4X7FA

Crystal structure of norovirus gii.10 p domain in complex with nano-25
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
314
structure length
307
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 72
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4x7fA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4x7fA01
2ZL6A 4X7EA 3Q6RA 4QVJA 2ZL7A 4P2NA 4WZLA 4P25A 4Z4YA 2OBTA 4Z4VA 4X06A 3BQJA 3SJPA 5F4OA 4RDLA 4OP7A 3ASSA 4OOVA 3Q6QA 3BY2A 4RM0A 4QUZA 4X7CA 4WZTA 3ASRA 5J35A 3Q39A 3PUNA 4Z4WA 3SLDA 4RDKA 4P1VA 3ASPA 4P26A 4QV2A 4RLZA 5IYNA 3ASTA 3LQ6A 4X7DA 3PA1A 4RDJA 5E6TA 4QVAA 5IYQA 4Z4SA 3BY1A 3LQEA 3SLNA 5J3OA 4RPDA 3ONUA 3Q3AA 5HZBA 4Z4UA 3ASQA 4RPBA 3PA2A 2ZL5A 5IYWA 4ROXA 4OOXA 4OOSA 3D26A 4P12A 3R6KA 3V7AA 4X7FA 3SKBA 4Z4RA 5KW9A 3R6JA 4Z4ZA 4WZKA 5BSYA 2OBSA 4OPSA 3PUMA 3ONYA 4Z4TA 5IYPA 4X05A 3PVDA 2OBRA 1IHMA 5BSXA 3SEJA 5HZAA 5IYRA 4P3IA 5F4JA 4WZEA 4X0CA 3Q38A 4OPVA 4X07A 3RY8A 5F4MA 4OPOA
chains in the Genus database with same CATH superfamily
2BM0A 2C4UA 1H8EA 3BCFA 1RQRA 1FNDA 2XZOA 4QVJA 1UD4A 4XM3A 4ZGQB 2VZLA 2CF4A 1DG1G 5B6IA 3T53B 4C0SA 5CDFA 1EWYA 4Z4VA 1MRZA 4B3XA 2F4NA 1QFJA 2BMWA 3WY9A 2X53S 2E1BA 2J7KA 3AVTA 1T6XA 1E3ZA 1YJNB 4OOVA 1NDHA 1BJKA 3BY2A 2C5HA 4YAOA 4TN1A 2DIEA 3CTAA 4QUZA 3G4SB 2ZTNA 1XE1A 3OW7A 4RD4A 4B47A 4WZTA 5J35A 4HE6A 1U2RA 2VNKA 4XKVA 4G1VA 1J9ZA 1Q81D 4Z4WA 1OB2A 4PC6A 4B44A 4FK8A 1JNYA 2VNJA 1QVFB 1FRQA 1PKVA 2GJKA 5DSZA 3OPOA 5IYNA 1FNMA 2JDIA 4G6IA 3ASTA 3CRZA 3LO8A 3LQ6A 4X7DA 2WSSA 2WJVA 1W2BB 1KK2A 2FX3A 4J0QA 4DK1A 1ZM2A 3WBKA 1EFTA 5E6TA 1EFUA 2DEUA 1YX2A 5IYQA 3ZPNA 2XZLA 3VMFA 1VQ5B 1NJID 1CQXA 4P9SA 3CPWB 1UD2A 2V7XA 4M2LA 5J3OA 4LC0A 1VQNB 1W34A 1WOSA 2PE3A 4ASUA 4NNJA 3AGPA 1HVXA 2QGGA 3CP8A 3CP2A 4PC1A 3ASQA 1K8AD 1AMOA 2ZZQA 1IB0A 3AGQA 3PA2A 1WSVA 2XNCA 2B7CA 4ZGNB 4C43A 1T6ZA 2BN4A 2OK7A 4X7FA 2GREA 4XMYA 2ZXHA 2QDXA 4Z4RA 2QE7A 2F43A 3ZIAA 1V0FA 4Y7CA 3CMAB 5KW9A 3OEHA 1M90D 5AN9A 4Z4ZA 1VQOB 5BSYA 2CW5A 4Q7JB 1BMFA 2DETA 4GQNA 1IJEA 5EMNA 1NB9A 1PJ6A 1Y0YA 2PMDA 3VO2A 4DQKA 2GPJA 1OGJA 1B23P 2DY1A 