5A8AA

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with fmn and adp (p3 2 21)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
b'GRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
molecule tags Transferase
source organism Corynebacterium ammoniagenes
publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
total genus 35
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a8aA00
1NB9A 5A88A 2VBSA 3ZUGA 1N05A 4UZFA 1Q9SA 1MRZA 1N08A 3BNWA 5FO1A 1T6XA 2I1LA 5FNZA 2VBTA 2VBUA 1S4MA 1N06A 1N07A 5A8AA 1T6ZA 2OYNA 1T6YA 1NB0A 1P4MA 2VBVA 5FO0A 5TRDA 2X0KA 3OP1A 5A89A 3CTAA 4UZEA 2P3MA
chains in the Genus database with same CATH superfamily
2ZXIA 2Q6LA 3T53B 3AVTA 4M4SA 3SLDA 4XN3A 1FDRA 2HDNB 5FA6A 5JBQA 4UZUA 4LBVA 4K1XA 1ZM2A 2C2WA 2I1LA 4Y9RA 1UD4A 5HXBA 4XLEA 2QEXB 2QE7A 2W6JA 1N07A 4X7EA 3AVXA 3CPXA 4WZEA 4CQJA 2ZTNA 3FPKA 4G1VA 5E6TA 3W2HA 4QV2A 1P4MA 2X3UA 3BY2A 2CF4A 1BX1A 1BMFA 2OBRA 4B47A 1QGZA 3AGQA 4YAFA 4WWVA 3U6KA 1E64A 4QVAA 3W5HA 3ASRA 1BPLA 2F1MA 3QFTA 4KKSA 4OPOA 2X85A 1FNBA 2V7UA 4LBZA 4TT3A 4OOVA 3H94A 4TMXA 5FO1A 3SLNA 3OW2B 4HE6A 4ZGQB 1TVCA 5FNZA 4XLHA 1WP6A 1RQPA 3I55B 1EFTA 4RDKA 1PJ7A 4XL9A 2E1BA 3CCUB 1YHQB 2GK6A 1IJEA 3ZZ0A 3QFSA 4EH1A 2ZL7A 3ES9A 5IK2A 1AIPA 5KNLA 2D74A 3OP1A 4Y9UA 5KSWB 1Q7YD 1EWYA 2HMAA 2P3MA 1XQBA 2DCUA 3I1FA 4YAWA 1VF7A 4R71A 1K73D 1OB5A 1M1KD 1VQMB 3CRZA 3ONYA 1PKVA 1NJID 4AF7A 5BSXA 1KJZA 1WPCA 3ASQA 1GJRA 3VNUA 4NNJA 4LBWA 1GR1A 4B43A 1E63A 4GQNA 4WZKA 1UD8A 3A8JA 2YWGA 1CQXA 5IYWA 3P26A 3QFCA 1PJ6A 1KMHA 1DDIA 4Z4SA 3CMEB 1W2BB 2Z6BD 1S0UA 1QFZA 3A8IA 3KEWA 3KL9A 2V7XA 2C4UA 2VNKA 1UD2A 2JJ2A 4M53A 4TN1A 4TMVA 2OBTA 1OGJA 1UD3A 2JIZA 5A88A 4KKUA 3U2QA 1VQ7B 4II3A 1KRHA 1NDHA 2FX3A 4G6IA 2GPJA 3SKBA 3V7AA 5CDFA 5HKKA 2WZPP 1QFJA 1QH0A 1UMKA 4RD4A 5F4JA 1G7RA 3LQ6A 1VQOB 4DK1A 2CNDA 1VQ8B 5DS0A 2VNJA 3CCJB 3ZZUA 4B4DA 1QGAA 3OEHA 4RDJA 2XNDA 3OZVA 3PUMA 3W2FA 3Q38A 3G4SB 4PGOA 1WSRA 2B5OA 4X7DA 3CCSB 1YLOA 2ZXHA 4P2NA 1R5NA 1VQLB 4H9GA 3ZIAA 3ZBUA 1BLIA 1AMOA 2W6IA 1MRZA 1QVFB 2Q6OA 1W0KA 1WU8A 2PIAA 3WBKA 4AC9A 3FPPA 1VLYA 1QGYA 