3SJZA

The structure of aif2gamma subunit delta 41-45 from archaeon sulfolobus solfataricus complexed with gdp and gdpnp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
409
structure length
409
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEETIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title HOLD FOR PUBLICATION
rcsb
source organism Sulfolobus solfataricus p2
total genus 95
structure length 409
sequence length 409
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjzA01
2DY1A 3ND9A 1Q81D 1DARA 4YAWA 2HUPA 1CJVC 5C2JB 1BKDR 1HQYE 1KSGA 2GPJA 4PGOA 5CK5A 1QVAA 1P2SA 3X1DA 2HF9A 2NO6A 4IRUB 4GP7A 3U2QA 1N6OA 4AWXA 4HAWA 4QM6A 3QQ5A 4B48A 2RKOA 1ZINA 2H1LA 3AF0A 2FSIA 4LUCA 2HJVA 3VKHA 3SEAA 1DAKA 1T91A 2VF8A 5FR2A 1G8PA 4B71A 3IDQA 1KY3A 2HV8A 5GVRA 1VKJA 1RE0A 4O2LA 1N6IA 2GJ9A 3RC8A 4RCZA 5H59A 4KLNA 3RS2A 3OZXA 2NO7A 1T5LA 2XGJA 1Q57A 1R0WA 4D0NA 4HUQB 2ZPTX 1UFQA 3QG1A 4IOKA 4KBGA 3GLFA 1Z6AA 2JJ8A 3U7GA 5G53C 1Z6XA 3VR2A 3ZGXA 2QMHA 2ZYTX 1OFTA 3BD9A 4NH0A 4F7WA 2I1VB 3IGFA 1E99A 1W0KD 3KB1A 2RC6A 1T4GA 2V4ZA 4L4UA 3VKGA 3LRPA 1MV5A 1NL3A 4B34A 3PVSA 4LPSA 1M7GA 4C30A 1RFLA 4C0QC 3K9GA 3TRFA 4V0OA 5BYJA 2JAQA 5FUWA 1G4UR 2E9SA 3CH5A 2V6IA 2VP6A 3KKNA 4II7A 4MDEA 2AWNA 3HDTA 3T1QA 2WKPA 4CDGA 4RD6A 4CT4B 2C78A 1EK0A 1AQYA 1KK2A 1MKYA 2GTPA 4HB3A 3EZ6A 1UAAA 4JBWA 3I62A 5DHAA 2VHCA 2WMNB 1KZGB 6Q21A 5KSOA 3SBDA 1D8TA 1LV7A 3MWLA 1R0XA 1R5NA 1W2BB 2OV2A 3M1IA 5EXPA 2WJJA 3QKSA 4LC1A 2G0NA 1ZU5A 2YZ2A 2P5TB 4A1FA 4MGKR 4QBHA 4TYQA 4FMDB 1COWD 1H42A 3K9NA 2JLZA 4W7SA 1C4OA 1Z3IX 3B60A 4HE5A 1IY1A 1DOAA 1FNMA 1E0KA 2B21A 3GLFB 3QXJA 3NBXX 3T12A 2C96A 1BX1A 3NHBA 5CM8B 1OH5A 2MSEB 4S35A 421PA 1P73A 3W5JA 2BIFA 5IK2D 4L8GA 1FNDA 2WBLC 1XNJA 3UK6A 5EUQB 8OHMA 4RD2A 1B0UA 4Q1FA 2IX3A 3FDIA 5DE3A 4HDCA 2C98A 4PZZA 4RZXA 3REFA 1KI3A 1CJMA 4GOXA 3ZD6A 2HXYA 2VSFA 3VQTA 1U9IA 3QSYA 2FA9A 3T61A 3GEIA 4D4MA 3T1TA 5FBRB 3I32A 2ODNA 1N5JA 4LV5B 4MYHA 5FFMA 1VQ7B 2FSGA 1P75A 4YHBA 5DI3A 2CJWA 1GTVA 3AVVA 3BWDD 1ESMA 4O25A 5KSPA 1Z0AA 1RYFA 2FX3A 1P61B 1E0AA 1ZIOA 4HDQB 3X1WA 4NYIR 1Z0JA 4PC7A 3CKLA 3CXCB 2QAJA 2Q3MA 3N70A 3QKSB 3C4JA 1ZNZA 4DCNA 2DEUA 1HTWA 2DFLA 1CR4A 2XITA 3C7KA 5KUTA 3G4SB 4MA4A 4BLQA 5FI0B 5IDVA 1MRNA 1X1SA 2QROA 1FPMA 1TU4A 2IXFA 4X8HA 1BX0A 1E2KA 4HLCA 4Z1MA 1Q20A 1VCMA 4GZMA 5IT5A 4QGGA 4RKFA 1KI6B 4UNSA 1S3GA 2QPAA 1JECA 3B7GA 4JVNA 1KZ7B 3MJHA 3ZVMA 5JWOA 2DB3A 1DVRA 1QHXA 1W4RA 4G01B 2B7CA 1QF9A 1N3BA 4JVLA 2NO1A 4YMVA 4BLTA 4KYIB 5HPYB 2P2LA 3Q5DA 3LBNA 4E5UA 1BMFD 4PPGA 3E1SA 