4X7FA

Crystal structure of norovirus gii.10 p domain in complex with nano-25
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
314
structure length
307
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norwalk virus
total genus 72
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4x7fA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4x7fA01
3V7AA 2ZL7A 3BY1A 3R6KA 3LQEA 5J35A 4P3IA 4X7CA 4QUZA 4Z4SA 5IYWA 4OOXA 3BY2A 4Z4VA 3PVDA 4X7EA 4Z4TA 5IYNA 3ASRA 5IYRA 3ASTA 3SLDA 5HZAA 4RDKA 4P2NA 3Q38A 3SLNA 4OPVA 4Z4WA 3ONYA 3Q3AA 4X7FA 2OBRA 3RY8A 4ROXA 4Z4ZA 4OPOA 4Z4UA 4WZKA 4Z4YA 4QV2A 4WZEA 5IYPA 3Q6QA 4X06A 4X07A 4RDLA 5F4JA 3BQJA 5IYQA 4RDJA 4WZLA 3PA2A 4RLZA 4X7DA 5BSYA 3R6JA 3PUNA 4P26A 4WZTA 4X05A 5KW9A 5BSXA 5E6TA 5F4OA 4Z4RA 5HZBA 4OP7A 2OBTA 3SEJA 2ZL5A 5J3OA 3Q6RA 3SKBA 3ONUA 3PA1A 4OPSA 4X0CA 4OOSA 4QVJA 2ZL6A 3ASPA 4OOVA 4RPDA 3LQ6A 4RM0A 3Q39A 2OBSA 4P25A 4RPBA 1IHMA 3PUMA 4QVAA 3ASQA 5F4MA 3D26A 4P1VA 3SJPA 4P12A 3ASSA
chains in the Genus database with same CATH superfamily
2QE7A 2PE3A 2NV4A 4XLCA 2ZL7A 4YAFA 3WY9A 3JQPA 1V5VA 4RCYA 1OGIA 1Q7YD 5FL7A 3AVUA 3OAAA 2X0KA 3OPOA 2WZNA 3ZPNA 4Q7JB 1H8HA 2BVNA 3ZZ0A 4B43A 3CCUB 3A8JA 4QUZA 4YELA 2XNDA 4Z4SA 3ZBUA 2JIZA 1JA1A 4OOXA 1E79A 1JJ2B 4Z4VA 2BN4A 3PVDA 3I55B 2YWGA 1W34A 1Q86D 3OE7A 2C5BA 3WYAA 2DOGA 3JQQA 1YIJB 1A8PA 2ZZEA 1BLIA 5A89A 1YHQB 1FNDA 4G7XA 1W2BB 5IYRA 4ZCMA 3MMPA 2HCJB 1ELOA 4LBWA 4XOTA 3KEWA 3LNNA 1OB0A 1GAWA 5H5JA 2DETA 1UD8A 1W35A 2R6HA 4RDKA 3OJWA 4R71A 1OGJA 5AN9A 4FN5A 1PKVA 2D74A 4ACBA 1DARA 3W2EA 4UZEA 1I8DA 3T56B 2OBRA 3CC2B 3RY8A 4FXUA 4XOPA 3WBJA 1JB9A 2BM0A 2V7VA 4TMZA 2WZPP 5HKKA 3CCMB 3ZUGA 3Q6QA 1NBMA 4FWTA 1QGZA 5F4JA 5TRDA 2JN9A 4WZLA 3PA2A 4RLZA 3WQZA 1WORA 3PUNA 3CCRB 1JNYA 1AIPA 4XLHA 4E0FA 3AVXA 4HIZA 1EFRA 3CMMA 4TT3A 1N07A 1RQRA 2CW5A 1QH0A 1KQSB 2X6YA 1IJEA 4NCNA 1XE1A 2BGJA 2OTJB 1T6ZA 1EWYA 2ZL5A 1XFOA 4ZCLA 4XLEA 1CNEA 2RC5A 3CCJB 4TSFA 2VNKA 2GK6A 2E1BA 1E64A 4DNTB 1QX4A 3QFRA 4LBZA 3ONUA 5CDFA 4B3GA 4RD0A 1OHHA 3CRZA 2CBXA 4X0CA 4OOSA 4QVJA 2X6WA 4L8JA 3V76A 2X3UA 1Y0RA 