2VNHA 5BSXA 5H59A 2WJYA 4CQJA 3ZZUA 3CCEB 1JA1A 2RC5A 1YIJB 1QFYA 2WZNA 3W5HA 2BF4A 1Q82D 1PJ7A 3OOCA 4P3YA 1VQ6B 3ZBUA 3VNUA 2NV4A 3WYAA 5A88A 1GAWA 4Y9UA 3LVBA 4ZV4A 1UMKA 1WOPA 4NCNA 4X8IA 1IJFA 4PAAA 4DQLA 3OJWA 3RY8A 1N8RD 3CCLB 1G7CA 4PGOA 1H42A 2ZXIA 2ZL6A 1FNCA 1VLYA 3BC9A 4BPRA 1UD8A 3CW2A 3ZZ0A 1S72B 1YLOA 1WDTA 2B5OA 3BH4A 1K28D 3HAGA 2HMAA 1WP6A 3U6KA 5DS0A 4P25A 3T56B 1R5BA 1KZLA 2WR8A 1VHEA 2BGJA 5H5JA 4X06A 1B2RA 2BGIA 4TMWA 5F4OA 2OK8A 3NE5B 2GJPA 2ZZEA 4YAWA 3W2FA 1QUFA 4OP7A 1YJWB 3CCQB 2XGJA 4WWVA 2D3NA 1EFCA 2D3LA 4UAJA 3AVUA 1S0UA 3GSIA 4XLHA 2M5SA 4X7CA 3ASRA 2PLFA 4DK0A 1FDRA 3I56B 2JIZA 2VJIA 1GJRA 5KSWB 3FJOA 2ZBUA 2QTLA 4DNTB 3ZUGA 3FKSA 1QGAA 1D1NA 4XQFA 4P26A 4UZEA 1E1RA 4U9UA 5FA6A 3WNDA 3ZZTA 1Y0RA 4RLZA 1I8DA 2C2WA 2YWEA 4ZCIA 1DDGA 5HXBA 2XNJA 4ACAA 1VQ9B 4YHBA 5THXA 1E64A 3A35A 4L8JA 4E0FA 4RDJA 1SKQA 1VQPB 1AIPA 4TKOB 3CCJB 4XLEA 4XONA 2XOKA 1WU8A 1XQBA 1Q7YD 4RJLA 1T6YA 2D9RA 5FL7A 1WOOA 1W35A 4FN5A 1YJ9B 4RD0A 1KJZA 4RPDA 3OJXA 3AVWA 1ZM4A 1UD5A 3CMEB 3OKXA 4PC2A 5HZBA 3B8HA 1OHHA 2W6IA 4LBVA 1BPLA 4YELA 4P6YA 1ZM9A 1VHOA 1G7TA 1EP3B 3W2IA 2P3MA 4IW3B 4P12A 3DDYA 3V7AA 1GO2A 3WNBA 5FNZA 4TMTA 2V7TA 3H9NA 3W2HA 1Q9SA 5GV7A 1SKYB 1COWA 1Q86D 2F1MA 1N0VC 1FRNA 2QN6A 3PUMA 2F1LA 1N07A 3ONYA 1WPCA 4RD3A 1GAQA 3A8KA 3LNNA 1KK0A 2OBRA 1IHMA 1VLOA 2XZPA 3E1YE 3ZBTA 1K9MD 2VBTA 3BCDA 1TUIA 4AF6A 1TVCA 1W0JA 2B7BA 2OYNA 3WNCA 3J81k 4WZEA 1SM4A 3I55B 3VO1A 2ZBVA 1D8TA 4PC3A 4RD6A 1QG0A 2EFGA 2GK6A 1G7RA 4N3GA 1OB5A 1T5EA 4RD1A 4Z1MA 1YITB 1W9XA 3OAAA 4X0CA 4LBYA 3ZC3A 1ZUNB 1QH0A 4ZCMA 4R71A 4XLCA 4MYTA 4OPOA 3P27A 4UZUA 1WTHD 4M4SA 1KRHA 2XNDA 4AVZA 1BX1A 3B82A 4X7EA 3Q6RA 5L46A 1F60A 3AVVA 2ZL7A 4Y9RA 4WZLA 1BX0A 4Z4YA 4EH1A 2DCUA 4YAUA 5A8AA 4FWTA 4TMVA 3CCRB 3SJZA 4KKTA 1VQ8B 1FNBA 3BQJA 3SJPA 3T51B 1I7PA 1XB2A 4YXWA 1FX0A 1MABA 2WYRA 3JQPA 2VNIA 3FPKA 2WPDA 3ASSA 4XD7A 3QFSA 1YHQB 3Q6QA 2I1LA 4TT3A 1VQLB 1N0UA 4G5GA 4RM0A 2VBUA 3OZUA 3G05A 1VQKB 3GVLA 3H94A 3Q39A 2D74A 2QTZA 3A3GA 3KEWA 3PUNA 4TMZA 4M1KA 4RCZA 3QSYA 1E79A 2Q6OA 3SLDA 3BNWA 4RDKA 4P1VA 