4X7EA

Crystal structure of norovirus gii.10 p domain in complex with nano-85
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
315
structure length
304
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norovirus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 69
structure length 304
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4x7eA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4x7eA01
4Z4TA 1IHMA 3SLNA 3Q3AA 3PA2A 4WZEA 3R6JA 3PUMA 3ASRA 5IYNA 5F4OA 4X7DA 2ZL7A 4X7EA 3Q38A 4OOXA 4X7FA 2OBSA 4X0CA 3ASTA 5J3OA 3SJPA 3SEJA 3R6KA 4Z4SA 4Z4WA 3Q39A 3RY8A 3D26A 4Z4UA 3SKBA 4OPVA 3ASPA 3LQ6A 4X06A 5IYQA 4Z4ZA 4RPBA 4P1VA 5F4MA 4Z4VA 4RPDA 4QV2A 3Q6QA 5IYRA 4RDLA 4Z4RA 5BSYA 4WZTA 4P3IA 5F4JA 4OOVA 4P12A 2OBRA 3ONYA 5BSXA 5J35A 5HZBA 4X05A 4ROXA 4OPSA 3ASSA 3LQEA 4RDJA 3BQJA 4QUZA 2ZL5A 3BY2A 4OP7A 4P25A 3ASQA 4P26A 5IYPA 4RDKA 3Q6RA 2ZL6A 4WZKA 5HZAA 3ONUA 3BY1A 3V7AA 4RM0A 3PUNA 4P2NA 4QVJA 4WZLA 4X7CA 4X07A 5E6TA 4RLZA 5IYWA 2OBTA 5KW9A 4QVAA 4OOSA 3SLDA 3PVDA 4Z4YA 4OPOA 3PA1A
chains in the Genus database with same CATH superfamily
4Z4TA 3CCRB 3ZPNA 3QFRA 4XN0A 3W5HA 2ZXIA 3CMAB 4DNTB 2HCJB 2QEXB 1HZEA 4XMYA 4Y9RA 1S0UA 3B8HA 2Q6IA 3AVVA 2JDIA 1B23P 1GAWA 3Q3AA 2OTLB 4G1VA 4WZEA 3OOCA 2CC2A 2VYQA 1FNDA 1QFZA 1RQRA 5DSZA 4TMVA 2OTJB 4X7DA 4M1KA 5J3OA 1EP3B 2Z6BD 2D3NA 2QTZA 5IK2A 2EIXA 3SEJA 5B6IA 2GREA 3ZUGA 3V76A 2V7XA 1W2BB 2EFGA 4R71A 2YWHA 4Z4UA 1HVXA 2GK7A 3CCQB 1PKVA 1CNEA 4XONA 1QG0A 1T6YA 3GIRA 1BX0A 1FDRA 3WBJA 4YEJA 2BGIA 5DN6A 1Y0YA 2XOKA 2ZBVA 3DDYA 1IJEA 1UMKA 4X06A 5IYQA 1Q7YD 5FIUA 2E1BA 1N05A 4P1VA 3OZWA 3QFTA 3CESA 2JJ1A 4P22A 2R9VA 4Z4VA 4QV2A 4XM3A 4RDLA 1U2RA 1VQKB 4YXWA 2CF4A 2B7CA 4P3IA 1KQSB 1NB0A 1YJNB 1VQ5B 1ZM4A 4OOVA 4UZFA 3CP8A 5A88A 3VNVA 4DK1A 1VQ9B 2FVGA 2OBRA 2CBXA 1ZM9A 3ONYA 5HZBA 2BSAA 1WOSA 4Q7JB 5JBQA 2E1RA 3QFCA 1VQ7B 2PLFA 2CW5A 4AF6A 3OJXA 1DG1G 2ZL5A 4PC6A 1UD2A 4L8JA 2QMUA 3GVLA 4YAWA 3CC2B 2OK8A 1NDHA 1DARA 3GVKA 4LBWA 4XLAA 4B48A 3WNDA 1WU8A 4PC1A 4B4DA 1F20A 2C5BA 2AHOA 1H8HA 2V4DA 1QVGB 4P2NA 4WQMA 3WYAA 1VQNB 1P4MA 4ASUA 