3SJZA

The structure of aif2gamma subunit delta 41-45 from archaeon sulfolobus solfataricus complexed with gdp and gdpnp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
409
structure length
409
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEETIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title HOLD FOR PUBLICATION
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Translation
total genus 95
structure length 409
sequence length 409
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjzA01
3DM5A 1Q7YD 1RE0A 4FCVA 4IHQA 1E9FA 1GAWA 5FTKA 4BFWA 2ZSBA 3SU8A 2IYRA 2IT1A 1RPZA 2UZ3A 3OJWA 1KO1A 1A7JA 1J8MF 5CM9C 4HB3A 1DPFA 1GRRA 1YITB 1G18A 2X1VA 3O8CA 3O8BA 5FOSA 1OXTA 4GL2A 3CCVB 4BZXA 4FINA 2VSXA 1E9RA 1L4YA 4JZKA 3EASA 3QG5A 1AKEA 2D06A 2G6BA 4GNKA 2EU8A 4IVPA 4OBEA 1EFUA 4OJKA 2J59A 1ZUHA 5EUQB 3OAAD 2ZRHA 1XMSA 4IDNA 4IVQA 3B5JA 2VO1A 1KC8D 1T0JB 2W2XA 4PHHA 4EUNA 1GNRA 4KCGA 5J4YA 2JLVA 1W4RA 2OCYC 3ZBUA 4JLAA 4M8NE 2DHRA 4DLTA 3OESA 2RGXA 1FP7A 4HB0A 4CEJA 3B6EA 2W0SA 3GFOA 3EIQA 2GXUA 4GI7A 1W0KD 5KO2A 4B3GA 4C3ZA 5DE3A 1KK1A 5JCPA 3NVAA 2NGRA 1KI6B 2GWHA 1DEKA 5TARA 1DOAA 2IUTA 1UKYA 2IEZA 1QH0A 3NKVA 4ARZA 2IXGA 1BOFA 1SXJA 4HAZA 2VPPA 1G4AE 3KXIA 3R7WB 4YAUA 4PZZA 3JQRA 2GJ9A 2KI5A 2QMOA 1LV7A 5FBVB 1QHHB 3KJIA 1N25A 3LNCA 4B2IA 5GVSA 5JLJA 3KQUA 3R9IA 3K1JA 4IEEA 3K0CA 2Q9CA 5KUTA 3LDAA 2DR3A 4DLXA 1COWA 1W47A 5EXSA 3KQHA 4QHSA 1X1SA 4TZ0A 4CIDA 4G5QA 1XJCA 1NVXQ 3TSOA 3B9PA 1XD2A 4EFNA 2OAP1 3QXCA 4IRUB 4LOAA 1X6VA 3C7KA 4URVR 2VA8A 1ZM7A 1BMFA 5FBQB 2ZI4A 4HLDA 1Q82D 5E7JA 2YVUA 5H8WA 1E2FA 1GDDA 3CPHA 1UKZA 2O0KA 3NH9A 1QGAA 5DSZA 4B76A 2RB4A 1FQKA 1GFIA 2IYLD 2B7CA 4Z1MA 5J4HA 4JKYA 3A1VA 3HPQA 1GG2A 2ZS9A 2FJUA 2YOFA 4KYIB 4QGAA 4C2UA 1FTNA 4PO1A 4POAA 1IN7A 3VX4A 2RGBA 4HAUA 2O0JA 1OFTA 1R10A 1FX0B 2CCJA 2R44A 4ON9A 3A36A 4TLBA 1OT3A 4LBVA 2FDCA 1F2UA 2PT5A 3CRMA 3EIEA 4JKIA 1PV4A 1EESA 1SVSA 3HWSA 5AR1A 4XWKA 4V0OA 1ZD1A 3K70D 3MRSA 2JLUA 1KKMA 3RNLA 2G3YA 5L3RA 3I3SR 3B85A 3L0IB 3PUWA 4RVCA 5DNYB 4LV6A 3LBHA 2CEAA 2V6IA 2ODEA 2E1RA 1HUQA 1ANKA 1OH7A 1S72B 4JLBA 2C78A 2ZUDA 1EWRA 4URZR 2HLDA 3ADBA 5KNCA 2ZU6A 2RHDA 1P75A 2KBEA 3CF6R 5EZ5A 2DFKB 4B4DA 1ZD8A 4O25A 2D2EA 1KO8A 3FTQA 1SXJD 2W83A 3MG9A 3QVVA 2IYUA 1R5NA 1YZTA 4E5UA 2OT3B 4N0DA 4NKRA 3THWA 3TSWA 2A5GA 1P5ZB 1ZNYA 2H8KA 4G5GA 2QT1A 1FUKA 4KO8A 4P4SA 3SQXA 1KKLA 2VSOA 1FL9A 2WJJA 4XD7D 1COWD 3MWYW 4L4UA 4F92B 3CM0A 1E1RA 3E1SA 3MCAA 4YLGA 1Z0JA 1IN5A 1C1YA 3IPXA 1QF9A 1O3YA 2CMKA 3LV8A 1KI9A 3W2HA 1R0ZA 3NBZC 4ERNA 5L3VA 2FSIA 4OHWA 3THYA 1IY0A 4FWTA 4Q9LA 1CNEA 1G3MA 3FPKA 2CHGA 2GVDC 3NTUA 2O8BB 3GFPA 4BPRA 3CPWB 2ZVQX 4HLUC 1LF5A 1G291 4H1VA 4R98A 4YMSA 4HB2A 2GEUA 2ZJ5A 5FPSA 2OTJB 3RHFA 5HKKA 1XP8A 4FCWA 4URYR 1OV4A 2ZAOA 1IN4A 3Q5DA 1DTSA 4DLVA 5LD2B 3ZZTA 1NJGA 3SJCA 4QGFA 3FFBA 2O8FA 2GESA 2JEOA 1S9HA 3KTAA 2MSDB 2QL6A 1N6PA 2NPIA 1OKKA 3GP8A 1GSIA 4NBSA 4GP6A 1RJ9B 4RZ3A 3U3RA 4F93B 1ODFA 1QHYA 5KSYA 1KSFX 4RD6A 3BGWA 1ONBA 3Q3JB 4NONA 3RDPA 3K0FB 2GILA 1SM4A 2KBFA 3C8UA 4M21A 2QTZA 3CRZA 2V9PA 4KI0A 4MA4A 4YONB 2O8CA 2GF9A 3Q85A 4TMKA 3VQTA 3I8XA 1NKTA 1XEWX 3EPHA 1T91A 4L9WA 4A15A 4P4TA 1XEFA 4HDCA 1E2GA 3KJEA 3GJ7A 5CDFE 4OI0A 3QIAA 3AM1A 4TTQA 1YE8A 2A5JA 3W2GA 3RS0A 5CIQA 4GZMA 1OH5A 3LY5A 2X19A 4TMTA 1W4AA 5IRCD 1RZ3A 3GLFB 2XNSA 1G4UR 3EWSA 2ZYWX 5JJKA 3VNVA 1EGAA 3CO5A 3PJRA 4HAXA 3IBYA 1G9XA 1E2JA 3BB3A 1I7PA 1GO2A 1HQCA 1VDZA 1F2TA 2WJVA 3IO5A 1MT0A 4NHOA 3TR0A 1G8PA 2JLWA 2CHQA 3FWYA 1VTKA 2P6NA 4QBFA 5GJBA 3X2SA 3D6TB 5EXTA 2BEKA 1RIFA 3ZIAA 3GLHA 1ZU5A 2IS4A 1HY3A 1DG1G 4US2R 1XXHB 4ZIRA 1TUEA 1OIWA 1NN5A 1S3SA 1SZPA 1Q1QA 2OUKA 1TMKA 2CL6X 4GFDA 2ONKA 4LJ4A 3RC3A 2QMEA 2FG5A 1FFHA 1K9MD 4F4IA 3O8DA 1DAEA 2Q3HA 4FN5A 2NG1A 3JQPA 4C0BA 1EK0A 3H0KA 5FUWA 3OIVA 1CR0A 2AKYA 2EIXA 3GJ3A 1G7RA 3SFZA 2ZITA 3PV0A 4D0LB 2ZREA 1N6OA 1VIAA 3TAHA 1KJWA 2FMXA 4EPRA 3NDPA 1E0KA 1KNXA 4QHTA 1NY5A 4JLMA 5HXBA 1ELOA 2GJAA 1GL9B 1ZW6A 3A1UA 4HUTA 1R7RA 4UNRA 2ZJZA 4Z54A 1OYYA 4AF6A 3AF3A 3HYRA 3KQNA 3WNCA 1OF1A 1VCOA 2HF8A 4KVAA 2QMHA 1JEDA 4UJ3A 3U7HB 2J7PA 4LZZA 2YWGA 3VHLB 2R9VA 3CONA 2QT0A 4ZO4A 2IWRA 1K5DA 1MO3A 2RH5A 1Q1EA 1JJ7A 4JJKA 3VO1A 3C16C 1U9IA 1AGRA 1TUIA 3AH8A 3EPKA 2GDJA 4Q4LA 4MYHA 3BBPA 3CKLA 5FTJA 3RWMB 2JA1A 3FGNA 4AD8A 4XWAA 3W6PA 3FHOA 1E9AA 1LVGA 2XZLA 4RKEA 1BX1A 1IOZA 4LBYA 1KI6A 3WRXC 4XVQA 1GRQA 1VYUA 2VBCA 3CIOA 4PZLA 5KDDA 1WF3A 3G71B 5FL7A 3PITA 4EJSC 3DMNA 4DCVA 5AN9A 3R7WA 5CITA 2KJQA 1ZIPA 3I56B 1VQ4B 5FA6A 1E62A 4ZDWA 2DFNA 1QHHA 1KY3A 5DI9A 2AN9A 4PANA 5CYPA 1RC8A 2ZPTX 4FW9A 3T5DA 4P3YA 1RYFA 1HT1E 1SHZA 2FZ4A 2N42A 2CRVA 4FD2A 4HZIA 1HH4A 3ZIAD 5L3SB 3UKDA 1NSTA 4EIWA 1J7KA 2B92A 4BFYA 4KBFA 1LY1A 1U94A 4TQUS 1GVHA 4PAQA 2CJWA 5G3ZA 2V3CC 2VTKA 1LNZA 2WWHA 1JJ2B 2IF2A 1CEEA 3MLEA 3CCUB 4URUR 5FPKA 2XZOA 1ZUNB 4NH0A 4Q03A 4MRVA 2ECKA 3KKPA 1XWIA 3QBVA 4K46A 4L15A 4Q18A 4Q66C 4RD1A 1J90A 2E87A 1HT2E 3BOSA 5JBQA 1UFQA 4Q7LA 4TLCA 2CNWA 5FOVA 4Y7CA 1K8AD 1LTQA 3MAAC 2G0TA 4LHZA 3VNUA 3LO8A 