4X7EA

Crystal structure of norovirus gii.10 p domain in complex with nano-85
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
315
structure length
304
Chain Sequence
b'SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
molecule tags Viral protein
source organism Norovirus
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
total genus 69
structure length 304
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4x7eA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4x7eA01
4Z4VA 5IYPA 3D26A 4RDLA 4P2NA 4P3IA 4QVJA 4QV2A 4X7CA 4X7DA 3Q6QA 4WZTA 5J35A 3SEJA 5IYQA 4P26A 4QUZA 3SJPA 4Z4WA 3ONUA 3R6KA 4Z4UA 5IYNA 4X06A 4P1VA 4X0CA 4RDKA 4WZEA 5KW9A 5HZAA 2OBSA 3PUNA 4X07A 3Q6RA 5IYWA 4WZKA 3ASRA 4X7FA 3LQEA 2OBTA 3ONYA 4ROXA 5F4MA 1IHMA 4OPVA 4RPBA 3ASSA 4OP7A 3RY8A 4OPOA 3BQJA 4QVAA 4Z4ZA 5F4JA 5BSXA 4RDJA 3Q39A 4Z4RA 4RLZA 3Q3AA 5J3OA 3ASTA 4OOXA 5E6TA 3PA2A 3Q38A 3PUMA 4Z4TA 5F4OA 3ASPA 4RM0A 5HZBA 2ZL5A 3PVDA 4P12A 3PA1A 3R6JA 4X7EA 4OOVA 3V7AA 3SKBA 4Z4SA 4Z4YA 4X05A 5IYRA 5BSYA 3SLNA 3ASQA 3BY1A 3SLDA 3LQ6A 4OPSA 4RPDA 2OBRA 4P25A 2ZL6A 3BY2A 2ZL7A 4OOSA 4WZLA
chains in the Genus database with same CATH superfamily
3W2EA 1FRNA 2GK6A 4AVZA 1OHHA 1M1KD 4XNFA 2OK8A 1KMHA 1UMKA 5AN9A 4DQLA 1N05A 1WORA 1CNFA 2BM1A 4X7DA 4RD2A 3JQQA 2JJ2A 2VBVA 3AVVA 4UZFA 3SEJA 2YWGA 1D1NA 1Q9SA 1AMOA 2Q6LA 1OGIA 2QTLA 3I1FA 2EFGA 4P26A 1YJWB 1GJRA 3QFCA 3SJPA 4G7WA 4DNRB 2QEXB 1ZM9A 4Z4WA 1B23P 4Z4UA 1VHEA 1UD5A 2X0KA 4LBZA 3U6KA 1FNBA 1VQOB 1V5VA 2BF4A 2GJPA 4Y9RA 2HLDA 4RD3A 4II2A 3WNCA 3CCJB 1HVXA 2WYRA 1WU8A 2X6YA 3LNNA 3ZZ0A 4XMYA 4X07A 4DK0A 5KSWB 2X6WA 1H8EA 3ASRA 1NJID 4ZCLA 1UD3A 1FDRA 2PMDA 3AGQA 3CP2A 4ROXA 1WOSA 2WPDA 4B47A 4HIZA 2FX3A 2X6XA 4XLCA 3ZBUA 1FNCA 3ASSA 2R9VA 2WJYA 5JBQA 3RY8A 3W5UA 2WJVA 3CTAA 2F4NA 4OPOA 4EH1A 1H85A 3V76A 3BQJA 4MYTA 4QVAA 1YI2B 4YXWA 4UZUA 4X8IA 2CRVA 1Q82D 4XL9A 1GVHA 2YWEA 4TMWA 2BM0A 1VLYA 3FPKA 1NB9A 3T56B 3ES9A 4LBVA 4TMVA 3MCAA 1KC8D 5FIUA 1G7RA 2F43A 1P4MA 5J3OA 4XD7A 1YJ9B 3ASTA 1EP3B 3MHPA 1KJZA 5E6TA 4B44A 2GJKA 3KL9A 1YIJB 1VQ9B 1QX4A 2EIXA 2GQFA 4ZCMA 