1VQLB 2JN9A 3U2QA 2V7WA 1WSVA 3OZUA 5GV8A 3G71B 1OB5A 3AVUA 2C78A 4ZV4A 1OGIA 1YHQB 2VJJA 1Q9SA 2QGGA 1VHEA 4TMTA 3AVWA 1KMHA 2HMAA 1E62A 4RCZA 4EH1A 1AIPA 3WQZA 1UD8A 3H94A 4J0QA 2B5OA 2VBUA 4NBSA 1VQOB 3NE5B 1VF7A 3FPPA 1A8PA 4XLHA 1K28D 3SLDA 4DQKA 3I55B 4AF7A 4B3FX 1VQMB 4RD1A 4OPOA 4P3YA 3ZBTA 1KD1D 2WR8A 2RC6A 1OGJA 3JQPA 3A8JA 4TMZA 5A89A 2XZOA 5HKKA 2DEUA 5FA6A 1IHMA 3SLNA 4JMQA 1TTTA 2BVNA 3CCMB 2C4UA 1HA3A 1K9MD 1G7RA 2GJPA 1GO2A 4YAOA 1IJFA 3PA2A 1D2EA 3PUMA 4XOPA 2Q6LA 5L46A 2QE7A 2ZL7A 4KKUA 4P6VF 4B44A 2WJYA 4OOXA 4X7FA 3VO1A 4X0CA 3ASTA 3LVBA 1XQBA 1YJ9B 3HAGA 2X6WA 1E1QA 2VBVA 3I56B 3AGPA 4IW3B 3E20A 4Z4SA 1VQPB 4Z4WA 1WDTA 2V7TA 4NNJA 4PGOA 3W5VA 1RQPA 3CD6B 1VHOA 3RY8A 4G6IA 3SKBA 2DERA 4XNFA 4FK8A 3BC9A 1V0FA 1VLOA 1KRHA 1FRNA 4RJLA 5DS0A 2BPOA 1R5OA 2B7BA 3ZBUA 2C2WA 4OPVA 3ASPA 2FX3A 1MRZA 1UD4A 1CQXA 4QHYA 1VQ8B 2C5HA 4MYUA 4RPBA 3CMEB 2ZZGA 4RD3A 3T56B 3CC4B 2C4TA 3Q6QA 1COWA 1W34A 1EFCA 2JIZA 4AC9A 1XE1A 5FNZA 1ELOA 4WZTA 2LZJA 3ZZUA 1NJID 4ZGNB 1VQ4B 2HLDA 3W5UA 3W2FA 1YI2B 2DIEA 4II2A 3CXCB 4NCNA 1V5VA 3SJZA 2YWEA 3A1PA 3OW7A 4P12A 4RD6A 1GVHA 2ZTGA 5BSXA 1N0UA 5J35A 1NBMA 1XFOA 2GQFA 3CB4A 3ES9A 3ZZTA 1WTHD 2VJIA 1TVCA 4XOTA 1UD6A 1Q82D 3W2EA 3WBKA 4AVZA 1H8EA 2OYNA 2V7VA 4P25A 5THXA 3CCLB 2GPJA 1I8DA 4RDKA 1GR1A 5FO0A 1W0KA 4TT3A 3OZVA 4XL9A 5GV7A 2ZL6A 4YAFA 5HZAA 1UD3A 2GJRA 4UZEA 1BMFA 2BGJA 2ZZEA 4K1XA 4M53A 3MHPA 2X0KA 3G6EB 1YJWB 3LO8A 3AGQA 4X7CA 2BF4A 2XZLA 3WNCA 4E0FA 1KC8D 3ZZ0A 2F1LA 1FNBA 4XN3A 4XLCA 5CDFA 1J9ZA 1QGZA 2OBTA 4DNRB 1YITB 5KSWB 4UZUA 4ZCLA 4Y9UA 4KKSA 1VJSA 3QSYA 2C77A 2I1LA 3OAAA 4LBVA 1JB9A 3PENA 4OOSA 1JA0A 4H9GA 1N0VC 3PVDA 4G7WA 2YWFA 2D74A 1VLYA 4YHBA 4DK0A 1E43A 4KKTA 2M5SA 4YELA 3U6KA 1VQ6B 1NB9A 3VMFA 3WNBA 3OKXA 4MYTA 1S4MA 1E64A 1KK3A 2KVOA 1ZUNB 1WSRA 3J81k 2DOGA 3WY9A 1PJ6A 1T6XA 3ZIAA 1JA1A 4G7XA 3FJOA 3P27A 5F4OA 5H59A 3CCVB 4X7EA 3A3GA 1QH0A 3AVYA 1YX2A 3QFSA 3T51B 4ZCIA 4HIZA 2VBSA 4XQFA 2W6IA 5AN9A 4GQNA 3CCUB 1KK0A 2BM1A 4LBYA 3R6KA 2OK7A 2V7UA 3CPXA 2V7QA 3Q39A 3VNUA 2J7KA 4YALA 1WOOA 3W2GA 3D26A 4B3GA 1G7TA 3B78A 3CMMA 