4XR6A 3FPKA 1H8EA 5LMZA 2VYQA 2VNIA 1KZLA 4RD6A 3Q39A 2F1MA 4PC1A 2V7WA 4RPBA 1TTTA 4MYTA 2XZPA 5FO1A 3H94A 2RC6A 3GVJA 4J0QA 3OFNA 4DNRB 2V7UA 3AVTA 3OJXA 5DN6A 1VLYA 3CP2A 1WOSA 1YJNB 1E63A 1H42A 4G5GA 1P4MA 3OZUA 2VBUA 1N06A 2C78A 2OK7A 4AC9A 2CK3A 5FNZA 2XOKA 3OW2B 1T6YA 1KD1D 2XGJA 2FVGA 1HVXA 1VHEA 2ZITA 3B82A 4P3IA 3OEEA 2EIXA 4TKOB 1I18A 3DDYA 4TMXA 4NBSA 2FX3A 2VBSA 1CQXA 2GREA 3MHPA 4YEJA 2GQFA 4II2A 3VR6A 1U2RA 3BY2A 1FNBA 2C77A 4XL9A 3QFCA 1BPLA 2DIEA 5H59A 3T53B 3WNBA 2ZTNA 1G7TA 2F43A 1EP1B 2ZTGA 4Z4TA 4HE5A 1DG1G 2X8KA 1VQOB 1IB0A 1I7PA 1EFTA 1Q9SA 2Z6BD 3FJOA 4YHBA 1UD6A 1NRKA 1WP6A 2Q6LA 1ZM9A 3LVBA 4XM3A 3CC7B 1T5EA 4CQJA 3GQBA 1GR1A 4P2NA 4U9UA 4XLAA 1QFZA 4KKSA 5KNLA 1Q81D 1QGAA 1WSVA 2C5HA 3Q38A 3SLNA 4UAJA 4B4DA 4TN1A 3CMAB 1SKYB 4X7FA 1HA3A 4ROXA 3BCFA 4Z4ZA 1MRZA 1QUEA 3VO2A 4F7DA 2DYIA 1OB5A 4Z4UA 1N0UA 1BQEA 4XKVA 2QMUA 3W5UA 4Z4YA 5B6IA 4WZEA 5FA6A 1D8TA 1YITB 4X06A 4X07A 3G71B 1GAQA 4MYUA 4YAOA 3BH4A 5IYQA 1VQ5B 2D3LA 5FO0A 4GQNA 1D2EA 2VBVA 4BPRA 2B5OA 1EXMA 2Q6IA 1UMKA 3R6JA 3JQRA 3W5VA 4B3FX 1K8AD 1SM4A 5GV7A 3U2QA 2GJPA 1VQ9B 3CCSB 3ZZTA 2M5SA 2DEUA 2XNCA 5KW9A 1QVGB 3OKXA 4N3NA 5E6TA 2QEXB 3J81k 1E3ZA 2Q6KA 2OBTA 2QDXA 4N3GA 4RCZA 4YALA 1FRNA 1KJZA 5J3OA 3I56B 1VQ8B 3VMFA 3Q6RA 1K73D 2X6XA 2V7QA 4KKUA 3WBKA 2DY1A 4B48A 1TUIA 3VNUA 3OZWA 4K1XA 2BPOA 3ASPA 4OOVA 1G7SA 1G7CA 3ES9A 3LQ6A 2ZZQA 4M2LA 4RM0A 4P6YA 1WTHD 4QFMA 1UD3A 2B7BA 1KK3A 4G7WA 4ZGNB 3CPWB 1SKQA 1F60A 3WNCA 1IHMA 3PUMA 1ZUNB 4QHYA 1EP3B 1NDHA 3ASQA 2OYNA 2V4DA 4P1VA 1NJID 2P3MA 1TLLA 1QGYA 1KK2A 1PJ5A 1R5NA 5IK2A 4DK1A 1W9XA 2CRVA 3V7AA 2BF4A 1F20A 3QFTA 2PIAA 2HLDA 2QGGA 4RD4A 4PAAA 3ZIAA 3R6KA 4P9SA 1VQMB 2JDIA 1YJ9B 1Y0YA 4YAWA 2AHOA 1V0FA 5THXA 2LZJA 1BMFA 2HMAA 4PC7A 1FNCA 3GIRA 2D9RA 5IYWA 1VHOA 3ISXA 2KVOA 4M1KA 3P27A 4XLFA 4P3YA 3W5HA 1S4MA 2J7KA 2R9VA 3G05A 3W2GA 5IYNA 2OTLB 3E1YE 2BMWA 1VQ7B 3ASRA 2ZBVA 3NE5B 1XQBA 4XD7A 2C4UA 1NB0A 4DK0A 3OOCA 2WPDA 1JA0A 3ASTA 1VQPB 4NNJA 3BC9A 2F1LA 2BGIA 2ZXIA 1EFUA 1KC8D 1TVCA 2BM1A 4JMQA 1ZM4A 4M4SA 4RD3A 2E1RA 3ONYA 3Q3AA 2GK7A 3WNDA 