3ASPA 1VF7A 4QV2A 4YEJA 4KKSA 4WQMA 3U2QA 1GR1A 1NBMA 4PABA 1EP1B 3OZWA 3E20A 1QUEA 2WZPP 3QFCA 4G1BA 2E1RA 1UD3A 4QVAA 4Z4SA 3W5UA 4HIZA 2PIAA 4P6VF 3LQEA 1HA3A 4AF7A 2EIXA 1M1KD 2X6XA 3Q3AA 3A8JA 1QGZA 1R5OA 1V0EA 2JN9A 2CNDA 1DDIA 4XR6A 4B4DA 2YWFA 2R9VA 3AVXA 2ZL5A 3VNVA 1KK3A 1W87A 2CBXA 4OOXA 1KTVA 1KD1D 2VBSA 2HCJB 3CC2B 1EXMA 3W2EA 5GV8A 3SKBA 1N08A 2DYIA 3A3BA 2GJRA 3FPPA 3R6JA 5JBQA 4WZKA 3G6EB 1GVHA 1EP2B 1XFOA 1S4MA 3CESA 4QFMA 4XLAA 4X05A 1K73D 4G7XA 1QVGB 5TV2A 1TLLA 3AVYA 5TR9A 5F4JA 2CK3A 2GQFA 2Q6LA 3CCSB 2HLDA 2X6WA 4YAFA 1ZM3A 4ACBA 4II2A 3MMPA 2CC2A 3CC4B 2VBVA 1V5VA 1ELOA 4XOPA 3Q38A 1VQ4B 4LBWA 4OPVA 4XLFA 1TTTA 1QGYA 4NBSA 2BV3A 3A1PA 3GVKA 3OP1A 2OTLB 2VJJA 2Q6KA 5KNLA 3JQRA 4DNRB 1D2EA 4XL9A 2QEXB 3CC7B 3B78A 3QFRA 2YWGA 3ISXA 3OEEA 4P2NA 5HKKA 2Z6BD 1F20A 4B3FX 3MCAA 1A8PA 3OFNA 1KMHA 2OBTA 3I1FA 3OZVA 3WXMA 2V4DA 1KC8D 4TSFA 3QE2A 5FO0A 2V31A 1CNFA 2BPOA 4RDLA 3MHPA 4RCYA 3OW2B 2ZZGA 4XNFA 3JQQA 1WORA 1YI2B 3V76A 4XN0A 2CRVA 1EFRA 3PENA 1OB0A 1E62A 1VQMB 2DERA 2BSAA 2RC6A 2GK7A 2QA4B 4KKUA 2X85A 2C5BA 1WSRA 3CB4A 4ZCLA 5FIUA 5FO1A 4B43A 1RQPA 1JA0A 2X0KA 1H8HA 1KK1A 2ZTGA 4XN3A 2YWHA 2BVNA 1E3XA 2W6JA 2OTJB 3PA1A 1BQEA 1E63A 4PC7A 2DOGA 4M0LA 4B3GA 2Q6IA 4H9GA 1G7SA 4UZFA 3CCVB 4F7DA 3CMMA 3W2GA 2C77A 5TRDA 2V7QA 2X6YA 3BY1A 3SLNA 4XORA 4HE5A 1KQSB 4RD2A 3CCMB 1JJ2B 4QHYA 1R5NA 3ONUA 2LZJA 1P4MA 2KVOA 4JMQA 1QX4A 2X3UA 3GIRA 3U6BA 4Z4UA 1VQ7B 3P26A 4N3NA 1NRKA 1PJ5A 4RPBA 3QFTA 3A8IA 1UD6A 5IYWA 4ROXA 3OE7A 4II3A 2QMUA 4OOSA 4LBZA 2FVGA 3D26A 2V7VA 3R6KA 1HZEA 4M53A 1E1QA 2AHOA 2R6HA 4XKWA 4AC9A 3G71B 1I18A 3ES9A 2JJ1A 2X8KA 5LMZA 1N05A 4P22A 3CPXA 4TMXA 4G7WA 2C4TA 3WQZA 4MYUA 3VR6A 2OBSA 4OPSA 5IK2A 2V7UA 4Z4TA 5IYPA 4B48A 1QFZA 3PVDA 2HDNB 2VYQA 2JJ2A 2BM1A 1E43A 4FXUA 5TY0A 3SEJA 5HZAA 5IYRA 4P3IA 1W0KA 3W5VA 3GQBA 4YALA 3CD6B 1H85A 4XOTA 3KL9A 1BLIA 2C78A 3JU4A 5A89A 2ZITA 1VJSA 2NPFA 3WBJA 1DARA 1OGIA 3GVJA 1JB9A 2XEXA 1N06A 4X07A 2ZZFA 2V7WA 5F4MA 1CNEA 1NB0A 4K1XA 3CCUB 3CXCB 5DN6A
chains in the Genus database with same CATH topology
