4X7FA

Crystal structure of norovirus gii.10 p domain in complex with nano-25
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
314
structure length
307
Chain Sequence
b'KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
molecule tags Viral protein
source organism Norwalk virus
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
total genus 72
structure length 307
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4x7fA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4x7fA01
5IYWA 3SLNA 5IYRA 3Q39A 4X7EA 4P26A 3ASRA 4RPDA 3R6KA 4OP7A 4ROXA 5BSYA 4X7DA 2ZL7A 2OBRA 5IYQA 4X07A 5F4JA 4X0CA 4OOSA 4RDLA 5IYPA 4X05A 3V7AA 3PUMA 5J35A 4P1VA 5HZAA 3BQJA 5IYNA 2OBSA 1IHMA 4RDKA 4P12A 4Z4VA 4WZTA 3PUNA 4QVJA 4OOXA 4RPBA 4OPOA 3ASSA 3Q38A 4P2NA 4Z4TA 4RM0A 5F4MA 3PA1A 3SKBA 5HZBA 3D26A 4QVAA 4X7CA 3LQ6A 5BSXA 3BY1A 3LQEA 4RLZA 3PA2A 4Z4UA 4WZEA 3ASTA 2ZL6A 3ONYA 3Q3AA 4QV2A 4X06A 3Q6QA 5J3OA 4P3IA 3ONUA 4RDJA 4X7FA 3SJPA 2ZL5A 4Z4WA 4Z4ZA 2OBTA 4QUZA 4OPSA 3SLDA 4WZLA 5F4OA 3ASQA 3Q6RA 4OOVA 3RY8A 4WZKA 3SEJA 5KW9A 4Z4YA 4Z4RA 4Z4SA 3BY2A 3ASPA 3PVDA 5E6TA 3R6JA 4OPVA 4P25A
chains in the Genus database with same CATH superfamily
2ZITA 1VF7A 3CXCB 3QFCA 4XORA 3AGQA 5IYRA 5HXBA 5A89A 3CP8A 4RPDA 3CCRB 1KK2A 5TY0A 1PJ6A 1Y0YA 4B48A 4XM3A 2OBRA 4FWTA 1TUIA 1W87A 1M1KD 4HIZA 4J0QA 5F4JA 2GJKA 4MYUA 2XEXA 4B4DA 4ZCLA 1QUEA 3AGPA 2NPFA 1EWYA 1YJ9B 1XFOA 4RDLA 1NBMA 3CCLB 1E43A 4E0FA 4X05A 2C77A 1Q9SA 4H9GA 4P22A 1XE1A 4Z1MA 2P3MA 2X3UA 4YAFA 3CB4A 3LVBA 3JQRA 1A8PA 1Q82D 3LNNA 1T6ZA 4EH1A 1WPCA 3KL9A 1UD3A 3VR6A 2B7CA 2GK6A 2VBTA 3CCEB 1H85A 3W2IA 5L46A 2WR8A 4M0LA 4YEJA 2V31A 3A8IA 3PUNA 4QVJA 4RD3A 3OZWA 4XLFA 2CW5A 2YWEA 4P2NA 4Z4TA 1VHEA 4KKUA 2OYNA 5F4MA 5H59A 2BF4A 3J81k 1GVHA 2B7BA 4PAAA 4UAJA 2BM1A 5THXA 2ZTGA 3GVKA 3OFNA 4X7CA 4M1KA 4B43A 4TMTA 4B44A 4R71A 1QVGB 2C4TA 1KTVA 3BY1A 1BLIA 3W2GA 4DQLA 2RC6A 1MRZA 2CRVA 3PA2A 2YWHA 3CP2A 1G7RA 4PC1A 1EP1B 2WYRA 4U9UA 2FX3A 4KKSA 5FNZA 1UD2A 4Z4UA 4G1BA 1BJKA 5EMNA 3MHPA 4XLEA 2GJPA 1WU8A 1KC8D 1YJNB 1WORA 2D3NA 4PGOA 1PJ7A 3ONYA 4QV2A 1TTTA 1FRQA 