4X7FA

Crystal structure of norovirus gii.10 p domain in complex with nano-25
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
314
structure length
307
Chain Sequence
b'KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 72
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4x7fA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4x7fA01
3SLDA 4RPDA 5IYRA 3ASPA 4Z4ZA 2ZL5A 4OOVA 4Z4YA 3PA1A 3R6JA 5IYWA 3V7AA 3PUNA 4QVJA 5BSXA 4X0CA 5J3OA 3D26A 3Q39A 4X06A 4OOXA 4WZTA 3BY1A 3BQJA 5HZAA 3ASQA 3Q6QA 3BY2A 2ZL6A 3ASTA 4OOSA 4X7EA 4P26A 3RY8A 3ONUA 4P2NA 4Z4WA 5J35A 4RPBA 4Z4UA 2OBSA 4RM0A 4X07A 5BSYA 4P25A 3SEJA 4WZEA 5F4OA 5KW9A 4X7FA 5F4MA 4RDJA 4OPSA 3Q6RA 4OPVA 3Q3AA 3SKBA 5F4JA 4OPOA 5HZBA 4QUZA 5IYPA 3ONYA 3LQEA 3R6KA 4WZLA 2OBTA 3PUMA 4Z4RA 2OBRA 4RDLA 4P12A 4Z4SA 4RLZA 3ASSA 3PA2A 5E6TA 4P3IA 4Z4TA 4OP7A 4QVAA 3LQ6A 4RDKA 4X7CA 3ASRA 4Z4VA 4P1VA 1IHMA 4QV2A 4ROXA 3Q38A 2ZL7A 5IYNA 3PVDA 5IYQA 4X7DA 4X05A 4WZKA 3SLNA 3SJPA
chains in the Genus database with same CATH superfamily
3OP1A 1V0FA 2DEUA 4P3YA 4Q7JB 3SLDA 1XE1A 5FO0A 2QA4B 2V4DA 3BH4A 3AGQA 5H59A 1YHQB 4TMWA 3J81k 1E3ZA 4OOVA 4GQNA 4DNRB 1Y0YA 3BCFA 1WOSA 4G5GA 3WNCA 1S0UA 2VNKA 5FNZA 1G7RA 1W87A 5KNLA 5EMNA 1OB5A 5B6IA 2DETA 1TUIA 2B7CA 4Y9UA 3WXMA 3D26A 1KRHA 2JIZA 1H8EA 4E0FA 1EP3B 2D74A 3FPPA 3CCRB 1TTTA 5HXBA 3OZWA 4HE5A 1K8AD 4X8IA 1AMOA 2JJ1A 2GQFA 1BX0A 1OGJA 3ONUA 3OJXA 4XN3A 3H94A 2V7QA 2I1LA 4XLAA 4X07A 3CCEB 4B43A 3CCJB 4DK0A 4PGOA 3SEJA 3OJWA 2J7KA 2Q6LA 3BC9A 5F4OA 4BPRA 5KW9A 4Y9RA 3OZUA 4LBWA 3CCMB 3VO2A 4LBZA 4NNJA 1YI2B 4OPSA 1PJ5A 1TLLA 4OPVA 1NJID 4TSFA 2WR8A 3CP8A 5F4JA 1DARA 1ZM9A 2XNJA 2W6IA 4ZV4A 1MABA 1GJRA 2QGGA 2VBVA 1XQBA 1I7PA 3AVYA 2GPJA 4YXWA 3ONYA 2D9RA 4QFMA 2F1LA 1WTHD 2PIAA 3GQBA 3PUMA 4PC7A 2V7XA 3E1YE 4B4DA 1M90D 3LO8A 3P26A 3E20A 4P9SA 1E79A 4UAJA 4PC6A 1OB2A 1WU8A 4XL9A 3AVVA 4AF6A 2E1BA 1G7CA 4PC1A 4YAUA 3PA2A 4XORA 5E6TA 1WOPA 3WNBA 2BGJA 1QUFA 1YJWB 2WSSA 1V0EA 3W2EA 1UD4A 1Q86D 4B3GA 2GK7A 2ZITA 3QE2A 2X6XA 2AHOA 3DDYA 4TMVA 3OOCA 4XR6A 4XQFA 4UZUA 4K1XA 4ACBA 3G05A 1OGIA 