3SJZA

The structure of aif2gamma subunit delta 41-45 from archaeon sulfolobus solfataricus complexed with gdp and gdpnp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
409
structure length
409
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEETIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HOLD FOR PUBLICATION
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 95
structure length 409
sequence length 409
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjzA01
2JLVA 1CJVC 4S2EA 4KFRA 2F1IA 1NBMA 3W5VA 3QF7A 1TF5A 4Q02A 2HXYA 2ZANA 3FGNA 4HDOB 1KK3A 2GNOA 4IXMA 2ZM5A 2XSZD 4MH0R 5L3QA 2CXXA 1G21E 4U5XA 3CCUB 1NP6A 1GFIA 2CLDX 3ZGXA 1QVFB 1ZM2A 3U7FB 5HCIA 1EESA 3TLXA 1CXZA 4DCSA 4D0NA 1KAOA 4R7ZA 4GT1A 4FI3C 2QAGA 1VCMA 1NN5A 3KKNA 1A5TA 2P67A 5FTJA 2WKRA 3U3KA 2JLZA 1Z5ZA 4Q66C 4QJ5A 4WZ6A 4WW0A 1Z06A 4YONB 3I73A 3CB4A 3ZVLA 1KI9A 2GXUA 1RRCA 2YOHA 2HUPA 3B8HA 5EXPA 4U9UA 1NMXA 3AB3A 4B6EA 1YRBA 3HU3A 1M6NA 4NZYA 5FPSA 3VNVA 1YITB 1L4YA 3I8SA 4RD1A 1ZC4A 2XJ9A 1OE0A 4KV9A 2ZJOA 4BFWA 4XVQA 4PHTA 3WHLA 2BBSA 3CD6B 5EE0A 2HYDA 2HYIC 1YU9A 3DEFA 3NHAA 3RRZA 4BASA 4IRUB 2V55B 3TE6A 2KE5A 4G3XA 3B85A 4P31A 1XJ0A 4PANA 1SVIA 4G1BA 3IIMA 4H9GA 3I72A 3RYTC 1FPMA 2YHSA 3T61A 4AKEA 2JIZA 4JLBA 1FTSA 1G3IA 3RC3A 1P7CA 3NWJA 3LBIA 3DO6A 1YHQB 1H85A 2HCJB 3I5YA 3Q5DA 4JSTA 1P2UA 2GJ8A 1DAHA 1DDIA 4M2LA 5A0FA 2GQFA 3ZVNA 3LQQA 3FFBA 4F92B 1VQLB 3QJYA 4LUCA 4DB2A 3N2EA 4H1UA 2QDXA 3RLFA 2GK7A 1KDOA 4W5JA 3GCGA 4QJ4A 4BRWA 3EZFA 4JLJA 2IA5A 4LK2A 1G5TA 4RZUA 4LHZA 1AS3A 1F6BA 2HDNB 2G1KA 1NRJB 2FZLA 2CL6X 1E9BA 1UKEA 1TUEA 3WYFA 1ZIOA 4MYCA 3D6TB 3K53A 1JR3E 4TYPA 4W5HA 2H17A 2J45A 4LC1A 1OT3A 1G8FA 5B58C 4URZR 3ZD7A 4NYJQ 1GM5A 4GL2A 1M7GA 3BD9A 3EPJA 3JQQA 2W2XA 2W2TA 2QI9C 2PT5A 3TVTA 2FH5B 5DI3B 2Z5FA 3TR0A 4QGGA 3RABA 3IEVA 1ZUIA 3CH5A 1NMZA 4WXPA 2O8FA 1VQOB 4HYYA 2O8EB 1KO5A 4BZXA 4KFSA 1W0JA 2IK8A 3IIJA 4IEIA 4ZPXA 3E70C 3EASA 1KDRA 3DM9B 1OXTA 3A1VA 4FWIB 2VTKA 3B13B 1DVRA 2DFTA 1E9FA 2CL0X 3PV0A 4LWZA 2PZFA 2IHBA 2ZRJA 1NJID 3L8YA 2OCBA 1MKYA 3DOFA 4KCGA 3CM0A 4Z51A 3FDIA 1GNRA 4G5SA 2ZITA 4XSGA 2RCNA 3A58B 1G8YA 3CCQB 3PJRA 1YR7A 4EDHA 1UBCA 4IDNA 1KHTA 1XMVA 4Q9IA 5KHOC 1N6RA 5FTKA 4M1SA 5DIFA 3T12A 1S9DA 1H8ED 1U98A 1IN6A 5EP4A 1IAQA 2V6JA 4CT4B 5TY0A 1FL9A 1HEIA 4ARZA 4N3NA 2DERA 1NY6A 1P60A 2VP6A 4JYBA 1AA9A 4B47A 1I4TD 1VYVA 2BKEA 2W6IA 2QNRA 4EPXA 3REGA 1NY5A 2H1LA 3E5HA 1LNZA 5GV7A 1OSNA 1G17A 1KSHA 3U3JA 2A2ZA 2ZU6A 1W36C 1JJVA 3QKRB 5M04A 3CCRB 1G41A 5E4FA 5GV8A 5B57C 2ZS7A 5J47A 3CRZA 1Q86D 1CU1A 2X2EA 3SJAA 4BFZA 2QBYB 5IK2A 1PJRA 3N70A 3QENA 2C99A 4URVR 2GBLC 4Q9HA 1KD1D 4NPHA 2O8CA 4LJ5A 4YAFA 1QHHA 3IEUA 4M9QA 3TQFA 5C46F 3H1TA 4M8NE 2BBTA 2QAGB 5K8IA 4TYNA 3W3AA 3RC8A 4NL4H 1G4UR 4MGYR 1CRPA 1II8B 1S2MA 1XX6A 2W6JA 4ON9A 1NJFA 2ZETA 4TL8A 3QI2A 1VHLA 1EFRA 1TQ4A 4AK9A 4EFLA 1QVAA 4F91B 2ZJ2A 1KSJA 4NONA 3CRRA 5KPDA 3TRFA 2EVWX 3ZLJA 3GP8A 3KKOA 3BE4A 2BMDA 1ZAKA 1FRQA 4Z54A 2OFOA 4IW3B 3K0CC 5L3QB 3WBKA 3QPUA 2WOOA 4YHBA 2P0EA 2GEVA 5BN4A 3CMEB 3VAAA 4TSFA 2WPDD 2AKYA 3KJIA 4B3BA 3GJ0A 2IYSA 1MOZA 3CONA 3LY5A 4XD7D 4P6VF 2IHYA 2RGNA 1FMJA 2ODNA 3D8BA 3TGPA 3MFYA 4I99A 1DBSA 5FUXA 4RFSA 4LYJA 4RZXA 1Z0JA 3TSWA 5HXBA 3ZZUA 1S8FA 3OEEA 4LI0A 4MA4A 3OF5A 5B2ZA 4MGIR 3T1OA 3GD7A 2OTJB 4B3CA 4AF7A 4QM6A 2PCJA 3L82B 2XNSA 2R8RA 4HUTA 3VO2A 2KBFA 1HQCA 2YYZA 5IK2D 2P3SA 3KB1A 3W2FA 2WPDA 3OIYA 4BLPA 2PIAA 4LC0A 2FU5C 3KTAB 4F93B 4JVMA 2CDNA 4I1OA 2J0QA 4KFUA 5KSWB 3CW2A 2L0XA 3NBZC 3M1IA 1H42A 2GBLA 4TMZA 1W0KA 2FA9A 1IOZA 3KXIA 4Q21A 3UMRA 3UG7A 1W4CA 2FSHA 2ZPTX 3ZS9A 3B6EA 1E2DA 3MD0A 1NN3A 2QT1A 1RZ3A 1P3JA 4ZIRA 4NKRA 2W2VA 4EPVA 4GRAA 4PR0A 3MG9A 2KWIA 1G20E 3AGQA 1FOEB 1OXSC 1G8PA 3VR2A 1E9SA 1S9HA 1B23P 2QTLA 4M22A 3RSOA 2OXRA 1W5TA 2ZE8A 3K70B 2UZIR 4MQBA 1AGRA 2BEKA 4RZ2A 2FGKA 4O2LA 2NQ2C 4MDEA 2RGGA 1QZXA 1T8UA 5FTNA 3U4QB 2MMGA 3EPKA 5FOVA 1DEKA 1GTVA 2DYKA 3ASZA 4C3ZA 1PV4A 4GP6A 4PPGA 4Q1DA 5JJLA 1CEEA 1P2SA 4FW9A 2NIPA 2X2FA 1TMKA 1GZSA 3KXKA 4B48A 3QKSA 1YZNA 4GBMA 3AGPA 2JJ2D 3UATA 3GLGB 1ZRHA 3QXCA 5KSZA 1QHGA 2GPJA 3B82A 2W0SA 2YC2C 1R6BX 1VMAA 2AHOA 4RVCA 3AQ4A 1C9KA 2RGDA 4JLAA 4KJZA 4ITRC 2F3RA 2XNDD 1HY3A 4Q7MB 1XCPA 2V1XA 4BFTA 1D9XA 4GFDA 2IWHA 2VP2A 3RVBA 4F4JA 3I8XA 1KZGB 5FA6A 4I4LA 4KHZA 4YMSA 5DO9A 1MO3A 3AUXA 5H8WA 1GJRA 1VIYA 4KU4A 5GJCA 3RRNA 4IVPA 3EPHA 1XZPA 4Q1AA 3TW4A 5ELXA 2VNJA 4A2PA 1QFZA 2A78A 4JVSB 4OHXA 3TKLA 4Q1EA 4F4IA 3GLFA 1S3SA 5HKKD 4LPSA 4CVNA 2OFWA 1OXVA 2QT0A 4HB3A 3RRYA 3QPVA 5IHPA 2OCAA 1T5LA 3SFVA 4IOJA 3MLEA 3SE0A 3V4FA 4FMDB 1E69A 2YWEA 3QSYA 3I55B 4UJ5A 2WICA 3LFUA 3EPLA 2D4HA 3CCEB 4KO8A 4TTRA 4CEJB 2EQBA 3CRQA 2J0SA 5JZVA 2KB0A 4ZGQB 4FWTA 2F43B 2FJUA 3LVQE 5EUMA 2GF9A 2R6HA 1KK0A 5BYJA 1XEWY 2GRJA 2WWXA 2H7VA 2JIZD 3OZXA 2VIIA 3RDPA 3M0EA 4W7SA 4M1MA 2V3CC 1NSFA 3OEED 4MRVA 4Q4JA 4A6XA 3VR1A 3EC2A 3PFIA 1GDDA 4O3MA 4UQOA 621PA 3THYA 3P4XA 2ORWA 2XITA 2Q3HA 4LYFA 3S1AB 5FOXA 2A5GA 2XSZA 1RFLA 2F7SA 5UKDA 5HR5A 4O25A 2NZ8A 2Q0HA 3DKVA 