4XORA 4XD7A 5FO1A 1W0JA 1KTVA 5HXBA 3MCAA 3KEWA 4Z4ZA 3W2HA 1QFJA 4LC0A 5F4MA 2F43A 3A35A 3LNNA 4RPDA 1KJZA 1PJ7A 4RD0A 4G5GA 1ZM2A 2DYIA 1QX4A 3BCDA 3G05A 3OPOA 4TMXA 3E1YE 1G7SA 2DY1A 1QGYA 1S72B 5F4JA 1DDIA 3CCEB 1N07A 2X53S 4TKOB 2HDNB 4RCYA 2JJ2A 4F7DA 3CCSB 2ZBUA 2Q6OA 4X05A 1QGAA 1T5EA 1FNMA 1OHHA 4OPSA 3ASSA 3BH4A 2BN4A 2ZITA 4RDJA 3A3BA 1BQEA 4PC3A 3P26A 4QUZA 5EMNA 1YLOA 3ZC3A 3JQRA 1EP2B 4DQLA 2BM0A 4OP7A 1N8RD 3ASQA 4P26A 4FXUA 1WP6A 3Q6RA 1Q81D 3I1FA 1GJRA 4G1BA 3BY1A 1QUEA 2XGJA 1EFUA 4U9UA 2ZZFA 4WZLA 1FNCA 3CW2A 2R6HA 4X07A 5E6TA 3AVXA 3G4SB 3OW2B 1TLLA 2XNJA 1T6ZA 2NV4A 4FN5A 5KW9A 4QVAA 1FRQA 1CNFA 1E3XA 2NPFA 1QUFA 4Y7CA 1OB2A 2VBTA 4HE5A 1H85A 3OEHA 4BPRA 4Z4YA 4YAUA 3PA1A 4N3GA 1BX1A 2XZPA 2ZZQA 4Z1MA 1SKYB 4CQJA 2D9RA 4RD2A 5H5JA 1FX0A 2BV3A 4TN1A 4HE6A 2WPDA 1D1NA 3W2IA 1GAQA 3CPWB 4XLEA 4XR6A 3R6JA 1OB0A 3ASRA 2P3MA 1W87A 5IYNA 1EFRA 1G7CA 3WXMA 3FKSA 3A8IA 1K8AD 3Q38A 1AMOA 2OBSA 1WORA 4PAAA 1K73D 2RC5A 2WYRA 3SJPA 1YIJB 1EWYA 3CTAA 1V0EA 4B3XA 1XB2A 2BMWA 4XLFA 2X85A 3ISXA 1JNYA 2CNDA 3OJWA 2GK6A 4QFMA 2QDXA 3GSIA 2WSSA 4XKWA 5TY0A 3OE7A 2Q6KA 4C0SA 3LQ6A 2W6JA 4WWVA 1F60A 1WOPA 3VR6A 3CCJB 1N06A 2X8KA 5FL7A 3CP2A 5KNLA 2ZTNA 1KK2A 2D3LA 2PIAA 4ZGQB 3OEEA 2VNJA 1SM4A 5IYRA 4Z4RA 2QN6A 4ACBA 5BSYA 3CC7B 2VNKA 1E63A 3JQQA 3VO2A 4FWTA 3KL9A 2DETA 4LBZA 5TRDA 2X6YA 4PC7A 2CRVA 1B2RA 4TSFA 2VNHA 2QTLA 2XNCA 3JU4A 2ZXHA 4II3A 1IB0A 2F1MA 1SKQA 3BCFA 4ROXA 1QFYA 4P9SA 1E1RA 1R5BA 4RD4A 1E79A 2WJVA 3LQEA 2X6XA 3BQJA 1WPCA 2PE3A 3GQBA 4ACAA 4M4SA 4PABA 1EFTA 3OFNA 1Q86D 3BY2A 5LMZA 1M1KD 1JJ2B 2XEXA 4UAJA 3U6BA 2CK3A 1DDGA 2PMDA 3A8KA 4B43A 1KK1A 4N3NA 5IYPA 3QE2A 5TR9A 2WZNA 4WZKA 3CRZA 1ZM3A 1BLIA 3ONUA 4TMWA 5TV2A 1QVFB 2V31A 1BPLA 3V7AA 1R5NA 3B82A 4XKVA 1Y0RA 1E3ZA 1MABA 1PJ5A 4RM0A 4C43A 3PUNA 1M90D 4QVJA 4M0LA 2YWGA 2WZPP 2F4NA 1H42A 3H9NA 3AVTA 3GVJA 1W35A 1W9XA 4M2LA 2DCUA 4RLZA 1N08A 1BJKA 4B47A 5IYWA 2XNDA 2VNIA 3T53B 1NRKA 1TUIA 4PC2A 2X3UA 1I7PA 4P6YA 1EP1B 1KZLA 1EXMA 2GJKA 3FPKA 5A8AA 4ZCMA 3MMPA 1I18A 4X8IA 2QA4B 1D8TA 3BNWA 2VZLA 1UD5A 3OP1A
