5A8AA

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with fmn and adp (p3 2 21)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
b'GRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 35
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a8aA00
4UZFA 1N06A 3OP1A 1S4MA 5A8AA 5TRDA 2VBSA 2VBUA 1Q9SA 1T6ZA 5FO1A 2P3MA 5A89A 5FO0A 1T6YA 1T6XA 1MRZA 2VBVA 1N05A 1P4MA 5A88A 1NB0A 1N07A 3ZUGA 2VBTA 5FNZA 2X0KA 4UZEA 3BNWA 1N08A 1NB9A 2OYNA 2I1LA 3CTAA
chains in the Genus database with same CATH superfamily
2Q6KA 4P3YA 1QG0A 3WNDA 3SJZA 2R9VA 4IW3B 2YWGA 4RD1A 1BJKA 3GVKA 3FPPA 5FA6A 3SKBA 3CMAB 4P2NA 3AVWA 3Q6RA 5IYRA 3RY8A 2V7VA 4TN1A 4M1KA 4XMYA 5J35A 1QUFA 1PKVA 1UD6A 2JN9A 1T6XA 4B48A 2ZZFA 2XNCA 3ZBTA 4YAOA 1ZUNB 3MCAA 4RDJA 1VQ4B 2GPJA 4QFMA 1Q82D 4M2LA 1W0KA 3JU4A 1YIJB 1W34A 4P26A 4RM0A 4RD4A 1YITB 2C5HA 1HVXA 3MMPA 2YWEA 1ELOA 4HE6A 3H94A 1QX4A 3KL9A 2RC6A 3W2EA 1FNDA 3WNBA 2DIEA 3WYAA 3CB4A 3VNUA 4Y9RA 2GJKA 1TTTA 2X85A 2RC5A 4XNFA 2J7KA 3AVVA 4TSFA 5IK2A 5FO0A 3WNCA 5AN9A 1QH0A 4P3IA 1EFTA 2ZBUA 2VNJA 3ZC3A 3CMEB 1BX1A 4DK0A 1P4MA 4TMXA 1NJID 1XFOA 2JDIA 3ZUGA 5B6IA 1PJ6A 3BQJA 2GQFA 3LQEA 4X05A 4II2A 4XKVA 2E1BA 3W2GA 3AVYA 4OOXA 1NRKA 2ZL7A 4YAWA 2OYNA 2VNKA 4Z4RA 4PC1A 1GJRA 2LZJA 2XNJA 1VQPB 2QTZA 4XLHA 5KSWB 2CF4A 2F1MA 1FNCA 2VBSA 4YAFA 3OEEA 4DK1A 1IHMA 1OB5A 2GK6A 4NCNA 5BSYA 3OJXA 2ZTNA 3QFRA 1JA1A 1VJSA 2D74A 1IJFA 3FKSA 3JQQA 2DERA 3J81k 1KK3A 1FRQA 3A8KA 3AGQA 1G7SA 1XQBA 2BM1A 2HMAA 1K8AD 1QGYA 1ZM9A 1G7RA 1Y0YA 5THXA 4MYTA 1XB2A 4QVJA 3ZIAA 4TMTA 1QFZA 2ZITA 1NBMA 3W5VA 4EH1A 5HZAA 1R5BA 2OBRA 4B3XA 3G6EB 3GVLA 4PGOA 1AMOA 1UD8A 4G6IA 2V4DA 3PVDA 3ONYA 1Q7YD 5GV8A 3ASQA 4TT3A 2CC2A 1QVGB 2HCJB 1E3XA 3A8IA 4YEJA 3OW7A 1TVCA 4Q7JB 2DETA 3R6JA 4ZGNB 4KKUA 2R6HA 2PMDA 3PA1A 2VJIA 3HAGA 2OBTA 4P6VF 5HZBA 3ZZ0A 5FNZA 3CRZA 2VZLA 2FX3A 3U6KA 5F4OA 5IYPA 1FX0A 3SJPA 2WJYA 2V7XA 3W5HA 4WQMA 1WOPA 5IYNA 4HE5A 4U9UA 2WZNA 4UZFA 4LBVA 4X7EA 2BMWA 2VBUA 1EXMA 4XLCA 2VNIA 3SEJA 1GO2A 1W0JA 4UZUA 1V0FA 5TY0A 2OTJB 2V7TA 4N3NA 3CC2B 4X06A 3CD6B 4RDLA 2OBSA 