1GAQA

Crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
296
structure length
296
Chain Sequence
ESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase.
pubmed doi rcsb
source organism Zea mays
total genus 81
structure length 296
sequence length 296
chains with identical sequence C
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gaqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gaqA02
1QGZA 3QFSA 2NPFA 3U2QA 3ZC3A 4DQLA 3CCVB 4PC3A 4R71A 3AVXA 4M53A 2B5OA 1QG0A 3OJWA 3WNCA 2BF4A 2PLFA 1ZUNB 3LYUA 3CC7B 1S0UA 5DSZA 3WNBA 5H59A 3ZZ0A 4DQKA 1W34A 2DEUA 1DDGA 3WBKA 3AVUA 1J9ZA 2QTZA 2VZLA 1QFJA 1EP2B 1FDRA 4F7DA 4PGOA 4FN5A 2BSAA 1E62A 2HDNB 4B3XA 2OTJB 1KK0A 1VQ4B 1QGYA 1ZM9A 1FRQA 1R5BA 5H5JA 2QMUA 3B8HA 1JA0A 2BM0A 2GQFA 1G7SA 1SKQA 3CCMB 3MCAA 1IB0A 3ZZTA 1GVHA 3ZBTA 1M90D 3U6KA 3QE2A 1N0UA 2RC6A 1GAQA 1A8PA 2YWGA 4RD2A 3VO2A 3G71B 3VMFA 4RCZA 3OW2B 1KK1A 5THXA 2X3UA 3WNDA 1W35A 1W87A 4ACAA 2OK7A 1YJWB 3B82A 1GR1A 2DY1A 1XE1A 1K9MD 2VNJA 3ES9A 4H9GA 4U9UA 2DCUA 3E20A 1BQEA 4P3YA 4ZGQB 2YWFA 1VQLB 3JQPA 4M4SA 1YJ9B 2QEXB 1G7TA 1R5OA 1YI2B 1QX4A 4TMVA 1YITB 2BV3A 4B48A 1BX1A 3CCUB 4LBVA 2BVNA 1G7RA 5TY0A 2FX3A 4UAJA 2BMWA 3CMAB 1VQMB 3SJZA 1YHQB 1TTTA 1JA1A 3WXMA 4MYTA 4MYUA 3VNVA 1M1KD 1WDTA 4AC9A 1KRHA 1KQSB 2EFGA 3E1YE 3I56B 1IJEA 1N0VC 1NJID 1D1NA 1Q86D 2VNHA 1BX0A 1KC8D 3CCSB 3QSYA 1ELOA 4TMWA 2C78A 4QHYA 3CCEB 4Y7CA 1VQOB 2OK8A 2BGJA 3OZUA 4HE5A 2VNIA 3CMEB 1FNCA 4IW3B 3B78A 1TVCA 3CC4B 2QDXA 2VYQA 2VNKA 1EP3B 1NDHA 1EWYA 2QTLA 2E1RA 4EH1A 2PMDA 4Y9UA 1OGIA 4ACBA 1ZM3A 3W2FA 1R5NA 1QVFB 4PC1A 1FNDA 1EFTA 3CB4A 1K8AD 4TN1A 4YAOA 1VQ7B 2YWHA 4PC7A 4P6VF 4RCYA 3W2HA 1XB2A 4FK8A 2CNDA 3I1FA 1OGJA 2CRVA 3W2EA 3VO1A 4TMZA 4NCNA 4RJLA 1H85A 3AVVA 1DDIA 1AMOA 3W2IA 4N3GA 1QGAA 1QUEA 1VQ9B 4G5GA 3AGQA 4Q7JB 1B23P 4RD4A 5EMNA 4M1KA 4J0QA 5FA6A 1YJNB 3ZBUA 1Q82D 2C77A 3G6EB 4B43A 4LC0A 1QFZA 4TMXA 3AVYA 3AVTA 1FNBA 3CPWB 4M0LA 1AIPA 2OTLB 3JQQA 2DERA 4RD1A 2HCJB 4ZCLA 5JBQA 4QFMA 2EIXA 4N3NA 4B47A 4YALA 1KJZA 3W2GA 4NBSA 2ZITA 1EFUA 2BM1A 4C0SA 1F20A 2BPOA 1N8RD 3MHPA 1YIJB 1HA3A 2B7CA 3QFCA 3ZZUA 5GV8A 1E64A 3I55B 2R6HA 4BPRA 4RD6A 1CQXA 3AGPA 2QN6A 4AF7A 4Y9RA 4AF6A 1OB5A 1IJFA 5KSWB 2J7KA 1K73D 4K1XA 1KD1D 1VQ8B 4ZCIA 3AVWA 2AHOA 4B44A 3W5HA 4LBYA 3VNUA 1JB9A 1JJ2B 1EFCA 1QH0A 4YAUA 4ZCMA 3U6BA 4FWTA 3CCQB 2XNJA 2YWEA 3OZWA 3QFRA 2D74A 4YAWA 5HXBA 3FJOA 3MMPA 1JNYA 1CNEA 4LBZA 3CCJB 1B2RA 2BGIA 2XEXA 1D2EA 1VQNB 3CC2B 3CW2A 5AN9A 1ZM2A 4ZGNB 1S72B 3CD6B 2PIAA 4PC2A 3V76A 1Q7YD 4WQMA 1VQPB 1KTVA 3G4SB 3LO8A 1ZM4A 2B7BA 1DARA 1I7PA 3JQRA 4RD0A 1SM4A 1FRNA 3CCRB 3OZVA 1QUFA 4G1VA 1TLLA 4HE6A 3LVBA 3A1FA 4M2LA 3W5VA 1QVGB 1DG1G 3P27A 3QFTA 1BJKA 2HMAA 3P26A 5GV7A 1CNFA 1FNMA 1U2RA 2DETA 1H42A 2GPJA 3CCLB 3WBJA 4YAFA 3OJXA 1EP1B 2QA4B 4B4DA 4G1BA 3J81k 1VQ6B 1TUIA 3PENA 1D8TA 3WY9A 3FPKA 5TR9A 1OB2A 1EXMA 1W2BB 3WYAA 1GJRA 1KK3A 3LRXA 1E63A 4RD3A 2XNCA 1Q81D 1VQ5B 2BN4A 5TV2A 4ZV4A 2RC5A 4YHBA 4PC6A 1VQKB 1GO2A 1KK2A 3CRZA 1F60A 4TMTA 1G7CA 1UMKA 4C43A 4LBWA 1QFYA 1GAWA 3W5UA 3CXCB
chains in the Genus database with same CATH superfamily
1KS9A 1ZH8A 5DBFA 4QVAA 1YS1X 2PX3A 3D8UA 5KAPA 3RYHA 3ETEA 3SXJA 4IYRA 3FPPA 1DI0A 1MHPA 2QSYA 2JVIA 3N2ZB 4UHKA 2EKZA 2B20A 2IU4A 4REMA 5E2IA 1E0JA 3KQSA 4B3RB 3G0IA 4LRYA 1UBEA 4A5OA 4C88A 4Y6SA 3KKKA 1KMQA 3AEXA 3ROXA 4REOA 5HIJA 3DBOB 4QA9A 5BY2A 1JG3A 3OOCA 5CAEA 3TBKA 1JBQA 5E7MA 1XVVA 2E6KA 2EBUA 3OZFA 3T5DA 2IEGA 4PNZA 3NHUA 4S1OA 3WK4A 2IELA 3PC4A 1NB0A 1E98A 1Q83A 4OU4A 2BONA 2PZJA 1YH3A 1E3ZA 2Q9AA 1PZEA 2IS1A 4NBWA 1LWNA 4RMHA 2O1XA 4UHBA 2BE7A 2VAMA 1L9KA 1S1CA 3H5LA 1DXOA 2QN1A 4AZSA 4C7JA 1Y5LA 4Q3LA 4MYSA 1YI8A 4H1HA 3UMSA 2A86A 2AL7A 4P26A 1U8EA 2A9PA 1RVV1 2VZ8A 2NO1A 1ZK4A 2WW8A 4IOLA 1NHGA 2IDJA 3S0JA 1Y89A 3UGTA 5FOUA 1SIOA 5IN4A 5LNK6 4UEJA 5JZBA 1ULTA 3SQXA 4QJ4A 1AQLA 4P2GA 4YP5A 3TI7A 4BECA 5ES3A 1EGVB 1Z4OA 3LKVA 3A3PA 1LPPA 5CDGA 3IEUA 3SM3A 1RNLA 1TT5B 5THKA 4YS6A 3VZQA 1DRUA 2YV4A 3QM1A 4HJXA 3H2KA 2XRFA 4DV3B 4QSHA 1ZC3A 1PSWA 3JWEA 1PJ5A 2GMWA 2FKNA 3ADKA 3R3YA 4IQFA 4AO7A 4EMUA 5AKKA 4FNOA 1B4DA 5DYGA 2NTEA 4FQ5A 4C7VA 4NDZA 2LKDA 1XEXA 3F8WA 3N53A 3P1JA 4DIMA 4QNMA 2W7TA 4R0NA 3AR6A 4RD2A 1LY1A 2W22A 4XLLA 1E1QA 5IYNA 2VO1A 4F1KA 3DPUA 3W7VA 4AECA 1JS1X 1OLUB 1YRQA 3HDQA 3WNDA 4MMZB 1WMFA 1X38A 5H1YA 5L3SB 1XMPA 4LWZA 3PA6A 3PNBA 1ECFA 1W1IA 2DPHA 4L28A 2QSJA 1KBOA 2APJA 2C29D 2QUZA 4HFJA 3UOAB 4AJLA 2GRJA 1PR9A 3DLIA 5JBNA 3QA9A 3DUFA 4H7KA 3DBHA 4GC9A 2SICE 4C3VA 1QQ7A 1JIKA 1LXCA 2H06A 2WP0A 2DCUA 3FOWA 1VB3A 4L74A 3T54A 4BZZA 5AVJA 4Q3CA 1IMJA 1I7NA 3LSTA 4L4RA 2PSSA 1HT3A 4CCYB 1IWPB 4UCFA 5BT9A 3L7MA 3I2YX 1ZSVA 2CV0A 4P3XA 3BL6A 2AJBA 2ZYTX 4JLMA 4OQLA 2CN1A 4NULA 1Y4AE 1V8BA 2AWNA 2OCAA 4OFZA 4YMVA 3IBTA 3CP8A 3UJBA 2HWXA 3I9JA 4XJXA 4BCBA 2ZB8A 3F67A 3F3MA 1FPMA 3C5CA 3QX8A 4EFLA 1EUCB 2AC4A 1FVXA 5A5VA 1ORDA 5DEOA 3TMKA 1BDHA 2E2WA 1N2IA 3O3CA 3JATB 1SCUA 4OXYA 3Q4GA 3RS4A 2Y9MB 4EI2A 4E5SA 1SB9A 2GM4A 4CV3A 3CUWA 3EMDA 