4X7EA

Crystal structure of norovirus gii.10 p domain in complex with nano-85
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
315
structure length
304
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norovirus
molecule tags Viral protein
total genus 69
structure length 304
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4x7eA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4x7eA01
5F4MA 4P1VA 4X07A 4QVAA 4OPSA 3V7AA 4Z4WA 3ONYA 3ONUA 3PUMA 4P12A 3ASPA 3R6JA 4RDJA 3ASQA 5J3OA 5IYQA 2ZL5A 3ASSA 5IYRA 5HZAA 4X06A 4X7DA 4RDKA 5F4OA 3ASTA 3SLNA 3SJPA 4Z4TA 4Z4YA 4X05A 4WZEA 2OBRA 3R6KA 5IYNA 3Q39A 4P26A 2OBTA 3Q6QA 4X7EA 3LQEA 4P2NA 3D26A 3SLDA 3PUNA 4QUZA 5F4JA 4Z4ZA 5BSYA 4OOSA 4RLZA 2ZL7A 4WZKA 4RPBA 4X7FA 4QVJA 4WZLA 4RDLA 3SEJA 4Z4SA 3BQJA 3BY2A 3SKBA 3PVDA 3Q38A 4WZTA 4QV2A 4OOVA 5KW9A 2ZL6A 3Q3AA 5J35A 3ASRA 3PA2A 5BSXA 4ROXA 5IYPA 3BY1A 4RM0A 4OP7A 4P25A 4Z4RA 3LQ6A 3Q6RA 5HZBA 4X0CA 4Z4UA 4P3IA 4RPDA 4OPVA 4X7CA 3RY8A 5IYWA 3PA1A 4OOXA 4OPOA 4Z4VA 1IHMA 2OBSA 5E6TA
chains in the Genus database with same CATH superfamily
4B4DA 1W9XA 4PC1A 5F4MA 4G1VA 4X07A 3E20A 3AVVA 4G6IA 4OPSA 3T51B 2C4TA 1W0JA 1F60A 5H59A 4CQJA 1QFJA 4WQMA 4DK0A 1CNFA 2VNIA 4LBZA 1QGZA 3ASPA 1PJ7A 1UD5A 3OEEA 3B82A 5FO1A 2HDNB 3R6JA 1WSVA 3VO2A 1T6XA 3WY9A 1WORA 2QEXB 1VQ8B 4AF6A 3ASQA 2JJ2A 3KL9A 1DG1G 2C5BA 2EFGA 4P6VF 2VZLA 3OOCA 1DARA 4ZV4A 5IYRA 2XZPA 2Z6BD 5HZAA 3CCMB 3CCSB 1N8RD 1HZEA 2ZXHA 2ZTGA 4XN3A 2OK8A 4LBVA 3SLNA 3I1FA 3FPPA 4Z4TA 3WXMA 2ZZFA 1Q9SA 3CP8A 4Z4YA 4G1BA 4X05A 4C0SA 2V7QA 3G6EB 1T6YA 3Q6QA 1VQPB 1DDGA 1K73D 1B23P 4P22A 1IJEA 3CESA 1W34A 4N3NA 4P6YA 4MYUA 1V0FA 4QUZA 4AF7A 5BSYA 1BQEA 3AGQA 5TV2A 2C78A 4R71A 2CW5A 3ZUGA 1VQNB 4PGOA 3ZBTA 3OPOA 4XD7A 1XE1A 4RPBA 1B2RA 2W6IA 4K1XA 4NNJA 4TKOB 1WOSA 4X7FA 2GK6A 2V4DA 3CMEB 4RCZA 1V5VA 1QUEA 4WZTA 4ZGQB 3WYAA 5KW9A 3V76A 2CBXA 1KZLA 3Q3AA 4G5GA 4XLHA 1U2RA 2ZZEA 3ASRA 5BSXA 4ROXA 2Q6LA 4TSFA 1UD6A 1M1KD 2ZZQA 2WJVA 1PJ6A 2FVGA 2ZBVA 3OAAA 4YAFA 2FX3A 3T56B 3CCUB 1FDRA 1QUFA 3BY1A 3G05A 1KK3A 1R5OA 4XLCA 3G4SB 3CC7B 1RQPA 3HAGA 