2OTJB 3CCSB 4RCYA 5HZBA 1W0KA 1RQPA 4FK8A 5TY0A 4XN0A 1CNEA 2DETA 3CW2A 2HMAA 1ZM2A 4X7EA 4G5GA 3CCVB 3AVTA 1WTHD 4TN1A 1VQLB 2DY1A 4YELA 3V7AA 3SJZA 2CBXA 2BSAA 4M2LA 1GO2A 3ISXA 1D8TA 1K28D 4PAAA 4RD0A 4Z4YA 1CQXA 3VMFA 1K9MD 1SKQA 2WZPP 1R5BA 1W9XA 1BX1A 1YJNB 1ELOA 3ASQA 2VNJA 1VLOA 2YWHA 2F1MA 2VJIA 4P22A 1JNYA 1BQEA 1R5OA 4YHBA 4H9GA 2C5HA 3VR6A 3BY2A 4WWVA 1N8RD 3FKSA 1WOOA 1EP1B 1UD8A 4ASUA 4B43A 4CQJA 1E64A 4XN3A 1T5EA 5FA6A 1TTTA 1DG1G 2WSSA 1JB9A 5TV2A 1VQNB 1GAQA 4TMTA 5IYPA 2CC2A 4RDLA 2BPOA 1KTVA 4Z1MA 2C4UA 4P2NA 4PC1A 2CNDA 2XNJA 1E3ZA 4P3IA 4QVJA 4UAJA 1NRKA 1MABA 1HZEA 3I56B 2Q6IA 3Q6QA 4ACBA 1N08A 4LBYA 4G1BA 2VBSA 1W87A 1QUEA 3OW7A 1JA1A 3B78A 3WQZA 2RC5A 5DSZA 1FX0A 1QGYA 3VO1A 1T6XA 1WP6A 4AF7A 4WZEA 2ZBVA 2AHOA 3A35A 5KW9A 3U2QA 1F20A 1WDTA 4FN5A 2OBSA 2V7QA 4XR6A 5HZAA 2Q6OA 3CMAB 4K1XA 4C0SA 1NDHA 2C5BA 3CCRB 5F4MA 1ZM3A 2QTZA 4KKSA 3WBKA 2NV4A 4G7XA 1N07A 2C78A 3GVJA 1KK0A 3CP8A 3PENA 5LMZA 3OZUA 2GREA 4U9UA 2XEXA 1QVGB 1YHQB 4Z4ZA 4RD4A 5F4JA 5DN6A 4RDJA 2W6IA 2P3MA 2X53S 4ZCIA 2ZXIA 1UD2A 1EP2B 2QDXA 5A89A 4Z4RA 3CRZA 2DERA 2V7UA 2R6HA 3OEEA 3WXMA 3ZIAA 4XLFA 3BNWA 1N06A 1JJ2B 4OOXA 1R5NA 1OGJA 1VQ5B 3CCUB 1W2BB 2BGJA 3A8JA 1V0EA 3H94A 3QE2A 2C2WA 3W2HA 3G4SB 2D3LA 3LO8A 3Q38A 1KZLA 4HE5A 3GQBA 1H42A 3KEWA 1SKYB 1G7CA 4RM0A 3ZUGA 4E0FA 4TSFA 4BPRA 3PVDA 3VNUA 1EFUA 1E63A 3P27A 3W5VA 4XLHA 3BH4A 4M0LA 1KQSB 1QFYA 2CK3A 4B48A 2XNCA 3ZC3A 4YAFA 3A3BA 1VJSA 4ACAA 2JDIA 4Z4SA 4TMZA 4R71A 3WNBA 5IYRA 3OW2B 5BSYA 5L46A 3CCLB 3CCEB 3GIRA 4TT3A 2WR8A 4YAWA 3U6BA 2ZZEA 3QFTA 3LQ6A 2NPFA 3SLDA 1QH0A 4DQKA 2X3UA 1OB5A 1G7SA 1OB0A 2OBRA 4Y7CA 1E43A 2D3NA 4XKVA 1IB0A 3A1PA 1I7PA 3CXCB 4OOSA 4TMXA 4RCZA 2QGGA 3AVYA 3T51B 3G6EB 4Z4VA 1Q81D 1B2RA 1UD4A 2V31A 3D26A 2CW5A 1QFZA 2BN4A 3CMMA 4YAOA 2XOKA 4XKWA 1N0VC 2ZXHA 4QV2A 3GSIA 4X7CA 4J0QA 1BMFA 2C4TA 2DCUA 3DDYA 4NCNA 4WZTA 5FO0A 4XOPA 1YLOA 2QN6A 1OB2A 3W5HA 4G6IA 2DYIA 1PJ7A 5IYQA 3CC4B 2D74A 3FJOA 2W6JA 1IJFA 4F7DA 1T6ZA 3JQRA 3R6KA 1XFOA 1DARA 4ZGNB 1EXMA 2B5OA 5IYNA 1I18A 3JQPA 4TKOB 2JJ1A 4P1VA 2ZZGA 2J7KA 4PC7A 4RDKA 1FNMA 4X0CA 