2ZL6A 4X7EA 3Q6RA 4QVJA 2ZL7A 4P2NA 4WZLA 4P25A 4Z4YA 2OBTA 4Z4VA 4X06A 3BQJA 3SJPA 5F4OA 4RDLA 4OP7A 3ASSA 4OOVA 3Q6QA 3BY2A 4RM0A 4QUZA 4X7CA 4WZTA 3ASRA 5J35A 3Q39A 3PUNA 4Z4WA 3SLDA 4RDKA 4P1VA 3ASPA 4P26A 4QV2A 4RLZA 5IYNA 3ASTA 3LQ6A 4X7DA 3PA1A 4RDJA 5E6TA 4QVAA 5IYQA 4Z4SA 3BY1A 3LQEA 3SLNA 5J3OA 4RPDA 3ONUA 3Q3AA 5HZBA 4Z4UA 3ASQA 4RPBA 3PA2A 2ZL5A 5IYWA 4ROXA 4OOXA 4OOSA 3D26A 4P12A 3R6KA 3V7AA 4X7FA 3SKBA 4Z4RA 5KW9A 3R6JA 4Z4ZA 4WZKA 5BSYA 2OBSA 4OPSA 3PUMA 3ONYA 4Z4TA 5IYPA 4X05A 3PVDA 2OBRA 1IHMA 5BSXA 3SEJA 5HZAA 5IYRA 4P3IA 5F4JA 4WZEA 4X0CA 3Q38A 4OPVA 4X07A 3RY8A 5F4MA 4OPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL6 A;  4X7E A;  3Q6R A;  4QVJ A;  2ZL7 A;  4P2N A;  4WZL A;  4P25 A;  4Z4Y A;  2OBT A;  4Z4V A;  4X06 A;  3BQJ A;  3SJP A;  5F4O A;  4RDL A;  4OP7 A;  3ASS A;  4OOV A;  3Q6Q A;  3BY2 A;  4RM0 A;  4QUZ A;  4X7C A;  4WZT A;  3ASR A;  5J35 A;  3Q39 A;  3PUN A;  4Z4W A;  3SLD A;  4RDK A;  4P1V A;  3ASP A;  4P26 A;  4QV2 A;  4RLZ A;  5IYN A;  3AST A;  3LQ6 A;  4X7D A;  3PA1 A;  4RDJ A;  5E6T A;  4QVA A;  5IYQ A;  4Z4S A;  3BY1 A;  3LQE A;  3SLN A;  5J3O A;  4RPD A;  3ONU A;  3Q3A A;  5HZB A;  4Z4U A;  3ASQ A;  4RPB A;  3PA2 A;  2ZL5 A;  5IYW A;  4ROX A;  4OOX A;  4OOS A;  3D26 A;  4P12 A;  3R6K A;  3V7A A;  4X7F A;  3SKB A;  4Z4R A;  5KW9 A;  3R6J A;  4Z4Z A;  4WZK A;  5BSY A;  2OBS A;  4OPS A;  3PUM A;  3ONY A;  4Z4T A;  5IYP A;  4X05 A;  3PVD A;  2OBR A;  1IHM A;  5BSX A;  3SEJ A;  5HZA A;  5IYR A;  4P3I A;  5F4J A;  4WZE A;  4X0C A;  3Q38 A;  4OPV A;  4X07 A;  3RY8 A;  5F4M A;  4OPO A; 
#chains in the Genus database with same CATH topology
 2BM0 A;  2C4U A;  1H8E A;  3BCF A;  1RQR A;  1FND A;  2XZO A;  4QVJ A;  1UD4 A;  4XM3 A;  4ZGQ B;  2VZL A;  2CF4 A;  1DG1 G;  5B6I A;  3T53 B;  4C0S A;  5CDF A;  1EWY A;  4Z4V A;  1MRZ A;  4B3X A;  2F4N A;  1QFJ A;  2BMW A;  3WY9 A;  2X53 S;  2E1B A;  2J7K A;  3AVT A;  1T6X A;  1E3Z A;  1YJN B;  4OOV A;  1NDH A;  1BJK A;  3BY2 A;  2C5H A;  4YAO A;  4TN1 A;  2DIE A;  3CTA A;  4QUZ A;  3G4S B;  2ZTN A;  1XE1 A;  3OW7 A;  4RD4 