5A8AA

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with fmn and adp (p3 2 21)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
GRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
total genus 35
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a8aA00
1S4MA 5FO0A 1Q9SA 2VBVA 4UZFA 1NB0A 3BNWA 1T6ZA 5A89A 5A88A 1N08A 3ZUGA 1N05A 1N07A 1MRZA 5FO1A 2P3MA 2OYNA 2VBSA 1P4MA 2X0KA 2VBTA 1NB9A 2VBUA 5TRDA 3CTAA 2I1LA 5FNZA 3OP1A 1N06A 1T6XA 1T6YA 5A8AA 4UZEA
chains in the Genus database with same CATH superfamily
3BY1A 4KKTA 4XL9A 2D3NA 1U2RA 2ZL7A 4IW3B 4WZKA 1EFCA 1PJ7A 1NRKA 1VF7A 4H9GA 2WZPP 5AN9A 2WR8A 1FNDA 3P27A 1FNCA 1V0FA 3OEHA 4P9SA 4RDKA 3A8JA 4RPDA 2BSAA 2D3LA 3AVYA 3ASPA 2XEXA 3CP2A 4LBYA 5JBQA 3G6EB 1QFYA 3WNBA 4DK0A 3CMEB 4GQNA 2GK7A 1S0UA 5KNLA 1E64A 2ZITA 5A8AA 3PENA 4UAJA 4F7DA 4ZV4A 4YAUA 2X6WA 3E20A 2V7VA 3Q38A 1ZM3A 4TN1A 4TSFA 2FX3A 1EFTA 1VQNB 2C5HA 1N8RD 2QE7A 1JJ2B 3QFSA 4WZEA 1IB0A 3OEEA 2DEUA 2QN6A 5F4MA 1KMHA 3W5UA 2M5SA 3E1YE 3ASQA 1TUIA 2WJYA 4P3YA 1RQPA 4XOTA 1ZM2A 3R6JA 1BPLA 2DIEA 2C4TA 3Q3AA 4M2LA 1TLLA 1BLIA 1EFUA 4DQKA 1H85A 2CW5A 4PABA 4DNTB 4B3XA 1KZLA 1T6ZA 4Z1MA 2ZBUA 1BX1A 3T56B 3ONUA 3OPOA 4XORA 3CD6B 4B43A 3I55B 3VMFA 2BN4A 2BM1A 4N3GA 4YALA 3BH4A 2PMDA 3G71B 1E43A 2X0KA 1E3ZA 1JNYA 3BC9A 3VR6A 3A8IA 4QUZA 3CCUB 4OOVA 2B7BA 5LMZA 3AGPA 5BSYA 1HVXA 1VQOB 2XGJA 3PA1A 3ZPNA 4RD1A 3CW2A 1S72B 1NB0A 2WSSA 4NNJA 1KK3A 1NJID 2VNHA 1FNMA 1DARA 4RD0A 3W2GA 2GK6A 1N07A 3FPPA 3OAAA 1K28D 4XN0A 4C43A 1WP6A 4X07A 5L46A 2XZLA 2BPOA 1FRNA 2XNJA 4E0FA 4ZGNB 1D2EA 3OOCA 4RD3A 2BV3A 2X8KA 3WBKA 3A35A 2VNKA 4WQMA 3Q6RA 3SJZA 1IJFA 4WZLA 1BMFA 2V7UA 3CTAA 2JIZA 2V31A 2VNIA 4P22A 1R5BA 1R5OA 4G1BA 4LC0A 2B7CA 2OK7A 5IYQA 1M90D 2GPJA 3ZBUA 3OJXA 3PA2A 1WU8A 1YX2A 2QTLA 2RC6A 1PKVA 4G6IA 4X7EA 4MYTA 4P6YA 5CDFA 1EXMA 4PGOA 1I8DA 1KK1A 2CNDA 1KD1D 2BF4A 3AVVA 4B47A 3JQRA 1Q7YD 4NCNA 1J9ZA 2B5OA 3SLDA 3ZIAA 2BMWA 5TY0A 5BSXA 4Z4UA 5B6IA 1QGZA 4YELA 1OB2A 1I18A 4HE5A 5DN6A 1VLYA 2WZNA 2E1BA 4X0CA 4YAFA 3OP1A 1PJ6A 2X3UA 2VNJA 3J81k 4RD6A 2VYQA 2NPFA 