1E2FA 5HE8A 3U3RA 3WNDA 3GLIE 4KFTA 3TVDA 4TMWA 5FI1B 2OILA 1CR2A 2IUUA 3TBKA 3VR4A 1OLOA 5HCNA 1NL3A 4D26A 4URUR 3B9PA 2BM1A 3X2SA 1G4AE 4TMTA 1XDBA 2HT1A 3BERA 4MDFA 2OE2A 4NCNA 2J9RA 3THXA 2R6AA 3ES9A 1QRAA 5EP1A 2C5LA 2DR3A 5JEDA 2ZJZA 2V9PA 3G82C 3R7WA 2BOVA 1Z83A 1E2EA 3L0SA 1W0JD 2R65A 4KLNA 2Q21A 1EK0A 4PPFA 1QVGB 4EPRA 1KDTA 5FPYA 5TXGA 4YALA 1NVVQ 2WAYA 1Q7YD 3U44B 1WA5A 3EIEA 4R9UC 3ZBTA 2CHVA 4L9WA 3CMAB 4XOIA 4OL0A 5KNBA 3CZPA 3GJ8A 1E9RA 4LRWA 1KNQA 2I4IA 2EWWA 2GETA 2F6RA 3AM1A 1E96A 5EE1A 2WZQA 3KXLA 4QL3A 4DUGD 5HPYB 4EUNA 4NCKA 1JXMA 2FEOA 4BGDA 1ZC3A 1SVKA 1ZP6A 3W2HA 4LSGA 4PO9A 5TARA 1FQKA 3RRMA 5CYOA 1QHNA 1E63A 3W2GA 4B33A 4JKIA 5C4GB 4DSNA 4ACBA 1KQSB 2QMUA 2IS1A 4ACAA 3EG5A 1SXJA 2IYWA 1E1QA 1O87A 5AWFC 3CBQA 5JBQA 2IXEA 1M1KD 4CIDA 3BC1A 3B78A 3LXRA 5KDDA 2ZRFA 3CPWB 1W4AA 4TWZA 1G7SA 5AJWA 3W5UA 2ZS9A 5FBVB 4AG6A 1ZCBA 3PG5A 4GNKA 2QP4A 5KO2A 4RY2A 3PITA 2V7QA 2G77B 4C7OB 4Q48A 4G0NA 4RD0A 2NO6A 1E4YA 4PPNA 1J90A 1SHKA 3VR5A 4DXAA 1Q22A 2G1JA 2IUTA 1TADA 3LA6A 4QG7A 2OHFA 1VQ7B 4A0RA 3L43A 1YE8A 1A82A 4L8GA 5D3QA 4PAQA 5JJIA 2KI5A 2Z6VA 4KI0A 3ZQ6A 1FTNA 3CNOA 4HB0A 3QXXA 2QENA 4Q7KA 4PZZA 5EE9A 2XOKA 2WJJA 4C43A 1WRBA 2IUSA 4Q19A 1FP6A 3QEOA 4A4DA 3QF4A 4DJTA 2IYYA 1IXRC 5IDVA 1R0XA 2C78A 4AD8A 4ILEA 2OZEA 4M9SA 1TNDA 3AKCA 4LV6A 4EIWA 1ZUNB 3X1XA 3NH6A 1IY2A 1VYUA 3HP1A 1S3GA 1TQDA 3AVTA 3C8UA 4URYR 1XMSA 1ZNZA 2J5XA 1NVVR 4C0KA 1SXJC 2FFBA 1QFJA 3CRVA 1HA3A 4HAXA 1SM4A 5CK5A 3ZS8A 4Q1CA 2IT1A 2IF2A 2ZXUA 4OQXA 4X8MA 1JA1A 4PTLA 4QKQA 2UVQA 3BOSA 4MITA 5FPTA 3JZMA 3G5UA 1Y63A 2QGNA 4V0MA 1CJUC 1GKYA 3IQXA 1U81A 1E2QA 1Q3TA 3ADDA 1XZQA 3IKJA 1GRNA 2BWJA 1CJKC 2R6FA 4V0NA 1W36D 3KKQA 2P6RA 2XB2A 2HT6A 5F3WB 5FL7A 5C18A 5E7MA 1ZVQA 4L15A 5DSZA 1ZD9A 4CRWB 2ATXA 2JLXA 3A1UA 1X8JA 1OFUX 2AK2A 4E22A 2ZSAA 2NZJA 2VYFA 2F43A 1U8AA 1X8LA 2A9KA 3CPJB 3P1JA 4RFSB 1OH7A 2FSIA 2AXNA 2Z43A 5FBRB 5SZIA 1JB9A 4ZGNB 2RGBA 2ZI3A 3UK6A 3KQKA 4FMCB 5EJEA 2BPOA 2BEJA 4Y0VA 1KKMA 2DFKB 4JLNA 2ZUBA 5LD2B 5JWHA 2J87A 1SULA 2XNCA 3KB2A 3IILA 4YAWA 1YR8A 3ADKA 4QC2A 2CCGA 2C9OA 4P4SB 4A8JB 1WDTA 2DWOA 1ZM4A 3BS4A 4KLZA 2JJ1A 5LB2A 2VEDA 1I7PA 1G291 4CT5A 2AWNA 4JT2A 3T15A 121PA 2QTFA 2SHKA 4ASUD 5J4KA 1D2EA 3O8RA 3O8BA 2J7PA 3MWJA 2FE4A 4AKHA 3B2EA 2GXAA 3HU2A 1ZU5A 1P75A 2G0NA 4OI0A 1N6HA 4YXWA 1E64A 4CDGA 3SN6A 1QUEA 2XNDA 4HAVA 5CLQA 2WKPA 1CULC 1E6CA 2ZR7A 3ECCA 1GOTA 3PCRB 3T1VA 3E1SA 4FMDF 2OCYC 3T5DA 1QGZA 2OK8A 4QRHA 1BKDR 3A37A 1KAGA 2H57A 4JS0A 2D7DA 3UANA 3U3MA 4Z1MD 1OH5A 3AEZA 1UAAA 1E0SA 1Z6YA 4CEHB 4HLCA 4LV8B 1UBGA 5LDDC 1FRNA 1UKVY 5F9FA 5B30A 4AF6A 3Q7QA 2P2LA 4GMDA 4TZ6A 2QA5A 2QM8A 2RAPA 3U7EB 2QQ0A 5H5JA 2ZI6A 4HZIA 5GJWC 3FFAA 2CNDA 4HAYA 3A4MA 2DB3A 4PSKA 3W90A 4DSUA 2QROA 3A1TA 1E1RA 3QVUA 1W35A 3BFVA 5EZ5A 5DISB 1BO6A 1U8ZA 4JBWA 2CE2X 4ERNA 1D5CA 2BIFA 4MRNA 4M1TA 3N5CA 2YWGA 1T3SA 4B71A 4JJKA 1D2NA 3NEYA 1DTSA 1G5RA 1GIAA 4AYWA 3K9HA 2HJGA 4DCNA 4UKDA 1EWQA 2I1VB 3A1SA 4LHVA 1VCIA 3KQLA 5JJKA 1Z6GA 2J41A 4JMPA 1Z8FA 2D62A 4RD3A 2WWGA 2JEOA 4RKEA 4JLPA 2MSCB 2CBZA 2QTHA 4BZPA 3AF1A 2PMKA 3LO8A 2FMXA 3B60A 3IHWA 1E9EA 4L16A 4A0HA 4IKEA 3OAAD 3OHMA 1OYYA 3FYHA 3QFSA 1UM8A 3GJ4A 4E03A 1CP2A 3CCLB 3GFTA 4TQUS 4Q47A 1E62A 1GNQA 4NYIQ 3OFNA 4C7OA 3KX2A 1Q57A 4DLXA 3KQNA 1R8SA 1KO1A 2GCOA 2VP9A 2WJVA 1FUUA 4ARZB 1X3SA 4I1SA 1GVNB 5AJVB 2BCJQ 2P65A 4DB4A 3UG6A 1TU4A 1EP1B 4TQ9A 3Q9LA 5K8LA 3GLIA 2BMJA 3BK7A 1E1RD 5GJVC 4DT1A 1E2MA 2RGAA 3MJHA 1G6OA 3NEJA 2OUKA 4Y7CA 3KL4A 1R5NA 2BMFA 3FHTA 4UNRA 1RIFA 4HEJA 2Z83A 2O8EA 5F98A 4POAA 1Z47A 1G1MA 1TU3A 3VMFA 2CHQA 3T34A 1WXQA 3Q7PA 1GR1A 1W46A 4KVGA 5AJZA 3JQPA 4Y9UA 5HE9A 4Q5IA 1MO6A 2BBWA 3BB4A 3IGFA 1NG1A 3H84A 4FCWA 5EQTA 4EAQA 4Q4HA 4TL7A 5DN6A 1KDPA 1I2MA 2X77A 2Z0MA 2AD5A 5J4HA 2X1VA 3ND8A 2C96A 3LLMA 4OK5A 3KQUA 2OG2A 1W0KD 1WF3A 4ESHA 4ZCMA 2BJWA 2XX3A 3X1ZA 2UKDA 2OXCA 1RW4A 4X8LA 3MSXA 2ANCA 2QRZA 1UKZA 1Q82D 1E32A 2G0TA 1DARA 4P4SA 2WHXA 4TLBA 4DLSA 4NTZA 1E1QD 4XD7A 1CLUA 3HDTA 1UBEA 3AKYA 3PIRA 4AG5A 4M9XA 2GDJA 3IBGA 3AVPA 3NC0C 3K9GA 4UJ3A 1S4QA 5F9HA 1R8QA 3EWAA 1E2KA 3C7KA 3AF2A 2RGNC 1CS4C 1G18A 1W5SA 1YZQA 5JS7A 1J99A 3TW8B 1Z0IA 2VNIA 3BRWD 4NMMA 1OV4A 1QHHB 2LCFA 1MRSA 2XNJA 1E99A 2NG1A 3QQ5A 4O0MA 5CM8B 4WZAE 2QA4B 1R0WA 1X8KA 4LYAA 5EXSA 4BPRA 1P5ZB 4F4CA 2ATVA 3IBYA 3V4RA 1ZBDA 4TYWA 4QBIA 4HE5A 4B4DA 1II8A 1XMIA 3CF0A 4PQFA 3WBJA 5G3ZA 3PENA 1VCNA 1SVSA 2FPKA 1YR6A 3H2YA 2H16A 1WCV1 2R6GA 2OM2A 1T91A 5BN5A 3HYRA 5JFGA 4KAXA 8OHMA 3PXGA 3WXMA 2RC5A 5TR9A 1RJ9B 4OQFA 1XPOA 3CCSB 3WRXC 2GZHA 1WMSA 2YV5A 2R6DA 4DIEA 2HCBA 1KJWA 1DS6A 2PZGA 4J0QA 2O0KA 3VTKA 3LVRE 2XAUA 1Z0FA 2A3RA 4PHFA 1JXOA 2FNAA 4Q4HB 3FPKA 2JA1A 1NIPA 1MO5A 4TLAA 2O0HA 4HDCA 2BHRA 3AVWA 2Q9BA 3KUCA 1XD9A 3WHKA 4QM7A 2WIAA 4OI2A 4AYTA 1XPUA 1R0ZA 1N2CE 1QHIA 1XTRA 3AH8A 3O8DA 2GXSA 4IFEA 2IYTA 2VO1A 3LW7A 1M7BA 4KSCA 2QORA 1GRQA 2VSXA 1MABB 3NXSA 5F2EA 1NKTA 4HUQB 4DZZA 1E2LA 2CMKA 2GJ9A 2PLRA 1KY2A 4C0SA 2FPLA 3L0IB 1D2MA 5FR1A 3W5IA 2BVNA 3F8TA 1UMKA 2ZE7A 