1T5EA 1WP6A 3B82A 1UMKA 1H42A 1HA3A 1N0VC 1UD4A 1VQKB 3W2HA 2JJ2A 4XLEA 4ACBA 1VHOA 1KQSB 3CP2A 3NE5B 3OZUA 2BGIA 4LC0A 4Z4SA 3W2FA 1VQMB 1FDRA 2I1LA 2B7BA 4YELA 4RCZA 2OTLB 1S0UA 3FPKA 4QV2A 1VQOB 5TRDA 3CP8A 3GVJA 1K28D 3ZPNA 2BGJA 1QGZA 4Y7CA 3I1FA 1TLLA 4MYUA 2DYIA 4XLFA 5JBQA 3OW2B 4QHYA 3KEWA 1WOOA 1GR1A 1UD5A 1EP2B 1UD2A 4E0FA 2X6YA 1COWA 1YJ9B 1FNBA 3CMMA 3Q38A 2M5SA 1VQ6B 3BNWA 4X8IA 1OB0A 4X7DA 2BN4A 1W35A 4HIZA 1KK0A 3CPWB 1D8TA 1K73D 3PUMA 3AGPA 4PABA 3VR6A 4H9GA 2QE7A 3OP1A 1JA0A 1KTVA 2XGJA 4M4SA 2NV4A 2BM0A 2ZTGA 3SLDA 4LBWA 1WU8A 4C0SA 1I18A 1EFCA 3OOCA 1B23P 5TV2A 4X0CA 2GJPA 1VLYA 1N05A 4N3GA 4RJLA 1VQ8B 1M1KD 1NDHA 3GSIA 2B5OA 4P9SA 1WSVA 2W6IA 1A8PA 2QMUA 1W2BB 4FN5A 3SLNA 1KK1A 3CESA 5FIUA 4Z4TA 2QA4B 4XORA 2V31A 1E64A 3QFTA 4F7DA 1ZM2A 2QN6A 1E1QA 2Q6IA 4WZEA 3PENA 4DNRB 5KNLA 5E6TA 1N0UA 2X6XA 4OPSA 1K9MD 3OFNA 3T56B 1OGIA 3OZVA 4XOPA 2C2WA 2ZXHA 5FO1A 3WQZA 1W87A 1WORA 4Z1MA 1GAWA 3ASPA 1WOSA 3GQBA 2PE3A 3MHPA 1WSRA 5LMZA 1VQ5B 2C77A 5IYWA 1KK2A 1QUEA 4X7FA 1GVHA 1H85A 2KVOA 4B3GA 1DDIA 2FVGA 3P27A 2V7UA 4Y9UA 4TMWA 2WZPP 1AIPA 2ZZQA 4GQNA 2F1LA 3A3BA 2YWFA 5H59A 4WWVA 2Q6OA 3A35A 3CTAA 4RLZA 2X8KA 1PJ7A 1XE1A 2QEXB 1JNYA 1T6ZA 4NNJA 1M90D 3ZZUA 3CC4B 2F43A 2P3MA 3CCJB 4XLAA 3V76A 2VJJA 3ASSA 2JIZA 1KJZA 3OEHA 4ROXA 2BVNA 2ZZGA 4G5GA 3ASRA 3CCRB 2BV3A 2E1RA 4RD6A 5HKKA 4Z4WA 3CCVB 2C78A 4PC3A 1CQXA 4Z4ZA 2XZLA 1JJ2B 3ZBUA 1WTHD 3Q39A 5DS0A 2X3UA 4ZGQB 3JQPA 2ZBVA 1HZEA 1EP3B 1KZLA 2D9RA 1VQ9B 5A8AA 3DDYA 1E62A 2ZL6A 3BCFA 1Q86D 2EIXA 2GK7A 3A1PA 4TKOB 3PUNA 1N8RD 4UAJA 1F60A 1KRHA 2X6WA 5IYQA 2CNDA 1GAQA 2XOKA 4G1VA 3U6BA 5FL7A 1EFUA 4CQJA 1BPLA 3OE7A 1BQEA 5CDFA 1BLIA 1F20A 1N08A 2XZPA 3A8JA 1CNEA 1VQLB 1NB9A 4Z4VA 2DCUA 3R6KA 2EFGA 3CXCB 4FK8A 1UD3A 2D3NA 1QFJA 1YJNB 4J0QA 3LNNA 1SKYB 1V0EA 2HDNB 3VO2A 1D1NA 3ISXA 5F4MA 5GV7A 4M53A 2WSSA 1DG1G 4XM3A 4X7CA 4B47A 2Z6BD 4L8JA 1YX2A 1T6YA 2PIAA 2OK8A 4AF6A 2W6JA 1V5VA 2C5BA 4OPVA 4B44A 4WZTA 3QFSA 1FNMA 1QGAA 1VQNB 3P26A 4C43A 4XONA 3ONUA 4B4DA 4RPDA 2ZXIA 2QTLA 2WYRA 4AVZA 1DDGA 3WY9A 4ACAA 3D26A 5J3OA 1QFYA 