2FVGA 1A8PA 3OEEA 2X8KA 3JQRA 1EP2B 1N0VC 1NB0A 2R6HA 3T51B 2XOKA 4C43A 4OPSA 1VQ4B 3B78A 4TMWA 3T56B 2XZLA 2EFGA 1WOPA 4RJLA 4X06A 3CTAA 4UZEA 3G6EB 3ASTA 3ASPA 4TKOB 3LQEA 3E1YE 1WDTA 3A8KA 5AN9A 4ASUA 2ZL5A 4WQMA 1N0UA 1WTHD 3A3BA 5J35A 1ZM9A 1GO2A 5DSZA 1VQ6B 3SJZA 2WYRA 4YHBA 4Z4WA 2DY1A 2RC6A 2GQFA 2X53S 2X6YA 2J7KA 4XQFA 2YWHA 2BF4A 2VZLA 1E62A 2BPOA 2GJRA 2V7VA 3W5VA 2D3LA 2BGJA 2PE3A 4Z4TA 1YITB 2VYQA 2QA4B 4WZTA 2PMDA 3WNCA 4B3FX 3SEJA 4XOTA 3CP2A 3E20A 3LNNA 4X7CA 4C0SA 4YAOA 3A3GA 1IJFA 4YXWA 1VQKB 5GV8A 1Q86D 1BX0A 2WR8A 3P27A 3D26A 1OGIA 2B7BA 3U6BA 1E1QA 1N8RD 4FWTA 3W5UA 1YI2B 1QVGB 4ZV4A 2QTZA 2BVNA 4P25A 3GIRA 5LMZA 1G7TA 3RY8A 3VNVA 1DARA 1CNFA 3QFRA 4HIZA 1T6YA 1F60A 4TMZA 1KK1A 4LC0A 1Y0YA 5EMNA 4Z4YA 4UAJA 1IB0A 3V76A 2V4DA 4MYUA 2DETA 1G7CA 3HAGA 1RQRA 1H42A 3BCFA 4P12A 4U9UA 4YAUA 4RCYA 1W35A 2GJKA 4X7FA 4X05A 2OK7A 4G5GA 5FIUA 1E79A 1Q9SA 1YJWB 3WY9A 4AF6A 5HZBA 3CC7B 4RD6A 3VMFA 1CNEA 2XNJA 5IYRA 4ZCIA 3SJPA 1VLOA 2X6XA 3OZWA 2V7WA 3VO1A 1VQPB 3CCLB 4ACAA 1YIJB 1B23P 4B3XA 5TV2A 4Z4UA 3CW2A 5GV7A 3CC4B 4RM0A 5FL7A 3CCRB 2KVOA 2ZBVA 5TRDA 1H8EA 3OJXA 3A35A 1GVHA 5H59A 1VQNB 3BH4A 1JB9A 4P6VF 2QGGA 1Q81D 4TMTA 2JJ1A 1I8DA 3JU4A 2NPFA 2BM1A 3QE2A 3W2GA 1HVXA 3WBJA 1KTVA 5TY0A 3BY1A 1EFRA 4Z4ZA 1WSVA 1FRNA 4RCZA 1K9MD 3JQQA 4RD0A 4XD7A 1JA0A 4DQKA 5F4MA 1IHMA 2F4NA 2Q6IA 1OHHA 2VNHA 2C77A 3Q6QA 1QX4A 1W87A 2ZL6A 4B44A 1H85A 2E1RA 2VBUA 1S4MA 3OW7A 1WORA 5A8AA 3CXCB 2QDXA 1V5VA 2YWEA 1DDGA 3GQBA 4G1BA 1JNYA 2QN6A 2VJJA 2VBVA 4X8IA 2LZJA 4QFMA 2BSAA 5FO0A 2C78A 4RDLA 2DOGA 1Q82D 4PC3A 1V0EA 4P9SA 1HA3A 2V7QA 4PC1A 2WJYA 1KK0A 4AVZA 1NB9A 1WOSA 4XLCA 5F4OA 3CMMA 3CCMB 4FK8A 1XE1A 4PC6A 1J9ZA 3FKSA 1XB2A 4XOPA 1FNMA 4Z4RA 3AGPA 1G7SA 3B82A 3PA1A 1FRQA 1K8AD 4Q7JB 1T6ZA 2M5SA 3GVLA 2NV4A 3OFNA 4OOSA 2CK3A 3PUNA 1VHEA 1D1NA 4YALA 3NE5B 1SKQA 2Q6KA 1VJSA 3Q6RA 1NRKA 2GREA 4WZLA 1U2RA 2DEUA 5TR9A 2AHOA 3WXMA 4YELA 1KK2A 3CMAB 1QUEA 4II2A 3WQZA 2EIXA 4JMQA 1T6XA 2D3NA 3CCVB 4XR6A 1I18A 4P26A 1D2EA 2VBTA 1E3XA 2ZZEA 2R9VA 4QVJA 2XGJA 1V0FA 2OYNA 3OE7A 3PVDA 4XONA 3CCQB 2ZBUA 3CCEB 4QHYA 