5HKKA 1N07A 1VQ6B 1KK1A 1FNCA 5GV8A 4MYTA 1NB0A 3BC9A 1UMKA 3Q6RA 1YI2B 1UD4A 2X6WA 4X0CA 1BX0A 2QGGA 1WDTA 2X85A 1BPLA 4RPDA 5A8AA 1OHHA 2BGJA 1CNEA 2GQFA 2ZXIA 1QVFB 1VLOA 2Q6KA 3PA1A 4PAAA 3CCLB 1WSRA 3QFTA 2XGJA 2E1RA 2YWEA 4ZGNB 1W2BB 2B7CA 3GQBA 3OKXA 4YAOA 1MABA 2OBSA 1IHMA 2DOGA 1I7PA 2ZTNA 4QV2A 5DS0A 4B3FX 4XR6A 1KQSB 3QFSA 5DN6A 2D3LA 4QVAA 3LVBA 3W2EA 4M53A 4NBSA 4Y9UA 4TT3A 3PENA 5H5JA 4PC6A 5TRDA 2BM0A 4KKUA 4PC3A 1PJ5A 2JDIA 3VNUA 1UD8A 2AHOA 2QMUA 2EIXA 4P12A 4P9SA 4Y9RA 1QFYA 2WZPP 1G7CA 1QG0A 1WU8A 4II2A 2BPOA 2X6YA 5AN9A 1G7SA 2ZL5A 1N0VC 3H9NA 3P27A 4X06A 2VBUA 4YAWA 3AGPA 1NB9A 4RDKA 3AVYA 3CD6B 2XZLA 4XOPA 4YELA 2V7XA 3CMMA 2F43A 4L8JA 1VQ4B 1AIPA 1QGAA 1TVCA 3SJPA 1R5NA 3OJWA 2X6XA 3OEHA 1VQOB 1UD3A 1W0KA 2OYNA 3CP2A 1FRQA 3R6KA 1A8PA 3Q39A 5B6IA 2CC2A 4X7EA 1EFRA 3LQEA 1XB2A 4JMQA 1KJZA 3PUNA 3BCFA 1FRNA 4KKTA 2BV3A 1UD2A 5L46A 3W5VA 2XOKA 1E3XA 3AVUA 4XQFA 4OOSA 1BX1A 4RLZA 3A8IA 1QGYA 1VQMB 1YIJB 1RQRA 4N3GA 2D74A 4WZKA 3P26A 2XZOA 2HCJB 4XNFA 4XOTA 3QFRA 1S4MA 5GV7A 4RDLA 2R6HA 3SEJA 2WSSA 2XNDA 2HMAA 3BQJA 3OW2B 3GVKA 4RD0A 3SKBA 3PVDA 1D1NA 2VBVA 1N05A 1I18A 2GJKA 2KVOA 1EXMA 4M4SA 1TTTA 2C4UA 4X8IA 5J35A 3BH4A 4XKWA 1GR1A 1R5BA 1NBMA 4TMZA 2QN6A 2CK3A 1AMOA 1WPCA 2JIZA 4Z1MA 1W87A 1WOOA 4EH1A 5DSZA 1NJID 1G7RA 2XNCA 3OZUA 2ZITA 1OB0A 1I8DA 1YHQB 2CRVA 1NDHA 4OP7A 4P25A 4FK8A 4Z4RA 3WNDA 2CNDA 2F1LA 5FIUA 2J7KA 3I56B 2DCUA 1OB2A 2F4NA 1HVXA 1YX2A 4C43A 1YITB 3CCEB 4PC7A 5FA6A 4RD2A 1WOPA 4RJLA 1KK2A 2WZNA 3OZWA 4P3IA 4YHBA 4UZFA 2V31A 4LBWA 2BVNA 3WNCA 2GJPA 5IYWA 1XQBA 1K28D 2VBTA 4OPOA 3ZC3A 5THXA 5A89A 3VNVA 4TMWA 5E6TA 3AVXA 3CCJB 1YLOA 1EFCA 1ZM2A 3SJZA 1XFOA 2BM1A 3E1YE 3V7AA 4Z4WA 3CPWB 3JQRA 4J0QA 1VQ5B 1E64A 2XNJA 3AVWA 1YJNB 5FO0A 3ONUA 2DEUA 1H8EA 3U6BA 1K8AD 3ZPNA 4DNRB 3W5UA 3GVLA 4NCNA 4YAUA 2B7BA 3ZZ0A 4B3GA 1V0EA 3W2HA 1M90D 2LZJA 3CCRB 5IYQA 3ASSA 2OTJB 1EWYA 3JQQA 1EFUA 1Y0RA 3GVJA 1VQ7B 3CXCB 3CW2A 4X7DA 2D9RA 2JJ1A 2VYQA 2X0KA 3ASTA 4TMVA 1GJRA 5F4OA 1K9MD 1E43A 3ZZTA 1TLLA 2BSAA 2F1MA 4FN5A 4IW3B 1Q86D 1WP6A 1OB5A 4ZCMA 2DY1A 1VQKB 3W2IA 1VLYA 