4MI3A 3I5XA 2PDAA 1V6SA 3GRKA 4IIJA 4IY1A 4FHFA 2PZFA 3NDRA 4FGLA 4WFKA 4IX9A 3PE6A 5ALFA 2H31A 3VH3A 4FBMA 4WBNA 2I99A 3DTVB 2PU5A 1WUKS 3SF8B 1TCVA 3NETA 5FLYA 1S8FA 2QV7A 3U31A 5SV2A 2C9OA 1ZO8A 2G25A 4C2UA 2FXIA 1IJEA 1KL7A 4RMJA 1XP5A 2GPBA 3SIPA 2B5WA 4M99A 1KYYA 2JH8A 3EFOA 1NN0A 2XAAA 3B2EA 4R31A 4EQ6B 3SQLA 5KOHA 2PIDA 2JJ1A 2IZ0A 3K1YA 4TSKA 3D4OA 4HDMB 5FUXA 1FXWA 2EEPA 4DQXA 1WETA 1KYQA 3HKEA 1NNSA 5A4AA 1AHPA 3FFWA 2PGOA 5K0JA 2H52A 2OD9A 5AVKA 3NOVA 5EN4A 1AUOA 4TKVA 3HXTA 1C9KA 3CCEB 1EWRA 5DHTA 2OCGA 4YN3A 3ZHZA 1HZZA 2RHDA 2GCGA 2ESRA 3Q3IA 4TXJA 3ZWPA 3VNAA 3PRJA 4R05A 3M3PA 1FYFA 3RVDA 3TRIA 2EZ8A 3TEMA 4NV1A 2YV2A 1L5MA 2RJNA 4EKIA 2UZ1B 2CVOA 1FFGA 3B78A 1CF9A 2DR3A 3DOHA 5AM4A 4OOEA 4JEHA 3VZCA 3WLQA 5HZKA 5JRZA 1Z13A 4PLFA 4Z2YA 1X70A 3S2ZA 4UPEA 1FDUA 1GKIA 1XZNA 2WKWA 1L5GB 3ICPA 5A9SB 1GITA 1TQ4A 1T2FA 3A05A 3CX4A 5IDWA 1QONA 1ZJYA 4CR8A 2HMYB 4C6RA 3OW7A 1INLA 3QUBA 4FHCA 4Z4GA 2PS9A 2WHPA 2ZYGA 1QZ3A 4CN9A 5EIEA 1F4VA 4J7CA 3DL7A 3SZUA 3U17A 4EO7A 3QXSA 3SJCA 2I4LA 3A1CA 4ND4A 1V6AA 4N01A 4XLEA 1A4RA 1JYSA 1PI3A 2DM6A 4X00A 1Q0ZA 3RC7A 2I8AA 2IOFA 4PC1A 1MLDA 4KBYA 4GPEA 4KKVA 2QAJA 1M2KA 2EBFX 1E2DA 2JD0A 2LCFA 1J4AA 3A1VA 2NAFA 3G85A 3IV6A 2V55B 2YWHA 4G1CA 4K6KA 4KQFA 5FL7D 5BNTA 2VUSA 1H6CA 1M73E 4EFKA 2BYTA 3U4AA 4UW9A 1OFTA 3OFND 5FBZA 1BOOA 2C1ZA 5TVKA 3VKWA 4YP0A 2NSDA 3EIQA 4B31A 5HQTA 5TRTA 2ZUBA 1J2UA 3DT6A 4HXYA 1XZMA 3UUGA 5HXAA 3DAPA 3KFXA 4CTNA 3Q1KA 3THOA 3P2YA 1I5OA 3UGQA 1OBOA 3EIUA 3U5TA 4IH1A 2XVXA 2O8FA 3VO1A 4E4RA 1FLDA 1EM6A 4BUZA 1SUBA 2ZXFA 5DGHA 2RI6A 1UD3A 3PR3A 3ZGVA 1QV6A 2QJTA 5E9WA 3UFBA 3TW6A 2I34A 4L0DA 2X4IA 1Y3DE 2MJLA 5AI0A 3DL0A 3KR1A 4LMRA 4DW8A 1Y8ZA 1SD1A 4A1OA 2VJYA 2LKCA 2NNLD 4EHKA 2C58A 5ICCA 4RHCA 4WASA 2X4DA 4ZVMA 2VQDA 4FFNA 4F60A 8AT1A 1CVIA 2R5FA 2IOFK 5ADUS 4DR6B 1FX0B 1F48A 1KETA 1O5TA 3JARA 2HMVA 3BMOB 5J43A 1U7ZA 4K9MA 2OLEA 4EO9A 1TO2E 4WEQA 4G5GA 3RT1A 1VHJA 2OFWA 2H8GA 4JLVA 1ADCA 2Y92A 3NHPA 2X42A 3C41J 3R5JA 1CIVA 4YMTA 4P22A 3S44A 4F4DA 4HNGA 3OCYA 2FFBA 1HDZA 1GN8A 4YO8A 3E15A 4B2IA 3AHIA 1Z18A 3MW8A 1ZH4A 3IKTA 1ZIPA 3HKCB 3CM0A 3R09A 1KDVA 4TYYA 2ZR7A 1ILWA 1H2HA 4Z49A 4BE4A 3DOUA 3ITKA 4K6GA 2CXOA 4RXUA 1G16A 3ZTWA 4Z4TA 1XEAA 2GA8A 4J6FA 1H1LA 3WGMA 1V16B 3REQA 5A4IS 3C48A 2X40A 1O97C 2RGUA 2R8XA 2HADA 3MCVA 4ZQHA 5B1YA 2H07A 2OWEA 3ROTA 5E6SA 4FU0A 1OWMA 1TF2A 3AY3A 4Q3DA 4U2BA 2GD0A 1A9QA 4J1NA 4EJSA 3G59A 3M6UA 1RYFA 5C34B 3WYCA 1R4AA 2X0IA 3FTEA 1Q6ZA 3L1UA 5EXSA 3GLFB 4HAXA 4IWYA 5JUWA 3ZOKA 3R8FA 3IDAA 1P0CA 1D09A 4MKHA 4CM8B 3Q3CA 3BTSA 4KE6A 1M6EX 3H05A 4ERXA 5CFPA 5LB4A 4DIKA 3TQHA 3PVCA 1ZJZA 4DZRA 1LVHA 3MWDB 4ZI5A 2OKGA 3QBTA 2C9CA 5L3ZA 3D3EA 1E9RA 4K87A 1E7QA 4UNSA 5KJ1A 1W0KA 1DTWA 3LUHA 5F3DA 2QLMA 5KWEA 4E5NA 1OFGA 4RVNA 1N8RD 5EHIA 1XFOA 1GNVA 3U62A 1QC5A 1F4PA 3IURA 3SICE 3C97A 1WOOA 1S8NA 4KWIA 3BXZA 5IBRA 1XU9A 1GQOA 5A05A 2EG9A 4E0FA 1YIJB 3LLSA 5CA1A 2FMIA 3INNA 1WDLA 3DYBA 4CM4A 1C29B 4QAQA 4R1LA 2HRDA 2Q2NA 1WBBA 5FUBA 3I55B 4GQNA 1COWD 1MENA 5CDSA 2QQ5A 3AL2A 4U6SA 3DXZA 2EF1A 4MA4A 4UHFA 5DHAA 3M49A 4Y9TA 3LQRA 1SIUA 1E59A 3LZDA 5FNVA 4AY2A 5L6MB 1Z56C 4A10A 3PJEA 4Q4AB 3MCZA 3HJRA 1ZCFA 5CUQA 3KSAC 2W6OA 2WFZA 1U0NA 2NW6A 3A70A 3KVNA 4OH1A 4AZ3A 2GXSA 1DUVG 1ISIA 1VLOA 2RGWA 2B1GA 3D5QA 3GNLA 3PCXA 1SZCA 4OM7A 2GH1A 2OM2A 4MUXA 1FW8A 4UBJA 1FYDA 5MFPA 4KOAA 2R6ZA 4RNDB 2IF2A 2ZPAA 2C42A 1N2BA 4XOPA 1KI3A 2F64A 1H8ED 1RQ7A 1Z47A 2BFOA 1QBGA 2EQAA 4KQ9A 3W1VA 4LJ7A 2PUFA 2JAXA 3ZJTA 1DAFA 1EFRD 1I4TD 4ZQFA 3VO8A 4AT1A 3TVDA 2RGAA 4HZIA 5HZAA 1SZPA 4GKAA 4KGVA 1EFVB 3ZY6A 2PH5A 1PR0A 1F51E 3A25A 3EW9A 4BNFA 4XZ3A 1LSUA 2C9MA 2ZTVA 3LQYA 1I7LA 2Q3DA 3X1WA 2V0GA 5B58T 2C96A 4Z4ZA 3B9BA 4OBBA 4XTCS 4DSUA 4KB5A 3LKDA 4US1R 5KVVA 5DISB 2XNJA 5EZQA 4L5CA 1P3JA 2YJ3A 3KJXA 3T3OA 1WNFA 1VE1A 2X6XA 2A1TS 1X7ZB 1R6DA 3A36A 4EFDA 4DPMA 2G1PA 4CL8A 3DZGA 3PWSA 1CZOA 1MNAA 2C2OA 1HE1C 2BOVA 2HLHA 2Z8XA 4WY5A 4NOLA 4B7XA 4ARSA 2YC4C 3TTVA 1VCOA 1SU6A 5EIWA 2WD8A 1DRWA 1KI8A 1NOKA 1AGXA 3WIDA 1F4LA 2GEBA 1TMGE 2OGTA 1YIOA 2BRUA 3HWRA 1S9DA 1XU4A 3DDZX 3K0BA 4W8OA 4ZGNB 2QL9A 4YUWA 5JAPA 1S7CA 4CI0B 4ZI7F 2VSQA 4YJ2B 1U31A 3FD8A 4LI3X 4W7IA 3N2NA 2I6XA 2FX2A 1OKKD 2ZBPA 3WKCA 2FW8A 5C1PA 2O8BB 5JJKA 1APBA 1XJCA 1TZJA 4RM3A 4A91A 4CIXA 4MB0A 5F98A 3ZOZA 1T25A 3GGPA 3H5OA 2VPYA 3SAJA 1M34A 1XHFA 3Q15C 1DZIA 4RGBA 3WTCA 4AD8A 3IUYA 4U7WA 4RQAA 1QVAA 3FLEA 3BD8A 1IL0A 3JSXA 4HE6A 2HL6A 3UH0A 5A6VA 1D2HA 5DHRA 2FVXA 2GJPA 2WTXA 1T1EA 1J5PA 1V1MA 3GJ0A 2GLXA 2ZUFA 4KACA 2J6CA 4PBTA 1UPUA 1R4ZA 5T3YA 3CP2A 1XZBA 5KAMA 4D9EA 4DJDC 4KRXA 2UXCB 4O1HA 3RHTA 1Z3CA 2X4GA 5AKGA 3SSOA 4WN9B 4WZEA 3HCDA 1CNFA 3IHWA 1FNMA 4BAZA 1LI5A 1V1JA 1Z4KA 2VKTA 3M9XA 5C35A 1GKYA 2BMVA 3B1YA 4OOFA 2PX0A 3WMRA 4BYMA 5ETJA 5AR1A 3NASA 3WBJA 4BO9A 1L3IA 4YAFA 2VPIA 1HYGA 4MX8A 1JU4A 4OK3A 1ZRSA 3A9TA 1GQYA 2Q5HA 4IDDA 1T3TA 2CNNA 2WNIA 2YVQA 4URWR 1IUNA 3ICWA 3QPDA 2EGHA 3BA6A 1YS9A 1VQ6B 2AE1A 1J0CA 4XWGA 2ALJA 3EZ2A 5EJFA 4EGAA 1JH8A 