2YWGA 1P6XA 3N2EA 4RVCA 4Q1AA 1G7TA 1GP2A 4TQAA 2WAYA 5JWHA 3IUYA 1SM4A 5L3QA 4H9GA 4TMZA 1KO8A 3PEWA 2F7SA 4TQUS 2DWOA 1EGAA 2B5OA 3CC4B 5KNCA 2BCGY 2R9VA 1FQKA 1JB9A 3FTQA 2N46A 1Z0KA 1WCV1 2CJWB 1P9RA 2V7QA 1E2FA 2GHIA 4D0GA 1KAOA 4CF7A 1B2RA 3ADBA 1KRHA 2AD1A 1CS4C 4XJXA 2YWEA 3HYRA 1NG9A 3FE2A 5J4HA 2CLDX 2RGEA 3E5HA 4JLMA 3THXA 2RGGA 4ZKEA 3UWOA 5FL7D 3RRYA 1X1RA 4PAOA 4A2WA 1CIPA 2XOKA 3QKRA 1E1RD 1E2GA 4IOJA 3A58B 3FMPB 4B44A 1OIWA 5CJ2A 3W34A 5THXA 3KB2A 5AR1A 1QHNA 3BBPA 1HT1E 4MYTA 3ZZTA 1XXHE 3LD9A 5B2ZA 1KJZA 4BEJA 2CNWD 2I4IA 1HV8A 3DEFA 2ZJZA 4L15A 2QP4A 5GJCA 4BGDA 2H57A 1A7JA 4HZUA 3E2IA 4JBYA 1VQKB 3NDBB 2F43B 2FN4A 4K1XA 2PIAA 1YZTA 1AJEA 4DCTA 2W6IA 4QL3A 1U2RA 4M1KA 2DBYA 3MRSA 5L3QB 5KDDA 4UJ5A 3TR0A 1QUEA 3DPUA 2N42A 4FCWA 1A5TA 4JMPA 5HR5A 2V9PA 2ZTSA 1XBTA 1J7KA 4L9WA 2YINC 1AGPA 2ZJ8A 3JQRA 1IHUA 2GEVA 5DSZA 3D8BA 1QVFB 1GL6A 1NKTA 2Q21A 5B58C 2C2HA 2AK3A 3KZ1E 4C3ZA 1J8YF 2YC4C 2EFHB 3FKQA 4LK2A 2WWIA 2ZYVX 3JZAA 1DAMA 3THXB 1VQ8B 1UKYA 3GJ5A 4BECA 1NRJB 4Q9HA 3ZQJA 4EPRA 3CRRA 4EPVA 3PEUA 1U0LA 3QKRB 1U8AA 2CL6X 2O0HA 2LWIA 1GL7A 1ZIPA 1VQ5B 4M4SA 2GBLC 3NEYA 4NKRA 4GSYA 4V0KA 4Q1EA 1U98A 3TNFA 3OIVA 4MRPA 5H8WA 1DPFA 2O8BA 1DELA 1UMKA 1II0A 3ICQB 2N1BA 2RHDA 3DVLA 2QA5A 3QNUA 1W34A 2IWHA 1XEWY 4OJKA 4JSYA 5FOWA 2GA8A 4OQLA 3UPUA 1W87A 3BB3A 2JJ1A 2VYQA 1XCGB 3EZ7A 3MSXA 4X8LA 3BJIC 2AKAB 3FMOB 4HLQB 1OIXA 3TQCA 1H85A 5FUVA 3I73A 3MUFA 5J5CA 3FMIA 2WVJA 3QI2A 4DWJA 4JLAA 1CTQA 3FPAA 1YR8A 2IYTA 3Q5EA 3P27A 4B33A 1CLUA 4EFLA 1FNCA 4D4LA 4IHQA 1W48A 1VPLA 3MG9A 2BEKA 4JT4A 1UKVY 1H8ED 2JEOA 4G3XA 3L8YA 4HATA 4V0NA 3AKDA 3CO5A 4B3BA 4MDFA 2QM8A 3RS7A 3RS0A 3QOFA 4WW0A 2B7BA 3QUSA 1FMJA 2PZEA 4NPHA 5JCPA 2VF7A 5JRJA 1TQ2A 3WNBA 3G71B 1R8QA 1KHTA 1Z0DA 3V9PA 3NWJA 2JCSA 1YIJB 1E69A 4AK9A 3A4NA 4U00A 1NDHA 2RGNC 2GZHA 4DB2A 5AJZA 1ZM2A 4FCVA 3QFSA 1GNQA 2YC2C 4N0DA 4M1MA 4Q9JA 3LX5A 1RPZA 2X2FA 1E2QA 5SZKB 3U4QA 2YOGA 5EE3A 1VDZA 2HYIC 4P3YA 1E2JA 3SZRA 3WP0A 1NY5A 3QFTA 1SXJC 2ECKA 4AURA 2NZ8A 2OCPA 4B73A 4TYNA 1KDTA 1OW3B 2ONJA 3PXGA 4QXAA 4M21A 4TT3D 4RZ2A 3CR7A 1NBMA 2ZRMA 1O87A 3TIFA 1II9A 3JZMA 2QAGA 2H18A 3JVUA 1PLJA 4OQNA 5TVKA 1JA0A 2ZE5A 3ZIAD 3CIOA 4FWTA 4LYAA 4QHTA 3U60B 3R9XA 4A0GA 3J81k 1TEXA 1ZUHA 2FMXA 1TLLA 4LHXA 2EFCB 2OSBA 5E7MA 4I1SA 1D2NA 4ZCMA 1ZD8A 4I1VA 3ONWA 4RZ3A 2BMFA 3NH6A 2Q3FA 2ZM5A 1M1KD 5KPDA 1SVMA 4TSFA 4F4JA 2Q9BA 2Z4RA 3AVQA 2HCJB 2ZRHA 4GRAA 4ZO4A 1QG4A 2C03A 2QPTA 1E32A 1W5TA 4M9ZA 3CCUB 2CLCX 2CRVA 1UBCA 1R2QA 1W2HA 3PJRA 3HU2A 4K81B 5JRZA 4NU0A 