2CRVA 4RLZA 2CW5A 3R6KA 4XM3A 3MCAA 4YEJA 2HCJB 4PC2A 3CPWB 4N3NA 3B8HA 3Q3AA 2X6WA 3VR6A 1DG1G 1R5OA 2WJVA 4BPRA 5B6IA 1M90D 4P3IA 3OPOA 1ELOA 1FNDA 4RD1A 3OOCA 3ZUGA 3OJWA 4P6YA 3CESA 4E0FA 1GAWA 1N08A 3BNWA 4FXUA 1W0JA 3ZZTA 2F1LA 4HE5A 2B7CA 2GK7A 1GAQA 4XMYA 1EP1B 3LVBA 2ZZGA 4M1KA 1HZEA 1FX0A 2JN9A 2QTLA 3OAAA 2D9RA 4FN5A 2OTLB 5KW9A 1BJKA 3GVJA 2C5BA 1WOOA 1YJNB 2BM0A 3AVUA 2DYIA 1SKYB 4Z1MA 3AVWA 3MMPA 4G7XA 2JDIA 2OK8A 5THXA 1KQSB 1EP3B 3ISXA 1ZUNB 3FJOA 3PENA 5L46A 1E1RA 3BQJA 3WNDA 3AVYA 3JQPA 1B2RA 1R5BA 2VNIA 4XLAA 3I56B 1W9XA 1EFCA 4OOXA 4DNRB 1JJ2B 1T5EA 1QG0A 1SM4A 1YX2A 3VO2A 4B3GA 3ZPNA 4ACBA 3LO8A 5IYNA 3AVVA 2BN4A 4PC7A 1VQ5B 4RPBA 4XKVA 4QUZA 3A1PA 1JA1A 2PLFA 3ZBTA 2XZPA 4PABA 5BSYA 1VHOA 1XFOA 3MHPA 3PA2A 4XLFA 3J81k 4M2LA 1VQ9B 3DDYA 3CP8A 3OZUA 2VBSA 1EFUA 2C4TA 3GSIA 4MYTA 4DNTB 1D8TA 4X0CA 2VJIA 1YJ9B 3CD6B 1EXMA 1ZM4A 4ZCMA 1PJ5A 4NBSA 1KC8D 4ZCLA 2DERA 4XKWA 3WYAA 1ZM3A 3ONUA 1KK3A 4X07A 4B48A 4TSFA 4XORA 1I7PA 2CBXA 4OPVA 2WZNA 1Y0RA 4Y7CA 1COWA 1F20A 3W2EA 2DIEA 1TTTA 1NBMA 3CB4A 4RPDA 3ZC3A 1TLLA 1BQEA 1N05A 1OB2A 2YWFA 4DK0A 3BCDA 2WSSA 1UD5A 4LBYA 2WPDA 1S72B 5IYPA 4NCNA 2XNCA 4KKTA 1N06A 1QFYA 2ZTGA 4PAAA 4RD2A 1W34A 4XNFA 2ZZFA 3QSYA 4DQLA 3G71B 2RC5A 4M0LA 4ROXA 2OTJB 4N3GA 2V31A 3CC2B 1KD1D 1H8HA 1UD6A 2X0KA 1KZLA 3ASSA 1QUFA 5A89A 2F43A 2V7TA 1OB0A 5DN6A 5IYQA 3Q39A 2XEXA 2GJPA 1K28D 3GVKA 3H9NA 1TUIA 4UZFA 4Z4VA 2QMUA 2ZITA 1E3ZA 4F7DA 4ZGNB 4P3YA 1E43A 2BV3A 5J3OA 3BC9A 4G7WA 2BGIA 2ZZQA 4IW3B 3G05A 2C5HA 2BMWA 2HLDA 1FNCA 4L8JA 2XZOA 4XN0A 3WNBA 3R6JA 3W2IA 2CC2A 4RD3A 5HZAA 1MABA 4OP7A 5H5JA 4P22A 3OKXA 2OBSA 4P1VA 4J0QA
chains in the Genus database with same CATH topology
1NB9A 5A88A 2VBSA 3ZUGA 1N05A 4UZFA 1Q9SA 1MRZA 1N08A 3BNWA 5FO1A 1T6XA 2I1LA 5FNZA 2VBTA 2VBUA 1S4MA 1N06A 1N07A 5A8AA 1T6ZA 2OYNA 1T6YA 1NB0A 1P4MA 2VBVA 5FO0A 5TRDA 2X0KA 3OP1A 5A89A 3CTAA 4UZEA 2P3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB9 A;  5A88 A;  2VBS A;  3ZUG A;  1N05 A;  4UZF A;  1Q9S A;  1MRZ A;  1N08 A;  3BNW A;  5FO1 A;  1T6X A;  2I1L A;  5FNZ A;  2VBT A;  2VBU A;  1S4M A;  1N06 A;  1N07 A;  5A8A A;  1T6Z A;  2OYN A;  1T6Y A;  1NB0 A;  1P4M A;  2VBV A;  5FO0 A;  5TRD A;  2X0K A;  3OP1 A;  5A89 A;  3CTA A;  4UZE A;  2P3M A; 