3E20A 3LO8A 4OPOA 2XEXA 4FK8A 3G4SB 3OEHA 2QN6A 4WZKA 1YLOA 1G7RA 1XB2A 3A8KA 4QV2A 3FPPA 3CCVB 4Z1MA 1BJKA 3CMEB 1QG0A 1E1RA 4RDLA 1HZEA 2W6JA 3ZBTA 2WJVA 2D3NA 4RD1A 4H9GA 3T51B 4P26A 1VQ4B 1GJRA 4AF6A 4II3A 1KK1A 3CTAA 3FKSA 2EFGA 4X05A 4XONA 4G1VA 1S72B 1K28D 1QFYA 5BSXA 3QFSA 5L46A 5FIUA 2C2WA 1YX2A 2I1LA 5F4OA 1ZM3A 4WQMA 4Z4RA 5KSWB 2XZLA 4OP7A 1VQLB 2W6IA 2GJRA 2VZLA 1VQ6B 4XN0A 2HDNB 4XMYA 4TMVA 1VJSA 4TMTA 4M0LA 4XQFA 3PA1A 2PLFA 2QTLA 3CP8A 4XKWA 1YI2B 1VLOA 5TR9A 3AVWA 2DCUA 1PJ7A 1R5OA 3A35A 1PJ6A 4XN3A 3AGPA 4ZV4A 3ZZUA 2C4TA 2V7XA 1T6XA 2QA4B 2JJ1A 1N0VC 4G6IA 1KK0A 3CC4B 1VQKB 2QTZA 2OBSA 3CD6B 4P25A 3OW7A 1WOOA 1D1NA 2VNHA 4P22A 1FX0A 3SJZA 4KKTA 2ZXHA 5F4MA 3D26A 1FRQA 3SJPA 4P12A 5HZAA 3A1PA 3W2IA 1M90D 4B3XA 2JJ2A 5EMNA 4AF7A 3AVYA 1DDGA 1E3XA 3JU4A 4YXWA 5A88A 3CCEB 3BY1A 1N08A 1UD4A 4IW3B 4DQLA 3I1FA 1WU8A 3LQEA 4PC6A 5J35A 2YWFA 3ZC3A 2VJIA 2V7TA 3WXMA 3U6KA 1M1KD 1BX1A 4LBVA 4X7CA 3CPXA 2ZZGA 4DQKA 1VQNB 3VO1A 1E43A 3A8IA 2BV3A 4XNFA 2WYRA 3U6BA 4XORA 4WWVA 3H9NA 3CCLB 3BCDA 1K9MD 3AVVA 4RJLA 4B47A 3CCQB 4X7EA 4C43A 1VF7A 3QSYA 1N8RD 1QUFA 2OK8A 4Y7CA 2VBTA 1DDIA 1UD2A 1NB9A 1W87A 1WDTA 3SLDA 1FNMA 1RQPA 2YWEA 1MABA 1J9ZA 3CW2A 3CESA 3W2HA 1E62A 1GO2A 2X53S 2CF4A 2ZZFA 4OPVA 1ZM2A 4Z4WA 1UD5A 4EH1A 1CNFA 2B7CA 4RD2A 4G1BA 1BX0A 3MCAA 1FDRA 3AGQA 2GJKA 5IYPA 1QVFB 1WOPA 5TV2A 1OB2A 1IJFA 2PMDA 3A3GA 1GVHA 3BQJA 4PGOA 1N05A 3QE2A 1WSRA 4RDJA 2GPJA 4X7DA 3GVKA 5BSYA 4Y9RA 4WZTA 1AMOA 4LC0A 1S0UA 1QFJA 4PABA 3G6EB 3A3BA 2WR8A 2VNJA 2CC2A 1V0EA 3B8HA 1YJWB 5GV8A 2ZBUA 1H85A 3BNWA 4HE6A 2BSAA 1WPCA 5HZBA 2X85A 2YWHA 5DS0A 3SEJA 1KRHA 1W0KA 2V31A 1E1QA 4ZCIA 4UZFA 4C0SA 3GSIA 1EFCA 5JBQA 1COWA 1R5BA 2XNJA 4B44A 4UZUA 1B2RA 4ACAA 3SKBA 4LBYA 1Q82D 2DERA 3OP1A 4X8IA 2Q6OA 3KL9A 4ZGQB 4OPSA 1EP2B 3W2FA 3GVLA 4AVZA 4P6VF 2ZL6A 3HAGA 3OZVA 2NPFA 2CNDA 4M53A 3CXCB 1KTVA 4RPDA 4Y9UA 3P26A 4PC2A 1W0JA 3CB4A 4ASUA 2XZOA 3PENA 5TY0A 3B78A 4PC3A 2VJJA 4YAUA 3VNVA 5DSZA 5A8AA 2F4NA 1B23P 2WJYA 4QVAA 4TMWA 2WSSA 3ASSA 1KMHA 5HXBA
chains in the Genus database with same CATH topology