3ZBTA 1ZM4A 2WJYA 1BPLA 2PMDA 1ZM3A 1P4MA 4P6YA 1BQEA 2OK8A 2C5HA 2OBTA 3B82A 4L8JA 4YHBA 4YAUA 2F43A 4II2A 5A88A 1N08A 4II3A 1S0UA 1QH0A 2KVOA 1FNCA 3DDYA 4UZFA 5F4OA 4OOVA 2HCJB 1YX2A 5FIUA 2D9RA 1VQ6B 4TMWA 2R6HA 2BSAA 1BX1A 4Z4RA 1XB2A 1UD8A 1JA1A 5FA6A 2XZLA 1E79A 4XN0A 5IK2A 2OK7A 3WNDA 1YIJB 2CF4A 1HZEA 2VNKA 1KK1A 4TMVA 2Q6IA 3I56B 4P25A 1FDRA 1QX4A 5GV8A 3H94A 2BVNA 3A3GA 1VQPB 1R5BA 1YHQB 1YJWB 1V0EA 1HVXA 3ASRA 2VYQA 3VMFA 1QFJA 3R6KA 4ROXA 5BSYA 5B6IA 1AMOA 1GO2A 2FVGA 2X0KA 1W35A 1RQRA 2XZPA 1W2BB 2XZOA 2X6XA 2WZPP 1JNYA 1W0JA 2V7XA 2DIEA 4OOSA 1K9MD 1K8AD 2X8KA 4NCNA 1UMKA 2CNDA 1VQ7B 1T5EA 1W9XA 1FRNA 4ACBA 3V7AA 3CCMB 1WOOA 2QGGA 3OJWA 3AVYA 4P1VA 4K1XA 5HZAA 1G7CA 1TLLA 2V7UA 2WZNA 3U6KA 1YITB 3OJXA 4XN3A 1UD4A 2V7TA 3AVTA 1VLOA 4N3NA 4DNRB 1IHMA 4RDKA 4P3YA 1D1NA 4Z4VA 2DYIA 1E63A 1FX0A 1GR1A 4G1VA 3ZPNA 3W2HA 4PC2A 4YELA 4DNTB 2XOKA 2V7VA 2DERA 1QFYA 1JA0A 4TMXA 2CBXA 3CPWB 1VQ8B 4RPBA 1VHOA 2ZZQA 3BNWA 3CMEB 3OE7A 3FPPA 4RM0A 4DQKA 2Q6LA 1IJEA 3VNUA 1KZLA 5TRDA 2E1BA 4ZCIA 2QTLA 2WPDA 3G6EB 1E1RA 4QVAA 4XQFA 1VJSA 1UD5A 3LQ6A 3WNBA 4XL9A 2DETA 3KEWA 3PENA 1JJ2B 4Y9UA 1D8TA 2BN4A 5DS0A 1XQBA 1ZM9A 1I18A 1QGAA 1NB9A 3AVWA 5TV2A 3ES9A 1QGZA 2GQFA 3T53B 2RC5A 4M53A 1OB0A 2BGIA 3MCAA 1HA3A 4TSFA 4LBZA 4C43A 2GREA 5HKKA 4YAOA 4DK1A 1NB0A 5JBQA 3A8KA 2ZL6A 2ZZEA 1R5NA 3CD6B 3OEEA 1WTHD 4RDJA 1GAQA 1WSVA 1VQ5B 1E3XA 3W5HA 3CCUB 1EXMA 2OTLB 2VBVA 4QUZA 3QSYA 3OOCA 2C5BA 4OPSA 2F4NA 3SLDA 3T56B 3FKSA 1DARA 4HE5A 1MABA 3CW2A 2ZXHA 1K28D 1VQNB 1Q86D 3RY8A 2BV3A 3P26A 3SEJA 5TR9A 3ZZ0A 1OB2A 4X8IA 1OGJA 2Z6BD 4ZGQB 2JIZA 4PABA 3OPOA 4HE6A 3VNVA 3E20A 5FO0A 3SJZA 3QFRA 2X85A 2V7WA 4XD7A 5E6TA 3R6JA 2QEXB 3VO2A 3PA1A 1D2EA 1U2RA 1OHHA 4ACAA 1B23P 1EFUA 3OKXA 4X7EA 3A1PA 1UD6A 2X6WA 4P26A 5GV7A 1N8RD 2DEUA 1N0VC 4XKVA 3GVLA 2HLDA 4UZEA 3I55B 4ZCMA 1SKYB 5IYQA 2V7QA 2M5SA 3GVJA 3ZZUA 2X6YA 2NV4A 2WJVA 4X0CA 3LO8A 2GJRA 4WWVA 5FL7A 2VZLA 1EFTA 2JN9A 3FJOA 4ZGNB 5IYPA 4NBSA 1G7SA 3A3BA 2J7KA 2QMUA 3B8HA 1VQ9B 5J35A 3CESA 4M2LA 4XR6A 2GK7A 3BQJA 1WDTA 1I7PA 5IYNA 1GJRA 5CDFA 1R5OA 4P12A 3V76A 3ZZTA 4YAWA 