4QHTA 3EC1A 4BLOA 3TMKA 2QTZA 2QL6A 4P4TA 2C98A 4LPKA 5LBIA 4B43A 5FL7D 4JLOA 5GVSA 2ZE6A 1FDRA 1J8YF 3W5HA 1UBFA 3REFA 2QSYA 1QH0A 2R62A 4TMXA 4DT1B 3NIBA 1F48A 3OIVA 5BXQC 1XTSA 2Z4RA 3ZBUA 2V7QD 4UXJA 4DLZA 3T1TA 1COWD 2DPXA 3D7MA 3BH7A 4TL6A 4LBYA 4CEIB 4K8OA 1ESMA 2FFAA 1F5NA 1N0VC 1BH2A 4PAOA 4G5RA 4LX0A 1W2BB 3CPEA 4DSOA 1C4OA 3BH0A 3P32A 5GADl 1QHXA 2IYUA 3I61A 2HEIA 3K0EA 4C30A 3WMEA 1KO7A 2ONKA 5EE5B 4OHWA 5L3SB 1N5JA 5AUQA 4DSTA 1OH6A 4MYUA 1I4LD 2VPPA 1N6LA 4HLDA 1XTKA 1N6NA 5J5CA 1YZUA 2ZRCA 4C0JA 2FEMA 2ZR0A 5FUVA 2B7CA 2H5EA 2RC6A 5JCPA 4M4SA 1RYHA 3MWYW 3ICQB 3NBXX 4XTCS 3QNUA 1A8PA 3PEVA 3VFDA 4DCTA 1OKKA 2H18A 4DUGA 1QFYA 1XD8A 2XEXA 4Q18A 5THXA 2WWWA 1PLKA 3NG1A 4ZDWA 3K09C 1YZLA 4Q4JB 2ZEJA 1W47A 5KNCA 5CM9C 1IXZA 2IYZA 3QE2A 5CB8A 4M1OA 2VHUA 3BB3A 3NDPA 3TAUA 4A82A 2HLDD 2XZPA 4HSEA 3R9WA 2DY1A 4Q00A 4A8JA 3DDCA 3IO3A 4KVAA 1GITA 2OSBA 4B35A 5HZKA 2ZJYA 5GJBA 4FD2A 3LH5A 2ZQ5A 5G3YA 5GVRA 1SQ5A 2DETA 1AS0A 3A6PC 4N3GA 2YWHA 3VQTA 2QN6A 1J7KA 3BWDD 3H86A 2DFNA 1CJTC 2WAXA 1E2IA 2QSZA 4V0ME 4QNMA 1C1YA 5ANRB 4PHGA 1VCOA 3OZVA 4LBWA 1OW3B 1UFQA 4OI4A 5L8VA 3CWZA 4OHVA 2FF7A 2FZ4A 3KJEA 4NH0A 1T3HA 2IXFA 3CNNA 4XJXA 4B75A 3OJWA 3EIQA 3U5ZB 3DVLA 2WMNB 2JJ2A 2VHJA 3BFXA 5FBWB 2GZAA 3SOPA 3TH5A 1DAIA 1BQEA 1VIAA 2DWPA 3P20A 4OK3A 3R7WB 2A5JA 1GNPA 3EAQA 4K81B 4BLSA 1N6PA 2B21A 4GZMA 1KK1A 1E4VA 3KQHA 2IYVA 3LLUA 4F7DA 2FX3A 5BN3A 3THYB 1VQ9B 1HH4A 3RWMB 3WMFA 1TVCA 3GJ5A 2VSFA 3SHFA 4G1UC 1X86B 1IN5A 1J70A 1XJQA 3ADBA 1Z63A 4GP7A 4HLUA 1XCGB 2CCJA 3C41J 5B64A 1XTJA 1FNNA 5TVKA 1N5KA 3I32A 1OGIA 5AUOB 1DG1G 1YJ9B 1M7HA 3N2IA 4MGZR 5LB4A 5J4YA 3G0HA 3W8NA 5JCZA 2A5YB 4K46A 3THWA 5EP2A 2EWVA 1TEVA 3FHCB 2MMCA 1FMLA 1SVMA 1T4GA 2IEZA 5E7JA 5IT5A 5JLJA 1LS1A 3WP0A 3Q5EA 5HZHA 3ICEA 1RE0A 2EFGA 1NVXQ 1TL7C 1CJMA 1GL7A 4YDHB 2O0JA 2QAJA 4JL5A 2AWOA 4K1XA 2VHTA 4OJKA 4Q4AA 1U8YA 2EYQA 3U6KA 2VP4A 1YZKA 3FKSA 4U00A 3J81k 2C2HA 1XD2B 1PUJA 3IIKA 1KMQA 2G6BA 4E09A 2GWHA 3KKPA 1KJYA 1X6VA 1QHSA 4G01B 2GEDA 2OBLA 4V03A 1NBME 4W5WA 2I3BA 3SBDA 4HAWA 2YOFA 3QKTA 1A2KC 1SVOA 3B1ZA 1H8HA 4GOXA 4RFVA 1XEWX 1YHNA 4XWAA 3I62A 2OBNA 3I4LA 2K5UA 4IOMA 4P32A 4TMKA 1KMHA 1Q1QA 3SBEA 4B3XA 5JMTA 3EA5A 2ONJA 3P27A 3K09A 3QXJA 2LWIA 1KSGA 1XXHA 2J3EA 1QVRA 4RSGA 3FKQA 5EE3A 1NJGA 3P4YA 1K73D 3GEIA 2PLFA 1SZPA 4BE7B 4L5BA 1MO4A 4LJ7A 3UPUA 3B1VA 1JNYA 2CK3D 3ONWA 1LTQA 5AJYA 4TLEA 1VQ5B 1WP9A 2WSMA 4P4UA 1BX0A 1F20A 1F60A 4I81A 3U7HB 1KKLA 2ZRKA 3LAWA 2Y8EA 4LHYA 1JAIA 3K0SA 1YIJB 2OV2A 2FSFA 3EA0A 3HWSA 5EMNA 1VDZA 5P21A 4AYXA 1EP2B 1XTQA 1W1WA 1S1CA 3LBHA 4MKHA 1ZNYA 4C0QC 1LFDB 4HZUA 5D3MA 4M1WA 1VTKA 2ZYTX 1FX0B 3BGWA 1VECA 1H65A 5DYGA 3D31A 1Q1EA 2NO7A 1FP7A 3UWKA 2WOJA 5BYKA 1EXMA 1N6IA 1VYTA 4LCBA 5J4LA 1VQ6B 5CYPA 2OO7A 5FPKA 1U94A 2QUZA 3RANA 3DZ8A 4URXR 1EWRA 2YJTD 3MWKA 4KITB 2ZVQX 1DPFA 3U60B 2FV8A 4DC9A 1YJNB 1KI3A 2RKOA 1TAGA 3IQWA 1W87A 2XGJA 2RMKA 1ZM9A 2P5TB 3GQBA 3DMNA 5FTLA 3QUSA 4LBZA 4D4JA 4L4UA 3OE7A 4N1AA 2HMAA 1OB2A 4GZLA 5J40A 521PA 4EJSA 3PUVA 4OHYA 3A36A 4AKIA 1KY3A 1IY0A 4YQFA 3U3OA 4LHXA 2ZSDA 1W2GA 2D7CA 2FFQA 3KZ1E 3UIEA 4TTPA 4C2TA 1X1RA 4QBFA 3CCMB 1JAHA 1GKIA 1YQTA 4KODA 1AS2A 1N25A 1L8QA 2Q3FA 3LDAA 1Z08A 4JYCA 1T6NA 4A2WA 3R8FA 4DCVA 1GAWA 2BSAA 2YC4C 1GSIA 1OB5A 1US8B 1E0JA 2F1RA 3QIAA 4HB4A 4MRPA 4EPWA 5JWOA 1OXXK 3W5JA 1DAGA 1KOFA 1VHTA 3T35A 2ZYUX 3UMSA 3F3YA 3GJ7A 1K5GA 1P9RA 1BMFA 3OIWA 3K1JA 2O8FB 1Z0AA 3RS4A 1AM4D 4ASUA 1R10A 5A4JA 3SJBA 3EX7C 1R0YA 3CLVA 2C9CA 1CR0A 2RB4A 3AV0B 1U0LA 1RRPA 5DI9A 5EXTA 4G5QA 3OZUA 4EH1A 2OAP1 2GCPA 2GJKA 3HU1A 1F3OA 4PSVA 4NCIA 5HKKA 1BMFD 1W34A 3SDZA 2ZYWX 1KNXA 3A4NA 2OK7A 3CX6A 4US2R 2YKGA 2FGJA 1XXHE 4A15A 4JZKA 4C9BA 1W4RA 1H8HD 3KFVA 4JVNA 1ZCAA 3R9XA 4DLYA 4OBEA 1AGPA 3TSOA 4DRZA 2BJVA 3EZ2A 3C5CA 5FOWA 2Q6TA 4A0GA 1XMJA 5CIQA 2X8AA 3TUIC 2XTZA 4S35A 2AX4A 2GAAA 2W6ID 3LX5A 3PEYA 5TV2A 2G88A 3MUFA 4R98A 4MKFA 5FI0B 3OEHA 4PSAA 4U02A 4F38A 4QJ3A 5K8UA 5G53C 5J4VA 3X1YA 1QG2A 4CGZA 1KI2A 1ELOA 3RS0A 2ZAMA 4A6PA 4V0KA 1AK2A 4LJYA 2ZJ5A 3SQXA 2FDCA 2XXAA 1G5PA 5HTKA 2QGZA 4BZQA 1G6HA 2ZVPX 1IN7A 4YC7A 3SQWA 4IOKA 3MGCA 1VG0B 1CR1A 4YMVA 3Q72A 1TQ2A 1DDGA 1GP2A 2H8KA 2R2AA 2G9NA 1G7TA 2VNKA 3NBYC 1ZMXA 3DL0A 3FMFA 3VR6A 2JCSA 2CEAA 5IF9A 1Y3AA 2QAGC 1CR4A 4MUAA 3QFRA 1VQMB 1OYWA 2HLDA 2VF7A 3ASYA 4UXHA 1AKYA 4KYUA 1M1YE 4TT3D 3FVQA 3TIFA 4BFYA 2WWYA 2PZEA 3VR3A 1W36B 2HV8A 1WBDA 3I3SR 2GCNA 4GMXA 3AP2A 2QU8A 5KOYA 1FZQA 3LQRA 4ZCIA 3I92A 2ZI9A 2WWIA 1GO2A 1P61B 1N3BA 2IX3A 2AK3A 1XF9A 1YZGA 4EJSC 4LDJA 5DN6D 4NYJR 2KBEA 4LJAA 1AN0A 2PCLA 1VQ4B 3ZIAD 4CF7A 4TT3A 1JR6A 4C0HA 4JLKA 4WOPA 1AZTA 1H8EA 5KSOA 3QEJA 1J9ZA 2A5DA 1ZD8A 5CK4A 5AR1A 3CKLA 1U9IA 1Z2CA 3DMDA 5H70A 4TQAA 3M6AA 2VNHA 2YOGA 3QBTA 5CLLA 3GEEA 3AVXA 3QKUA 3NDBB 2V1UA 1HT1E 5DYIA 2X3UA 2CK3A 2WBLC 4M21A 5H1YA 5FBQB 2CE7A 4PAMA 2B8WA 4AI6A 1SKYE 3JQRA 2F3TA 1G7CA 3ETLA 2XXAB 3Q85A 4ZV4A 3HJNA 3VHLB 4ZKEA 1K9MD 1E2HA 1US8A 1NN1A 1YRAA 4ZIRB 4HZUB 2CLCX 4TSFD 5D3MB 5AK0A 5FUWA 1JBKA 4PZLA 