3V7AA 2ZL7A 3BY1A 3R6KA 3LQEA 5J35A 4P3IA 4X7CA 4QUZA 4Z4SA 5IYWA 4OOXA 3BY2A 4Z4VA 3PVDA 4X7EA 4Z4TA 5IYNA 3ASRA 5IYRA 3ASTA 3SLDA 5HZAA 4RDKA 4P2NA 3Q38A 3SLNA 4OPVA 4Z4WA 3ONYA 3Q3AA 4X7FA 2OBRA 3RY8A 4ROXA 4Z4ZA 4OPOA 4Z4UA 4WZKA 4Z4YA 4QV2A 4WZEA 5IYPA 3Q6QA 4X06A 4X07A 4RDLA 5F4JA 3BQJA 5IYQA 4RDJA 4WZLA 3PA2A 4RLZA 4X7DA 5BSYA 3R6JA 3PUNA 4P26A 4WZTA 4X05A 5KW9A 5BSXA 5E6TA 5F4OA 4Z4RA 5HZBA 4OP7A 2OBTA 3SEJA 2ZL5A 5J3OA 3Q6RA 3SKBA 3ONUA 3PA1A 4OPSA 4X0CA 4OOSA 4QVJA 2ZL6A 3ASPA 4OOVA 4RPDA 3LQ6A 4RM0A 3Q39A 2OBSA 4P25A 4RPBA 1IHMA 3PUMA 4QVAA 3ASQA 5F4MA 3D26A 4P1VA 3SJPA 4P12A 3ASSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7A A;  2ZL7 A;  3BY1 A;  3R6K A;  3LQE A;  5J35 A;  4P3I A;  4X7C A;  4QUZ A;  4Z4S A;  5IYW A;  4OOX A;  3BY2 A;  4Z4V A;  3PVD A;  4X7E A;  4Z4T A;  5IYN A;  3ASR A;  5IYR A;  3AST A;  3SLD A;  5HZA A;  4RDK A;  4P2N A;  3Q38 A;  3SLN A;  4OPV A;  4Z4W A;  3ONY A;  3Q3A A;  4X7F A;  2OBR A;  3RY8 A;  4ROX A;  4Z4Z A;  4OPO A;  4Z4U A;  4WZK A;  4Z4Y A;  4QV2 A;  4WZE A;  5IYP A;  3Q6Q A;  4X06 A;  4X07 A;  4RDL A;  5F4J A;  3BQJ A;  5IYQ A;  4RDJ A;  4WZL A;  3PA2 A;  4RLZ A;  4X7D A;  5BSY A;  3R6J A;  3PUN A;  4P26 A;  4WZT A;  4X05 A;  5KW9 A;  5BSX A;  5E6T A;  5F4O A;  4Z4R A;  5HZB A;  4OP7 A;  2OBT A;  3SEJ A;  2ZL5 A;  5J3O A;  3Q6R A;  3SKB A;  3ONU A;  3PA1 A;  4OPS A;  4X0C A;  4OOS A;  4QVJ A;  2ZL6 A;  3ASP A;  4OOV A;  4RPD A;  3LQ6 A;  4RM0 A;  3Q39 A;  2OBS A;  4P25 A;  4RPB A;  1IHM A;  3PUM A;  4QVA A;  3ASQ A;  5F4M A;  3D26 A;  4P1V A;  3SJP A;  4P12 A;  3ASS A; 
#chains in the Genus database with same CATH topology
 2QE7 A;  2PE3 A;  2NV4 A;  4XLC A;  2ZL7 A;  4YAF A;  3WY9 A;  3JQP A;  1V5V A;  4RCY A;  1OGI A;  1Q7Y D;  5FL7 A;  3AVU A;  3OAA A;  2X0K A;  3OPO A;  2WZN A;  3ZPN A;  4Q7J B;  1H8H A;  2BVN A;  3ZZ0 A;  4B43 A;  3CCU B;  3A8J A;  4QUZ A;  4YEL A;  2XND A;  4Z4S A;  3ZBU A;  2JIZ A;  1JA1 A;  4OOX A;  1E79 A;  1JJ2 B;  4Z4V A;  2BN4 A;  3PVD A;  3I55 B;  2YWG A;  1W34 A;  1Q86 D;  3OE7 A;  2C5B A;  3WYA A;  