1Q81D 1B2RA 5DSZA 4WZTA 4RCZA 3WY9A 2WSSA 3OZUA 1E62A 1KQSB 1CNEA 4JMQA 4OOXA 3WBJA 3WYAA 4OPOA 3ASSA 3Q38A 1E64A 1QVFB 4LBVA 1H42A 4XLAA 1RQPA 4RJLA 1NJID 3SKBA 4ASUA 4AF7A 3JU4A 1BMFA 2HDNB 1K73D 3D26A 1T6XA 3CC4B 1QFZA 2JDIA 3QFSA 5BSXA 3HAGA 3VO1A 4XOTA 1J9ZA 1PKVA 4PC6A 1WOPA 4RD4A 3CC7B 4ZV4A 1QG0A 1YLOA 1OGIA 1N07A 3BH4A 3AVVA 2DY1A 4DK0A 1H8EA 3CMAB 1CQXA 3QE2A 3GQBA 4P6VF 3CCQB 4Y7CA 1DDGA 1M90D 2XGJA 3JQQA 2F1LA 1F20A 2D74A 2ZXIA 2VJIA 3G4SB 2BPOA 3ASTA 3OAAA 3Q3AA 4IW3B 3A35A 1TVCA 2BM0A 3Q6QA 4P3IA 1YI2B 3WQZA 1KMHA 4LC0A 3W2FA 2D3LA 2LZJA 3ZUGA 1S72B 2C4UA 1Y0RA 4Z4ZA 3U2QA 1S4MA 3A8JA 3BC9A 4LBWA 4TKOB 4B3FX 2VNIA 3CCVB 4XLHA 2R9VA 4QHYA 2AHOA 4N3GA 4WZLA 3ISXA 1ZUNB 1E1QA 5KW9A 3JQPA 4Z4YA 1W34A 2W6IA 1OB5A 4Z4SA 3T51B 3W5VA 3ASPA 3OP1A 4FXUA 2XNDA 1VQLB 2PLFA 3CPXA 3CRZA 5AN9A 3ZIAA 1KK3A 4M4SA 2BMWA 1CNFA 1GAWA 3BCDA 3W2EA 5IYWA 1SM4A 3SLNA 3OEHA 3Q39A 1KRHA 4G7XA 2GPJA 2CK3A 1KJZA 2OTJB 2C78A 2YWFA 4OP7A 1EP2B 4X7DA 1QUFA 1I8DA 2ZL7A 4GQNA 2QDXA 4TT3A 1AIPA 1E3ZA 1V5VA 3GSIA 1ZM2A 4QFMA 4X07A 3AVXA 4G5GA 4RD2A 3CCSB 2XNJA 3MMPA 2VJJA 3ZBUA 2DOGA 1H8HA 1PJ5A 2W6JA 4FN5A 1FNMA 4YALA 3PUMA 1EFCA 1FNDA 4XONA 4CQJA 2VNJA 2ZZFA 4NNJA 3GIRA 2PE3A 1KD1D 4YXWA 2OBSA 4AVZA 1W0KA 2ZBVA 3FPKA 1ELOA 3ZC3A 3WNCA 2QA4B 4PC7A 4AF6A 3I1FA 5LMZA 1SKQA 4XMYA 1F60A 3CC2B 1VQOB 1VLYA 4XOPA 3OW7A 2F1MA 5KNLA 3WXMA 5HZBA 3NE5B 3B78A 1T6YA 2QN6A 4AC9A 4WQMA 2Q6OA 3P27A 4PC3A 2B5OA 5DN6A 1Q7YD 1NRKA 5FO1A 3G05A 4XLCA 2C2WA 2ZZGA 4RD6A 1DG1G 5KSWB 4RD1A 3W5UA 3H9NA 3LQEA 3G71B 4RLZA 1COWA 1VQ4B 2XNCA 2EFGA 4TMZA 4B3XA 1KK0A 4XKWA 2E1RA 4MYTA 1WSRA 2HMAA 4LBYA 1QGYA 2VNHA 1JB9A 3CCJB 4KKTA 4C0SA 1WP6A 1EP3B 3WBKA 3CMMA 1BX0A 4WZEA 5H5JA 2I1LA 1WOSA 2CC2A 3AVUA 3CTAA 4RCYA 4X06A 5J3OA 2JJ1A 3ONUA 3E1YE 3OZVA 1G7TA 2Q6KA 4TN1A 4X7FA 2QE7A 3SJPA 2ZL5A 4F7DA 4G6IA 4Z4WA 1VQKB 2QTZA 1IB0A 2V4DA 3U6BA 1DDIA 1N05A 1EFRA 2BGJA 2JJ2A 2X53S 4B3GA 2YWGA 3OW2B 1N0UA 3ASQA 1FNBA 4BPRA 3Q6RA 4Q7JB 1IJFA 1NDHA 2VBSA 2DCUA 3BCFA 2VBUA 1N06A 4WZKA 4RD0A 4G7WA 2ZBUA 4P9SA 4FK8A 2ZTNA 4UZUA 2PIAA 3BY2A 1V0FA 3QFTA 4B47A 2EIXA 1VQMB 3PVDA 5A8AA 4Y9RA 4OPVA 4XNFA