3O8RA 1AM4D 1CJTC 4B43A 2UKDA 4Q48A 1ZIOA 3B1VA 3ADDA 3LVBA 3QUSA 3KKQA 1JBKA 1FX0A 2C98A 3W5IA 5JCZA 4PSVA 2V8OA 3A1TA 1YI2B 4A2PA 1BX0A 2IHBA 5H1YA 2G1JA 2DFLA 4W5JA 2YNMA 2IS1A 2XTZA 2J7PD 4EPWA 1KI8A 1N5JA 1DAGA 1KTVA 4TMVA 2VHUA 3AVYA 4BFUA 4JYBA 2HT1A 3AVUA 3RVBA 2IF0A 4DBLC 4G0NA 4A6XA 2FV8A 4B2PA 1GNPA 1Q20A 3LH5A 4LJ7A 2G83A 5IHPA 1OXSC 4JL8A 3I92A 4DVGA 1G3UA 1CR1A 1TL7C 1GJRA 2NZJA 4DSNA 2Q3MA 3GJXC 3KDSE 4B32A 2OHFA 4N3NA 2QP3A 4C30A 4M53A 2BDTA 5GV7A 3TK1A 4AKEA 1W7AA 1YHQB 5FL7D 4Q5IA 5AWFC 2R6FA 1X86B 2PCLA 3E5HA 3UXMA 1F5NA 3W5UA 2QGZA 2ZJOA 4M1TA 1FZQA 1E1QA 1KO4A 4EPXA 4NDZA 2J5XA 3G6EB 1YR6A 4M9XA 3I73A 5TY0A 3K0EA 4OYHA 2X8AA 4IXNA 1W2HA 2C77A 2OBMA 2HF9A 2ZYTX 1AS0A 3OIYA 2JLRA 1T5LA 5FPHA 1U90A 2ZSAA 2ZVPX 1N0WA 1K6MA 1E96A 3ZD6A 1G8GA 1W36C 3CD6B 3HP1A 1JR3A 3SHWA 4DRZA 4LC0A 1NMYA 3PUXA 3TE6A 2WWWA 2R6HA 1N5KA 2QP9X 2UVQA 3MMPA 3OEED 2V1UA 3FMPB 1U8YA 1DO0A 3NIBA 4KHZA 2O8BA 1XX6A 1KRHA 2QROA 1U8ZA 2VF7A 1YZKA 5DN6D 4G3XA 2WAXA 3WMGA 3BH6A 4KFTA 1VYTA 1KYIA 4FMBB 1R5BA 2C9CA 1OIXA 1QGZA 3QSYA 3LAWA 4LK2A 2QI9C 1H65A 4LX0A 4L5BA 4KBGA 4CZ2A 2H57A 2B21A 4QGGA 3G0HA 1IXRC 2P67A 2A9KA 3M0EA 4Y9UA 4C0LA 3U44B 3NDBB 1KZGB 1P3JA 1RJ9A 2F3RA 3ZS9A 1OH8A 3PXGA 4M1MA 3UG7A 3VX3A 4FIDA 2C03A 1LS1A 2QGNA 3K0FA 4DSTA 5KDOA 1SXJE 1R5OA 3ZBTA 2AFIE 3FB4A 1IXSB 3AVVA 3IKJA 3NHBA 1R0XA 4LJ9A 4LYJA 4AYWA 1YU9A 2ZR0A 4E22A 4TWZA 3CXCB 3F5FA 4RCYA 4ITRC 3SC3A 3WRYC 4DUGD 1P60A 3CC7B 4PQYA 4YDHB 2GPJA 4UNPA 3TQCA 2RCNA 1JB1A 1N6NA 2BJVA 1IJFA 3JZMA 3CB4A 2JLXA 3LQQA 1Q86D 4C43A 2CK3A 1AZSC 2LKDA 5C46F 4KU4A 2JJ2A 2IHYA 3GLFA 4IXMA 3OIUA 2C2HA 1KK0A 2WBLC 1IONA 2VP5A 2OXRA 3L8YA 3W3AA 1H8HD 4TZ6A 1BIFA 3U4QB 1VYVA 4TL8A 5DYGA 3KL4A 1UADA 4PQFA 1G3RA 3CMAB 1E1QD 1XEXB 4JLDA 1UEJA 2FFAA 5JZVA 2W58A 4DHEA 5K8LA 4W5WA 5CB8A 4HZUB 2ZRBA 3U3MA 1ZCAA 2PH1A 2QTVB 1QHIA 4YXWD 4MGKR 3BK7A 4A82A 1XXHA 4WXRA 2Z43A 4M2LA 1XZQA 1YHNA 2WVJA 4PQRA 3B13B 3OFNA 1G64A 1XJ0A 2JAQA 1P4SA 1W5TA 1JR3D 1L7VC 1XRJA 5CLLA 3B8HA 3PUZA 2ZYVX 3CZQA 3ZVRA 3HDTA 4M1KA 4DCTA 4Z8YA 5G53C 2XJ4A 1ZM2A 1QX4A 3CRW1 2XNDA 4JVMA 2GAAA 2GKSA 1MO6A 2OFOA 5JHHB 1ZD9A 2FA9A 3AP3A 2ERYA 4NPHA 3V00A 1FNDA 5UKDA 3B9QA 3AGQA 1ZYUA 1GKUB 2FSFA 5HTKA 1F20A 1NLZA 1NBMA 4TLDA 4ZPXA 2NQ2C 1XF9A 121PA 1Z6YA 4Y0VA 4JVSB 2XAUA 3VR3A 1GOTA 1XBTA 4CT5A 2CVFA 4MRPA 4WW0A 4AF7A 1N3BA 3QXSA 2VIIA 3AVQA 4IDPA 1Z5ZA 3KXKA 3VR4A 4M0LA 2J7KA 1K5GA 1QZXA 4MRNA 2TMKA 1G3IA 1QFJA 2OBLA 3AF0A 5TDHA 1IBRA 2FPLA 2BBWA 2H17A 5TXGA 4A92A 4DLZA 1BKDR 3EA0A 4OHVA 3BORA 4QXAA 3AF1A 4OQMA 1N6HA 4DDWA 5E7MA 5F2EA 1MV5A 1PUIA 3IIMA 4DLYA 1G8YA 1TU3A 2VF8A 3W6NA 1E99A 4BLTA 4E07A 2IL1A 2CK3D 2I1QA 5EP3A 5FBLB 1RRFA 3RS4A 3G82C 1DAKA 1Q22A 2FPMA 3ZS8A 1VQOB 2CDNA 2YV5A 4B73A 3MFYA 5HZKA 3V4RA 5KDLA 3W6OA 4M1YA 5HR5A 1IY1A 6Q21A 2O8CB 1ZUIA 5BN3A 3CLVA 1P7CA 2GVZC 4EH1A 4DEXA 2IYXA 2J0UB 4DLWA 3W5VA 1YZQA 2J45A 2PX3A 1NNEA 2JJ1A 3QXHA 2HEIA 2ZRJA 2GQFA 3TUZC 1CRPA 1RKBA 1G5TA 3GJ5A 1ZCBA 4PFSA 4D4LA 621PA 1SVWA 2J46A 4ESVA 5KTYA 3UMSA 3Q7PA 4XWOA 2FF7A 1VPLA 5E7IA 4CVNA 4EDHA 4H9GA 2JASA 3W5JA 3GLGB 1PUJA 2AK3A 3NEJA 5TVKA 5LDDC 2PL3A 3T35A 3WY9A 1G7CA 2FSHA 4A2QA 3OFND 4S35A 3UIEA 2PLFA 1LB1B 1TQ2A 2QSYA 3EZFA 1VQLB 1D2MA 2IYWA 2PCJA 3C14C 2P2LA 4JYCA 1XE1A 3VR2A 5GVRA 2A30A 4C0SA 1E2NA 5LBIA 2GCPA 2FOLA 3AB3A 1AS2A 2XNDD 4NYIR 5CB6A 2JATA 5M04A 4V0KA 1IJEA 3D7MA 1GAQA 1HYQA 3LD9A 2W6IA 3ZLJA 1AA9A 3AKEA 3C41J 3QENA 3DL0A 1NBMD 3OE7D 1PJRA 4UQOA 1E94E 1ZC4A 1G8HA 1XD9A 5J40A 4DB2A 3V4FA 3OZUA 3B2EA 1E4VA 1F48A 4OQLA 5JSZB 3I5XA 2HDNB 3W5HA 5HCNA 5CK5A 4M9SA 4F91B 1OIVA 1TLLA 1GTVA 1KJYA 1GRNA 4V0MA 5JEEA 1NIJA 2EW1A 1VQ5B 2VHTA 3M4YA 3C5HA 2Z6VA 5P21A 1TF7A 1VKJA 4K8OA 1NG1A 4PO9A 3GLIB 3EZ2A 4ZKEA 1CTQA 1FOEB 5EXPA 3K09C 2RGNA 3SBEA 1EFCA 1Q57A 1TF2A 4EJSB 1HQYE 3IIJA 4NTZA 1KO5A 1JNYA 1B0UA 1P9RA 4A8JC 2DPXA 2FFBA 2FZLA 5THXA 4IW3B 1CJUC 4KSBA 1SVIA 1AJEA 1QG0A 3FMOB 2I3BA 4I99A 3TBKA 2J41A 5CLQA 4R9UC 2V7QA 1Z6XA 2JJ1D 1WB9A 3LWNA 3SOPA 2R6DA 2CE7A 4Q00A 3X1XA 3L0OA 2YKGA 4CRWB 2EVWX 2NIPA 3CRRA 1FP6A 1G1MA 3NBYC 5FTNA 2Z0MA 1M6NA 1ZJ6A 4TYYA 1B2RA 4O2LA 3ADKA 3U7GA 1W44A 2RGAA 1KSJA 1HA3A 2P5SA 4IOMA 1HV8A 1IB0A 3QY0A 4TLAA 2IW3A 2OTLB 2P0EA 2FPKA 2ORWA 4GP7A 3VHXA 2O0HA 2VP9A 4A0FA 2P5TB 4N3GA 1SKYB 4MRSA 3SJBA 2JLZA 4ZDJA 1UMKA 1ETUA 3CCLB 2FFQA 2V54A 4IOKA 1Z47A 1PLLA 1E2IA 4RD4A 1YJNB 4IOLA 5C18A 4GSYA 5ANRB 2WOJA 8OHMA 2CJWB 3U44A 5BWMA 1U8AA 1YR8A 1N5IA 2YC2C 5B58C 4C2TA 2RGEA 4TT3A 3EC2A 1CRQA 2F9LA 2LCFA 1WXQA 5H70A 3ONWA 3TW8B 2A3RA 3CCEB 2RMKA 4V0NA 1Z83A 4QBIA 5LB2A 4OHYA 3VKWA 1GL7A 2F1RA 3BRWD 3QQ5A 3QKTA 5FI0B 4Q21A 2QDXA 3PEUA 5EE5B 4MGYR 3LX5A 4QNMA 1E2PA 1NY6A 3IEUA 1SXJC 3RABA 1J2JA 3RWOA 4M1OA 1UBFA 5DH9A 3QPWA 4QC2A 4TL9A 1KAGA 2NTYC 5A4JA 1AS3A 1XTKA 1T3HA 1U2RA 3U4QA 1N2CE 1OXVA 1XEWY 2OFXA 1MOZA 4KSCA 4NE2A 1VHTA 3S1AB 4A36A 1XEXA 4Q9KA 4BLPA 2ZETA 5JJLA 4BECA 3CZPA 4HZUA 2IS6A 3K9HA 4G01B 1Z2AA 2BPOA 2QQEA 1SGWA 2XNJA 5DISB 1D2EA 2OXCA 3L43A 2IYTA 3T15A 5C2JB 1E2DA 