2DOG A;  3JQQ A;  1YIJ B;  1A8P A;  2ZZE A;  1BLI A;  5A89 A;  1YHQ B;  1FND A;  4G7X A;  1W2B B;  5IYR A;  4ZCM A;  3MMP A;  2HCJ B;  1ELO A;  4LBW A;  4XOT A;  3KEW A;  3LNN A;  1OB0 A;  1GAW A;  5H5J A;  2DET A;  1UD8 A;  1W35 A;  2R6H A;  4RDK A;  3OJW A;  4R71 A;  1OGJ A;  5AN9 A;  4FN5 A;  1PKV A;  2D74 A;  4ACB A;  1DAR A;  3W2E A;  4UZE A;  1I8D A;  3T56 B;  2OBR A;  3CC2 B;  3RY8 A;  4FXU A;  4XOP A;  3WBJ A;  1JB9 A;  2BM0 A;  2V7V A;  4TMZ A;  2WZP P;  5HKK A;  3CCM B;  3ZUG A;  3Q6Q A;  1NBM A;  4FWT A;  1QGZ A;  5F4J A;  5TRD A;  2JN9 A;  4WZL A;  3PA2 A;  4RLZ A;  3WQZ A;  1WOR A;  3PUN A;  3CCR B;  1JNY A;  1AIP A;  4XLH A;  4E0F A;  3AVX A;  4HIZ A;  1EFR A;  3CMM A;  4TT3 A;  1N07 A;  1RQR A;  2CW5 A;  1QH0 A;  1KQS B;  2X6Y A;  1IJE A;  4NCN A;  1XE1 A;  2BGJ A;  2OTJ B;  1T6Z A;  1EWY A;  2ZL5 A;  1XFO A;  4ZCL A;  4XLE A;  1CNE A;  2RC5 A;  3CCJ B;  4TSF A;  2VNK A;  2GK6 A;  2E1B A;  1E64 A;  4DNT B;  1QX4 A;  3QFR A;  4LBZ A;  3ONU A;  5CDF A;  4B3G A;  4RD0 A;  1OHH A;  3CRZ A;  2CBX A;  4X0C A;  4OOS A;  4QVJ A;  2X6W A;  4L8J A;  3V76 A;  2X3U A;  1Y0R A;  4XR6 A;  3FPK A;  1H8E A;  5LMZ A;  2VYQ A;  2VNI A;  1KZL A;  4RD6 A;  3Q39 A;  2F1M A;  4PC1 A;  2V7W A;  4RPB A;  1TTT A;  4MYT A;  2XZP A;  5FO1 A;  3H94 A;  2RC6 A;  3GVJ A;  4J0Q A;  3OFN A;  4DNR B;  2V7U A;  3AVT A;  3OJX A;  5DN6 A;  1VLY A;  3CP2 A;  1WOS A;  1YJN B;  1E63 A;  1H42 A;  4G5G A;  1P4M A;  3OZU A;  2VBU A;  1N06 A;  2C78 A;  2OK7 A;  4AC9 A;  2CK3 A;  5FNZ A;  2XOK A;  3OW2 B;  1T6Y A;  1KD1 D;  2XGJ A;  2FVG A;  1HVX A;  1VHE A;  2ZIT A;  3B82 A;  4P3I A;  3OEE A;  2EIX A;  4TKO B;  1I18 A;  3DDY A;  4TMX A;  4NBS A;  2FX3 A;  2VBS A;  1CQX A;  2GRE A;  3MHP A;  4YEJ A;  2GQF A;  4II2 A;  3VR6 A;  1U2R A;  3BY2 A;  1FNB A;  2C77 A;  4XL9 A;  3QFC A;  1BPL A;  2DIE A;  5H59 A;  3T53 B;  3WNB A;  2ZTN A;  1G7T A;  2F43 A;  1EP1 B;  2ZTG A;  4Z4T A;  4HE5 A;  1DG1 G;  2X8K A;  1VQO B;  1IB0 A;  1I7P A;  1EFT A;  1Q9S A;  2Z6B D;  3FJO A;  4YHB A;  1UD6 A;  1NRK A;  1WP6 A;  2Q6L A;  1ZM9 