1FNBA 1X1SA 1D1NA 2CNWA 1OKKD 2GAOA 2IC5A 1UF9A 4RCZA 3H4MA 3VHXA 5FH9A 5LPNA 3L0PA 4GSYA 1D9ZA 2YWFA 4P0TA 1XWIA 3CRW1 3IPXA 2J0VA 2WJGA 4TMVA 1EFHA 4GOJA 1GRRA 2C04A 3WRYC 4C2UA 3KUDA 2NO0A 4DQLA 1UPTA 2JAQA 3CF6R 1EFRD 2WJHA 3PVSA 2ZRDA 2ODWA 4V02A 3VO1A 1QBKC 2VP0A 3AUYA 1RPZA 5DH9A 2PBRA 4Q7LA 5SZKB 2ZRAA 3U61B 2C9YA 2O8CB 3WMGA 2P6UA 3VNUA 2PL3A 4KBFA 3AVYA 4FMBB 5FOUA 5C1BA 1T3LA 1F2UB 1G3MA 4JIMA 3P26A 3NVAA 3O47A 3SYKA 2HJVA 2LKDA 2YVUA 4D80A 5AUNB 1HT2E 4LJ4A 4ZO4A 5E7IA 3GLHA 2GESA 1Z28A 1VQ8B 4BPBA 2OAQ1 2ORIA 4WBSA 3S1AA 4Q9JA 4CEJA 3ZYCA 3TK1A 2D2EA 4NCHA 5FR2A 2FSGA 2PH1A 1NF3A 4QNRA 4B34A 1IQPA 1JECA 1S72B 2ZREA 3RHFA 2NGRA 3I1FA 1P2TA 2RH5A 4PC6A 4A0FA 5H59A 2XB4A 3ZVRA 1HV8A 3SC3A 4RJLA 3LXXA 3EZ9A 1N8RD 3U2QA 1DOAA 2HF9A 4B3FX 3QG1A 1WBBA 3SZRA 2QE7D 4ZI2A 3THXB 1SXJE 1U0JA 4IDPA 1XFAA 3CF2A 1L7VC 3CR7A 1TTTA 5AN9A 3KKMA 5IRCD 1BX1A 1E2GA 2D74A 1R2QA 4QXAA 2Z4SA 1II0A 4OKSA 4PQRA 4QFMA 1D6JA 3HR7A 1TPZA 2BBOA 2O8BB 1RRGA 4NP6A 1YR9A 3AVQA 2NO1A 2ERYA 3FMIA 2PMDA 4HLQB 1SHZA 1ZD1A 4BEJA 3R8CA 4EQ6A 3ZQJA 1VPLA 3BJIC 3GLGA 1GAJA 1G8GA 3FE2A 4MGKR 5JS8A 1MV5A 3CPHA 4BLQA 3CR8A 1P4SA 2OCPA 3IHLA 3QPWA 2NO9A 3CXCB 5G40A 1YJ5A 1KJZA 4IOLA 4IHQA 2XZLA 2WIBA 1RJ9A 2IYQA 3B1YA 1M34E 4ZCLA 1PVOA 4DLWA 1VG8A 2ZRMA 4NYIR 3TUZC 3Q3JB 4IDQA 4EPYA 1OGJA 1CBUA 2MSDB 3K0AA 4FK8A 4HB2A 1JALA 2QY9A 4Y0AA 4UXIA 4PHHA 2TMKA 2BDTA 2GXQA 4FINA 4C0BA 4D6PA 4WAUA 3PUXA 5CJPA 4EFNA 5KPJA 1WE2A 4HLUC 1QG4A 1XPRA 1IM2A 4QOSA 1FQJA 1EFCA 2CJWA 1NSTA 1FW6A 4G5OA 5CJ2A 1E2PA 4YMWA 4JKYA 2O52A 2ZJAA 3QY0A 1ZINA 4G1VA 4YXWD 3LRPA 4QHSA 2VYQA 4D81A 2ZUDA 3RWOA 3CO5A 2GVZC 4BLTA 4PC2A 4Y9RA 4MYHA 2EFCB 2ODEA 4JBXA 2P5SA 3I5XA 2JLYA 2WTUA 1RYFA 2A30A 4YAUA 4NHOA 4M9ZA 3WP1B 2GILA 2VQSA 1A2BA 1W2HA 1WQ1R 4AY2A 1S96A 2W6JD 4GOKA 5C2JB 3ZD6A 4A9AA 3NKVA 4TN1A 3W2IA 4U7DA 2RGEA 5FFMA 4EQ6B 2RHDA 5CDFE 4LJ6A 2WJIA 4Q03A 2REOA 3BIFA 4PPQA 1G64A 1G7RA 4DLVA 4C0AC 1ONBA 1GL6A 3VX3A 1M90D 4JBYA 5DHFA 4B73A 1T8TA 1OHHD 2XTNA 3AP1A 3W9YA 2OLKA 2VHCA 4QGHA 4D4MA 2OBMA 2WMOB 2QMEA 3DHWC 2JDIA 4MKGA 1NLZA 3CCJB 1Z6XA 4DLTA 1YI2B 3GJ6A 1LS6A 1QGYA 4YDSA 5KYKA 4DIDA 3AVVA 3QFTA 1F2TB 4E5UA 2JATA 2RGCA 1KSFX 3BB1A 3K0FA 4PC3A 3OEHD 4AC9A 1ESNA 4Q01A 3CWQA 3QF4B 1CNEA 2DCUA 3QXHA 3X1DA 3DZDA 3KJHA 4QBGB 2NTYC 5JEEA 4IVRA 2BCGY 1IBRA 1E79A 3BORA 2PJRA 1R7RA 2BMEA 1G16A 1GWNA 5K8TA 4CYMA 4IDHA 4B6FA 1TF2A 3SU8A 4D25A 2B5OA 4NDZA 1Z22A 1AIPA 1M2OB 1N0UA 4YAOA 2IYRA 2IYLD 2QTVB 4Q9LA 2O5VA 3G4SB 3DKPA 3OFND 2N42A 2CVFA 5DE3A 2F55A 4RD2A 2P6NA 2QQEA 4DLRA 2Q3MA 2XJ4A 2O8DA 1NDHA 1COWA 4TLDA 3JVUA 1BJKA 4URWR 3C4JA 2CCKA 2QPTA 2REXB 4BQSA 1K5DA 1ODFA 2G83A 1SKYB 2XZOA 4DHEA 5EP3A 2V54A 4ZI3A 4ZDJA 4TYYA 2GK6A 4H1VA 4IVQA 2CHGA 2JLUA 1K8AD 4NYMR 1F2UA 3RSLA 1S0UA 5FBLB 1KTVA 3TJZA 2J7KA 1FX0A 4DBLC 1W4BA 2N1BA 3QE0A 4DDVA 3CIOA 2NPIA 3B1XA 3SEAA 5BQ5A 3OJXA 1R5BA 3GJ3A 3ZVMA 2DHRA 1IHUA 2MSEB 3SR0A 1VQPB 2C77A 1KI1A 2PX3A 1JJ2B 4WQMA 4HDQB 3MRSA 1FNMA 1VG9B 1EX7A 5KDOA 1BOFA 5JHGB 3DOEA 4IJMA 1LF0A 1EFUA 1LY1A 1QF9A 221PA 3EARA 3MMPA 2VP5A 5JI2E 3LO5A 1E2JA 1EGAA 1Q1BA 2PEYA 3L8ZA 1PUIA 2DWQA 3SNHA 5JI3E 1KC8D 2DFLA 2GHIA 1AMOA 1KIMA 3ZZ0A 1P9NA 3SJZA 1QX4A 2AN9A 1XNJA 4CW7A 4KSBA 4B32A 3AF4A 4L9SA 1KI7A 4ZDKA 4HUQA 2AD1A 1KMHB 5KDLA 4ABYA 1BYUA 4IFBA 2HXSA 3CX8A 2WSSD 3K8YA 1K8RA 2AL7A 1RC8A 1EX6A 3U6BA 1G9XA 3PQCA 4OQNA 5L3RA 4YMTA 3FOZA 2F1JA 1R5OA 3THWB 2QBYA 1XEFA 3B1WA 1MRNA 1N6KA 2ODBA 1W48A 1N5IA 3BAFA 3SI7A 1FUKA 1BYIA 3QFCA 4LOAA 1Q44A 1HQYE 2VSOA 2ZI7A 5KSYA 4HI0E 2ZIAA 3NC1C 1OIWA 1YJWB 2QG6A 4CEIA 4JLDA 2JASA 3V00A 3SJCA 4BLRA 2R9VA 1IB0A 3ND9A 4LY6A 5LD2C 4B2LA 2OESA 1DAEA 2R6CA 1P73A 4M53A 4PZYA 1NLYA 3U7GA 2NOAA 4A8JC 3ZZTA 4QHYA 4AKGA 4DVGA 1SGWA 1U9IC 3WYGA 3ADCA 3I56B 3K0CA 1CNFA 1XU4A 1GAQA 2CVHA 2VH5R 1G3RA 2FWRA 1JA0A 1LB1B 4OI1A 1KO8A 1OFIA 3AF3A 2D06A 4Q9KA 2GA8A 4EFMA 1E0KA 4R2IA 4Z8XA 2IW3A 1XBTA 2ZRIA 1E9DA 3GJXC 3CRMA 1ZU4A 1XTIA 2ZAOA 1NI3A 3FTQA 1JEDA 1P6XA 3A8TA 1F2TA 1Q21A 3W34A 4MUBA 2FPMA 1DAKA 1KI8A 2R44A 4QGFA 3BFKA 4V0OA 3LX8A 1TEXA 1Z07A 3OESA 2JLWA 4D2IA 2ZSFA 4OK6A 1L2TA 4UNPA 2FOLA 3CNLA 1JB1A 2VZLA 2YZ2A 4DEYA 2GEUA 1MH1A 3O8CA 2ORVA 2EFHB 1G19A 3QKRA 4US0R 4LV5B 3PR1A 2IS6A 1XEXB 1E9AA 5C4MA 4FCVA 3GLHE 1OH8A 5KNDA 1HE8B 1ZUHA 1N6OA 1DO0A 1ZIPA 1NKSA 4E07A 4PO1A 3UMFA 4BFUA 3ZDQA 3W6NA 3GPLA 5FTMA 1OIXA 2VHQA 2ZI5A 3C16C 4JL8A 3WYAA 2B92A 1B2RA 2AFIE 1FNCA 1M8PA 3BBPA 4O2RA 3W3ZB 1CKEA 1J2JA 3T5GA 4MRSA 3TR5A 3M4YA 5JSZB 3LNCA 1M74A 3HPQA 3KDSE 1OF1A 2QPOA 1VQKB 2QEXB 1PLLA 1T5IA 2GCOB 1JEEA 4FXPA 2ERXA 4A36A 1IN4A 4Z1MA 3ZC3A 3EZ7A 2ZI4A 4FN5A 3AP3A 4II7A 4A92A 2IL1A 2E9SA 3AVUA 1XCMA 3K9LA 4UNSA 3W2EA 1JQLB 2GZDA 4NE2A 2J7PD 3K70D 1P72A 4OQLA 3OAAA 4B44A 4X8OA 5EZ6B 5JRZA 4EJSB 3VU9B 1TLLA 2B7BA 2QP9X 3E1YE 3TQCA 4XWKA 3IUYA 4AIIA 4G5GA 1KO4A 3CZQA 5CDFA 2J46A 4Q1FA 4FIDA 1NVWQ 3EZ6A 3CH4B 1NG9A 3G71B 4GPTA 2F1HA 3AKDA 1ZW6A 3Q8XB 4BFVA 1E3MA 5AUPB 4ZKDA 1KZ7B 3GFPA 2E87A 3IDQA 4B74A 1VQNB 3KTAA 4LBVA 1K6MA 