chains in the Genus database with same CATH topology
5IYWA 3SLNA 5IYRA 3Q39A 4X7EA 4P26A 3ASRA 4RPDA 3R6KA 4OP7A 4ROXA 5BSYA 4X7DA 2ZL7A 2OBRA 5IYQA 4X07A 5F4JA 4X0CA 4OOSA 4RDLA 5IYPA 4X05A 3V7AA 3PUMA 5J35A 4P1VA 5HZAA 3BQJA 5IYNA 2OBSA 1IHMA 4RDKA 4P12A 4Z4VA 4WZTA 3PUNA 4QVJA 4OOXA 4RPBA 4OPOA 3ASSA 3Q38A 4P2NA 4Z4TA 4RM0A 5F4MA 3PA1A 3SKBA 5HZBA 3D26A 4QVAA 4X7CA 3LQ6A 5BSXA 3BY1A 3LQEA 4RLZA 3PA2A 4Z4UA 4WZEA 3ASTA 2ZL6A 3ONYA 3Q3AA 4QV2A 4X06A 3Q6QA 5J3OA 4P3IA 3ONUA 4RDJA 4X7FA 3SJPA 2ZL5A 4Z4WA 4Z4ZA 2OBTA 4QUZA 4OPSA 3SLDA 4WZLA 5F4OA 3ASQA 3Q6RA 4OOVA 3RY8A 4WZKA 3SEJA 5KW9A 4Z4YA 4Z4RA 4Z4SA 3BY2A 3ASPA 3PVDA 5E6TA 3R6JA 4OPVA 4P25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYW A;  3SLN A;  5IYR A;  3Q39 A;  4X7E A;  4P26 A;  3ASR A;  4RPD A;  3R6K A;  4OP7 A;  4ROX A;  5BSY A;  4X7D A;  2ZL7 A;  2OBR A;  5IYQ A;  4X07 A;  5F4J A;  4X0C A;  4OOS A;  4RDL A;  5IYP A;  4X05 A;  3V7A A;  3PUM A;  5J35 A;  4P1V A;  5HZA A;  3BQJ A;  5IYN A;  2OBS A;  1IHM A;  4RDK A;  4P12 A;  4Z4V A;  4WZT A;  3PUN A;  4QVJ A;  4OOX A;  4RPB A;  4OPO A;  3ASS A;  3Q38 A;  4P2N A;  4Z4T A;  4RM0 A;  5F4M A;  3PA1 A;  3SKB A;  5HZB A;  3D26 A;  4QVA A;  4X7C A;  3LQ6 A;  5BSX A;  3BY1 A;  3LQE A;  4RLZ A;  3PA2 A;  4Z4U A;  4WZE A;  3AST A;  2ZL6 A;  3ONY A;  3Q3A A;  4QV2 A;  4X06 A;  3Q6Q A;  5J3O A;  4P3I A;  3ONU A;  4RDJ A;  4X7F A;  3SJP A;  2ZL5 A;  4Z4W A;  4Z4Z A;  2OBT A;  4QUZ A;  4OPS A;  3SLD A;  4WZL A;  5F4O A;  3ASQ A;  3Q6R A;  4OOV A;  3RY8 A;  4WZK A;  3SEJ A;  5KW9 A;  4Z4Y A;  4Z4R A;  4Z4S A;  3BY2 A;  3ASP A;  3PVD A;  5E6T A;  3R6J A;  4OPV A;  4P25 A; 
#chains in the Genus database with same CATH topology
 2ZIT A;  1VF7 A;  3CXC B;  3QFC A;  4XOR A;  3AGQ A;  5IYR A;  5HXB A;  5A89 A;  3CP8 A;  4RPD A;  3CCR B;  1KK2 A;  5TY0 A;  1PJ6 A;  1Y0Y A;  4B48 A;  4XM3 A;  2OBR A;  4FWT A;  1TUI A;  1W87 A;  1M1K D;  4HIZ A;  4J0Q A;  5F4J A;  2GJK A;  4MYU A;  2XEX A;  4B4D A;  4ZCL A;  1QUE A;  3AGP A;  2NPF A;  1EWY A;  1YJ9 B;  1XFO A;  4RDL A;  1NBM