3U6KA 3A3BA 1VQKB 1K8AD 1UD3A 1B2RA 1GR1A 1GVHA 2CC2A 2OYNA 3DDYA 4X8IA 4AC9A 1YJNB 1P4MA 3ES9A 4ACBA 4PC6A 2X6XA 4ZCIA 1EP1B 1ZM4A 3I1FA 2ZXHA 4X7CA 2VBTA 4II3A 2VBUA 4Z4VA 1Y0YA 1VQMB 4RPBA 3ZZ0A 4TKOB 4AF7A 2XZOA 1E1RA 4N3NA 3CCEB 4CQJA 1GAQA 1YLOA 3ISXA 4RCYA 2ZZGA 1WDTA 1IJEA 2J7KA 2NV4A 3ASSA 3CC7B 3GSIA 4XMYA 3W5VA 3CC4B 4P2NA 4Z4TA 1N08A 4LBZA 2LZJA 3V7AA 4M4SA 3KEWA 3ZUGA 2JJ2A 1XB2A 3FPKA 1EWYA 2OK8A 3OJWA 4DQLA 3OZWA 4II2A 5DSZA 3PVDA 1QGYA 3G05A 1DDGA 3ZC3A 3OZUA 4R71A 1SKQA 1MABA 3LVBA 3OE7A 3PUNA 4RD4A 3ZBTA 4B3GA 1G7CA 4XQFA 4HE6A 1KQSB 1F60A 2E1RA 4AVZA 3AVXA 1VQ5B 2WYRA 3LQEA 1VQ9B 1QVFB 1ELOA 1CQXA 3WXMA 4QVJA 1N0VC 1ZUNB 5IYRA 4EH1A 4WZTA 1FDRA 3SEJA 2XNDA 1NBMA 5A89A 3GQBA 2EFGA 4XR6A 1JA0A 3WNDA 2ZL5A 4X05A 3CESA 2XNCA 3FJOA 1BX0A 2VBSA 4FWTA 1OGJA 4XLHA 4TMZA 1QX4A 4ROXA 3CB4A 4B4DA 2ZZFA 5FA6A 3D26A 4XLEA 4B48A 1AIPA 2WJVA 4PC2A 2W6JA 2QGGA 1JA1A 1NDHA 2OBTA 3CP8A 3LQ6A 3QE2A 5IK2A 4WWVA 3RY8A 4YEJA 5HZAA 1DDIA 3ASTA 2JJ1A 2X53S 1UD2A 2JDIA 4PC3A 4RDJA 4UZFA 1VQ4B 3GVKA 3LO8A 5A88A 1R5NA 3MCAA 4QVAA 2V7XA 1W0JA 4OOXA 1MRZA 1D8TA 2V4DA 1QG0A 4G7XA 3P26A 4X06A 4ZCMA 1QH0A 4DNRB 3JQPA 2CF4A 3A3GA 3CCLB 2CBXA 4RLZA 4OPSA 4L8JA 4P3IA 3H94A 4TMTA 1G7SA 3A1PA 4OOSA 5E6TA 3AVUA 3GVJA 1IHMA 1HZEA 1WOPA 1NB9A 3B78A 2ZXIA 4XKWA 4DK1A 2HDNB 2I1LA 3OW7A 3VNUA 1SKYB 2Q6LA 4YAWA 2DCUA 3W2HA 1VQ6B 5GV7A 3VO1A 3CCVB 2Q6KA 1WORA 4XLFA 2ZBVA 2QEXB 3CCQB 2ZZQA 3CCMB 1FRQA 4JMQA 4XM3A 5TV2A 1K73D 1WPCA 1W87A 4KKSA 4QV2A 3CC2B 3OW2B 3AVWA 4ACAA 2AHOA 3I56B 2XOKA 2CRVA 4B3FX 1UD5A 2C77A 4Z4ZA 4K1XA 3B8HA 4J0QA 1VHEA 3BY2A 4PAAA 2PIAA 4TT3A 1OB5A 1RQRA 1F20A 5TR9A 4YAOA 1UD6A 1OB0A 1SM4A 3B82A 2WPDA 4M53A 2V7WA 2HCJB 1ZM9A 5TRDA 1GO2A 1T5EA 3CPXA 1VQ7B 1BQEA 1M1KD 3WBJA 2YWGA 1VLOA 1E62A 1N0UA 1QVGB 3BNWA 2C4UA 1YITB 1G7TA 2ZZEA 4ZCLA 1W0KA 3QSYA 1WOSA 2YWFA 3NE5B 2VJJA 4U9UA 1COWA 2Z6BD 3CPWB 1QUFA 4PC7A 3QFTA 1H8EA 1TTTA 3QFCA 4XOPA 4ASUA 4LBVA 2F1MA 3LNNA 4P6VF 4TMXA 3FKSA 4P12A 1W34A 2OBRA 2PLFA 2EIXA 1W9XA 5FNZA 1KK0A 3AVTA 3KL9A 4XN3A 1XE1A 1GAWA 2GJRA 1GJRA 5H5JA 3V76A 