1XRJA 5JRJA 1YKSA 4NBSA 3VKHA 4PQYA 4DEXA 4DLUA 3CC4B 3SYLA 1CQXA 1IONA 2O8DB 4OQMA 4TYQA 1U0HC 1HURA 2HF8A 2EU8A 6Q21A 2QE7A 2VLIA 2ZE5A 1DELA 1R4AA 4PGOA 2RHMA 3ZIAA 1HUQA 1U2RA 2CNWD 2F9LA 3BXZA 3K9NA 1U99A 4RKFA 2PT7A 5BWMA 1AJEA 4F7WA 3T1QA 2VA8A 1XB2A 1LV7A 3L2OB 3MAAC 1GILA 2JJ8A 1ZM3A 3FKSD 1Q12A 5FL3A 3K0AB 3NH9A 2XTMA 1AQUA 1Q3HA 2FG5A 2WVJA 1DAFA 4OYHA 2IEYA 1TQ6A 2VRWA 1G3QA 4RD6A 1W49A 1V5WA 2QRNA 5AJXA 3RS2A 3G6EB 3LD9A 2CJWB 4IDOA 3FMOB 1HE1C 2GVDC 4LYHA 3QKSB 3ZH9B 1DE0A 2CLSA 1ZM7A 4BRUA 4XVUA 3GLGE 4N0EA 1RKBA 3SHWA 2BM0A 3OW2B 2GF0A 5JECA 1AKEA 1DG3A 3FHOA 4XSHA 4NU0A 2ZJ8A 4I1VA 2ZRBA 4WVFA 1QGAA 2C03A 5G41A 3OIUA 3JZAA 3CCVB 1JR3A 2QZ4A 2W83A 4EKDA 4LHWA 4LJ8A 5CB6A 4PO8A 1ZJ6A 5FOTA 4M1KA 1UDXA 1T9HA 3WY9A 2WWFA 1JJ7A 3SS8A 1E79D 3QBVA 3OZWA 4N0DA 3GLFB 4MYTA 2BGJA 1BS1A 3IPYA 3SFZA 1XEXA 1OIVA 3AF0A 4YLGA 4ESVA 2RGXA 5SZJA 1A4RA 4Q1BA 4GDFA 4A1FA 1GVHA 4P33A 2EFEB 2FFHA 5L3VA 3EWSA 2E1RA 1MABA 1W7AA 1UEJA 1NN0A 1J8MF 3K0FB 4XIGS 2ZRLA 3GLIB 821PA 2VL7A 1S1MA 4C4PA 2ZR9A 4RZ3A 3EIHA 3L0OA 4JVLA 2DEUA 2REBA 1OFHA 2Q9CA 2WWHA 3DM5A 3B7GA 4WA7A 1PLJA 4GI7A 4I1UA 5EUQB 1P2VA 5FOSA 1A7JA 2ZRGA 3NTUA 3TSZA 3TNFA 2YINC 2FN4A 3DPUA 3TUJC 4QBHA 1EP3B 1LF5A 3OE7D 5E95A 3WNCA 3FB4A 5FPHA 1DO2A 3FWYA 4HAZA 4M0LA 2BN4A 3MCAA 4D82A 2ZU0C 1CF4A 1CIPA 2LKCA 1GKUB 1KGDA 4OJQA 3HR8A 4DWJA 4B3GA 3LV8A 3VU9A 4PC7A 3CC2B 4DDWA 3QXSA 4HATA 1V43A 1PZNA 1VKJA 1Q20A 2BGIA 2NMVA 1E2NA 4PFSA 3CX7A 3H0KA 1EG7A 4C0LA 2C8VA 4TL9A 1WB9A 3W8RA 1II9A 2B6HA 2ZUCA 421PA 4DCUA 1Q1ZA 3PEWA 5JWRA 2GKSA 5E3HA 1W44A 5KUTA 3THOA 5CIWA 1SVWA 3C15C 2VF8A 1ANKA 3B5JA 5DLQC 1Q81D 3F0TA 4JL6A 3PUWA 2QP3A 4Q4LA 3FPAA 4M1YA 1Z0KA 4WZBE 2EIXA 3EW9A 4B3DA 4YMUA 3E2IA 2PJZA 2NPFA 2UZ3A 1Z3IX 2A5FA 4QGAA 3E20A 2WKQA 3CUEF 1Z6TA 3NBFA 5CITA 5JSZA 1BIFA 1I4DD 4NYMQ 3IO5A 2AKAB 1SKQA 1NLFA 1N5LA 2BMWA 3KFXA 5TDHA 4XWOA 3BH6A 1B0UA 2OT3B 2ECKA 4IEEA 2BV3A 3VKWA 4W9MC 2IS4A 3PUZA 3C5HA 2J59A 2N46A 2H92A 2B8TA 3JVVA 3B9QA 2ASEA 2VBCA 3AVOA 4BEBA 2BKUA 1UADA 1DAMA 3LWNA 4TTQA 1JQJC 1GL9B 2KSQA 4Q7JB 1IJEA 1OJLA 2EFDB 2WM9B 3U4QA 3VKGA 4WIAA 3LVBA 2JGNA 4JJZA 3U44A 5DHAA 1UKYA 4D4LA 1A1VA 2YNMA 4D4KA 3RNLA 3W6OA 1LVGA 2D2FA 4PXAA 2ZTSA 5DGXA 3ZJYA 1Z29A 2ZS8A 2XOKD 3GLHB 2IF0A 2AXPA 3LBNA 3RAPR 4BECA 4DDTA 5BW8A 1JR3D 1KI4A 4P3YA 1UJ2A 3RS3A 4BUJA 3GMTA 1YZTA 1OHHA 1JI0A 4X8HA 2ZRNA 1E0AA 3NHBA 1EFTA 4XH9B 2PX0A 3W6PA 4BWYA 2OTLB 1L4UA 5TB5A 4UAJA 2OLJA 1JPNA 4DDUA 4D0LB 3QG5A 2BC9A 5A5GA 2IS2A 2J0UA 4D0GA 1QUFA 2CRVA 1UDWA 3EXAA 1SXJB 3CC7B 1XJCA 4PX9A 2IBMA 3GLFE 2QMHA 4PC1A 1IXSB 1TF7A 3PEUA 2Q9AA 2V4ZA 4JLVA 2BF4A 3A4LA 1E94E 2J1LA 1MR3F 2V8OA 5H68A 1TX4B 2IXGA 3D3QA 4A2QA 5DNYB 3SYNA 1IN8A 1JPJA 1UEIA 2OEPA 4KBGA 2GJSA 3QOFA 4TZ0A 2WV9A 3VX4A 4KYIB 2GJAA 3T06B 1OXUA 1KRHA 2ZRHA 3UKDA 2D3WA 1N0WA 2X19A 1AQYA 2F9MA 1IJFA 1CRQA 2GTPA 5L3SA 5JHHB 2PEZA 4UNNA 1Z6AA 1QG0A 4HE6A 1CTQA 1SVLA 2V6IA 1P9WA 1KI6B 2G3YA 1YVDA 4BFSA 2O8BA 5KSPA 1AZSC 3C14C 4UNQA 2IWRA 4MRRA 3TAHA 1KK2A 4FMCF 2AR7A 1E9CA 1T0JB 2ZJBA 2A7QA 2W00A 2ZSBA 4AURA 3MHPA 1TUIA 1DADA 1G3UA 4LGMA 4B76A 4Q4AB 1E98A 1O3YA 4RD4A 3R20A 2AFHE 4XTRA 4DKXA 1ZNXA 1SXJD 4NCJA 5FUYA 1OFTA 1GG2A 3GFOA 4HAUA 2QM7A 4LJ9A 1GUAA 3RS7A 4BFXA 3MJRA 2KJQA 2JJ1D 4TLCA 4LZZA 3K70C 4Z8YA 4CZ2A 3QVVA 1FNDA 2QMOA 2IYXA 2W0MA 3HYTA 3V9PA 3AKEA 3HPRA 3PUYA 1LW7A 1VG1A 1P62B 2J0UB 2W58A 2WJYA 2ZSEA 721PA 5TMPA 1NNEA 2JDID 3X1WA 2EW1A 3UXMA 1QDEA 1D8TA 1HTWA 4MKIA 4US1R 1EWYA 1FFHA 1MT0A 3FMPB 4FCTA 1XXHB 4DQKA 4OHZA 4KXFB 3FJOA 4WXRA 1Z2AA 4XVRA 3KJGA 1ETUA 1XD2A 4CEHA 1NIJA 2JLSA 1HYQA 4ZDIA 1RVDA 5DI3A 2JLQA 1RRFA 2ZYVX 5SZHB 2WSSA 2CL7X 3R9IA 1IY1A 3WNBA 1NVUQ 1T0HB 1Q0UA 1NMYA 4JSYA 5EXXA 1KYIA 3RS5A 1NBMD 2ZROA 5KU1A 2C95A 2ANBA 4V0LA 4B2PA 4JLMA 2JLRA 1U90A 1Z0DA 1QHYA 3LW8A 4AWXA 5KTYA 1KI6A 1ZNWA 3F5FA 2QEQA 1G8HA 4R2HA 4B2IA 4RCYA 1I2DA 3MWLA 4EPTA 3V76A 3UWOA 1XP8A 4JT4A 2DBYA 2QPAA 1ZYUA 1OPXA 2I1QA 2EYUA 2ZRPA 4IXNA 3GEHA 3A1WA 2OFXA 1XE1A 4R71A
chains in the Genus database with same CATH superfamily
3CZ5A 4S2EA 4MGHA 3DFZA 1YZFA 2HQRA 2VDVE 1V16B 4Q02A 2G9ZA 2YASA 3TJRA 2QGFA 4HDOB 5EIEA 4PONA 3C97A 4MH0R 5EWMB 3WMXA 5M5BA 1MT3A 3CCUB 1OI2A 1GFIA 2CLDX 1TYDE 4JAVC 3RROA 2QNIA 3LUJA 1LZLA 2PX8A 2G80A 4BJ3A 2BTQB 3ELWA 3NCTA 3TLXA 4X7DA 1PJ5A 3NDIA 2AS0A 1VZ3A 2FN9A 5AKZA 1IDOA 4KBYA 1O95C 2F59A 3WQZA 5TPWA 2YZNA 1IUNA 1Z5UA 3K7EA 3KKNA 4RIIA 2ID8A 3U3KA 4WZ6A 4WW0A 1ENPA 1NGSA 5HIKA 1QQAA 2E55A 2FFJA 2C1XA 4FYVA 2SBTA 4R68A 3EH1A 4U3JB 3AT1A 5EC8A 2Y1DA 3JTEA 2JF0A 3CB4A 1JTVA 4BZZA 4OOFA 2BR3A 4J75A 3UOWA 2FP4B 1JKXA 2QL5A 3DZBA 2LD4A 5AM2A 1EAYA 3B8HA 3H5IA 2HMSA 4QOFA 4RSMA 5EXPA 4U9UA 3D0KA 4QDKA 3P0IA 4C0XA 1I18A 1M6NA 2VQ6A 1SRQA 2TMYA 2ZBRA 3I8SA 1IBKB 2QZ9A 5JTTA 4AP5A 3H1BA 4NNPA 2CKDA 3HFGA 3TCXB 2NTEA 2R48A 4K9QA 3OQIB 1C0IA 4PHTA 3WHLA 3GELA 2HYDA 3VGJA 3OFVA 3FKJA 1YU9A 2VRCD 2AMLA 1GEEA 3D3WA 3NHAA 4OLBA 2ZT6A 3LDFA 3TL2A 3OECA 3SKXA 1FU8A 3T7IA 3TE6A 2QLJA 1XJ0A 4PANA 4MCIA 1P4AA 2P9GA 5K0GA 