4ZCMA 1B2RA 4TMVA 3CCMB 1JB9A 4AC9A 4XR6A 1SKQA 4QUZA 5A89A 4G7WA 4X07A 1DARA 1G7CA 4P1VA 3CCEB 2WR8A 1EWYA 4XN0A 3I55B 3GIRA 2NPFA 3A3GA 4XL9A 4YHBA 5TR9A 1YHQB 1KD1D 3AVXA 5DSZA 1YJWB 2BSAA 3CW2A 1Q81D 3OKXA 1EFRA 3Q6QA 1I7PA 1TUIA 4M0LA 4G1BA 1YLOA 1VQ7B 4RD3A 1OHHA 3LVBA 3QSYA 3WBKA 1KMHA 3G05A 2Q6LA 3E1YE 3ES9A 3T53B 1WDTA 4OOVA 1OB2A 2C4TA 3BC9A 3ASTA 1E63A 2WJVA 3WXMA 3VNVA 2ZL5A 1CNFA 3LQ6A 4XOTA 4FXUA 2VBVA 1WPCA 2OK7A 4B3FX 1E3ZA 1PJ5A 1KC8D 2AHOA 2JJ1A 2VYQA 4KKSA 5EMNA 1FRNA 2YWHA 3CPXA 2CRVA 2PLFA 3B78A 3E20A 4PAAA 2C4UA 4II3A 4QVAA 1MABA 4XN3A 3VMFA 3W2IA 3OJWA 3V7AA 4G7XA 1ZM3A 4P12A 2CBXA 1OGJA 4TMZA 4WZLA 4WZKA 4P25A 1SM4A 2D3LA 2XEXA 2GREA 4XD7A 4RPBA 1VF7A 2XNDA 3BCDA 4RCYA 4XQFA 3H9NA 1R5NA 1MRZA 2WPDA 2CK3A 1EP1B 5KW9A 5A88A 1NB0A 4YALA 2B7CA 4ZV4A 2DY1A 4Z4UA 4ZCIA 4RDKA 2ZZEA 4OOSA 1BX0A 3BY2A 4P22A 2X0KA 4JMQA 4UZEA 3VO1A 3T51B 3B8HA 1ZM4A 5BSXA 4ZCLA 3CCSB 3ZZTA 2F4NA 4OP7A 1Y0RA 3OZWA 4NBSA 1N06A 1U2RA 1S4MA 2DEUA 1S72B 3QE2A 3AVUA 2XZOA 2HLDA 4PC7A 4ASUA 3AVTA 2VNHA 1E1RA 5DN6A 2BPOA 4PC6A 1E79A 3FJOA 1D2EA 1N07A 1H8HA 2VBTA 4LBZA 4XKWA 4AF7A 1J9ZA 1VLOA 2GJRA 3Q3AA 5F4JA 3LO8A 3I56B 2CW5A 1R5OA 3CCLB 1W9XA 3G4SB 4OPOA 5L46A 1H8EA 2QDXA 4LBYA 4DNTB 1RQRA 4DQKA 3BH4A 2V7WA 3BY1A 1Q9SA 2DOGA 3PA2A 4RD2A 1G7TA 3WBJA 4BPRA 4FWTA 3OPOA 3G71B 4P6YA 3CCQB 1RQPA 2X53S 3CC7B 4R71A 1QVFB 3OAAA 3JQRA 2BF4A 1IJEA 5HXBA 3QFCA 4PC2A 1VHEA 5H5JA 3U2QA 4RD0A 4B43A 1E43A 3W5UA 1I8DA 4K1XA 4DQLA 1BMFA 1IB0A 2QGGA 4YAUA 2V7QA 3CCUB 1YI2B 4YXWA 4Z4YA 4KKTA
chains in the Genus database with same CATH topology
4UZFA 1N06A 3OP1A 1S4MA 5A8AA 5TRDA 2VBSA 2VBUA 1Q9SA 1T6ZA 5FO1A 2P3MA 5A89A 5FO0A 1T6YA 1T6XA 1MRZA 2VBVA 1N05A 1P4MA 5A88A 1NB0A 1N07A 3ZUGA 2VBTA 5FNZA 2X0KA 4UZEA 3BNWA 1N08A 1NB9A 2OYNA 2I1LA 3CTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UZF A;  1N06 A;  3OP1 A;  1S4M A;  5A8A A;  5TRD A;  2VBS A;  2VBU A;  1Q9S A;  1T6Z A;  5FO1 A;  2P3M A;  5A89 A;  5FO0 A;  1T6Y A;  1T6X A;  1MRZ A;  2VBV A;  1N05 A;  1P4M A;  5A88 A;  1NB0 A;  1N07 A;  3ZUG A;  2VBT A;  5FNZ A;  2X0K A;  4UZE A;  3BNW A;  1N08 A;  1NB9 A;  2OYN A;  2I1L A;  3CTA A; 