4ESEA 1AF4A 3D6FA 3B3FA 4B2PA 4LWPA 4P38A 2K87A 1GUDA 4XLAA 4HVCA 1IVSA 1HE5A 2WSYB 1J9EA 4UAUA 3RU7A 3EIHA 3R7WB 3LW7A 4BNHA 1RWXA 3DBLA 1RXIA 2YWBA 4IRXA 1T6XA 1BXRB 2GEKA 2QL5A 1GA6A 1X0VA 1JR4A 1E7RA 4G86A 1P3DA 3GH3A 1VQ5B 2IUTA 2JFPA 1J2JA 4BVKA 3FAKA 4MNTA 2CUNA 2ZUSA 4OL0A 3OAAA 4N5MA 3V42A 4BV8A 3K16A 2X14A 4PC6A 3I6MA 4G6ZA 5JYDA 5AW2A 2PUEA 5AIBA 1GZSA 3GFRA 4DSOA 1O8CA 1WSVA 1UMKA 1DDOA 3LBAA 5L4SA 1EVZA 1UDWA 4WA7A 3W5UA 3UMBA 2O9JA 3V7UA 3E9QA 4QUIA 3NV7A 3D6AA 2VNAA 2ZSJA 3LPCA 3NBFA 4IOMA 5JEDA 4GR4A 3U2QA 4BB5A 4LZAA 1D4FA 3PNOA 1I9CA 3FTQA 4RHFA 3PVDA 3CCVB 1WTCA 3FNBA 1I2CA 4R71A 3D8SA 1K5DA 1YA8A 3U7FB 1PV1A 4PHGA 2P0AA 1KIFA 3A9CA 3L6EA 4Y30A 2COKA 5KYVA 3TVYA 3T95A 5IYZA 2OPHA 1K75A 2RONA 5ITVA 1NZJA 1IOZA 2OHXA 4Q12A 5AM2A 3OIVA 3I04M 4Q3BA 1ZUNB 3C15C 4PX9A 4PZDA 1PT8A 4CNBA 1JKJB 3H5WA 3GQVA 2DAPA 1PSDA 4HAYA 4L8FA 5DP2A 4C04A 3QY0A 1B1AA 2O3RA 2R6FA 1G6Q1 5D6OA 2IZ6A 4WCFA 3RYFB 3ANSA 3QF4A 1BG6A 4NMXB 1ZGBA 2YNMA 4CYMA 2Z6BD 2P4UA 3T3IA 2CF6A 4BTLA 4CKYA 2H1VA 1PG5A 1F8UA 3L93A 3NO4A 4OEHA 4R3NA 5A3SA 3CRNA 2BM9A 3X2SA 1WV0A 4M9CA 4RK6A 2DBYA 5DN9A 3FPHA 3BQ9A 1Y9ZA 4RHEA 2B83A 4ZV7A 3DCYA 2JFZA 2H2FA 3B7PA 3PC8A 3WO0A 4ZDKA 2OO7A 2PV0A 3A6JA 2NU7A 4IFIA 1LPAB 2VHUA 5DKFA 4ED9A 1QGYA 2ZB7A 5AP9A 4KI7A 2Q2WA 2QMUA 4DK0A 2HXSA 5GONA 3U7IA 4HQ0A 5EMMA 4MUJA 4XIFA 1Y4DE 2C8KA 1KA9H 3CVJA 4HXFB 4TMKA 1ZCBA 4YRJA 1V4VA 3CCMB 1FEZA 3CWCA 1HDRA 1UK8A 3E7FA 3I12A 3O21A 3AB7A 4MR8A 3SOPA 4B45A 2HCFA 4MKIA 3JQ7B 4CMIB 2IYSA 3JYOA 4B8YA 2V9CA 3D0RA 4AKHA 1C5KA 3H17A 1ZD9A 3QW2A 1N2CA 1RFLA 2ZRMA 3WE7A 5GONF 2Z3ZA 1Q14A 2F1KA 3TK1A 1H2AS 1NQXA 4FN4A 4A2WA 4F0JA 3QLUA 5EMHA 3OF5A 5FTMA 5JH7A 3KKZA 1QM5A 2X77A 1SG9A 2HBZA 3V4OA 4X66B 3EEIA 1H8HD 4BJ1A 4OD0A 3DLAA 4UD2A 4HY3A 4HOYA 3EE6A 2BFNA 2CLDX 1OT5A 1DKNA 3BHIA 4OQQA 9GPBA 2ZQYA 5EJ6A 1Y4SA 3ZWXA 2FSPA 4K9SA 9MHTA 2F9MA 3ER9A 2XXAA 4EY4A 1KO8A 3Q7QA 4B6RA 5EG5A 3ZCRA 3CNEA 1L8AA 5JH7F 2QJRA 1P62B 3AVQA 1JFRA 1KZGB 5GY7A 4LKOA 2YWJA 5JWRA 3OQIA 4OUKX 3SQWA 5DLYA 3ME5A 1UZNA 4HDSA 3PJFA 4GICA 3IIKA 5KQLA 3ETNA 3DMGA 4U9UA 4DGSA 1A7AA 1XVAA 3E20A 1KAQA 1E92A 2N3ZA 2Z98A 3I9LA 2X6TA 3K9CA 4P7FA 3MTDA 1EWTA 4OOSA 3FZNA 3G05A 4M22A 1OYWA 1GYQA 2DPMA 4X90A 5CYGA 1CETA 1KNXA 3IMGA 2PWZA 4HATA 2IL1A 3ILHA 3KZNA 2QG6A 3WHIA 2DWPA 3F2IA 4HMPA 1T5BA 1NHWA 4CKBA 4FCTA 4OLHA 3KB2A 4OSEA 3SR3A 4CLXA 1JMVA 2KX7A 3GAFA 1JIIA 3HFGA 4TYWA 4NYIQ 3AONB 5K8IA 4UAJA 3ELBA 3NLLA 3T5GA 3UMMA 4BO6A 3EXEA 3ZEIA 3KPJA 3H9JA 5AVOA 3QUQA 4QQNA 4MYCA 4FSXA 3U4MA 5EKUA 5K3BA 3DPIA 2OYRA 3U1VA 2FW6A 3OWHA 5IKEA 1K9SA 1X3SA 3ZH9B 3BILA 1G2PA 3CW8X 3G5UA 4NE7A 1MC1A 1E3XA 3W4KA 1I4EB 3OESA 2HN9A 2HSWA 1HMYA 2W2OA 3EDOA 4DNRB 3FR8A 3H42B 1TKAA 2W6JD 1JL3A 4A8JA 2OXIA 4C1BA 1M6WA 1LS1A 3ZJ5A 4BJHB 1G20E 2A4MA 2VP3A 4JT9A 2AG5A 3L01A 1IHMA 5EYPB 5TMEA 4ZN6A 4I81A 2O0LA 5JXWA 3P2OA 1ZXXA 4ZHQB 5GZ3A 3KUDA 3D6HA 4P31A 4Q16A 1ZPDA 5HILA 3K05A 2ZI5A 3NOQA 4NYJQ 4WZAE 2XRMA 3M2TA 2H1SA 3BD7A 4G1EB 1E0DA 2WJHA 3SU8A 2YUIA 2PRZA 1L1QA 3NWJA 3JR7A 4QDJA 2J0UB 2CJFA 2ROQA 3H6KA 5JZ9A 3NHRA 1GRVA 3G8AA 2XQIA 1P18A 4NENB 3GDGA 2DBRA 5CDTA 2FVGA 5LZ9A 1ONBA 2GYYA 3LWDA 1M2HA 1EJ0A 1W96A 3P0RA 5D1NA 1Q1NA 3PIRA 3CMEB 1JR3E 3A1TA 4DRZA 5JLJA 2Z2IA 3RKUA 1V3VA 2I7XA 2YHSA 2R2AA 2HF2A 3EFBA 1GZ7A 5ALQA 4PQYA 3LX8A 1VSVA 1ZM7A 2NU6A 4WXHA 1PJRA 1CQIA 2VNKA 1H3NA 1N25A 4RPJA 1YRLA 4GYKA 2I2DA 4BO8A 5L3RA 3ZW8A 1Z36A 4OGGA 4B6EA 4G8DA 2EP7A 2W2QA 4YRKA 5CHYA 5EE5B 5E2AA 1DBVO 4NFHA 2CHEA 3FMVA 3I39X 2VEDA 4OHPA 4MJLA 3MJRA 3IUEA 2ZM5A 1IXYA 2MSEB 3R77A 3QVLA 1Z5ZA 2FR1A 3BX1A 2QY9A 3HCBA 4TT8A 2XTAA 1UBMS 2XGSA 1FNDA 3WL6A 1HSZA 1SGWA 2QUKA 1MAVA 1JSXA 4NJOA 5LBIA 3UUWA 1RRVA 1KEUA 4M8NE 4X9XA 2ZI9A 4DRYA 3FWPA 3FHOA 2HXGA 5T8KC 2Y77A 4AULA 1M2WA 4WNCA 1EINA 2A30A 2VRBA 4UMEA 2YWDA 2Y6VA 3ESDA 1WX1A 3I37X 3I6QA 4A2CA 5K2OA 1N2JA 4DXHA 2P9HA 1DIAA 5GJCA 4FNAA 3HB9A 4X97A 1OGJA 3GB9A 1JTEA 1L8QA 3MWLA 2VI5A 3QXHA 3TLGB 4FYMA 2J9FB 4L95C 2BEWA 3NALA 2Q3BA 5LWHA 4NCNA 3GVKA 2V0NA 3VH1A 4R0MA 4YC7A 1TYAE 1P7YA 1SCJA 4TVKA 1QGOA 4YDHB 3BRWD 4RDKA 4RVDA 2VCYA 3P2MA 5CH3A 1KORA 3V2IA 5FEUA 3PHBE 1FU7A 2HU5A 1FYEA 5AI6A 5BN1A 2I6TA 1U9YA 3LOPA 4BB9A 4CFZA 1AMOA 3ONEA 5DXJA 1KMCA 2JAUA 3G1TA 3NEYA 3PD1A 1BLIA 1U8TA 1C7ZA 2DX7A 2XCUA 3OFJA 4PRYA 1VLZA 3R6KA 5EMKA 2HRRA 1H23A 5BXYA 3GW8A 1UBRS 4YAEA 4B1FA 1QX3A 4BMDA 5KREA 1FUEA 3AZQA 4AW9A 1XZIA 5ICFA 1GP2A 3WKBA 1H6AA 3OA0A 1WF6A 2QN2A 3GV0A 8ABPA 3FKSA 3O3OB 3SE0A 5LZ2A 4EPWA 4ENSA 2XUFA 5BN4A 3K6JA 4J1TA 4QG7A 1KZHA 2PZGA 2CLMB 2NXCA 5KYGA 4B7ZA 4J4TA 4J0QA 1PLKA 3ET5A 4RNCA 3EZ7A 1RD4A 5FA6A 1E2EA 3R41A 3ZBUA 4QD3A 3ZWOA 5K3AA 1DQSA 3RS2A 4ZJYA 1F2DA 4PPGA 3HM9A 3BF7A 1NW6A 1NUTA 3TRHA 4CIBA 2A88A 2BJHA 3VR3D 1MABA 2DTDA 2W6IA 1D2MA 1V1RA 3CTPA 3KAPA 3UW3A 3P97A 4WDRA 3WGGA 5HX7A 5BPHA 1YKGA 5CB4B 4O4HA 4DLRA 2BW0A 3AVYA 1XXLA 4MPRA 4RPGA 5BWOA 4M0LA 2JFOA 2OXCA 1CHDA 1DKOA 2ZANA 2DWQA 2DSTA 4YUVA 3ZY4A 1IXSB 1WXXA 2QZZA 4UNRA 3WGKA 4ZVRA 2X1LA 3OG9A 