4X7EA

Crystal structure of norovirus gii.10 p domain in complex with nano-85
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
315
structure length
304
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norovirus
total genus 69
structure length 304
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4x7eA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4x7eA01
3ASTA 3LQ6A 4OOVA 2OBSA 4OPVA 4RM0A 4RLZA 4X7CA 3V7AA 4QVJA 5BSYA 4WZTA 4P2NA 3PVDA 4QV2A 3SLDA 4RDLA 1IHMA 4Z4RA 4P26A 4OPSA 4Z4ZA 3D26A 5F4JA 2ZL5A 4QVAA 4WZKA 5HZBA 4X05A 3BY2A 3Q6QA 4OP7A 3R6JA 4OOSA 4QUZA 3ASQA 3LQEA 3ASRA 5J3OA 4WZEA 3R6KA 4Z4YA 4RDKA 3SKBA 3ONYA 5IYWA 2ZL6A 5KW9A 4RDJA 3ONUA 3BY1A 4X7FA 5F4OA 3SEJA 5J35A 5IYNA 5IYPA 3SLNA 4P3IA 4Z4VA 3RY8A 4ROXA 5BSXA 2OBRA 4Z4WA 5E6TA 4RPBA 4X06A 3SJPA 5IYQA 4OPOA 3Q38A 4X07A 3PUMA 4OOXA 4Z4SA 3BQJA 3PA2A 2OBTA 5F4MA 3ASSA 4P25A 4Z4TA 3Q3AA 5IYRA 3Q6RA 5HZAA 4X7EA 2ZL7A 3Q39A 4Z4UA 3PA1A 4X7DA 4P12A 4RPDA 4WZLA 3PUNA 4X0CA 3ASPA 4P1VA
chains in the Genus database with same CATH superfamily
3ASTA 4YELA 3CC2B 2XZLA 4OOVA 1DARA 1F20A 2GJPA 4QVJA 5FIUA 2C2WA 2P3MA 2X0KA 4Y9UA 3A35A 1H8EA 1YLOA 2QGGA 3OP1A 1VQPB 3JQQA 3PVDA 2BVNA 1XE1A 2D3NA 2F43A 3HAGA 3QFCA 1IHMA 3FPKA 4ZCIA 4OPSA 1B2RA 1TTTA 3WNCA 3ZPNA 2VNKA 1QUEA 4XLAA 1D2EA 4TKOB 5F4JA 1GAWA 3ZZ0A 2AHOA 4PC2A 4QVAA 5A8AA 1VQNB 1E1QA 4G6IA 4II3A 2ZZEA 1EWYA 1QGAA 2XNDA 3Q6QA 5EMNA 3ZBTA 2GREA 3GVJA 3ZBUA 4XQFA 1E63A 4G1VA 2VBUA 3B78A 1UD5A 1KD1D 2BGIA 3G71B 3ASRA 3OAAA 4NCNA 2VBTA 2ZBUA 1E3ZA 4Z4YA 3CW2A 4XN3A 2PLFA 1HZEA 1E43A 4YALA 3P27A 4TN1A 2DERA 1BMFA 5IYWA 2X3UA 2BM1A 2Q6KA 4B3FX 4RDJA 4RCYA 1ZM2A 2VNHA 1WORA 1ZM9A 1KC8D 5LMZA 1FRQA 3MMPA 4F7DA 3AVYA 4XLCA 1N08A 1QG0A 3CP2A 4XLHA 5IYNA 4P3IA 4UZUA 2HDNB 1OB2A 3W2IA 1FRNA 3G4SB 4YAFA 4AF6A 2DEUA 1YJWB 2X6WA 1T6YA 2CF4A 4TMZA 3OZVA 4X06A 2YWGA 2YWEA 1V5VA 1XB2A 5B6IA 1FDRA 1MRZA 2QDXA 4YAOA 1EFUA 3CCLB 1QH0A 1BX0A 1BJKA 1B23P 2RC6A 2JIZA 3ZIAA 1S4MA 5F4MA 4TMVA 1H8HA 4JMQA 1BLIA 1UD2A 2R6HA 2X6YA 3QFSA 1Q81D 4TMWA 1VF7A 4U9UA 3Q3AA 5IYRA 1YITB 3QSYA 4X7EA 