2AXPA 2JJ8A 4V0LA 1W36B 5JRZA 1IY2A 1VQ6B 3QI2A 1LS6A 1V43A 2BBOA 1Z28A 4ZGQB 2F6RA 3LX8A 1TF5A 3OZWA 4HDOB 5EUMA 3VR1A 1XTSA 1XPUA 2EFGA 4HLUA 1SHKA 4B35A 3OW2B 1GVNB 1YRBA 4EPTA 4C9BA 5J4KA 3EZ7A 4Q1AA 3DKPA 3EC1A 1J70A 2CCKA 1E2KA 3AF2A 3OZVA 1G7SA 3SR0A 5GV8A 1YRAA 2W6JA 2OG2A 1MO4A 1S3GA 2C8VA 1W5SA 4MYCA 2HYIC 2AWNA 4MRRA 4D26A 4D25A 2A5FA 2XZPA 2EYQA 3AGPA 2OILA 2ZI3A 1N6KA 1XMJA 5KNBA 2WZQA 1NI3A 1T5IA 4TMWA 1D5CA 1T9HA 2CL0X 2DFTA 3WP0A 2JDIA 1OFIA 1BMFD 4TT3D 1OB5A 1XD8A 3MD0A 1F3OA 2NO1A 5FTLA 1YR7A 1XMVA 3VR5A 2WSSA 3RLFA 4Z1MD 3N2IA 5F9FA 4MDEA 2BC9A 4JBWA 3TW4A 4BFXA 2BMEA 2ZU0C 1GZSA 3THOA 5K8IA 1XB2A 3P26A 1SVLA 3QVUA 3PEYA 3TGPA 3GEEA 1KQSB 1NKSA 3CR8A 4A2WA 5DIFA 3ZZUA 3M1IA 1Z0KA 4QJ3A 3T1TA 2O5VA 2WJGA 4HE6A 1W87A 4TTRA 5GADl 4LBWA 2WWXA 1MO5A 3I32A 2WMNB 2VP6A 2Z4RA 4PPFA 1JR3E 2BKEA 4L16A 1UJ2A 2HYDA 4LDJA 2J0UA 3RS3A 4HSEA 2VSFA 2N1BA 1EX7A 2GRJA 4RD2A 3M6AA 4TYQA 1DO2A 4URWR 1HEIA 2HLDD 1QVFB 3GEIA 3BE4A 4Q9IA 1EFRA 1JXOA 3H2YA 3NWJA 4K1XA 3RRZA 3TUIC 4D0GA 3GLGA 5AJYA 3WBJA 5FFMA 4JVNA 2VNHA 4F7WA 4MKHA 1SQ5A 2VRWA 1CBUA 2VYQA 1VQ9B 4LYAA 2RHMA 4KYUA 1AQUA 4ACBA 1GP2A 2CLDX 3FJOA 1E32A 2OCBA 2WJYA 2QBYB 1Z63A 1S9DA 3TR5A 2ZJ2A 4BGDA 2BVNA 2WHXA 2WPDA 1Z0DA 2NO9A 2R6AA 4HI0E 1OYWA 4PSKA 3RS7A 2ZQ5A 1A2BA 3VKHA 4QBGB 4WA7A 3FHCB 1R4AA 1P9WA 1Y63A 3ZGXA 2BBSA 3VFDA 4Q01A 1H8EA 1E1RD 1F60A 2IBMA 3JVVA 1KSGA 2EWVA 2E9SA 4NYIQ 3DKVA 5TMPA 2A78A 3CX6A 4AYTA 3TSZA 1ZM9A 2NMVA 4G1UC 4N0EA 5DGXA 2REBA 4UNSA 5J47A 5JSZA 5FUXA 3B1YA 4QG7A 1I2DA 1R8SA 3RS5A 1QHGA 4AK9A 4D4MA 4B74A 1NG9A 3L0SA 2HJVA 5HKKD 1TQ6A 4FWIB 5FR2A 2P6RA 4XJXA 1YR9A 1Q44A 3J81k 2QAGC 3UWOA 2C99A 1UDXA 1H42A 2D7DA 1G6OA 4KLNA 1C4OA 3GLIA 1CJKC 4OKSA 3P1JA 1OKKD 1XXHE 2X2EA 4KVGA 1UKVY 2KSQA 2ZSDA 2HJGA 4GMDA 4PTLA 3A6PC 5CJPA 4EJSA 1W2GA 2RGCA 4BLOA 1JB9A 5AJWA 4Q4AB 5E95A 4QKQA 1Z6TA 1AKYA 4WQMA 1OFUX 4LYFA 3IPYA 1CJMA 4M1WA 3WBKA 2GEDA 4XVUA 4JVLA 1KK2A 1DELA 1E2QA 4PC1A 2EFEB 2ZRDA 4G5OA 2ZRFA 4EQ6B 3I72A 5JWHA 3H4MA 5F9HA 2XEXA 3T06B 4Q47A 3L0PA 4PPGA 4D6PA 1T6NA 4UXIA 2DETA 3NXSA 4TN1A 1JAIA 2QA5A 5CK4A 3W2FA 1WDTA 1NBME 1NVUQ 2AD1A 2G0NA 2K5UA 2QEQA 2QNRA 3GPLA 1FPMA 3ASZA 2IS2A 1NRJB 3PQCA 1Z0IA 3CC2B 2QU8A 3IHWA 3GCGA 1IQPA 3LBNA 4BUJA 3BFKA 3UPUA 2QP4A 1XTJA 3LXXA 4DDTA 3AVXA 1E0JA 3FPAA 3SBDA 2ZRCA 3LLUA 3U3JA 3WHKA 3AF4A 3O47A 2Q0HA 3SE0A 1WRBA 3KB1A 4ZV4A 3GJ8A 2J0SA 3UMFA 4MUBA 5G3YA 1N0VC 1P73A 3CNLA 2YOGA 3A1WA 3W2IA 1RYHA 4G1BA 1E0SA 4BEJA 4EKDA 4HAYA 2NZ8A 4W7SA 4D4JA 1E79A 1X8JA 2ZXUA 2QMUA 1R6BX 1H8ED 3U6BA 4FMDF 3DO6A 3KFVA 1G20E 1MH1A 1G19A 1NLYA 1ZC3A 2VP0A 4LJAA 3HU2A 5FBWB 4DIDA 2GTPA 4AG5A 5J4VA 1I2MA 5DO9A 4A6PA 1K8RA 2PJZA 2QPOA 2XOKA 3TRFA 3OJXA 4BQSA 3MUFA 3A1SA 3KQKA 521PA 4C0KA 5C1BA 2AWOA 4FMDB 2BF4A 5EE9A 1E9SA 4OQXA 2F43B 5BXQC 3LBIA 1A4RA 1QHNA 4XTRA 1P6XA 4Z51A 3TIFA 4QGHA 1ZNXA 2YWEA 1VG1A 5DLQC 5TB5A 5EP1A 3TVDA 3K8YA 1U0HC 4Z8XA 1SKQA 2BMDA 3IIKA 3PUYA 2QM8A 3BS4A 4PR0A 4K81B 3U3OA 4A8JB 4BFVA 4DCNA 2FX3A 1NN1A 2AD5A 1GNQA 1E63A 1GUAA 3E70C 3S1AA 1Z0FA 2WAYA 4DSOA 2RGGA 2IWHA 1NJFA 2O8DA 4YDSA 1DS6A 5GJWC 3CX7A 5KHOC 4A0GA 5IDVA 2J3EA 1OSNA 2G1KA 2OLJA 4Q1BA 5FTMA 4C7OB 3PVSA 3REGA 1OPXA 4GDFA 3BFVA 3QPVA 3WP1B 4CEIA 3N70A 1P62B 2PEYA 1YZGA 2WM9B 2ZS8A 2CVHA 3BAFA 4OI4A 1HTWA 2XJ9A 1XCGB 2REXB 4DZZA 4PX9A 1VQKB 3CR7A 1E2LA 4LJ8A 3T61A 3DZ8A 3CC4B 1DBSA 4HLCA 4R2HA 3B78A 4HYYA 2B8TA 1BYIA 4B2LA 1CULC 1E79D 2XTNA 4FXPA 4ASUA 4CT4B 2ASEA 1YJ9B 1S8FA 3REFA 2ZR9A 2WWYA 2GZDA 4V03A 4B44A 1W4BA 5LPNA 3WXMA 3CCSB 4Q02A 2IA5A 5FI1B 3NBFA 3MHPA 4DXAA 4NL4H 1X8LA 3JQQA 4UXJA 4C4PA 4CDGA 4QOSA 2HT6A 2ZR7A 4Q19A 3CCJB 1N6LA 1XU4A 1BJKA 4DT1A 4DSUA 2CNWD 2ZI7A 1I4DD 3E1YE 3SJAA 1ESMA 4P6VF 2QA4B 2YINC 4BFZA 4PGOA 4OQNA 4D4KA 4DB4A 2YHSA 1Z8FA 3CNOA 5AUPB 1FTSA 1X3SA 3K0SA 4RZUA 4YMWA 2D7CA 3WYGA 4AKHA 221PA 2C9YA 5J5CA 3BC1A 2VP2A 4LSGA 4PZYA 5CDFA 4B6EA 4B3DA 5K8UA 1EWQA 3WMFA 1OHHA 1E64A 5G40A 4HB4A 1QRAA 3AP1A 3RC8A 4Y0AA 3H86A 2QTLA 4LJYA 2N46A 3T1OA 3RRYA 4NCIA 2HCBA 4OQFA 1U99A 2BV3A 4HDQB 3RS2A 4Q4HB 1JXMA 4LPSA 2QQ0A 2F1JA 3FMIA 1W35A 4PPNA 4RD3A 3BJIC 3AKYA 1R8QA 3NBXX 4RSGA 4US1R 4DJTA 1JPJA 4GT1A 3UG6A 4KFSA 3DEFA 4PC3A 2AX4A 4JT2A 4A4DA 1BS1A 1FQJA 2GA8A 1KMHB 4C0JA 1DARA 4LPKA 5DI3A 4LHYA 1OJLA 3SDZA 4II7A 3U7FB 1S4QA 4YAWA 5TR9A 3G5UA 1QVAA 1WQ1R 2QBYA 3KXLA 4B3FX 2ZIAA 4P4UA 2O8EB 3K9NA 1UBCA 4B34A 2DWQA 4BLQA 1M34E 1FRNA 4OI2A 1FNMA 3R20A 4XIGS 2ANBA 3KX2A 4EAQA 2XSZA 1E4YA 1BH2A 1P9NA 4I1UA 2QM7A 1KOFA 3JVUA 3P32A 2MSEB 3KJHA 4ASUD 2BMFA 4LHWA 5KSOA 1Q12A 3X1ZA 2YWFA 1QUFA 1MRNA 5GJCA 2H1LA 4RFVA 2WIAA 3DDCA 1JPNA 3P27A 2X77A 4DDVA 4GPTA 3L2OB 5E3HA 3CWQA 1WBBA 2RKOA 4YAFA 5EZ6B 3QBTA 1FUUA 1XMIA 3W2EA 1D8TA 1G7TA 3CUEF 3PEVA 1Z3IX 1G41A 2G88A 1AN0A 3CWZA 4AC9A 4QJ5A 3ICQB 2LKCA 1LFDB 5H59A 2C5LA 2GBLC 3LLMA 4MKFA 721PA 2P3SA 2BMWA 1ZINA 1E3MA 2R65A 4NYJQ 4Q4AA 4R7ZA 2RGDA 4UAJA 2XITA 2VNJA 4KV9A 3U60B 3V76A 2KWIA 1X8KA 2IXFA 4I81A 1L8QA 2XTMA 3QFCA 2PJRA 2W0MA 4EQ6A 2BM0A 5SZIA 1UBEA 4BFSA 1RFLA 