3Q38A 1EFCA 1VLOA 1T6YA 2VBUA 3A8KA 3PVDA 4KKTA 4Y7CA 1U2RA 1S72B 2CF4A 1VQNB 1NDHA 1EFRA 3CESA 1IB0A 3ZPNA 5TY0A 2C4TA 4TMXA 3CC2B 2QEXB 4II2A 3WBKA 3MCAA 3SLNA 2OK8A 4DQKA 4RPDA 1DG1G 1RQRA 3OFNA 3ZC3A 2QN6A 3ZBTA 3ASPA 3CCLB 2NPFA 2ZZGA 2VJJA 3R6JA 2CW5A 1W35A 5IYWA 2DYIA 2X0KA 4QVJA 2BF4A 1E3XA 1JA0A 2CNDA 1M1KD 4XLCA 3CC4B 5AN9A 4FXUA 4X06A 3U6KA 1KTVA 3VR6A 3U2QA 3GIRA 3AGPA 2XGJA 5HZAA 2C77A 3W2GA 1QGYA 3Q6QA 4RD2A 4C43A 4OOSA 2ZXHA 3W5VA 3WYAA 2R6HA 1QVGB 2V7WA 4KKSA 2KVOA 1CNFA 1FRNA 4P2NA 3JQRA 2JJ2A 1BJKA 2EFGA 2OBSA 4FN5A 4P25A 1QH0A 3MMPA 4MYUA 2YWHA 1QX4A 4DK1A 4RD3A 1COWA 4HIZA 3G6EB 1GO2A 4YHBA 1ELOA 2Q6OA 4RDJA 4XLEA 1OB0A 1QUEA 1N8RD 4YALA 1N05A 1PJ6A 4B47A 3GSIA 1KZLA 3ZUGA 3A8JA 3ZZ0A 3CC7B 2YWGA 1W0JA 4P22A 3CP2A 4OPOA 4PC3A 2HMAA 1Q9SA 4G1VA 4QUZA 4XLFA 1T6XA 1GVHA 1UMKA 2F1MA 3WQZA 1EFTA 3GVLA 1DDGA 4B3FX 2CC2A 1G7TA 4RDLA 4Z4RA 1EXMA 4P12A 3OW2B 3B8HA 3QFTA 3ZZUA 2VJIA 2ZTGA 4ZCLA 4LBYA 3I55B 4II3A 1KC8D 3ASSA 1E63A 3NE5B 3CPWB 3VNVA 2X6YA 3A1PA 3OW7A 2V7TA 3QFRA 4P3IA 3CXCB 3CMEB 3JQQA 1ZM3A 4XOTA 4OP7A 1UD3A 3CTAA 1BX1A 3AVUA 2HCJB 4YAWA 2HLDA 4RDKA 4FWTA 4J0QA 4X7CA 3ASRA 4Z1MA 3G4SB 5TV2A 1VQ4B 1QGAA 2YWFA 1GAWA 1EP2B 3AVXA 1SKQA 1Y0RA 4TMTA 1SKYB 2C2WA 4PC2A 1IJEA 1GR1A 1ZM4A 4WQMA 2VNHA 4NCNA 4AVZA 1I18A 2ZZFA 2BSAA 3ZZTA 5IYNA 1HZEA 1VQKB 2GJPA 2NV4A 2B7BA 4TKOB 4XLHA 4P6VF 1E62A 1MRZA 1CQXA 2PE3A 1UD5A 1W2BB 2GK6A 2XEXA 2W6JA 4UZEA 4YAOA 1AIPA 4L8JA 4X7DA 1SM4A 4ACAA 1QVFB 4CQJA 4TMZA 3G71B 1W34A 4X05A 2WJYA 4XONA 2CRVA 2X85A 5DN6A 4B44A 1NB0A 4WZKA 3A3BA 1VLYA 4YELA 2GREA 2C5HA 3SJPA 4B3XA 3ZIAA 1WDTA 3PENA 4MYTA 5IYRA 2CBXA 4HE6A 2DY1A 1K73D 2ZL5A 4FK8A 4PABA 2ZBVA 2HDNB 2ZZEA 3BCDA 4ZCIA 3PA1A 4TN1A 5A89A 1KK1A 1WSVA 1VHEA 4M2LA 1VQMB 1CNEA 2ZBUA 4RD6A 1IJFA 2V7UA 3PUNA 1TVCA 5BSXA 4X0CA 1J9ZA 3CCVB 5J3OA 1YJ9B 5KSWB 1WPCA 2QMUA 3JU4A 4KKUA 3CD6B 1T6ZA 2B5OA 3BY1A 3KL9A 5FA6A 3BQJA 4U9UA 3ASQA 2WJVA 4C0SA 1FX0A 2ZL6A 3ASTA 4ASUA 2D3NA 2VNJA 3AVTA 4P26A 3CCQB 1W9XA 3RY8A 3CRZA 3WY9A 1BQEA 5J35A 1P4MA 3T56B 1VF7A 3I56B 3GVJA 1ZUNB 3MHPA 1EFUA 4Z4UA 