#chains in the Genus database with same CATH topology
 2Q6K A;  4P3Y A;  1QG0 A;  3WND A;  3SJZ A;  2R9V A;  4IW3 B;  2YWG A;  4RD1 A;  1BJK A;  3GVK A;  3FPP A;  5FA6 A;  3SKB A;  3CMA B;  4P2N A;  3AVW A;  3Q6R A;  5IYR A;  3RY8 A;  2V7V A;  4TN1 A;  4M1K A;  4XMY A;  5J35 A;  1QUF A;  1PKV A;  1UD6 A;  2JN9 A;  1T6X A;  4B48 A;  2ZZF A;  2XNC A;  3ZBT A;  4YAO A;  1ZUN B;  3MCA A;  4RDJ A;  1VQ4 B;  2GPJ A;  4QFM A;  1Q82 D;  4M2L A;  1W0K A;  3JU4 A;  1YIJ B;  1W34 A;  4P26 A;  4RM0 A;  4RD4 A;  1YIT B;  2C5H A;  1HVX A;  3MMP A;  2YWE A;  1ELO A;  4HE6 A;  3H94 A;  1QX4 A;  3KL9 A;  2RC6 A;  3W2E A;  1FND A;  3WNB A;  2DIE A;  3WYA A;  3CB4 A;  3VNU A;  4Y9R A;  2GJK A;  1TTT A;  2X85 A;  2RC5 A;  4XNF A;  2J7K A;  3AVV A;  4TSF A;  5IK2 A;  5FO0 A;  3WNC A;  5AN9 A;  1QH0 A;  4P3I A;  1EFT A;  2ZBU A;  2VNJ A;  3ZC3 A;  3CME B;  1BX1 A;  4DK0 A;  1P4M A;  4TMX A;  1NJI D;  1XFO A;  2JDI A;  3ZUG A;  5B6I A;  1PJ6 A;  3BQJ A;  2GQF A;  3LQE A;  4X05 A;  4II2 A;  4XKV A;  2E1B A;  3W2G A;  3AVY A;  4OOX A;  1NRK A;  2ZL7 A;  4YAW A;  2OYN A;  2VNK A;  4Z4R A;  4PC1 A;  1GJR A;  2LZJ A;  2XNJ A;  1VQP B;  2QTZ A;  4XLH A;  5KSW B;  2CF4 A;  2F1M A;  1FNC A;  2VBS A;  4YAF A;  3OEE A;  4DK1 A;  1IHM A;  1OB5 A;  2GK6 A;  4NCN A;  5BSY A;  3OJX A;  2ZTN A;  3QFR A;  1JA1 A;  1VJS A;  2D74 A;  1IJF A;  3FKS A;  3JQQ A;  2DER A;  3J81 k;  1KK3 A;  1FRQ A;  3A8K A;  3AGQ A;  1G7S A;  1XQB A;  2BM1 A;  2HMA A;  1K8A D;  1QGY A;  1ZM9 A;  1G7R A;  1Y0Y A;  5THX A;  4MYT A;  1XB2 A;  4QVJ A;  3ZIA A;  4TMT A;  1QFZ A;  2ZIT A;  1NBM A;  3W5V A;  4EH1 A;  5HZA A;  1R5B A;  2OBR A;  4B3X A;  3G6E B;  3GVL A;  4PGO A;  1AMO A;  1UD8 A;  4G6I A;  2V4D A;  3PVD A;  3ONY A;  1Q7Y D;  5GV8 A;  3ASQ A;  4TT3 A;  2CC2 A;  1QVG B;  2HCJ B;  1E3X A;  3A8I A;  4YEJ A;  3OW7 A;  1TVC A;  4Q7J B;  2DET A;  3R6J A;  4ZGN B;  4KKU A;  2R6H A;  2PMD A;  3PA1 A;  2VJI A;  3HAG A;  2OBT A;  4P6V F;  5HZB A;  