5A8AA

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with fmn and adp (p3 2 21)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
155
structure length
155
Chain Sequence
GRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
total genus 35
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a8aA00
1P4MA 3CTAA 3OP1A 5FO0A 1S4MA 1N07A 1NB0A 5FO1A 2P3MA 5A8AA 1N06A 5TRDA 5FNZA 3BNWA 1T6YA 5A89A 1N08A 1N05A 2X0KA 4UZEA 3ZUGA 1NB9A 1T6ZA 2VBVA 2VBTA 2OYNA 1Q9SA 2VBSA 2VBUA 4UZFA 1MRZA 1T6XA 2I1LA 5A88A
chains in the Genus database with same CATH superfamily
2XNDA 5EMNA 4RM0A 3CXCB 3G4SB 3MMPA 1M1KD 4M0LA 4U9UA 2E1BA 1N8RD 1W9XA 2C4TA 4II3A 4OOSA 4P22A 1QUFA 3QFTA 2YWHA 3V76A 5A89A 4YAWA 2V7UA 4XL9A 5DSZA 1YI2B 1H8HA 1YITB 2X0KA 4BPRA 2ZL5A 3DDYA 3CCQB 5IYRA 2V7WA 1D2EA 4UZUA 1W0JA 2EIXA 1NDHA 1TUIA 1EP3B 1TVCA 1KK0A 3LQEA 4FK8A 2KVOA 4XN3A 1YJNB 3AGQA 4YAFA 4LBYA 3CC7B 5GV7A 3PENA 4X8IA 2PMDA 1NRKA 3G05A 4X7DA 1G7RA 4AF6A 4RPBA 1EP2B 3J81k 1D1NA 1TTTA 3W2IA 3CD6B 2GK6A 1Q86D 4XLAA 4B3FX 4J0QA 4NCNA 3CCEB 2XZPA 4YALA 2Q6KA 2FX3A 1QVGB 4M1KA 3CMEB 4HIZA 2F1LA 1EWYA 2JJ2A 3SLNA 2XNJA 3CCMB 2D74A 3CRZA 4Z4WA 4MYTA 4TKOB 2JN9A 4B47A 2XGJA 2OBRA 4PGOA 4YHBA 4ZGNB 3ZZUA 2YWFA 3AVYA 4II2A 2V7QA 3AVXA 5HKKA 3CPXA 3FPKA 3QFSA 4XNFA 3B78A 3WXMA 4XMYA 4IW3B 2XZOA 4RCYA 1S0UA 3WY9A 1DDIA 2ZL6A 1FNDA 1T6YA 2CBXA 3Q39A 1YJ9B 1N08A 1PJ6A 4QVJA 4UZEA 4TN1A 1IJEA 2OK8A 2NV4A 2QN6A 2VJIA 4ZCLA 4XORA 4CQJA 3CCJB 2VJJA 1Q7YD 4TMWA 4RDJA 3NE5B 2GK7A 2Q6LA 4QFMA 4R71A 1UD2A 2OYNA 1VF7A 2C4UA 3QE2A 4PC2A 4Z4VA 3W5UA 1Q9SA 5BSYA 5KSWB 1VHEA 2DOGA 1E62A 2OBTA 2ZXHA 3OOCA 1WDTA 2DIEA 3AVUA 1BPLA 4H9GA 3A8JA 4DQLA 1E3XA 1F20A 1IHMA 2X6XA 5FIUA 4FWTA 3ASPA 1W0KA 1EFRA 1VQ8B 5DN6A 2BV3A 2GJPA 3FJOA 2OTJB 3OPOA 3BC9A 1UMKA 3W2HA 4P6YA 4YELA 1H8EA 2V31A 2BM1A 2X85A 1Q81D 3OE7A 4RD0A 2CRVA 1FNBA 5A8AA 1Y0YA 1AIPA 1WOPA 5H5JA 2BGJA 3Q3AA 1QFZA 1COWA 4DK0A 3A8IA 2WSSA 3Q6QA 1RQPA 1RQRA 2QMUA 3JQRA 4TMTA 4F7DA 3CC4B 2QTZA 4E0FA 5AN9A 3QFRA 1I18A 1NJID 1W87A 3BY1A 4TMVA 3W5VA 3WBKA 2JJ1A 1V0FA 2ZZGA 4JMQA 3ZC3A 