2FB9A 1SVIA 1R37A 1S8NA 2OQRA 4Z7JA 2VBIA 1PN3A 2AOTB 1H94A 3TIXB 1J2TA 3ZV5A 1WD5A 2Y9PB 3QU9A 2X23A 4RH1A 3T61A 4AKEA 4JLBA 5KCMA 5FO0A 2O5EA 2ILVA 3KL9A 1WXHA 3HEAA 1T5TA 3IFSA 2YQZA 4ND8B 1O57A 3WO1A 4F2GA 3O31A 4B40A 1RXUA 1H1LA 4AS1A 4FDUA 1DNPA 1Y80A 1QFXA 2CVPA 2QLBA 4PYKA 1VPWA 3ND7A 4WDQA 2E89A 1DDIA 2BR4A 5EA2A 4WXHA 3GDOA 3R8XA 2GQFA 1SBZA 1VMEA 4EK9A 3ZW7A 1VQLB 5CA0B 2G5TA 1ZO8A 3C5EA 1H5QA 3N2EA 4IFIA 3NJRA 4H1UA 3NWBA 1DXHA 3C3WA 3VDQA 5KQSA 2YWRA 3GCGA 5I3CA 5AM3A 1I7LA 4UZUA 5I9SA 2GBPA 5BWBA 4Q0MA 1T1SA 4LK2A 4LHZA 1N08A 3JSAA 3T7SA 1RNLA 3A4TA 2L2QA 1NRJB 2FZLA 1UKEA 2LIPA 3JD1A 2YFYA 3K53A 3NYIA 1S3FA 5ED0A 3ST7A 4TYPA 2F1LA 4I14A 3H2IA 3H5TA 1G8FA 4AMUA 1H2XA 1NX6A 2FJPA 4RK6A 3IALA 2BKAA 4XJTA 4RPBA 2OA0A 3VR5D 4IXWA 1A69A 4TKMA 4CM6A 2X0IA 4DMRA 4YFVA 3BXPA 2CFSA 5DT2A 2SCUB 5EZYF 3DH0A 3JQQA 1U0NA 1LFAA 1P1JA 2W2TA 1O5TA 2QI9C 2PT5A 1W29A 1YQQA 5LZ7A 4BP8A 2ZZMA 2HLHA 3RABA 2C82A 1L5HA 3DTTA 3UGTA 1ZUIA 3CH5A 5T5QA 2X2PA 4X71A 1KO5A 2EZTA 2G8LA 2Y0PA 3K1TA 3EPRA 2IK8A 3K6RA 3LBFA 4CUKA 4F3TA 4PGFA 1QB8A 1U04A 4G56A 3BGOS 3FRIA 3PYMA 4AWBA 2OORA 4DPKA 2AG0A 3H04A 5K6AC 1OXTA 5IJXA 4EOGA 4IIFA 2P2GA 2PSJA 2VTKA 2DFTA 2YMLA 3AWIA 2WU0A 3NWOA 1KTIA 1V11B 2ZRJA 3AUTA 3SLNA 2OCBA 2ZIEA 3D6HA 4KCGA 4AJ4A 3RR2A 1JDPA 2YBEA 3CM0A 3DZIA 5DNYB 3LT5A 5T57A 4YJFB 3W7BA 4Q82A 2O1WA 2RCNA 3A58B 5K3FA 4EDHA 1L4BA 3U1TA 1GG5A 1KEPA 3OIFA 2G4VA 3EXHB 1JSRA 3TN7A 2CF5A 4Q9IA 5KHOC 2HLNA 2B35A 4K28A 3H6KA 3DT9A 5DIFA 4BDTA 2V7VA 2P41A 4F1WA 1H8ED 2IEGA 3P9YA 4I9FA 3SQMA 3T5TA 4D9FA 5EWJB 1MHTA 4YUVA 2EEZA 2MIIA 3CSDA 1UDCA 1W25A 4L0DA 1OBOA 4GLJA 4IPTA 1NY6A 1NATA 1UMCA 2VP6A 2QYHA 4XPIA 2Z6AA 1MAHA 4BN4A 4LFBB 2W6IA 1P1KA 4OHKA 4JI4B 1HLFA 2QNRA 1BHQ1 4P8RA 4P0QB 3REGA 3DEIA 1HE3A 1X7YA 3DZFA 5IUKC 5GV7A 1WKBA 1EWKA 1WOSA 2R6ZA 3A6EA 1KSHA 4TKVA 5FWXB 5M04A 4O4IB 1GEGA 1HSZA 1Z12A 3OHPA 2Q5FA 2ZS7A 3EAGA 5K03A 1I30A 1MJHA 1UBNA 5IK2A 4YBRA 5CAEB 1XYGA 1PJRA 4Z4IA 5K3SA 2A92A 4FMPA 4NPHA 2GEKA 4LJ5A 4YAFA 1QHHA 2DBRA 4M9QA 5LZ9A 2QL7A 1WORA 1M1YA 2BBTA 3M8KA 3D7KA 1PI3A 3W3AA 5KZMB 3RC8A 2HRZA 1E3XA 2A94A 4MGYR 1K88A 1ISJA 4ZCRA 2ZWAA 4JA2A 3SX4A 4O4LB 3D6UA 3DE4X 3J80A 4Z0NA 4F91B 4JJ7A 5IC5A 3S4YA 1Z5NA 4NONA 2QX9A 2BISA 2WNHA 3QJ5A 3OLQA 4QNNA 2EVWX 4Q3CA 3BE4A 1JDVA 1NTRA 1H6CA 4O8CA 1WMBA 2BMDA 3S5UA 2DQSA 2EGHA 1NJ8A 2Z2IA 1N3IA 3DB1A 1P5FA 2ZVDA 4Z54A 3CZMA 1XLVA 2WOOA 3H3XA 4ZVRA 4MS3A 3G5TA 4YELA 4Q16A 2X5OA 3ZKAA 2Y0EA 3ZIDA 2AKYA 3KJIA 5I6DA 2IYSA 1AOXA 4GHWA 4YCSA 3CONA 3LY5A 4XD7D 5B7NA 2RGNA 3D3WB 1YDHA 4YV7A 3RYCB 4DSZA 3TGPA 3MFYA 4I99A 1DBSA 3E8MA 3TSWA 3ZKWB 2RE8A 3DW3X 4Q7EA 4UNIA 3JZDA 4MUXA 1YGPA 3T1OA 3RM3A 2FLKA 1M6VB 4AF7A 1XLTC 5H81A 2Q1XA 1ZAYA 4E5NA 2PCJA 1UWVA 4YAEA 3DE7X 3PUIA 5CFLA 1GGKA 3KB1A 1MC4A 3VR5H 2WPDA 4Q05A 2PIAA 1P7WA 1YZ3A 4LC0A 4F93B 1E1DA 1GU7A 1PR6A 3EFEA 4I1OA 2XYGA 1L5MA 5KSWB 2GHQA 3NBZC 4OQYA 1DWPA 3M1IA 3JVEA 1H42A 1CS0B 4TMZA 1JJFA 2GBLA 3JZIA 3PPYA 5KNBH 2FA9A 1IOZA 1NQ5A 2RG1A 2W4QA 3UMRA 4ENTA 4JBGA 3DZKA 3DZJA 4W82A 1GFSA 1QZUA 3SQOA 3TLCA 3QLEA 2HWUA 1E2DA 5CVCA 3AL0C 2VCHA 1USGA 4U6QA 2FY8A 4C7JA 2Y0BA 1TE2A 4UVHA 2W2VA 4E0BA 3GP3A 2OUIA 2KLHA 3FWPA 1ISMA 4H1TA 1ONPA 2FW8A 5FDFA 1OXSC 3WL5A 3PU6A 4MB2A 5CXSA 2PWYA 3RSOA 2QTLA 1JHMA 1DKQA 2BEKA 3NALA 2Q46A 4PTZA 4TKLA 1RHMA 2CLOB 3I9LA 3MCTA 3ZDEA 3E9EA 3GN2A 2VXCA 4FC6A 5I4KA 3R0JA 3ZCVA 2VJCA 3L6RA 1T8UA 1GPKA 2MMGA 3LT0A 3PUNA 3AJEA 3FPGA 5LQAA 5EHIA 3WFZA 3EJ6A 1DEKA 1J8FA 1GTVA 2DYKA 2QTBA 4EGFA 2B0CA 1Y5IA 4JC0A 4E1BA 3V2HA 2B9EA 3JQCA 2P9JA 5HGJA 3CPSA 5F7XA 1TMKA 4I3FA 2ZZFA 3GLGB 2IXBA 4GBMA 5KC9A 1T2CA 1OWMA 1ZRHA 1W9MA 5KSZA 1QHGA 1C8VB 4HQ0A 1PTJC 2W0SA 5EJ9A 2DAPA 3MTQA 3RPEA 4RVCA 3HGQA 4XGNA 5DBFA 3KWMA 3PT9A 1C9KA 2RGDA 4KJZA 4RPJA 1FMTA 1QORA 3BBLA 1HY3A 2IY9A 1PGNA 1XCPA 3OOCA 2VP2A 3HL4A 5EWLB 3AUFA 1KZGB 5A2QA 1O9BA 2YR0A 1O58A 3OZ7A 5GONF 3WRVA 4BNMA 1MO3A 1WX1A 2RD2A 4KU4A 1RJWA 1YE5A 1S2IA 2VCEA 4IVPA 4I6GA 1WP4A 4P6YA 1GZ7A 1M10A 4KK4A 3WE7A 2VNJA 3EISA 5F2NA 4A2PA 4JVSB 5IJ0A 1W4ZA 4BV8A 1T9GR 2OD9A 3B3JA 4XGKA 4Z9YA 5TF0A 4EEZA 1BJTA 1EFVA 4LPSA 3DVAA 4ZQBA 2I67A 4CVNA 2QT0A 5IHPA 5WRFA 3R3SA 2Q7XA 4NULA 1YIOA 2Z56A 3CHYA 3RIYA 4U4AA 4G37A 3VV3A 2E48A 2PBLA 3V4FA 4FMDB 4B7CA 2YWEA 4BBPA 3QSYA 1Z3CA 3E9RA 3K8OE 3LQ2A 3LFUA 3UKJA 1TCAA 2D4HA 3CCEB 4M0KA 5K0CA 2H1OA 3QU2A 1KVTA 4JT8A 3X1MA 4CEJB 2EQBA 3CRQA 5JZVA 5HIMA 3L8HA 3AEKA 3CTMA 4Y2QA 3I2JA 1NW8A 4MI3A 3P97A 5TGDA 3E0XA 3MYRA 4QDXA 3V2UA 5BYJA 2EWMA 2WWXA 2ZBDA 2H7VA 3OJOA 1EG2A 2BFCA 2GJ4A 3OZXA 4MUJA 2HY7A 3STVA 4KPFC 5CVTA 2VAPA 2B4RO 3UT6A 4NENB 3KXDA 1PJLA 2GO1A 1T25A 4G0QA 3KIPA 5KQMA 3ICPA 1H3EA 3MRVA 4YMIA 4CM9D 3KC2A 3PFIA 4UFPA 1FYWA 4FXOA 4O3MA 3BTOA 1Y1RA 4DSAA 1MZPA 4EMBA 2I22A 4P92A 1EVQA 3REQA 3ASPA 5AVYA 3FDXA 1CQIA 1VJ0A 4EX6A 3FTPA 5IYZB 4TV8F 2NV6A 4D96A 2F7SA 4J4HA 5HOQA 1F9EA 5CT4A 3UAYA 3GZJA 3FOFC 1C3OB 1Y1TA 5HE8A 4O63O 5AKJA 3GLIE 1PKEA 2I03A 1E7MA 2MYPA 1DRUA 1MQ9A 3JR7A 4HVLA 5BXYA 2HA5A 2AFIB 4Q39A 