A;  4B47 A;  4WZT A;  5J35 A;  4HE6 A;  1U2R A;  2VNK A;  4XKV A;  4G1V A;  1J9Z A;  1Q81 D;  4Z4W A;  1OB2 A;  4PC6 A;  4B44 A;  4FK8 A;  1JNY A;  2VNJ A;  1QVF B;  1FRQ A;  1PKV A;  2GJK A;  5DSZ A;  3OPO A;  5IYN A;  1FNM A;  2JDI A;  4G6I A;  3AST A;  3CRZ A;  3LO8 A;  3LQ6 A;  4X7D A;  2WSS A;  2WJV A;  1W2B B;  1KK2 A;  2FX3 A;  4J0Q A;  4DK1 A;  1ZM2 A;  3WBK A;  1EFT A;  5E6T A;  1EFU A;  2DEU A;  1YX2 A;  5IYQ A;  3ZPN A;  2XZL A;  3VMF A;  1VQ5 B;  1NJI D;  1CQX A;  4P9S A;  3CPW B;  1UD2 A;  2V7X A;  4M2L A;  5J3O A;  4LC0 A;  1VQN B;  1W34 A;  1WOS A;  2PE3 A;  4ASU A;  4NNJ A;  3AGP A;  1HVX A;  2QGG A;  3CP8 A;  3CP2 A;  4PC1 A;  3ASQ A;  1K8A D;  1AMO A;  2ZZQ A;  1IB0 A;  3AGQ A;  3PA2 A;  1WSV A;  2XNC A;  2B7C A;  4ZGN B;  4C43 A;  1T6Z A;  2BN4 A;  2OK7 A;  4X7F A;  2GRE A;  4XMY A;  2ZXH A;  2QDX A;  4Z4R A;  2QE7 A;  2F43 A;  3ZIA A;  1V0F A;  4Y7C A;  3CMA B;  5KW9 A;  3OEH A;  1M90 D;  5AN9 A;  4Z4Z A;  1VQO B;  5BSY A;  2CW5 A;  4Q7J B;  1BMF A;  2DET A;  4GQN A;  1IJE A;  5EMN A;  1NB9 A;  1PJ6 A;  1Y0Y A;  2PMD A;  3VO2 A;  4DQK A;  2GPJ A;  1OGJ A;  1B23 P;  2DY1 A;  2VNH A;  5BSX A;  5H59 A;  2WJY A;  4CQJ A;  3ZZU A;  3CCE B;  1JA1 A;  2RC5 A;  1YIJ B;  1QFY A;  2WZN A;  3W5H A;  2BF4 A;  1Q82 D;  1PJ7 A;  3OOC A;  4P3Y A;  1VQ6 B;  3ZBU A;  3VNU A;  2NV4 A;  3WYA A;  5A88 A;  1GAW A;  4Y9U A;  3LVB A;  4ZV4 A;  1UMK A;  1WOP A;  4NCN A;  4X8I A;  1IJF A;  4PAA A;  4DQL A;  3OJW A;  3RY8 A;  1N8R D;  3CCL B;  1G7C A;  4PGO A;  1H42 A;  2ZXI A;  2ZL6 A;  1FNC A;  1VLY A;  3BC9 A;  4BPR A;  1UD8 A;  3CW2 A;  3ZZ0 A;  1S72 B;  1YLO A;  1WDT A;  2B5O A;  3BH4 A;  1K28 D;  3HAG A;  2HMA A;  1WP6 A;  3U6K A;  5DS0 A;  4P25 A;  3T56 B;  1R5B A;  1KZL A;  2WR8 A;  1VHE A;  2BGJ A;  5H5J A;  4X06 A;  1B2R A;  2BGI A;  4TMW A;  5F4O A;  2OK8 A;  3NE5 B;  2GJP A;  2ZZE A;  4YAW A;  3W2F A;  1QUF A;  4OP7 A;  1YJW B;  3CCQ B;  2XGJ A;  4WWV A;  2D3N A;  1EFC A;  2D3L A;  4UAJ A;  3AVU A;  1S0U A;  3GSI A;  4XLH A;  2M5S A;  4X7C A;  3ASR A;  2PLF A;  4DK0 A;  1FDR