2EIXA 1R5OA 2ZL7A 1N06A 4PC3A 4AVZA 2NPFA 2VBVA 3PA1A 2ZZQA 4B3XA 4G7XA 3OEEA 4P12A 4ZGNB 4RPDA 3OJXA 3CRZA 1FNCA 4DK1A 4E0FA 2V7TA 1VQMB 4QFMA 1WDTA 1WOSA 4UAJA 4X0CA 4P6VF 4YXWA 1BPLA 3VR6A 1KQSB 4K1XA 1KRHA 2DCUA 2GK6A 1T5EA 4DQLA 3CXCB 2GPJA 2Q6LA 1VHOA 4PABA 3AVWA 3KL9A 3QE2A 3CMEB 1NJID 3V7AA 1IJEA 3OZUA 1K8AD 4Z1MA 1KTVA 3W2FA 4AC9A 4WZTA 3CP8A 3FKSA 4C0SA 1VQ4B 4XMYA 2QTZA 4RDLA 1K28D 2CBXA 4Z4RA 4FWTA 4Z4ZA 4EH1A 1E1RA 4M0LA 3OE7A 4C43A 1SKYB 2V7XA 3D26A 3OJWA 4DQKA 4LC0A 2NV4A 1OGJA 1VJSA 3ZZUA 2DY1A 1G7SA 2VJJA 3A8JA 3OW7A 1W87A 2FVGA 3QFTA 4PGOA 5HZBA 3MHPA 3CCSB 2YWFA 3VNVA 5GV8A 1NDHA 1YI2B 1VLYA 1WTHD 1TLLA 1H85A 1E64A 1T6XA 4YAWA 1E3XA 3WBJA 1ZM3A 2GK7A 2J7KA 3LQEA 5J3OA 1QVGB 3E20A 2D74A 2CRVA 3R6KA 4P9SA 1AMOA 2F4NA 3GIRA 2XZOA 4RDKA 1R5NA 3SKBA 3WBKA 2BV3A 2V7QA 3B8HA 3ONYA 4ZCLA 1G7CA 1Q9SA 1KK2A 2EFGA 3U6BA 1N0UA 2V31A 3ONUA 1W0KA 2W6IA 4B48A 3CPWB 2QN6A 5FL7A 5GV7A 3VMFA 4XD7A 1VQKB 1COWA 2C77A 1F60A 3ZC3A 5J35A 4LBVA 1IJFA 1N05A 1V0FA 3LVBA 4WQMA 2F1MA 1ZUNB 3GVKA 1I8DA 2E1BA 2WYRA 1QGYA 4RD3A 1D8TA 2C4TA 2R9VA 4ROXA 2WZNA 5BSXA 1YJNB 4XONA 2OBRA 2M5SA 1VQLB 3AVUA 4RD0A 2ZZGA 1NBMA 2XEXA 1VLOA 4X07A 4FN5A 3OZWA 1QUFA 4Z4SA 4B3GA 3CMAB 3BQJA 3I1FA 1V0EA 2C78A 1I18A 3VO2A 4KKTA 4BPRA 2QA4B 2PIAA 5L46A 2V7VA 1YHQB 1BX1A 4QHYA 5CDFA 4KKUA 3SJZA 1CQXA 4M53A 4P6YA 5IK2A 3I56B 1W2BB 4M2LA 3ZUGA 3FPPA 4NBSA 4RD2A 3AVVA 1UD8A 4MYUA 1SM4A 1DDGA 4XNFA 2WZPP 1BQEA 1VQ6B 3KEWA 2C4UA 1UD4A 1OHHA 1QFYA 1H42A 1E62A 1Y0YA 3WXMA 2KVOA 5DSZA 1RQRA 1EP1B 1RQPA 3A3GA 4N3NA 1DDIA 2DIEA 4RD1A 1UD3A 3BCDA 1VQ8B 3AVXA 2OBSA 4RM0A 2ZBVA 4B4DA 3T53B 1Y0RA 1N0VC 1J9ZA 2DETA 2ZXHA 5TRDA 4XOTA 2V7UA 1JNYA 1CNFA 3FJOA 4QV2A 2XZPA 3AVTA 3DDYA 2CC2A 4XOPA 1WSRA 2VJIA 5H5JA 1VQ5B 3OPOA 2YWHA 4LBZA 3G6EB 4TSFA 1PJ5A 2C5HA 3BNWA 1GAQA 3OFNA 1XQBA 4WZKA 5FA6A 1DG1G 2XGJA 3BC9A 2B5OA 5DN6A 3ISXA 1FX0A 4R71A 5FNZA 2WR8A 1N8RD 4OOSA 1VHEA 2ZTGA 4QUZA 1M1KD 2VZLA 1P4MA 1OB5A 4FXUA 3CCUB 2JJ1A 5HKKA 4YHBA 4RD6A 2WJVA 3ASQA 3GSIA 3H94A 1VQOB 3GQBA 4WZEA 2Q6IA 4Y7CA 4AF7A 2QMUA 4DK0A 1YJ9B 2JJ2A 1D1NA 2DYIA 