1GSHA 1X1DA 5IYPA 3CO5A 3WGVA 4W1QA 1P5JA 2QV0A 3E70C 2BT4A 2HCJB 4XD7A 3AKEA 2ZJ2A 3D26A 3G2LA 4ZCLA 4MDFA 1Z5WA 3O94A 4BMPB 1NB9A 4NJEA 1JI0A 4AZWA 3RBVA 4PLPA 1ND6A 1ULZA 2JBAA 4FONA 4DNFA 1G3QA 3HS3A 5BN5B 1CX9B 2ZJ0A 2D1YA 3G5MA 4AZ0A 4B6FA 1KJZA 1SBCA 2XDAA 3KPUA 4H6PA 1KQ3A 3HBLA 1PBNA 3ZI4A 3LY5A 2ES4A 2DGDA 2ZYDA 3LK6A 1XD2A 2EQ5A 4KZKA 4YT5A 1UPFA 2HA5A 1FLNA 3D3KA 2QPLA 3QKSB 3R0QA 1SVKA 2FPXA 3MYRA 4NS4A 2Q8QA 4ZDWA 4CIYA 1L4BA 1LWOA 4IXNA 4B83A 2ZBQA 5F9MA 1WZEA 2EZTA 2OGWA 2HU2A 4MV5A 4YWJA 2W2KB 4DUYB 2ZULA 2XQFA 2Z83A 1K97A 1JDVA 2ZTUA 1K9VF 2YR0A 4ZQCB 2VTDA 2X0FA 3WDSA 1CVRA 4M1YA 2W6PA 4MAFA 1LLCA 5TJHA 2QGZA 2RI1A 1XX6A 1NXVA 2XOKD 1O77A 1S2LA 3QVGA 4CEIB 2DPXA 2OQIA 2QN6A 1JFVA 1RHJA 1VPLA 221PA 4F3CA 4LQCA 2G9UA 1ISPA 2VK2A 3WLEA 2WKRA 3FI0A 1N08A 2ZL7A 3SBEA 1NIJA 4JYMA 2AIRA 2KMLA 3I6IA 4EB0A 3KD3A 4C4ZA 2WHRA 3G2HA 4MV8A 1Q20A 1XHLA 5AKLA 1K73D 4XWKA 3U56A 5D7NA 3JQCA 4PW0A 3MCWA 1RQ2A 3HR7A 4EHNA 1XMXA 4G0QA 1FS4A 1JTVA 2QT9A 2RGBA 1JB1A 2NYAA 5C53B 4DG9A 1YSCA 2I76A 3UC5A 1HE4A 1KJ8A 1WABA 1UFQA 1DAGA 3G17A 2JEOA 2OFOA 3IBGA 4HSEA 3CG0A 4B76A 3WAJA 2C4WA 4Z4QA 3G1UA 1FP4A 2WMYA 2ZRBA 4KBFA 2QBYB 1URPA 2IRWA 2PUAA 4DBLC 5B30A 4M6WB 4F9EA 4XQEA 4EP1A 4BQRA 2A92A 2B35A 2GASA 1BE1A 1V5GA 3BL5A 1PJCA 4U7GA 1JQKA 2AVNA 1XMIA 3ESBA 4D3ZA 4MVYA 1LCIA 1P0QA 1BGVA 5AW3A 2NSYA 4YCCA 1O97D 1UKCA 2HPHA 2VP6A 3FLAA 5G40A 3W3AD 4WVFA 3S81A 2G0AA 6REQA 1QCDA 3FSGA 2XT0A 5JRDS 1A5AB 1UWVA 3MJEA 3OIGA 3HY3A 4HL6A 1XV5A 2B4YA 4D57A 5JZSA 1Z15A 3F5DA 1C0PA 2RGRA 4KIFA 2LZ0A 1D6SA 3MQ2A 1LLUA 2K6GA 3U09A 1K27A 4JNCA 4RIGA 1L8OA 1NKTA 1WCIA 2ZSHA 3CMMA 5KX5B 1MMFB 1UJ4A 1SUAA 3TW4A 1GNTA 3IEIA 3CEPB 3BGOS 1LQTA 1PLLA 3MG9A 1D2EA 1WKCA 2D62A 1NATA 1X1RA 4MV1A 3PGMA 2HK9A 4P12A 3FVTA 1RDFA 4MRAA 3PHCA 4D98A 3HKDB 1ZM2A 3ZWKA 4ETWA 4UVEA 4LX8A 1YVDA 1L7RA 2ECPA 5A1JA 4G9GA 4JFRA 3DTVD 5FBQB 2JLYA 2XWSA 2FN9A 4YV7A 3USES 5CR9A 1U6KA 3KZOA 3LQ6A 2Z95A 2ZZKA 1T6ZA 2C04A 3ONVA 3DBIA 1RP7A 2ORIA 5FYDA 5JG7A 4BU0A 1ZOIA 4TTRA 4ENVA 1OUMA 1FRNA 1U1IA 2FN8A 2VWGA 3EZFA 4PO8A 1ILEA 1VHWA 4QRDA 4HNUA 1MV8A 3FCCA 4LAFA 4GI5A 2QPTA 1NL3A 1XQ1A 1DQPA 4XCQA 5DBEX 4ADSG 4E7OA 4D5GA 3OF2A 1QKKA 2ATVA 1IVNA 4EG1A 1KE2A 5JXIA 3OM1A 2IU3A 4IRMA 2ZSFA 3X43A 1G8KA 3E8SA 3OOEA 3WTBA 4IKOA 5FPPA 2W58A 3TPFA 4BFXA 1H65A 1UFRA 2H1CA 4MV0A 5FI5A 5IVIA 3IE1A 1X8LA 4KQJA 1P7PA 2OT3B 2BEKA 4U8HA 2WK1A 1SOUA 4PR0A 3SLNA 1TM1E 2WD9A 1D2AA 3VPCA 1JHVA 1RYDA 2B34A 2A9JA 2ERCA 1JQ3A 1CT9A 3B1VA 4JMLA 5ALDA 3IUNA 5G0UA 3FWNA 2WJJA 4OHOA 1L7XA 2Z30A 4DAOA 3Q3EA 2HIAA 3OO1A 2BJWA 2VUHB 3ABIA 4INPA 5KYWA 3E3MA 1Q0LA 4QUBA 1Z6XA 1CZNA 2UVPA 3VU9A 2FQYA 3OY2A 3F6RA 2ZBVA 1ULUA 2HSJA 4FNGA 5INTA 5LDDC 3GG9A 3HA2A 1QH1B 3D6VA 3MOSA 4RGVA 4UXHA 5ESDA 4AJ1A 621PA 4PHCA 1KEKA 2E37A 3P2EA 3E9MA 3GJ8A 4O4LA 5J1SB 1TM3E 3A1EA 3DHYA 1VF7A 2IYWA 5EFOA 5EJ8A 1LV7A 3WBFA 4NXMB 3CTAA 1A5TA 5IXSA 1ZJJA 1P2SA 1VJDA 1G5FA 2CKMA 2FSUA 4D5EA 5I9IA 1RZRD 1NXTA 3PEVA 2V3WA 4BGIA 4XOTA 3QVWA 3T5CA 2VZ9A 3EAFA 4DUPA 1NP6A 3MBIA 5KSYA 3LRXA 4O4LF 3L8HA 1CE8A 1RQLA 2Z57A 3GJ5A 3ZQ4A 1I2BA 1NSTA 3C7AA 3OX3A 3P0HA 4IHQA 4TLCA 4XORA 4UUNA 4ZI7B 1N57A 4UM9B 1YTUA 1USVA 3K0AB 4H16A 1OXUA 4KR7A 3W8EA 4L4UA 4Z2AA 1EX9A 1V5EA 1YVRA 1X8KA 2O6LA 2R11A 5EKDA 3CRZA 2C82A 3NZEA 4DCOA 1EBBA 4GAEA 4XKWA 1N3BA 2IBTA 3SFZA 3B89A 5C5EA 1QFYA 1BHSA 1O6BA 2A67A 4RSRA 5K4AA 5JAHA 2YCBA 3LDUA 2E4WA 2O3TA 2NPFA 3MWGA 4HFMA 3ZIAD 1SKMA 2B6HA 3ZLVA 1H22A 3V4RA 2YYSA 1QYWA 3SEZA 4RH1A 2Y2UA 3QYAA 3HDVA 4MQFB 4N40A 3F6SA 4K6FA 5CTAA 4J75A 3WNCA 2VTBB 4RPLA 3RDPA 2XYPA 3HUFA 2H2GA 3A27A 5FOQA 3OE7A 3VR1A 4KU4A 1Y1KE 4RHUA 4XIJA 3LFTA 4BEWA 3AESB 2HREA 3OIWA 1AQUA 1H2BA 1OXXK 3N7AA 4X41A 1UJMA 5DGCA 4C30A 1XRQA 2Z2YA 4X45A 4GVLA 5HNKA 4U7TB 1QFJA 1N75A 2A9FA 3OT1B 2IEDA 3COSA 1SK8A 1KZLA 4GVXA 4AL4A 4ZZ3A 2RH9B 4YJGA 3BJMA 4X6XA 3LF1A 2JFQA 2A5JA 2Z6AA 2E4VA 4X20A 4PGOA 3CRVA 1PR5A 1T1IA 3O92A 4JV5B 1SQ5A 4NVRA 2H4JA 2WLSA 1GRNA 1PNVA 2WMDA 2HDNB 4EHFA 1Z45A 2BISA 1WUHS 2GERA 2PJZA 1BGWA 5DIZA 2X13A 2HR1A 2ZDQA 4R2IA 1ZM9A 4M87A 3CEJA 4MA5A 2IIVA 2O0HA 2FQXA 3R9KA 4A92A 1DLJA 1A2KC 1V95A 2FKAA 1NE2A 3I0MA 1Z6GA 2BM0A 2G5TA 4R1OA 1L8LA 5GM1A 1AK9A 1Y81A 3AG5A 4LOIA 5F5LA 5JANA 1K2WA 2PYDA 4PRZA 2P9ZA 1PTKA 3MXTA 2QX8A 1GRRA 1LRJA 5EWMA 5BSMA 2ZI4A 3RFCA 3S7ZA 4DMHA 5C1OA 3WJAA 1R37A 4GO1A 1NUHA 2GYUA 2X0JA 4KO3S 5EZYF 4W5WA 3R4CA 1V8PA 4D8WA 3PRKE 3C5HA 1EK6A 2B4KA 2WSMA 3IAM1 4X8OA 1AV6A 1XF9A 3ASPA 4CKCA 4BYGA 3QEKA 2RAVA 1TC2A 1Q16A 2YXNA 2ZT7A 2DUNA 1Y8QB 3W8FA 3ZHQA 3TZHA 2P6OA 1P6UA 1W9HA 4A6DA 5HJEA 1L1RA 3AY0A 2QRJA 4ARZA 5ECYA 1E3DA 1HSOA 2AMJA 4XFKA 2BHRA 3RS8A 4RCZA 3WLOA 4F5EA 1ZW1A 2WTEA 2GN4A 3W6NA 2AEEA 5CNJA 3G0BA 4XPIB 5K0SA 4QTYA 2X3UA 1KDOA 2O2GA 5DXFA 3SVZA 3H9QA 2OK7A 5G02A 4TT3A 1VLVA 1LVGA 2QRPA 3GJZA 1UMCA 1F2VA 1P91A 1N2HA 6CHYA 4QPCA 3SN6A 2YRWA 1D2GA 4ND5A 3LA8A 4BRWA 3ES9A 5DM60 4JVNA 2ZAIA 3VVBA 1Z74A 3Q10A 1YR2A 4UUAA 4RHTA 1U9JA 3H4VA 5AI8A 5D2CA 1BQEA 1L9XA 3FVRA 