4XMYA 2OBRA 1KRHA 3JU4A 3MHPA 1EP2B 1YJ9B 3CPXA 4P26A 4UZEA 1F20A 2BGIA 3SLDA 3CC2B 2DERA 3OZVA 3ES9A 1KTVA 3U6KA 4UAJA 5F4JA 2WPDA 3CC4B 3W2GA 4YXWA 4HIZA 1T5EA 4TMXA 4FXUA 4M1KA 2GJRA 1VHEA 3T53B 3ISXA 1KD1D 4DNTB 4G7XA 1VHOA 1Y0YA 1OGJA 3LNNA 2XEXA 1E3ZA 3CCVB 3FJOA 4WZLA 2R9VA 4RCYA 3CCQB 3BY2A 4H9GA 1BLIA 1VQ9B 1ZM4A 3I55B 5TY0A 2ZL6A 1EP1B 2Q6IA 2DETA 4XLFA 2ZBUA 3VMFA 3GSIA 1JNYA 2OK7A 3BNWA 5IYPA 4PABA 4B43A 4UZUA 3OJXA 4XKVA 3QE2A 5FL7A 2B5OA 3OP1A 1KMHA 3A3GA 1QH0A 4LC0A 2WYRA 1FNBA 1WTHD 2JN9A 3B78A 1T6ZA 3J81k 2M5SA 5A88A 4BPRA 1EP3B 4PC2A 4M0LA 4ACAA 1EFTA 2YWHA 4HE5A 1NRKA 1QFZA 2BMWA 3JQPA 1BMFA 5CDFA 2QDXA 4XL9A 3A1PA 2NPFA 4B44A 3RY8A 2Q6OA 1N08A 1ZUNB 3MCAA 4XONA 4XM3A 1Q7YD 1JA1A 4OOXA 3CRZA 3QSYA 1GAWA 3VR6A 1PKVA 3A3BA 2WR8A 4TMTA 2YWGA 1KC8D 3ZBUA 2VNJA 4P1VA 1P4MA 4TN1A 1DDIA 2C5HA 2GREA 1S72B 4LBYA 2DIEA 3W5HA 3DDYA 4RD1A 3G71B 2E1BA 2NV4A 4FWTA 4XN0A 2OTLB 3WNBA 3A8KA 3ONYA 1H85A 3PUMA 1CQXA 1D2EA 2QTZA 2C77A 4P3YA 4B47A 1E79A 4Q7JB 4DQLA 3H94A 3FKSA 4RDJA 2GPJA 1Q81D 4QHYA 2VJJA 5J3OA 5IK2A 1W35A 1N0UA 3NE5B 4U9UA 4ZCLA 4RD6A 4AC9A 3OW7A 3WBKA 1Q82D 3KEWA 1TUIA 2C2WA 2RC6A 1JB9A 4XLEA 4RD4A 2W6JA 5HXBA 2VNHA 1SKQA 3W2FA 1ELOA 2X53S 1ZM3A 2QE7A 2YWFA 1SM4A 3WQZA 1VJSA 4WZEA 5IYNA 2QA4B 4XLAA 1QX4A 2PE3A 2OBTA 4B48A 4P2NA 2WJYA 3D26A 1MRZA 1ZM9A 4G7WA 4F7DA 1E1QA 1GO2A 4Z4ZA 3CMAB 1BJKA 3A8JA 3U2QA 3WBJA 2DYIA 3OE7A 1H8HA 2VNKA 2ZL7A 5EMNA 4XORA 4RD3A 1FNDA 1D8TA 3OFNA 4KKSA 2GK7A 4M2LA 4QVJA 2CF4A 4Z4SA 5TR9A 3VO1A 5KSWB 3LO8A 3BCDA 1COWA 3Q38A 2RC5A 4OOVA 2QTLA 1OGIA 2BF4A 2V7TA 2PIAA 2I1LA 5FNZA 2ZZGA 3CB4A 4YEJA 1E62A 3PA2A 3GIRA 1VF7A 4II3A 4DK1A 5KNLA 4E0FA 2PMDA 1GAQA 1IJFA 4YALA 1KK0A 3A35A 1FX0A 4QFMA 2X8KA 4RM0A 3QFCA 2V7UA 5JBQA 4ASUA 1QVGB 1E1RA 1S0UA 3ZZUA 1IB0A 2D3NA 3CTAA 1JA0A 2BN4A 4HE6A 1SKYB 1JJ2B 1J9ZA 2VBSA 2P3MA 3LQ6A 1E63A 1H42A 4GQNA 3ZIAA 3FPKA 2V7VA 4WWVA 5HZBA 1HA3A 1N06A 1G7TA 3MMPA 4ACBA 4Z4UA 4OPVA 4ZCIA 1FNMA 3AVTA 4X7CA 2V7WA 3B8HA 4AVZA 2HLDA 2VJIA 5LMZA 2PLFA 4B3XA 4DQKA 1VQLB 4Z4VA 1YJWB 1GVHA 2X3UA 4Y7CA