A;  3LVB A;  4XM3 A;  3CC7 B;  1T5E A;  4CQJ A;  3GQB A;  1GR1 A;  4P2N A;  4U9U A;  4XLA A;  1QFZ A;  4KKS A;  5KNL A;  1Q81 D;  1QGA A;  1WSV A;  2C5H A;  3Q38 A;  3SLN A;  4UAJ A;  4B4D A;  4TN1 A;  3CMA B;  1SKY B;  4X7F A;  1HA3 A;  4ROX A;  3BCF A;  4Z4Z A;  1MRZ A;  1QUE A;  3VO2 A;  4F7D A;  2DYI A;  1OB5 A;  4Z4U A;  1N0U A;  1BQE A;  4XKV A;  2QMU A;  3W5U A;  4Z4Y A;  5B6I A;  4WZE A;  5FA6 A;  1D8T A;  1YIT B;  4X06 A;  4X07 A;  3G71 B;  1GAQ A;  4MYU A;  4YAO A;  3BH4 A;  5IYQ A;  1VQ5 B;  2D3L A;  5FO0 A;  4GQN A;  1D2E A;  2VBV A;  4BPR A;  2B5O A;  1EXM A;  2Q6I A;  1UMK A;  3R6J A;  3JQR A;  3W5V A;  4B3F X;  1K8A D;  1SM4 A;  5GV7 A;  3U2Q A;  2GJP A;  1VQ9 B;  3CCS B;  3ZZT A;  2M5S A;  2DEU A;  2XNC A;  5KW9 A;  1QVG B;  3OKX A;  4N3N A;  5E6T A;  2QEX B;  3J81 k;  1E3Z A;  2Q6K A;  2OBT A;  2QDX A;  4N3G A;  4RCZ A;  4YAL A;  1FRN A;  1KJZ A;  5J3O A;  3I56 B;  1VQ8 B;  3VMF A;  3Q6R A;  1K73 D;  2X6X A;  2V7Q A;  4KKU A;  3WBK A;  2DY1 A;  4B48 A;  1TUI A;  3VNU A;  3OZW A;  4K1X A;  2BPO A;  3ASP A;  4OOV A;  1G7S A;  1G7C A;  3ES9 A;  3LQ6 A;  2ZZQ A;  4M2L A;  4RM0 A;  4P6Y A;  1WTH D;  4QFM A;  1UD3 A;  2B7B A;  1KK3 A;  4G7W A;  4ZGN B;  3CPW B;  1SKQ A;  1F60 A;  3WNC A;  1IHM A;  3PUM A;  1ZUN B;  4QHY A;  1EP3 B;  1NDH A;  3ASQ A;  2OYN A;  2V4D A;  4P1V A;  1NJI D;  2P3M A;  1TLL A;  1QGY A;  1KK2 A;  1PJ5 A;  1R5N A;  5IK2 A;  4DK1 A;  1W9X A;  2CRV A;  3V7A A;  2BF4 A;  1F20 A;  3QFT A;  2PIA A;  2HLD A;  2QGG A;  4RD4 A;  4PAA A;  3ZIA A;  3R6K A;  4P9S A;  1VQM B;  2JDI A;  1YJ9 B;  1Y0Y A;  4YAW A;  2AHO A;  1V0F A;  5THX A;  2LZJ A;  1BMF A;  2HMA A;  4PC7 A;  1FNC A;  3GIR A;  2D9R A;  5IYW A;  1VHO A;  3ISX A;  2KVO A;  4M1K A;  3P27 A;  4XLF A;  4P3Y A;  3W5H A;  1S4M A;  2J7K A;  2R9V A;  3G05 A;  3W2G A;  5IYN A;  2OTL B;  3E1Y E;  2BMW A;  1VQ7 B;  3ASR A;  2ZBV A;  3NE5 B;  1XQB A;  4XD7 A;  2C4U A;  1NB0 A;  4DK0 A;  3OOC A;  2WPD A;  1JA0 A;  3AST A;  1VQP B;  4NNJ A;  3BC9 A;  2F1L A;  2BGI A;  2ZXI A;  1EFU A;  1KC8 D;  1TVC A;  2BM1 A;  