4XM3A 2OYNA 3H9NA 5TRDA 2KVOA 2YWFA 2ZZFA 3PUNA 4HE6A 4X7FA 2ZTGA 3ONYA 4GQNA 1FRQA 5H5JA 1IHMA 4OPVA 2V7TA 2ZZQA 1E1RA 4RD1A 4RPBA 4YAUA 3OP1A 2B7BA 1IJEA 2VNIA 4M53A 1MRZA 1WPCA 1J9ZA 1KK3A 2B7CA 1DDIA 3CD6B 3OKXA 4WQMA 4B3GA 3QFRA 3WYAA 1H8HA 1YX2A 1K73D 3CMEB 3Q39A 2E1RA 1V0FA 1SM4A 1KK2A 4KKUA 1XE1A 5IK2A 3CB4A 1VQ4B 4XLEA 1TUIA 2GPJA 3BCFA 3B82A 3AVXA 1VQ7B 4Q7JB 3CPWB 1VHOA 4N3NA 2HCJB 3A3GA 4PABA 1F60A 3OOCA 4MYUA 4PC6A 4P9SA 1E62A 3PUMA 4N3GA 4Z4TA 3OZWA 5F4OA 1S72B 3OEHA 3ASPA 4P6YA 1YITB 3W2FA 2ZL5A 1PJ6A 2M5SA 2OTLB 2E1BA 3JU4A 4P12A 1I8DA 3PA1A 3R6JA 3G71B 3MMPA 4OOVA 5FNZA 2BVNA 4DK1A 3G05A 4M4SA 3SKBA 1AIPA 4M1KA 3CCMB 1GAWA 3SLNA 1JA0A 3FPPA 3VNVA 5KNLA 3AVWA 1E1QA 2V4DA 2VNKA 3BY1A 3OJXA 4LC0A 4B3FX 4OPSA 2DEUA 4ZGQB 5H59A 3LVBA 3CESA 4P25A 3ZZTA 3HAGA 3AGPA 4FWTA 4WZLA 3WY9A 1VF7A 1Q86D 2XGJA 4XLAA 1WSRA 2C77A 2ZITA 5CDFA 1NB0A 1U2RA 4QHYA 1FNDA 1DDGA 2PE3A 1KRHA 2PLFA 1K8AD 5HXBA 2QE7A 4P3YA 2PIAA 2RC6A 3OPOA 1S0UA 1VQMB 4B3XA 5J35A 1PKVA 1BLIA 2F1LA 2JN9A 2WZNA 2ZTNA 4YALA 3QSYA 3AVUA 1UD6A 2VZLA 1VQPB 1EFRA 4RD6A 1T6YA 1EFCA 3QFSA 4QUZA 4ZV4A 2X85A 3W2IA 1BJKA 5FO1A 3ONUA 3A8IA 2XZOA 4PGOA 1HA3A 4PC3A 1WOPA 4RJLA 4B4DA 1G7TA 4X06A 1EWYA 5GV7A 2VBTA 1TVCA 2VNHA 4XONA 2XZLA 3BC9A 5B6IA 3Q6RA 1A8PA 3GVKA 2XNDA 5GV8A 1QFJA 4WZKA 5IYWA 1Q7YD 4JMQA 3LQEA 2OBTA 1TLLA 4AF6A 3E1YE 3CC7B 1VQ6B 3P26A 3ZBTA 2BV3A 2X8KA 3BCDA 3B8HA 4PC2A 4NNJA 2V7XA 1E79A 3T53B 1ZUNB 4OP7A 1BPLA 4C43A 1QUFA 2GJRA 2ZBUA 4II3A 1KK1A 3E20A 5DS0A 2VBUA 4G1VA 3ZPNA 4XOTA 1Y0YA 1W0JA 3VO2A 2BGIA 5BSXA 2QA4B 1QG0A 2QMUA 3OE7A 1NBMA 4Y9UA 5A8AA 4RLZA 1BX0A 3Q3AA 4QFMA 4UZEA 4KKTA 4XORA 1WSVA 1XQBA 4L8JA 3OFNA 2DIEA 3I55B 1S4MA 2HDNB 1QGZA 3CPXA 1D2EA 1RQRA 3PA2A 3A8KA 3GVLA 5HKKA 3CCQB 1VQ8B 1XB2A 2BMWA 3ZZUA 1COWA 2DOGA 3OZVA 1E3XA 1ZM4A 3WBJA 5TR9A 5THXA 4FXUA 2XZPA 5EMNA 2D9RA 4LBWA 2FVGA 1W35A 2OK7A 3CC2B 3W2GA 4YEJA 1M90D 4IW3B 1PJ5A 4AC9A 4XQFA 5A88A 1VQKB 4DNTB 4X05A 2V7WA 3J81k 2JIZA 1W34A 4NBSA 1QGAA 2Q6KA 2Z6BD 3NE5B 2LZJA 5FL7A 2VYQA 3OJWA 4RPDA 2GK7A 1QVFB 2V7VA 1GR1A 2ZL6A 4P6VF 1KD1D 1Y0RA 2I1LA 2VJJA 2ZL7A 3OAAA 1N0UA 2CF4A 1EFTA 3WNDA