4F7DA 2OM2A 3U3KA 4XOIA 1WMSA 3ETLA 2QN6A 3TH5A 3K9LA 1YQTA 4M9ZA 2WWIA 3GQBA 1U0LA 4BWYA 4TMZA 2ZUBA 4ACAA 3MWKA 2WV9A 2JJ2D 2W00A 3OIWA 5EP2A 1WCV1 2FNAA 4RZ2A 1W34A 4LJ5A 5EE0A 2WOOA 4LI0A 1XZPA 3AQ4A 3B1ZA 4EPVA 1KSHA 2QZ4A 4J0QA 5FOTA 4LJ6A 2ZRIA 3FFAA 2MMCA 4BZPA 4AKGA 3CRVA 3T1VA 5FOXA 4YMTA 1UKEA 1CKEA 2EFHB 2YYZA 2HCJB 5FH9A 1RVDA 2ZRPA 5KSZA 4IVRA 2XSZD 4P32A 4JS0A 3UATA 1QHSA 4O2RA 4JLVA 1Q21A 1OFHA 1A8PA 1Z6GA 1QBKC 4KFUA 2IK8A 1NVVR 2ONJA 4EPYA 3AV0B 3MSXA 2CHVA 3CX8A 1P2UA 3AKCA 3QKRA 1CXZA 1QG2A 1SVKA 1YZNA 4PAOA 4Q1FA 2ZRAA 1W0KA 2CNDA 4I1VA 3PUVA 2NOAA 4BFTA 2L0XA 4Q1EA 2WKRA 4ZI2A 4OI1A 2QRZA 2BMJA 3R9XA 2F43A 2QAGB 2J1LA 2C04A 3LQRA 2GZAA 1VCIA 2GF0A 4MGIR 4NCHA 1E9BA 3K09A 3QF7A 4RFSB 4M1SA 1ZNZA 2BCJQ 2ZANA 2OV2A 2JLQA 4YAOA 2OLKA 3ND9A 1AZTA 2JGNA 4A8JA 2GJSA 3ZVLA 2ODWA 3EG5A 3RANA 3FMFA 3QG1A 4MYUA 3K53A 5HZHA 2OSBA 1Z07A 1G5PA 4RZXA 1L4UA 1XTQA 2HXYA 3IBGA 4XSGA 3R9WA 5GJVC 5CJ2A 1TTTA 1JALA 1P72A 4CGZA 3I55B 5B57C 2D2FA 4G5SA 3DPUA 4MH0R 4UNQA 2IYQA 3AVPA 1G8FA 1G5RA 2H92A 3GLHE 5FOUA 821PA 1BO6A 1E2EA 3GJ6A 4IDOA 1NLFA 4JLNA 5D3QA 1DAMA 4UNNA 4C7OA 1F6BA 3QEOA 4JLJA 4TLEA 3P4YA 1QG4A 1E9CA 2ZRLA 1M7HA 2NO0A 4IEIA 4LRWA 5E4FA 4LV5B 3ZVNA 1E9DA 3U6KA 3THXB 2QPTA 2YC4C 4CF7A 1M74A 3EWAA 3Q9LA 2A2ZA 1IN8A 3NHAA 2Z5FA 4YQFA 2EYUA 1Q3TA 1EFTA 2AXNA 3FHTA 1JAHA 4QRHA 1TEVA 5KSPA 2D74A 1CIPA 2GXSA 3CNNA 3LRPA 4B48A 1XPRA 3BH7A 4U9UA 3GLIE 1S1MA 3T34A 3CW2A 3V9PA 3U5ZB 3W9YA 2HXSA 4LHXA 1Y3AA 4LBZA 2R6CA 5KYKA 1ZAKA 1TVCA 5CIWA 1W0JA 3TKLA 1UDWA 5AJVB 5BN4A 4IFEA 4XVRA 2WKPA 5H68A 1G3QA 3SYLA 1Z22A 4ZCMA 1M8PA 2VLIA 4U00A 3KB2A 2GK7A 3U7EB 1XCPA 1BQEA 2RGNC 2W6ID 2PBRA 2D4HA 2KB0A 3EARA 3SI7A 3B82A 3TQFA 4UJ5A 4B3CA 3K70C 3EXAA 1T4GA 3BXZA 1M7BA 1OGIA 4TYWA 1DAIA 1CNFA 5HCIA 1KGDA 3IQWA 2BSAA 4Q7MB 3ZZ0A 2WSMA 5HE8A 2JLYA 4JLPA 5BYKA 5A5GA 3RRMA 3I62A 4JLOA 2R8RA 3T12A 1VG9B 4PHFA 5L3QB 3CH5A 4XD7A 3W8NA 1TX4B 4ZDIA 5BN5A 3ADCA 4KFRA 1E2MA 2ZRKA 4TL6A 2GXAA 2XB4A 1VQ8B 1N6IA 2B5OA 1SKYE 1VIYA 2CL7X 3GJ0A 4Q4HA 1JA0A 3FKSA 4CW7A 4QL3A 4O3MA 1FNCA 2W2VA 3BB1A 1GM5A 3VKGA 2V6JA 1NVWQ 4RCZA 3EX7C 1K73D 2Q3FA 2QRNA 1DE0A 3SJZA 1QVGB 3PFIA 4CEHB 2F1IA 2QTHA 1S0UA 3DM9B 2ZS7A 1KMHA 2GZHA 2VQSA 3I5YA 2J87A 4WZAE 1VCNA 3K0CC 5HE9A 3KKOA 3T1QA 1RW4A 1S96A 2AL7A 3IDQA 1YKSA 2V7QD 2O8EA 2CE2X 4AY2A 1CF4A 1W4CA 1PLKA 1ZMXA 3AVOA 2FFHA 3KZ1E 2O8DB 1XJQA 5KPJA 1JI0A 5L8VA 1M1KD 5EE1A 1EX6A 3WYFA 4M22A 1BYUA 1D6JA 1KD1D 4MGZR 4Q1CA 4OHZA 3AVTA 1R2QA 1ZBDA 3FYHA 4B6FA 1G6HA 1NJID 1KO7A 1OXUA 1FDRA 2FEMA 2JCSA 4CEIB 4IDQA 4PAMA 1NSFA 1I4LD 3F8TA 1GWNA 1U0JA 2WMOB 4JL6A 2H7VA 3A4LA 2DY1A 4OHXA 1W0JD 4DLRA 4DKXA 3CCQB 1Q3HA 2QORA 2VNKA 2B8WA 2C96A 2F9MA 4TMXA 2I1VB 1GAJA 2OEPA 4WAUA 1DDGA 4UKDA 4S2EA 2Q9AA 1N5LA 3IQXA 3QE2A 4P33A 3SEAA 3TJZA 2QUZA 3AKDA 5AUOB 4RD0A 2AHOA 1SVOA 2BN4A 4WZBE 1OGJA 4C0QC 2DWOA 1T0HB 1A5TA 4JBYA 4PHTA 2JIZA 1JJVA 1KI7A 4F4CA 4KXFB 1YZUA 5AK0A 4DT1B 2VNIA 1EG7A 2WIBA 2H16A 1KIMA 4X8HA 2REOA 3A4MA 3EIHA 1KDTA 3PEWA 4QFMA 1HURA 2OESA 1A2KC 3DHWC 3FKSD 3I4LA 5D3MB 5DYIA 1TU4A 1RRGA 5FUVA 1X1RA 2ZJYA 3QF4A 1U81A 3EZ9A 2OZEA 3ZVMA 4U02A 1WE2A 1KHTA 1GKYA 1MR3F 1MABB 1T8UA 1TADA 5IK2A 5SZHB 2OE2A 4DIEA 2BOVA 3LVQE 3WMEA 3MGCA 4MYTA 1KI4A 1E0AA 2IUSA 4TTPA 3SYNA 2IX3A 3X1DA 4IDHA 3TMKA 4LC1A 5AUNB 1VQPB 2R6GA 3EPLA 3U61B 2ZE8A 2GNOA 1G16A 3QXXA 4LY6A 2PX0A 1II9A 3KUDA 1IHUA 4EFLA 1EP1B 3UANA 3NC1C 4FMCF 3U2QA 3W34A 1KI3A 1V5WA 1DADA 5DI3B 3RSOA 3BERA 3SHFA 5KOYA 2OK8A 4ILEA 2DEUA 2PT7A 5EE3A 3QXJA 3HU3A 3SS8A 1KDOA 4BLRA 2AFHE 5JMTA 3L8ZA 1KI2A 4PC7A 1M1YE 1NIPA 1UBGA 2MMGA 3HYTA 1ZNWA 4OL0A 1PVOA 2DBYA 3NEYA 4FMCB 4JBXA 4LUCA 4NYMQ 5DHAA 1OW3B 1NVVQ 2PZEA 5A0FA 2QAGA 3TNFA 3N5CA 2W6JD 5BW8A 1N0UA 1W2BB 1NP6A 1T3SA 3PG5A 1CS4C 4OK5A 4LYHA 4ZI3A 2IYZA 4RFSA 3C5CA 4G1VA 1US8B 4WIAA 2BJWA 1S2MA 2LWIA 4HUQB 1Z29A 4PO8A 2PIAA 2OK7A 2JDID 3GLFE 2PLRA 2ZI6A 4OK3A 1II0A 5KPDA 2JIZD 3K0AB 3X1WA 4MKGA 2Z4SA 3HR7A 4CYMA 4AI6A 1Z08A 1QGYA 2H18A 1EFHA 2WSSD 3B1WA 3WYAA 4A1FA 5KU1A 1DG3A 1N8RD 1KZ7B 1QDEA 2VP4A 3HU1A 2GHIA 3LXRA 4P0TA 4DEYA 4NYJR 3AVWA 2ZJAA 2NO6A 4YC7A 1NN0A 1P2SA 2ZRMA 4ZKDA 1XPOA 3CF2A 1VCMA 3GMTA 2FN4A 3DOEA 3D31A 1JA1A 4JIMA 3VU9B 5IK2D 3IO3A 2F3TA 1QFZA 3Q7QA 3KFXA 1FNNA 3FOZA 4B3BA 5DHFA 1IM2A 3THXA 3GD7A 1FMLA 1P2TA 1U98A 3B7GA 5CYOA 3HPRA 3VTKA 4D80A 1E6CA 5EQTA 1Q81D 5FR1A 1AQYA 2ORVA 4MUAA 2ZE7A 5JECA 3ES9A 5EMNA 4KITB 1AK2A 1N6RA 4HAVA 4Q1DA 4AKIA 1D1NA 1P61B 2A5DA 4QJ4A 3SN6A 1EFRD 4X8LA 1NMZA 3SNHA 2VZLA 2IYYA 2ZSEA 4WXPA 4FK8A 4DC9A 4D82A 1CU1A 1W46A 2FU5C 1KDRA 1H85A 1JEEA 2QE7A 2OCAA 3I61A 3PIRA 1WA5A 2CXXA 4AWXA 1FNBA 2X2FA 1QHXA 2OO7A 3BB4A 2VHCA 3FVQA 4JSYA 2R62A 2G9NA 3CH4B 1QUEA 4HEJA 2QY9A 2WPDD 2OFWA 3L82B 2GCNA 4ESHA 2VH5R 1AGPA 2HV8A 2ZE5A 3C15C 3HR8A 4QM7A 2KE5A 4F4JA 1II8B 2GCOB 3A4NA 5AJXA 3F0TA 1DDIA 3I1FA 3HJNA 4PC2A 1YZLA 5AUQA 4P31A 2GJKA 1RRPA 5FBRB 4JT4A 4AYXA 2XXAB 3WNBA 1LF0A 4B33A 5K8TA 1W1WA 3QKSB 4X8MA 1B23P 2MSCB 2BM1A 2YWHA 1Z6AA 3P20A 4V02A 4D0NA 3NG1A 