A;  3I56 B;  2JIZ A;  2VJI A;  1GJR A;  5KSW B;  3FJO A;  2ZBU A;  2QTL A;  4DNT B;  3ZUG A;  3FKS A;  1QGA A;  1D1N A;  4XQF A;  4P26 A;  4UZE A;  1E1R A;  4U9U A;  5FA6 A;  3WND A;  3ZZT A;  1Y0R A;  4RLZ A;  1I8D A;  2C2W A;  2YWE A;  4ZCI A;  1DDG A;  5HXB A;  2XNJ A;  4ACA A;  1VQ9 B;  4YHB A;  5THX A;  1E64 A;  3A35 A;  4L8J A;  4E0F A;  4RDJ A;  1SKQ A;  1VQP B;  1AIP A;  4TKO B;  3CCJ B;  4XLE A;  4XON A;  2XOK A;  1WU8 A;  1XQB A;  1Q7Y D;  4RJL A;  1T6Y A;  2D9R A;  5FL7 A;  1WOO A;  1W35 A;  4FN5 A;  1YJ9 B;  4RD0 A;  1KJZ A;  4RPD A;  3OJX A;  3AVW A;  1ZM4 A;  1UD5 A;  3CME B;  3OKX A;  4PC2 A;  5HZB A;  3B8H A;  1OHH A;  2W6I A;  4LBV A;  1BPL A;  4YEL A;  4P6Y A;  1ZM9 A;  1VHO A;  1G7T A;  1EP3 B;  3W2I A;  2P3M A;  4IW3 B;  4P12 A;  3DDY A;  3V7A A;  1GO2 A;  3WNB A;  5FNZ A;  4TMT A;  2V7T A;  3H9N A;  3W2H A;  1Q9S A;  5GV7 A;  1SKY B;  1COW A;  1Q86 D;  2F1M A;  1N0V C;  1FRN A;  2QN6 A;  3PUM A;  2F1L A;  1N07 A;  3ONY A;  1WPC A;  4RD3 A;  1GAQ A;  3A8K A;  3LNN A;  1KK0 A;  2OBR A;  1IHM A;  1VLO A;  2XZP A;  3E1Y E;  3ZBT A;  1K9M D;  2VBT A;  3BCD A;  1TUI A;  4AF6 A;  1TVC A;  1W0J A;  2B7B A;  2OYN A;  3WNC A;  3J81 k;  4WZE A;  1SM4 A;  3I55 B;  3VO1 A;  2ZBV A;  1D8T A;  4PC3 A;  4RD6 A;  1QG0 A;  2EFG A;  2GK6 A;  1G7R A;  4N3G A;  1OB5 A;  1T5E A;  4RD1 A;  4Z1M A;  1YIT B;  1W9X A;  3OAA A;  4X0C A;  4LBY A;  3ZC3 A;  1ZUN B;  1QH0 A;  4ZCM A;  4R71 A;  4XLC A;  4MYT A;  4OPO A;  3P27 A;  4UZU A;  1WTH D;  4M4S A;  1KRH A;  2XND A;  4AVZ A;  1BX1 A;  3B82 A;  4X7E A;  3Q6R A;  5L46 A;  1F60 A;  3AVV A;  2ZL7 A;  4Y9R A;  4WZL A;  1BX0 A;  4Z4Y A;  4EH1 A;  2DCU A;  4YAU A;  5A8A A;  4FWT A;  4TMV A;  3CCR B;  3SJZ A;  4KKT A;  1VQ8 B;  1FNB A;  3BQJ A;  3SJP A;  3T51 B;  1I7P A;  1XB2 A;  4YXW A;  1FX0 A;  1MAB A;  2WYR A;  3JQP A;  2VNI A;  3FPK A;  2WPD A;  3ASS A;  4XD7 A;  3QFS A;  1YHQ B;  3Q6Q A;  2I1L A;  4TT3 A;  1VQL B;  1N0U A;  4G5G A;  4RM0 A;  2VBU A;  3OZU A;  3G05 A;  1VQK B;  3GVL A;  3H94 A;  3Q39 A;  2D74 A;  2QTZ A;  3A3G A;  3KEW