3G8CA 2BFWA 3ILVA 4OLAA 1KJNA 1SXPA 3SC4A 1Z25A 4NBRA 3R7AA 4A23A 4A1FA 4HH3C 3JYPA 1VRWA 2A9QA 4X0CA 5M5BA 1U2TA 2QEQA 2PMKA 3ESRA 1Z4PX 4TZ0A 2AZDA 3RFVA 1Z22A 5MGBA 4NCJA 5CNMA 5DHFA 2CVFA 5JS6A 3ENZA 3NKVA 4Q1FA 3F6YA 3W4JA 1G7RA 4E33A 5KWIA 3G0DA 1Z2DA 2V1XA 1HDGO 4NMWA 3X1MA 1O57A 1R6TA 2VLBA 2Z2ZA 4INOA 5FYQA 3WP1B 1N07A 3Q8MA 3DF7A 3EAQA 4BOYA 1UDXA 2J67A 4KAJA 2GHQA 5C8YF 2RHCA 1YS7A 3ZWBA 3U4HA 2AQHA 3M89A 1GPWB 2CXXA 4TUYA 1YS4A 2VN8A 4TGLA 4B81A 1WD7A 4ZMBA 4AN1A 2GFIA 1VBFA 1G3RA 5ALJA 1E3IA 2VDWA 4PO9A 1I8TA 4PIVA 5DU2A 2ATIA 4N7RA 3JQFC 5FUQA 3CR3C 4WNAA 5A9RA 5ERYA 2IE0A 3G6WA 3F8SA 3UYKA 4UHJA 5D86A 4PAOA 3L9WA 3ABZA 5A5FA 1DPFA 1XAIA 4GMFA 1A9XB 1K7YA 4TUYF 4C5AA 3CN9A 4Q24A 1GT6A 4PX2A 2H9YA 4RLHA 2FK8A 4Z4RA 4V24A 3TLYA 4RLSA 1YHZA 4QPJC 3PQCA 1WXQA 4LJKA 1K8ZB 1O9HA 3IOBA 4KDCA 4J91A 1N6RA 1IQRA 4MW1A 4WFIA 5CA0B 3PLNA 2OCLA 3F9IA 3T51B 2I4NA 4IBOA 3A1WA 1ZYUA 3OZUA 1DIGA 1VE3A 3RAJA 2GN9A 3UH1A 4CCAA 2HRCA 5L53A 3SHOA 3LWZA 5CFZA 3R3SA 3EW7A 2WPNA 1R8XA 1Y3BE 4EUSA 3UGJA 4A8HA 4LQ4A 4OF4A 4QIHA 1NQUA 1TVCA 4IM7A 1T9GR 4ZMSA 1Z4NA 3B3QA 4YCMA 3NHLA 3HGQA 5EOVA 4D74A 1NVGA 4GM4A 1GQQA 1YNSA 1EA5A 3LP8A 2PT7A 1T5TA 1N6KA 4WGFA 1JXQA 1XL0A 2BF7A 1T8UA 2A0KA 3V1UA 2V7EA 3KQKA 1SVUA 3FUTA 1N5OX 4W7SA 3KL4A 2Y4NA 2YY5A 3K1JA 4MVJE 1F1JA 2OQ2A 3C98A 3DAYA 3E4CA 3VYUB 2ISCA 4BNTA 4X62B 4NZ9A 1G4UR 5CH5A 2X76A 2Z2JA 3R2JA 3U40A 1A96A 3G49A 4GI7A 3F96A 2O7SA 4WRRA 3G9UA 3WDMA 1WEHA 1DAOA 3DAFA 1GUAA 1SUSA 1UKBA 3I2HA 3CXRA 3O0TA 4HGOA 4LSWA 4PBRA 3V8RA 4TLBA 1V2HE 7ADHA 4PX5A 3I23A 5DEIA 4P82A 5BQFA 1W4LA 3AFHA 1EESA 1JQLB 4B71A 4J03A 4RS4A 2F1IA 1Z12A 3NAMA 3OOSA 2QLLA 4IQ0A 4Z4VA 3LF2A 4JX9A 2X7JA 5JNWA 4DM4A 2CXTA 5I7FA 5LQDA 3WRXC 4IVRA 5TXGA 3EMKA 2BGUA 1XTRA 3DT9A 4UHDA 2X0EA 3TIFA 2BI4A 1XFDA 1XP8A 1Q1EA 5KVCA 1WVIA 3BRQA 4BLQA 5FEMA 2NZYA 3EVBA 4JEUA 2I2AA 1JF8A 2E49A 4FC7A 3FOCA 2GNAA 2YVLA 3G0CA 5IT9A 2P0EA 4HLUA 4K9PA 4DJEC 4MZXA 4Z0NA 1NJSA 4FT4A 5ELLA 1QU3A 3KLOA 1U2DA 2WI8A 1C1HA 2GPWA 2XCOA 2RHMA 2R6R1 1XEWX 4R6WA 4DUGA 4V1CB 2BFEB 3AVVA 4I9NA 4JOCA 1NV9A 1EAMA 3KQTA 3V1TC 4AKTA 1OXBB 1CUDA 2PBFA 4FI3F 4WKBA 4P08A 5CX1B 1NVAA 3DP9A 1OA0A 3G9ZA 1Z5OA 3FCAA 2R68A 2Q45A 3AK4A 4UJ5A 1H3FA 4YAGA 1L5QA 4JHLA 3RWBA 1TAHA 1ANKA 5HF8A 1UIMA 1E5TA 4XONA 2PEYA 3I8SA 3T7KA 4UOEA 4B87A 2VJIA 1GSIA 4HBZA 1B23P 1TO1E 3COYA 2ZBFA 5FUMA 1OWPA 1W88B 5B55A 4XDHA 3KCNA 4OGKA 4D9BA 4PZEA 3DVLA 4YJHA 2DH5A 4YWHA 1NT2A 3ADDA 1CQWA 3BQNB 1NFQA 1NV8A 3EB9A 3HYNA 4ISBA 2JGNA 4DVJA 5AJTA 5E0OA 4RULA 1T5DX 3IP6A 1ODSA 3JSAA 4ZO7A 1ZAKA 5TVGA 4XWOA 1U0OC 2NUTB 2ZJOA 3GXBA 1XTVA 2AMLA 4I0WB 3NWEA 3AC0A 1QK4A 4H6XA 2KYRA 1RABA 1C4WA 4FQ8A 1R6BX 5FULA 2Q5IA 5C8XA 1GL7A 3AI1A 1LW7A 4RPIA 2C9DA 2FUNB 4LW8A 4OYYA 1XJ0A 1TKCA 1V3UA 2JIDA 2WZPP 1PJLA 2CZQA 2RE8A 3SQDA 4Y9SA 2Q3FA 4XYEA 1B6SA 5CXXA 1GTZA 4EGQA 2BFCB 3FNRA 1ZESA 2CMDA 4JSYA 4UCXA 2ZIUB 5IJ9A 3L4KA 5KYTA 3JQGB 4B3SB 4EATA 3AJ9A 4A5SA 4P0PB 3V4FA 5DW0A 2ILVA 4B47A 3FHLA 4F2HA 4WUVA 1YFJA 5DTMA 4DCMA 1VKJA 1PHRA 2D7CA 3C3CA 3PL1A 4Q1BA 2I7CA 3BJIC 3MTGA 4BP1A 3PTAA 2QD2A 1EE2A 3VYRB 5GQSA 4C4TA 1BPLA 1XBTA 2WP8J 4FFBB 4HDKB 2FUG1 4G0YA 3U49A 1MV5A 2IXDA 3EPKA 4OHUA 3LT0A 1YDEA 3TLXA 5KSOA 1BVYF 3A9RA 3DXFA 2QXYA 3PL5A 4MHOA 4MCJA 1K6EA 1YE3A 3JD3A 1T9KA 3WB0A 5BSKA 1LLDA 2QAGB 3PC7A 3O8OB 1NYRA 3HJUA 5E7IA 2R8BA 2ZWVA 2IYOA 3FMIA 1QIIA 2B4AA 2AOTA 4KGDA 4I5FA 5EE1A 4A2QA 4MPTA 4HRVA 1IZZA 1DC7A 3SZLA 2O2SA 2ZS7A 4EM6A 1KYZA 3H2IA 1A9TA 3KKEA 2G83A 4R2JA 2TMGA 2ZJBA 4IRUB 2OGSA 1T2EA 4HNAA 2XD4A 4Y2XA 3ESQA 3HUTA 4TV9A 2OBLA 1MAWA 1SRRA 1WB5A 2SKCA 4U0KA 1KXZA 2VCHA 1U0JA 2GVNA 4GBMA 3BTOA 1F12A 1CNMA 1BYUA 2COUA 2D13A 2C57A 2B2XA 1GIAA 2ZAMA 1M2OA 3B9QA 4RPKA 5EWLB 3S1AA 3H87A 2LNDA 1DFHA 2X2OA 1EJ6A 4K05A 2WJWA 1PZHA 1NZDA 1Y8AA 2JGDB 4QTTB 2POQX 4LJ8A 4FX2A 2YQ5A 1DV1A 4ZVTA 3VR6H 3I8XA 1XZ8A 4LZNA 2PKQP 3ZV7A 4L75A 4EUFA 2A59A 3GFQA 1ZWLA 5L45A 1YU9A 1HQDA 4LZOA 2K2QB 3EY9A 3FGNA 1RQRA 2J3HA 4DMFA 4LRXA 4H2DA 5IF3A 4INJA 1TDJA 1PK7A 3AMVA 3IV9A 1XC7A 1REQA 1ULHA 1T35A 3OZWA 1TTPB 4NWIA 1JT9A 3P9XA 3D02A 4JI7B 1Z3IX 2P65A 3DQPA 3HVKA 2HJRA 3M1AA 2H2AA 4LRSB 1ODLA 1TPYA 1WY5A 2JLSA 4UE3S 3FPJA 2PPLA 3OSUA 4G9BA 4JIGA 4KLNA 5H81A 4YP6A 3C5EA 3GD5A 5E6UB 4BLWA 3I2KA 4XM3A 4L27A 4C2AA 1SN7A 2JA1A 3L06A 3IT1A 4RIFA 2IYNA 1NT4A 4UFOA 2X8JB 4C5BA 2NPOA 4EA9A 1CB7A 2I33A 1WXFA 3LH5A 4ZGWA 2L82A 1RLIA 3AHGA 1K6XA 2JG3A 3T5AA 3HXPA 4Q9AA 2HLDA 3LCUA 4LUCA 3V76A 3O7WA 3GOHA 3JWHA 3UXEA 1PUXA 2NXNA 4H15A 4AMBA 5EKSA 1E3SA 2P69A 2VQFB 1DARA 1NPDA 3BK7A 1EUDA 1QP8A 5LFAA 5K05A 5DLPA 4O2AA 4JNKA 2QR5A 1AU9A 5C46F 4YCDA 4ZGGA 3LKZA 4JBLA 1I8DA 4A26A 1KVRA 1OV4A 1CZUA 4AMZA 4ZQEA 4B4VA 1X7YB 3K70D 5CT4A 1UBKS 5A5GA 4F38A 2I71A 2OAEA 4K86A 1XTUA 3ZW9A 3VOBA 3PLRA 4M2LA 2WT4A 2R00A 3NBYC 4I3FA 4M8KA 4E0BA 2SKDA 1LDYA 1IOWA 2G63A 2OBBA 3DFKA 3HACA 3RNLA 4FE4A 5A4DA 3C3XA 3MNFA 1K7EB 4MOWA 5D84A 1MB4A 2WVJA 3AYXB 3JQAB 4YXWA 4IINA 1NVVR 3AF3A 5BNIA 1PN3A 3N0VA 3GA0A 1J25A 