#chains in the Genus database with same CATH topology
 2ZXI A;  2Q6L A;  3T53 B;  3AVT A;  4M4S A;  3SLD A;  4XN3 A;  1FDR A;  2HDN B;  5FA6 A;  5JBQ A;  4UZU A;  4LBV A;  4K1X A;  1ZM2 A;  2C2W A;  2I1L A;  4Y9R A;  1UD4 A;  5HXB A;  4XLE A;  2QEX B;  2QE7 A;  2W6J A;  1N07 A;  4X7E A;  3AVX A;  3CPX A;  4WZE A;  4CQJ A;  2ZTN A;  3FPK A;  4G1V A;  5E6T A;  3W2H A;  4QV2 A;  1P4M A;  2X3U A;  3BY2 A;  2CF4 A;  1BX1 A;  1BMF A;  2OBR A;  4B47 A;  1QGZ A;  3AGQ A;  4YAF A;  4WWV A;  3U6K A;  1E64 A;  4QVA A;  3W5H A;  3ASR A;  1BPL A;  2F1M A;  3QFT A;  4KKS A;  4OPO A;  2X85 A;  1FNB A;  2V7U A;  4LBZ A;  4TT3 A;  4OOV A;  3H94 A;  4TMX A;  5FO1 A;  3SLN A;  3OW2 B;  4HE6 A;  4ZGQ B;  1TVC A;  5FNZ A;  4XLH A;  1WP6 A;  1RQP A;  3I55 B;  1EFT A;  4RDK A;  1PJ7 A;  4XL9 A;  2E1B A;  3CCU B;  1YHQ B;  2GK6 A;  1IJE A;  3ZZ0 A;  3QFS A;  4EH1 A;  2ZL7 A;  3ES9 A;  5IK2 A;  1AIP A;  5KNL A;  2D74 A;  3OP1 A;  4Y9U A;  5KSW B;  1Q7Y D;  1EWY A;  2HMA A;  2P3M A;  1XQB A;  2DCU A;  3I1F A;  4YAW A;  1VF7 A;  4R71 A;  1K73 D;  1OB5 A;  1M1K D;  1VQM B;  3CRZ A;  3ONY A;  1PKV A;  1NJI D;  4AF7 A;  5BSX A;  1KJZ A;  1WPC A;  3ASQ A;  1GJR A;  3VNU A;  4NNJ A;  4LBW A;  1GR1 A;  4B43 A;  1E63 A;  4GQN A;  4WZK A;  1UD8 A;  3A8J A;  2YWG A;  1CQX A;  5IYW A;  3P26 A;  3QFC A;  1PJ6 A;  1KMH A;  1DDI A;  4Z4S A;  3CME B;  1W2B B;  2Z6B D;  1S0U A;  1QFZ A;  3A8I A;  3KEW A;  3KL9 A;  2V7X A;  2C4U A;  2VNK A;  1UD2 A;  2JJ2 A;  4M53 A;  4TN1 A;  4TMV A;  2OBT A;  1OGJ A;  1UD3 A;  2JIZ A;  5A88 A;  4KKU A;  3U2Q A;  1VQ7 B;  4II3 A;  1KRH A;  1NDH A;  2FX3 A;  4G6I A;  2GPJ A;  3SKB A;  3V7A A;  5CDF A;  5HKK A;  2WZP P;  1QFJ A;  1QH0 A;  1UMK A;  4RD4 A;  5F4J A;  1G7R A;  3LQ6 A;  1VQO B;  4DK1 A;  2CND A;  1VQ8 B;  5DS0 A;  2VNJ A;  3CCJ B;  3ZZU A;  4B4D A;  1QGA A;  3OEH A;  4RDJ A;  2XND A;  3OZV A;  3PUM A;  3W2F A;  3Q38 A;  3G4S