chains in the Genus database with same CATH topology
5F4MA 4P1VA 4X07A 4QVAA 4OPSA 3V7AA 4Z4WA 3ONYA 3ONUA 3PUMA 4P12A 3ASPA 3R6JA 4RDJA 3ASQA 5J3OA 5IYQA 2ZL5A 3ASSA 5IYRA 5HZAA 4X06A 4X7DA 4RDKA 5F4OA 3ASTA 3SLNA 3SJPA 4Z4TA 4Z4YA 4X05A 4WZEA 2OBRA 3R6KA 5IYNA 3Q39A 4P26A 2OBTA 3Q6QA 4X7EA 3LQEA 4P2NA 3D26A 3SLDA 3PUNA 4QUZA 5F4JA 4Z4ZA 5BSYA 4OOSA 4RLZA 2ZL7A 4WZKA 4RPBA 4X7FA 4QVJA 4WZLA 4RDLA 3SEJA 4Z4SA 3BQJA 3BY2A 3SKBA 3PVDA 3Q38A 4WZTA 4QV2A 4OOVA 5KW9A 2ZL6A 3Q3AA 5J35A 3ASRA 3PA2A 5BSXA 4ROXA 5IYPA 3BY1A 4RM0A 4OP7A 4P25A 4Z4RA 3LQ6A 3Q6RA 5HZBA 4X0CA 4Z4UA 4P3IA 4RPDA 4OPVA 4X7CA 3RY8A 5IYWA 3PA1A 4OOXA 4OPOA 4Z4VA 1IHMA 2OBSA 5E6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F4M A;  4P1V A;  4X07 A;  4QVA A;  4OPS A;  3V7A A;  4Z4W A;  3ONY A;  3ONU A;  3PUM A;  4P12 A;  3ASP A;  3R6J A;  4RDJ A;  3ASQ A;  5J3O A;  5IYQ A;  2ZL5 A;  3ASS A;  5IYR A;  5HZA A;  4X06 A;  4X7D A;  4RDK A;  5F4O A;  3AST A;  3SLN A;  3SJP A;  4Z4T A;  4Z4Y A;  4X05 A;  4WZE A;  2OBR A;  3R6K A;  5IYN A;  3Q39 A;  4P26 A;  2OBT A;  3Q6Q A;  4X7E A;  3LQE A;  4P2N A;  3D26 A;  3SLD A;  3PUN A;  4QUZ A;  5F4J A;  4Z4Z A;  5BSY A;  4OOS A;  4RLZ A;  2ZL7 A;  4WZK A;  4RPB A;  4X7F A;  4QVJ A;  4WZL A;  4RDL A;  3SEJ A;  4Z4S A;  3BQJ A;  3BY2 A;  3SKB A;  3PVD A;  3Q38 A;  4WZT A;  4QV2 A;  4OOV A;  5KW9 A;  2ZL6 A;  3Q3A A;  5J35 A;  3ASR A;  3PA2 A;  5BSX A;  4ROX A;  5IYP A;  3BY1 A;  4RM0 A;  4OP7 A;  4P25 A;  4Z4R A;  3LQ6 A;  3Q6R A;  5HZB A;  4X0C A;  4Z4U A;  4P3I A;  4RPD A;  4OPV A;  4X7C A;  3RY8 A;  5IYW A;  3PA1 A;  4OOX A;  4OPO A;  4Z4V A;  1IHM A;  2OBS A;  5E6T A; 
#chains in the Genus database with same CATH topology
 4B4D A;  1W9X A;  4PC1 A;  5F4M A;  4G1V A;  4X07 A;  3E20 A;  3AVV A;  4G6I A;  4OPS A;  3T51 B;  2C4T A;  1W0J A;  1F60 A;  5H59 A;  4CQJ A;  1QFJ A;  4WQM A;  4DK0 A;  1CNF A;  2VNI A;  4LBZ A;  1QGZ A;  3ASP A;  1PJ7 A;  1UD5 A;  3OEE A;  3B82 A;  5FO1 A;  2HDN B;  3R6J A;  1WSV A;  3VO2 A;  1T6X A;  3WY9 A;  1WOR A;  2QEX B;  1VQ8 B;  4AF6 A;  3ASQ A;  2JJ2 A;  3KL9 A;  1DG1 G;  2C5B