1PJ7A 5KNLA 2WSSA 2ZL6A 2OTJB 5KW9A 1EP2B 3J81k 1Q82D 2JN9A 5THXA 5H59A 4UZEA 1NB9A 4CQJA 4DNTB 3BY1A 3AGQA 3JQRA 3PENA 4RD4A 4X7FA 3CC4B 4RCZA 5JBQA 3T56B 1S72B 4Q7JB 4G5GA 3CESA 3LO8A 4ZGQB 1OGIA 1QVFB 1GJRA 2OYNA 3SLNA 5KSWB 4XKWA 4M1KA 4Z4VA 2WJYA 4P3YA 4Z4WA 1HVXA 2RC5A 4LBWA 2WPDA 5A88A 1W34A 5E6TA 4RPBA 3SJPA 5IYQA 3CC7B 4LBYA 1FNDA 3Q38A 4ZCMA 3PUMA 4L8JA 3CCVB 1JJ2B 2I1LA 2OBTA 2Z6BD 2QEXB 1XFOA 1K73D 2OK7A 2CW5A 1FNBA 1WOPA 4TMTA 4UZFA 1MABA 1UD6A 2PE3A 2V4DA 3G05A 3MCAA 2ZZFA 4P25A 4Z4TA 1S0UA 2GQFA 1KMHA 5HXBA 3CB4A 3W5UA 4KKSA 1JB9A 4Z4UA 1W35A 1EFCA 4RJLA 4X7DA 1WP6A 1WSVA 4II2A 2CNDA 2C5BA 4WZLA 3I55B 3QFRA 1U2RA 4ASUA 1K9MD 3ASPA 1QGZA 1M90D 1N07A 4FK8A 5DS0A 1ZM4A 2X8KA 2HMAA 2QE7A 3CPXA 2W6JA 1KK1A 2BMWA 3LQ6A 2B7CA 3WYAA 3WNBA 4M4SA 1YX2A 1FNMA 4OPVA 4RLZA 4X7CA 3A8KA 4XORA 4B44A 5BSYA 3CCQB 4HIZA 3WQZA 3VNUA 4ACBA 2E1RA 3A8IA 1QFZA 4P2NA 4XM3A 1G7RA 3SLDA 1KK0A 1KJZA 2F1LA 4P26A 1VQ9B 1QFJA 1EXMA 1NRKA 2JDIA 2GJKA 4XLEA 2D9RA 2ZL5A 3W2HA 4XKVA 1IB0A 1PJ6A 2CK3A 2ZITA 3CMMA 4X05A 1QX4A 3BY2A 1KK3A 3CTAA 4OP7A 3R6JA 4PAAA 5TV2A 3T51B 2QTLA 2BPOA 2GJRA 3LNNA 4HE5A 3B82A 2X85A 1EFTA 1Q86D 2VYQA 1HA3A 2VNJA 1PKVA 1ELOA 3GVLA 4MYTA 2DOGA 3ES9A 3U2QA 2BF4A 2ZTNA 2PMDA 2XNCA 2D3LA 2Q6OA 1WPCA 4IW3B 2XOKA 2OK8A 3CCEB 5FO1A 4G7WA 5AN9A 1TUIA 4TMXA 1JA1A 1CNEA 1R5BA 5F4OA 1YIJB 1GO2A 4B47A 2ZXIA 3SEJA 3E1YE 5A89A 1EFRA 4NNJA 1WU8A 5IYPA 4ZV4A 2FX3A 1SKQA 3BH4A 3OOCA 3P26A 4TT3A 4HE6A 4H9GA 3CCJB 1Q7YD 3CD6B 3RY8A 3OW2B 3WY9A 5FO0A 1T6ZA 4J0QA 3W5HA 3A1PA 4PC7A 3U6KA 1TVCA 4OPOA 2BSAA 3NE5B 4XR6A 2HCJB 1G7TA 2BM0A 4N3GA 4OOXA 4X8IA 1A8PA 3W2EA 4B43A 3CCRB 2BN4A 3PA2A 2LZJA 1GR1A 4YAUA 3BCFA 4G1BA 4PC1A 3ASSA 3JQPA 2OTLB 1UMKA 5TR9A 1NB0A 1W0JA 5TY0A 1EP3B 1GVHA 1OB0A 3OKXA 4P22A 3Q6RA 3AGPA 5HZAA 3Q39A 2X6XA 1E79A 2V7WA 4XN0A 4WWVA 1W9XA 1AIPA 2HLDA 1I7PA 4XLFA 4DNRB 3PUNA 1JA0A 1KZLA 4PC6A 3A3BA 2B7BA 4GQNA 3H9NA 3ZZTA 3OEHA 3W2GA 2X53S 4P1VA 4XL9A 3JU4A 3CCMB 2BGJA 4Y9RA 1WOOA 3V76A 4ACAA 2VNIA 1VQ7B 4YEJA 3VO1A 2XNJA 2VBSA 3WNDA 3W5VA
chains in the Genus database with same CATH topology