1YJNB 4ARZA 2ZYWX 4YDSA 1W1WA 1RIFA 4IEIA 3CRQA 5B64A 3I5YA 5B30A 1WDTA 2WWYA 4KYUA 4TLAA 1KJWA 1OHHD 3IO3A 3AF2A 4TL9A 2D2EA 4OHWA 2GXQA 2D06A 4TYYA 2QE7D 1NSFA 1DE0A 1VQNB 1FNNA 2ODWA 5FTLA 1JEEA 3C16C 2C9YA 4KU4A 3AVOA 4JVMA 1G7CA 4B47A 1SVOA 5AJXA 3EW9A 1KO1A 3KJHA 3CX7A 1IN5A 1Z22A 1GSIA 4Q1CA 3VX3A 2CCGA 3IPYA 4B74A 4DQKA 2EVWX 4R98A 3U3OA 3KDSE 2OAP1 3CF0A 4KJZA 3W5HA 4TMTA 1Q82D 2BM1A 4C43A 1AZSC 1G8GA 1L8QA 1RZ3A 2DCUA 3DOEA 5FUYA 4DLXA 2AWOA 2FJUA 2UKDA 4Q9IA 4NCKA 3K0CC 1CEEA 1WA5A 2F1RA 1NMXA 4FWIB 3RAPR 1NJFA 1VQ6B 3NXSA 3UG6A 4JT2A 1IONA 3M6AA 2W2XA 3CH4B 1F2TB 1SKYE 2IW3A 1ONBA 2ZRLA 1YQTA 5LPNA 4U02A 2DWPA 2VA8A 2JGNA 2P65A 5FA6A 4DDVA 2QMUA 2MSCB 2QRZA 3PUWA 2G83A 3LBHA 1P7CA 1KI9A 1P5ZB 2BSAA 4PC6A 1ELOA 1YKSA 3VR3A 3CRVA 4DSUA 2R6HA 2FFHA 3PG5A 4C9BA 3AUXA 5L3SB 3PIRA 3F0TA 4G0NA 3QE2A 2FGKA 5K8TA 3SYNA 2P67A 5LB2A 2AXNA 4LX0A 3GFTA 3MWJA 3KQHA 4LJ4A 2NG1A 4CW7A 5LD2B 4Y9RA 4JLOA 3SNHA 4ASUD 4GDFA 1XRJA 1JB1A 1GZSA 4JSTA 4Z8YA 4P33A 4IVPA 4RJLA 4D25A 1KK3A 3QXHA 1XPOA 1KDPA 4LHZA 1Z07A 2ZRKA 1RJ9A 2NO9A 3OEEA 4AYTA 3A1TA 2F1IA 4QRHA 3WP1B 3VU9A 2BJVA 1EX6A 5H1YA 5G40A 4B3FX 3AP2A 1N6LA 1CJTC 4GBMA 2GESA 4YONB 5FPHA 3PR1A 2O5VA 5DN6A 3AV0B 1UDWA 2I1QA 1JPJA 1FP6A 2ZU0C 4Q9LA 5EJEA 2XAUA 3PUXA 2ZJAA 4YXWD 2ZRCA 2P6RA 2GJAA 5EMNA 3HU1A 4DIEA 3MLEA 1TQ4A 5EUMA 1GUAA 1VYTA 2C5LA 4URXR 3KJGA 3WMFA 2QQEA 4DRZA 4QJ5A 3CZPA 1W35A 1WQ1R 2A3RA 2OK8A 4I81A 3PFIA 1OIVA 1KMHA 1QHIA 2CL0X 1YRAA 4ZGNB 3KQLA 4BFWA 3SDZA 4OI0A 2ZI6A 3GJ3A 1U0JA 4YAUA 3E20A 1VIYA 3RWMB 1YVDA 2RMKA 2J41A 1GAQA 2DHRA 4B3DA 3QENA 2R62A 2WJVA 4LCBA 2P3SA 3NTUA 3I72A 4TL7A 4GMXA 4HLUC 5LDDC 1W36B 3T35A 2R44A 1TTTA 1IBRA 2OM2A 4TTQA 2ONKA 3KTAA 3Q85A 5JECA 3TW8B 2QN6A 2C9OA 5H70A 3VU9B 1BOFA 3B9QA 3SBEA 4URYR 3QF7A 3LXRA 4BFVA 4UNRA 1Q7YD 2P5SA 2CHVA 4BFTA 3GFPA 2FEOA 4BZPA 4NCJA 1BYIA 5CB8A 3H2YA 3RC3A 4PZLA 2ODBA 1T0HB 4HAZA 2FPMA 1XCPA 3B5JA 3IBYA 1LF5A 4G5QA 1OGIA 1G8FA 2WOJA 4KHZA 4F91B 1CRQA 3THWB 5L3VA 2DFKB 3DL0A 3H1TA 5FOUA 4AYWA 1UM8A 2H8KA 2ZSAA 3OE7D 3ZS8A 1O3YA 2J7KA 2HEIA 3D6TB 1QHSA 2XX3A 2FSHA 2QTZA 1ZAKA 5EE0A 5E4FA 5KSWB 3K53A 3CONA 4W5JA 5IF9A 1TEVA 3MWKA 1IM2A 4IDHA 1EWQA 3QXSA 5K8IA 2ANCA 5JHGB 5JEDA 1H8HA 1T3HA 2OXRA 1KSJA 1I7PA 4ZI3A 1EWRA 1P60A 1OYWA 1E0JA 3PQCA 3ZD7A 4EPWA 1WXQA 1VYUA 5FI1B 4FW9A 3NKVA 4Q47A 1G7RA 2ZRDA 4PO8A 5CIWA 4U5XA 4JL6A 3LY5A 1F2UA 4UJ3A 1OFHA 4C4PA 4RCYA 4A8JA 2GETA 3I92A 4BPRA 1TF5A 3W2GA 2R6DA 4ILEA 3NEJA 4H1VA 2F9LA 4IKEA 3ES9A 1P72A 4R2HA 1P9WA 2IYVA 4GP6A 2OK7A 4EH1A 2ZRGA 4EQ6A 