2BGJA 3BCFA 2GQFA 1UD4A 2W6IA 4OPVA 5FO1A 3WQZA 3H9NA 1EP3B 4P1VA 3OZVA 2QTZA 1YI2B 4YHBA 3GVLA 2HLDA 3SLNA 4ZGQB 3PUMA 3MHPA 1WSRA 4B44A 1W35A 5FIUA 1CNEA 5DS0A 1KK2A 4Y7CA 3ZZTA 4YXWA 5EMNA 2V7TA 4PC1A 4RM0A 1Q9SA 2R9VA 5HZBA 4QFMA 1FX0A 3MMPA 4Z4RA 3VO2A 1N05A 2F4NA 4XONA 1VJSA 4P26A 3CCJB 1XQBA 1H42A 2R6HA 4XD7A 3T51B 3W5HA 4G1VA 4OP7A 3CMAB 3BQJA 4XLCA 3WNCA 1WSVA 4G5GA 2KVOA 3WYAA 1QFZA 4AF6A 4LBWA 4M1KA 2DETA 3G4SB 4C0SA 2C2WA 2YWHA 1N06A 1T6XA 1WOOA 2GREA 4FN5A 4RD2A 5FO0A 1UMKA 1E1QA 2VZLA 1BJKA 2PE3A 3OKXA 1G7RA 5KW9A 1XFOA 3U2QA 5THXA 5FL7A 3Q39A 4OPOA 1QFJA 2VJIA 1H8HA 3CRZA 2OTJB 4G7WA 2FVGA 2QDXA 1KJZA 2X6YA 1VQ8B 1UD8A 3AGQA 3JQQA 3JU4A 3QFRA 5GV8A 1A8PA 3CMMA 2X85A 4X7DA 2C5BA 2QMUA 1YJWB 1FNBA 1Q82D 3GIRA 1JB9A 2BVNA 2Q6OA 3T53B 2RC5A 4XLAA 5HKKA 3ZZUA 2BM0A 4P25A 3W2EA 3VNVA 4XNFA 5IYWA 5H59A 5F4OA 3HAGA 1T6YA 5IYPA 1YHQB 4RJLA 4UZEA 4Z4YA 2GJPA 2DOGA 2VBVA 4RDLA 1W2BB 2DYIA 5HXBA 1YJ9B 4FXUA 3R6KA 3U6BA 1HA3A 4BPRA 1Q86D 3ASRA 3BCDA 2D74A 2OBSA 2DY1A 4KKUA 2P3MA 2BGIA 4Y9RA 4FK8A 4NBSA 1I7PA 4XKVA 5F4JA 1V0EA 3Q6QA 4QHYA 5IYNA 1E3XA 1VQPB 1YIJB 4M0LA 4X7FA 1E79A 3CCRB 1V5VA 4Y9UA 1KC8D 4MYUA 3CXCB 4UZUA 1D1NA 3SKBA 1Q81D 1VQLB 2QA4B 4TMWA 2HMAA 1S4MA 1K9MD 3W2IA 2ZL6A 1QGAA 4Z4SA 2DERA 1PJ5A 2CK3A 2D9RA 1AMOA 2XZPA 1VHOA 2GJKA 1QUEA 1EP2B 1TVCA 1Y0RA 4TMVA 3W2FA 2F1LA 1KRHA 1KTVA 2JN9A 5KSWB 2C78A 1EFRA 2F43A 5J35A 1CNFA 5J3OA 1OGIA 2V7QA 1OHHA 2Q6IA 4HIZA 1B23P 3A8KA 3WY9A 1E63A 4Q7JB 2OTLB 1WTHD 1DG1G 2ZTNA 2YWEA 3ONYA 4RCZA 3SJPA 3CCSB 2ZTGA 3OFNA 4Z4WA
chains in the Genus database with same CATH topology
1S4MA 5FO0A 1Q9SA 2VBVA 4UZFA 1NB0A 3BNWA 1T6ZA 5A89A 5A88A 1N08A 3ZUGA 1N05A 1N07A 1MRZA 5FO1A 2P3MA 2OYNA 2VBSA 1P4MA 2X0KA 2VBTA 1NB9A 2VBUA 5TRDA 3CTAA 2I1LA 5FNZA 3OP1A 1N06A 1T6XA 1T6YA 5A8AA 4UZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4M A;  5FO0 A;  1Q9S A;  2VBV A;  4UZF A;  1NB0 A;  3BNW A;  1T6Z A;  5A89 A;  5A88 A;  1N08 A;  3ZUG A;  1N05 A;  1N07 A;  1MRZ A;  5FO1 A;  2P3M A;  2OYN A;  2VBS A;  1P4M A;  2X0K A;  2VBT A;  1NB9 A;  2VBU A;  5TRD A;  3CTA A;  2I1L A;  5FNZ A;  3OP1 A;  1N06 A;  1T6X A;  1T6Y A;  5A8A A;  4UZE A; 