3ASTA 3LQ6A 4OOVA 2OBSA 4OPVA 4RM0A 4RLZA 4X7CA 3V7AA 4QVJA 5BSYA 4WZTA 4P2NA 3PVDA 4QV2A 3SLDA 4RDLA 1IHMA 4Z4RA 4P26A 4OPSA 4Z4ZA 3D26A 5F4JA 2ZL5A 4QVAA 4WZKA 5HZBA 4X05A 3BY2A 3Q6QA 4OP7A 3R6JA 4OOSA 4QUZA 3ASQA 3LQEA 3ASRA 5J3OA 4WZEA 3R6KA 4Z4YA 4RDKA 3SKBA 3ONYA 5IYWA 2ZL6A 5KW9A 4RDJA 3ONUA 3BY1A 4X7FA 5F4OA 3SEJA 5J35A 5IYNA 5IYPA 3SLNA 4P3IA 4Z4VA 3RY8A 4ROXA 5BSXA 2OBRA 4Z4WA 5E6TA 4RPBA 4X06A 3SJPA 5IYQA 4OPOA 3Q38A 4X07A 3PUMA 4OOXA 4Z4SA 3BQJA 3PA2A 2OBTA 5F4MA 3ASSA 4P25A 4Z4TA 3Q3AA 5IYRA 3Q6RA 5HZAA 4X7EA 2ZL7A 3Q39A 4Z4UA 3PA1A 4X7DA 4P12A 4RPDA 4WZLA 3PUNA 4X0CA 3ASPA 4P1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AST A;  3LQ6 A;  4OOV A;  2OBS A;  4OPV A;  4RM0 A;  4RLZ A;  4X7C A;  3V7A A;  4QVJ A;  5BSY A;  4WZT A;  4P2N A;  3PVD A;  4QV2 A;  3SLD A;  4RDL A;  1IHM A;  4Z4R A;  4P26 A;  4OPS A;  4Z4Z A;  3D26 A;  5F4J A;  2ZL5 A;  4QVA A;  4WZK A;  5HZB A;  4X05 A;  3BY2 A;  3Q6Q A;  4OP7 A;  3R6J A;  4OOS A;  4QUZ A;  3ASQ A;  3LQE A;  3ASR A;  5J3O A;  4WZE A;  3R6K A;  4Z4Y A;  4RDK A;  3SKB A;  3ONY A;  5IYW A;  2ZL6 A;  5KW9 A;  4RDJ A;  3ONU A;  3BY1 A;  4X7F A;  5F4O A;  3SEJ A;  5J35 A;  5IYN A;  5IYP A;  3SLN A;  4P3I A;  4Z4V A;  3RY8 A;  4ROX A;  5BSX A;  2OBR A;  4Z4W A;  5E6T A;  4RPB A;  4X06 A;  3SJP A;  5IYQ A;  4OPO A;  3Q38 A;  4X07 A;  3PUM A;  4OOX A;  4Z4S A;  3BQJ A;  3PA2 A;  2OBT A;  5F4M A;  3ASS A;  4P25 A;  4Z4T A;  3Q3A A;  5IYR A;  3Q6R A;  5HZA A;  4X7E A;  2ZL7 A;  3Q39 A;  4Z4U A;  3PA1 A;  4X7D A;  4P12 A;  4RPD A;  4WZL A;  3PUN A;  4X0C A;  3ASP A;  4P1V A; 
#chains in the Genus database with same CATH topology
 3AST A;  4YEL A;  3CC2 B;  2XZL A;  4OOV A;  1DAR A;  1F20 A;  2GJP A;  4QVJ A;  5FIU A;  2C2W A;  2P3M A;  2X0K A;  4Y9U A;  3A35 A;  1H8E A;  1YLO A;  2QGG A;  3OP1 A;  1VQP B;  3JQQ A;  3PVD A;  2BVN A;  1XE1 A;  2D3N A;  2F43 A;  3HAG A;  3QFC A;  1IHM A;  3FPK A;  4ZCI A;  4OPS A;  1B2R A;  1TTT A;  3WNC A;  3ZPN A;  2VNK A;  1QUE A;  4XLA A;  1D2E A;  4TKO B;  5F4J A;  1GAW A;  3ZZ0 A;  2AHO A;  