2IUUA 3TBKA 2J3QA 3INYA 5D8DA 3IUEA 1RBMA 4URUR 3BRWA 3C6BA 1WG8A 3ZDCA 4LDAA 1G4AE 2BDEA 2FZEA 2DUMA 1U7UA 1UJBA 3PR3A 1YCFA 3THXA 2R6AA 1ISSA 2VWPA 2ZUFA 2R5WA 3O8QA 5K0ZA 1N33B 3UICA 2R0QC 4IWYA 4W9RA 3LPMA 4N6OA 2V9PA 1NBOA 3G82C 1BRMA 3N3BC 3VYSB 2UUAB 1G63A 2BOVA 4DRXB 1FDTA 1RAAA 3L0SA 1G9TA 2X0JA 3F98A 4P4GA 3HKDB 5IKOA 3ZDZB 3EAFA 5EQFA 4KLNA 2H51A 1ADBA 1SBCA 2XWBF 3KLBA 2PGXA 2XYQA 5FO1A 3KR2A 3WLAA 4HWOA 5E9QA 5TXGA 1HE2A 4MLZA 4YALA 1NVVQ 2QX7A 3MFQA 4HT3B 1ZIYA 5CH8A 3NNSA 3U44B 3SHVA 4BKMA 2IITA 2CHVA 5L9AA 5KNBA 3RFCA 5EOVA 1B6TA 4DTIA 1CDZA 2O3TA 1KNQA 2DP4E 2J07A 1PJ4A 3FVVA 2GETA 1XVVA 4QECA 3BIOA 1EGVB 1E96A 4QUBA 5EE1A 2C94A 4BJ6A 3FETA 2O6LA 3OU6A 5F1YA 2FEOA 1BE0A 3MSCA 4YDQA 1WMDA 2CW5A 4LSGA 1MAAA 3Q3AA 5IAEA 3L92A 4ARBA 2JGDA 5AVWA 4OHOA 1Z5WA 1QHNA 2JK0A 3OM8A 3PXDA 1E63A 4ZT4A 3W2GA 4DSNA 3D5QA 3PFFA 3W5BA 2VZEA 3GH3A 2V65A 3G2MA 1ZJWA 3M4XA 1BA3A 3FOEC 2DTDA 1Y8CA 2O2IA 3BA1A 2LVBA 5HMMA 2BMAA 1XZCA 3CBQA 2WKWA 4G81A 3KU4A 3OU7A 2Z5VA 4MQ4A 2PV7A 2RKWA 5JAIA 4CIDA 3BJRA 3LXRA 1DCKA 3PRHA 4C08A 5GADl 3BVPA 3GA0A 2ZIZA 2Z57A 5JPDA 2N0SA 4QX6A 3UV6A 1TO2E 2ZS9A 1Q0QA 4AG6A 2HRBA 1YF3A 3Q2IA 2QR5A 1P2FA 3WRWA 3EB9A 5EIWA 3S2EA 1I32A 5E8RA 1N2CB 3BWXA 4MROA 4Q48A 3RKSA 4WLEA 4G0NA 1MDFA 5I7AA 2NO6A 1GPBA 4L57A 4C4ZA 3F7TA 4Q3KA 5CU7A 4A27A 1TADA 3DQPA 4QG7A 1I4EB 2OHFA 4Q6WA 4LX8A 5C0OE 4EO4A 1QQBA 5G1NA 1GD1O 5DASA 1KFCB 1UZAA 4FYJA 5JH7B 3C4QA 4HCJA 3WLFA 3K9BA 1V7PC 2KMLA 2KI5A 3FI9A 3EEBA 1PO7A 4KI0A 1J8VA 3C45A 4BRUA 1FTNA 4O59O 3WJ2A 1Z8NA 4WESA 5L7YA 5EE9A 5C8YA 1MGPA 4ED9A 2XOKA 4C14A 4C43A 2IUSA 5I51A 3UW3A 1C9EA 3AJDA 3QEOA 2BKVA 2ZB8A 4DJTA 3A9CA 2EF1A 1Z74A 2AT1A 1R0XA 5IJ0B 3PXUA 3O4GA 3UJ3X 4AD8A 1NFQA 4U7WA 1DL5A 1UC8A 2AEMA 2AH5A 1TNDA 4M9SA 4RTMA 1FQOA 2Z2XA 4XAQA 1YE3A 4JJ8A 4EKEA 4EIWA 1ZUNB 3SMQA 3NH6A 4MVJA 3HP1A 2HREA 3N59A 4JDUA 1TYCA 6ABPA 3E48A 4EBBA 1HM5A 4URYR 4TTIA 2V97A 5A1TA 1NVVR 5I9LA 2FFBA 2OBYA 1T4CB 1KVRA 1HA3A 2D0PB 5CK5A 1SM4A 13PKA 1EGMB 1J0DA 2HJHA 2XPCA 2NU7B 2IF2A 2YZ7A 4PLFA 4Q1CA 4OQXA 5EGSA 4W5NA 2WM3A 4NATA 3F5SA 4X91A 2UVQA 2FN7A 1DBRA 1V16A 5GZ6A 1BZYA 2H06A 1A4IA 4KQEA 1Y63A 4V0MA 3I5UA 4U0JA 3QVLA 3LDUA 3TW6A 4NJEA 1OQAA 1EXDA 1U81A 4X7FA 1Q3TA 3ADDA 4FBLA 1SC1A 3N8HA 3OPVA 2BWJA 1CJKC 2R6FA 1ZR4A 1W36D 3KKQA 4O1HA 4LF5B 2HT6A 1SUEA 4LSWA 3VDXA 5F3WB 1VP9A 4KIWA 2FZWA 4FLEA 4O0LA 4W1RA 1ZD5A 4HEQA 5E7MA 3MIZA 4J1SA 1IUPA 4UAUA 1SBTA 2ZJ3A 5CTAA 1FP4A 2NSLA 5AJTA 4CRWB 3DLHA 2ATXA 4JYMA 3IVCA 4Y1GA 3NQ41 5K4GA 1RRKA 4E22A 2CJFA 3TKAA 4EW3A 2VUTA 4GQAA 3ZI4A 2F43A 1HF3A 5HZMA 1YI0A 2A9KA 4E2WA 3KCNA 5HFJA 4XCQA 4MYSA 2FSIA 1LSJA 2Z43A 2HJ9A 5SZIA 3QIVA 4UBIA 3GPDG 1SCIA 1GG8A 3E61A 4C1BA 3PA2A 2XAAA 4FMCB 1WPQA 2BPOA 2BEJA 5EJEA 3CUWA 2QD2A 1AD2A 1A72A 1TAQA 3F6SA 5LD2B 2EHDA 3EGOA 2J0EA 5DOZA 3PHHA 3KB2A 3SYTA 4BS9A 3V42A 4DLLA 2XTAA 1KC3A 1YR8A 2G04A 2GN1A 3IILA 4P4SB 3ZNQA 2PTHA 2DWOA 4N9WA 4QVAA 4QXMA 4UMDA 4WCVA 4UTPA 3KCQA 2OCLA 3TMYA 3A05A 4CPDA 1DX9A 5HKBA 2FK8A 4XR6A 2EBUA 1Q17A 3C3PA 3ETCA 3OY2A 2PZAA 4J0EA 4KQJA 4P98A 4CT5A 4LMRA 3KYDA 3SM3A 1MGOA 2OCGA 5DGCA 5DGDA 5ER6A 1A8HA 4LECA 5BOSB 3OSZA 4JLWA 5J4KA 2XGOA 3R5KA 1O5IA 1YVPA 5DP1A 2YUIA 1I3OA 3IMCA 3M33A 2GPNA 3HKDA 4X45A 4AKHA 3I05A 3WGHA 2OZLA 1XQVA 2Q1YA 1HRKA 1M5TA 4NDNE 1ZU5A 4YCDA 2WJZB 2G0NA 1N6HA 5FP0A 4JQZA 3MBOA 3SN6A 3WMWA 1SUIA 3IP3A 3LHIA 3PQ6A 4JBHA 3A3YA 5LYJF 3T1VA 3ACBA 2C2YA 3E1SA 3MVEA 2G71A 3C1UA 4MKRA 4WRRA 1Q0TA 4K7JA 1AZWA 4KNYA 1PJ7A 3A3OA 1KAGA 2D7DA 4JS0A 1AGNA 4J29A 3OPOA 1X39A 1YDGA 3HB7A 1XL0A 5DCYA 3RUDA 4Z1MD 3QTBA 1XZBA 1OH5A 1Z6YA 4CEHB 1NMQA 3I58A 5BW4A 4RWEA 1T24A 1UKVY 5AP9A 3OMLA 3TBHA 1FJXA 1HZZA 1B0PA 2NSDA 1U7TA 2GYVA 3NBAA 5GJWC 1FIUA 3GHHA 1K66A 2H5JA 5FQOA 4UM9B 2CNDA 4PZ9A 1M8GA 4LNAA 4C6HA 2X6TA 3A4MA 4HQFA 2I6GA 1XKLA 2DB3A 3CNHA 4PSKA 5D85A 4WVLA 2CUKA 1VI2A 2QROA 2GN2A 1PL6A 3BFVA 3QVUA 4UVGA 5DISB 3KVVA 3ZCUA 2FEPA 3K32A 5CNMA 4B80A 1V5VA 5BWCA 2W2LA 4WZBA 5LLSA 2YWGA 1PYGA 2WF8A 4K9SA 5LP6F 1ZS9A 4RQBA 2I66A 3ZU6A 4BO5A 3HKBB 1NUHA 1G5RA 2AOUB 1D2AA 2HO5A 1N57A 2Q0QA 1R8JA 3B3FA 3K9HA 4I66A 1R88A 3OU2A 4J91A 4P5DA 4RV5A 2PRZA 4XUCA 3EIFA 4B6JA 3CE6A 3GL9A 3P4UA 4Q3EA 1Z8DA 1JIQA 5PNTA 3FLMA 3SQLA 4C5CA 1Q91A 3CJQA 5IYRA 4QYTA 4PO3X 4ZEMA 3QV2A 2X2OA 4BNDB 2WWGA 2C7RA 4HVTA 4MA0A 3VPSA 5JCJD 2ETVA 2ACEA 2MSCB 2OB1A 1IEXA 3ETNA 4JLPA 5D3KA 2QTHA 3SZOA 3TB4A 4BQEA 3IHWA 3HB5X 1O03A 3ESZA 1B0ZA 4A0HA 1BU8A 1LQUA 1SKAA 4OQZA 3DL2A 4YASA 3TPZA 3QFSA 3GK3A 3LXUX 3A6DA 1SN7A 3HDVA 3CCLB 2JKZA 5DK4A 5A5VA 1FP1D 2N3ZA 2IDKA 1EJ0A 2OVBA 1N2ZA 3MCZA 5EFOA 3OFNA 4C7OA 3PNLA 1JPVA 1JFFB 1Q57A 2F17A 2DIEA 2V8BA 3KYJB 1KO1A 3M6UA 1M6VA 3BT7A 1ISIA 2P9HA 2VP9A 4R05A 3ZHUA 4DM4A 4RY0A 1STOA 2R8BA 1U0FA 2AI3A 1TU4A 1V48A 4JZYA 4TQ9A 4HY3A 3WQRA 1SHLA 2A0FA 5HK9A 2BMJA 2V7PA 5F2OA 3GLIA 5DX1A 5GJVC 4LDQA 3S68A 3GFSA 5FA8A 2OUKA 3CUTA 1IPFA 5A7FA 1CF2O 1QPGA 4D8VA 1U1FA 2CSUA 2F64A 5I8ZA 3ZU4A 3L8MA 3DMYA 4BWGA 1ZJYA 1CB0A 4Z4SA 1JLMA 4HEJA 4KGXA 4PSDA 