A 1E2QA 1PT8A 5G40A 3VSAA 3A1EA 2XB6A 3C3EA 2GBPA 3QPWA 2YYAA 3AI1A 1DC4A 4DIDA 5C1PA 2IRWA 2KSQA 4TWRA 3ILYA 3WBBA 1WETA 2XBUA 4DL9A 4AJNA 1CG6A 3I3OA 5FOWA 1Y4ZA 2IU6A 3H5VA 3UKOA 4B81A 4DOMA 2UUCB 5KQMA 4ZCTA 2IEGA 1P1HA 3IHKA 3QF7A 2JGLA 3CCJB 1KU0A 2QAGC 1Z5WA 4GBMA 3SC4A 1R4MA 2WYWA 3BE4A 4JOQA 5DYYA 3OQBA 2HHLA 3K1AA 1FVXA 1LBIA 2VT6A 2ZJAA 4ZK6A 4Z4FA 4M54A 4HKTA 1Y6GA 3UMGA 1T3HA 3RJ9A 1V26A 5K0EA 3PQCA 4CWAA 2XA1A 3W90A 3S8EA 3RSQA 2WWIA 2QA4B 5D5QA 5J63A 1RC8A 1YNSA 1AQLA 3I5XA 3F6CA 5A5DA 3JQGB 1V71A 5LC1A 4FGZA 1GCIA 3L2OB 1YB6A 2WF5A 3TVYA 2IP1A 2Z5LA 1V1MA 3GYGA 4MVJF 3GH1A 1B0UA 4UFOA 4WNYA 3T1QA 3TJZA 5HXAA 2GM4A 4Z8XA 2ZR0A 4CTKA 5FTMA 2AW5A 4L28A 3G68A 1A9XB 3ESAA 4UTOA 4TLDA 5CTAA 4YX9A 5HQ3A 3TTYA 1XP8A 4JNKA 3T12A 1X1DA 3BDIA 3BH0A 1CUZA 1BE1A 4P32A 3NOVA 1VHEA 3WYNA 2LPMA 1IVYA 1RYFA 2XCQA 3K1JA 1U7HA 3L7OA 3P5SA 1JPNA 3L0OA 1RM3A 1IN8A 3JWEA 4IF4A 2OV4A 2XB9A 2PR7A 1JP7A 1V1MB 4LE2A 5JBNA 3EISA 3C8UA 1L5HB 3LBAA 2J5KA 1HWYA 3QU5A 4DNQA 3IIKA 4Q7JB 1GKIA 1IN6A 3KHUA 4GWGA 3T52A 1M5TA 1G8KA 1Z8HA 4JD5A 3MNFA 4IIFA 3OJXA 5TR9A 1GZ4A 2Y0DA 3TLAA 3OTOB 4XB2A 1DUIA 3LDFA 3RVJA 1W44A 5DBOA 5A3VA 2F64A 1WB5A 4Q3CA 1NVBA 2VJMA 1JGTA 2BWJA 2J7PA 1CZLA 4O3FA 5TX7A 3ZV5A 2XGOA 2GLUA 1O87A 2Q28A 4YO8A 1RACA 5D51S 4C43A 2VH1A 2CJFA 2X40A 2VHCA 3AM4A 4PHCA 5FYQA 4IP0A 2D1FA 5IVPA 1ILWA 3M1YA 3OLWA 3KZXA 1L5NA 1QE5A 4NR0A 3AFMA 1GSOA 3RTEA 2VTVA 4A6XA 4E15A 2AHRA 1WSBA 5HFJA 4WI1A 3K72B 1KEZA 1IHPA 4P7BA 3QKIA 2QYOA 1P77A 3FWYA 4NNJA 4D3SA 3L3BA 3COPA 5SY4A 4EG7A 5KNBA 1N6OA 3NBMA 4J0DA 2BHNA 2IH4A 4KPFC 3RI3A 4AUEA 2O7SA 3CZQA 3HCPA 3MGGA 4URYR 1M34E 4DDTA 3GARA 3QEBZ 1J56A 2QL6A 1XI2A 1PEYA 5DISB 3AGQA 4UU0A 2Q2QA 1P60A 1VF7A 1IZZA 1LBQA 1P2VA 3OURA 3UOWA 1FJGB 1QCDA 1Y1SA 3IMFA 3GMSA 2WC1A 3CM0A 3ZS9A 4FDUA 1IY9A 2Q7XA 2H8GA 1TW2A 4PIVA 1YZGA 2FEOA 2J0UB 4K8OA 2YL2A 1Z6ZA 3TEJA 1AN0A 4FWTA 2I4TA 5I8ZA 1MGPA 2OL4A 4RU1A 3WGNA 4CDMA 2VK4A 2EL9A 5GONA 3FPJA 4X8HA 1RJEA 1FLVA 3H2ZA 3T38A 1PI3A 2PRJA 4Z99A 3KQSA 4BFVA 1XGKA 3A25A 3AB3A 1W0KA 2QW0X 2BMWA 1Z36A 2VEDA 3GN1A 4IHAA 2DTEA 1YS9A 2NADA 