3ZZ0 A;  5FNZ A;  3CRZ A;  2VZL A;  2FX3 A;  3U6K A;  5F4O A;  5IYP A;  1FX0 A;  3SJP A;  2WJY A;  2V7X A;  3W5H A;  4WQM A;  1WOP A;  5IYN A;  4HE5 A;  4U9U A;  2WZN A;  4UZF A;  4LBV A;  4X7E A;  2BMW A;  2VBU A;  1EXM A;  4XLC A;  2VNI A;  3SEJ A;  1GO2 A;  1W0J A;  4UZU A;  1V0F A;  5TY0 A;  2OTJ B;  2V7T A;  4N3N A;  3CC2 B;  4X06 A;  3CD6 B;  4RDL A;  2OBS A;  1T5E A;  1WP6 A;  3B82 A;  1UMK A;  1H42 A;  1HA3 A;  1N0V C;  1UD4 A;  1VQK B;  3W2H A;  2JJ2 A;  4XLE A;  4ACB A;  1VHO A;  1KQS B;  3CP2 A;  3NE5 B;  3OZU A;  2BGI A;  4LC0 A;  4Z4S A;  3W2F A;  1VQM B;  1FDR A;  2I1L A;  2B7B A;  4YEL A;  4RCZ A;  2OTL B;  1S0U A;  3FPK A;  4QV2 A;  1VQO B;  5TRD A;  3CP8 A;  3GVJ A;  1K28 D;  3ZPN A;  2BGJ A;  1QGZ A;  4Y7C A;  3I1F A;  1TLL A;  4MYU A;  2DYI A;  4XLF A;  5JBQ A;  3OW2 B;  4QHY A;  3KEW A;  1WOO A;  1GR1 A;  1UD5 A;  1EP2 B;  1UD2 A;  4E0F A;  2X6Y A;  1COW A;  1YJ9 B;  1FNB A;  3CMM A;  3Q38 A;  2M5S A;  1VQ6 B;  3BNW A;  4X8I A;  1OB0 A;  4X7D A;  2BN4 A;  1W35 A;  4HIZ A;  1KK0 A;  3CPW B;  1D8T A;  1K73 D;  3PUM A;  3AGP A;  4PAB A;  3VR6 A;  4H9G A;  2QE7 A;  3OP1 A;  1JA0 A;  1KTV A;  2XGJ A;  4M4S A;  2NV4 A;  2BM0 A;  2ZTG A;  3SLD A;  4LBW A;  1WU8 A;  4C0S A;  1I18 A;  1EFC A;  3OOC A;  1B23 P;  5TV2 A;  4X0C A;  2GJP A;  1VLY A;  1N05 A;  4N3G A;  4RJL A;  1VQ8 B;  1M1K D;  1NDH A;  3GSI A;  2B5O A;  4P9S A;  1WSV A;  2W6I A;  1A8P A;  2QMU A;  1W2B B;  4FN5 A;  3SLN A;  1KK1 A;  3CES A;  5FIU A;  4Z4T A;  2QA4 B;  4XOR A;  2V31 A;  1E64 A;  3QFT A;  4F7D A;  1ZM2 A;  2QN6 A;  1E1Q A;  2Q6I A;  4WZE A;  3PEN A;  4DNR B;  5KNL A;  5E6T A;  1N0U A;  2X6X A;  4OPS A;  1K9M D;  3OFN A;  3T56 B;  1OGI A;  3OZV A;  4XOP A;  2C2W A;  2ZXH A;  5FO1 A;  3WQZ A;  1W87 A;  1WOR A;  4Z1M A;  1GAW A;  3ASP A;  1WOS A;  3GQB A;  2PE3 A;  3MHP A;  1WSR A;  5LMZ A;  1VQ5 B;  2C77 A;  5IYW A;  1KK2 A;  1QUE A;  4X7F A;  1GVH A;  1H85 A;  2KVO A;  4B3G A;  1DDI A;  2FVG A;  3P27 A;  2V7U A;  4Y9U A;  4TMW A;  2WZP P;  1AIP A;  2ZZQ A;  4GQN A;  2F1L A;  3A3B A;  2YWF