3NBYC 5FOVA 4DUGA 2JLWA 1XJ0A 2KI5A 2YVUA 2WIBA 5TV2A 4LGMA 4M2LA 1QGZA 2C04A 4EUNA 2B92A 1U8YA 2IYWA 2BWJA 1XP8A 4A2PA 4URWR 4V0LA 3K70D 2A7QA 2HLDA 3U44A 2JIZD 1P3JA 3QEJA 3U7EB 2IUUA 2QTVB 5EQTA 3TUJC 4LRWA 1A2KC 521PA 5TB5A 3P26A 2RAPA 4OJQA 2JLSA 1E1QD 3CMEB 3SJZA 1K8RA 1JXMA 1AM4D 1E6CA 1IAQA 1MOZA 1SGWA 3RDPA 2VTKA 3SU8A 5J4KA 3THOA 3AKEA 5DYIA 2CMKA 3Q72A 4WIAA 1XMIA 2PBRA 4Q5IA 1E9BA 1D6JA 4ZI2A 5DNYB 4KBFA 3A1UA 4K46A 3RANA 1OXUA 2A5JA 4HDOB 3QY0A 5JS7A 2G88A 3Q3JB 5GJVC 1XXHA 4C0AC 2RC5A 4AI6A 1F2UB 1NSTA 1N5KA 4DT1A 1KOFA 4KLZA 2RGDA 1NVVR 4F38A 4QOSA 2GXSA 5GV7A 1R6BX 4EQ6B 621PA 5P21A 1PLLA 4MKFA 1ZNXA 1CJUC 2EU8A 2IF2A 2OFWA 2QTHA 3NBZC 1X6VA 1EP3B 1Q0UA 3RWOA 3X1XA 5DYGA 3I56B 3LO5A 1E64A 1CULC 5EXXA 3TJZA 3IBGA 4HZIA 2FFQA 1N6RA 2PEZA 3QPWA 1G20E 3OFNA 4E07A 2J0QA 1XTIA 4OHXA 3U44B 2XOKD 1KQSB 1XTKA 1Q44A 1G16A 1SVSA 3SFVA 1EFRA 4Q19A 3ZQ6A 4AKIA 1L4YA 4XVQA 3M4YA 2ZR0A 2WICA 1YI2B 1QG0A 4MUBA 4B4DA 3OEHA 2BBWA 2YJTD 4RFVA 5M04A 4NMMA 1GWNA 1RVDA 1UADA 3CUEF 4B3CA 4Z54A 3TLXA 2X2EA 3BB4A 5J4YA 3KXKA 2GXAA 1IY2A 2J59A 1LF0A 4LJAA 1R0ZA 4TMKA 1US8B 4UXHA 3VX4A 1G6HA 3LQQA 1WBBA 2EW1A 1SXJD 1XXHB 1Q3TA 2W6ID 5GV8A 3EIQA 4P0TA 4EJSA 4MRNA 4WOPA 2BPOA 3AF1A 5AUOB 2EFGA 4DT1B 4Q4LA 3BE4A 1YZQA 4PQRA 2QBYB 3V00A 1AKYA 5JI3E 4XSHA 1OKKD 4ACAA 2X3UA 1V5WA 3FKSD 1N0WA 3KQNA 1G4AE 2AFIE 1JJ7A 2BC9A 4HAXA 1KTVA 2ZI9A 2AR7A 1GNRA 1G64A 2I3BA 1SZPA 2QGZA 2RGXA 4QHSA 3ADKA 3HP1A 1E62A 1OXTA 2IC5A 2PJZA 3CRW1 3MCAA 1XCMA 2CDNA 3EX7C 4MITA 4IOLA 5F9FA 2ZRNA 3WRYC 4ZIRA 4LHYA 4ZDJA 1UKZA 4TN1A 3QKTA 1DS6A 2QSYA 3FHTA 2BBSA 2G1JA 4QNRA 2W00A 4A0FA 4H1UA 5HE9A 2A5YB 1R4AA 1E9RA 1GITA 4BFYA 3FYHA 5TXGA 1ZRHA 3DM9B 3NG1A 1KI6A 3EXAA 4Y0VA 4ZDWA 3T5GA 4P31A 4KITB 2CK3A 3QG5A 4PXAA 1IN7A 2JJ1D 4NCIA 4NYIQ 2ZSEA 4WXPA 3E1YE 3TSOA 4LHVA 3OAAA 1P9NA 1YZLA 1E2LA 3A1WA 4EJSB 2ZJYA 4JZKA 3TVTA 1BYUA 4XWAA 3OIUA 4FMCF 4DB4A 4YAFA 3AVYA 3VR4A 1WRBA 4WZAE 1Z28A 1HQCA 1ZM7A 3CWQA 2QSZA 4XOIA 2B6HA 1AKEA 1ETUA 1XEWX 1XD8A 1N5LA 1RRGA 2LKDA 3LQRA 2EWWA 1BO6A 4QBGB 3RRMA 1NY6A 1Q12A 1CNFA 1JAIA 2OCBA 1KGDA 1KJYA 4RD4A 1P2TA 1A4RA 1G21E 1ZMXA 2J0VA 2VSXA 2Z6VA 2ZAOA 3RRZA 1HYQA 3U7HB 5FPYA 4FMBB 2FG5A 2RH5A 2ERXA 3TBKA 2CLSA 3GEHA 3QPUA 4A15A 4ZIRB 3VNUA 1G8HA 1JQLB 3WBJA 4UQOA 1E0SA 1QH0A 1KI2A 1OGJA 2H16A 3EA0A 4NCNA 5G41A 3RVBA 1CF4A 4DZZA 5HZKA 1JR3D 2F6RA 2FH5B 4N0EA 1QVGB 1ZYUA 2WMOB 3GJ0A 4AKGA 1X8KA 2ANBA 2W83A 3L0PA 4WZBE 3CBQA 3ZJYA 5DGXA 2V54A 3DMNA 3KKOA 1D5CA 4US2R 3WHKA 1ZM9A 1TL7C 4ZDKA 1EFCA 1NBMD 3B8HA 5C4GB 2JLYA 