A;  3CCL B;  1E43 A;  4E0F A;  4X05 A;  2C77 A;  1Q9S A;  4H9G A;  4P22 A;  1XE1 A;  4Z1M A;  2P3M A;  2X3U A;  4YAF A;  3CB4 A;  3LVB A;  3JQR A;  1A8P A;  1Q82 D;  3LNN A;  1T6Z A;  4EH1 A;  1WPC A;  3KL9 A;  1UD3 A;  3VR6 A;  2B7C A;  2GK6 A;  2VBT A;  3CCE B;  1H85 A;  3W2I A;  5L46 A;  2WR8 A;  4M0L A;  4YEJ A;  2V31 A;  3A8I A;  3PUN A;  4QVJ A;  4RD3 A;  3OZW A;  4XLF A;  2CW5 A;  2YWE A;  4P2N A;  4Z4T A;  1VHE A;  4KKU A;  2OYN A;  5F4M A;  5H59 A;  2BF4 A;  3J81 k;  1GVH A;  2B7B A;  4PAA A;  4UAJ A;  2BM1 A;  5THX A;  2ZTG A;  3GVK A;  3OFN A;  4X7C A;  4M1K A;  4B43 A;  4TMT A;  4B44 A;  4R71 A;  1QVG B;  2C4T A;  1KTV A;  3BY1 A;  1BLI A;  3W2G A;  4DQL A;  2RC6 A;  1MRZ A;  2CRV A;  3PA2 A;  2YWH A;  3CP2 A;  1G7R A;  4PC1 A;  1EP1 B;  2WYR A;  4U9U A;  2FX3 A;  4KKS A;  5FNZ A;  1UD2 A;  4Z4U A;  4G1B A;  1BJK A;  5EMN A;  3MHP A;  4XLE A;  2GJP A;  1WU8 A;  1KC8 D;  1YJN B;  1WOR A;  2D3N A;  4PGO A;  1PJ7 A;  3ONY A;  4QV2 A;  1TTT A;  1FRQ A;  3ZBT A;  1ZM4 A;  2WJY A;  1BPL A;  2PMD A;  1ZM3 A;  1P4M A;  4P6Y A;  1BQE A;  2OK8 A;  2C5H A;  2OBT A;  3B82 A;  4L8J A;  4YHB A;  4YAU A;  2F43 A;  4II2 A;  5A88 A;  1N08 A;  4II3 A;  1S0U A;  1QH0 A;  2KVO A;  1FNC A;  3DDY A;  4UZF A;  5F4O A;  4OOV A;  2HCJ B;  1YX2 A;  5FIU A;  2D9R A;  1VQ6 B;  4TMW A;  2R6H A;  2BSA A;  1BX1 A;  4Z4R A;  1XB2 A;  1UD8 A;  1JA1 A;  5FA6 A;  2XZL A;  1E79 A;  4XN0 A;  5IK2 A;  2OK7 A;  3WND A;  1YIJ B;  2CF4 A;  1HZE A;  2VNK A;  1KK1 A;  4TMV A;  2Q6I A;  3I56 B;  4P25 A;  1FDR A;  1QX4 A;  5GV8 A;  3H94 A;  2BVN A;  3A3G A;  1VQP B;  1R5B A;  1YHQ B;  1YJW B;  1V0E A;  1HVX A;  3ASR A;  2VYQ A;  3VMF A;  1QFJ A;  3R6K A;  4ROX A;  5BSY A;  5B6I A;  1AMO A;  1GO2 A;  2FVG A;  2X0K A;  1W35 A;  1RQR A;  2XZP A;  1W2B B;  2XZO A;  2X6X A;  2WZP P;  1JNY A;  1W0J A;  2V7X A;  2DIE A;  4OOS A;  1K9M D;  1K8A D;  2X8K A;  4NCN A;  1UMK A;  2CND A;  1VQ7 B;  1T5E A;  1W9X A;  1FRN A;  4ACB A;  3V7A A;  3CCM B;  1WOO A;  2QGG A;  3OJW A;  3AVY A;  4P1V A;  4K1X A;  5HZA A;  1G7C A;  1TLL A;  2V7U A;  2WZN A;  