A;  2EFG A;  4P6V F;  2VZL A;  3OOC A;  1DAR A;  4ZV4 A;  5IYR A;  2XZP A;  2Z6B D;  5HZA A;  3CCM B;  3CCS B;  1N8R D;  1HZE A;  2ZXH A;  2ZTG A;  4XN3 A;  2OK8 A;  4LBV A;  3SLN A;  3I1F A;  3FPP A;  4Z4T A;  3WXM A;  2ZZF A;  1Q9S A;  3CP8 A;  4Z4Y A;  4G1B A;  4X05 A;  4C0S A;  2V7Q A;  3G6E B;  1T6Y A;  3Q6Q A;  1VQP B;  1DDG A;  1K73 D;  1B23 P;  4P22 A;  1IJE A;  3CES A;  1W34 A;  4N3N A;  4P6Y A;  4MYU A;  1V0F A;  4QUZ A;  4AF7 A;  5BSY A;  1BQE A;  3AGQ A;  5TV2 A;  2C78 A;  4R71 A;  2CW5 A;  3ZUG A;  1VQN B;  4PGO A;  3ZBT A;  3OPO A;  4XD7 A;  1XE1 A;  4RPB A;  1B2R A;  2W6I A;  4K1X A;  4NNJ A;  4TKO B;  1WOS A;  4X7F A;  2GK6 A;  2V4D A;  3CME B;  4RCZ A;  1V5V A;  1QUE A;  4WZT A;  4ZGQ B;  3WYA A;  5KW9 A;  3V76 A;  2CBX A;  1KZL A;  3Q3A A;  4G5G A;  4XLH A;  1U2R A;  2ZZE A;  3ASR A;  5BSX A;  4ROX A;  2Q6L A;  4TSF A;  1UD6 A;  1M1K D;  2ZZQ A;  2WJV A;  1PJ6 A;  2FVG A;  2ZBV A;  3OAA A;  4YAF A;  2FX3 A;  3T56 B;  3CCU B;  1FDR A;  1QUF A;  3BY1 A;  3G05 A;  1KK3 A;  1R5O A;  4XLC A;  3G4S B;  3CC7 B;  1RQP A;  3HAG A;  5HKK A;  1N07 A;  1VQ6 B;  1KK1 A;  1FNC A;  5GV8 A;  4MYT A;  1NB0 A;  3BC9 A;  1UMK A;  3Q6R A;  1YI2 B;  1UD4 A;  2X6W A;  4X0C A;  1BX0 A;  2QGG A;  1WDT A;  2X85 A;  1BPL A;  4RPD A;  5A8A A;  1OHH A;  2BGJ A;  1CNE A;  2GQF A;  2ZXI A;  1QVF B;  1VLO A;  2Q6K A;  3PA1 A;  4PAA A;  3CCL B;  1WSR A;  3QFT A;  2XGJ A;  2E1R A;  2YWE A;  4ZGN B;  1W2B B;  2B7C A;  3GQB A;  3OKX A;  4YAO A;  1MAB A;  2OBS A;  1IHM A;  2DOG A;  1I7P A;  2ZTN A;  4QV2 A;  5DS0 A;  4B3F X;  4XR6 A;  1KQS B;  3QFS A;  5DN6 A;  2D3L A;  4QVA A;  3LVB A;  3W2E A;  4M53 A;  4NBS A;  4Y9U A;  4TT3 A;  3PEN A;  5H5J A;  4PC6 A;  5TRD A;  2BM0 A;  4KKU A;  4PC3 A;  1PJ5 A;  2JDI A;  3VNU A;  1UD8 A;  2AHO A;  2QMU A;  2EIX A;  4P12 A;  4P9S A;  4Y9R A;  1QFY A;  2WZP P;  1G7C A;  1QG0 A;  1WU8 A;  4II2 A;  2BPO A;  2X6Y A;  5AN9 A;  1G7S A;  2ZL5 A;  1N0V C;  3H9N A;  3P27 A;  4X06 A;  2VBU A;  4YAW A;  3AGP A;  1NB9 A;  4RDK A;  3AVY A;  3CD6 B;  2XZL A;  4XOP A;  4YEL A;  2V7X