4N3GA 1E1RA 1EP1B 1H8HA 4G7XA 2QTLA 4X7FA 1H85A 1VQ9B 1KK3A 5F4MA 5FL7A 1WORA 3WNDA 2JDIA 2PMDA 4NBSA 3OEEA 1VQ6B 3ES9A 3A3GA 2OTLB 1NBMA 3Q3AA 5FO1A 2BPOA 4IW3B 3SKBA 2VBTA 1JA1A 1VHOA 5THXA 1YJNB 1BPLA 4M4SA 4PAAA 5DSZA 4G7WA 2FX3A 1N06A 1EWYA 3U6BA 2D3LA 5A88A 3ZBUA 4WZLA 2DCUA 3CCUB 4AF7A 3OAAA 4RCZA 3W2IA 1VQLB 4N3NA 2OBRA 2GJKA 3I1FA 2BN4A 1PJ7A 4Z4SA 4RLZA 1ZM2A 1Q81D 1R5OA 1PKVA 3VMFA 1N08A 1G7SA 1UD2A 4XKWA 3OE7A 4G6IA 5GV8A 1XFOA 1B2RA 2ZXIA 1S4MA 1I8DA 3GVKA 2CK3A 4Z4TA 2R9VA 1W0KA 4DNTB 1Q82D 4M53A 4WWVA 1VQ8B 2BMWA 5DS0A 4M0LA 2DOGA 3VO1A 3QSYA 2E1RA 2BGIA 2BM1A 1JJ2B 5LMZA 1D8TA 1T5EA 2LZJA 4P1VA 1IHMA 1FDRA 4ZGNB 1Q7YD 3WBJA 4ROXA 2X3UA 3CMMA 1QFJA 2ZL7A 2WZPP 3VNUA 4LC0A 1FRQA 1E64A 1B23P 3H9NA 3CPXA 3LNNA 1K9MD 2M5SA 4QHYA 2VZLA 1D2EA 2WZNA 4LBVA 1DDIA 2X8KA 1YITB 3CB4A 2OTJB 4RCYA 2Z6BD 2F4NA 3CMAB 3JQPA 1QFZA 1FNMA 4Z4ZA 2XOKA 1F60A 2PLFA 1R5NA 1WSRA 3W5HA 4Z4YA 4ZCMA 2XZLA 4G1BA 3OZVA 1F20A 1VJSA 2F43A 1A8PA 3V7AA 2XZPA 2QE7A 2YWEA 1KJZA 3Q39A 1E1QA 4EH1A 1N0VC 4OOXA 4WZTA 5A8AA 4F7DA 2C5BA 3A8IA 3T51B 2BV3A 3A35A 3BY2A 1BMFA 4X7EA 1VQOB 3OKXA 4AC9A 4Z4WA 5IK2A 1JB9A 3T53B 1VQ5B 3HAGA 4RPBA 5BSYA 3QFCA 3OEHA 4RM0A 1YIJB 1YLOA 2VNIA 3FKSA 3OPOA 4WZEA 5TR9A 1KD1D 4P6YA 1WP6A 4XD7A 2Q6IA 4YEJA 4M1KA 4XM3A 3Q6RA 4UZFA 5H5JA 1D1NA 3QFSA 3CCSB 1KMHA 2FVGA 5CDFA 3W5UA 5HKKA 4XOPA 1JNYA 2ZTNA 3LVBA 4R71A 2WYRA 5HZBA 2VYQA 5FIUA 3V76A 2RC5A 3CW2A 5IYPA 1KQSB 1QFYA 1HA3A 1HVXA 5GV7A 1XB2A 2ZZQA 3LQEA 3R6KA 3FJOA 2OBTA 4XMYA 1E43A 1KK0A 2VBSA 3KEWA 4TT3A 4YAFA 4RD1A 2Q6KA 4RD4A 1UD8A 1FNBA 2DIEA 1VQPB 4H9GA 3P27A 2V7VA 2BVNA 2X53S 3B82A 4ZGQB 2DERA 1FNDA 2OK7A 1BLIA 2P3MA 2V31A 4QVAA 1V5VA 5TRDA 3SJZA 3LQ6A 3FPKA 1NRKA 1N0UA 2RC6A 3B78A 1KK2A 3BNWA 1YX2A 1QGZA 4Z4VA 2WPDA 1K28D 2JN9A 1NB9A 1WOOA 4DQLA 2XZOA 2EIXA 1FNCA 4JMQA 4QV2A 3W2HA 1UD6A 4RJLA 4B48A 5L46A 2C4UA 3W2FA 2XNDA 2X6WA 4XKVA 2BM0A 3ISXA 2OYNA 2QDXA 5IYQA 4XNFA 4RD0A 1VQ7B 1GAQA 1H42A 2GJRA 1OHHA 1R5BA 1QG0A 1N07A 5JBQA 2C78A 4XN0A 2XNCA 2QTZA 3AVWA 1RQPA
chains in the Genus database with same CATH topology