B;  4PGO A;  1WSR A;  2B5O A;  4X7D A;  3CCS B;  1YLO A;  2ZXH A;  4P2N A;  1R5N A;  1VQL B;  4H9G A;  3ZIA A;  3ZBU A;  1BLI A;  1AMO A;  2W6I A;  1MRZ A;  1QVF B;  2Q6O A;  1W0K A;  1WU8 A;  2PIA A;  3WBK A;  4AC9 A;  3FPP A;  1VLY A;  1QGY A;  2FVG A;  1A8P A;  3OEE A;  2X8K A;  3JQR A;  1EP2 B;  1N0V C;  1NB0 A;  2R6H A;  3T51 B;  2XOK A;  4C43 A;  4OPS A;  1VQ4 B;  3B78 A;  4TMW A;  3T56 B;  2XZL A;  2EFG A;  1WOP A;  4RJL A;  4X06 A;  3CTA A;  4UZE A;  3G6E B;  3AST A;  3ASP A;  4TKO B;  3LQE A;  3E1Y E;  1WDT A;  3A8K A;  5AN9 A;  4ASU A;  2ZL5 A;  4WQM A;  1N0U A;  1WTH D;  3A3B A;  5J35 A;  1ZM9 A;  1GO2 A;  5DSZ A;  1VQ6 B;  3SJZ A;  2WYR A;  4YHB A;  4Z4W A;  2DY1 A;  2RC6 A;  2GQF A;  2X53 S;  2X6Y A;  2J7K A;  4XQF A;  2YWH A;  2BF4 A;  2VZL A;  1E62 A;  2BPO A;  2GJR A;  2V7V A;  3W5V A;  2D3L A;  2BGJ A;  2PE3 A;  4Z4T A;  1YIT B;  2VYQ A;  2QA4 B;  4WZT A;  2PMD A;  3WNC A;  4B3F X;  3SEJ A;  4XOT A;  3CP2 A;  3E20 A;  3LNN A;  4X7C A;  4C0S A;  4YAO A;  3A3G A;  1IJF A;  4YXW A;  1VQK B;  5GV8 A;  1Q86 D;  1BX0 A;  2WR8 A;  3P27 A;  3D26 A;  1OGI A;  2B7B A;  3U6B A;  1E1Q A;  1N8R D;  4FWT A;  3W5U A;  1YI2 B;  1QVG B;  4ZV4 A;  2QTZ A;  2BVN A;  4P25 A;  3GIR A;  5LMZ A;  1G7T A;  3RY8 A;  3VNV A;  1DAR A;  1CNF A;  3QFR A;  4HIZ A;  1T6Y A;  1F60 A;  4TMZ A;  1KK1 A;  4LC0 A;  1Y0Y A;  5EMN A;  4Z4Y A;  4UAJ A;  1IB0 A;  3V76 A;  2V4D A;  4MYU A;  2DET A;  1G7C A;  3HAG A;  1RQR A;  1H42 A;  3BCF A;  4P12 A;  4U9U A;  4YAU A;  4RCY A;  1W35 A;  2GJK A;  4X7F A;  4X05 A;  2OK7 A;  4G5G A;  5FIU A;  1E79 A;  1Q9S A;  1YJW B;  3WY9 A;  4AF6 A;  5HZB A;  3CC7 B;  4RD6 A;  3VMF A;  1CNE A;  2XNJ A;  5IYR A;  4ZCI A;  3SJP A;  1VLO A;  2X6X A;  3OZW A;  2V7W A;  3VO1 A;  1VQP B;  3CCL B;  4ACA A;  1YIJ B;  1B23 P;  4B3X A;  5TV2 A;  4Z4U A;  3CW2 A;  5GV7 A;  3CC4 B;  4RM0 A;  5FL7 A;  3CCR B;  2KVO A;  2ZBV A;  5TRD A;  1H8E A;  3OJX A;  3A35 A;  1GVH A;  5H59 A;  1VQN B;  3BH4 A;  1JB9 A;  4P6V F;  2QGG A;  1Q81 D;  4TMT A;  2JJ1 A;  1I8D A;  3JU4 A;  2NPF A;  2BM1 A;  3QE2 A;  