A;  3PUN A;  4TMZ A;  4M1K A;  4RCZ A;  3QSY A;  1E79 A;  2Q6O A;  3SLD A;  3BNW A;  4RDK A;  4P1V A;  3ASP A;  1VF7 A;  4QV2 A;  4YEJ A;  4KKS A;  4WQM A;  3U2Q A;  1GR1 A;  1NBM A;  4PAB A;  1EP1 B;  3OZW A;  3E20 A;  1QUE A;  2WZP P;  3QFC A;  4G1B A;  2E1R A;  1UD3 A;  4QVA A;  4Z4S A;  3W5U A;  4HIZ A;  2PIA A;  4P6V F;  3LQE A;  1HA3 A;  4AF7 A;  2EIX A;  1M1K D;  2X6X A;  3Q3A A;  3A8J A;  1QGZ A;  1R5O A;  1V0E A;  2JN9 A;  2CND A;  1DDI A;  4XR6 A;  4B4D A;  2YWF A;  2R9V A;  3AVX A;  2ZL5 A;  3VNV A;  1KK3 A;  1W87 A;  2CBX A;  4OOX A;  1KTV A;  1KD1 D;  2VBS A;  2HCJ B;  3CC2 B;  1EXM A;  3W2E A;  5GV8 A;  3SKB A;  1N08 A;  2DYI A;  3A3B A;  2GJR A;  3FPP A;  3R6J A;  5JBQ A;  4WZK A;  3G6E B;  1GVH A;  1EP2 B;  1XFO A;  1S4M A;  3CES A;  4QFM A;  4XLA A;  4X05 A;  1K73 D;  4G7X A;  1QVG B;  5TV2 A;  1TLL A;  3AVY A;  5TR9 A;  5F4J A;  2CK3 A;  2GQF A;  2Q6L A;  3CCS B;  2HLD A;  2X6W A;  4YAF A;  1ZM3 A;  4ACB A;  4II2 A;  3MMP A;  2CC2 A;  3CC4 B;  2VBV A;  1V5V A;  1ELO A;  4XOP A;  3Q38 A;  1VQ4 B;  4LBW A;  4OPV A;  4XLF A;  1TTT A;  1QGY A;  4NBS A;  2BV3 A;  3A1P A;  3GVK A;  3OP1 A;  2OTL B;  2VJJ A;  2Q6K A;  5KNL A;  3JQR A;  4DNR B;  1D2E A;  4XL9 A;  2QEX B;  3CC7 B;  3B78 A;  3QFR A;  2YWG A;  3ISX A;  3OEE A;  4P2N A;  5HKK A;  2Z6B D;  1F20 A;  4B3F X;  3MCA A;  1A8P A;  3OFN A;  1KMH A;  2OBT A;  3I1F A;  3OZV A;  3WXM A;  2V4D A;  1KC8 D;  4TSF A;  3QE2 A;  5FO0 A;  2V31 A;  1CNF A;  2BPO A;  4RDL A;  3MHP A;  4RCY A;  3OW2 B;  2ZZG A;  4XNF A;  3JQQ A;  1WOR A;  1YI2 B;  3V76 A;  4XN0 A;  2CRV A;  1EFR A;  3PEN A;  1OB0 A;  1E62 A;  1VQM B;  2DER A;  2BSA A;  2RC6 A;  2GK7 A;  2QA4 B;  4KKU A;  2X85 A;  2C5B A;  1WSR A;  3CB4 A;  4ZCL A;  5FIU A;  5FO1 A;  4B43 A;  1RQP A;  1JA0 A;  2X0K A;  1H8H A;  1KK1 A;  2ZTG A;  4XN3 A;  2YWH A;  2BVN A;  1E3X A;  2W6J A;  2OTJ B;  3PA1 A;  1BQE A;  1E63 A;  4PC7 A;  2DOG A;  4M0L A;  4B3G A;  2Q6I A;  4H9G A;  1G7S A;  4UZF A;  3CCV B;  4F7D A;  3CMM A;  3W2G A;  2C77 A;  5TRD A;  2V7Q A;  2X6Y A;  3BY1 A;  3SLN