3SLDA 4RPDA 5IYRA 3ASPA 4Z4ZA 2ZL5A 4OOVA 4Z4YA 3PA1A 3R6JA 5IYWA 3V7AA 3PUNA 4QVJA 5BSXA 4X0CA 5J3OA 3D26A 3Q39A 4X06A 4OOXA 4WZTA 3BY1A 3BQJA 5HZAA 3ASQA 3Q6QA 3BY2A 2ZL6A 3ASTA 4OOSA 4X7EA 4P26A 3RY8A 3ONUA 4P2NA 4Z4WA 5J35A 4RPBA 4Z4UA 2OBSA 4RM0A 4X07A 5BSYA 4P25A 3SEJA 4WZEA 5F4OA 5KW9A 4X7FA 5F4MA 4RDJA 4OPSA 3Q6RA 4OPVA 3Q3AA 3SKBA 5F4JA 4OPOA 5HZBA 4QUZA 5IYPA 3ONYA 3LQEA 3R6KA 4WZLA 2OBTA 3PUMA 4Z4RA 2OBRA 4RDLA 4P12A 4Z4SA 4RLZA 3ASSA 3PA2A 5E6TA 4P3IA 4Z4TA 4OP7A 4QVAA 3LQ6A 4RDKA 4X7CA 3ASRA 4Z4VA 4P1VA 1IHMA 4QV2A 4ROXA 3Q38A 2ZL7A 5IYNA 3PVDA 5IYQA 4X7DA 4X05A 4WZKA 3SLNA 3SJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SLD A;  4RPD A;  5IYR A;  3ASP A;  4Z4Z A;  2ZL5 A;  4OOV A;  4Z4Y A;  3PA1 A;  3R6J A;  5IYW A;  3V7A A;  3PUN A;  4QVJ A;  5BSX A;  4X0C A;  5J3O A;  3D26 A;  3Q39 A;  4X06 A;  4OOX A;  4WZT A;  3BY1 A;  3BQJ A;  5HZA A;  3ASQ A;  3Q6Q A;  3BY2 A;  2ZL6 A;  3AST A;  4OOS A;  4X7E A;  4P26 A;  3RY8 A;  3ONU A;  4P2N A;  4Z4W A;  5J35 A;  4RPB A;  4Z4U A;  2OBS A;  4RM0 A;  4X07 A;  5BSY A;  4P25 A;  3SEJ A;  4WZE A;  5F4O A;  5KW9 A;  4X7F A;  5F4M A;  4RDJ A;  4OPS A;  3Q6R A;  4OPV A;  3Q3A A;  3SKB A;  5F4J A;  4OPO A;  5HZB A;  4QUZ A;  5IYP A;  3ONY A;  3LQE A;  3R6K A;  4WZL A;  2OBT A;  3PUM A;  4Z4R A;  2OBR A;  4RDL A;  4P12 A;  4Z4S A;  4RLZ A;  3ASS A;  3PA2 A;  5E6T A;  4P3I A;  4Z4T A;  4OP7 A;  4QVA A;  3LQ6 A;  4RDK A;  4X7C A;  3ASR A;  4Z4V A;  4P1V A;  1IHM A;  4QV2 A;  4ROX A;  3Q38 A;  2ZL7 A;  5IYN A;  3PVD A;  5IYQ A;  4X7D A;  4X05 A;  4WZK A;  3SLN A;  3SJP A; 
#chains in the Genus database with same CATH topology
 3OP1 A;  1V0F A;  2DEU A;  4P3Y A;  4Q7J B;  3SLD A;  1XE1 A;  5FO0 A;  2QA4 B;  2V4D A;  3BH4 A;  3AGQ A;  5H59 A;  1YHQ B;  4TMW A;  3J81 k;  1E3Z A;  4OOV A;  4GQN A;  4DNR B;  1Y0Y A;  3BCF A;  1WOS A;  4G5G A;  3WNC A;  1S0U A;  2VNK A;  5FNZ A;  1G7R A;  1W87 A;  5KNL A;  5EMN A;  1OB5 A;  5B6I A;  2DET A;  1TUI A;  2B7C A;  4Y9U A;  3WXM A;  3D26 A;  1KRH A;  2JIZ A;  1H8E A;  4E0F A;  1EP3 B;  2D74 A;  3FPP