3W2G A;  1HVX A;  3WBJ A;  1KTV A;  5TY0 A;  3BY1 A;  1EFR A;  4Z4Z A;  1WSV A;  1FRN A;  4RCZ A;  1K9M D;  3JQQ A;  4RD0 A;  4XD7 A;  1JA0 A;  4DQK A;  5F4M A;  1IHM A;  2F4N A;  2Q6I A;  1OHH A;  2VNH A;  2C77 A;  3Q6Q A;  1QX4 A;  1W87 A;  2ZL6 A;  4B44 A;  1H85 A;  2E1R A;  2VBU A;  1S4M A;  3OW7 A;  1WOR A;  5A8A A;  3CXC B;  2QDX A;  1V5V A;  2YWE A;  1DDG A;  3GQB A;  4G1B A;  1JNY A;  2QN6 A;  2VJJ A;  2VBV A;  4X8I A;  2LZJ A;  4QFM A;  2BSA A;  5FO0 A;  2C78 A;  4RDL A;  2DOG A;  1Q82 D;  4PC3 A;  1V0E A;  4P9S A;  1HA3 A;  2V7Q A;  4PC1 A;  2WJY A;  1KK0 A;  4AVZ A;  1NB9 A;  1WOS A;  4XLC A;  5F4O A;  3CMM A;  3CCM B;  4FK8 A;  1XE1 A;  4PC6 A;  1J9Z A;  3FKS A;  1XB2 A;  4XOP A;  1FNM A;  4Z4R A;  3AGP A;  1G7S A;  3B82 A;  3PA1 A;  1FRQ A;  1K8A D;  4Q7J B;  1T6Z A;  2M5S A;  3GVL A;  2NV4 A;  3OFN A;  4OOS A;  2CK3 A;  3PUN A;  1VHE A;  1D1N A;  4YAL A;  3NE5 B;  1SKQ A;  2Q6K A;  1VJS A;  3Q6R A;  1NRK A;  2GRE A;  4WZL A;  1U2R A;  2DEU A;  5TR9 A;  2AHO A;  3WXM A;  4YEL A;  1KK2 A;  3CMA B;  1QUE A;  4II2 A;  3WQZ A;  2EIX A;  4JMQ A;  1T6X A;  2D3N A;  3CCV B;  4XR6 A;  1I18 A;  4P26 A;  1D2E A;  2VBT A;  1E3X A;  2ZZE A;  2R9V A;  4QVJ A;  2XGJ A;  1V0F A;  2OYN A;  3OE7 A;  3PVD A;  4XON A;  3CCQ B;  2ZBU A;  3CCE B;  4QHY A;  2CRV A;  4RLZ A;  2CW5 A;  3R6K A;  4XM3 A;  3MCA A;  4YEJ A;  2HCJ B;  4PC2 A;  3CPW B;  4N3N A;  3B8H A;  3Q3A A;  2X6W A;  3VR6 A;  1DG1 G;  1R5O A;  2WJV A;  4BPR A;  5B6I A;  1M90 D;  4P3I A;  3OPO A;  1ELO A;  1FND A;  4RD1 A;  3OOC A;  3ZUG A;  3OJW A;  4P6Y A;  3CES A;  4E0F A;  1GAW A;  1N08 A;  3BNW A;  4FXU A;  1W0J A;  3ZZT A;  2F1L A;  4HE5 A;  2B7C A;  2GK7 A;  1GAQ A;  4XMY A;  1EP1 B;  3LVB A;  2ZZG A;  4M1K A;  1HZE A;  1FX0 A;  2JN9 A;  2QTL A;  3OAA A;  2D9R A;  4FN5 A;  2OTL B;  5KW9 A;  1BJK A;  3GVJ A;  2C5B A;  1WOO A;  1YJN B;  2BM0 A;  3AVU A;  2DYI A;  1SKY B;  4Z1M A;  3AVW A;  3MMP A;  4G7X A;  2JDI A;  2OK8 A;  5THX A;  1KQS B;  1EP3 B;  3ISX A;  1ZUN B;  3FJO A;  3PEN A;  5L46 A;  1E1R A;  3BQJ A;  3WND A;  3AVY A;  3JQP A;  