#chains in the Genus database with same CATH topology
 3BY1 A;  4KKT A;  4XL9 A;  2D3N A;  1U2R A;  2ZL7 A;  4IW3 B;  4WZK A;  1EFC A;  1PJ7 A;  1NRK A;  1VF7 A;  4H9G A;  2WZP P;  5AN9 A;  2WR8 A;  1FND A;  3P27 A;  1FNC A;  1V0F A;  3OEH A;  4P9S A;  4RDK A;  3A8J A;  4RPD A;  2BSA A;  2D3L A;  3AVY A;  3ASP A;  2XEX A;  3CP2 A;  4LBY A;  5JBQ A;  3G6E B;  1QFY A;  3WNB A;  4DK0 A;  3CME B;  4GQN A;  2GK7 A;  1S0U A;  5KNL A;  1E64 A;  2ZIT A;  5A8A A;  3PEN A;  4UAJ A;  4F7D A;  4ZV4 A;  4YAU A;  2X6W A;  3E20 A;  2V7V A;  3Q38 A;  1ZM3 A;  4TN1 A;  4TSF A;  2FX3 A;  1EFT A;  1VQN B;  2C5H A;  1N8R D;  2QE7 A;  1JJ2 B;  3QFS A;  4WZE A;  1IB0 A;  3OEE A;  2DEU A;  2QN6 A;  5F4M A;  1KMH A;  3W5U A;  2M5S A;  3E1Y E;  3ASQ A;  1TUI A;  2WJY A;  4P3Y A;  1RQP A;  4XOT A;  1ZM2 A;  3R6J A;  1BPL A;  2DIE A;  2C4T A;  3Q3A A;  4M2L A;  1TLL A;  1BLI A;  1EFU A;  4DQK A;  1H85 A;  2CW5 A;  4PAB A;  4DNT B;  4B3X A;  1KZL A;  1T6Z A;  4Z1M A;  2ZBU A;  1BX1 A;  3T56 B;  3ONU A;  3OPO A;  4XOR A;  3CD6 B;  4B43 A;  3I55 B;  3VMF A;  2BN4 A;  2BM1 A;  4N3G A;  4YAL A;  3BH4 A;  2PMD A;  3G71 B;  1E43 A;  2X0K A;  1E3Z A;  1JNY A;  3BC9 A;  3VR6 A;  3A8I A;  4QUZ A;  3CCU B;  4OOV A;  2B7B A;  5LMZ A;  3AGP A;  5BSY A;  1HVX A;  1VQO B;  2XGJ A;  3PA1 A;  3ZPN A;  4RD1 A;  3CW2 A;  1S72 B;  1NB0 A;  2WSS A;  4NNJ A;  1KK3 A;  1NJI D;  2VNH A;  1FNM A;  1DAR A;  4RD0 A;  3W2G A;  2GK6 A;  1N07 A;  3FPP A;  3OAA A;  1K28 D;  4XN0 A;  4C43 A;  1WP6 A;  4X07 A;  5L46 A;  2XZL A;  2BPO A;  1FRN A;  2XNJ A;  4E0F A;  4ZGN B;  1D2E A;  3OOC A;  4RD3 A;  2BV3 A;  2X8K A;  3WBK A;  3A35 A;  2VNK A;  4WQM A;  3Q6R A;  3SJZ A;  1IJF A;  4WZL A;  1BMF A;  2V7U A;  3CTA A;  2JIZ A;  2V31 A;  2VNI A;  4P22 A;  1R5B A;  1R5O A;  4G1B A;  4LC0 A;  2B7C A;  2OK7 A;  5IYQ A;  1M90 D;  2GPJ A;  3ZBU A;  3OJX A;  3PA2 A;  1WU8 A;  1YX2 A;  2QTL A;  2RC6 A;  1PKV A;  4G6I A;  4X7E A;  4MYT A;  4P6Y A;  5CDF A;  