A;  3CCR B;  1TTT A;  5HXB A;  3OZW A;  4HE5 A;  1K8A D;  4X8I A;  1AMO A;  2JJ1 A;  2GQF A;  1BX0 A;  1OGJ A;  3ONU A;  3OJX A;  4XN3 A;  3H94 A;  2V7Q A;  2I1L A;  4XLA A;  4X07 A;  3CCE B;  4B43 A;  3CCJ B;  4DK0 A;  4PGO A;  3SEJ A;  3OJW A;  2J7K A;  2Q6L A;  3BC9 A;  5F4O A;  4BPR A;  5KW9 A;  4Y9R A;  3OZU A;  4LBW A;  3CCM B;  3VO2 A;  4LBZ A;  4NNJ A;  1YI2 B;  4OPS A;  1PJ5 A;  1TLL A;  4OPV A;  1NJI D;  4TSF A;  2WR8 A;  3CP8 A;  5F4J A;  1DAR A;  1ZM9 A;  2XNJ A;  2W6I A;  4ZV4 A;  1MAB A;  1GJR A;  2QGG A;  2VBV A;  1XQB A;  1I7P A;  3AVY A;  2GPJ A;  4YXW A;  3ONY A;  2D9R A;  4QFM A;  2F1L A;  1WTH D;  2PIA A;  3GQB A;  3PUM A;  4PC7 A;  2V7X A;  3E1Y E;  4B4D A;  1M90 D;  3LO8 A;  3P26 A;  3E20 A;  4P9S A;  1E79 A;  4UAJ A;  4PC6 A;  1OB2 A;  1WU8 A;  4XL9 A;  3AVV A;  4AF6 A;  2E1B A;  1G7C A;  4PC1 A;  4YAU A;  3PA2 A;  4XOR A;  5E6T A;  1WOP A;  3WNB A;  2BGJ A;  1QUF A;  1YJW B;  2WSS A;  1V0E A;  3W2E A;  1UD4 A;  1Q86 D;  4B3G A;  2GK7 A;  2ZIT A;  3QE2 A;  2X6X A;  2AHO A;  3DDY A;  4TMV A;  3OOC A;  4XR6 A;  4XQF A;  4UZU A;  4K1X A;  4ACB A;  3G05 A;  1OGI A;  3Q38 A;  1EFC A;  1VLO A;  1T6Y A;  2VBU A;  3A8K A;  3PVD A;  4KKT A;  4Y7C A;  1U2R A;  1S72 B;  2CF4 A;  1VQN B;  1NDH A;  1EFR A;  3CES A;  1IB0 A;  3ZPN A;  5TY0 A;  2C4T A;  4TMX A;  3CC2 B;  2QEX B;  4II2 A;  3WBK A;  3MCA A;  3SLN A;  2OK8 A;  4DQK A;  4RPD A;  1DG1 G;  1RQR A;  3OFN A;  3ZC3 A;  2QN6 A;  3ZBT A;  3ASP A;  3CCL B;  2NPF A;  2ZZG A;  2VJJ A;  3R6J A;  2CW5 A;  1W35 A;  5IYW A;  2DYI A;  2X0K A;  4QVJ A;  2BF4 A;  1E3X A;  1JA0 A;  2CND A;  1M1K D;  4XLC A;  3CC4 B;  5AN9 A;  4FXU A;  4X06 A;  3U6K A;  1KTV A;  3VR6 A;  3U2Q A;  3GIR A;  3AGP A;  2XGJ A;  5HZA A;  2C77 A;  3W2G A;  1QGY A;  3Q6Q A;  4RD2 A;  4C43 A;  4OOS A;  2ZXH A;  3W5V A;  3WYA A;  2R6H A;  1QVG B;  2V7W A;  4KKS A;  2KVO A;  1CNF A;  1FRN A;  4P2N A;  3JQR A;  2JJ2 A;  1BJK A;  2EFG A;  2OBS A;  4FN5 A;  4P25 A;  1QH0 A;  3MMP A;  4MYU A;  2YWH A;  1QX4 A;  4DK1 A;  4RD3 A;  1COW A;  4HIZ A;  3G6E B;  1GO2 A;  