A;  5H59 A;  4WWV A;  2Q6O A;  3A35 A;  3CTA A;  4RLZ A;  2X8K A;  1PJ7 A;  1XE1 A;  2QEX B;  1JNY A;  1T6Z A;  4NNJ A;  1M90 D;  3ZZU A;  3CC4 B;  2F43 A;  2P3M A;  3CCJ B;  4XLA A;  3V76 A;  2VJJ A;  3ASS A;  2JIZ A;  1KJZ A;  3OEH A;  4ROX A;  2BVN A;  2ZZG A;  4G5G A;  3ASR A;  3CCR B;  2BV3 A;  2E1R A;  4RD6 A;  5HKK A;  4Z4W A;  3CCV B;  2C78 A;  4PC3 A;  1CQX A;  4Z4Z A;  2XZL A;  1JJ2 B;  3ZBU A;  1WTH D;  3Q39 A;  5DS0 A;  2X3U A;  4ZGQ B;  3JQP A;  2ZBV A;  1HZE A;  1EP3 B;  1KZL A;  2D9R A;  1VQ9 B;  5A8A A;  3DDY A;  1E62 A;  2ZL6 A;  3BCF A;  1Q86 D;  2EIX A;  2GK7 A;  3A1P A;  4TKO B;  3PUN A;  1N8R D;  4UAJ A;  1F60 A;  1KRH A;  2X6W A;  5IYQ A;  2CND A;  1GAQ A;  2XOK A;  4G1V A;  3U6B A;  5FL7 A;  1EFU A;  4CQJ A;  1BPL A;  3OE7 A;  1BQE A;  5CDF A;  1BLI A;  1F20 A;  1N08 A;  2XZP A;  3A8J A;  1CNE A;  1VQL B;  1NB9 A;  4Z4V A;  2DCU A;  3R6K A;  2EFG A;  3CXC B;  4FK8 A;  1UD3 A;  2D3N A;  1QFJ A;  1YJN B;  4J0Q A;  3LNN A;  1SKY B;  1V0E A;  2HDN B;  3VO2 A;  1D1N A;  3ISX A;  5F4M A;  5GV7 A;  4M53 A;  2WSS A;  1DG1 G;  4XM3 A;  4X7C A;  4B47 A;  2Z6B D;  4L8J A;  1YX2 A;  1T6Y A;  2PIA A;  2OK8 A;  4AF6 A;  2W6J A;  1V5V A;  2C5B A;  4OPV A;  4B44 A;  4WZT A;  3QFS A;  1FNM A;  1QGA A;  1VQN B;  3P26 A;  4C43 A;  4XON A;  3ONU A;  4B4D A;  4RPD A;  2ZXI A;  2QTL A;  2WYR A;  4AVZ A;  1DDG A;  3WY9 A;  4ACA A;  3D26 A;  5J3O A;  1QFY A;  4ZCM A;  1B2R A;  4TMV A;  3CCM B;  1JB9 A;  4AC9 A;  4XR6 A;  1SKQ A;  4QUZ A;  5A89 A;  4G7W A;  4X07 A;  1DAR A;  1G7C A;  4P1V A;  3CCE B;  2WR8 A;  1EWY A;  4XN0 A;  3I55 B;  3GIR A;  2NPF A;  3A3G A;  4XL9 A;  4YHB A;  5TR9 A;  1YHQ B;  1KD1 D;  3AVX A;  5DSZ A;  1YJW B;  2BSA A;  3CW2 A;  1Q81 D;  3OKX A;  1EFR A;  3Q6Q A;  1I7P A;  1TUI A;  4M0L A;  4G1B A;  1YLO A;  1VQ7 B;  4RD3 A;  1OHH A;  3LVB A;  3QSY A;  3WBK A;  1KMH A;  3G05 A;  2Q6L A;  3E1Y E;  3ES9 A;  3T53 B;  1WDT A;  4OOV A;  1OB2 A;  2C4T A;  3BC9 A;  3AST A;  1E63 A;  2WJV A;  3WXM A;  3VNV A;  2ZL5 A;  1CNF A;  3LQ6 A;  4XOT A;  4FXU A;  2VBV A;  