1PJ7A 3P26A 3PA2A 5HZBA 4XQFA 4RD3A 1I7PA 2VNIA 5IYPA 2WJYA 2BSAA 2Z6BD 3GIRA 4X7CA 2B7CA 2VNJA 3ASQA 3ASSA 2V7VA 4M53A 4G5GA 1CNEA 4M4SA 4XONA 1N0VC 1VQLB 2GREA 3WNBA 1YHQB 1JA0A 5H59A 1QGAA 1FRQA 2D3NA 1S4MA 1OGJA 1UD6A 1GAQA 4QV2A 1CNFA 2C5BA 5TRDA 1FNCA 1I8DA 2YWGA 5KW9A 4XLCA 4OOVA 1VLOA 5IYWA 4P9SA 2V4DA 4WWVA 3JQPA 3T56B 1E1QA 4RD2A 4RDLA 4TMZA 4FXUA 3SJPA 3SKBA 4UAJA 4PABA 3RY8A 2DYIA 3R6JA 4YAOA 1OB0A 2X53S 4KKTA 4MYUA 2VBUA 4RD1A 1MABA 2I1LA 4N3GA 3I56B 4LBZA 4RD6A 3JU4A 2WJVA 2VYQA 4P25A 1BMFA 2CK3A 2XEXA 2ZITA 4PC7A 4KKUA 5B6IA 1WSVA 4P26A 3VR6A 4ACAA 3AVTA 3OFNA 4WZKA 4L8JA 2W6IA 1VQ7B 3QSYA 3LVBA 3VMFA 1S72B 4P3IA 2C77A 2CF4A 2J7KA 1QH0A 5LMZA 1W34A 1JNYA 3U6BA 1VQPB 2BGIA 4TSFA 5J35A 1VQ5B 4QVAA 2OK7A 3BH4A 5IYQA 1VQ4B 2F43A 4FN5A 4G6IA 3ZZTA 4QUZA 3I1FA 4B44A 3VNUA 1G7CA 2WZNA 1ZM9A 1KTVA 2QGGA 1QG0A 1PJ5A 4Y9UA 2NPFA 4XKVA 4AF7A 3VNVA 1GO2A 3LQ6A 1VQ9B 4XD7A 4YXWA 1QUEA 1EFUA 2HLDA 5GV8A 4X07A 1QGZA 1NB9A 1Q82D 5THXA 1EP1B 1FX0A 3GVLA 3Q6RA 1XQBA 3JQQA 4PAAA 4C43A 1VQ6B 3CCVB 4KKSA 2Q6IA 1K8AD 4Z4ZA 4RPDA 4P2NA 1OB5A 4UZFA 1R5BA 3ASTA 5A88A 2HMAA 3U6KA 4N3NA 4XLHA 2HDNB 2V7XA 3GVKA 4XR6A 1WPCA 4G7XA 2QTLA 3CCUB 1N07A 3WQZA 3ZPNA 5HXBA 1XB2A 4G7WA 3PA1A 1BJKA 2DY1A 3OJWA 2PLFA 1K73D 3A3BA 2PIAA 4YEJA 3ZUGA 1WORA 2BVNA 2R6HA 1IB0A 1T6ZA 3H9NA 4ACBA 2VNKA 1R5NA 3BCDA 2PE3A 2X8KA 3CB4A 4B48A 4TT3A 2ZZFA 1BX1A 4WZEA 5F4MA 1H42A 1KD1D 1J9ZA 4Z4UA 1XFOA 4B4DA 3OP1A 1KK2A 2QE7A 4XOPA 1N06A 1BX0A 1G7SA 1ZM2A 1B23P 2Q6OA 3PUMA 5FNZA 3BNWA 4EH1A 4Q7JB 1YIJB 2YWEA 3AVWA 5KNLA 1HVXA 4ROXA 2GQFA 1SKQA 3VO2A 3ZZ0A 1EFTA 1KK3A 1V5VA 2QDXA 1Y0RA 4X06A 3V7AA 4LBWA 2QA4B 4XLEA 4LC0A 1AMOA 4LBVA 2DCUA 5TY0A 5E6TA 4NNJA 3OW2B 4Z4SA 1WTHD 2HCJB 2RC5A 3KEWA 1IJFA 3QFCA 2ZTNA 4X7FA 3W2FA 1JJ2B 1OGIA 3CC2B 1YX2A 1K9MD 3PUNA 4DNTB 4GQNA 1KJZA 2CC2A 2M5SA 4AVZA 2D9RA 2ZL7A 3WBJA 1DARA 1FNMA 5FA6A 1ZM4A 2DEUA 4OPVA 3CESA 1V0EA 3CPWB 2LZJA 2WYRA 1G7TA 1VQMB 1KZLA 2BN4A 4P1VA 1E43A 2ZTGA 3D26A 2F4NA 1GAWA 1KK1A 4C0SA 1HZEA 2EFGA 4K1XA 3AVVA 4RJLA 3G6EB 1MRZA 3MHPA 4Z4YA 2V7TA 2E1RA 1EXMA 3ONUA 5CDFA 