chains in the Genus database with same CATH topology
4Z4TA 1IHMA 3SLNA 3Q3AA 3PA2A 4WZEA 3R6JA 3PUMA 3ASRA 5IYNA 5F4OA 4X7DA 2ZL7A 4X7EA 3Q38A 4OOXA 4X7FA 2OBSA 4X0CA 3ASTA 5J3OA 3SJPA 3SEJA 3R6KA 4Z4SA 4Z4WA 3Q39A 3RY8A 3D26A 4Z4UA 3SKBA 4OPVA 3ASPA 3LQ6A 4X06A 5IYQA 4Z4ZA 4RPBA 4P1VA 5F4MA 4Z4VA 4RPDA 4QV2A 3Q6QA 5IYRA 4RDLA 4Z4RA 5BSYA 4WZTA 4P3IA 5F4JA 4OOVA 4P12A 2OBRA 3ONYA 5BSXA 5J35A 5HZBA 4X05A 4ROXA 4OPSA 3ASSA 3LQEA 4RDJA 3BQJA 4QUZA 2ZL5A 3BY2A 4OP7A 4P25A 3ASQA 4P26A 5IYPA 4RDKA 3Q6RA 2ZL6A 4WZKA 5HZAA 3ONUA 3BY1A 3V7AA 4RM0A 3PUNA 4P2NA 4QVJA 4WZLA 4X7CA 4X07A 5E6TA 4RLZA 5IYWA 2OBTA 5KW9A 4QVAA 4OOSA 3SLDA 3PVDA 4Z4YA 4OPOA 3PA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4T A;  1IHM A;  3SLN A;  3Q3A A;  3PA2 A;  4WZE A;  3R6J A;  3PUM A;  3ASR A;  5IYN A;  5F4O A;  4X7D A;  2ZL7 A;  4X7E A;  3Q38 A;  4OOX A;  4X7F A;  2OBS A;  4X0C A;  3AST A;  5J3O A;  3SJP A;  3SEJ A;  3R6K A;  4Z4S A;  4Z4W A;  3Q39 A;  3RY8 A;  3D26 A;  4Z4U A;  3SKB A;  4OPV A;  3ASP A;  3LQ6 A;  4X06 A;  5IYQ A;  4Z4Z A;  4RPB A;  4P1V A;  5F4M A;  4Z4V A;  4RPD A;  4QV2 A;  3Q6Q A;  5IYR A;  4RDL A;  4Z4R A;  5BSY A;  4WZT A;  4P3I A;  5F4J A;  4OOV A;  4P12 A;  2OBR A;  3ONY A;  5BSX A;  5J35 A;  5HZB A;  4X05 A;  4ROX A;  4OPS A;  3ASS A;  3LQE A;  4RDJ A;  3BQJ A;  4QUZ A;  2ZL5 A;  3BY2 A;  4OP7 A;  4P25 A;  3ASQ A;  4P26 A;  5IYP A;  4RDK A;  3Q6R A;  2ZL6 A;  4WZK A;  5HZA A;  3ONU A;  3BY1 A;  3V7A A;  4RM0 A;  3PUN A;  4P2N A;  4QVJ A;  4WZL A;  4X7C A;  4X07 A;  5E6T A;  4RLZ A;  5IYW A;  2OBT A;  5KW9 A;  4QVA A;  4OOS A;  3SLD A;  3PVD A;  4Z4Y A;  4OPO A;  3PA1 A; 
#chains in the Genus database with same CATH topology
 4Z4T A;  3CCR B;  3ZPN A;  3QFR A;  4XN0 A;  3W5H A;  2ZXI A;  3CMA B;  4DNT B;  2HCJ B;  2QEX B;  1HZE A;  4XMY A;  4Y9R A;  1S0U A;  3B8H A;  2Q6I A;  3AVV A;  2JDI A;  1B23 P;  1GAW A;  3Q3A A;  2OTL B;  4G1V A;  4WZE A;  3OOC A;  2CC2 A;  2VYQ A;  1FND A;  1QFZ A;  1RQR A;  5DSZ A;  4TMV A;  2OTJ B;  4X7D A;  4M1K A;  5J3O A;  1EP3 B;  2Z6B D;  2D3N A;  2QTZ A;  5IK2 A;  2EIX A;  