1B2R A;  1R5B A;  2VNI A;  4XLA A;  3I56 B;  1W9X A;  1EFC A;  4OOX A;  4DNR B;  1JJ2 B;  1T5E A;  1QG0 A;  1SM4 A;  1YX2 A;  3VO2 A;  4B3G A;  3ZPN A;  4ACB A;  3LO8 A;  5IYN A;  3AVV A;  2BN4 A;  4PC7 A;  1VQ5 B;  4RPB A;  4XKV A;  4QUZ A;  3A1P A;  1JA1 A;  2PLF A;  3ZBT A;  2XZP A;  4PAB A;  5BSY A;  1VHO A;  1XFO A;  3MHP A;  3PA2 A;  4XLF A;  3J81 k;  4M2L A;  1VQ9 B;  3DDY A;  3CP8 A;  3OZU A;  2VBS A;  1EFU A;  2C4T A;  3GSI A;  4MYT A;  4DNT B;  1D8T A;  4X0C A;  2VJI A;  1YJ9 B;  3CD6 B;  1EXM A;  1ZM4 A;  4ZCM A;  1PJ5 A;  4NBS A;  1KC8 D;  4ZCL A;  2DER A;  4XKW A;  3WYA A;  1ZM3 A;  3ONU A;  1KK3 A;  4X07 A;  4B48 A;  4TSF A;  4XOR A;  1I7P A;  2CBX A;  4OPV A;  2WZN A;  1Y0R A;  4Y7C A;  1COW A;  1F20 A;  3W2E A;  2DIE A;  1TTT A;  1NBM A;  3CB4 A;  4RPD A;  3ZC3 A;  1TLL A;  1BQE A;  1N05 A;  1OB2 A;  2YWF A;  4DK0 A;  3BCD A;  2WSS A;  1UD5 A;  4LBY A;  2WPD A;  1S72 B;  5IYP A;  4NCN A;  2XNC A;  4KKT A;  1N06 A;  1QFY A;  2ZTG A;  4PAA A;  4RD2 A;  1W34 A;  4XNF A;  2ZZF A;  3QSY A;  4DQL A;  3G71 B;  2RC5 A;  4M0L A;  4ROX A;  2OTJ B;  4N3G A;  2V31 A;  3CC2 B;  1KD1 D;  1H8H A;  1UD6 A;  2X0K A;  1KZL A;  3ASS A;  1QUF A;  5A89 A;  2F43 A;  2V7T A;  1OB0 A;  5DN6 A;  5IYQ A;  3Q39 A;  2XEX A;  2GJP A;  1K28 D;  3GVK A;  3H9N A;  1TUI A;  4UZF A;  4Z4V A;  2QMU A;  2ZIT A;  1E3Z A;  4F7D A;  4ZGN B;  4P3Y A;  1E43 A;  2BV3 A;  5J3O A;  3BC9 A;  4G7W A;  2BGI A;  2ZZQ A;  4IW3 B;  3G05 A;  2C5H A;  2BMW A;  2HLD A;  1FNC A;  4L8J A;  2XZO A;  4XN0 A;  3WNB A;  3R6J A;  3W2I A;  2CC2 A;  4RD3 A;  5HZA A;  1MAB A;  4OP7 A;  5H5J A;  4P22 A;  3OKX A;  2OBS A;  4P1V A;  4J0Q A; 
#chains in the Genus database with same CATH homology
 1NB9 A;  5A88 A;  2VBS A;  3ZUG A;  1N05 A;  4UZF A;  1Q9S A;  1MRZ A;  1N08 A;  3BNW A;  5FO1 A;  1T6X A;  2I1L A;  5FNZ A;  2VBT A;  2VBU A;  1S4M A;  1N06 A;  1N07 A;  5A8A A;  1T6Z A;  2OYN A;  1T6Y A;  1NB0 A;  1P4M A;  2VBV A;  5FO0 A;  5TRD A;  2X0K A;  3OP1 A;  5A89 A;  3CTA A;  4UZE A;  2P3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...