4PC2 A;  4QVA A;  5A8A A;  1VQN B;  1E1Q A;  4G6I A;  4II3 A;  2ZZE A;  1EWY A;  1QGA A;  2XND A;  3Q6Q A;  5EMN A;  3ZBT A;  2GRE A;  3GVJ A;  3ZBU A;  4XQF A;  1E63 A;  4G1V A;  2VBU A;  3B78 A;  1UD5 A;  1KD1 D;  2BGI A;  3G71 B;  3ASR A;  3OAA A;  4NCN A;  2VBT A;  2ZBU A;  1E3Z A;  4Z4Y A;  3CW2 A;  4XN3 A;  2PLF A;  1HZE A;  1E43 A;  4YAL A;  3P27 A;  4TN1 A;  2DER A;  1BMF A;  5IYW A;  2X3U A;  2BM1 A;  2Q6K A;  4B3F X;  4RDJ A;  4RCY A;  1ZM2 A;  2VNH A;  1WOR A;  1ZM9 A;  1KC8 D;  5LMZ A;  1FRQ A;  3MMP A;  4F7D A;  3AVY A;  4XLC A;  1N08 A;  1QG0 A;  3CP2 A;  4XLH A;  5IYN A;  4P3I A;  4UZU A;  2HDN B;  1OB2 A;  3W2I A;  1FRN A;  3G4S B;  4YAF A;  4AF6 A;  2DEU A;  1YJW B;  2X6W A;  1T6Y A;  2CF4 A;  4TMZ A;  3OZV A;  4X06 A;  2YWG A;  2YWE A;  1V5V A;  1XB2 A;  5B6I A;  1FDR A;  1MRZ A;  2QDX A;  4YAO A;  1EFU A;  3CCL B;  1QH0 A;  1BX0 A;  1BJK A;  1B23 P;  2RC6 A;  2JIZ A;  3ZIA A;  1S4M A;  5F4M A;  4TMV A;  1H8H A;  4JMQ A;  1BLI A;  1UD2 A;  2R6H A;  2X6Y A;  3QFS A;  1Q81 D;  4TMW A;  1VF7 A;  4U9U A;  3Q3A A;  5IYR A;  1YIT B;  3QSY A;  4X7E A;  2EIX A;  1R5O A;  2ZL7 A;  1N06 A;  4PC3 A;  4AVZ A;  2NPF A;  2VBV A;  3PA1 A;  2ZZQ A;  4B3X A;  4G7X A;  3OEE A;  4P12 A;  4ZGN B;  4RPD A;  3OJX A;  3CRZ A;  1FNC A;  4DK1 A;  4E0F A;  2V7T A;  1VQM B;  4QFM A;  1WDT A;  1WOS A;  4UAJ A;  4X0C A;  4P6V F;  4YXW A;  1BPL A;  3VR6 A;  1KQS B;  4K1X A;  1KRH A;  2DCU A;  2GK6 A;  1T5E A;  4DQL A;  3CXC B;  2GPJ A;  2Q6L A;  1VHO A;  4PAB A;  3AVW A;  3KL9 A;  3QE2 A;  3CME B;  1NJI D;  3V7A A;  1IJE A;  3OZU A;  1K8A D;  4Z1M A;  1KTV A;  3W2F A;  4AC9 A;  4WZT A;  3CP8 A;  3FKS A;  4C0S A;  1VQ4 B;  4XMY A;  2QTZ A;  4RDL A;  1K28 D;  2CBX A;  4Z4R A;  4FWT A;  4Z4Z A;  4EH1 A;  1E1R A;  4M0L A;  3OE7 A;  4C43 A;  1SKY B;  2V7X A;  3D26 A;  3OJW A;  4DQK A;  4LC0 A;  2NV4 A;  1OGJ A;  1VJS A;  3ZZU A;  2DY1 A;  1G7S A;  2VJJ A;  3A8J A;  3OW7 A;  1W87 A;  2FVG A;  3QFT A;  4PGO A;  5HZB A;  3MHP A;  3CCS B;  2YWF A;  3VNV A;  5GV8 A;  1NDH A;  1YI2 B;  1VLY A;  1WTH D;  1TLL A;  