5TR9A 2RC6A 3SEJA 2ZBUA 2D3LA 1QGYA 5F4JA 5BSXA 1A8PA 1NB0A 4DK1A 4DQKA 3OW7A 1KMHA 1EFCA 3CP8A 4Z1MA 2QEXB 4X0CA 1N05A 2BPOA 4QHYA 4B3XA 1M90D 1E79A 1VQOB 2WZPP 3W2EA 3GQBA 4NBSA 4P6VF 4Y9RA 3AGPA 4XN0A 1DDGA 2GPJA 3ZIAA 1WOOA 3GSIA 3Q38A 4P12A 2WR8A 1OB2A 2XNCA 3MCAA 1GJRA 3SLDA 3W5HA 4PC1A 4ZGQB 3R6KA 2ZBVA 1VQNB 4Y7CA 1SM4A 3OJXA 1QFJA 1R5OA 5DS0A 1E63A 3ES9A 3P27A 3T51B 1KC8D 1XE1A 2C5HA 1FDRA 4B43A 3LO8A 5FL7A 1VHOA 3ASRA 3CW2A 1BLIA 4Z4RA 4WZTA 2ZZEA 2VNHA 4RD4A 4ZV4A 3E20A 4TMXA 2GJKA 1UD8A 3OEEA 4WQMA 2CW5A 2OTLB 1D8TA 4B3GA 3WNCA 1W35A 4XM3A 3CMAB 1VQKB 2CNDA 2B5OA 3OEHA 4P3YA 4XLFA 3OAAA 2JIZA 2VZLA 4HE5A 3I55B 5JBQA 1KQSB 1T5EA 4OOXA 2C78A 2BMWA 5FO1A 1KRHA 2P3MA 3BY2A 3BQJA 3CCLB 4DNRB 1CQXA 4RCZA 1WOSA 3B8HA 3CCSB 1N0UA 3WYAA 3A3GA 3PVDA 2X6WA 1E3ZA 1B2RA 3LNNA 4OP7A 3BCFA 4YAUA 1OHHA 2OBSA 1WSRA 2W6JA 4WZLA 2ZZQA 3OZWA 1UD5A 1WP6A 3A1PA 1GVHA 5IK2A 1HA3A 4X05A 4X7EA 4M2LA 3CCRB 3OZVA 1ZUNB 2VBSA 1ZM3A 3FPPA 1TLLA 1WU8A 1UD4A 2ZXIA 2DETA 5L46A 1E1RA 1YJWB 1P4MA 3E1YE 5HZAA 1YLOA 4OPOA 1JA1A 3ZBTA 4PC6A 3A35A 3FKSA 1BQEA 5TV2A 1F60A 4RLZA 3CMMA 4ZCIA 2F1MA 3GVJA 5J3OA 5IYNA 2GJRA 3A8KA 3SJZA 1DG1G 3G71B 4ASUA 2VBVA 4AC9A 1ELOA 2DERA 2JDIA 5F4OA 1U2RA 3OKXA 2XOKA 4XOTA 1PKVA 3VO1A 2XZLA 4Z4TA 1QFYA 1FRNA 4OPSA 1NBMA 2X6YA 1E64A 4PC3A 1QX4A 3B82A 3H94A 3ONYA 1GR1A 3WNDA 3CTAA 5FO0A 1SKYB 4RDKA 2BM0A 4G1VA 3W2GA 3ISXA 3HAGA 2C2WA 2B7BA 1W2BB 2WPDA 1UD3A 3OZUA 4HE6A 2X3UA 4G1BA 3U2QA 4ZCMA 3CP2A 3T53B 1VLYA 2R9VA 3ZBUA 1JB9A 2VBTA 1K28D 1VJSA 2BF4A 2AHOA 1H85A 3KL9A 4XKWA 1QVFB 1T6XA 2FVGA
chains in the Genus database with same CATH topology
1P4MA 3CTAA 3OP1A 5FO0A 1S4MA 1N07A 1NB0A 5FO1A 2P3MA 5A8AA 1N06A 5TRDA 5FNZA 3BNWA 1T6YA 5A89A 1N08A 1N05A 2X0KA 4UZEA 3ZUGA 1NB9A 1T6ZA 2VBVA 2VBTA 2OYNA 1Q9SA 2VBSA 2VBUA 4UZFA 1MRZA 1T6XA 2I1LA 5A88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4M A;  3CTA A;  3OP1 A;  5FO0 A;  1S4M A;  1N07 A;  1NB0 A;  5FO1 A;  2P3M A;  5A8A A;  1N06 A;  5TRD A;  5FNZ A;  3BNW A;  1T6Y A;  5A89 A;  1N08 A;  1N05 A;  2X0K A;  4UZE A;  3ZUG A;  1NB9 A;  1T6Z A;  2VBV A;  2VBT A;  2OYN A;  1Q9S A;  2VBS A;  2VBU A;  4UZF A;  1MRZ A;  1T6X A;  2I1L A;  5A88 A; 