4OKNA 1I94B 4NC9A 3DR3A 3Q6MA 5FPSA 5CA0A 5F5LA 4WY8A 1HDCA 4CTJA 1KQGA 2Q6TA 3CUKA 4XUEA 1AKTA 1LGYA 4HBGA 1ADCA 4UNPA 1MORA 4GWKA 3ZGOA 2PQ0A 2I99A 3T5DA 2IEDA 1PYGA 4XIIA 1QKIA 1NR1A 4P1VA 4IJQA 5MFPA 3SBDA 3IAM1 1X7GA 3U7IA 2P9YA 2H2DA 4EGAA 1EUDB 4LDRA 4YRGA 4J1TA 4GD3Q 2OHXA 1W581 3BERA 2IHYA 1FJ2A 4QFMA 3L79A 3N6RA 1SBZA 2G5GX 3ETNA 3F46A 4ND6A 3UK7A 1DLJA 4JEUA 3UMBA 3X0DA 4DAEA 4RZSA 4UVGA 5ALIA 1T5BA 2L2QA 4K5QA 4ANFA 1Q83A 3PA8A 4P7JA 3MYYA 4Q4HB 1TO6A 3Q4GA 4RD3A 3CRQA 5BN3B 1AUOA 2FZ5A 2O8CA 1JLLB 1CSEE 2J4CA 1DX9A 5FUMA 4K3UA 1LSUA 4X7BA 3TW4A 3HMKA 3TAHA 1DTWA 4QULA 5KOHB 4QXRA 5DMHA 1VPEA 2GYVA 3HKEB 4JI3B 1K7CA 1KEPA 4Q9HA 1NM5A 1XA3A 1XD2B 4BFYA 2WG2A 4YPVA 3A6PC 1CLEA 5HF8A 3K2BA 3O4HA 1KOLA 3H1PA 1R2QA 3WADA 2H63A 2OG1A 3ZLVA 4ARVA 2O5CA 1Q0SA 2Z3ZA 3CHYA 2JGAA 4C6HA 4LRQA 1P6QA 5GV8A 1V0FA 1EVYA 3MTAA 3ONEA 3UYLA 4BUJA 2G36A 1P0FA 4EHLA 3C8HA 5JISA 1NF2A 3Q72A 1WW3A 4UUAA 2BMJA 1IHMA 4H17A 2IEBA 1SIOA 2PH1A 1ZU5A 2Q0XA 3ISXA 1K5GA 4D9EA 3AVTA 1W4CA 4ZDKA 1Q86D 1G5TA 3PSHA 5H3CA 3DDSA 3BF8A 4A2PA 2O0HA 3WA7A 6PFKA 3VYRB 3KM0A 1DJMA 4FE3A 5CVDA 3ICOA 1WP6A 3A37A 3ERCA 1MZPA 1HQDA 2F3SA 2DPMA 1LKZA 3CWZA 4X06A 4BNTA 3DOEA 3HXKA 5F5XA 2ODAA 1GTJ1 1NQXA 4J6FA 2W42A 1JR6A 1CYDA 1ZHFA 1OZ0A 1TK9A 3OCZA 5CT8A 4BS9A 4L8VA 3UGJA 1GM5A 2WQ6A 5CCEA 1C9JA 2R47A 4HEQA 3TFQA 3W8DA 3B20A 4U3JB 2CT8A 1C9MA 1P62B 3JWGA 3C97A 4G1CA 3THXB 1OXKB 4ZHQF 5TGZA 3PPXA 1TYAE 1T6XA 2E85A 3GUYA 4CMAA 3QTBA 4PO8A 3VC3A 4D57A 1TJYA 4EAAA 3M6FA 4G0QA 4Q4AA 1CVIA 2VF2A 3GVLA 1GDTA 4B47A 3GX1A 3HCAA 2ZLBA 2JFOA 2Y05A 1TVCA 1W0JA 1YJBA 1P2SA 1KYXA 1UKVY 3CISA 4KDEA 4CM7A 1UFKA 3ECSA 4YJ2F 3AJ8A 1GADO 5THKA 4O0LA 4TWJA 2QVXX 3FPCA 5AXDA 3UHAA 4C03A 3K9LA 3DNMA 3N8IA 1TCUA 4XKJA 4JL5A 3UK2A 4BX8A 1U0OC 1NN5A 1N2EA 1NW6A 1S72B 4DLVA 2EJTA 2FW1A 1KXJA 2DBYA 5KWJA 5JLAA 1M2VA 4DQKA 2LIPA 3EOAI 4IGAA 5A1JA 1QIDA 3D3QA 4Q3LA 1P29A 3B2NA 4DUPA 3R09A 5T41A 1BX1A 3H94A 1PR1A 2WMDA 3MQ4A 3FGNA 1NMYA 1HEIA 2EIXA 1T6YA 1GN8A 1RPJA 1CKEA 1I1NA 1P9RA 1ZKDA 2OHFA 1H8HD 2II6A 1KC1A 2BKLA 1A8QA 1ZKMA 2HA7A 2GAOA 2IYZA 5BV0A 1PZGA 