1WPC A;  2OK7 A;  4B3F X;  1E3Z A;  1PJ5 A;  1KC8 D;  2AHO A;  2JJ1 A;  2VYQ A;  4KKS A;  5EMN A;  1FRN A;  2YWH A;  3CPX A;  2CRV A;  2PLF A;  3B78 A;  3E20 A;  4PAA A;  2C4U A;  4II3 A;  4QVA A;  1MAB A;  4XN3 A;  3VMF A;  3W2I A;  3OJW A;  3V7A A;  4G7X A;  1ZM3 A;  4P12 A;  2CBX A;  1OGJ A;  4TMZ A;  4WZL A;  4WZK A;  4P25 A;  1SM4 A;  2D3L A;  2XEX A;  2GRE A;  4XD7 A;  4RPB A;  1VF7 A;  2XND A;  3BCD A;  4RCY A;  4XQF A;  3H9N A;  1R5N A;  1MRZ A;  2WPD A;  2CK3 A;  1EP1 B;  5KW9 A;  5A88 A;  1NB0 A;  4YAL A;  2B7C A;  4ZV4 A;  2DY1 A;  4Z4U A;  4ZCI A;  4RDK A;  2ZZE A;  4OOS A;  1BX0 A;  3BY2 A;  4P22 A;  2X0K A;  4JMQ A;  4UZE A;  3VO1 A;  3T51 B;  3B8H A;  1ZM4 A;  5BSX A;  4ZCL A;  3CCS B;  3ZZT A;  2F4N A;  4OP7 A;  1Y0R A;  3OZW A;  4NBS A;  1N06 A;  1U2R A;  1S4M A;  2DEU A;  1S72 B;  3QE2 A;  3AVU A;  2XZO A;  2HLD A;  4PC7 A;  4ASU A;  3AVT A;  2VNH A;  1E1R A;  5DN6 A;  2BPO A;  4PC6 A;  1E79 A;  3FJO A;  1D2E A;  1N07 A;  1H8H A;  2VBT A;  4LBZ A;  4XKW A;  4AF7 A;  1J9Z A;  1VLO A;  2GJR A;  3Q3A A;  5F4J A;  3LO8 A;  3I56 B;  2CW5 A;  1R5O A;  3CCL B;  1W9X A;  3G4S B;  4OPO A;  5L46 A;  1H8E A;  2QDX A;  4LBY A;  4DNT B;  1RQR A;  4DQK A;  3BH4 A;  2V7W A;  3BY1 A;  1Q9S A;  2DOG A;  3PA2 A;  4RD2 A;  1G7T A;  3WBJ A;  4BPR A;  4FWT A;  3OPO A;  3G71 B;  4P6Y A;  3CCQ B;  1RQP A;  2X53 S;  3CC7 B;  4R71 A;  1QVF B;  3OAA A;  3JQR A;  2BF4 A;  1IJE A;  5HXB A;  3QFC A;  4PC2 A;  1VHE A;  5H5J A;  3U2Q A;  4RD0 A;  4B43 A;  1E43 A;  3W5U A;  1I8D A;  4K1X A;  4DQL A;  1BMF A;  1IB0 A;  2QGG A;  4YAU A;  2V7Q A;  3CCU B;  1YI2 B;  4YXW A;  4Z4Y A;  4KKT A; 
#chains in the Genus database with same CATH homology
 4UZF A;  1N06 A;  3OP1 A;  1S4M A;  5A8A A;  5TRD A;  2VBS A;  2VBU A;  1Q9S A;  1T6Z A;  5FO1 A;  2P3M A;  5A89 A;  5FO0 A;  1T6Y A;  1T6X A;  1MRZ A;  2VBV A;  1N05 A;  1P4M A;  5A88 A;  1NB0 A;  1N07 A;  3ZUG A;  2VBT A;  5FNZ A;  2X0K A;  4UZE A;  3BNW A;  1N08 A;  1NB9 A;  2OYN A;  2I1L A;  3CTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...