4YHB A;  1ELO A;  2Q6O A;  4RDJ A;  4XLE A;  1OB0 A;  1QUE A;  1N8R D;  4YAL A;  1N05 A;  1PJ6 A;  4B47 A;  3GSI A;  1KZL A;  3ZUG A;  3A8J A;  3ZZ0 A;  3CC7 B;  2YWG A;  1W0J A;  4P22 A;  3CP2 A;  4OPO A;  4PC3 A;  2HMA A;  1Q9S A;  4G1V A;  4QUZ A;  4XLF A;  1T6X A;  1GVH A;  1UMK A;  2F1M A;  3WQZ A;  1EFT A;  3GVL A;  1DDG A;  4B3F X;  2CC2 A;  1G7T A;  4RDL A;  4Z4R A;  1EXM A;  4P12 A;  3OW2 B;  3B8H A;  3QFT A;  3ZZU A;  2VJI A;  2ZTG A;  4ZCL A;  4LBY A;  3I55 B;  4II3 A;  1KC8 D;  3ASS A;  1E63 A;  3NE5 B;  3CPW B;  3VNV A;  2X6Y A;  3A1P A;  3OW7 A;  2V7T A;  3QFR A;  4P3I A;  3CXC B;  3CME B;  3JQQ A;  1ZM3 A;  4XOT A;  4OP7 A;  1UD3 A;  3CTA A;  1BX1 A;  3AVU A;  2HCJ B;  4YAW A;  2HLD A;  4RDK A;  4FWT A;  4J0Q A;  4X7C A;  3ASR A;  4Z1M A;  3G4S B;  5TV2 A;  1VQ4 B;  1QGA A;  2YWF A;  1GAW A;  1EP2 B;  3AVX A;  1SKQ A;  1Y0R A;  4TMT A;  1SKY B;  2C2W A;  4PC2 A;  1IJE A;  1GR1 A;  1ZM4 A;  4WQM A;  2VNH A;  4NCN A;  4AVZ A;  1I18 A;  2ZZF A;  2BSA A;  3ZZT A;  5IYN A;  1HZE A;  1VQK B;  2GJP A;  2NV4 A;  2B7B A;  4TKO B;  4XLH A;  4P6V F;  1E62 A;  1MRZ A;  1CQX A;  2PE3 A;  1UD5 A;  1W2B B;  2GK6 A;  2XEX A;  2W6J A;  4UZE A;  4YAO A;  1AIP A;  4L8J A;  4X7D A;  1SM4 A;  4ACA A;  1QVF B;  4CQJ A;  4TMZ A;  3G71 B;  1W34 A;  4X05 A;  2WJY A;  4XON A;  2CRV A;  2X85 A;  5DN6 A;  4B44 A;  1NB0 A;  4WZK A;  3A3B A;  1VLY A;  4YEL A;  2GRE A;  2C5H A;  3SJP A;  4B3X A;  3ZIA A;  1WDT A;  3PEN A;  4MYT A;  5IYR A;  2CBX A;  4HE6 A;  2DY1 A;  1K73 D;  2ZL5 A;  4FK8 A;  4PAB A;  2ZBV A;  2HDN B;  2ZZE A;  3BCD A;  4ZCI A;  3PA1 A;  4TN1 A;  5A89 A;  1KK1 A;  1WSV A;  1VHE A;  4M2L A;  1VQM B;  1CNE A;  2ZBU A;  4RD6 A;  1IJF A;  2V7U A;  3PUN A;  1TVC A;  5BSX A;  4X0C A;  1J9Z A;  3CCV B;  5J3O A;  1YJ9 B;  5KSW B;  1WPC A;  2QMU A;  3JU4 A;  4KKU A;  3CD6 B;  1T6Z A;  2B5O A;  3BY1 A;  3KL9 A;  5FA6 A;  3BQJ A;  4U9U A;  3ASQ A;  2WJV A;  4C0S A;  1FX0 A;  2ZL6 A;  3AST A;  4ASU A;  2D3N A;  2VNJ A;  3AVT A;  4P26 A;  3CCQ B;  1W9X A;  3RY8 A;  3CRZ A;  3WY9 A;  1BQE A;  