4JMQ A;  1ZM4 A;  4M4S A;  4RD3 A;  2E1R A;  3ONY A;  3Q3A A;  2GK7 A;  3WND A;  3E20 A;  3LO8 A;  4OPO A;  2XEX A;  4FK8 A;  3G4S B;  3OEH A;  2QN6 A;  4WZK A;  1YLO A;  1G7R A;  1XB2 A;  3A8K A;  4QV2 A;  3FPP A;  3CCV B;  4Z1M A;  1BJK A;  3CME B;  1QG0 A;  1E1R A;  4RDL A;  1HZE A;  2W6J A;  3ZBT A;  2WJV A;  2D3N A;  4RD1 A;  4H9G A;  3T51 B;  4P26 A;  1VQ4 B;  1GJR A;  4AF6 A;  4II3 A;  1KK1 A;  3CTA A;  3FKS A;  2EFG A;  4X05 A;  4XON A;  4G1V A;  1S72 B;  1K28 D;  1QFY A;  5BSX A;  3QFS A;  5L46 A;  5FIU A;  2C2W A;  1YX2 A;  2I1L A;  5F4O A;  1ZM3 A;  4WQM A;  4Z4R A;  5KSW B;  2XZL A;  4OP7 A;  1VQL B;  2W6I A;  2GJR A;  2VZL A;  1VQ6 B;  4XN0 A;  2HDN B;  4XMY A;  4TMV A;  1VJS A;  4TMT A;  4M0L A;  4XQF A;  3PA1 A;  2PLF A;  2QTL A;  3CP8 A;  4XKW A;  1YI2 B;  1VLO A;  5TR9 A;  3AVW A;  2DCU A;  1PJ7 A;  1R5O A;  3A35 A;  1PJ6 A;  4XN3 A;  3AGP A;  4ZV4 A;  3ZZU A;  2C4T A;  2V7X A;  1T6X A;  2QA4 B;  2JJ1 A;  1N0V C;  4G6I A;  1KK0 A;  3CC4 B;  1VQK B;  2QTZ A;  2OBS A;  3CD6 B;  4P25 A;  3OW7 A;  1WOO A;  1D1N A;  2VNH A;  4P22 A;  1FX0 A;  3SJZ A;  4KKT A;  2ZXH A;  5F4M A;  3D26 A;  1FRQ A;  3SJP A;  4P12 A;  5HZA A;  3A1P A;  3W2I A;  1M90 D;  4B3X A;  2JJ2 A;  5EMN A;  4AF7 A;  3AVY A;  1DDG A;  1E3X A;  3JU4 A;  4YXW A;  5A88 A;  3CCE B;  3BY1 A;  1N08 A;  1UD4 A;  4IW3 B;  4DQL A;  3I1F A;  1WU8 A;  3LQE A;  4PC6 A;  5J35 A;  2YWF A;  3ZC3 A;  2VJI A;  2V7T A;  3WXM A;  3U6K A;  1M1K D;  1BX1 A;  4LBV A;  4X7C A;  3CPX A;  2ZZG A;  4DQK A;  1VQN B;  3VO1 A;  1E43 A;  3A8I A;  2BV3 A;  4XNF A;  2WYR A;  3U6B A;  4XOR A;  4WWV A;  3H9N A;  3CCL B;  3BCD A;  1K9M D;  3AVV A;  4RJL A;  4B47 A;  3CCQ B;  4X7E A;  4C43 A;  1VF7 A;  3QSY A;  1N8R D;  1QUF A;  2OK8 A;  4Y7C A;  2VBT A;  1DDI A;  1UD2 A;  1NB9 A;  1W87 A;  1WDT A;  3SLD A;  1FNM A;  1RQP A;  2YWE A;  1MAB A;  1J9Z A;  3CW2 A;  3CES A;  3W2H A;  1E62 A;  1GO2 A;  2X53 S;  2CF4 A;  2ZZF A;  4OPV A;  1ZM2 A;  4Z4W A;  1UD5 A;  4EH1 A;  1CNF A;  2B7C A;  4RD2 A;  4G1B A;  1BX0 A;  3MCA A;  1FDR A;  3AGQ A;  2GJK