1IJEA 4JJZA 3IHLA 3TW4A 3EIEA 2F43A 1T9HA 4L16A 4M1TA 1OT3A 1G5RA 5F9HA 2EFEB 1W49A 2F3TA 1S8FA 4B2IA 4MGYR 1UBEA 1LVGA 4DJTA 5CK4A 1E2HA 1LNZA 2NPFA 2FWRA 2GF9A 3U3MA 1WB9A 3FMFA 1H65A 2GJKA 1TADA 4OI4A 1SVIA 1VQLB 3ZVRA 1EFTA 5BN4A 1PUIA 2X77A 1IN6A 3LXXA 2J45A 2ZE8A 5F2EA 3TQFA 3ZVLA 3Q7PA 3F3YA 4JYCA 4PC3A 1FDRA 4TSFD 5HKKA 2CHQA 2BKUA 4K8OA 1QFYA 1N6NA 3QE0A 1PLKA 4W5HA 3WMEA 2BOVA 1UF9A 2R6GA 4MQBA 1OYYA 1D9XA 2CE2X 2ZITA 3FWYA 4U9UA 1N2CE 5EP2A 2WWXA 4F4IA 5FOSA 4KFTA 3W8NA 4DCVA 5JBQA 4BZXA 2QTLA 4DLZA 4MUAA 1N8RD 4NYMQ 2KWIA 5KDLA 1N25A 4DLVA 2BJWA 4NZYA 2J5XA 2VP2A 4DSOA 3QFRA 2XZOA 4OK3A 2PMKA 3TE6A 3OIWA 1QUFA 1XX6A 4P4UA 3C14C 1GRQA 2WAXA 4OQFA 1KI1A 2Z5FA 1U9IC 4UKDA 3L0OA 4LBZA 3AVUA 4UNPA 4BUJA 4EPYA 3SS8A 2XTMA 4HI0E 1MT0A 4F93B 5E3HA 1XTJA 4LJ8A 1EXMA 5FR1A 4DC9A 2WWHA 4HE6A 1JNYA 3BFKA 4B43A 4PHHA 4RD1A 4PC2A 1CNEA 4HB4A 1Z0FA 2WJIA 1B23P 2R65A 1R5OA 3HYTA 1E4YA 5HE8A 4FMCB 1K5DA 1NLZA 3IILA 4C2TA 4NYMR 1XJCA 1ZJ6A 4Q01A 4CEHB 3PV0A 4A92A 4P6VF 1OH8A 4LI0A 4ERNA 4HUTA 1W0JA 3K70C 1K6MA 1E2NA 3ZZ0A 2FFAA 5LB4A 2O8EB 2XXAA 3C5CA 4I1OA 5UKDA 3SE0A 2GK7A 1TVCA 5DLQC 4WBSA 1KNXA 2BVNA 1LFDB 2PT5A 4GT1A 4LDJA 4Q7LA 4X8MA 4E22A 4EDHA 3KKMA 3SJBA 4RZUA 1Q3HA 1Q21A 2GK6A 4FIDA 2PT7A 1VG1A 2IYUA 2KE5A 3DKVA 2QT0A 4A0RA 4O0MA 1S9DA 2AN9A 3QIAA 1N0VC 1SKYB 2VYFA 3K9HA 3CW2A 2CVFA 3I3SR 4YLGA 3CCEB 3TH5A 4XD7D 1YJWB 2IWRA 2GNOA 1IN8A 4RSGA 1VQ9B 3AEZA 1SHZA 5F3WB 3SQWA 4PC1A 5CYOA 4M53A 3I55B 2BGJA 4B2PA 4B3GA 5DI9A 4BE7B 2OAQ1 4BEBA 2OEPA 3B9PA 2JDID 4IW3B 3CPEA 4MKIA 1IJFA 4ZGQB 3D3QA 4DLTA 1Y63A 1S3SA 1ZM4A 3CPHA 5AK0A 3W9YA 1E9FA 5JS8A 5TY0A 3P32A 2O0JA 2Q6TA 4R2IA 3VHLB 3VR6A 1COWA 2CHGA 3MMPA 4M0LA 1HUQA 3GMTA 2QRNA 1GKYA 1PJRA 4HB2A 2GCPA 5CYPA 4BFUA 2JLVA 2XXAB 5IK2A 4D4KA 2JA1A 1K9MD 1FTNA 3QPVA 4IDNA 3W6PA 1GFIA 2YWHA 2OXCA 2ZJ2A 3Q7QA 1ZUIA 3W8RA 1A1VA 4HLDA 1VCOA 2ZS7A 3U61B 4TTRA 2IYQA 4PX9A 2ZUCA 2WZQA 4Q1DA 3MD0A 1EG7A 2XJ9A 3RHFA 1WMSA 2EQBA 3GP8A 4CEJB 1IXRC 1IN4A 5JHHB 1GVNB 3FJOA 4FD2A 2CNDA 4NP6A 1ZM3A 3CCLB 1FQJA 2BMDA 4PSKA 4OI2A 3T1OA 2ZREA 1VMAA 1OV4A 2WOOA 3KUCA 3ND8A 3V4FA 1VG8A 1PVOA 1LB1B 4IFEA 3CM0A 1N6KA 2ZE7A 5C18A 1ZBDA 3IKJA 1AS2A 4TZ0A 4LYFA 1G1MA 1DAEA 2PX0A 2VHTA 1HH4A 3PUYA 4OI1A 4W5WA 4KXFB 4QG7A 5TDHA 3AQ4A 3QVUA 1G3UA 1NLYA 1FL9A 3B85A 2ZRBA 5FBLB 1KKLA 2FZ4A 1CXZA 5GADl 3G82C 2WV9A 1I4DD 1NG1A 5F98A 4US0R 2CL7X 3JQPA 4QJ3A 5AWFC 4E03A 1XWIA 1XU4A 5AUPB 3DZDA 2WSSA 4XTCS 4BLRA 3SHFA 1J8MF 2G1KA 2J7PD 2KBFA 4DCSA 1E2MA 2ZRFA 4DHEA 1T5IA 1VG9B 4MRRA 2ZANA 1VHLA 2W6JA 