chains in the Genus database with same CATH topology
4Z4VA 5IYPA 3D26A 4RDLA 4P2NA 4P3IA 4QVJA 4QV2A 4X7CA 4X7DA 3Q6QA 4WZTA 5J35A 3SEJA 5IYQA 4P26A 4QUZA 3SJPA 4Z4WA 3ONUA 3R6KA 4Z4UA 5IYNA 4X06A 4P1VA 4X0CA 4RDKA 4WZEA 5KW9A 5HZAA 2OBSA 3PUNA 4X07A 3Q6RA 5IYWA 4WZKA 3ASRA 4X7FA 3LQEA 2OBTA 3ONYA 4ROXA 5F4MA 1IHMA 4OPVA 4RPBA 3ASSA 4OP7A 3RY8A 4OPOA 3BQJA 4QVAA 4Z4ZA 5F4JA 5BSXA 4RDJA 3Q39A 4Z4RA 4RLZA 3Q3AA 5J3OA 3ASTA 4OOXA 5E6TA 3PA2A 3Q38A 3PUMA 4Z4TA 5F4OA 3ASPA 4RM0A 5HZBA 2ZL5A 3PVDA 4P12A 3PA1A 3R6JA 4X7EA 4OOVA 3V7AA 3SKBA 4Z4SA 4Z4YA 4X05A 5IYRA 5BSYA 3SLNA 3ASQA 3BY1A 3SLDA 3LQ6A 4OPSA 4RPDA 2OBRA 4P25A 2ZL6A 3BY2A 2ZL7A 4OOSA 4WZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4V A;  5IYP A;  3D26 A;  4RDL A;  4P2N A;  4P3I A;  4QVJ A;  4QV2 A;  4X7C A;  4X7D A;  3Q6Q A;  4WZT A;  5J35 A;  3SEJ A;  5IYQ A;  4P26 A;  4QUZ A;  3SJP A;  4Z4W A;  3ONU A;  3R6K A;  4Z4U A;  5IYN A;  4X06 A;  4P1V A;  4X0C A;  4RDK A;  4WZE A;  5KW9 A;  5HZA A;  2OBS A;  3PUN A;  4X07 A;  3Q6R A;  5IYW A;  4WZK A;  3ASR A;  4X7F A;  3LQE A;  2OBT A;  3ONY A;  4ROX A;  5F4M A;  1IHM A;  4OPV A;  4RPB A;  3ASS A;  4OP7 A;  3RY8 A;  4OPO A;  3BQJ A;  4QVA A;  4Z4Z A;  5F4J A;  5BSX A;  4RDJ A;  3Q39 A;  4Z4R A;  4RLZ A;  3Q3A A;  5J3O A;  3AST A;  4OOX A;  5E6T A;  3PA2 A;  3Q38 A;  3PUM A;  4Z4T A;  5F4O A;  3ASP A;  4RM0 A;  5HZB A;  2ZL5 A;  3PVD A;  4P12 A;  3PA1 A;  3R6J A;  4X7E A;  4OOV A;  3V7A A;  3SKB A;  4Z4S A;  4Z4Y A;  4X05 A;  5IYR A;  5BSY A;  3SLN A;  3ASQ A;  3BY1 A;  3SLD A;  3LQ6 A;  4OPS A;  4RPD A;  2OBR A;  4P25 A;  2ZL6 A;  3BY2 A;  2ZL7 A;  4OOS A;  4WZL A; 
#chains in the Genus database with same CATH topology
 3W2E A;  1FRN A;  2GK6 A;  4AVZ A;  1OHH A;  1M1K D;  4XNF A;  2OK8 A;  1KMH A;  1UMK A;  5AN9 A;  4DQL A;  1N05 A;  1WOR A;  1CNF A;  2BM1 A;  4X7D A;  4RD2 A;  3JQQ A;  2JJ2 A;  2VBV A;  3AVV A;  4UZF A;  3SEJ A;  2YWG A;  1D1N A;  1Q9S A;  1AMO A;  2Q6L A;  1OGI A;  2QTL A;  3I1F A;  2EFG A;  4P26 A;  1YJW B;  1GJR A;  3QFC A;  3SJP A;  4G7W