3SEJ A;  5B6I A;  2GRE A;  3ZUG A;  3V76 A;  2V7X A;  1W2B B;  2EFG A;  4R71 A;  2YWH A;  4Z4U A;  1HVX A;  2GK7 A;  3CCQ B;  1PKV A;  1CNE A;  4XON A;  1QG0 A;  1T6Y A;  3GIR A;  1BX0 A;  1FDR A;  3WBJ A;  4YEJ A;  2BGI A;  5DN6 A;  1Y0Y A;  2XOK A;  2ZBV A;  3DDY A;  1IJE A;  1UMK A;  4X06 A;  5IYQ A;  1Q7Y D;  5FIU A;  2E1B A;  1N05 A;  4P1V A;  3OZW A;  3QFT A;  3CES A;  2JJ1 A;  4P22 A;  2R9V A;  4Z4V A;  4QV2 A;  4XM3 A;  4RDL A;  1U2R A;  1VQK B;  4YXW A;  2CF4 A;  2B7C A;  4P3I A;  1KQS B;  1NB0 A;  1YJN B;  1VQ5 B;  1ZM4 A;  4OOV A;  4UZF A;  3CP8 A;  5A88 A;  3VNV A;  4DK1 A;  1VQ9 B;  2FVG A;  2OBR A;  2CBX A;  1ZM9 A;  3ONY A;  5HZB A;  2BSA A;  1WOS A;  4Q7J B;  5JBQ A;  2E1R A;  3QFC A;  1VQ7 B;  2PLF A;  2CW5 A;  4AF6 A;  3OJX A;  1DG1 G;  2ZL5 A;  4PC6 A;  1UD2 A;  4L8J A;  2QMU A;  3GVL A;  4YAW A;  3CC2 B;  2OK8 A;  1NDH A;  1DAR A;  3GVK A;  4LBW A;  4XLA A;  4B48 A;  3WND A;  1WU8 A;  4PC1 A;  4B4D A;  1F20 A;  2C5B A;  2AHO A;  1H8H A;  2V4D A;  1QVG B;  4P2N A;  4WQM A;  3WYA A;  1VQN B;  1P4M A;  4ASU A;  1VQL B;  2JN9 A;  3U2Q A;  2V7W A;  1WSV A;  3OZU A;  5GV8 A;  3G71 B;  1OB5 A;  3AVU A;  2C78 A;  4ZV4 A;  1OGI A;  1YHQ B;  2VJJ A;  1Q9S A;  2QGG A;  1VHE A;  4TMT A;  3AVW A;  1KMH A;  2HMA A;  1E62 A;  4RCZ A;  4EH1 A;  1AIP A;  3WQZ A;  1UD8 A;  3H94 A;  4J0Q A;  2B5O A;  2VBU A;  4NBS A;  1VQO B;  3NE5 B;  1VF7 A;  3FPP A;  1A8P A;  4XLH A;  1K28 D;  3SLD A;  4DQK A;  3I55 B;  4AF7 A;  4B3F X;  1VQM B;  4RD1 A;  4OPO A;  4P3Y A;  3ZBT A;  1KD1 D;  2WR8 A;  2RC6 A;  1OGJ A;  3JQP A;  3A8J A;  4TMZ A;  5A89 A;  2XZO A;  5HKK A;  2DEU A;  5FA6 A;  1IHM A;  3SLN A;  4JMQ A;  1TTT A;  2BVN A;  3CCM B;  2C4U A;  1HA3 A;  1K9M D;  1G7R A;  2GJP A;  1GO2 A;  4YAO A;  1IJF A;  3PA2 A;  1D2E A;  3PUM A;  4XOP A;  2Q6L A;  5L46 A;  2QE7 A;  2ZL7 A;  4KKU A;  4P6V F;  4B44 A;  2WJY A;  4OOX A;  4X7F A;  3VO1 A;  4X0C A;  3AST A;  3LVB A;  1XQB A;  1YJ9 B;  3HAG A;  2X6W A;  1E1Q A;  2VBV A;  3I56 B;  3AGP A;  4IW3 B;  3E20 A;  4Z4S A;  1VQP B;  4Z4W A;  1WDT A;  2V7T A;  