5CIQA 4C0HA 1R0YA 3NDPA 4EPTA 5KNDA 1CU1A 4DCUA 2X8AA 2XTZA 3SFZA 4B35A 2ZROA 2BEJA 3C5HA 2O0KA 3TKLA 4FN5A 2FPKA 1NIPA 3FB4A 1HA3A 3BERA 5TARA 2F3RA 3BXZA 1G291 1L4UA 121PA 1HURA 1E2EA 2IS4A 1BMFA 4PSVA 4M22A 2NO0A 1F2TA 4Z8XA 1GR1A 3MGCA 5EE5B 4FI3C 3I1FA 2P6UA 4PQFA 1YR6A 4TLCA 3TUIC 1GIAA 3TMKA 3UMRA 3O8RA 1JR6A 5FBWB 4XTRA 2BKEA 1OFUX 2IBMA 1I4LD 1H8HD 2NIPA 2PZFA 4LPKA 1U0HC 3VTKA 1TMKA 1XTQA 4N3NA 1CRPA 2J0UA 4OQXA 5L3SA 3AP1A 1CBUA 1ZD9A 3NIBA 3BORA 2A5DA 2YHSA 3L82B 2BV3A 1JAHA 3TUZC 4JKYA 3DO6A 4Q48A 3W6NA 1LW7A 1R5BA 4TL6A 1KI4A 2JJ2A 3IHWA 3LBIA 5FL7A 3EC1A 1G18A 4DUGD 2CBZA 3KJIA 4DDWA 3OJWA 4B6EA 2ZIAA 1S1MA 2R6CA 1E1RA 1AS3A 2WJYA 1A8PA 1Q86D 1M90D 1D2MA 1KIMA 3UKDA 3GLGE 4J0QA 1Q1EA 4Q7MB 3IIKA 1ODFA 2X1VA 4HAVA 4WZ6A 4WQMA 3KFVA 3C8UA 4GZLA 4Q02A 4V0ME 5IRCD 2EIXA 2A30A 2CNWA 2XNDA 2VLIA 3SOPA 4ZCIA 1Z83A 2GRJA 1FP7A 3A8TA 2ZAMA 4LOAA 3RRNA 3TVDA 3CB4A 1MO3A 2BMEA 2FF7A 1G6OA 2JASA 1KO7A 2XNCA 2FSFA 4BRUA 4NHOA 2IHYA 1KC8D 3BRWD 4BPBA 3ETLA 5DISB 3MHPA 1AGRA 1GKUB 2IYZA 3B82A 4JL5A 1FOEB 3BB1A 4FCTA 4AIIA 3SN6A 4NCHA 2D74A 3SYLA 4JVSB 3RABA 2HF8A 1M34E 2NTYC 4Q03A 4ITRC 2FDCA 1W47A 4TTPA 5IHPA 1Z5ZA 2DETA 3A37A 2A5FA 2PMDA 2J87A 2J0UB 2VNJA 3OJXA 2QGNA 2XSZA 2QEXB 2DWQA 3BGWA 1G41A 2H17A 3K09A 1XE1A 3FFAA 1MABB 2ZXUA 2QAGC 1AQUA 3DDCA 3N2IA 4DDTA 1BJKA 1VIAA 4IDQA 1UJ2A 5A4JA 3OZUA 1FMLA 3B1XA 4CEIA 2VP4A 2D7DA 3PCRB 2WPDA 1UEJA 1EX7A 4KODA 2IS1A 1SVKA 4OHVA 5AJWA 4GOKA 3ZDQA 3K8YA 3GPLA 4IEEA 1IY0A 4UNQA 5J47A 5FPKA 3ZC3A 3EC2A 3X2SA 4DXAA 3CX6A 1GVHA 1SXJE 3IEUA 1G5PA 4PANA 2W58A 1ZP6A 2D2FA 5JI2E 2VP0A 4B76A 1EFRD 4KAXA 1Q22A 2HT6A 3BH7A 2HT1A 3B1WA 2UZ3A 2J9RA 3UMFA 2REXB 2MSDB 1BQEA 5D3QA 3UXMA 3THWA 2OTJB 3FOZA 1PZNA 3W5IA 1FX0B 2QT1A 4N3GA 4NYJR 1T0JB 1Z2CA 1DO0A 2ZI7A 3HWSA 4JIMA 5JEEA 5K8LA 3AGPA 1I2DA 5FTKA 5JJLA 3UIEA 2MMCA 1MH1A 1NVXQ 1YU9A 1GNPA 2DYKA 4LWZA 4M1SA 1XPRA 2IF0A 2GF0A 4M9QA 4P32A 4URVR 2QEQA 1NN5A 3GCGA 4MKGA 4QBFA 1H8EA 3SC3A 2QY9A 1ZD1A 1S1CA 3QVVA 1VYVA 4CEIB 5EXSA 5SZJA 3G0HA 4XIGS 3L43A 2V1UA 1IXZA 1CP2A 3TSZA 2Z43A 2OLKA 1OLOA 3DHWC 2RCNA 2F1HA 4EPXA 4TWZA 4LJ9A 4LZZA 1Z0IA 2XTNA 3VMFA 1XTSA 4TYPA 3KQKA 4HAUA 2OCYC 2A5GA 2ZR7A 5JSZB 2AXPA 3B78A 1IOZA 4QGAA 2J1LA 2HCBA 4YALA 2HYDA 3CWZA 4HAYA 2OE2A 4DEXA 4EFNA 2WSMA 1AA9A 4RKEA 1NKSA 4GFDA 4XWKA 4A9AA 2QG6A 1JJVA 1U94A 2VIIA 3AF4A 3U3RA 2PJRA 3S1AA 3T5DA 5BQ5A 4TT3A 2A9KA 1E79A 5FPSA 4YQFA 5DH9A 2NGRA 3CCQB 5EP4A 4QC2A 2CK3D 2C8VA 1XEXA 3ZIAA 3KQUA 1SHKA 1KO4A 3IQXA 1S9HA 4CT5A 2QPOA 1DDGA 3OAAD 1NN3A 3LFUA 