1W5TA 3G5UA 3VHXA 4RTRA 2H9AA 3I09A 4LS3A 1FUYB 1N1DA 4Y6GB 4R71A 2AOWA 1PJ7A 3OW7A 4JXKA 5EZSA 1XLUA 2QU8A 1O8BA 2IYFA 3W8NA 2MMCA 4GOLD 1OZGA 2YDXA 4F1KA 1UZMA 3ADBA 4X1YA 5EESA 1L7RA 4PBRA 1CYEA 5LCXA 5AW6A 2QRVA 2AYYA 2Q29A 4NCXA 2FDCA 1M2KA 5HF6A 1NWHA 8ATCA 5IC4A 4X7DA 2D7JA 2KE5A 3MT7A 3ES9A 1ICIA 1Y81A 4OXRA 4DR6B 2C1EA 1TFUA 4GNRA 1EK1A 2TMGA 3AR2A 1XRPA 5FOTA 1QK5A 4MV3A 4RC9A 4FCTA 4BLSA 1R16A 4R7GA 1RQRA 2FWAA 1J21A 4OXIA 3L7BA 3DZBA 1FFBA 2FETA 2WHPA 3FPPA 1NI3A 4BE4A 3VGJA 1Q15A 1T24A 1U0JA 3GLKA 4IDCA 1PR3A 5L3SB 1V39A 3ED1A 4BVBA 3STVA 4FGSA 4NWIA 3K70B 1XQYA 2IVZA 2D7CA 1XQ6A 1V43A 4QYTA 3TMAA 1ZK3A 2MYNA 3RRFA 5K3AA 4EJSB 4DCPA 4X6LA 4ID9A 3IUSA 1QYXA 3D3WA 5JZ9A 2AS0A 2PO7A 4OJQA 4PPGA 1CQIB 2WB4A 1GRNA 4GLLA 4IKEA 4MIKA 3QBEA 5KYVA 3RB8A 1G3QA 3NEJA 4N3BA 4C1NA 1FU8A 1UOPA 2JGRA 3DBHB 3BJRA 2X0EA 1RQNA 1O6FA 2QA5A 3H0EA 2P2ZA 2HMYB 3MERA 4PX3A 3JQBC 6YASA 2PGJA 2BVNA 1MB3A 4OHUA 4B40A 2O57A 4ED9A 4EFNA 4Q82A 4YHHB 4F0JA 3ZDCA 1JWBB 4B6EA 1DPGA 2FSGA 4D9FA 4PPQA 2ILVA 2HA5A 5FPQA 4A1FA 3MTIA 4HNSA 5ANRB 3ZW9A 1QOPB 2JIZD 2WNSA 3NWPA 5EXXA 1SCBA 2X6TA 4MR7A 4D79A 3WOVA 1TJPB 1TAHA 2G83A 2I4RA 3QJGA 5EYPB 4N82A 1EWKA 2G7ZA 1Q0UA 3JYQA 5FNVA 3QIVA 3OC0A 3QWBA 4J2HA 3UCFA 2H4ZA 3JAWB 2BHTA 2Q9CA 3B12A 5IXSA 4EFKA 3TQQA 3V1YA 3U0VA 1H6CA 2IOFA 1HE3A 3IMCA 3L4EA 2ORVA 3CCCA 3OFKA 5ICFA 4DIUA 1BMTA 5LMCA 4CKWB 4MRAA 3D4BA 3HAGA 4K28A 3AVVA 1DWPA 2IOHA 4FYYA 4QNMA 4RZXA 4WXEA 1Q0LA 3UJ6A 4TMXA 3QF4A 3EGVA 4R1OA 3AOGA 3QSYA 3JATB 4Q7EA 5JS6A 1QR2A 4HPWA 3IBSA 4EHDA 1IWBB 1DO8A 3HE3A 4H7KA 3C3PA 4LYGA 1KJQA 1PFQA 1A8PA 3THYB 1IRIA 1AQJA 1JBKA 2Y27A 3F49S 4WY5A 5TEWA 4YAJA 1W9XA 4GUDA 1TQHA 2F3TA 2P67A 3I9FA 4Y2PA 2EHDA 3E70C 4PG6A 4QVIA 4FKMA 4MLPA 4HAIA 1L8OA 7AT1A 4XJVA 4MUBA 1W2HA 5IDXA 2WZQA 4BWFB 4PZUA 3EIXA 1J1UA 3SNHA 1X19A 2YV3A 2RGEA 1JHPA 3R3JA 3GOQA 4HS4A 1S6YA 3GXOA 2QXUA 5D3MB 5KMGA 1N32B 2IY9A 2WFLB 4MH0R 4G1VA 1B0PA 1HR0B 3PF8A 2VQFB 4IXTA 4ITRC 2O8VA 1IUKA 1SG6A 3F78A 2O2JA 4WOKA 4BNNA 5DNAA 1U1DA 5LP6F 4O4LB 3IBCA 4R5MA 5DW3A 1QAMA 3HZHA 4LZNA 4KODA 2YS6A 4I1IA 3C3XA 3A10A 2P4HX