1U9IC 2VYFA 1XTRA 5TV2A 3D8BA 4QM6A 1D9XA 1T3LA 2WWGA 5C4GB 3QKRB 1OH6A 2ODBA 5L3QA 3X1YA 2ZSFA 2GAOA 1DAFA 4BLSA 4HLQB 2QAJA 1ZM3A 5IT5A 1FW6A 4JSTA 4NZYA 5F98A 2DCUA 1R0YA 2BCGY 1WBDA 4NMMA 4C0AC 1XTIA 1E69A 5C4MA 1KY2A 3MWJA 1PLJA 3MJRA 3OEEA 2F55A 5ELXA 2IXEA 4QBHA 4TSFA 4XH9B 2QG6A 3CPEA 4BASA 4CEHA 3LW8A 3FDIA 1VQNB 2ORIA 4XTCS 5DN6A 4WOPA 5JI2E 1CR2A 2ZJ8A 2IUUA 3MWLA 2A5YB 3B60A 4I1SA 3G4SB 3UK6A 4DCSA 3LFUA 4RJLA 4YALA 3PCRB 2ATXA 3OEHA 4B71A 2PMKA 4MITA 4WBSA 3QE0A 4JMPA 1VQ7B 2VHJA 4RY2A 3KQLA 1YIJB 5FL3A 4BRWA 2QPAA 3ZD7A 1JQJC 3KKNA 1CR4A 4NU0A 2NO7A 3H1TA 2GXQA 2EFDB 4ABYA 3ZQ6A 2GJ8A 2R2AA 4RKFA 5BYJA 1ZVQA 1JECA 2QE7D 1WP9A 2Q21A 3D3QA 3GFTA 4Q9HA 4KLZA 3CCRB 3ZYCA 2XNCA 2B6HA 3BIFA 4DUGA 4Q4JB 2F1HA 4LV8B 4LHVA 1ESNA 4I1OA 4KJZA 1GITA 2I4IA 5IF9A 5KSWB 3ZDQA 3ICEA 1KJZA 4IKEA 1VHLA 2BEJA 3UWKA 1CQXA 2F7SA 2DERA 4NP6A 3AUYA 3KKMA 4KODA 4BPBA 3IHLA 4V0ME 1M7GA 1KK3A 2GK6A 4MQBA 3KJGA 3LA6A 4A0RA 3K70B 2DYKA 3EZ6A 3CBQA 1H8HA 1GL6A 2VEDA 3CRQA 3ZJYA 2X3UA 1OXXK 1YVDA 1DAHA 2O52A 5FUYA 4EFMA 2OAQ1 4GBMA 4KAXA 2SHKA 5B64A 2XOKD 1VG0B 4D81A 2CCGA 4CEJB 3MJHA 3QPUA 4YXWA 1AMOA 1Z2CA 4JL5A 3CF0A 4QNRA 4E09A 4OJQA 2ZAMA 2V1XA 5AJZA 2V55B 5EXXA 4GOKA 4M9QA 1TQ4A 3QFTA 1NMXA 4ARZB 1TEXA 2WJIA 5JHGB 1SXJB 5D3MA 3B1XA 4PC6A 2AK2A 2QSZA 4A9AA 1G17A 1EWYA 3Q8XB 2UZIR 4TSFD 3OHMA 1L2TA 2DWPA 2PZFA 3CMEB 1MABA 2ZTSA 4Q9JA 3RRNA 4YMUA 2FGKA 5F3WB 2AKAB 4JJZA 4ZDKA 1FMJA 2FE4A 2ZRNA 1R0WA 3BD9A 4IFBA 4DQLA 1RRCA 1LW7A 2YZ2A 1CP2A 3F3YA 2XB2A 5KNDA 4PXAA 2YJTD 4PPQA 4PSAA 1YJWB 3OEHD 4G5RA 1XD2B 2FWRA 4B47A 421PA 3BFXA 1PZNA 1IAQA 3BH0A 1Q1BA 3VR6A 1A1VA 3ZC3A 4PHGA 4FCTA 2BWJA 1J8YF 2ANCA 4MDFA 4N1AA 3OZXA 5JRJA 1G21E 1E9EA 3VAAA 2ZM5A 1W36D 2WJHA 1CLUA 1XFAA 1VECA 1YJ5A 3SFVA 1OB2A 2C95A 2J0VA 2Q9BA 3KUCA 5FOWA 5J4LA 4IJMA 4O0MA 5LD2C 3TAUA 1GKIA 2ATVA 3PR1A 4TQAA 1EP3B 1VMAA 1S1CA 5LB4A 4QHYA 3NC0C 4ZGNB 4Y9RA 5SZKB 2QENA 4YMVA 1ZP6A 4Q7JB 4UXHA 2ZEJA 3UMRA 3IGFA 3E20A 3SQWA 1P2VA 2JLSA 3W3ZB 4W9MC 2ZJBA 1F2UB 1A82A 2GETA 3VMFA 4BE7B 2FGJA 2FEOA 2OBNA 3SZRA 2HMAA 4B75A 1OLOA 4AURA 1D2NA 3GJ4A 4F38A 2ZE6A 1ZRHA 3A58B 2GBLA 3AUXA 1US8A 4NCKA 3RSLA 3P4XA 4HUQA 2B7BA 5FPTA 4BEBA 1QVRA 2FH5B 3QJYA 1MRSA 1KMQA 5G41A 4X8OA 1GILA 4M4SA 3ND8A 4B3XA 3K0AA 4TYPA 3R8FA 5JJIA 3ZQJA 3IEVA 4DQKA 3AP2A 5JEDA 1Q1ZA 4FI3C 2BGJA 1T8TA 1SVMA 1Q0UA 4BZQA 1HE1C 1GIAA 3DMDA 1UF9A 5EP4A 1Z0AA 1NN3A 1TNDA 1QFYA 2NPFA 4HAWA 3LW7A 1KAOA 4AG6A 3EPJA 3QOFA 4YHBA 4E03A 3VO2A 1MKYA 1W48A 2ERXA 3EAQA 3FKQA 4AIIA 3TVTA 3W90A 3DVLA 3THWB 3TLXA 2AR7A 4GZLA 3VU9A 2OCPA 2BHRA 4P4SB 3JZAA 2ZRGA 4GOXA 1CJVC 1OHHD 2BIFA 4IOJA 3WHLA 1JR6A 3CPJB 3C4JA 4OK6A 5JI3E 1M2OB 3Q72A 5EJEA 2IYSA 3NH6A 1W49A 2CLCX 2EFCB 2IEYA 2QTFA 1M90D 3OE7A 3SYKA 2ZI9A 4DDUA 1GR1A 2Y8EA 4HATA 4HE5A 4MKIA 2RC5A 2ZROA 3THYB 2WWFA 2BKUA 3TUJC 1EXMA 3QF4B 5HPYB 1C9KA 3DOFA 2PZGA 2ZYUX 4XSHA 3Q5EA 1EP2B 2PMDA 2J9RA 2Q6TA 2VHQA 3BWDD 4I4LA 1O87A 4H1UA 1D9ZA 3RYTC 3W8RA 1Z06A 2P65A 2WKQA 3RAPR 2O8FB 4ZCIA 1HE8B 1JQLB 1KNQA 2QEXB 1DVRA 3KTAB 1VQMB 1J9ZA 1IN6A 2RAPA 2PEZA 2ODNA 2XX3A 1II8A 2GCOA 4TQ9A 4TL7A 5B2ZA 1XNJA 3A37A 2W2TA 1NDHA 2C9OA 3PENA 5B30A 2Z83A 3GEHA 3I8SA 3OAAA 1UM8A 2XXAA 4DCUA 2H5EA 4BRUA 1UEIA 2V4ZA 3QKSA 2G77B 3LO5A 4NYMR 3ZH9B 3QNUA 2WTUA 1NL3A 1TQDA 4C0HA 5JFGA 1IXZA 1SULA 4WZ6A 2CBZA 5FPYA 4JLKA 4ZCLA 3IILA 4L9SA 4A0HA 5JS8A 5L3SA 4GRAA 4D2IA 2VL7A 4DWJA 2D3WA 3N2EA 4R71A 5JWRA 2XGJA 5CM8B 1UAAA 4R2IA 3K9GA 1I4TD 5JS7A 3GLGE 3QFSA 4WVFA 1OE0A 2EQBA 4US0R 3EA5A 3QKUA 3H84A 1E2HA 2A7QA 2FSGA 1AIPA 2BGIA 1ZU4A 1F2TB 1UPTA 5H5JA 5JWOA 2WICA 2D62A 2YOHA 3CCMB 1KI1A 3EW9A 3E2IA 1TPZA 3GLHB 4GOJA 3WNDA 2ZUCA 1KDPA 2P6UA 1VG8A 3IUYA 4Q7KA 4ZIRB 5SZJA 1XDBA 3DZDA 2BBTA 4L8GA 2EWWA 2IYVA 4LGMA 4LCBA 3T5GA 3QEJA 2RC6A 2ZI5A 1E98A 4W5HA 4U7DA 4LWZA 1NF3A 4URXR 4TYNA 3A8TA 2IC5A 2J0QA 3LVRE 5BQ5A 1XCMA 2CLSA 2GEVA 3R8CA 4NCJA 2HUPA 3ECCA 4U5XA 2DB3A 3AEZA 4DLUA 3ASYA 3OF5A 4NCNA 3QFRA 4GMXA 1FRQA 1TAGA 4DLSA 1ZM4A 1J99A 3FE2A 4Q4JA
chains in the Genus database with same CATH superfamily
3DM5A 2ZOSA 1CCWA 1R50A 1YA6A 4UHEA 4O63O 5A88A 3W8FA 2ZSBA 4R2MA 4BVHA 4UPEA 3P0FA 1MHTA 1XHFA 1SR8A 1J8MF 3NEAA 3QLTA 4L27A 3G79A 3KJXA 4RVDA 1FTGA 3NUZA 1DB3A 1YI0A 5CFRA 4FINA 3WK9A 4HXYA 1QLHA 5TMEA 2ZSJA 1AKEA 2G6BA 2HCRA 4GNKA 5E9JA 2OOKA 5MHTA 1TC2A 2CBGA 2J59A 4E6PA 3PLAE 2ZRHA 3AUSA 3KVVA 1H4TA 2A88A 4IVQA 4FB4A 2W2XA 5ITWA 4OX9B 3LDGA 5J4YA 3FNIA 2JLVA 1W4RA 2XYPA 3PDIA 1TYEB 3GLKA 1KEKA 2OCYC 1XL1A 1QP8A 2PV7A 3N76A 4JLAA 2IOQA 2PUJA 1XAIA 1RI4A 1VMEA 2RGXA 3BE5A 2ONYA 3CZAA 3QV2A 4P7KA 3CEHA 3N28A 4TM7A 1FP7A 4LOJA 1ABEA 5LU9A 4CEJA 3BG5A 4EITA 3GFOA 4H27A 1VRWA 3EIQA 3O84A 1UWKA 3GX1A 3L7DA 4BCBA 3HBAA 4C3ZA 4RDKA 4GLJA 4O6VA 2X8JB 2NGRA 4QV2A 5J35A 2GWHA 2WILA 2YJGA 3NVAA 1C30A 3R3SA 4IO0A 3VNQA 1I1HA 4KQIA 5TARA 4FEYA 3SQMA 1J5EB 2IEZA 3B6MA 3DH0A 3NKVA 2IXGA 4ARZA 4P53A 1YB5A 3ND6A 3ORHA 4HAZA 1X7GA 2VPPA 1SHJA 1PL7A 1YR3A 2XVXA 4YAUA 1J2TA 5LNK1 3OTGA 2FQ1A 3IDFA 5AK3A 1P0QA 1N25A 