4NNJ A;  4PGO A;  3W5V A;  1RQP A;  3CD6 B;  1VHO A;  3RY8 A;  4G6I A;  3SKB A;  2DER A;  4XNF A;  4FK8 A;  3BC9 A;  1V0F A;  1VLO A;  1KRH A;  1FRN A;  4RJL A;  5DS0 A;  2BPO A;  1R5O A;  2B7B A;  3ZBU A;  2C2W A;  4OPV A;  3ASP A;  2FX3 A;  1MRZ A;  1UD4 A;  1CQX A;  4QHY A;  1VQ8 B;  2C5H A;  4MYU A;  4RPB A;  3CME B;  2ZZG A;  4RD3 A;  3T56 B;  3CC4 B;  2C4T A;  3Q6Q A;  1COW A;  1W34 A;  1EFC A;  2JIZ A;  4AC9 A;  1XE1 A;  5FNZ A;  1ELO A;  4WZT A;  2LZJ A;  3ZZU A;  1NJI D;  4ZGN B;  1VQ4 B;  2HLD A;  3W5U A;  3W2F A;  1YI2 B;  2DIE A;  4II2 A;  3CXC B;  4NCN A;  1V5V A;  3SJZ A;  2YWE A;  3A1P A;  3OW7 A;  4P12 A;  4RD6 A;  1GVH A;  2ZTG A;  5BSX A;  1N0U A;  5J35 A;  1NBM A;  1XFO A;  2GQF A;  3CB4 A;  3ES9 A;  3ZZT A;  1WTH D;  2VJI A;  1TVC A;  4XOT A;  1UD6 A;  1Q82 D;  3W2E A;  3WBK A;  4AVZ A;  1H8E A;  2OYN A;  2V7V A;  4P25 A;  5THX A;  3CCL B;  2GPJ A;  1I8D A;  4RDK A;  1GR1 A;  5FO0 A;  1W0K A;  4TT3 A;  3OZV A;  4XL9 A;  5GV7 A;  2ZL6 A;  4YAF A;  5HZA A;  1UD3 A;  2GJR A;  4UZE A;  1BMF A;  2BGJ A;  2ZZE A;  4K1X A;  4M53 A;  3MHP A;  2X0K A;  3G6E B;  1YJW B;  3LO8 A;  3AGQ A;  4X7C A;  2BF4 A;  2XZL A;  3WNC A;  4E0F A;  1KC8 D;  3ZZ0 A;  2F1L A;  1FNB A;  4XN3 A;  4XLC A;  5CDF A;  1J9Z A;  1QGZ A;  2OBT A;  4DNR B;  1YIT B;  5KSW B;  4UZU A;  4ZCL A;  4Y9U A;  4KKS A;  1VJS A;  3QSY A;  2C77 A;  2I1L A;  3OAA A;  4LBV A;  1JB9 A;  3PEN A;  4OOS A;  1JA0 A;  4H9G A;  1N0V C;  3PVD A;  4G7W A;  2YWF A;  2D74 A;  1VLY A;  4YHB A;  4DK0 A;  1E43 A;  4KKT A;  2M5S A;  4YEL A;  3U6K A;  1VQ6 B;  1NB9 A;  3VMF A;  3WNB A;  3OKX A;  4MYT A;  1S4M A;  1E64 A;  1KK3 A;  2KVO A;  1ZUN B;  1WSR A;  3J81 k;  2DOG A;  3WY9 A;  1PJ6 A;  1T6X A;  3ZIA A;  1JA1 A;  4G7X A;  3FJO A;  3P27 A;  5F4O A;  5H59 A;  3CCV B;  4X7E A;  3A3G A;  1QH0 A;  3AVY A;  1YX2 A;  3QFS A;  3T51 B;  4ZCI A;  4HIZ A;  2VBS A;  4XQF A;  2W6I A;  5AN9 A;  4GQN A;  3CCU B;  1KK0 A;  2BM1 A;  4LBY A;  3R6K A;  2OK7 A;  2V7U A;  3CPX A;  2V7Q A;  3Q39 A;  3VNU A;  2J7K A;  4YAL A;  1WOO A;  3W2G A;  3D26 A;  4B3G