1EXM A;  4PGO A;  1I8D A;  1KK1 A;  2CND A;  1KD1 D;  2BF4 A;  3AVV A;  4B47 A;  3JQR A;  1Q7Y D;  4NCN A;  1J9Z A;  2B5O A;  3SLD A;  3ZIA A;  2BMW A;  5TY0 A;  5BSX A;  4Z4U A;  5B6I A;  1QGZ A;  4YEL A;  1OB2 A;  1I18 A;  4HE5 A;  5DN6 A;  1VLY A;  2WZN A;  2E1B A;  4X0C A;  4YAF A;  3OP1 A;  1PJ6 A;  2X3U A;  2VNJ A;  3J81 k;  4RD6 A;  2VYQ A;  2NPF A;  3U6K A;  3A3B A;  1VQK B;  1K8A D;  1UD3 A;  1B2R A;  1GR1 A;  1GVH A;  2CC2 A;  2OYN A;  3DDY A;  4X8I A;  4AC9 A;  1YJN B;  1P4M A;  3ES9 A;  4ACB A;  4PC6 A;  2X6X A;  4ZCI A;  1EP1 B;  1ZM4 A;  3I1F A;  2ZXH A;  4X7C A;  2VBT A;  4II3 A;  2VBU A;  4Z4V A;  1Y0Y A;  1VQM B;  4RPB A;  3ZZ0 A;  4TKO B;  4AF7 A;  2XZO A;  1E1R A;  4N3N A;  3CCE B;  4CQJ A;  1GAQ A;  1YLO A;  3ISX A;  4RCY A;  2ZZG A;  1WDT A;  1IJE A;  2J7K A;  2NV4 A;  3ASS A;  3CC7 B;  3GSI A;  4XMY A;  3W5V A;  3CC4 B;  4P2N A;  4Z4T A;  1N08 A;  4LBZ A;  2LZJ A;  3V7A A;  4M4S A;  3KEW A;  3ZUG A;  2JJ2 A;  1XB2 A;  3FPK A;  1EWY A;  2OK8 A;  3OJW A;  4DQL A;  3OZW A;  4II2 A;  5DSZ A;  3PVD A;  1QGY A;  3G05 A;  1DDG A;  3ZC3 A;  3OZU A;  4R71 A;  1SKQ A;  1MAB A;  3LVB A;  3OE7 A;  3PUN A;  4RD4 A;  3ZBT A;  4B3G A;  1G7C A;  4XQF A;  4HE6 A;  1KQS B;  1F60 A;  2E1R A;  4AVZ A;  3AVX A;  1VQ5 B;  2WYR A;  3LQE A;  1VQ9 B;  1QVF B;  1ELO A;  1CQX A;  3WXM A;  4QVJ A;  1N0V C;  1ZUN B;  5IYR A;  4EH1 A;  4WZT A;  1FDR A;  3SEJ A;  2XND A;  1NBM A;  5A89 A;  3GQB A;  2EFG A;  4XR6 A;  1JA0 A;  3WND A;  2ZL5 A;  4X05 A;  3CES A;  2XNC A;  3FJO A;  1BX0 A;  2VBS A;  4FWT A;  1OGJ A;  4XLH A;  4TMZ A;  1QX4 A;  4ROX A;  3CB4 A;  4B4D A;  2ZZF A;  5FA6 A;  3D26 A;  4XLE A;  4B48 A;  1AIP A;  2WJV A;  4PC2 A;  2W6J A;  2QGG A;  1JA1 A;  1NDH A;  2OBT A;  3CP8 A;  3LQ6 A;  3QE2 A;  5IK2 A;  4WWV A;  3RY8 A;  4YEJ A;  5HZA A;  1DDI A;  3AST A;  2JJ1 A;  2X53 S;  1UD2 A;  2JDI A;  4PC3 A;  4RDJ A;  4UZF A;  1VQ4 B;  3GVK A;  3LO8 A;  5A88 A;  1R5N A;  3MCA A;  4QVA A;  2V7X A;  1W0J A;  4OOX A;  1MRZ A;  1D8T A;  2V4D A;  1QG0 A;  4G7X A;  3P26 A;  4X06 A;  4ZCM