#chains in the Genus database with same CATH topology
 2XND A;  5EMN A;  4RM0 A;  3CXC B;  3G4S B;  3MMP A;  1M1K D;  4M0L A;  4U9U A;  2E1B A;  1N8R D;  1W9X A;  2C4T A;  4II3 A;  4OOS A;  4P22 A;  1QUF A;  3QFT A;  2YWH A;  3V76 A;  5A89 A;  4YAW A;  2V7U A;  4XL9 A;  5DSZ A;  1YI2 B;  1H8H A;  1YIT B;  2X0K A;  4BPR A;  2ZL5 A;  3DDY A;  3CCQ B;  5IYR A;  2V7W A;  1D2E A;  4UZU A;  1W0J A;  2EIX A;  1NDH A;  1TUI A;  1EP3 B;  1TVC A;  1KK0 A;  3LQE A;  4FK8 A;  2KVO A;  4XN3 A;  1YJN B;  3AGQ A;  4YAF A;  4LBY A;  3CC7 B;  5GV7 A;  3PEN A;  4X8I A;  2PMD A;  1NRK A;  3G05 A;  4X7D A;  1G7R A;  4AF6 A;  4RPB A;  1EP2 B;  3J81 k;  1D1N A;  1TTT A;  3W2I A;  3CD6 B;  2GK6 A;  1Q86 D;  4XLA A;  4B3F X;  4J0Q A;  4NCN A;  3CCE B;  2XZP A;  4YAL A;  2Q6K A;  2FX3 A;  1QVG B;  4M1K A;  3CME B;  4HIZ A;  2F1L A;  1EWY A;  2JJ2 A;  3SLN A;  2XNJ A;  3CCM B;  2D74 A;  3CRZ A;  4Z4W A;  4MYT A;  4TKO B;  2JN9 A;  4B47 A;  2XGJ A;  2OBR A;  4PGO A;  4YHB A;  4ZGN B;  3ZZU A;  2YWF A;  3AVY A;  4II2 A;  2V7Q A;  3AVX A;  5HKK A;  3CPX A;  3FPK A;  3QFS A;  4XNF A;  3B78 A;  3WXM A;  4XMY A;  4IW3 B;  2XZO A;  4RCY A;  1S0U A;  3WY9 A;  1DDI A;  2ZL6 A;  1FND A;  1T6Y A;  2CBX A;  3Q39 A;  1YJ9 B;  1N08 A;  1PJ6 A;  4QVJ A;  4UZE A;  4TN1 A;  1IJE A;  2OK8 A;  2NV4 A;  2QN6 A;  2VJI A;  4ZCL A;  4XOR A;  4CQJ A;  3CCJ B;  2VJJ A;  1Q7Y D;  4TMW A;  4RDJ A;  3NE5 B;  2GK7 A;  2Q6L A;  4QFM A;  4R71 A;  1UD2 A;  2OYN A;  1VF7 A;  2C4U A;  3QE2 A;  4PC2 A;  4Z4V A;  3W5U A;  1Q9S A;  5BSY A;  5KSW B;  1VHE A;  2DOG A;  1E62 A;  2OBT A;  2ZXH A;  3OOC A;  1WDT A;  2DIE A;  3AVU A;  1BPL A;  4H9G A;  3A8J A;  4DQL A;  1E3X A;  1F20 A;  1IHM A;  2X6X A;  5FIU A;  4FWT A;  3ASP A;  1W0K A;  1EFR A;  1VQ8 B;  5DN6 A;  2BV3 A;  2GJP A;  3FJO A;  2OTJ B;  3OPO A;  3BC9 A;  1UMK A;  3W2H A;  4P6Y A;  4YEL A;  1H8E A;  2V31 A;  2BM1 A;  2X85 A;  1Q81 D;  3OE7 A;  4RD0 A;  2CRV A;  1FNB A;  