4D80A 3ZVNA 1GAWA 5C1BA 2V6JA 4M9SA 5DIFA 1DO2A 2XJ4A 2W2VA 4U7DA 3N5CA 1KYIA 5CDFE 3D7MA 1JR3E 1R8SA 3EPHA 4YMSA 3RS4A 2FPLA 3O8CA 1VG0B 3O47A 5JWRA 4NONA 3DZ8A 4TLEA 1KSHA 3GLHE 1S0UA 5E95A 4BZQA 2E1RA 2GCOA 1QZXA 1JQJC 4JLJA 4GI7A 3AM1A 4LJYA 1E2PA 1HEIA 2CCJA 1JXOA 5KNBA 3G6EB 1NBME 1OHHA 5FTJA 1M1YE 3FVQA 4CRWB 4Q4HB 4IVRA 4YDHB 3BS4A 1UDXA 4GMDA 2CXXA 2KBEA 3WNDA 4IDPA 1E9AA 3CPJB 5LBIA 3AH8A 3S1AB 1OPXA 2QE7A 4I4LA 1NI3A 1NVVQ 2DFTA 2Q0HA 2QNRA 4Z1MD 2KSQA 4BLOA 1XTRA 1RW4A 4DLSA 3LVRE 4RFSA 1XEXB 5CLLA 3IIJA 1MO4A 3GEEA 4JLVA 3U6BA 1T3LA 1W46A 3TR5A 3B2EA 3CCVB 4FINA 4N1AA 5D3MB 4HEJA 1RRPA 2GKSA 2H5EA 2QZ4A 2G3YA 4IFBA 4PQYA 2C9CA 2J3EA 1KSFX 1US8A 4AF6A 3KX2A 4Q7KA 3D31A 3A1SA 4JYBA 3PEVA 4OK5A 5ANRB 4C0SA 5HCNA 1XB2A 2L0XA 3AKCA 1JJ2B 2QI9C 5BWMA 2FGJA 4LV8B 3T34A 4JJKA 3AB3A 2QBYA 2YNMA 3ADDA 4XVUA 3RSOA 4P4TA 5H68A 2V7QD 4Q4JB 5A0FA 2GCOB 2QMEA 3GJXC 3E70C 3EPKA 2H7VA 3G5UA 2OZEA 3R9WA 1F20A 4TMVA 1DAIA 4KSBA 1TF7A 1R10A 3FHOA 3EZFA 3KFXA 4KFUA 5EP3A 2GVZC 4BQSA 3GD7A 1UKEA 1VQMB 3ZBUA 1F48A 5HXBA 1CR0A 4ASUA 1KD1D 2ZEJA 3SQXA 1YZGA 3WBKA 4XH9B 1IQPA 2ZI5A 4CIDA 2CEAA 2QUZA 1XDBA 3B1VA 2ZS8A 3QBVA 4RFSB 4IOMA 2ZUDA 3T1VA 1TUIA 2GVDC 3UATA 3AF3A 2OILA 4F7DA 1M8PA 3NC1C 4Q66C 4A8JC 4C0LA 4DDUA 2VQSA 1WBDA 4DKXA 2GJ8A 2ZYUX 1VQPB 1EESA 4YXWA 2QQ0A 1G9XA 3GJ8A 1JEDA 2QMOA 1CKEA 1SVLA 2V1XA 1GM5A 1RKBA 2VNKA 3AUYA 1ZVQA 1M7HA 3U6KA 1M6NA 5E7JA 4ACBA 1TQ6A 2BGIA 4Y0AA 3RNLA 2PLFA 4KCGA 4YC7A 2ORVA 4LV6A 1W0JD 1DBSA 1KY2A 2IYYA 2J0SA 4A82A 2ODEA 5J40A 3K0SA 2VRWA 3CPWB 1M74A 2RGBA 2FE4A 2UZIR 1QFJA 2CCKA 1U81A 3K1JA 4TLDA 1J70A 4NDZA 4LJ5A 4QJ4A 3V4RA 1DG3A 2QORA 4OHZA 2VHQA 4A6XA 1OSNA 3IEVA 3RLFA 5KSZA 1X8JA 3CNLA 4TLBA 4O2RA 4PSAA 4R7ZA 1S72B 2G6BA 4LC0A 1E9DA 1KDOA 3O8DA 1MR3F 2ZETA 1KDRA 4PHTA 4PTLA 5CM9C 4W9MC 1RC8A 1K8AD 2ORIA 2XNSA 5BYKA 4DBLC 4BASA 4OBEA 4F4CA 3WYGA 5JFGA 1G3QA 2QM7A 4QGHA 5KYKA 1NN1A 4ON9A 4PAQA 2YYZA 3GLIE 4RD0A 2OUKA 4US1R 5BN5A 2W2TA 2A78A 4X8OA 4PZYA 4M1YA 1NLFA 4OYHA 1KAGA 1U99A 4HSEA 1ZU4A 4AG6A 3JVVA 4PO1A 3OE7A 2OBLA 1G3RA 4WVFA 2OBMA 5FPTA 2Q9AA 1NNEA 1RRFA 1WE2A 4Q18A 2IUTA 2IA5A 5BN3A 4M9XA 3VNVA 3REGA 1TQDA 1JI0A 2CE7A 3FHCB 4KVAA 5KO2A 1L7VC 2Z83A 4I99A 2HDNB 4PPFA 5FH9A 1GOTA 2CVHA 5AJVB 2ZUBA 3IO5A 3PUZA 2V3CC 3F8TA 4DLWA 4MH0R 3T15A 5E7IA 2A2ZA 2EYQA 4URUR 5FOTA 4G1VA 2OTLB 4Q9KA 4OL0A 3CCJB 1E2IA 2B8WA 2V8OA 1W7AA 3WHLA 2GCNA 4XSGA 2F9MA 1QVRA 2ZI3A 3L2OB 2VNIA 1YE8A 5JJIA 2REOA 1Z6GA 5SZIA 3CCMB 3CC2B 1HT2E 4LYHA 3HU3A 4QKQA 4Z51A 2ZVQX 4LBVA 2ZRAA 3LH5A 4EJSC 