1H85 A;  1E64 A;  1T6X A;  4YAW A;  1E3X A;  3WBJ A;  1ZM3 A;  2GK7 A;  2J7K A;  3LQE A;  5J3O A;  1QVG B;  3E20 A;  2D74 A;  2CRV A;  3R6K A;  4P9S A;  1AMO A;  2F4N A;  3GIR A;  2XZO A;  4RDK A;  1R5N A;  3SKB A;  3WBK A;  2BV3 A;  2V7Q A;  3B8H A;  3ONY A;  4ZCL A;  1G7C A;  1Q9S A;  1KK2 A;  2EFG A;  3U6B A;  1N0U A;  2V31 A;  3ONU A;  1W0K A;  2W6I A;  4B48 A;  3CPW B;  2QN6 A;  5FL7 A;  5GV7 A;  3VMF A;  4XD7 A;  1VQK B;  1COW A;  2C77 A;  1F60 A;  3ZC3 A;  5J35 A;  4LBV A;  1IJF A;  1N05 A;  1V0F A;  3LVB A;  4WQM A;  2F1M A;  1ZUN B;  3GVK A;  1I8D A;  2E1B A;  2WYR A;  1QGY A;  4RD3 A;  1D8T A;  2C4T A;  2R9V A;  4ROX A;  2WZN A;  5BSX A;  1YJN B;  4XON A;  2OBR A;  2M5S A;  1VQL B;  3AVU A;  4RD0 A;  2ZZG A;  1NBM A;  2XEX A;  1VLO A;  4X07 A;  4FN5 A;  3OZW A;  1QUF A;  4Z4S A;  4B3G A;  3CMA B;  3BQJ A;  3I1F A;  1V0E A;  2C78 A;  1I18 A;  3VO2 A;  4KKT A;  4BPR A;  2QA4 B;  2PIA A;  5L46 A;  2V7V A;  1YHQ B;  1BX1 A;  4QHY A;  5CDF A;  4KKU A;  3SJZ A;  1CQX A;  4M53 A;  4P6Y A;  5IK2 A;  3I56 B;  1W2B B;  4M2L A;  3ZUG A;  3FPP A;  4NBS A;  4RD2 A;  3AVV A;  1UD8 A;  4MYU A;  1SM4 A;  1DDG A;  4XNF A;  2WZP P;  1BQE A;  1VQ6 B;  3KEW A;  2C4U A;  1UD4 A;  1OHH A;  1QFY A;  1H42 A;  1E62 A;  1Y0Y A;  3WXM A;  2KVO A;  5DSZ A;  1RQR A;  1EP1 B;  1RQP A;  3A3G A;  4N3N A;  1DDI A;  2DIE A;  4RD1 A;  1UD3 A;  3BCD A;  1VQ8 B;  3AVX A;  2OBS A;  4RM0 A;  2ZBV A;  4B4D A;  3T53 B;  1Y0R A;  1N0V C;  1J9Z A;  2DET A;  2ZXH A;  5TRD A;  4XOT A;  2V7U A;  1JNY A;  1CNF A;  3FJO A;  4QV2 A;  2XZP A;  3AVT A;  3DDY A;  2CC2 A;  4XOP A;  1WSR A;  2VJI A;  5H5J A;  1VQ5 B;  3OPO A;  2YWH A;  4LBZ A;  3G6E B;  4TSF A;  1PJ5 A;  2C5H A;  3BNW A;  1GAQ A;  3OFN A;  1XQB A;  4WZK A;  5FA6 A;  1DG1 G;  2XGJ A;  3BC9 A;  2B5O A;  5DN6 A;  3ISX A;  1FX0 A;  4R71 A;  5FNZ A;  2WR8 A;  1N8R D;  4OOS A;  1VHE A;  2ZTG A;  4QUZ A;  1M1K D;  2VZL A;  1P4M A;  1OB5 A;  4FXU A;  3CCU B;  2JJ1 A;  5HKK A;  4YHB A;  4RD6 A;  2WJV A;  3ASQ A;  3GSI A;  3H94 A;  1VQO B;  3GQB A;  4WZE A;  2Q6I A;  4Y7C