A;  4DNR B;  2QEX B;  1ZM9 A;  4Z4W A;  1B23 P;  4Z4U A;  1VHE A;  1UD5 A;  2X0K A;  4LBZ A;  3U6K A;  1FNB A;  1VQO B;  1V5V A;  2BF4 A;  2GJP A;  4Y9R A;  2HLD A;  4RD3 A;  4II2 A;  3WNC A;  3CCJ B;  1HVX A;  2WYR A;  1WU8 A;  2X6Y A;  3LNN A;  3ZZ0 A;  4XMY A;  4X07 A;  4DK0 A;  5KSW B;  2X6W A;  1H8E A;  3ASR A;  1NJI D;  4ZCL A;  1UD3 A;  1FDR A;  2PMD A;  3AGQ A;  3CP2 A;  4ROX A;  1WOS A;  2WPD A;  4B47 A;  4HIZ A;  2FX3 A;  2X6X A;  4XLC A;  3ZBU A;  1FNC A;  3ASS A;  2R9V A;  2WJY A;  5JBQ A;  3RY8 A;  3W5U A;  2WJV A;  3CTA A;  2F4N A;  4OPO A;  4EH1 A;  1H85 A;  3V76 A;  3BQJ A;  4MYT A;  4QVA A;  1YI2 B;  4YXW A;  4UZU A;  4X8I A;  2CRV A;  1Q82 D;  4XL9 A;  1GVH A;  2YWE A;  4TMW A;  2BM0 A;  1VLY A;  3FPK A;  1NB9 A;  3T56 B;  3ES9 A;  4LBV A;  4TMV A;  3MCA A;  1KC8 D;  5FIU A;  1G7R A;  2F43 A;  1P4M A;  5J3O A;  4XD7 A;  1YJ9 B;  3AST A;  1EP3 B;  3MHP A;  1KJZ A;  5E6T A;  4B44 A;  2GJK A;  3KL9 A;  1YIJ B;  1VQ9 B;  1QX4 A;  2EIX A;  2GQF A;  4ZCM A;  2OTJ B;  3CCS B;  4RCY A;  5HZB A;  1W0K A;  1RQP A;  4FK8 A;  5TY0 A;  4XN0 A;  1CNE A;  2DET A;  3CW2 A;  2HMA A;  1ZM2 A;  4X7E A;  4G5G A;  3CCV B;  3AVT A;  1WTH D;  4TN1 A;  1VQL B;  2DY1 A;  4YEL A;  3V7A A;  3SJZ A;  2CBX A;  2BSA A;  4M2L A;  1GO2 A;  3ISX A;  1D8T A;  1K28 D;  4PAA A;  4RD0 A;  4Z4Y A;  1CQX A;  3VMF A;  1K9M D;  1SKQ A;  2WZP P;  1R5B A;  1W9X A;  1BX1 A;  1YJN B;  1ELO A;  3ASQ A;  2VNJ A;  1VLO A;  2YWH A;  2F1M A;  2VJI A;  4P22 A;  1JNY A;  1BQE A;  1R5O A;  4YHB A;  4H9G A;  2C5H A;  3VR6 A;  3BY2 A;  4WWV A;  1N8R D;  3FKS A;  1WOO A;  1EP1 B;  1UD8 A;  4ASU A;  4B43 A;  4CQJ A;  1E64 A;  4XN3 A;  1T5E A;  5FA6 A;  1TTT A;  1DG1 G;  2WSS A;  1JB9 A;  5TV2 A;  1VQN B;  1GAQ A;  4TMT A;  5IYP A;  2CC2 A;  4RDL A;  2BPO A;  1KTV A;  4Z1M A;  2C4U A;  4P2N A;  4PC1 A;  2CND A;  2XNJ A;  1E3Z A;  4P3I A;  4QVJ A;  4UAJ A;  1NRK A;  1MAB A;  1HZE A;  3I56 B;  2Q6I A;  3Q6Q A;  4ACB A;  1N08 A;  4LBY A;  4G1B A;  2VBS A;  1W87 A;  1QUE A;  3OW7 A;  1JA1 A;  3B78 A;  3WQZ A;  2RC5 A;  5DSZ A;  1FX0 A;  1QGY A;  