A;  3CMM A;  2F43 A;  4L8J A;  1VQ4 B;  1AIP A;  1QGA A;  1TVC A;  3SJP A;  1R5N A;  3OJW A;  2X6X A;  3OEH A;  1VQO B;  1UD3 A;  1W0K A;  2OYN A;  3CP2 A;  1FRQ A;  3R6K A;  1A8P A;  3Q39 A;  5B6I A;  2CC2 A;  4X7E A;  1EFR A;  3LQE A;  1XB2 A;  4JMQ A;  1KJZ A;  3PUN A;  3BCF A;  1FRN A;  4KKT A;  2BV3 A;  1UD2 A;  5L46 A;  3W5V A;  2XOK A;  1E3X A;  3AVU A;  4XQF A;  4OOS A;  1BX1 A;  4RLZ A;  3A8I A;  1QGY A;  1VQM B;  1YIJ B;  1RQR A;  4N3G A;  2D74 A;  4WZK A;  3P26 A;  2XZO A;  2HCJ B;  4XNF A;  4XOT A;  3QFR A;  1S4M A;  5GV7 A;  4RDL A;  2R6H A;  3SEJ A;  2WSS A;  2XND A;  2HMA A;  3BQJ A;  3OW2 B;  3GVK A;  4RD0 A;  3SKB A;  3PVD A;  1D1N A;  2VBV A;  1N05 A;  1I18 A;  2GJK A;  2KVO A;  1EXM A;  4M4S A;  1TTT A;  2C4U A;  4X8I A;  5J35 A;  3BH4 A;  4XKW A;  1GR1 A;  1R5B A;  1NBM A;  4TMZ A;  2QN6 A;  2CK3 A;  1AMO A;  1WPC A;  2JIZ A;  4Z1M A;  1W87 A;  1WOO A;  4EH1 A;  5DSZ A;  1NJI D;  1G7R A;  2XNC A;  3OZU A;  2ZIT A;  1OB0 A;  1I8D A;  1YHQ B;  2CRV A;  1NDH A;  4OP7 A;  4P25 A;  4FK8 A;  4Z4R A;  3WND A;  2CND A;  2F1L A;  5FIU A;  2J7K A;  3I56 B;  2DCU A;  1OB2 A;  2F4N A;  1HVX A;  1YX2 A;  4C43 A;  1YIT B;  3CCE B;  4PC7 A;  5FA6 A;  4RD2 A;  1WOP A;  4RJL A;  1KK2 A;  2WZN A;  3OZW A;  4P3I A;  4YHB A;  4UZF A;  2V31 A;  4LBW A;  2BVN A;  3WNC A;  2GJP A;  5IYW A;  1XQB A;  1K28 D;  2VBT A;  4OPO A;  3ZC3 A;  5THX A;  5A89 A;  3VNV A;  4TMW A;  5E6T A;  3AVX A;  3CCJ B;  1YLO A;  1EFC A;  1ZM2 A;  3SJZ A;  1XFO A;  2BM1 A;  3E1Y E;  3V7A A;  4Z4W A;  3CPW B;  3JQR A;  4J0Q A;  1VQ5 B;  1E64 A;  2XNJ A;  3AVW A;  1YJN B;  5FO0 A;  3ONU A;  2DEU A;  1H8E A;  3U6B A;  1K8A D;  3ZPN A;  4DNR B;  3W5U A;  3GVL A;  4NCN A;  4YAU A;  2B7B A;  3ZZ0 A;  4B3G A;  1V0E A;  3W2H A;  1M90 D;  2LZJ A;  3CCR B;  5IYQ A;  3ASS A;  2OTJ B;  1EWY A;  3JQQ A;  1EFU A;  1Y0R A;  3GVJ A;  1VQ7 B;  3CXC B;  3CW2 A;  4X7D A;  2D9R A;  2JJ1 A;  2VYQ A;  2X0K A;  3AST A;  4TMV A;  1GJR A;  5F4O A;  1K9M D;  1E43 A;  3ZZT A;  1TLL A;  2BSA A;  2F1M A;  4FN5 A;  4IW3 B;  1Q86 D;  1WP6 A;  1OB5 