2MTBA 5KUTA 2VDRB 3A6GA 1KVTA 4NQZA 1AKNA 3FDZB 1Y8RA 4AXBA 1WR8A 1DOZA 2OL4A 1LPBB 3E9EA 4WZBB 4RDXA 3LW8A 4N8SA 2QYOA 3P2KA 2Q4RA 2V54A 1GPYA 3OHMA 1X39A 3DC2A 2EP5A 3TCKA 3YASA 5CVCA 4WK4B 4B75A 2LUOA 1EHCA 4G56A 1VZ2A 2XT6A 5HMMA 3QVXA 3ZGYA 3ZHRA 3ISTA 4JYAB 2MSDB 1HDXA 4JBNA 3ZX4A 4AY3A 3R8XA 2RBGA 1JU3A 3PA2A 1FMLA 4JX8A 5HZMA 4RVGA 1B3BA 1Z5VA 5BNFA 2J09A 3WYNA 4A6XA 1X1EA 4CFYA 2C2HA 2CMFA 5HFNA 1PBTA 5FBVB 4C76A 4D0LB 1VPWA 2I67A 3LYAA 3GLIE 1W2BB 2ZTMA 2WSSA 3WYAA 2CJWB 4YRIA 3KUUA 2P90A 3KYCA 3C7CB 3KALA 3DYIA 3DMHA 2EGUA 3PQDA 5BSFA 4YRDA 5KMGA 1ORRA 2VKQA 3IHLA 1PL7A 1JT2A 3EIXA 4ZDJA 2LIPA 5HFJA 3RAEC 3QNUA 1GO2A 1RJDA 1WU8A 2O5CA 1YBHA 3CJTA 1WCV1 5CEFA 1T5LA 2QAGC 2YMMA 4RC9A 3LHSA 4GP9A 4K9LA 3HBAA 2O3UA 3OA2A 1NXXA 5AKXA 2IUFA 4II3A 5C52B 1Q1QA 4JB8A 1RAIA 4QU8A 4DQLA 3ZU3A 1H1TA 2FG6C 3C3WA 4A3SA 5AW1A 2MOKA 1YQGA 1YI1A 3GD7A 1U04A 2A0WA 1LRKA 2B4QA 3RSCA 3AHCA 2W48A 5K3EA 4MHTA 3EQ8A 3B12A 4ZVLA 3ACDA 1LBQA 3NWBA 4UMVA 5L7TA 2H0AA 4MIEA 1SH7A 3AVOA 2HSEA 5CHEA 3KAJA 3OIUA 1EXNA 4OHCA 4I1VA 1HNXB 4I9HA 1WTAA 3KVOA 4RFSB 3URKA 4OOVA 1NWHA 5TQJA 3T61A 3D64A 4DCTA 2NG1A 4B3HA 5F1KA 4ZT3A 1D6MA 3DFIA 1ZA2A 4REQA 1BKYA 2BR4A 2V4MA 1K2VN 3G0GA 3E5HA 4HDNB 4WLFA 3TJRA 1T0IA 3TQIA 2I3DA 4BX0A 2RK4A 2HO4A 3GFTA 2ZT6A 4CM9A 1ZNWA 3KOXA 4Z4UA 1WWKA 1Y3FE 4B46A 1WOPA 2X9VA 1Z0JA 1UMBB 2ISQA 1WG8A 2XW6A 1W1UA 1SA0A 2B8JA 2K4MA 3GAZA 4ZWNA 5A3VA 3BAFA 5JECA 2F55A 4MI1A 4QBHA 4W5JA 5HEKA 3VDXA 2LDXA 1FFSA 5TMDA 2WUGA 4KUGA 2CBZA 2DWOA 4YRTA 3V4ZA 3IC5A 3KSZO 3ZJYA 5ALHA 2EATA 5LLDA 3ECCA 1A8IA 2IT1A 1N4AA 1X14A 3CN7A 5DN6D 4BQFA 4QOGA 1IC6A 2W2LD 3MF4A 1RQPA 1T3GA 1XOIA 2O7RA 3KEOA 3O75A 4EX7A 2XD9A 3MCAA 2C97A 5EL0A 4DARA 3GHHA 5TQ2B 5K09A 1QTQA 2NUBA 1ZWKA 3G8BA 2G5PA 2A5YB 4MMYB 3T15A 3C6XA 2XB6A 3NHKA 1A71A 1OROA 2J08A 2YIMA 3ZU5A 5J2UA 1HR0B 3DZHA 4GNRA 3Q39A 3D2CA 3WMWA 2IWRA 2GYWA 1FYVA 3PI6A 4MV9A 3ZCSA 3LQFA 3O90A 1R1DA 3T9FA 3AUSA 5K99A 5KYUB 1ISJA 1S2DA 3TW8B 1A8UA 1MAUA 4NU0A 3EEFA 3RVSA 2QORA 5L3QB 3AVPA 1ZVKA 4DADA 4H7IA 1H2ZA 4R1PA 1UEJA 4B17A 4PHTA 1CHNA 4CF7A 2O14A 4EBFA 1ZNZA 1E79A 1FK8A 4K8RB 2DFNA 4UOZA 1NP7A 2EBHX 2V5AA 2ZPTX 5DCWA 3STVA 5CBPB 4JENA 1NMYA 4L4XA 4YDQA 1SWWA 9ABPA 1QHXA 1XE1A 2H5LA 2Q21A 3PWTA 3EWSA 2NADA 4WZLA 3OLXA 1BAPA 4M3NA 3MPOA 1X7XB 4EY6A 1GPUA 4F1JA 1WZCA 1KFKB 2Z56A 2A5GA 4R68A 2BGWA 1NVWQ 2B8NA 5EUCA 1KOFA 4J9VA 5FCDA 4D96A 1I2ZA 1Z38A 2J3QA 5DBHX 4FEEA 2YMPA 1HFEL 3RTEA 1BJRE 3G02A 3I9V6 1ECCA 4IMPA 4F97A 3QEAZ 1M0EA 2JLVA 3WQHA 4P7JA 4EZBA 1DLIA 1EAYA 2DH6A 2QZSA 3DVAA 1JKIA 4KXFB 4PZPA 5AHWA 3T1NA 3A8IA 1C0EA 2ZRAA 4JKOA 4URUR 2FGJA 4LTNA 4IX1A 5KWJA 3THYB 1CRPA 3TOSA 2FRVA 1W85B 3I5UA 4FNMA 4KWCA 3COPA 5I45A 1ZH0A 2AKAB 1VECA 3HCFA 2FX3A 3EIFA 1CVLA 2O7QA 2WVHA 4DWVA 3MT7A 3OT4A 2W8BA 2EFJA 4ND6A 2FFJA 3FOZA 1OXKB 2VJNA 2ZJ4A 5G1OA 3BJEA 2FF5A 1GCOA 3LWNA 5ELXA 3BKWA 3VNVA 3GPLA 4YTEA 4UQOA 1SG0A 1RXCA 1WHSB 4RZSA 4MVXA 4MICA 5EZYB 2X6WA 3K0HA 3QXGA 3TLAA 3L8GA 3LUKA 2F8TA 1VCHA 4R1TA 1ZMRA 4KN5A 2H2IA 3EZGA 4RY8A 4LRUA 1N0VC 2PUTA 3LHDA 3ICQB 2EV9A 5DSTA 1KMIY 1MO5A 4LCEA 3RIHA 3ZWNA 3IEKA 3U4IA 4BO5A 2VHXA 3PF8A 5BT8A 4TZTA 1BMFD 2FR8C 2AG8A 2C7BA 3N8NA 1FQWA 4K88A 4BE7B 2C1XA 3KX2A 3MWKA 4TMWA 4B8WA 2PKCA 3K6KA 5BSRA 2C8JA 2Y0DA 1TGVA 3MJVA 2OK8A 4RL4A 1QO0D 3RSQA 4UTVA 5MN5A 3GY0A 1J0DA 5DPMA 1S2MA 2ZRFA 3V1MA 2NO9A 4AG3A 5JJ5A 3VC2A 4NHEA 3U80A 1DUSA 1NI4B 2WICA 5K8TA 5GMOA 1JWBB 5AVSA 4MB6A 2Q6VA 4ZZIA 1U2SA 2XIQA 4EHHA 4E03A 4EKNB 4Y8VA 1L4NA 3AQIA 3T5BA 2ZZMA 4KRGA 1V7QA 4QXOA 1C8VB 1OB0A 2GFQA 4MSUA 5CVEA 5HMLA 1LLQA 1KDZA 3WGJA 4XPZA 5IKMA 5HTKA 5IXJA 5JCXA 1C9JA 1YS2X 5LQRA 1W5FA 4UQPA 1XZEA 4B4KA 1W8DA 1OBVA 1DX6A 2C1EA 2C5AA 3W90A 4BFYA 4S05A 3LPNA 2AZ4A 3PVSA 3OZEA 4Z4YA 4M9QA 3VVMA 4BDTA 4G8CA 1W2WB 2MYPA 1R74A 3MQ4A 2F8MA 4XM2A 1VPVA 4EW1A 4BTVA 4R84A 1UBOS 1ZVJA 5KVAA 3VNRA 2XWBF 4D79A 1U63A 3GRPA 5B12A 4Z9YA 5C8YB 1UMDB 2CCJA 3CSUA 3VXKA 1HPLA 2Y0BA 1Y0BA 3H0KA 3A1NA 5CVUA 2EZ4A 2WRZA 3V33A 3CKLA 1COZA 2OZLB 1UOOA 3DDSA 3UK1A 3EGDB 2C95A 1W1WA 1MB9A 3TJZA 1E3JA 4RPDA 1SKUA 1Z2NX 4WLOA 3K5HA 3ZDQA 1NX9A 1P81A 4HP8A 4OQ4A 2WOOA 2HHAA 4QBIA 2HCTA 1H9BA 1A8QA 1R8QA 2J33A 4D81A 2FRDC 4QZVA 2JLZA 3A37A 1C80A 1IPFA 3ORYA 4A8PA 3IP5A 4G85A 1Y3AA 4UEWA 3BRCA 3T94A 3CCFA 4LSMA 2VHYA 3HM2A 4MQ4A 3ND8A 3PR1A 3E0XA 2Y1DA 2Y1WA 5ALIA 1JDSA 4ZARA 5BWNA 3QVOA 3P19A 2LDBA 2Q1SA 3KYJB 4BNJA 3F8TA 3CEAA 1RLTA 3NXKA 2IPXA 3IILA 1B76A 5BSVA 1G20A 2Q6TA 5FWYA 5GIOE 2HK6A 1XN1A 4M1TA 3ACCA 1A72A 5HWSA 1AHIA 1QZUA 1Y34E 2FPMA 1ADGA 2ZIXA 3UF0A 1K1EA 1QB8A 2NNWB 3C39A 1EVEA 3EIOA 2EARA 3GQBB 4FJ0A 4IJWA 4Y2PA 4EVQA 3DBRA 4RKFA 1LNSA 4QATA 1ZN9A 1OVMA 4WZAA 2A33A 4JDUA 5G41A 3GP5A 3EEYA 2JDIA 4WERA 2WY2D 1TL7C 4IDBA 3HSKA 3HL4A 1OAOC 1S89A 2YW2A 3A3NA 2Y3IA 4GLBA 2CNOA 4ZO4A 2GTIA 3NBMA 3K8YA 4PY2A 3LUCA 4TWBA 2WU1A 2NV2B 3GIDA 4FFSA 4DILA 2Q7DA 4B7AA 3ADPA 3ZS9A 2GD6A 3FIJA 1JG7A 3MINA 4X7PA 1JR3A 3G6EB 3PUWA 3VTZA 1PEKE 4LXQA 3C3YA 4I4TB 2W6MA 2I62A 1KMNA 