3VO1 A;  1T6X A;  1WP6 A;  4AF7 A;  4WZE A;  2ZBV A;  2AHO A;  3A35 A;  5KW9 A;  3U2Q A;  1F20 A;  1WDT A;  4FN5 A;  2OBS A;  2V7Q A;  4XR6 A;  5HZA A;  2Q6O A;  3CMA B;  4K1X A;  4C0S A;  1NDH A;  2C5B A;  3CCR B;  5F4M A;  1ZM3 A;  2QTZ A;  4KKS A;  3WBK A;  2NV4 A;  4G7X A;  1N07 A;  2C78 A;  3GVJ A;  1KK0 A;  3CP8 A;  3PEN A;  5LMZ A;  3OZU A;  2GRE A;  4U9U A;  2XEX A;  1QVG B;  1YHQ B;  4Z4Z A;  4RD4 A;  5F4J A;  5DN6 A;  4RDJ A;  2W6I A;  2P3M A;  2X53 S;  4ZCI A;  2ZXI A;  1UD2 A;  1EP2 B;  2QDX A;  5A89 A;  4Z4R A;  3CRZ A;  2DER A;  2V7U A;  2R6H A;  3OEE A;  3WXM A;  3ZIA A;  4XLF A;  3BNW A;  1N06 A;  1JJ2 B;  4OOX A;  1R5N A;  1OGJ A;  1VQ5 B;  3CCU B;  1W2B B;  2BGJ A;  3A8J A;  1V0E A;  3H94 A;  3QE2 A;  2C2W A;  3W2H A;  3G4S B;  2D3L A;  3LO8 A;  3Q38 A;  1KZL A;  4HE5 A;  3GQB A;  1H42 A;  3KEW A;  1SKY B;  1G7C A;  4RM0 A;  3ZUG A;  4E0F A;  4TSF A;  4BPR A;  3PVD A;  3VNU A;  1EFU A;  1E63 A;  3P27 A;  3W5V A;  4XLH A;  3BH4 A;  4M0L A;  1KQS B;  1QFY A;  2CK3 A;  4B48 A;  2XNC A;  3ZC3 A;  4YAF A;  3A3B A;  1VJS A;  4ACA A;  2JDI A;  4Z4S A;  4TMZ A;  4R71 A;  3WNB A;  5IYR A;  3OW2 B;  5BSY A;  5L46 A;  3CCL B;  3CCE B;  3GIR A;  4TT3 A;  2WR8 A;  4YAW A;  3U6B A;  2ZZE A;  3QFT A;  3LQ6 A;  2NPF A;  3SLD A;  1QH0 A;  4DQK A;  2X3U A;  1OB5 A;  1G7S A;  1OB0 A;  2OBR A;  4Y7C A;  1E43 A;  2D3N A;  4XKV A;  1IB0 A;  3A1P A;  1I7P A;  3CXC B;  4OOS A;  4TMX A;  4RCZ A;  2QGG A;  3AVY A;  3T51 B;  3G6E B;  4Z4V A;  1Q81 D;  1B2R A;  1UD4 A;  2V31 A;  3D26 A;  2CW5 A;  1QFZ A;  2BN4 A;  3CMM A;  4YAO A;  2XOK A;  4XKW A;  1N0V C;  2ZXH A;  4QV2 A;  3GSI A;  4X7C A;  4J0Q A;  1BMF A;  2C4T A;  2DCU A;  3DDY A;  4NCN A;  4WZT A;  5FO0 A;  4XOP A;  1YLO A;  2QN6 A;  1OB2 A;  3W5H A;  4G6I A;  2DYI A;  1PJ7 A;  5IYQ A;  3CC4 B;  2D74 A;  3FJO A;  2W6J A;  1IJF A;  4F7D A;  1T6Z A;  3JQR A;  3R6K A;  1XFO A;  1DAR A;  4ZGN B;  1EXM A;  2B5O A;  5IYN A;  1I18 A;  3JQP A;  4TKO B;  2JJ1 A;  4P1V A;  2ZZG A;  2J7K A;  4PC7 A;  4RDK A;  1FNM A;  4X0C A;  4XM3 A;  2OYN A;  3H9N A;  5TRD A;  