5J35 A;  1P4M A;  3T56 B;  1VF7 A;  3I56 B;  3GVJ A;  1ZUN B;  3MHP A;  1EFU A;  4Z4U A;  4N3G A;  1E1R A;  1EP1 B;  1H8H A;  4G7X A;  2QTL A;  4X7F A;  1H85 A;  1VQ9 B;  1KK3 A;  5F4M A;  5FL7 A;  1WOR A;  3WND A;  2JDI A;  2PMD A;  4NBS A;  3OEE A;  1VQ6 B;  3ES9 A;  3A3G A;  2OTL B;  1NBM A;  3Q3A A;  5FO1 A;  2BPO A;  4IW3 B;  3SKB A;  2VBT A;  1JA1 A;  1VHO A;  5THX A;  1YJN B;  1BPL A;  4M4S A;  4PAA A;  5DSZ A;  4G7W A;  2FX3 A;  1N06 A;  1EWY A;  3U6B A;  2D3L A;  5A88 A;  3ZBU A;  4WZL A;  2DCU A;  3CCU B;  4AF7 A;  3OAA A;  4RCZ A;  3W2I A;  1VQL B;  4N3N A;  2OBR A;  2GJK A;  3I1F A;  2BN4 A;  1PJ7 A;  4Z4S A;  4RLZ A;  1ZM2 A;  1Q81 D;  1R5O A;  1PKV A;  3VMF A;  1N08 A;  1G7S A;  1UD2 A;  4XKW A;  3OE7 A;  4G6I A;  5GV8 A;  1XFO A;  1B2R A;  2ZXI A;  1S4M A;  1I8D A;  3GVK A;  2CK3 A;  4Z4T A;  2R9V A;  1W0K A;  4DNT B;  1Q82 D;  4M53 A;  4WWV A;  1VQ8 B;  2BMW A;  5DS0 A;  4M0L A;  2DOG A;  3VO1 A;  3QSY A;  2E1R A;  2BGI A;  2BM1 A;  1JJ2 B;  5LMZ A;  1D8T A;  1T5E A;  2LZJ A;  4P1V A;  1IHM A;  1FDR A;  4ZGN B;  1Q7Y D;  3WBJ A;  4ROX A;  2X3U A;  3CMM A;  1QFJ A;  2ZL7 A;  2WZP P;  3VNU A;  4LC0 A;  1FRQ A;  1E64 A;  1B23 P;  3H9N A;  3CPX A;  3LNN A;  1K9M D;  2M5S A;  4QHY A;  2VZL A;  1D2E A;  2WZN A;  4LBV A;  1DDI A;  2X8K A;  1YIT B;  3CB4 A;  2OTJ B;  4RCY A;  2Z6B D;  2F4N A;  3CMA B;  3JQP A;  1QFZ A;  1FNM A;  4Z4Z A;  2XOK A;  1F60 A;  2PLF A;  1R5N A;  1WSR A;  3W5H A;  4Z4Y A;  4ZCM A;  2XZL A;  4G1B A;  3OZV A;  1F20 A;  1VJS A;  2F43 A;  1A8P A;  3V7A A;  2XZP A;  2QE7 A;  2YWE A;  1KJZ A;  3Q39 A;  1E1Q A;  4EH1 A;  1N0V C;  4OOX A;  4WZT A;  5A8A A;  4F7D A;  2C5B A;  3A8I A;  3T51 B;  2BV3 A;  3A35 A;  3BY2 A;  1BMF A;  4X7E A;  1VQO B;  3OKX A;  4AC9 A;  4Z4W A;  5IK2 A;  1JB9 A;  3T53 B;  1VQ5 B;  3HAG A;  4RPB A;  5BSY A;  3QFC A;  3OEH A;  4RM0 A;  1YIJ B;  1YLO A;  2VNI A;  3FKS A;  3OPO A;  4WZE A;  5TR9 A;  1KD1 D;  4P6Y A;  1WP6 A;  4XD7 A;  2Q6I A;  4YEJ A;  4M1K A;  4XM3 A;  3Q6R A;  4UZF A;  5H5J A;  1D1N A;  3QFS A;  3CCS B;  1KMH A;  2FVG