3U6K A;  1YIT B;  3OJX A;  4XN3 A;  1UD4 A;  2V7T A;  3AVT A;  1VLO A;  4N3N A;  4DNR B;  1IHM A;  4RDK A;  4P3Y A;  1D1N A;  4Z4V A;  2DYI A;  1E63 A;  1FX0 A;  1GR1 A;  4G1V A;  3ZPN A;  3W2H A;  4PC2 A;  4YEL A;  4DNT B;  2XOK A;  2V7V A;  2DER A;  1QFY A;  1JA0 A;  4TMX A;  2CBX A;  3CPW B;  1VQ8 B;  4RPB A;  1VHO A;  2ZZQ A;  3BNW A;  3CME B;  3OE7 A;  3FPP A;  4RM0 A;  4DQK A;  2Q6L A;  1IJE A;  3VNU A;  1KZL A;  5TRD A;  2E1B A;  4ZCI A;  2QTL A;  2WPD A;  3G6E B;  1E1R A;  4QVA A;  4XQF A;  1VJS A;  1UD5 A;  3LQ6 A;  3WNB A;  4XL9 A;  2DET A;  3KEW A;  3PEN A;  1JJ2 B;  4Y9U A;  1D8T A;  2BN4 A;  5DS0 A;  1XQB A;  1ZM9 A;  1I18 A;  1QGA A;  1NB9 A;  3AVW A;  5TV2 A;  3ES9 A;  1QGZ A;  2GQF A;  3T53 B;  2RC5 A;  4M53 A;  1OB0 A;  2BGI A;  3MCA A;  1HA3 A;  4TSF A;  4LBZ A;  4C43 A;  2GRE A;  5HKK A;  4YAO A;  4DK1 A;  1NB0 A;  5JBQ A;  3A8K A;  2ZL6 A;  2ZZE A;  1R5N A;  3CD6 B;  3OEE A;  1WTH D;  4RDJ A;  1GAQ A;  1WSV A;  1VQ5 B;  1E3X A;  3W5H A;  3CCU B;  1EXM A;  2OTL B;  2VBV A;  4QUZ A;  3QSY A;  3OOC A;  2C5B A;  4OPS A;  2F4N A;  3SLD A;  3T56 B;  3FKS A;  1DAR A;  4HE5 A;  1MAB A;  3CW2 A;  2ZXH A;  1K28 D;  1VQN B;  1Q86 D;  3RY8 A;  2BV3 A;  3P26 A;  3SEJ A;  5TR9 A;  3ZZ0 A;  1OB2 A;  4X8I A;  1OGJ A;  2Z6B D;  4ZGQ B;  2JIZ A;  4PAB A;  3OPO A;  4HE6 A;  3VNV A;  3E20 A;  5FO0 A;  3SJZ A;  3QFR A;  2X85 A;  2V7W A;  4XD7 A;  5E6T A;  3R6J A;  2QEX B;  3VO2 A;  3PA1 A;  1D2E A;  1U2R A;  1OHH A;  4ACA A;  1B23 P;  1EFU A;  3OKX A;  4X7E A;  3A1P A;  1UD6 A;  2X6W A;  4P26 A;  5GV7 A;  1N8R D;  2DEU A;  1N0V C;  4XKV A;  3GVL A;  2HLD A;  4UZE A;  3I55 B;  4ZCM A;  1SKY B;  5IYQ A;  2V7Q A;  2M5S A;  3GVJ A;  3ZZU A;  2X6Y A;  2NV4 A;  2WJV A;  4X0C A;  3LO8 A;  2GJR A;  4WWV A;  5FL7 A;  2VZL A;  1EFT A;  2JN9 A;  3FJO A;  4ZGN B;  5IYP A;  4NBS A;  1G7S A;  3A3B A;  2J7K A;  2QMU A;  3B8H A;  1VQ9 B;  5J35 A;  3CES A;  4M2L A;  4XR6 A;  2GK7 A;  3BQJ A;  1WDT A;  1I7P A;  5IYN A;  1GJR A;  5CDF A;  1R5O A;  4P12 A;  3V76 A;  3ZZT A;  4YAW A;  1Q81 D;  1B2R A;  5DSZ A;  4WZT A;  