A;  4AF7 A;  2QMU A;  4DK0 A;  1YJ9 B;  2JJ2 A;  1D1N A;  2DYI A;  1PJ7 A;  5KNL A;  2WSS A;  2ZL6 A;  2OTJ B;  5KW9 A;  1EP2 B;  3J81 k;  1Q82 D;  2JN9 A;  5THX A;  5H59 A;  4UZE A;  1NB9 A;  4CQJ A;  4DNT B;  3BY1 A;  3AGQ A;  3JQR A;  3PEN A;  4RD4 A;  4X7F A;  3CC4 B;  4RCZ A;  5JBQ A;  3T56 B;  1S72 B;  4Q7J B;  4G5G A;  3CES A;  3LO8 A;  4ZGQ B;  1OGI A;  1QVF B;  1GJR A;  2OYN A;  3SLN A;  5KSW B;  4XKW A;  4M1K A;  4Z4V A;  2WJY A;  4P3Y A;  4Z4W A;  1HVX A;  2RC5 A;  4LBW A;  2WPD A;  5A88 A;  1W34 A;  5E6T A;  4RPB A;  3SJP A;  5IYQ A;  3CC7 B;  4LBY A;  1FND A;  3Q38 A;  4ZCM A;  3PUM A;  4L8J A;  3CCV B;  1JJ2 B;  2I1L A;  2OBT A;  2Z6B D;  2QEX B;  1XFO A;  1K73 D;  2OK7 A;  2CW5 A;  1FNB A;  1WOP A;  4TMT A;  4UZF A;  1MAB A;  1UD6 A;  2PE3 A;  2V4D A;  3G05 A;  3MCA A;  2ZZF A;  4P25 A;  4Z4T A;  1S0U A;  2GQF A;  1KMH A;  5HXB A;  3CB4 A;  3W5U A;  4KKS A;  1JB9 A;  4Z4U A;  1W35 A;  1EFC A;  4RJL A;  4X7D A;  1WP6 A;  1WSV A;  4II2 A;  2CND A;  2C5B A;  4WZL A;  3I55 B;  3QFR A;  1U2R A;  4ASU A;  1K9M D;  3ASP A;  1QGZ A;  1M90 D;  1N07 A;  4FK8 A;  5DS0 A;  1ZM4 A;  2X8K A;  2HMA A;  2QE7 A;  3CPX A;  2W6J A;  1KK1 A;  2BMW A;  3LQ6 A;  2B7C A;  3WYA A;  3WNB A;  4M4S A;  1YX2 A;  1FNM A;  4OPV A;  4RLZ A;  4X7C A;  3A8K A;  4XOR A;  4B44 A;  5BSY A;  3CCQ B;  4HIZ A;  3WQZ A;  3VNU A;  4ACB A;  2E1R A;  3A8I A;  1QFZ A;  4P2N A;  4XM3 A;  1G7R A;  3SLD A;  1KK0 A;  1KJZ A;  2F1L A;  4P26 A;  1VQ9 B;  1QFJ A;  1EXM A;  1NRK A;  2JDI A;  2GJK A;  4XLE A;  2D9R A;  2ZL5 A;  3W2H A;  4XKV A;  1IB0 A;  1PJ6 A;  2CK3 A;  2ZIT A;  3CMM A;  4X05 A;  1QX4 A;  3BY2 A;  1KK3 A;  3CTA A;  4OP7 A;  3R6J A;  4PAA A;  5TV2 A;  3T51 B;  2QTL A;  2BPO A;  2GJR A;  3LNN A;  4HE5 A;  3B82 A;  2X85 A;  1EFT A;  1Q86 D;  2VYQ A;  1HA3 A;  2VNJ A;  1PKV A;  1ELO A;  3GVL A;  4MYT A;  2DOG A;  3ES9 A;  3U2Q A;  2BF4 A;  2ZTN A;  2PMD A;  2XNC A;  2D3L A;  2Q6O A;  1WPC A;  4IW3 B;  2XOK A;  2OK8 A;  3CCE B;  5FO1 A;  4G7W A;  5AN9 A;  1TUI A;  4TMX A;  1JA1 A;  1CNE A;  1R5B A;  5F4O A;  