A;  1G7T A;  3B78 A;  3CMM A;  4XOR A;  4XD7 A;  5FO1 A;  1W0J A;  1KTV A;  5HXB A;  3MCA A;  3KEW A;  4Z4Z A;  3W2H A;  1QFJ A;  4LC0 A;  5F4M A;  2F43 A;  3A35 A;  3LNN A;  4RPD A;  1KJZ A;  1PJ7 A;  4RD0 A;  4G5G A;  1ZM2 A;  2DYI A;  1QX4 A;  3BCD A;  3G05 A;  3OPO A;  4TMX A;  3E1Y E;  1G7S A;  2DY1 A;  1QGY A;  1S72 B;  5F4J A;  1DDI A;  3CCE B;  1N07 A;  2X53 S;  4TKO B;  2HDN B;  4RCY A;  2JJ2 A;  4F7D A;  3CCS B;  2ZBU A;  2Q6O A;  4X05 A;  1QGA A;  1T5E A;  1FNM A;  1OHH A;  4OPS A;  3ASS A;  3BH4 A;  2BN4 A;  2ZIT A;  4RDJ A;  3A3B A;  1BQE A;  4PC3 A;  3P26 A;  4QUZ A;  5EMN A;  1YLO A;  3ZC3 A;  3JQR A;  1EP2 B;  4DQL A;  2BM0 A;  4OP7 A;  1N8R D;  3ASQ A;  4P26 A;  4FXU A;  1WP6 A;  3Q6R A;  1Q81 D;  3I1F A;  1GJR A;  4G1B A;  3BY1 A;  1QUE A;  2XGJ A;  1EFU A;  4U9U A;  2ZZF A;  4WZL A;  1FNC A;  3CW2 A;  2R6H A;  4X07 A;  5E6T A;  3AVX A;  3G4S B;  3OW2 B;  1TLL A;  2XNJ A;  1T6Z A;  2NV4 A;  4FN5 A;  5KW9 A;  4QVA A;  1FRQ A;  1CNF A;  1E3X A;  2NPF A;  1QUF A;  4Y7C A;  1OB2 A;  2VBT A;  4HE5 A;  1H85 A;  3OEH A;  4BPR A;  4Z4Y A;  4YAU A;  3PA1 A;  4N3G A;  1BX1 A;  2XZP A;  2ZZQ A;  4Z1M A;  1SKY B;  4CQJ A;  2D9R A;  4RD2 A;  5H5J A;  1FX0 A;  2BV3 A;  4TN1 A;  4HE6 A;  2WPD A;  1D1N A;  3W2I A;  1GAQ A;  3CPW B;  4XLE A;  4XR6 A;  3R6J A;  1OB0 A;  3ASR A;  2P3M A;  1W87 A;  5IYN A;  1EFR A;  1G7C A;  3WXM A;  3FKS A;  3A8I A;  1K8A D;  3Q38 A;  1AMO A;  2OBS A;  1WOR A;  4PAA A;  1K73 D;  2RC5 A;  2WYR A;  3SJP A;  1YIJ B;  1EWY A;  3CTA A;  1V0E A;  4B3X A;  1XB2 A;  2BMW A;  4XLF A;  2X85 A;  3ISX A;  1JNY A;  2CND A;  3OJW A;  2GK6 A;  4QFM A;  2QDX A;  3GSI A;  2WSS A;  4XKW A;  5TY0 A;  3OE7 A;  2Q6K A;  4C0S A;  3LQ6 A;  2W6J A;  4WWV A;  1F60 A;  1WOP A;  3VR6 A;  3CCJ B;  1N06 A;  2X8K A;  5FL7 A;  3CP2 A;  5KNL A;  2ZTN A;  1KK2 A;  2D3L A;  2PIA A;  4ZGQ B;  3OEE A;  2VNJ A;  1SM4 A;  5IYR A;  4Z4R A;  2QN6 A;  4ACB A;  5BSY A;  3CC7 B;  2VNK A;  1E63 A;  3JQQ A;  3VO2 A;  4FWT A;  3KL9 A;  2DET A;  4LBZ A;  5TRD A;  2X6Y A;  4PC7 A;  2CRV A;  1B2R A;  4TSF