4S1NA 5GVSA 3ZU2A 3QOYA 1V5FA 3O4FA 3KQUA 1E7WA 2RE8A 1BDHA 4IEEA 4LRTB 3RKUA 1VL8A 1YDEA 1N5MA 2A57A 1Q7GA 1JDUA 5DHPA 1JR4A 3AFIA 2NXNA 1LDNA 2V6FA 1ZN8A 2VBUA 4M98A 1XD2A 2OAP1 2IU0A 3SK0A 1SD2A 1X6VA 3LLCA 1TEZA 1I80A 4RJIA 3RHZA 3EISA 3TMAA 4AJKA 2VA8A 4URVR 2Q5QA 1NZFA 4I46A 1KS9A 3VR6H 3LF2A 4MPTA 4L50A 3PGXA 2ZIGA 1XVVA 4R1MA 1E2FA 1GDDA 2RK3A 3NH9A 3TZ6A 1FJXA 1QO0A 1JXAA 1T1JA 2QJFA 2HSJA 2R1VB 2JCYA 4M8LA 4UBMA 3STVA 4B87A 1PL8A 2H4JA 3A1VA 1NNSA 2DKNA 2TMDA 2FJUA 3HPQA 4ARBA 1WSAA 2MDTA 4PO1A 5H4GA 3RC2A 3P9RA 1EVQA 4J0CA 3H2ZA 1YAJA 4MCIA 4OHPA 2CCJA 1R10A 4P3IA 1FX0B 2EZ4A 4NX2A 5B53A 5KC8A 2HRBA 4WY2A 1QP4A 2IDZA 4LBVA 2D5BA 3CRMA 2EBWA 4LSMA 2E4WA 1CUXA 4KPYA 1SVSA 3H5IA 4RMGA 1KAHA 1CY4A 3MS2A 2FMHA 3DKKA 4RHYA 4XWKA 5EFZA 3M9XA 3Q3IA 3E4CA 5JC8A 5L3RA 4FFDA 5I7UA 2AEJA 5ITVA 4C05A 5DNYB 4XWGA 1NC1A 2CEAA 4FGKA 4WBNF 3QEBZ 2JGKA 5HJ7A 4RDXA 3UWDA 3N8GA 4GI1A 1FLNA 1V2GA 2ZBFA 2AW3A 2HZ7A 1EWRA 4URZR 4A1OA 3DNFA 3N3BC 5ENZA 3O93A 4XASA 2ZU6A 1P75A 3CF6R 3HDYA 4XRRA 3JWPA 1ADFA 4ZAYA 2JHAA 4H1WA 2DFKB 4WZBB 1BD4A 1LBTA 1ZD8A 2C5FA 4O25A 1XV5A 1SHTX 1KL7A 2ON6A 4BNDA 3FTQA 4YBZA 4WBNB 5TJ9A 5K0BA 3HNOA 2VWHA 4HVLA 3OO1A 1VLJA 4LDPA 5F12A 1CUHA 3M9LA 4Z5XA 4CLXA 1NF9A 2BTOA 2JI9A 4NKRA 3THWA 1YWGO 1A77A 4TTAA 1U1CA 2Z8YA 2B82A 4FYKA 1EVIA 2H8KA 4G5GA 4E2ZA 1ECPA 1KKLA 4I66A 5CUQA 2VSOA 4LTDA 3W4KA 4X06A 4XD7D 4RPBA 1A9XA 4B5KA 1EPUA 4F92B 4J1TA 1L9XA 1J39A 4JB8A 3N53A 3O0DA 4CF3A 2IH5A 2JS7A 4MHTA 1QNFA 1V0EA 1R0ZA 1ZN7A 3SSMA 4ERNA 5K8VA 1IM5A 3AHDA 2FSIA 2X85A 5K4GA 3G2MA 5ISMA 4OP3A 2O50A 5HUJA 3FPKA 1YIAA 3MS4A 3GFPA 4BPRA 3RVNA 4QVIA 4K0RA 2I2DA 4L8JA 2IQIA 4BO2A 5JH7A 1G291 4YMSA 4R98A 4HB2A 1Z26A 2A8YA 2ZJ5A 1QO0D 1SXIA 5D5HA 3RHFA 4DZTA 3R0QA 1IN4A 1HDOA 1HGXA 2XKBA 7ABPA 3BMOA 3WWYA 5LD2B 2BUBA 4TRNA 3VTAA 1TCUA 5L46A 1CS0B 4RMJA 4BKOA 1LW6E 1TYBE 3OHPA 1S9HA 3FPSA 2MSDB 1C9EA 4JUIA 4AWAA 5JALA 1E2BA 1L8XA 1OKKA 1V0JA 4WZLA 4NBSA 5E3IA 2CFCA 1RJ9B 2PKQP 4C7BA 4F93B 2HNKA 1FSGA 1QHYA 1Z45A 5C1PA 1KSFX 1JLRA 2HW8A 1TO6A 3H17A 2GFIA 2KBFA 3VU3A 5AD1A 2QTZA 1TM3E 4F72A 2GF9A 2VDNB 3CKYA 3H6GA 2GD1O 1UUFA 3EPHA 3HZOA 3DDYA 4L9WA 1RQLA 4XM3A 1F6WA 1C29B 2JGEA 2X6YA 3KJEA 2H0RA 2NUAA 4Z9BA 3VNRA 4CWAA 3REQA 4QTYA 4YV0A 4OI0A 4U7GA 5KINB 5J2UA 3AEQA 4MQFB 2A5JA 3W2GA 3GDFA 1LFAA 4W99A 3FSGD 2XVZA 3NTLA 5CIQA 5GINE 1OH5A 5NLLA 3ZDFA 2E4AA 2WFAA 1KFBB 2JFOA 2OCIA 1W4AA 4NJMB 4J0IA 5CCDA 1RZ3A 2FR0A 3AUUA 2ISCA 5JJKA 1EGAA 5E9QA 4EY3A 3DTVB 3PJRA 1VOTA 4PG4A 5KTSA 2R11A 5EMMA 4V1CI 2W8BB 1M0SA 5AKEA 5F5NA 5DEOA 5IM4A 1AQLA 1E2JA 1EWVA 3BB3A 1VFNA 2YQ5A 4MWTA 3AF5A 1VDZA 4NHOA 3IO5A 5EG5A 5CJJA 1PV1A 5CXQA 5I4BA 4JJFA 3LCJA 1JKJB 2NXEA 5GJBA 2PUFA 2XE4A 1I32A 1IBCA 1E3QA 3P71T 5AVUA 1DG1G 4HWRA 4EYKA 4ZIRA 4US2R 1PZXA 1S3SA 1XTPA 1R6DA 2AMFA 1B8OA 3DWEX 2QMEA 4NDNE 5AQEA 3VC1A 2NG1A 2R8BA 1EK0A 2BGRA 3CUYA 3ILSA 3K4PA 3MT9A 3WB9A 3OM0A 4M8IA 1ES9A 1J0DA 1CR0A 4EW1A 2AKYA 3LKVA 3ZU5A 2EIXA 2BFEB 3GJ3A 1EZ4A 4EX7A 4V3CA 1G7RA 5HFAA 2OGUA 2R47A 2HREA 2NO5A 4D0LB 4ZHQA 3TN7A 3D0RA 1ZJYA 2XGOA 4NARA 5JCXA 1L1FA 3JZIA 4PXYA 2OR3A 2PIDA 2YMLA 5AVQA 3KWLA 4DM7A 1NY5A 1PDOA 2PH5A 9ATCA 3QP9A 3OURA 3DE5X 3L8GA 1ZW6A 3ICCA 1WTAA 4CM6A 4CYMA 2WD9A 2ZJZA 2G4CA 2DFDA 4F2DA 1C50A 1PWXA 2NVUA 4B2YA 3JVIA 1OF1A 3GRPA 3TYXA 1OBOA 4KVAA 4KRYA 3U7HB 1MC1A 1MGPA 3HJAA 3GRUA 4MMXB 2P6MA 4G41A 4YMHA 2YWGA 1YS6A 4C7MA 4YCCA 2WINI 2QT0A 4JITA 5ALGA 3DDUA 1V41E 4Y2HA 2FPXA 2NVOA 3VH1A 2QLMA 3H2SA 3VO1A 4JJKA 4BNZA 4UTZA 4XN0A 1P2GA 3QYAA 2XCQA 3AH8A 4ND5A 1I3OA 3ELYA 2GDJA 3CKLA 1ZOOA 3RWMB 2BF7A 3RJ5A 1ZD2P 4EELA 5K6RA 1JSXA 4OQZA 4KE6A 3W6PA 4JR2A 5ALFA 2XZLA 1LVGA 4NH4A 1CUSA 1BX1A 4P25A 1MFPA 2G1AA 1KI6A 2FR1A 4IAOA 4OQEA 2VBCA 3HN7A 5B1IA 1HT3A 1WWKA 5B55A 4F0JA 1ABFA 6YASA 4RCVA 5FWDA 4EJSC 2B4KA 5IKOA 3DMNA 1ORDA 2NM0A 1FS5A 4LVUA 1GPDG 4BBPA 1RM3A 3WS7A 3DQQA 5AYVA 2ZBRA 5BSRA 3RODA 3UAYA 3ZHOA 2CWWA 3I56B 2GEBA 3H2HA 4G0XA 1TO1E 3MC1A 1WETA 2DFNA 1QHHA 3I6BA 5FEUA 5TMBA 4AUEA 1VL6A 1CB0A 3H2BA 4I4IA 4FW9A 3T5DA 1H3EA 4RV9A 4HZIA 2BEWA 2I4MA 3UKOA 3P0JA 4LJRA 2FCAA 3AM5A 4JVOA 1WUHS 1WXDA 2WFLA 3MFQA 5THKA 3RIMA 1RLUA 1J7KA 3M6UA 3R0XA 3E9MA 2W7TA 3JYPA 4KBFA 3KKKA 5K09A 1N34B 2VJYA 3C6XA 4IV5A 3D02A 1VDMA 3HCFA 2CJWA 4DA4A 1LD3A 2QYHA 1VFPA 2WWHA 5COAA 4Z0PA 1CEEA 5EIOA 1EE2A 1GGMA 4MIOA 5FPKA 1ORVA 1ZUNB 1GT91 2FRDC 2P1DA 1JHPA 5CPFA 4DJ5X 4QEDA 5SY4A 3QBVA 1XWIA 3TXYA 4LOIA 1ZJ5A 4Z3DA 3TIGA 4RD1A 4XOUA 1USKA 4HJXA 2WZBA 3S8EA 4Y7CA 4YCDA 1QE3A 5JO9A 4PX3A 2G0TA 1TJ5A 4LHZA 1AKRA 4ZCRA 3UGJA 4HQLA 3GJSA 1NLUA 2F8SA 2VPXA 3C3CA 3PD0A 3ROTA 2ID7A 4BX0A 1T4MA 4EGCB 3ADDA 3LVBA 2OBYA 3QUSA 4JXZA 3KKQA 4D99A 3OKXA 4KWTA 3A1TA 1JFRA 1X7HA 3GRYA 5FBHA 1BX0A 5H1YA 1U3UA 4HQKA 4LYDA 4REMA 2XTZA 4HRXA 4EPWA 3T52A 2O7VA 1N5JA 1DAGA 3G2NA 4L0CA 2JFHA 1EVEA 3I2IA 2HT1A 2VDWB 3RRJA 3KJFA 5F7XA 4OXIA 3A0RB 3JQFA 4A6XA 4B2PA 3GP5A 1PR0A 1GNPA 4MP8A 4LJ7A 3NRJA 4WFJA 4BNMA 2G83A 1WXGA 4J9UE 5A3QA 2ZYGA 4EA9A 3EF0A 1CR1A 4JOQA 1GJRA 2NZJA 3H0CA 