1YIJ B;  1GO2 A;  4B47 A;  2ZXI A;  3SEJ A;  3E1Y E;  5A89 A;  1EFR A;  4NNJ A;  1WU8 A;  5IYP A;  4ZV4 A;  2FX3 A;  1SKQ A;  3BH4 A;  3OOC A;  3P26 A;  4TT3 A;  4HE6 A;  4H9G A;  3CCJ B;  1Q7Y D;  3CD6 B;  3RY8 A;  3OW2 B;  3WY9 A;  5FO0 A;  1T6Z A;  4J0Q A;  3W5H A;  3A1P A;  4PC7 A;  3U6K A;  1TVC A;  4OPO A;  2BSA A;  3NE5 B;  4XR6 A;  2HCJ B;  1G7T A;  2BM0 A;  4N3G A;  4OOX A;  4X8I A;  1A8P A;  3W2E A;  4B43 A;  3CCR B;  2BN4 A;  3PA2 A;  2LZJ A;  1GR1 A;  4YAU A;  3BCF A;  4G1B A;  4PC1 A;  3ASS A;  3JQP A;  2OTL B;  1UMK A;  5TR9 A;  1NB0 A;  1W0J A;  5TY0 A;  1EP3 B;  1GVH A;  1OB0 A;  3OKX A;  4P22 A;  3Q6R A;  3AGP A;  5HZA A;  3Q39 A;  2X6X A;  1E79 A;  2V7W A;  4XN0 A;  4WWV A;  1W9X A;  1AIP A;  2HLD A;  1I7P A;  4XLF A;  4DNR B;  3PUN A;  1JA0 A;  1KZL A;  4PC6 A;  3A3B A;  2B7B A;  4GQN A;  3H9N A;  3ZZT A;  3OEH A;  3W2G A;  2X53 S;  4P1V A;  4XL9 A;  3JU4 A;  3CCM B;  2BGJ A;  4Y9R A;  1WOO A;  3V76 A;  4ACA A;  2VNI A;  1VQ7 B;  4YEJ A;  3VO1 A;  2XNJ A;  2VBS A;  3WND A;  3W5V A; 
#chains in the Genus database with same CATH homology
 3AST A;  3LQ6 A;  4OOV A;  2OBS A;  4OPV A;  4RM0 A;  4RLZ A;  4X7C A;  3V7A A;  4QVJ A;  5BSY A;  4WZT A;  4P2N A;  3PVD A;  4QV2 A;  3SLD A;  4RDL A;  1IHM A;  4Z4R A;  4P26 A;  4OPS A;  4Z4Z A;  3D26 A;  5F4J A;  2ZL5 A;  4QVA A;  4WZK A;  5HZB A;  4X05 A;  3BY2 A;  3Q6Q A;  4OP7 A;  3R6J A;  4OOS A;  4QUZ A;  3ASQ A;  3LQE A;  3ASR A;  5J3O A;  4WZE A;  3R6K A;  4Z4Y A;  4RDK A;  3SKB A;  3ONY A;  5IYW A;  2ZL6 A;  5KW9 A;  4RDJ A;  3ONU A;  3BY1 A;  4X7F A;  5F4O A;  3SEJ A;  5J35 A;  5IYN A;  5IYP A;  3SLN A;  4P3I A;  4Z4V A;  3RY8 A;  4ROX A;  5BSX A;  2OBR A;  4Z4W A;  5E6T A;  4RPB A;  4X06 A;  3SJP A;  5IYQ A;  4OPO A;  3Q38 A;  4X07 A;  3PUM A;  4OOX A;  4Z4S A;  3BQJ A;  3PA2 A;  2OBT A;  5F4M A;  3ASS A;  4P25 A;  4Z4T A;  3Q3A A;  5IYR A;  3Q6R A;  5HZA A;  4X7E A;  2ZL7 A;  3Q39 A;  4Z4U A;  3PA1 A;  4X7D A;  4P12 A;  4RPD A;  4WZL A;  3PUN A;  4X0C A;  3ASP A;  4P1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...