2KVO A;  2YWF A;  2ZZF A;  3PUN A;  4HE6 A;  4X7F A;  2ZTG A;  3ONY A;  4GQN A;  1FRQ A;  5H5J A;  1IHM A;  4OPV A;  2V7T A;  2ZZQ A;  1E1R A;  4RD1 A;  4RPB A;  4YAU A;  3OP1 A;  2B7B A;  1IJE A;  2VNI A;  4M53 A;  1MRZ A;  1WPC A;  1J9Z A;  1KK3 A;  2B7C A;  1DDI A;  3CD6 B;  3OKX A;  4WQM A;  4B3G A;  3QFR A;  3WYA A;  1H8H A;  1YX2 A;  1K73 D;  3CME B;  3Q39 A;  2E1R A;  1V0F A;  1SM4 A;  1KK2 A;  4KKU A;  1XE1 A;  5IK2 A;  3CB4 A;  1VQ4 B;  4XLE A;  1TUI A;  2GPJ A;  3BCF A;  3B82 A;  3AVX A;  1VQ7 B;  4Q7J B;  3CPW B;  1VHO A;  4N3N A;  2HCJ B;  3A3G A;  4PAB A;  1F60 A;  3OOC A;  4MYU A;  4PC6 A;  4P9S A;  1E62 A;  3PUM A;  4N3G A;  4Z4T A;  3OZW A;  5F4O A;  1S72 B;  3OEH A;  3ASP A;  4P6Y A;  1YIT B;  3W2F A;  2ZL5 A;  1PJ6 A;  2M5S A;  2OTL B;  2E1B A;  3JU4 A;  4P12 A;  1I8D A;  3PA1 A;  3R6J A;  3G71 B;  3MMP A;  4OOV A;  5FNZ A;  2BVN A;  4DK1 A;  3G05 A;  4M4S A;  3SKB A;  1AIP A;  4M1K A;  3CCM B;  1GAW A;  3SLN A;  1JA0 A;  3FPP A;  3VNV A;  5KNL A;  3AVW A;  1E1Q A;  2V4D A;  2VNK A;  3BY1 A;  3OJX A;  4LC0 A;  4B3F X;  4OPS A;  2DEU A;  4ZGQ B;  5H59 A;  3LVB A;  3CES A;  4P25 A;  3ZZT A;  3HAG A;  3AGP A;  4FWT A;  4WZL A;  3WY9 A;  1VF7 A;  1Q86 D;  2XGJ A;  4XLA A;  1WSR A;  2C77 A;  2ZIT A;  5CDF A;  1NB0 A;  1U2R A;  4QHY A;  1FND A;  1DDG A;  2PE3 A;  1KRH A;  2PLF A;  1K8A D;  5HXB A;  2QE7 A;  4P3Y A;  2PIA A;  2RC6 A;  3OPO A;  1S0U A;  1VQM B;  4B3X A;  5J35 A;  1PKV A;  1BLI A;  2F1L A;  2JN9 A;  2WZN A;  2ZTN A;  4YAL A;  3QSY A;  3AVU A;  1UD6 A;  2VZL A;  1VQP B;  1EFR A;  4RD6 A;  1T6Y A;  1EFC A;  3QFS A;  4QUZ A;  4ZV4 A;  2X85 A;  3W2I A;  1BJK A;  5FO1 A;  3ONU A;  3A8I A;  2XZO A;  4PGO A;  1HA3 A;  4PC3 A;  1WOP A;  4RJL A;  4B4D A;  1G7T A;  4X06 A;  1EWY A;  5GV7 A;  2VBT A;  1TVC A;  2VNH A;  4XON A;  2XZL A;  3BC9 A;  5B6I A;  3Q6R A;  1A8P A;  3GVK A;  2XND A;  5GV8 A;  1QFJ A;  4WZK A;  5IYW A;  1Q7Y D;  4JMQ A;  3LQE A;  2OBT A;  1TLL A;  4AF6 A;  3E1Y E;  3CC7 B;  1VQ6 B;  3P26 A;  3ZBT A;  2BV3 A;  2X8K A;  3BCD A;  3B8H A;  4PC2 A;  4NNJ A;  2V7X A;  1E79 