A;  1QH0 A;  4DNR B;  3JQP A;  2CF4 A;  3A3G A;  3CCL B;  2CBX A;  4RLZ A;  4OPS A;  4L8J A;  4P3I A;  3H94 A;  4TMT A;  1G7S A;  3A1P A;  4OOS A;  5E6T A;  3AVU A;  3GVJ A;  1IHM A;  1HZE A;  1WOP A;  1NB9 A;  3B78 A;  2ZXI A;  4XKW A;  4DK1 A;  2HDN B;  2I1L A;  3OW7 A;  3VNU A;  1SKY B;  2Q6L A;  4YAW A;  2DCU A;  3W2H A;  1VQ6 B;  5GV7 A;  3VO1 A;  3CCV B;  2Q6K A;  1WOR A;  4XLF A;  2ZBV A;  2QEX B;  3CCQ B;  2ZZQ A;  3CCM B;  1FRQ A;  4JMQ A;  4XM3 A;  5TV2 A;  1K73 D;  1WPC A;  1W87 A;  4KKS A;  4QV2 A;  3CC2 B;  3OW2 B;  3AVW A;  4ACA A;  2AHO A;  3I56 B;  2XOK A;  2CRV A;  4B3F X;  1UD5 A;  2C77 A;  4Z4Z A;  4K1X A;  3B8H A;  4J0Q A;  1VHE A;  3BY2 A;  4PAA A;  2PIA A;  4TT3 A;  1OB5 A;  1RQR A;  1F20 A;  5TR9 A;  4YAO A;  1UD6 A;  1OB0 A;  1SM4 A;  3B82 A;  2WPD A;  4M53 A;  2V7W A;  2HCJ B;  1ZM9 A;  5TRD A;  1GO2 A;  1T5E A;  3CPX A;  1VQ7 B;  1BQE A;  1M1K D;  3WBJ A;  2YWG A;  1VLO A;  1E62 A;  1N0U A;  1QVG B;  3BNW A;  2C4U A;  1YIT B;  1G7T A;  2ZZE A;  4ZCL A;  1W0K A;  3QSY A;  1WOS A;  2YWF A;  3NE5 B;  2VJJ A;  4U9U A;  1COW A;  2Z6B D;  3CPW B;  1QUF A;  4PC7 A;  3QFT A;  1H8E A;  1TTT A;  3QFC A;  4XOP A;  4ASU A;  4LBV A;  2F1M A;  3LNN A;  4P6V F;  4TMX A;  3FKS A;  4P12 A;  1W34 A;  2OBR A;  2PLF A;  2EIX A;  1W9X A;  5FNZ A;  1KK0 A;  3AVT A;  3KL9 A;  4XN3 A;  1XE1 A;  1GAW A;  2GJR A;  1GJR A;  5H5J A;  3V76 A;  2BGJ A;  3BCF A;  2GQF A;  1UD4 A;  2W6I A;  4OPV A;  5FO1 A;  3WQZ A;  3H9N A;  1EP3 B;  4P1V A;  3OZV A;  2QTZ A;  1YI2 B;  4YHB A;  3GVL A;  2HLD A;  3SLN A;  4ZGQ B;  3PUM A;  3MHP A;  1WSR A;  4B44 A;  1W35 A;  5FIU A;  1CNE A;  5DS0 A;  1KK2 A;  4Y7C A;  3ZZT A;  4YXW A;  5EMN A;  2V7T A;  4PC1 A;  4RM0 A;  1Q9S A;  2R9V A;  5HZB A;  4QFM A;  1FX0 A;  3MMP A;  4Z4R A;  3VO2 A;  1N05 A;  2F4N A;  4XON A;  1VJS A;  4P26 A;  3CCJ B;  1XQB A;  1H42 A;  2R6H A;  4XD7 A;  3T51 B;  3W5H A;  4G1V A;  4OP7 A;  3CMA B;  3BQJ A;  4XLC A;  3WNC A;  1WSV A;  4G5G A;  2KVO A;  3WYA A;  1QFZ A;  4AF6 A;  4LBW A;  4M1K A;  2DET A;  3G4S B;  4C0S A;  