5A8A A;  1Y0Y A;  1AIP A;  1WOP A;  5H5J A;  2BGJ A;  3Q3A A;  1QFZ A;  1COW A;  4DK0 A;  3A8I A;  2WSS A;  3Q6Q A;  1RQP A;  1RQR A;  2QMU A;  3JQR A;  4TMT A;  4F7D A;  3CC4 B;  2QTZ A;  4E0F A;  5AN9 A;  3QFR A;  1I18 A;  1NJI D;  1W87 A;  3BY1 A;  4TMV A;  3W5V A;  3WBK A;  2JJ1 A;  1V0F A;  2ZZG A;  4JMQ A;  3ZC3 A;  1PJ7 A;  3P26 A;  3PA2 A;  5HZB A;  4XQF A;  4RD3 A;  1I7P A;  2VNI A;  5IYP A;  2WJY A;  2BSA A;  2Z6B D;  3GIR A;  4X7C A;  2B7C A;  2VNJ A;  3ASQ A;  3ASS A;  2V7V A;  4M53 A;  4G5G A;  1CNE A;  4M4S A;  4XON A;  1N0V C;  1VQL B;  2GRE A;  3WNB A;  1YHQ B;  1JA0 A;  5H59 A;  1QGA A;  1FRQ A;  2D3N A;  1S4M A;  1OGJ A;  1UD6 A;  1GAQ A;  4QV2 A;  1CNF A;  2C5B A;  5TRD A;  1FNC A;  1I8D A;  2YWG A;  5KW9 A;  4XLC A;  4OOV A;  1VLO A;  5IYW A;  4P9S A;  2V4D A;  4WWV A;  3JQP A;  3T56 B;  1E1Q A;  4RD2 A;  4RDL A;  4TMZ A;  4FXU A;  3SJP A;  3SKB A;  4UAJ A;  4PAB A;  3RY8 A;  2DYI A;  3R6J A;  4YAO A;  1OB0 A;  2X53 S;  4KKT A;  4MYU A;  2VBU A;  4RD1 A;  1MAB A;  2I1L A;  4N3G A;  3I56 B;  4LBZ A;  4RD6 A;  3JU4 A;  2WJV A;  2VYQ A;  4P25 A;  1BMF A;  2CK3 A;  2XEX A;  2ZIT A;  4PC7 A;  4KKU A;  5B6I A;  1WSV A;  4P26 A;  3VR6 A;  4ACA A;  3AVT A;  3OFN A;  4WZK A;  4L8J A;  2W6I A;  1VQ7 B;  3QSY A;  3LVB A;  3VMF A;  1S72 B;  4P3I A;  2C77 A;  2CF4 A;  2J7K A;  1QH0 A;  5LMZ A;  1W34 A;  1JNY A;  3U6B A;  1VQP B;  2BGI A;  4TSF A;  5J35 A;  1VQ5 B;  4QVA A;  2OK7 A;  3BH4 A;  5IYQ A;  1VQ4 B;  2F43 A;  4FN5 A;  4G6I A;  3ZZT A;  4QUZ A;  3I1F A;  4B44 A;  3VNU A;  1G7C A;  2WZN A;  1ZM9 A;  1KTV A;  2QGG A;  1QG0 A;  1PJ5 A;  4Y9U A;  2NPF A;  4XKV A;  4AF7 A;  3VNV A;  1GO2 A;  3LQ6 A;  1VQ9 B;  4XD7 A;  4YXW A;  1QUE A;  1EFU A;  2HLD A;  5GV8 A;  4X07 A;  1QGZ A;  1NB9 A;  1Q82 D;  5THX A;  1EP1 B;  1FX0 A;  3GVL A;  3Q6R A;  1XQB A;  3JQQ A;  4PAA A;  4C43 A;  1VQ6 B;  3CCV B;  4KKS A;  2Q6I A;  1K8A D;  4Z4Z A;  4RPD A;  4P2N A;  1OB5 A;  4UZF A;  1R5B A;  3AST A;  5A88 A;  2HMA A;  3U6K A;  4N3N A;  4XLH A;  2HDN B;  2V7X A;  3GVK A;  4XR6 A;  1WPC A;  