4RCZ A;  3WY9 A;  2WSS A;  3OZU A;  1E62 A;  1KQS B;  1CNE A;  4JMQ A;  4OOX A;  3WBJ A;  3WYA A;  4OPO A;  3ASS A;  3Q38 A;  1E64 A;  1QVF B;  4LBV A;  1H42 A;  4XLA A;  1RQP A;  4RJL A;  1NJI D;  3SKB A;  4ASU A;  4AF7 A;  3JU4 A;  1BMF A;  2HDN B;  1K73 D;  3D26 A;  1T6X A;  3CC4 B;  1QFZ A;  2JDI A;  3QFS A;  5BSX A;  3HAG A;  3VO1 A;  4XOT A;  1J9Z A;  1PKV A;  4PC6 A;  1WOP A;  4RD4 A;  3CC7 B;  4ZV4 A;  1QG0 A;  1YLO A;  1OGI A;  1N07 A;  3BH4 A;  3AVV A;  2DY1 A;  4DK0 A;  1H8E A;  3CMA B;  1CQX A;  3QE2 A;  3GQB A;  4P6V F;  3CCQ B;  4Y7C A;  1DDG A;  1M90 D;  2XGJ A;  3JQQ A;  2F1L A;  1F20 A;  2D74 A;  2ZXI A;  2VJI A;  3G4S B;  2BPO A;  3AST A;  3OAA A;  3Q3A A;  4IW3 B;  3A35 A;  1TVC A;  2BM0 A;  3Q6Q A;  4P3I A;  1YI2 B;  3WQZ A;  1KMH A;  4LC0 A;  3W2F A;  2D3L A;  2LZJ A;  3ZUG A;  1S72 B;  2C4U A;  1Y0R A;  4Z4Z A;  3U2Q A;  1S4M A;  3A8J A;  3BC9 A;  4LBW A;  4TKO B;  4B3F X;  2VNI A;  3CCV B;  4XLH A;  2R9V A;  4QHY A;  2AHO A;  4N3G A;  4WZL A;  3ISX A;  1ZUN B;  1E1Q A;  5KW9 A;  3JQP A;  4Z4Y A;  1W34 A;  2W6I A;  1OB5 A;  4Z4S A;  3T51 B;  3W5V A;  3ASP A;  3OP1 A;  4FXU A;  2XND A;  1VQL B;  2PLF A;  3CPX A;  3CRZ A;  5AN9 A;  3ZIA A;  1KK3 A;  4M4S A;  2BMW A;  1CNF A;  1GAW A;  3BCD A;  3W2E A;  5IYW A;  1SM4 A;  3SLN A;  3OEH A;  3Q39 A;  1KRH A;  4G7X A;  2GPJ A;  2CK3 A;  1KJZ A;  2OTJ B;  2C78 A;  2YWF A;  4OP7 A;  1EP2 B;  4X7D A;  1QUF A;  1I8D A;  2ZL7 A;  4GQN A;  2QDX A;  4TT3 A;  1AIP A;  1E3Z A;  1V5V A;  3GSI A;  1ZM2 A;  4QFM A;  4X07 A;  3AVX A;  4G5G A;  4RD2 A;  3CCS B;  2XNJ A;  3MMP A;  2VJJ A;  3ZBU A;  2DOG A;  1H8H A;  1PJ5 A;  2W6J A;  4FN5 A;  1FNM A;  4YAL A;  3PUM A;  1EFC A;  1FND A;  4XON A;  4CQJ A;  2VNJ A;  2ZZF A;  4NNJ A;  3GIR A;  2PE3 A;  1KD1 D;  4YXW A;  2OBS A;  4AVZ A;  1W0K A;  2ZBV A;  3FPK A;  1ELO A;  3ZC3 A;  3WNC A;  2QA4 B;  4PC7 A;  4AF6 A;  3I1F A;  5LMZ A;  1SKQ A;  4XMY A;  1F60 A;  3CC2 B;  1VQO B;  1VLY A;  4XOP A;  3OW7 A;  2F1M A;  5KNL A;  3WXM A;  5HZB A;  3NE5 B;  3B78 A;  1T6Y A;  2QN6 A;  4AC9 A;  4WQM A;  2Q6O A;  3P27 