2C2W A;  2YWH A;  1N06 A;  1T6X A;  1WOO A;  2GRE A;  4FN5 A;  4RD2 A;  5FO0 A;  1UMK A;  1E1Q A;  2VZL A;  1BJK A;  2PE3 A;  3OKX A;  1G7R A;  5KW9 A;  1XFO A;  3U2Q A;  5THX A;  5FL7 A;  3Q39 A;  4OPO A;  1QFJ A;  2VJI A;  1H8H A;  3CRZ A;  2OTJ B;  4G7W A;  2FVG A;  2QDX A;  1KJZ A;  2X6Y A;  1VQ8 B;  1UD8 A;  3AGQ A;  3JQQ A;  3JU4 A;  3QFR A;  5GV8 A;  1A8P A;  3CMM A;  2X85 A;  4X7D A;  2C5B A;  2QMU A;  1YJW B;  1FNB A;  1Q82 D;  3GIR A;  1JB9 A;  2BVN A;  2Q6O A;  3T53 B;  2RC5 A;  4XLA A;  5HKK A;  3ZZU A;  2BM0 A;  4P25 A;  3W2E A;  3VNV A;  4XNF A;  5IYW A;  5H59 A;  5F4O A;  3HAG A;  1T6Y A;  5IYP A;  1YHQ B;  4RJL A;  4UZE A;  4Z4Y A;  2GJP A;  2DOG A;  2VBV A;  4RDL A;  1W2B B;  2DYI A;  5HXB A;  1YJ9 B;  4FXU A;  3R6K A;  3U6B A;  1HA3 A;  4BPR A;  1Q86 D;  3ASR A;  3BCD A;  2D74 A;  2OBS A;  2DY1 A;  4KKU A;  2P3M A;  2BGI A;  4Y9R A;  4FK8 A;  4NBS A;  1I7P A;  4XKV A;  5F4J A;  1V0E A;  3Q6Q A;  4QHY A;  5IYN A;  1E3X A;  1VQP B;  1YIJ B;  4M0L A;  4X7F A;  1E79 A;  3CCR B;  1V5V A;  4Y9U A;  1KC8 D;  4MYU A;  3CXC B;  4UZU A;  1D1N A;  3SKB A;  1Q81 D;  1VQL B;  2QA4 B;  4TMW A;  2HMA A;  1S4M A;  1K9M D;  3W2I A;  2ZL6 A;  1QGA A;  4Z4S A;  2DER A;  1PJ5 A;  2CK3 A;  2D9R A;  1AMO A;  2XZP A;  1VHO A;  2GJK A;  1QUE A;  1EP2 B;  1TVC A;  1Y0R A;  4TMV A;  3W2F A;  2F1L A;  1KRH A;  1KTV A;  2JN9 A;  5KSW B;  2C78 A;  1EFR A;  2F43 A;  5J35 A;  1CNF A;  5J3O A;  1OGI A;  2V7Q A;  1OHH A;  2Q6I A;  4HIZ A;  1B23 P;  3A8K A;  3WY9 A;  1E63 A;  4Q7J B;  2OTL B;  1WTH D;  1DG1 G;  2ZTN A;  2YWE A;  3ONY A;  4RCZ A;  3SJP A;  3CCS B;  2ZTG A;  3OFN A;  4Z4W A; 
#chains in the Genus database with same CATH homology
 1S4M A;  5FO0 A;  1Q9S A;  2VBV A;  4UZF A;  1NB0 A;  3BNW A;  1T6Z A;  5A89 A;  5A88 A;  1N08 A;  3ZUG A;  1N05 A;  1N07 A;  1MRZ A;  5FO1 A;  2P3M A;  2OYN A;  2VBS A;  1P4M A;  2X0K A;  2VBT A;  1NB9 A;  2VBU A;  5TRD A;  3CTA A;  2I1L A;  5FNZ A;  3OP1 A;  1N06 A;  1T6X A;  1T6Y A;  5A8A A;  4UZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...