4G7X A;  2QTL A;  3CCU B;  1N07 A;  3WQZ A;  3ZPN A;  5HXB A;  1XB2 A;  4G7W A;  3PA1 A;  1BJK A;  2DY1 A;  3OJW A;  2PLF A;  1K73 D;  3A3B A;  2PIA A;  4YEJ A;  3ZUG A;  1WOR A;  2BVN A;  2R6H A;  1IB0 A;  1T6Z A;  3H9N A;  4ACB A;  2VNK A;  1R5N A;  3BCD A;  2PE3 A;  2X8K A;  3CB4 A;  4B48 A;  4TT3 A;  2ZZF A;  1BX1 A;  4WZE A;  5F4M A;  1H42 A;  1KD1 D;  1J9Z A;  4Z4U A;  1XFO A;  4B4D A;  3OP1 A;  1KK2 A;  2QE7 A;  4XOP A;  1N06 A;  1BX0 A;  1G7S A;  1ZM2 A;  1B23 P;  2Q6O A;  3PUM A;  5FNZ A;  3BNW A;  4EH1 A;  4Q7J B;  1YIJ B;  2YWE A;  3AVW A;  5KNL A;  1HVX A;  4ROX A;  2GQF A;  1SKQ A;  3VO2 A;  3ZZ0 A;  1EFT A;  1KK3 A;  1V5V A;  2QDX A;  1Y0R A;  4X06 A;  3V7A A;  4LBW A;  2QA4 B;  4XLE A;  4LC0 A;  1AMO A;  4LBV A;  2DCU A;  5TY0 A;  5E6T A;  4NNJ A;  3OW2 B;  4Z4S A;  1WTH D;  2HCJ B;  2RC5 A;  3KEW A;  1IJF A;  3QFC A;  2ZTN A;  4X7F A;  3W2F A;  1JJ2 B;  1OGI A;  3CC2 B;  1YX2 A;  1K9M D;  3PUN A;  4DNT B;  4GQN A;  1KJZ A;  2CC2 A;  2M5S A;  4AVZ A;  2D9R A;  2ZL7 A;  3WBJ A;  1DAR A;  1FNM A;  5FA6 A;  1ZM4 A;  2DEU A;  4OPV A;  3CES A;  1V0E A;  3CPW B;  2LZJ A;  2WYR A;  1G7T A;  1VQM B;  1KZL A;  2BN4 A;  4P1V A;  1E43 A;  2ZTG A;  3D26 A;  2F4N A;  1GAW A;  1KK1 A;  4C0S A;  1HZE A;  2EFG A;  4K1X A;  3AVV A;  4RJL A;  3G6E B;  1MRZ A;  3MHP A;  4Z4Y A;  2V7T A;  2E1R A;  1EXM A;  3ONU A;  5CDF A;  5TR9 A;  2RC6 A;  3SEJ A;  2ZBU A;  2D3L A;  1QGY A;  5F4J A;  5BSX A;  1A8P A;  1NB0 A;  4DK1 A;  4DQK A;  3OW7 A;  1KMH A;  1EFC A;  3CP8 A;  4Z1M A;  2QEX B;  4X0C A;  1N05 A;  2BPO A;  4QHY A;  4B3X A;  1M90 D;  1E79 A;  1VQO B;  2WZP P;  3W2E A;  3GQB A;  4NBS A;  4P6V F;  4Y9R A;  3AGP A;  4XN0 A;  1DDG A;  2GPJ A;  3ZIA A;  1WOO A;  3GSI A;  3Q38 A;  4P12 A;  2WR8 A;  1OB2 A;  2XNC A;  3MCA A;  1GJR A;  3SLD A;  3W5H A;  4PC1 A;  4ZGQ B;  3R6K A;  2ZBV A;  1VQN B;  4Y7C A;  1SM4 A;  3OJX A;  1QFJ A;  1R5O A;  5DS0 A;  1E63 A;  3ES9 A;  3P27 A;  3T51 B;  1KC8 D;  1XE1 A;  2C5H A;  1FDR A;  4B43 A;  3LO8 A;  5FL7 A;  1VHO A;  3ASR A;  3CW2 A;  1BLI A;  4Z4R A;  4WZT