1CZNA 4YJKA 2GHRA 1CRZA 4AJNA 1G1MA 1SOVA 1TU3A 3VYUB 2H59A 2CHQA 4J4TA 5JO0A 1K7XB 1GR1A 1W46A 5CEEA 4XM3A 3JQPA 4Y9UA 3A10A 5HE9A 4U2CA 2VR1A 3F7NA 4Q5IA 2EKQA 1B26A 3IT1A 2PFGA 4NFLA 1WVGA 3KZXA 4CM3A 4Q3OA 4FCWA 5BUZA 1ONNA 5IFKA 2G0AA 4Q4HA 5DYYA 4TL7A 1KAEA 1B4DA 1FFWA 2JRCA 3GGSA 1XFDA 4Z3KA 3V80A 5J4HA 4AN4A 1LDMA 3HCDA 5HZBA 3LLMA 4S1NA 4YRFA 4IH4A 3KQUA 1O94A 1M75A 3FVWA 1WF3A 3Q3GE 4I4TA 4ESHA 3SY8A 2XX3A 3BJMA 1PR9A 4QYIA 1PJBA 2PZMA 1F0YA 3G85A 3LQ1A 5H02A 3ZWCA 2HSJA 5JD3A 1UKZA 1LKZA 1E32A 1V45E 1XDZA 3WB1A 2C7GA 4R1MA 3ASQA 2V6BA 4P4SA 2CHFA 2UZ1B 2WHXA 4TLBA 4NTZA 3PQ2A 2JFXA 4KN8A 2EZ4A 3DW1X 4PE5B 2H1IA 4J2TA 1Z36A 4AG5A 2QRPA 2GDJA 2B4AA 4JJ4A 3EWAA 2FHPA 2KYRA 2P6MA 4TXJA 3AF2A 5F21A 5IZCC 5JS7A 4JR1A 2X0EA 1SUCA 1BC5A 1ZWKA 3PLNA 4NMMA 4IKOA 2LCFA 5CDTA 1E99A 4O0MA 3E3LA 2PAAA 2YMPA 4LYAA 2B34A 2HQ1A 5LMZA 1SCUB 4I5FA 3RQSA 2ATVA 1G0NA 5JZMA 1ZBDA 3V4RA 1YS1X 3X2FA 4B4DA 1XMIA 1FFDA 2HRQA 5G3ZA 4GLBA 3OPYA 1VCNA 3IP8A 1ZOOA 1NW4A 2J4DA 4M88A 3BSSA 3GLUA 4UM9D 5D51S 3ESRA 1R0SA 1LPSA 2VJYA 4R7TA 1QGUA 1T91A 2RHTA 5JFGA 4ZOLA 2JZCA 3PXGA 2RC5A 2ID9A 2B4YA 5TR9A 1RJ9B 2FSVA 1TMYA 3DAHA 2I29A 2OL4A 3KYIB 5B58C 4QEDA 1WMSA 1LD3A 3AHCA 4DIEA 4NMXB 3GNLA 1KJWA 3HY4A 4BX8A 2O0KA 4P4NA 3E7PA 3AEUB 2FK7A 1QCCA 4IINA 1JXOA 1Y5NA 2FNAA 3MUNA 4LE0A 1U6KA 3SIPA 3LOPA 4TLAA 3NATA 4AZWA 3L77A 1F0PA 2BHRA 4DBLE 2Q9BA 3DPSA 2AJ8A 4OI2A 5JISA 4A23A 4AMGA 1XTRA 3AH8A 3RWBA 1U8XX 2EBWA 4IM7A 3SHTA 1LUAA 4NBTA 1PWZA 3LW7A 1M7BA 4R54A 4AQ7A 2I6TA 4QQRA 2QORA 2VYVD 2RGRA 3EVFA 1QWOA 4UUMA 2I34A 1ZDMA 3LP5A 5F2EA 1NKTA 1U0EA 3HKBA 3JYOA 1E2LA 4EFDA 2CMKA 2GJ9A 5JXWA 1KY2A 4MVJH 1PJTA 5FR1A 1KH1A 2Y4OA 4E5VA 4W1PA 2ZE7A 4QHTA 3E9CA 3EC1A 1JIIA 3PZRA 4K9PA 4GM1A 4XGRA 2QTZA 1JKIA 2D1FA 4DMKA 3VX3A 2H11A 4K40A 3TQSA 4OLAA 5DBEX 5BYAA 2PMBA 5CLIA 4R3UC 4QTXA 1VHJA 1SIBE 2ZE6A 3F8WA 1CHNA 4PAAA 4JC8A 4QPPA 3ZY6A 1X7ZA 3DQQA 3KPYA 4X7EA 1QH0A 1JG2A 2R62A 3WKBA 4DT1B 3NIBA 3NU1A 5CB4A 1F48A 1C5KA 3OIVA 1XTSA 4X00A 3ZBUA 1M0EA 1SUBA 4UXJA 3UXYA 3D7MA 3BH7A 3GPBA 4LMBA 1RT9A 2FFAA 3PK0A 4LMAA 4QSHA 2RFLA 2WVHA 4DDMA 5IJ9B 4YV1A 5LFAA 3UK7A 4FGZA 4DILA 4LX0A 4H6XA 1XKTA 2GX6A 4PG6A 1B41A 2IHJA 3OQOA 3W6PA 3I61A 1RZUA 2WVAA 3K0EA 3OQPA 3GCZA 3MZ0A 5EE5B 4OHWA 1HNXB 3O9MA 4PG4A 4YRKA 1N5JA 1ZXLA 2X22A 3A28A 3AQIA 4PVDA 1DFIA 4TZKA 3NIDB 1AC5A 1ML3A 2YV4A 3IPAA 3THRA 4YCMA 4PZUA 5TJ9A 4UW9A 4Z86A 5CP8A 2RC6A 5DLEA 1HO3A 2YZGA 5BT8A 1EM6A 1RYHA 5CBPA 4MQUA 5EESA 1L5LA 2DWUA 1U6JA 2NU6A 4KZPA 3R7FA 1K7YA 4L9AA 2LCIA 1J2RA 4IIJB 2UV8A 1ZK2A 5LQDA 2C00A 2H18A 3AERA 3EUWA 4DUGA 2HRCA 1NZDA 3RS3A 1USKA 2AGVA 2XT9A 4Q18A 2XEXA 3W78A 2XUZA 4O4IA 2W6PA 3VYTB 4AZ3B 4EY8A 2ZEJA 3FYUC 3IVXA 4K3UA 5CM9C 3KLMX 5CB8A 1E3LA 4NBWA 4M1OA 5HQJA 1PZGA 1Z4KA 2VHUA 3NDPA 3RARA 4A82A 4DXHA 2HLDD 2W7TA 2RARA 1TM7E 3IO3A 1V3QE 2OSBA 1JLKA 4HEA6 4B35A 4C6TA 3QYFA 3G68A 1M1YB 3FOCA 3HCPA 4YS6A 5L40A 1KJ9A 3BICA 1LBEA 1YONA 4GICA 3HZZA 2P35A 2YWHA 5J2TB 2WAOA 2QN6A 3EJWA 3ENNA 5TRTA 1CJTC 2WAXA 2QSZA 4L08A 3CVJA 1C1YA 5JD6A 2XMBA 4YGXB 2VK1A 4OI4A 4GOLD 2BFPA 3NNDA 4P38A 3UPDA 3ZWOA 2O5RA 2VPQA 2BZGA 2QRJA 1BCSA 2QUBA 4NH0A 5GGYA 3T9DA 4D8UA 3HAGA 4G1FA 1XYVA 2OBBA 4RV4A 4B75A 3OJWA 3SC2B 1U7DA 3DVLA 1BE8A 2JJ2A 1TGYA 2KX7A 4CDRA 1TJ5A 1DEOA 5I7UA 4D99A 2C7QA 2Y1KA 3L4BC 1FC0A 2A5JA 2P11A 3BM5A 3MAJA 3CESA 1N2EA 2XF8A 3FSJX 3PR2B 1RADA 1N6PA 2Q3BA 5HRUA 5B4TA 1ZQ1A 2B21A 3A6LA 3K1ZA 2R4UA 1SUAA 3OLYA 3KQHA 4ZJYA 4ZV9A 2IYVA 2XQVA 3LLUA 4ROTA 2FX3A 3QVOA 5TQ0A 4ZVTA 2YCBA 1MENA 2AOVA 1CB7A 3SHFA 4BTEA 1TDJA 1X86B 1J70A 3GFRA 3L7DA 3N3AC 4QPZA 2BFEA 3ADBA 4E5PA 1Z75A 1XCGB 3FTCA 3ZWQA 2CCJA 4A0SA 1KY5A 1P45A 1DIBA 1WCIB 1Y9AA 3FUWA 4K3VA 4KGDA 3IR7A 1LBIA 2RKBA 2EX1A 4XYGA 1PFQA 2JI8A 2WG1A 4JR0A 5AUOB 1SRRA 5CFQA 1YJ9B 2PUDA 2VCYA 2VBFA 1W1IA 1Y6JA 4FFOA 3G0HA 5JCZA 4EO7A 4MTLA 3B1FA 2ZTHA 2I76A 4NZMA 3FHCB 4PLPA 4D5EA 1SVMA 4H18A 5BSVA 4I1IA 5IT5A 2Y99A 1D0IA 3FWNA 3OEYA 4DQUA 1QIDA 1HYGA 5HZHA 2QRQA 5HF5A 5C5IA 3P0RA 4Y2UA 5DK6A 1JZSA 1CJMA 1GL7A 1LVHA 1TL7C 2O0JA 3H9EO 3NAQA 2AWOA 4RHCA 4RETA 4Q4AA 3D3NA 2DPHA 3MNFA 1G2QA 2VP4A 3WIBA 1ZJ5A 3FKSA 2H0RA 2R84A 5KQPA 3KQYA 3J81k 1QIEA 2XWSA 1AHHA 1DBWA 4J2HA 2E82A 3VA7A 1QZZA 2GWHA 3NM6B 3SS9X 1KJYA 1X6VA 4G9GA 3STUA 4G0WA 1EM8B 1QHSA 1UJNA 3DNMA 4W5WA 1U4NA 2AQ8A 3RYIA 4HAWA 1XN1A 1T8SA 3B1ZA 2PWZA 3RSFA 4YP5A 4GKJB 3AM3A 3FSGA 4M38A 3SBEA 5HTOA 1KMHA 4FFBA 2Z9CA 1CHDA 3P9QA 2FN3A 2PGOA 3K09A 1WUIS 4XARA 1X7ZB 2DX7A 2J3EA 2EHJA 4RSGA 1IQUA 1F8XA 2H4YA 5DGHA 2H5LA 1K73D 3GEIA 5JAQA 2IZ0A 1SZPA 3RU2A 4DFDA 4TVSA 5C80A 5LZ2A 1DQPA 2GS9A 1VPEA 2ONZA 3CVVA 1CIVA 4ADSG 1WP9A 4P4UA 4MQ6A 2FR1A 2I33A 1B8OA 4J0CA 1SOAA 1C1DA 4J9VA 5LR6A 3SZMA 3HYNA 4WT7A 1ISGA 4AYXA 1VDZA 1EP2B 2JRLA 1E6LA 1S1CA 2X9QA 1ZNYA 1PGPA 1HTBA 1LFDB 3BKXA 1KARA 2PO5A 4JUCA 3EOZA 3FPBA 5D3MA 2P3LA 1VTKA 3USZA 4CL8A 1P0QA 1SXPA 5LU8A 1H65A 1BFDA 1VJDA 3L07A 4G8CA 2A59A 1Q1EA 1LSUA 2NO7A 3UWKA 3MQFA 3KZKA 5AI9A 3PNMA 1TCCA 1VYTA 3HM9A 4O2BB 3B7PA