3GZTB 2Z95A 2VPQA 3DE1X 5CBPA 3OPOA 1YHQB 1M5RA 4NE9A 3REOA 3O4JA 4MAAA 3WYEA 1U7TA 1X86B 2LIPA 1SUSA 1CUGA 1W9HA 1UD4A 2J9YB 2O1WA 3HWX1 1DQRA 1S2LA 4R0NA 3UXMA 2FN3A 4OHUA 4WESA 4JOBA 2XDYA 1KO4A 2Q2OA 1QGED 4HGNA 2Q4TA 4MVJG 1DC5A 5D8DA 4WOBA 3DMFA 3ZGOA 3ANMA 1J0XO 3EOAI 3ESYA 1MW9X 4WKOA 3K0EA 2BHNA 4OYHA 4IXNA 4UOEA 4RJKA 2H1CA 4CUKA 2JPDA 4FYPA 4G8BA 3OIYA 3LKBA 3MD9A 3TVYA 4HGOA 3T9AA 1XNHA 3QLUA 5ES3A 3WI7A 2BUAA 4N6NA 2ZSAA 2PRSA 4M1ZA 2Z6BD 4JJAA 1N57A 2VDKB 1E96A 3ZD6A 1G8GA 4MLPA 4DNOA 3CD6B 2H0AA 1UL1X 4DRZA 4LC0A 3TE6A 2IZ1A 2R6HA 1M2WA 1Z6QA 2UVQA 3PXEA 3FMPB 3TRDA 3NIBA 2IVZA 2AUMA 1WP4A 2VATA 1KRHA 2QROA 2VF7A 4GXRA 4OEHA 4XARA 3RIYA 3C1UA 2WAXA 1DEXA 2B20A 2JIOA 2Q50A 3BH6A 1E8DA 3EDYA 4FMBB 2CFRA 3HRKA 4RDIA 4RTQA 2EHDA 3A8JA 2Q3EA 3H1EA 4LK2A 4LX0A 4L5BA 2R00A 1PTKA 1TMYA 3HYSA 1PSWA 1CY0A 1CV2A 3QTLA 4JB3A 1XTZA 2B21A 3L7YA 4QDTA 2PGAA 1IXRC 1QIHA 3M0EA 1DQZA 5I01A 5F5LA 2F3RA 3ZS9A 4PBRA 3JPWA 3G2KA 4D3ZA 4FIDA 2AFHA 4L08A 1LS1A 2HA3A 5AM1A 4DSTA 4ED9A 4JELA 1R5OA 2AFIE 3T56B 1J09A 4QXPA 1R0XA 4XWWA 2ZZGA 1YU9A 4OGGA 4X20B 2EJBA 2DX7A 2FXIA 3HCRA 4E22A 4RCYA 3GJYA 3T3NA 3IVXA 1PFGA 1P29A 3KYJB 4QT0A 3IKTA 3CC7B 1BDBA 3B5IA 1MB2A 4PQYA 2Y9PB 1BA3A 3TQCA 5BN1A 1JB1A 1UOEA 1IJFA 3TLEA 2GR9A 4GQIA 3CB4A 1W52X 1QB7A 3WBBA 1DIGA 1JMVA 1VLOA 2A9FA 3JQEA 5F9MA 3IP1A 2B34A 4IS3A 2LKDA 3EF1A 4MA0A 2GHQA 4IXMA 3OZFA 4QODA 1PGPA 4RA9A 4QX6A 2WBLC 4LA4A 1IONA 3FPBA 1U5BB 2A67A 2VP5A 2WVHA 1M2EA 1SCUA 3AESA 2H0QA 3LDFA 4TZ6A 5CGQB 3JY6A 3PGMA 5DXFA 5IKPA 2FN8A 5H02A 1UADA 2CZGA 1G3RA 4PQFA 1FFYA 3CMAB 4W7IA 3A8IA 1KE2A 8ATCA 2P2ZA 2FFAA 1P1FA 1IOVA 2W58A 2V5VA 4EHAA 3JSXA 4HWSA 3RFFA 3VKUA 4IDFA 1UH5A 4PXSA 3WWOA 3ZHSA 5KWVA 4FCCA 4DREA 2QVYX 3EDRA 3DOHA 1XXHA 1F12A 4UE6A 4M2LA 4GPZA 5BT9A 4W1RA 4ZVTA 2HA0A 3B13B 4AB1A 1Y9JA 1XJ0A 1XKQA 5DJ5A 3UYLA 1W5TA 3BSYA 1L7VC 1CPYA 3MK31 4NU6A 1PJ4A 3B8HA 3ZVRA 5I5EA 2I9PA 5B3JA 3RSCA 3RJ9A 5LP6A 3PUKA 3QGMA 1T2CA 4I9HA 1Y5NA 4NOJA 5G53C 2XJ4A 3ZDZB 1AH2A 1QX4A 3S2GA 2JI4A 3K6JA 4MEBA 4QBTA 2VUTA 4EMTA 5IZCC 4PGGA 2OFOA 4X92A 1JDZA 4NPHA 3TGWA 4NFSA 1ZYUA 2FPIA 1V1MA 1SAYA 3EEFA 3QE3A 1MIHA 1O6BA 1ZIXA 5HTKA 5HHTA 2NN3C 3BQMB 3K8OE 4WLUA 5KOIA 2Y6VA 1D3AA 4ZPXA 5BR1A 5K0FA 3IAHA 1FU4A 4GMHA 3ZE7A 3B1JA 4CLOB 1QVVA 3HE3A 1OI7A 3RC1A 4JVSB 4E13A 2BE7A 3DHVA 4CTJA 1Z8DA 1Z2OX 4MRPA 4WW0A 4CT5A 1N3BA 3CZ5A 3E9EA 4RZIA 4JJEA 5CNIA 3TL3A 3S2EA 1DIHA 3OPNA 4MRNA 3HG7A 4ECAA 2TMKA 1V5VA 1G3IA 3IEPA 5BYAA 1YX2A 5KVCA 1T2NA 3EA0A 3TGLA 3R6DA 1H2EA 4OHVA 4PFQA 4QXAA 3R44A 2ETVA 1TMGE 2PVCA 3EFHA 1TK2A 2DAPA 1RAEA 5A4KA 1MV5A 4R9SA 2J30A 3IIMA 4QPCA 4QUJA 4Y6RA 4CCSA 2FQYA 3VOSA 1ZNQO 3W6NA 3COJA 3IAAA 2D1QA 1UBNA 3L40A 3DDNA 5FADA 2I1QA 1A50B 2KLBA 4AU1A 4H3HB 3ZS8A 2CDNA 3WMXA 3MFYA 4PS1A 3UFXA 2AYZA 1IY1A 3UAOA 4YJ2A 4JR0A 1SBZA 2X0RA 3ILYA 2O8CB 1ND6A 1P7CA 2PS3A 5JC1A 4TS4A 4EARA 3PKIA 2OYRA 1YZQA 2J45A 1NNEA 3WGZA 2JJ1A 3K31A 3V46A 1CZOA 1Y4DE 3QFHA 3A05A 3OT4A 1ZCBA 5FAXA 4XFKA 5CD9A 2QR2A 3Q39A 1C5KA 1MNAA 1SVWA 2J46A 4DZRA 2JLAA 1HVXA 2PL9A 1P2BA 3M5PA 1L7AA 5AHWA 5DGTA 1F4LA 5EEHA 1EAYA 5E7IA 1T0IA 1PNTA 4CVNA 3O38A 2C5EA 3QX8A 4GLLA 4OG2A 3GLGB 5JAOA 3SX0A 1VHOA 2BP7A 2CDCA 1GZ4A 2CXQA 3CLTD 3TZEA 2IS4A 2RBEA 3UIEA 1LB1B 1TQ2A 3RYFA 1J1UA 1W5BA 1VQLB 1JKMA 2CHUA 1KH1A 2V7EA 2WG0A 3G8CA 3IE0A 3M1AA 3N75A 4JZYA 1T5SA 1M6VB 2BGLA 3BJMA 4JYCA 4WUTA 4GOMD 2V58A 1E2NA 2VSYA 2GCPA 2PMWB 4HY3A 3OHSX 5B6PA 3OSZA 3D9QX 4NYIR 4B8WA 5JVDA 5LDHA 3K6SA 4WOCA 1ENOA 2JARA 5M04A 1X1AA 4NE7A 2XODA 5T4BA 2W6IA 3UKJA 3IHTA 4IEFB 3UAGA 4DJAA 4S04A 3B9RA 2QN9A 4NZMA 3UWPA 3M82A 3T3DA 3OO0A 3D2CA 4UQOA 1E94E 5LR6A 4LKOA 3MJVA 2C00A 4WXYB 5PNTA 5J40A 2DPHA 3LUKA 2OXFA 1Y1PA 3B2EA 1Z4OA 2FUCA 5KVAA 3I5XA 2HDNB 4M8SA 4YACA 5HCNA 4CM1A 4AZ3A 1L7OA 1LPNA 2X2PA 5CK5A 4ABTA 4Q6BA 5IKEA 4RW0A 1CC1S 5BNIA 4M9SA 3T9FA 1FJ2A 3EEYA 2C2BA 4JC5A 4U7HA 2W43A 2AEMA 1NQOA 1GTVA 4E33A 1JMKC 1R6AA 2X0JA 1YRWA 4HNHA 2O7RA 1R8YA 1UXIA 2Q3JA 5JEEA 1VQ5B 4DILA 1I4WA 3M4YA 2B98A 4L28A 3C5HA 3USCS 1FY2A 3GFGA 1TF7A 2WZDA 4AQ7A 2X9VA 4G89A 1M8JA 4N03A 4DV0B 5CBKA 2DLNA 2VTVA 4N7MA 3K09C 4QLBA 1L8AA 5JQWA 1RMYA 3IELA 3C3WA 3ZBPA 3ZH2A 4F96A 4QYSA 4AY4A 4NTZA 4C6TA 1JNYA 3OQIA 2O07A 2DPXA 2FZLA 1Y8QB 2XT9A 3SLKA 1CJUC 1DCMA 4KSBA 3SJ7A 3KM0A 5KQPA 2WYIA 4I99A 1SZJG 2J41A 5CLQA 4R9UC 4NPCA 4LXUA 4L75A 4OHKA 3D8HA 3TBKA 2JJ1D 3IAEA 4U0JA 2IHVA 3LWNA 2R6DA 1SQGA 1WPXA 1D04A 4Q00A 2YKGA 1U6KA 1FFXB 3LXMA 2ZVJA 3FYUA 3CRRA 5TF0A 3RGWS 2DPMA 3H18A 2Z0MA 1NV8A 3K05A 5FTNA 5A7HA 4D46A 4Q9NA 3H9JA 3H5WA 3SM9A 1QRTA 4TYYA 5AFSA 1DJNA 3C3PA 3SKYA 4DA0A 3C3XA 5CDYA 3ADKA 3U7GA 4PN3A 1PSDA 1KSJA 4DV4B 3I8OA 2G6TA 2YS7A 3C85A 1IB0A 1JDJA 2P0EA 4KHPB 1JG6A 2NU9A 5ALSA 2TS1A 2VP9A 2P5TB 1XTUA 3M6LA 1DFGA 3H8JA 4MRSA 3ORSA 2JLZA 4YLEA 4ZDJA 1UMKA 2HDOA 1GR0A 4MP6A 5B2EA 3CCLB 1RWQA 4IOKA 5BW4A 3HCAA 3VI4B 1W75A 3ABIA 3ZK7A 1E2IA 4RD4A 1JQ3A 4OBBA 2VQDA 4IIVA 3TWOA 4IOLA 1T36A 3WKCA 1WZ2A 1M76A 3KXDA 4N8DA 1UBTS 2WOJA 4Y6PA 5ANRB 3CVXA 