A;  4ZCM A;  2DY1 A;  1VQK B;  3W2I A;  1VLY A;  4XMY A;  2OBR A;  1KRH A;  3JU4 A;  3MHP A;  1EP2 B;  1YJ9 B;  3CPX A;  4P26 A;  4UZE A;  1F20 A;  2BGI A;  3SLD A;  3CC2 B;  2DER A;  3OZV A;  3ES9 A;  1KTV A;  3U6K A;  4UAJ A;  5F4J A;  2WPD A;  3CC4 B;  3W2G A;  4YXW A;  4HIZ A;  1T5E A;  4TMX A;  4FXU A;  4M1K A;  2GJR A;  1VHE A;  3T53 B;  3ISX A;  1KD1 D;  4DNT B;  4G7X A;  1VHO A;  1Y0Y A;  1OGJ A;  3LNN A;  2XEX A;  1E3Z A;  3CCV B;  3FJO A;  4WZL A;  2R9V A;  4RCY A;  3CCQ B;  3BY2 A;  4H9G A;  1BLI A;  1VQ9 B;  1ZM4 A;  3I55 B;  5TY0 A;  2ZL6 A;  1EP1 B;  2Q6I A;  2DET A;  4XLF A;  2ZBU A;  3VMF A;  3GSI A;  1JNY A;  2OK7 A;  3BNW A;  5IYP A;  4PAB A;  4B43 A;  4UZU A;  3OJX A;  4XKV A;  3QE2 A;  5FL7 A;  2B5O A;  3OP1 A;  1KMH A;  3A3G A;  1QH0 A;  4LC0 A;  2WYR A;  1FNB A;  1WTH D;  2JN9 A;  3B78 A;  1T6Z A;  3J81 k;  2M5S A;  5A88 A;  4BPR A;  1EP3 B;  4PC2 A;  4M0L A;  4ACA A;  1EFT A;  2YWH A;  4HE5 A;  1NRK A;  1QFZ A;  2BMW A;  3JQP A;  1BMF A;  5CDF A;  2QDX A;  4XL9 A;  3A1P A;  2NPF A;  4B44 A;  3RY8 A;  2Q6O A;  1N08 A;  1ZUN B;  3MCA A;  4XON A;  4XM3 A;  1Q7Y D;  1JA1 A;  4OOX A;  3CRZ A;  3QSY A;  1GAW A;  3VR6 A;  1PKV A;  3A3B A;  2WR8 A;  4TMT A;  2YWG A;  1KC8 D;  3ZBU A;  2VNJ A;  4P1V A;  1P4M A;  4TN1 A;  1DDI A;  2C5H A;  2GRE A;  1S72 B;  4LBY A;  2DIE A;  3W5H A;  3DDY A;  4RD1 A;  3G71 B;  2E1B A;  2NV4 A;  4FWT A;  4XN0 A;  2OTL B;  3WNB A;  3A8K A;  3ONY A;  1H85 A;  3PUM A;  1CQX A;  1D2E A;  2QTZ A;  2C77 A;  4P3Y A;  4B47 A;  1E79 A;  4Q7J B;  4DQL A;  3H94 A;  3FKS A;  4RDJ A;  2GPJ A;  1Q81 D;  4QHY A;  2VJJ A;  5J3O A;  5IK2 A;  1W35 A;  1N0U A;  3NE5 B;  4U9U A;  4ZCL A;  4RD6 A;  4AC9 A;  3OW7 A;  3WBK A;  1Q82 D;  3KEW A;  1TUI A;  2C2W A;  2RC6 A;  1JB9 A;  4XLE A;  4RD4 A;  2W6J A;  5HXB A;  2VNH A;  1SKQ A;  3W2F A;  1ELO A;  2X53 S;  1ZM3 A;  2QE7 A;  2YWF A;  1SM4 A;  3WQZ A;  1VJS A;  4WZE A;  5IYN A;  2QA4 B;  4XLA A;  1QX4 A;  2PE3 A;  2OBT A;  4B48 A;  4P2N A;  2WJY A;  3D26 A;  1MRZ A;  1ZM9 A;  4G7W A;  4F7D A;  1E1Q A;  1GO2 A;  4Z4Z