A;  4XOR A;  4HE5 A;  1KQS B;  4RD2 A;  3CCM B;  1JJ2 B;  4QHY A;  1R5N A;  3ONU A;  2LZJ A;  1P4M A;  2KVO A;  4JMQ A;  1QX4 A;  2X3U A;  3GIR A;  3U6B A;  4Z4U A;  1VQ7 B;  3P26 A;  4N3N A;  1NRK A;  1PJ5 A;  4RPB A;  3QFT A;  3A8I A;  1UD6 A;  5IYW A;  4ROX A;  3OE7 A;  4II3 A;  2QMU A;  4OOS A;  4LBZ A;  2FVG A;  3D26 A;  2V7V A;  3R6K A;  1HZE A;  4M53 A;  1E1Q A;  2AHO A;  2R6H A;  4XKW A;  4AC9 A;  3G71 B;  1I18 A;  3ES9 A;  2JJ1 A;  2X8K A;  5LMZ A;  1N05 A;  4P22 A;  3CPX A;  4TMX A;  4G7W A;  2C4T A;  3WQZ A;  4MYU A;  3VR6 A;  2OBS A;  4OPS A;  5IK2 A;  2V7U A;  4Z4T A;  5IYP A;  4B48 A;  1QFZ A;  3PVD A;  2HDN B;  2VYQ A;  2JJ2 A;  2BM1 A;  1E43 A;  4FXU A;  5TY0 A;  3SEJ A;  5HZA A;  5IYR A;  4P3I A;  1W0K A;  3W5V A;  3GQB A;  4YAL A;  3CD6 B;  1H85 A;  4XOT A;  3KL9 A;  1BLI A;  2C78 A;  3JU4 A;  5A89 A;  2ZIT A;  1VJS A;  2NPF A;  3WBJ A;  1DAR A;  1OGI A;  3GVJ A;  1JB9 A;  2XEX A;  1N06 A;  4X07 A;  2ZZF A;  2V7W A;  5F4M A;  1CNE A;  1NB0 A;  4K1X A;  3CCU B;  3CXC B;  5DN6 A; 
#chains in the Genus database with same CATH homology
 2ZL6 A;  4X7E A;  3Q6R A;  4QVJ A;  2ZL7 A;  4P2N A;  4WZL A;  4P25 A;  4Z4Y A;  2OBT A;  4Z4V A;  4X06 A;  3BQJ A;  3SJP A;  5F4O A;  4RDL A;  4OP7 A;  3ASS A;  4OOV A;  3Q6Q A;  3BY2 A;  4RM0 A;  4QUZ A;  4X7C A;  4WZT A;  3ASR A;  5J35 A;  3Q39 A;  3PUN A;  4Z4W A;  3SLD A;  4RDK A;  4P1V A;  3ASP A;  4P26 A;  4QV2 A;  4RLZ A;  5IYN A;  3AST A;  3LQ6 A;  4X7D A;  3PA1 A;  4RDJ A;  5E6T A;  4QVA A;  5IYQ A;  4Z4S A;  3BY1 A;  3LQE A;  3SLN A;  5J3O A;  4RPD A;  3ONU A;  3Q3A A;  5HZB A;  4Z4U A;  3ASQ A;  4RPB A;  3PA2 A;  2ZL5 A;  5IYW A;  4ROX A;  4OOX A;  4OOS A;  3D26 A;  4P12 A;  3R6K A;  3V7A A;  4X7F A;  3SKB A;  4Z4R A;  5KW9 A;  3R6J A;  4Z4Z A;  4WZK A;  5BSY A;  2OBS A;  4OPS A;  3PUM A;  3ONY A;  4Z4T A;  5IYP A;  4X05 A;  3PVD A;  2OBR A;  1IHM A;  5BSX A;  3SEJ A;  5HZA A;  5IYR A;  4P3I A;  5F4J A;  4WZE A;  4X0C A;  3Q38 A;  4OPV A;  4X07 A;  3RY8 A;  5F4M A;  4OPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...