3K09C 2E85A 2WF5A 1CSEE 3L6UA 4KKXB 5TSDA 2HQ1A 3AUAA 4YMWA 2FWJA 3RFUA 3TD2A 4DDKA 4ZT6A 1FNBA 4ID3A 4YA6A 1LSOA 3ENVA 4AJPA 5EJEA 3EZ6A 3DE6X 4X3OA 4IJMA 1YDWA 4KQXA 4Q9HA 1J8MF 4BCDA 2RHTA 4PAAA 4LZJA 1A82A 5K0EA 1V35A 1GEEA 2NQTA 1N7GA 2ZK7A 1O7JA 5LZ4A 2QL7A 1NBHA 1PCXA 2HLPA 3FYTA 5KCMA 2A9VA 3ROMA 3VPSA 4N7JA 4CF6A 2WZNA 1QHSA 4KE8A 3ZU2A 4DL9A 5AVZA 3TSCA 4GKBA 1F7UA 4PV7A 2OZPA 2J30A 1ODFA 3PICA 2V8BA 3K9GA 2QXTA 4INZA 3PXDA 5DNYB 1I3KA 1KYWA 2R6JA 4PIPA 3RADC 3CMCO 1FU4A 4OI2A 4XGKA 4CI9A 2PPVA 4PYJA 4P1VA 4JI4B 2FSFA 3II6X 2W8ZA 5EPOA 1GCGA 1H4TA 1VL8A 1R4MA 2XECA 3L7YA 4J2HA 3QKRA 4MWZA 1SCNE 2Z1MA 1HX7A 2NZJA 2VDLB 4MULA 3T5TA 2R6GA 2WWXA 2CLOB 3RSZA 2EJTA 4IDCA 2A4KA 2CVPA 2PA0A 4MR7A 1NBOA 1I30A 1T3HA 2JA2A 1K89A 2VP2A 2B99A 3ZE8A 2QM3A 5AUNB 1TVKB 2XVYA 1Y1LA 1OZGA 2AXEA 4QUHA 1QLWA 3I76A 1U2PA 3L7OA 1JE0A 1L5VA 1NP3A 1S3SA 4OJYA 4TS9A 4UAVA 4AO6A 1Y6JA 1EPUA 3LY7A 4DV6B 1NSYA 3Q8LA 4WKCA 5CDFE 3QQPA 1ONPA 3O4IA 4U6NA 2XGOA 1QHHB 4LJSA 4FXOA 4BE9A 5M04A 4ANFA 4EZIA 4RV9A 4A7PA 1Q7EA 1FUUA 1QCYA 3AEUB 4UTPA 5FWAA 4BO4A 1W6UA 2M1ZA 1TJ4A 2XBLA 3N07A 5FPYA 4DWOA 1R6VA 1PTJC 4F6RB 3IAFA 4C07A 2IA5A 3Q7PA 3JYQA 5ALEA 5FPKA 1ZJ4A 2QTVB 3DOOA 2V7TA 4U2CA 4BO3A 3O8DA 1XA4A 4Q3EA 3PUJA 4F3KA 4K1XA 1P17A 3TS1A 4LECA 3VA7A 1N8SA 5A5DA 5B2EA 5T4BA 4IO1A 4YB8A 4DHEA 1SQSA 4UE2A 4OQNA 4MJXA 4KKTA 2IYPA 1A9RA 2H17A 3D7RA 3CS3A 4DDWA 1BOFA 1ZL2A 1LB1B 1Z26A 6YASA 3UPUA 1QDLB 5U4QA 1SC6A 3BZBA 3RHZA 3P9YA 4RTNA 1XTPA 2LR0A 4QPNA 1TU3A 3BL8A 1JWLA 2NZ2A 2V6IA 1VP9A 1EJ2A 2GEVA 2ODTX 3MIZA 4JBYA 3U6BA 4G5FA 4MV4A 2IU0A 3ZWMA 3SVTA 3SZOA 3MJFA 2IZOA 3ESAA 3EQ7A 1OVGA 5KTYA 4DEXA 2X8AA 1P0IA 3HU1A 3JD2A 4I4CA 1SXJB 5REQA 3R6TA 4MGZR 5I3CA 1EIWA 5C5CA 2X1HA 2C5SA 3P9QA 1X2BA 2I7TA 3QYPA 4H27A 4L5AA 1FL9A 4XARA 1VE9A 1DO2A 1EG2A 2Q29A 1DQRA 3O84A 4ZT4A 4JYPA 1J8VA 1WNTA 3FF4A 3T4PA 4ZYLA 4GD3Q 2IF0A 3WI7A 4AWXA 3SGLA 4JB3A 2BGIA 1VHLA 2RD2A 3KTAA 4I5GA 3BCUA 3RF7A 2QX6A 3SXUB 1QF9A 2X6RA 3AHDA 3KWLA 3KZCA 3NANA 3PDHA 5BVHA 3KQLA 1YFKA 2W71A 1Z75A 2D5IA 1B0AA 5H68A 3NPAA 3S6JA 3GLQA 3M6IA 3QELB 4N0QA 5K6AA 2QU8A 3IVRA 1EWVA 4UDNA 3S4YA 1RXYA 4RF3A 1IBRA 2VYND 2J9XB 3L05A 5FJIA 3KD2A 4FGUA 4IH4A 2RH8A 4KWTA 4LYGA 4TRRA 3KQOA 4UZEA 1WCWA 4PQGA 5B7PA 1ZVVA 1B93A 2NU9A 2ZRKA 5ADWA 2FQWA 3L4EA 2AA3A 2IHZA 3GLTA 5DIFA 5DTIA 2P2DA 1DKUA 1VHOA 3MEQA 3ZY3A 4YIHA 3ZXSA 1DBIA 3LX5A 2VK1A 2X0DA 2ABWA 3OEHD 5IKOA 3RGWS 3L8ZA 6ABPA 5L46A 5FR1A 5DK6A 5BN3B 2PVCA 1WF3A 1R8YA 2A0XA 4PAQA 4QX6A 3WOHA 2QNIA 4K1LA 2IPNA 4PTZA 2P6UA 2VHTA 4GI2A 5IBCA 3PQ6A 4F4HA 2C3YA 2EFDB 3PDUA 4L4YA 5K4HA 3ANXA 1ZLXA 1NIPA 5GM2A 3QX3A 5KWSA 1DSSG 5CFNA 3R40A 2JC3A 2NPIA 1P9NA 5JS1A 2OOKA 3EHEA 5J47A 1HBJA 1BE8A 3GLFE 4U2KA 4PSDA 4P25A 4HEA1 1BFUA 1PT7A 3BMNA 4JJIA 2J0SA 4U0JA 4UAGA 1F14A 3IAUA 3FSJX 3I2IA 2QA4B 2HI0A 1YL7A 1L4UA 1N6NA 1GTG1 1FBNA 2JAOA 2BJVA 5BUSA 2XDYA 3NBQA 2XVMA 1VLYA 3DGEC 4QBKA 3WIEA 2HZ7A 4C9BA 4ZOQI 5I4BA 1USKA 3FWHA 2IW3A 4Y7DA 2BI8A 5J58A 1YBVA 3LNNA 5TS2A 1M5TA 1M2VA 2PMFA 2VLIA 2PD4A 4IKPA 4Q3AA 3SY8A 4YV1A 4TL7A 4GQBA 1K8XB 3D1JA 2ORVA 3G9XA 2PWYA 4B3JA 2X8BA 4HLNA 4RXMA 1Q9SA 4CODB 2F8SA 3IPLA 1UQUA 1RXVA 3CYFA 3ZX5A 3KT3A 4OQYA 2XNCA 4ZV4A 1LA2A 3CINA 2GOYA 1DMRA 4LCBA 4Q4HB 4TSRA 5DASA 1N06A 1N0WA 2LPMA 3NYIA 1I7QB 4OMCA 3GCDA 4IHJF 1TMYA 4R5MA 1SVOA 3LNCA 4V3CA 4OAOA 2KJQA 1HDIA 3QZUA 1KO7A 4QOFA 4XVHA 3E81A 1CDOA 1UPAA 4RA9A 4YROA 1J6UA 2LE0A 5JCJD 2PJRA 2AMFA 5TQ0A 3QLTA 4BO0A 4PZUA 4DYDA 2X86A 3VV2A 1DXQA 4W9NC 2C7RA 4D3DA 2BSQA 5IN5A 2X15A 4FYYA 4Q4CA 2KPOA 5DX8A 3BE6A 1FMFA 1S5PA 3FJYA 3PZBA 4WZ6A 3PFKA 3MAJA 2EJVA 2XITA 4Q4JA 1M1NA 3KL2A 3AERB 3O31A 1E4YA 1M7HA 2FV8A 3IKVA 4BO1A 2VF4X 1HOTA 3A1DA 1S0UA 2HKIA 3GCXA 3WNBA 4IHKA 3FPEA 5B7GA 5C8DA 5L6LB 2O3JA 1NW8A 3NI2A 3UAGA 5J63A 3AP1A 2HLNA 1QGUA 2B0JA 2DIEA 4DQVA 1TECE 3OTGA 1NTRA 2CL0X 4EYGA 3OE5A 2OEPA 3IJEB 3LJKA 4TLAA 1J9ZA 1BO6A 1UXKA 1FOEB 4ZOLA 4G5HA 2WKSA 4O0MA 3ZGOA 1OIVA 1PGQA 2MR6A 3SLRA 1L5FA 2WBLC 1CW2B 1A4IA 5KPJA 3M70A 1YGYA 3H7IA 4A82A 1QRAA 1WTHD 3T9BA 1T0HB 3AM4A 3OPYB 3MZ0A 1GNSA 3QTTA 2CHUA 3H9GA 1H0RA 2AN4A 1ODIA 4NNOA 1IN4A 3UO8B 3W9UA 3GLRA 2HV9A 3KC2A 1IUKA 1NVXQ 1UBGA 4YYEA 2R79A 3P9ZA 4OI4A 1SXJC 5IVDA 4CMCA 2FWPA 3IMEA 4MQ5A 3ZDXB 5ADVA 1C4XA 3T7IA 1EK0A 1TZCA 3KDPA 4LISA 2G0NA 2PD3A 4M7WA 1P73A 1YAHA 4WWHA 3HJCA 1W581 4UMDA 1RYBA 3M4ZA 3ZBTA 2NIPA 1J99A 1G17A 3HA7A 4R8LA 2PMWB 4ZEOA 3TWOA 2IYVA 3FIUA 2ZJ7A 5ARCA 1GLNA 2HK7A 5KTKA 3I5AA 1ZS9A 3E0QA 5JYBA 3IAEA 5KTNA 4JXKA 2B25A 2FZKA 3WQRA 1ML3A 3RS3A 4QUZA 1NVTA 4RJJA 1ZHOA 1GAQA 1EB9A 2E55A 2GKSA 3EJ6A 3JAKB 2IY7A 3C6YA 4BGEA 2IYZA 1KNQA 1VE6A 3OEED 4DANA 2WF9A 1KK1A 2F1MA 5THXA 3H6HA 3TE6A 3RT9A 5JAQA 1P1CA 4Y2YA 2IYFA 1OX4A 5GOZA 2MSCB 2NU8B 2R62A 3IL2A 4ALJA 3EGXA 1IZ7A 3OJ0A 3C14C 2C61A 2NO4A 2H92A 2HOQA 3T3HA 3ECSA 3F6PA 2CFSA 2CLCX 2OM6A 2W90A 3B1KA 3KSRA 1Q12A 4QGSA 5BW8A 1Q17A 3ZDCA 2R3SA 5AHKA 4YP9A 1Z7BA 2GBGA 4ESOA 1A5BB 1ZZEA 1J33A 1QE5A 3KQNA 1G2QA 4UXJA 3UJ3X 2QD1A 