A;  2VNH A;  2QTL A;  2XNC A;  3JU4 A;  2ZXH A;  4II3 A;  1IB0 A;  2F1M A;  1SKQ A;  3BCF A;  4ROX A;  1QFY A;  4P9S A;  1E1R A;  1R5B A;  4RD4 A;  1E79 A;  2WJV A;  3LQE A;  2X6X A;  3BQJ A;  1WPC A;  2PE3 A;  3GQB A;  4ACA A;  4M4S A;  4PAB A;  1EFT A;  3OFN A;  1Q86 D;  3BY2 A;  5LMZ A;  1M1K D;  1JJ2 B;  2XEX A;  4UAJ A;  3U6B A;  2CK3 A;  1DDG A;  2PMD A;  3A8K A;  4B43 A;  1KK1 A;  4N3N A;  5IYP A;  3QE2 A;  5TR9 A;  2WZN A;  4WZK A;  3CRZ A;  1ZM3 A;  1BLI A;  3ONU A;  4TMW A;  5TV2 A;  1QVF B;  2V31 A;  1BPL A;  3V7A A;  1R5N A;  3B82 A;  4XKV A;  1Y0R A;  1E3Z A;  1MAB A;  1PJ5 A;  4RM0 A;  4C43 A;  3PUN A;  1M90 D;  4QVJ A;  4M0L A;  2YWG A;  2WZP P;  2F4N A;  1H42 A;  3H9N A;  3AVT A;  3GVJ A;  1W35 A;  1W9X A;  4M2L A;  2DCU A;  4RLZ A;  1N08 A;  1BJK A;  4B47 A;  5IYW A;  2XND A;  2VNI A;  3T53 B;  1NRK A;  1TUI A;  4PC2 A;  2X3U A;  1I7P A;  4P6Y A;  1EP1 B;  1KZL A;  1EXM A;  2GJK A;  3FPK A;  5A8A A;  4ZCM A;  3MMP A;  1I18 A;  4X8I A;  2QA4 B;  1D8T A;  3BNW A;  2VZL A;  1UD5 A;  3OP1 A; 
#chains in the Genus database with same CATH homology
 4Z4T A;  1IHM A;  3SLN A;  3Q3A A;  3PA2 A;  4WZE A;  3R6J A;  3PUM A;  3ASR A;  5IYN A;  5F4O A;  4X7D A;  2ZL7 A;  4X7E A;  3Q38 A;  4OOX A;  4X7F A;  2OBS A;  4X0C A;  3AST A;  5J3O A;  3SJP A;  3SEJ A;  3R6K A;  4Z4S A;  4Z4W A;  3Q39 A;  3RY8 A;  3D26 A;  4Z4U A;  3SKB A;  4OPV A;  3ASP A;  3LQ6 A;  4X06 A;  5IYQ A;  4Z4Z A;  4RPB A;  4P1V A;  5F4M A;  4Z4V A;  4RPD A;  4QV2 A;  3Q6Q A;  5IYR A;  4RDL A;  4Z4R A;  5BSY A;  4WZT A;  4P3I A;  5F4J A;  4OOV A;  4P12 A;  2OBR A;  3ONY A;  5BSX A;  5J35 A;  5HZB A;  4X05 A;  4ROX A;  4OPS A;  3ASS A;  3LQE A;  4RDJ A;  3BQJ A;  4QUZ A;  2ZL5 A;  3BY2 A;  4OP7 A;  4P25 A;  3ASQ A;  4P26 A;  5IYP A;  4RDK A;  3Q6R A;  2ZL6 A;  4WZK A;  5HZA A;  3ONU A;  3BY1 A;  3V7A A;  4RM0 A;  3PUN A;  4P2N A;  4QVJ A;  4WZL A;  4X7C A;  4X07 A;  5E6T A;  4RLZ A;  5IYW A;  2OBT A;  5KW9 A;  4QVA A;  4OOS A;  3SLD A;  3PVD A;  4Z4Y A;  4OPO A;  3PA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...