A;  5IYP A;  1QVF B;  1WOP A;  5TV2 A;  1OB2 A;  1IJF A;  2PMD A;  3A3G A;  1GVH A;  3BQJ A;  4PGO A;  1N05 A;  3QE2 A;  1WSR A;  4RDJ A;  2GPJ A;  4X7D A;  3GVK A;  5BSY A;  4Y9R A;  4WZT A;  1AMO A;  4LC0 A;  1S0U A;  1QFJ A;  4PAB A;  3G6E B;  3A3B A;  2WR8 A;  2VNJ A;  2CC2 A;  1V0E A;  3B8H A;  1YJW B;  5GV8 A;  2ZBU A;  1H85 A;  3BNW A;  4HE6 A;  2BSA A;  1WPC A;  5HZB A;  2X85 A;  2YWH A;  5DS0 A;  3SEJ A;  1KRH A;  1W0K A;  2V31 A;  1E1Q A;  4ZCI A;  4UZF A;  4C0S A;  3GSI A;  1EFC A;  5JBQ A;  1COW A;  1R5B A;  2XNJ A;  4B44 A;  4UZU A;  1B2R A;  4ACA A;  3SKB A;  4LBY A;  1Q82 D;  2DER A;  3OP1 A;  4X8I A;  2Q6O A;  3KL9 A;  4ZGQ B;  4OPS A;  1EP2 B;  3W2F A;  3GVL A;  4AVZ A;  4P6V F;  2ZL6 A;  3HAG A;  3OZV A;  2NPF A;  2CND A;  4M53 A;  3CXC B;  1KTV A;  4RPD A;  4Y9U A;  3P26 A;  4PC2 A;  1W0J A;  3CB4 A;  4ASU A;  2XZO A;  3PEN A;  5TY0 A;  3B78 A;  4PC3 A;  2VJJ A;  4YAU A;  3VNV A;  5DSZ A;  5A8A A;  2F4N A;  1B23 P;  2WJY A;  4QVA A;  4TMW A;  2WSS A;  3ASS A;  1KMH A;  5HXB A; 
#chains in the Genus database with same CATH homology
 3V7A A;  2ZL7 A;  3BY1 A;  3R6K A;  3LQE A;  5J35 A;  4P3I A;  4X7C A;  4QUZ A;  4Z4S A;  5IYW A;  4OOX A;  3BY2 A;  4Z4V A;  3PVD A;  4X7E A;  4Z4T A;  5IYN A;  3ASR A;  5IYR A;  3AST A;  3SLD A;  5HZA A;  4RDK A;  4P2N A;  3Q38 A;  3SLN A;  4OPV A;  4Z4W A;  3ONY A;  3Q3A A;  4X7F A;  2OBR A;  3RY8 A;  4ROX A;  4Z4Z A;  4OPO A;  4Z4U A;  4WZK A;  4Z4Y A;  4QV2 A;  4WZE A;  5IYP A;  3Q6Q A;  4X06 A;  4X07 A;  4RDL A;  5F4J A;  3BQJ A;  5IYQ A;  4RDJ A;  4WZL A;  3PA2 A;  4RLZ A;  4X7D A;  5BSY A;  3R6J A;  3PUN A;  4P26 A;  4WZT A;  4X05 A;  5KW9 A;  5BSX A;  5E6T A;  5F4O A;  4Z4R A;  5HZB A;  4OP7 A;  2OBT A;  3SEJ A;  2ZL5 A;  5J3O A;  3Q6R A;  3SKB A;  3ONU A;  3PA1 A;  4OPS A;  4X0C A;  4OOS A;  4QVJ A;  2ZL6 A;  3ASP A;  4OOV A;  4RPD A;  3LQ6 A;  4RM0 A;  3Q39 A;  2OBS A;  4P25 A;  4RPB A;  1IHM A;  3PUM A;  4QVA A;  3ASQ A;  5F4M A;  3D26 A;  4P1V A;  3SJP A;  4P12 A;  3ASS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...