4GUAA 2Z6VA 4URYR 1QANA 2W6NA 4ZYVA 3WK7A 1L4GA 3H97A 4UBIA 1XMSA 2PLRA 1ZCAA 4FE7A 2XVAA 4G0MA 2YFKA 4FYKA 5IUKC 3UOGA 4CM6A 3BXFA 4M89A 1GGFA 3CCBA 1YITB 1QK5A 3SF0A 1C1DA 4MGKR 1UC8A 1DNPA 2GI4A 2YXLA 3GROA 1FW6A 4FHGA 3T3GA 3BNWA 5C7YA 3H4TA 3A06A 4GYJA 2CE7A 5AOBA 4OY3A 4JGGA 1DEKA 4XEUA 3KYDA 3SK0A 3UAZA 2WTNA 3IYLW 1ZH6A 1V96A 1G60A 4F2PA 3MGKA 3TOVA 1Y9EA 1PQWA 1Z2OX 3GUCA 5DI3A 1T8RA 3RVJA 3A10A 3TMYA 2TECE 4B2YA 4G97A 4YRLA 5D85A 2RCNA 4TN5A 3DD1A 2AR7A 4MCHA 3BTVA 3UK0A 1H2XA 2D8AA 1CWUA 4FMCF 1UPBA 4F4UA 1ORTA 2FE1A 4Q1CA 4NG4A 5JADA 1M1KD 3C7TA 5AI5A 4KAAA 5F2NA 4YV2A 2AOUB 4W5RA 3RWOA 2ZS9A 4JQOA 2EYQA 2QL6A 3F7OA 5E1OA 3VKHA 2YTZA 2P75A 4GG1A 4Q7LA 1KPIA 3MK31 4YAIA 2F9LA 4LZWA 3BDAA 2WG0A 4WXYB 1CEYA 1C3EA 3PDIB 2Q7OE 2NVUB 3LYHA 1T1RA 3H65A 2QUIA 4D45A 2JK0A 3R3XA 1JAXA 4QJIA 2J3JA 3NT5A 4HK4A 4WN3A 3KLPX 3K2BA 5K1ZA 3WL3A 2CBXA 3UXYA 4IIVA 4AJHA 3NAGA 4F04A 5J23A 1SHTX 4KQ2A 4X6UA 5BOSA 2WJGA 4R83A 4ZPJA 2VBIA 1I5EA 5BRNA 1Q2UA 3AWIA 5JYCA 1L4FA 1JHYA 3DGFC 3DLTA 4JITA 3AUYA 3H5IA 3CGWA 2R4QA 4QXAA 2R2GA 2B8TA 4G4SP 1OAAA 1QORA 1Z0AA 5LJIA 1GPH1 1GPLA 4G5SA 1KZ9A 1SCQA 4N5HX 2Y68A 4OBEA 2I29A 3AJAA 3K0KA 4R8KA 4I3HA 3Q3JB 1AOXA 3QE9Y 2ZUTA 3CRRA 1LU9A 5CLIA 1E1LA 1CLEA 2C4KA 4P4TA 5EZ6B 4DEVA 3WA7A 3AF4A 4AUKA 1MHTA 5CVVA 3TVTA 1XDSA 4CMHA 4IFEA 2FMUA 1C4KA 2E1RA 1XZKA 2IYEA 1ZN2A 4GMGA 1GPAA 4EH1A 1VJRA 1S01A 5CDYA 4Q0MA 3BXOA 1OILA 2W6CX 4JOBA 3R9XB 2HBYA 4R1SA 3LXRA 4KXLA 4EJSB 2H7XA 2FPGA 1PT9A 2YINC 1GNQA 1SOAA 3PXUA 3SYLA 4OX9Y 2Y76A 4TN1A 4B3FX 3EQ6A 2YQZA 1VJ1A 2BEVB 1VDZA 3FYSA 2E82A 2NQ2C 1NYTA 3TNLA 3TB6A 3LT1A 1U80A 2ZRCA 1IOLA 1YQTA 5HZHA 3OU6A 2HWUA 2I54A 3ISVA 3MILA 4IP0A 4PR3A 2FU5C 1V8OA 5IYWA 7MHTA 3HU5A 1S4QA 2Y8EA 4IEFB 4DJFC 1M2EA 5LDGA 2P3SA 4ARVA 5JNLA 5CA1B 3RQSA 4HZUA 1DMSA 3ZGLA 4BLSA 4D8VA 1BEUB 4BMCA 2WZDA 4F85A 3AETB 4FOOA 1AB5A 1DDIA 4EABA 3CLRC 3ENQA 2D00A 3DLHA 1NE7A 1N05A 3EGOA 3ONDA 1QGAA 4WKGA 1XVTA 2ZYVX 4D8XA 3OTIA 4ZVVA 4LJ6A 2VAVA 4AZ3B 1HDEA 1IBMB 3JYLA 1VIDA 4WOKA 2WM9B 2WV7A 4RH3A 4M9RA 1QV7A 4XTRA 5BVGA 5EMNA 2EJWA 3UJHA 4E21A 3DQQA 1UKVY 3RWMB 1WXHA 2VATA 4YLEA 4D6PA 5EXTA 3CO0S 2R8ZA 5HM8A 3HDGA 3VDQA 3N9IA 3RVBA 4TLDA 4FT2A 4DMUB 3ZVMA 4QM7A 5A6SA 1ETUA 1GZ5A 3BGSA 3CLUC 4RMGA 5TDHA 3NHMA 2BFBB 1TQ6A 3L7IA 1BD3A 4JAVC 5JDCA 1RXSA 5LP6F 5DX0A 1RWWA 4PLZA 5DNCA 3S2UA 1WB4A 5K0FA 2ZGVA 4AVZA 3UK7A 5IYRA 2JL1A 3S2IA 1U0LA 1F0NA 1WQ3A 3MPUA 2AB0A 5CD1A 3IA2A 4YRNA 3HDHA 3OCCA 3ZIDA 2JFXA 5JQGB 4XKVA 4J07A 2WWIA 2OHJA 4MVJA 3RTGA 1OJ7A 4PQFA 1OU0A 4NAVA 3S8MA 1XA3A 3TEJA 3JPWA 1M2FA 5GTDA 4YMGA 4L5BA 4AAYA 1Q0QA 2QW0X 4O8ZA 2CEKA 1QSGA 1Z35A 4R8MA 4IZHA 5BYBA 4YALA 1VJCA 5CLGA 1JVBA 1ZI6A 1E6CA 2ECOA 1K92A 3MOIA 4IXWA 4JP3A 1KWKA 2FUCA 4FWIB 3GOQA 3WMGA 1AY0A 1KFBB 3GEIA 1JEYA 1COWA 4GECA 5CEJA 2QN3A 4MR9A 4G0VA 1CUVA 3MYYA 5HGJA 3STUA 2GJRA 4CMKA 3Q6QA 1KTIA 1QK3A 4HVAA 4MKRA 5C9ZA 2JLUA 3MHPA 5AM0A 2HJVA 1VQ1A 3R6GA 4JN6B 3GGOA 4IYJA 2B7CA 1BMQA 2D54A 3H2YA 1O03A 5L7WA 1XQ9A 4GPD1 5FORA 1ZI8A 3PG5A 2XZTA 2YFQA 2QTFA 4BAGA 5T7BA 2V58A 4BNDA 4R1NA 1E89A 3IAXA 4UM7A 3HNOA 3KZXA 1ZU4A 3K9WA 3AGPA 2Y0EA 1IFXA 4HMQA 5CYFA 1OA1A 1Y7LA 2HJSA 1V1MB 4ZVUA 3VKGA 4BKQA 1PHPA 3HBJA 2X5XA 1PFGA 1Z7GA 1O0CA 1MG5A 1TM7E 3MUEA 4OQEA 4V03A 3AKCA 4DBLE 1QDEA 4BFWA 2FDCA 1WRBA 2VJCA 2JIZA 1ZHFA 2MDTA 3SC2A 5JROA 4JOSA 1IN7A 4RKEA 3TOCA 3ZK7A 4QARA 1EGHA 2VXOA 4OXNA 1U81A 3LHKA 4N76A 2V0CA 4DG5A 3OFKA 4ESHA 4UXIA 2V7PA 3EUEA 3JX9A 1PNRA 1HDYA 3AIKA 5CLJA 4QTXA 2QUHA 5FAKA 4O25A 2LGJA 1KZYC 3EZLA 1HORA 4IDNA 3K15A 1II9A 4L9WA 4ITRC 4JASB 3PQ3A 1BFDA 1IPHA 1II0A 1MRZA 3GVHA 4FD2A 1GCAA 4GM0A 4HX2A 4TKUB 4CQMB 4EJSC 3VGPA 2PL5A 1CJSA 2IHTA 3R24A 2A94A 1NRKA 4KAFA 2G82A 4MQEA 3L8FA 3Q72A 1WBDA 3KTDA 4KQMA 1P60A 4KUEA 1XZPA 3REFA 1QO9A 2UVQA 1TLFA 1XG5A 3OSZA 5A4JA 1T8PA 1AQIA 2IXTA 2O2CA 3OECA 3P9SA 3GCGA 3EXIA 3L0IB 1CR6A 4GRAA 1PIWA 4P0TA 1ODCA 4M0PA 2WMNB 2F6RA 4KSBA 2Q1UA 4MI6A 3PX3A 1OKKA 1T4DA 3VBCA 5FTLA 1G38A 3SJPA 3J7AC 3AZOA 1GU0A 3GLKA 2O8DA 3GEMA 3I83A 2XEXA 3PFWO 1M1ZA 3FTFA 4JJGA 4XX0B 1Z4IA 2JFVA 1VQNB 4Y0NA 1FE8A 3H5TA 4QC2A 4M98A 4S12A 4II2A 2XF2A 3KFLA 4CV1A 2PAAA 2PIAA 1P1KA 3RK1A 4O1MA 4X64B 4CTOA 1A8SA 2Z43A 4ZIRA 2C00A 4XVQA 1UFKA 3OQ6A 4CEJB 3NDBB 4I4NA 1JJVA 3V9PA 3F5FA 3WDLA 4BZPA 1F2TA 4RD0A 3IMFA 3ER8A 5B1HA 1I2DA 4KV9A 4ZMRA 1Q0PA 3D7SA 2O2EA 2XMZA 4EO4A 2H11A 3N8GA 5BSWA 3TZQA 4RTSA 3VVLA 3AR8A 1I7DA 2VCEA 4X85A 2BGNA 4B34A 5JSHA 1C81A 4DY4A 2NUAA 1NAHA 1QVGB 1J00A 1P2BA 1USUA 2RB5A 2XSZD 2GPSA 3EGCA 3MAAC 3RRXA 5FO1A 1W73A 3B60A 1KYTA 3RS9A 4L1KA 4BEVA 4LHXA 2ZJ5A 4HRAA 1YZVA 3E2IA 3NTXA 821PA 2YZMA 1GAEO 1Y98A 2NO6A 3L7KA 1D8AA 1XJWA 1RWNA 5GZ1A 2PJUA 1U2RA 1SCKA 4QFBA 3AFIA 2DHCA 5IDVA 3W0LB 3X0DA 1C7IA 2X6QA 3BGIA 3BHNA 3IPRA 4H7DA 1U4NA 2I87A 4IVPA 4UUOA 2ZIFA 4BNYA 5I7OA 1QAQA 1OLSB 1XU7A 2FN3A 3C7DB 1E60A 2GPJA 2D5BA 3JQ9A 3CCLB 4PG6A 3ZGZA 1Z6YA 2H57A 1PNOA 5GPBA 3T7DA 1EP1B 5CVDA 5IJZA 3R7LA 1YV9A 2HU8A 1ZY2A 1MVNA 1Y9AA 2BM8A 2NU7B