A;  2ZZE A;  2VNH A;  4RD4 A;  4ZV4 A;  3E20 A;  4TMX A;  2GJK A;  1UD8 A;  3OEE A;  4WQM A;  2CW5 A;  2OTL B;  1D8T A;  4B3G A;  3WNC A;  1W35 A;  4XM3 A;  3CMA B;  1VQK B;  2CND A;  2B5O A;  3OEH A;  4P3Y A;  4XLF A;  3OAA A;  2JIZ A;  2VZL A;  4HE5 A;  3I55 B;  5JBQ A;  1KQS B;  1T5E A;  4OOX A;  2C78 A;  2BMW A;  5FO1 A;  1KRH A;  2P3M A;  3BY2 A;  3BQJ A;  3CCL B;  4DNR B;  1CQX A;  4RCZ A;  1WOS A;  3B8H A;  3CCS B;  1N0U A;  3WYA A;  3A3G A;  3PVD A;  2X6W A;  1E3Z A;  1B2R A;  3LNN A;  4OP7 A;  3BCF A;  4YAU A;  1OHH A;  2OBS A;  1WSR A;  2W6J A;  4WZL A;  2ZZQ A;  3OZW A;  1UD5 A;  1WP6 A;  3A1P A;  1GVH A;  5IK2 A;  1HA3 A;  4X05 A;  4X7E A;  4M2L A;  3CCR B;  3OZV A;  1ZUN B;  2VBS A;  1ZM3 A;  3FPP A;  1TLL A;  1WU8 A;  1UD4 A;  2ZXI A;  2DET A;  5L46 A;  1E1R A;  1YJW B;  1P4M A;  3E1Y E;  5HZA A;  1YLO A;  4OPO A;  1JA1 A;  3ZBT A;  4PC6 A;  3A35 A;  3FKS A;  1BQE A;  5TV2 A;  1F60 A;  4RLZ A;  3CMM A;  4ZCI A;  2F1M A;  3GVJ A;  5J3O A;  5IYN A;  2GJR A;  3A8K A;  3SJZ A;  1DG1 G;  3G71 B;  4ASU A;  2VBV A;  4AC9 A;  1ELO A;  2DER A;  2JDI A;  5F4O A;  1U2R A;  3OKX A;  2XOK A;  4XOT A;  1PKV A;  3VO1 A;  2XZL A;  4Z4T A;  1QFY A;  1FRN A;  4OPS A;  1NBM A;  2X6Y A;  1E64 A;  4PC3 A;  1QX4 A;  3B82 A;  3H94 A;  3ONY A;  1GR1 A;  3WND A;  3CTA A;  5FO0 A;  1SKY B;  4RDK A;  2BM0 A;  4G1V A;  3W2G A;  3ISX A;  3HAG A;  2C2W A;  2B7B A;  1W2B B;  2WPD A;  1UD3 A;  3OZU A;  4HE6 A;  2X3U A;  4G1B A;  3U2Q A;  4ZCM A;  3CP2 A;  3T53 B;  1VLY A;  2R9V A;  3ZBU A;  1JB9 A;  2VBT A;  1K28 D;  1VJS A;  2BF4 A;  2AHO A;  1H85 A;  3KL9 A;  4XKW A;  1QVF B;  1T6X A;  2FVG A; 
#chains in the Genus database with same CATH homology
 1P4M A;  3CTA A;  3OP1 A;  5FO0 A;  1S4M A;  1N07 A;  1NB0 A;  5FO1 A;  2P3M A;  5A8A A;  1N06 A;  5TRD A;  5FNZ A;  3BNW A;  1T6Y A;  5A89 A;  1N08 A;  1N05 A;  2X0K A;  4UZE A;  3ZUG A;  1NB9 A;  1T6Z A;  2VBV A;  2VBT A;  2OYN A;  1Q9S A;  2VBS A;  2VBU A;  4UZF A;  1MRZ A;  1T6X A;  2I1L A;  5A88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...