2LDBA 1UZMA 2I8AA 2XBLA 3AJ9A 5T64A 3PVDA 2NYUA 3U44A 2PGOA 3VJMA 4CKYA 1N5IA 1XZDA 3O9MA 5B58C 4TWAA 1BGVA 1OZ0A 2CFSA 1WXQA 1V16B 2FKNA 2LCFA 5D2CA 3KDPA 1N8TA 3WR5A 3ZHYA 2PGXA 3FSRA 4QBIA 1OX5A 2VPIA 4G85A 1R15A 2H8GA 2PAAA 4U2DA 5EYPA 5L7YA 5C51B 2AQHA 3MB8A 5ILQA 4MQMA 3K5PA 1NVKA 1P3DA 4QYIB 3L6RA 5CLGA 3AHCA 5FI0B 4Q21A 4PZPA 3PC8C 4K9KA 1UQUA 5TS3A 5EE5B 4MGYR 5AJUA 2BH9A 3LX5A 5YASA 2X22A 4CTMA 2QDKA 2CV2A 1NY6A 4AO7A 3GIWA 1J2JA 2CUZA 1A96A 1UBFA 3HXPA 3AFNA 3IHKA 4U5QA 3K1ZA 2OBTA 1XMPA 3MWDB 3S6JA 1KAGA 2X14A 3H75A 4EB8A 1XTKA 2I3AA 4ZAVA 1U2RA 1GV1A 4CLEA 1N2XA 4JENA 2OKCA 1SCJA 3B89A 1OZGA 4G86A 2FJ0A 4KSCA 1IEWA 2J6CA 5HJ2A 4A36A 1QFMA 2VRBA 4BLPA 3CZPA 3RC7A 3O9ZA 1IUNA 1Q77A 4H15A 4NBNA 5LYJF 2QTVA 4H4DA 1KXZA 3QYFA 1RIIA 1SGWA 1W6UA 1T2UA 3L43A 4UVHA 4BBJA 2P4EA 5C2JB 1TZJA 1WNTA 4V0LA 5JRZA 4CN8A 1IY2A 1UBSB 4E3ZA 1V43A 2QI9F 5DNCA 5AVXA 2X0DA 1T1GA 1BROA 1LPAB 3A3OA 3LX8A 4HDOB 3ADOA 4IV8A 1YFLA 1GZ3A 2G5GX 2V98A 3NT4A 3CY6A 4RS3A 5EUMA 4B35A 5J4KA 5LYJB 1XPUA 3H2JA 1GVNB 2XA2A 3PFBA 3CR3C 5AI9A 4KX5A 5GQSA 5EVCA 3DKPA 3TQHA 4LY3A 4NS1A 4ND8B 1V71A 3VZSA 1RWVA 4U7JA 3SR0A 1KU6A 3NKLA 4CODB 4DUZB 1LLDA 5GV8A 2FMKA 1M54A 2OG2A 1E58A 2RIRA 3TCXB 4FHZA 5A9TA 1T9GR 4P0QB 2AWNA 1GFSA 5ILOA 3EQ7A 4D26A 4YA6A 3OF2A 1D2AA 2HIHA 2DUMA 1CY1A 3JASA 3N2KB 4L95C 5JZSA 1M8KA 5DTMA 4MVYA 3WADA 2WUVA 3T5BA 4NFHA 3P2EA 3WP0A 1AMUA 1QQ5A 3STHA 2JDIA 4I14A 3A10A 2PBFA 2RHOA 1XD8A 3MD0A 1F3OA 1D09A 2VCHA 1ZK2A 5IWCA 5AOBA 4E14A 3WSVA 1O96A 2VBIA 3NTVA 3I0ZA 4GKVA 4ZYUA 4PZ0A 5BSFA 4R69A 3VR5A 2JGIA 1P18A 3RLFA 1L5MA 3AI1A 3VR4H 4BZZA 2GD6A 4LHEA 1AU9A 5AICA 5T3YA 5EOVA 4BFXA 3KETA 3VJRA 3ABRB 4WY5A 4C1BA 4WN3A 4RHUA 2HJHA 4YDQA 5K8IA 1QPBA 2HWUA 3WDSA 1SVLA 3JRXA 4HL6A 2VK1A 1JFFA 3TGPA 2WB2A 3O7WA 5JU6A 3GRFA 2G07A 1T8RA 3ZZUA 3M1IA 4EG0A 3QSGA 3TOSA 4JXXA 3KZKA 2REQA 2DHQA 2O5VA 2WIFA 4YEJA 3PEFA 3WLFA 3TPZA 4LGVA 1IXKA 2GQ0A 2Q5HA 2Y05A 4TTRA 4CM8B 3WL3A 4EGSA 1MO5A 1YQQA 2EBHX 3BWYA 3I32A 2WMNB 1MC8A 1Q2XA 3GN2A 4PWYA 1EJ6A 1M1YB 1SZCA 2HFJA 3IXLA 5HF9A 4L16A 1IVSA 4PCLA 3ZY3A 2J0UA 1HYEA 4P3OA 3RS3A 5JJBA 2WTEA 2VN8A 4LFCB 4OMUA 5TQ0B 2GRJA 3AO0B 3IVGA 2GI4A 4B7ZA 1U9CA 4R2JA 3X3HA 4CM4A 3BL6A 2VJAA 2B0CA 1ZS9A 4RZHA 4YAEA 2IY8A 5KNCD 4P8RA 4GM0A 1EFRA 4BVEA 3D7RA 1TM7E 2ZVDA 3RRZA 3VZDA 4QRIA 1D7AA 1K27A 3WBJA 4ZZ0A 2MINB 4JVNA 2VNHA 1SQ5A 1N3LA 2A0UA 2OV1A 3GEDA 3DFIA 1QIJA 4PCUA 1AQUA 1OV6A 4ACBA 2CLDX 2VUIB 4HQOA 1VMKA 4D42A 4TV8B 4JI7B 2WJYA 3LC2O 2AR9A 1AQJA 3HRIA 5LDGA 1CT9A 1SU7A 1K7SN 1PJ5A 4DNTB 2WHXA 2NO9A 2R6AA 3HO8A 1EG2A 1OC2A 3LUHA 1Z3CA 4OKNA 4PW0A 3E1KA 2HHCA 1CDEA 2QRGA 2YV1A 4WA7A 3V4SA 4ZFNA 1T1SA 5ABPA 1QCZA 1Y63A 1E3WA 1JRLA 2IELA 4MR7A 1P7PA 3PHLA 1E1RD 1ZZGA 4P2BA 1BVHA 2IBMA 3FCCA 3F9CA 3SSAA 1KSGA 5IWAB 2B8NA 1HK7A 1X80A 5JYCA 1FUIA 5B5SA 3ZK9A 2XUAA 5TMPA 4DY6A 3ABOB 4AYTA 4ZK6A 3ESQA 3SXUA 2NMVA 4G1UC 4N0EA 5A5FA 4QE3A 2QV0A 4Z4TA 2RK4A 3A3GA 1LQUA 1A5ZA 4TROA 3RS5A 3TB6A 3DB2A 1BW9A 2Z1NA 3A4IA 4PVCA 1NG9A 4HDSB 4ARCA 4B6OA 1GGFA 5FI3A 4BIMA 4RULA 3H9UA 3VR5D 2G28A 3JTEA 5FR2A 1V1RA 5B37A 2EKQA 5I6DA 3O74A 4ZJYA 4DMGA 2LTAA 3CZMA 2EC5A 4LXIA 1AHIA 2CN1A 2XKAA 2YWJA 1G6OA 5CMLA 3GLIA 5HNKA 4KLRA 4OKSA 2PX6A 1IOWA 1WJGA 3UAXA 1NW5A 3AJ8A 2ZSDA 1KC3A 2I6FA 4BP9A 3BHMA 1ML3A 2RGCA 1VGQA 5SYAA 1OFUX 3GPLA 1PQWA 4E7PA 3AF6A 3WBKA 1OLUB 2Z8XA 4JVLA 1YZHA 5JAHA 2EFEB 3T1HB 1QFSA 4IMIB 4R6WA 1M66A 2PLNA 1WHTB 1S2OA 4GMFA 3T7AA 3R3ZA 5DDIP 5F9HA 3CLSD 4Q47A 3ZTWA 5EHZA 1WU8A 4MVXA 4PPGA 4D6PA 3RREA 1MXHA 1KMCA 5DBEX 3AY3A 3NXSA 4TN1A 5LQAA 4BFUA 3U7RA 2ZTLA 1L4BA 4F11A 3F7NA 3BCHA 2DTDA 2YW9A 1VI6A 2H06A 4XX0A 2XMPA 1UPFA 3GCGA 2CLMB 4DQDA 3W0LB 1GGJA 1TUGA 3LXXA 1P17A 3AVXA 1VGVA 1Z5VA 1E0JA 4Q3OA 3U80A 3WJ2A 2J3MA 3O9VA 4D5EA 3M2TA 1G55A 3JSAA 1UXOA 3AF4A 1NYQA 2Q0HA 4KVFA 5H82A 3HVJA 5A03A 2Q2VA 3BNWA 3GJ8A 1XQWA 4FE3A 5AIAA 5DWDA 3FDZB 2QRQA 5IJ0A 4WNYA 4Z53A 4WDQA 2YOGA 1WMDA 5CXUA 4F3TA 4XQ0A 4HS9A 1E0SA 2GUGA 4BEJA 4BV8A 3OZ7A 4EKDA 3TLGA 1EDEA 1X8JA 3PQ8A 2ASVA 3DO6A 3EGOA 5ARBA 1XF1A 3KFVA 1ILWA 1MH1A 1WQ3A 1PT8A 2XTAA 4XWTA 3ZDEA 3HU2A 4RVNA 4AG5A 3L9WA 5J4VA 3DMGA 1FDIA 4I6GA 2CBXA 1I2MA 4JI3B 3TW8A 4A6PA 2LCIA 4M55A 2YW2A 5ALEA 2AZ4A 4QQKA 3VR0A 4EYOA 3OJXA 3HP4A 3IP3A 3MUFA 3A1SA 3CNQS 4HTFB 4K9LA 4E30A 5JDIC 1Z7WA 1ID8A 1CUDA 4WNCA 4P2NA 2BFDA 3FMVA 5BXQC 2VQEB 1WPRA 1P6XA 4RPCA 1VCHA 4OUDB 1M0EA 1SBTA 4NOKA 5TB5A 5EXEA 3W4IA 3AY0A 1L8OA 1FS6A 1QV7A 3K8YA 2WB4A 4EECA 3KOWA 2GRUA 1SKQA 1L4LA 1FZTA 1NUPA 2PUDA 3BHJA 1SPXA 2FPUA 4K81B 4PR0A 2ZCVA 3U3OA 1JHUA 1KMNA 4A8JB 4HVCA 2PX4A 4PYJA 3DCYA 4BB5A 1Q0LA 4EI2A 3NNNA 4DCJA 5AW2A 1FDSA 4D02A 3OQHA 4L6CA 5AK6A 4ZQHA 5A7FA 5CA0A 4NAHA 1KZ4A 2WAYA 4AROA 3QX7A 3L05A 2PNFA 4RLZA 1O97C 2AQKA 1C9NA 1TVEA 2MYPA 2RGGA 5A3VA 3ZYZA 3K71B 3G9XA 1NJFA 3R7SA 4KWCA 3ZGVA 4H3VA 2YBDA 4ROXA 2IP2A 3BGIA 2J08A 2QTMA 3SIWA 4WTOA 4R1LA 5KHOC 1CZUA 3HO6A 5E1BA 2YS6A 3ASUA 2B0JA 4RADA 2OXTA 2OLJA 4UHJA 2HIAA 2J4FA 3EC7A 2R79A 4JCOA 5FTMA 2PT9A 2VHYA 1NRKA 3PVSA