A;  5CDF A;  3W5U A;  5HKK A;  4XOP A;  1JNY A;  2ZTN A;  3LVB A;  4R71 A;  2WYR A;  5HZB A;  2VYQ A;  5FIU A;  3V76 A;  2RC5 A;  3CW2 A;  5IYP A;  1KQS B;  1QFY A;  1HA3 A;  1HVX A;  5GV7 A;  1XB2 A;  2ZZQ A;  3LQE A;  3R6K A;  3FJO A;  2OBT A;  4XMY A;  1E43 A;  1KK0 A;  2VBS A;  3KEW A;  4TT3 A;  4YAF A;  4RD1 A;  2Q6K A;  4RD4 A;  1UD8 A;  1FNB A;  2DIE A;  1VQP B;  4H9G A;  3P27 A;  2V7V A;  2BVN A;  2X53 S;  3B82 A;  4ZGQ B;  2DER A;  1FND A;  2OK7 A;  1BLI A;  2P3M A;  2V31 A;  4QVA A;  1V5V A;  5TRD A;  3SJZ A;  3LQ6 A;  3FPK A;  1NRK A;  1N0U A;  2RC6 A;  3B78 A;  1KK2 A;  3BNW A;  1YX2 A;  1QGZ A;  4Z4V A;  2WPD A;  1K28 D;  2JN9 A;  1NB9 A;  1WOO A;  4DQL A;  2XZO A;  2EIX A;  1FNC A;  4JMQ A;  4QV2 A;  3W2H A;  1UD6 A;  4RJL A;  4B48 A;  5L46 A;  2C4U A;  3W2F A;  2XND A;  2X6W A;  4XKV A;  2BM0 A;  3ISX A;  2OYN A;  2QDX A;  5IYQ A;  4XNF A;  4RD0 A;  1VQ7 B;  1GAQ A;  1H42 A;  2GJR A;  1OHH A;  1R5B A;  1QG0 A;  1N07 A;  5JBQ A;  2C78 A;  4XN0 A;  2XNC A;  2QTZ A;  3AVW A;  1RQP A; 
#chains in the Genus database with same CATH homology
 3SLD A;  4RPD A;  5IYR A;  3ASP A;  4Z4Z A;  2ZL5 A;  4OOV A;  4Z4Y A;  3PA1 A;  3R6J A;  5IYW A;  3V7A A;  3PUN A;  4QVJ A;  5BSX A;  4X0C A;  5J3O A;  3D26 A;  3Q39 A;  4X06 A;  4OOX A;  4WZT A;  3BY1 A;  3BQJ A;  5HZA A;  3ASQ A;  3Q6Q A;  3BY2 A;  2ZL6 A;  3AST A;  4OOS A;  4X7E A;  4P26 A;  3RY8 A;  3ONU A;  4P2N A;  4Z4W A;  5J35 A;  4RPB A;  4Z4U A;  2OBS A;  4RM0 A;  4X07 A;  5BSY A;  4P25 A;  3SEJ A;  4WZE A;  5F4O A;  5KW9 A;  4X7F A;  5F4M A;  4RDJ A;  4OPS A;  3Q6R A;  4OPV A;  3Q3A A;  3SKB A;  5F4J A;  4OPO A;  5HZB A;  4QUZ A;  5IYP A;  3ONY A;  3LQE A;  3R6K A;  4WZL A;  2OBT A;  3PUM A;  4Z4R A;  2OBR A;  4RDL A;  4P12 A;  4Z4S A;  4RLZ A;  3ASS A;  3PA2 A;  5E6T A;  4P3I A;  4Z4T A;  4OP7 A;  4QVA A;  3LQ6 A;  4RDK A;  4X7C A;  3ASR A;  4Z4V A;  4P1V A;  1IHM A;  4QV2 A;  4ROX A;  3Q38 A;  2ZL7 A;  5IYN A;  3PVD A;  5IYQ A;  4X7D A;  4X05 A;  4WZK A;  3SLN A;  3SJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...