A;  3T53 B;  1ZUN B;  4OP7 A;  1BPL A;  4C43 A;  1QUF A;  2GJR A;  2ZBU A;  4II3 A;  1KK1 A;  3E20 A;  5DS0 A;  2VBU A;  4G1V A;  3ZPN A;  4XOT A;  1Y0Y A;  1W0J A;  3VO2 A;  2BGI A;  5BSX A;  2QA4 B;  1QG0 A;  2QMU A;  3OE7 A;  1NBM A;  4Y9U A;  5A8A A;  4RLZ A;  1BX0 A;  3Q3A A;  4QFM A;  4UZE A;  4KKT A;  4XOR A;  1WSV A;  1XQB A;  4L8J A;  3OFN A;  2DIE A;  3I55 B;  1S4M A;  2HDN B;  1QGZ A;  3CPX A;  1D2E A;  1RQR A;  3PA2 A;  3A8K A;  3GVL A;  5HKK A;  3CCQ B;  1VQ8 B;  1XB2 A;  2BMW A;  3ZZU A;  1COW A;  2DOG A;  3OZV A;  1E3X A;  1ZM4 A;  3WBJ A;  5TR9 A;  5THX A;  4FXU A;  2XZP A;  5EMN A;  2D9R A;  4LBW A;  2FVG A;  1W35 A;  2OK7 A;  3CC2 B;  3W2G A;  4YEJ A;  1M90 D;  4IW3 B;  1PJ5 A;  4AC9 A;  4XQF A;  5A88 A;  1VQK B;  4DNT B;  4X05 A;  2V7W A;  3J81 k;  2JIZ A;  1W34 A;  4NBS A;  1QGA A;  2Q6K A;  2Z6B D;  3NE5 B;  2LZJ A;  5FL7 A;  2VYQ A;  3OJW A;  4RPD A;  2GK7 A;  1QVF B;  2V7V A;  1GR1 A;  2ZL6 A;  4P6V F;  1KD1 D;  1Y0R A;  2I1L A;  2VJJ A;  2ZL7 A;  3OAA A;  1N0U A;  2CF4 A;  1EFT A;  3WND A; 
#chains in the Genus database with same CATH homology
 4Z4V A;  5IYP A;  3D26 A;  4RDL A;  4P2N A;  4P3I A;  4QVJ A;  4QV2 A;  4X7C A;  4X7D A;  3Q6Q A;  4WZT A;  5J35 A;  3SEJ A;  5IYQ A;  4P26 A;  4QUZ A;  3SJP A;  4Z4W A;  3ONU A;  3R6K A;  4Z4U A;  5IYN A;  4X06 A;  4P1V A;  4X0C A;  4RDK A;  4WZE A;  5KW9 A;  5HZA A;  2OBS A;  3PUN A;  4X07 A;  3Q6R A;  5IYW A;  4WZK A;  3ASR A;  4X7F A;  3LQE A;  2OBT A;  3ONY A;  4ROX A;  5F4M A;  1IHM A;  4OPV A;  4RPB A;  3ASS A;  4OP7 A;  3RY8 A;  4OPO A;  3BQJ A;  4QVA A;  4Z4Z A;  5F4J A;  5BSX A;  4RDJ A;  3Q39 A;  4Z4R A;  4RLZ A;  3Q3A A;  5J3O A;  3AST A;  4OOX A;  5E6T A;  3PA2 A;  3Q38 A;  3PUM A;  4Z4T A;  5F4O A;  3ASP A;  4RM0 A;  5HZB A;  2ZL5 A;  3PVD A;  4P12 A;  3PA1 A;  3R6J A;  4X7E A;  4OOV A;  3V7A A;  3SKB A;  4Z4S A;  4Z4Y A;  4X05 A;  5IYR A;  5BSY A;  3SLN A;  3ASQ A;  3BY1 A;  3SLD A;  3LQ6 A;  4OPS A;  4RPD A;  2OBR A;  4P25 A;  2ZL6 A;  3BY2 A;  2ZL7 A;  4OOS A;  4WZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...