A;  4PC3 A;  2B5O A;  5DN6 A;  1Q7Y D;  1NRK A;  5FO1 A;  3G05 A;  4XLC A;  2C2W A;  2ZZG A;  4RD6 A;  1DG1 G;  5KSW B;  4RD1 A;  3W5U A;  3H9N A;  3LQE A;  3G71 B;  4RLZ A;  1COW A;  1VQ4 B;  2XNC A;  2EFG A;  4TMZ A;  4B3X A;  1KK0 A;  4XKW A;  2E1R A;  4MYT A;  1WSR A;  2HMA A;  4LBY A;  1QGY A;  2VNH A;  1JB9 A;  3CCJ B;  4KKT A;  4C0S A;  1WP6 A;  1EP3 B;  3WBK A;  3CMM A;  1BX0 A;  4WZE A;  5H5J A;  2I1L A;  1WOS A;  2CC2 A;  3AVU A;  3CTA A;  4RCY A;  4X06 A;  5J3O A;  2JJ1 A;  3ONU A;  3E1Y E;  3OZV A;  1G7T A;  2Q6K A;  4TN1 A;  4X7F A;  2QE7 A;  3SJP A;  2ZL5 A;  4F7D A;  4G6I A;  4Z4W A;  1VQK B;  2QTZ A;  1IB0 A;  2V4D A;  3U6B A;  1DDI A;  1N05 A;  1EFR A;  2BGJ A;  2JJ2 A;  2X53 S;  4B3G A;  2YWG A;  3OW2 B;  1N0U A;  3ASQ A;  1FNB A;  4BPR A;  3Q6R A;  4Q7J B;  1IJF A;  1NDH A;  2VBS A;  2DCU A;  3BCF A;  2VBU A;  1N06 A;  4WZK A;  4RD0 A;  4G7W A;  2ZBU A;  4P9S A;  4FK8 A;  2ZTN A;  4UZU A;  2PIA A;  3BY2 A;  1V0F A;  3QFT A;  4B47 A;  2EIX A;  1VQM B;  3PVD A;  5A8A A;  4Y9R A;  4OPV A;  4XNF A; 
#chains in the Genus database with same CATH homology
 5IYW A;  3SLN A;  5IYR A;  3Q39 A;  4X7E A;  4P26 A;  3ASR A;  4RPD A;  3R6K A;  4OP7 A;  4ROX A;  5BSY A;  4X7D A;  2ZL7 A;  2OBR A;  5IYQ A;  4X07 A;  5F4J A;  4X0C A;  4OOS A;  4RDL A;  5IYP A;  4X05 A;  3V7A A;  3PUM A;  5J35 A;  4P1V A;  5HZA A;  3BQJ A;  5IYN A;  2OBS A;  1IHM A;  4RDK A;  4P12 A;  4Z4V A;  4WZT A;  3PUN A;  4QVJ A;  4OOX A;  4RPB A;  4OPO A;  3ASS A;  3Q38 A;  4P2N A;  4Z4T A;  4RM0 A;  5F4M A;  3PA1 A;  3SKB A;  5HZB A;  3D26 A;  4QVA A;  4X7C A;  3LQ6 A;  5BSX A;  3BY1 A;  3LQE A;  4RLZ A;  3PA2 A;  4Z4U A;  4WZE A;  3AST A;  2ZL6 A;  3ONY A;  3Q3A A;  4QV2 A;  4X06 A;  3Q6Q A;  5J3O A;  4P3I A;  3ONU A;  4RDJ A;  4X7F A;  3SJP A;  2ZL5 A;  4Z4W A;  4Z4Z A;  2OBT A;  4QUZ A;  4OPS A;  3SLD A;  4WZL A;  5F4O A;  3ASQ A;  3Q6R A;  4OOV A;  3RY8 A;  4WZK A;  3SEJ A;  5KW9 A;  4Z4Y A;  4Z4R A;  4Z4S A;  3BY2 A;  3ASP A;  3PVD A;  5E6T A;  3R6J A;  4OPV A;  4P25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...