A;  3CMA B;  1BJK A;  3A8J A;  3U2Q A;  3WBJ A;  2DYI A;  3OE7 A;  1H8H A;  2VNK A;  2ZL7 A;  5EMN A;  4XOR A;  4RD3 A;  1FND A;  1D8T A;  3OFN A;  4KKS A;  2GK7 A;  4M2L A;  4QVJ A;  2CF4 A;  4Z4S A;  5TR9 A;  3VO1 A;  5KSW B;  3LO8 A;  3BCD A;  1COW A;  3Q38 A;  2RC5 A;  4OOV A;  2QTL A;  1OGI A;  2BF4 A;  2V7T A;  2PIA A;  2I1L A;  5FNZ A;  2ZZG A;  3CB4 A;  4YEJ A;  1E62 A;  3PA2 A;  3GIR A;  1VF7 A;  4II3 A;  4DK1 A;  5KNL A;  4E0F A;  2PMD A;  1GAQ A;  1IJF A;  4YAL A;  1KK0 A;  3A35 A;  1FX0 A;  4QFM A;  2X8K A;  4RM0 A;  3QFC A;  2V7U A;  5JBQ A;  4ASU A;  1QVG B;  1E1R A;  1S0U A;  3ZZU A;  1IB0 A;  2D3N A;  3CTA A;  1JA0 A;  2BN4 A;  4HE6 A;  1SKY B;  1JJ2 B;  1J9Z A;  2VBS A;  2P3M A;  3LQ6 A;  1E63 A;  1H42 A;  4GQN A;  3ZIA A;  3FPK A;  2V7V A;  4WWV A;  5HZB A;  1HA3 A;  1N06 A;  1G7T A;  3MMP A;  4ACB A;  4Z4U A;  4OPV A;  4ZCI A;  1FNM A;  3AVT A;  4X7C A;  2V7W A;  3B8H A;  4AVZ A;  2HLD A;  2VJI A;  5LMZ A;  2PLF A;  4B3X A;  4DQK A;  1VQL B;  4Z4V A;  1YJW B;  1GVH A;  2X3U A;  4Y7C A; 
#chains in the Genus database with same CATH homology
 5F4M A;  4P1V A;  4X07 A;  4QVA A;  4OPS A;  3V7A A;  4Z4W A;  3ONY A;  3ONU A;  3PUM A;  4P12 A;  3ASP A;  3R6J A;  4RDJ A;  3ASQ A;  5J3O A;  5IYQ A;  2ZL5 A;  3ASS A;  5IYR A;  5HZA A;  4X06 A;  4X7D A;  4RDK A;  5F4O A;  3AST A;  3SLN A;  3SJP A;  4Z4T A;  4Z4Y A;  4X05 A;  4WZE A;  2OBR A;  3R6K A;  5IYN A;  3Q39 A;  4P26 A;  2OBT A;  3Q6Q A;  4X7E A;  3LQE A;  4P2N A;  3D26 A;  3SLD A;  3PUN A;  4QUZ A;  5F4J A;  4Z4Z A;  5BSY A;  4OOS A;  4RLZ A;  2ZL7 A;  4WZK A;  4RPB A;  4X7F A;  4QVJ A;  4WZL A;  4RDL A;  3SEJ A;  4Z4S A;  3BQJ A;  3BY2 A;  3SKB A;  3PVD A;  3Q38 A;  4WZT A;  4QV2 A;  4OOV A;  5KW9 A;  2ZL6 A;  3Q3A A;  5J35 A;  3ASR A;  3PA2 A;  5BSX A;  4ROX A;  5IYP A;  3BY1 A;  4RM0 A;  4OP7 A;  4P25 A;  4Z4R A;  3LQ6 A;  3Q6R A;  5HZB A;  4X0C A;  4Z4U A;  4P3I A;  4RPD A;  4OPV A;  4X7C A;  3RY8 A;  5IYW A;  3PA1 A;  4OOX A;  4OPO A;  4Z4V A;  1IHM A;  2OBS A;  5E6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...