2BHRA 2ZRIA 3P4XA 1W2GA 4BFSA 2VZLA 5KDOA 3BK7A 2WJHA 3WYFA 2D4HA 1UBGA 1D2EA 1ZCBA 2YV5A 4JL8A 1N6HA 4GNKA 3R7WA 2ZVPX 1M2OB 1OH7A 2GJSA 1YZUA 2WJGA 2WSSD 2ZE6A 3I8SA 3UMSA 5CJPA 2JIZA 2DR3A 1VCIA 4C0JA 1GAJA 4QBIA 2W6JD 5KHOC 2GAOA 2KJQA 4B32A 4A6PA 3CRMA 1XEFA 4MRVA 3QJYA 2BCJQ 821PA 4BLSA 4NTZA 1RYHA 4RY2A 2XEXA 3HPQA 1E1QA 3R20A 1NMYA 3I5XA 2GBLA 2GZDA 4JLKA 4YAOA 1II8A 1YZKA 1MRSA 1XZQA 1XFAA 3GLGA 1GDDA 4QFMA 2W0MA 3SYKA 1HY3A 4B2LA 4BRWA 1XZPA 4YMUA 4G5GA 2O8EA 2QDXA 3W2IA 5KU1A 2OG2A 4D82A 3AGQA 4V0MA 1E2DA 2JLUA 3OW2B 2ZRPA 1XJQA 2C77A 1FUKA 1JBKA 1KO5A 2P0EA 3CNOA 3W2EA 3EZ2A 4ZDIA 5AUNB 1YHNA 5DI3B 2J46A 4WXRA 2VPPA 2JLQA 1E9EA 3KKQA 1GILA 2QP3A 1XD2A 4PFSA 5A5GA 5DO9A 3CR8A 3EA5A 1P4SA 3BFXA 3LAWA 1Z06A 1XD9A 1E63A 3KL4A 3ZLJA 4M8NE 5J4LA 2JJ2D 5G3YA 2REBA 5TR9A 1QGYA 4GOJA 3R7WB 2ZSBA 4TZ6A 4LHWA 3K70B 2PCLA 2VBCA 4V03A 2Z4SA 1OXVA 2GILA 3B6EA 3AVXA 3T06B 4DIDA 5DHFA 3KUDA 3LW7A 1LTQA 4IXMA 4ZPXA 1X86B 2RGNA 3ZBTA 3B13B 2XNDD 1II8B 1XMJA 2ZS9A 3AVWA 3GLGB 3X1YA 4LJ6A 4Q00A 1AIPA 3CC7B 1W5SA 3R8FA 3EASA 1KI7A 2NOAA 4NBSA 3Q9LA 5KOYA 1PUJA 1L2TA 2GXUA 3MFYA 5HTKA 4OHYA 1SXJA 3LX8A 1W0KA 3P4YA 1GO2A 3DMDA 3U3KA 2ERYA 3C41J 2R8RA 5FUXA 3FPKA 1LS6A 2AFHE 3R9IA 5KSYA 4CEJA 3EPLA 2WWFA 3RSLA 3QEOA 2F55A 2XSZD 3VR5A 1N5IA 1OKKA 4C0BA 1Q1ZA 1RRCA 2GQFA 1F60A 1TX4B 3FKSA 1XD2B 3DKPA 3LV8A 1NVWQ 1ZC3A 1W4AA 3NC0C 4G5RA 5EE9A 1TAGA 1C9KA 3NVAA 4UXJA 3LLMA 5FOXA 3WRXC 1CR2A 5H5JA 1VHTA 1NF3A 3Q8XB 3TGPA 1W36D 4IJMA 1IB0A 2WPDD 3A36A 4UNNA 3W3ZB 3OEED 4M1WA 3QXXA 1IXSB 3KXIA 1UPTA 3MWYW 3GLFE 2ZSDA 2IHBA 5EZ5A 5B57C 3EG5A 2FV8A 2Q3HA 3W5VA 2IEYA 5DN6D 3U7FB 2W0SA 3VFDA 3EPJA 4AY2A 2IS2A 1J90A 4IXNA 4L5BA 2NPIA 2IYSA 2OHFA 4URZR 1G3IA 5C4MA 4CZ2A 2BMJA 3AVPA 4FK8A 1J9ZA 4HZUB 5FTMA 2F1JA 1J99A 2LKCA 1A2BA 2DFNA 1S4QA 1SXJB 1AZTA 1DAGA 3BFVA 2YOHA 3OZWA 4TMWA 3H4MA 2ORWA 3BOSA 1U90A 4CEHA 2SHKA 4PPNA 2XZLA 1PV4A 3EAQA 4DSTA 2E87A 1QX4A 2IEZA 4MYCA 5KPJA 4EFMA 1TPZA 4RD3A 3IPXA 1FRNA 3VO1A 3CCRB 4HB0A 5EP1A 1QFZA 3LO8A 2ASEA 3BH0A 4A36A 3ADCA 2EFDB 2GZAA 1JPNA 2ZJOA 2D62A 3MAAC 4A0HA 2IS6A 3THYA 4Q7JB 1DAHA 1R7RA 3L8ZA 1VTKA 4G5OA 4MGIR 3H0KA 3PEYA 4OK6A 2G0TA 5G3ZA 3TAHA 4O3MA 4BLPA 3K0CA 4CVNA 4QHYA 2G9NA 4WAUA 5CDFA 3ZH9B 3SJAA 1VQ4B 1JR3A 3FFBA 2ZQ5A 4OQMA 5EZ6B 3ICEA 2O8BB 3VO2A 5EE1A 1SKQA 3W5UA 2PEYA 4XVRA 5K8UA 3VHXA 1T3SA 1TNDA 3GLHA 3WNCA 3QF4A 4LYJA 4JBXA 3LWNA 1KKMA 2GDJA 2VSOA 4EAQA 1E94E 1NMZA 2DPXA 2OT3B 4ESHA 2JLXA 1Z08A 2PCJA 1E79D 1Q1BA 4FXPA 2ZR9A 4LJ7A 2HMAA 2Q9CA 5JZVA 2BM0A 4UAJA 1F5NA 1MO6A 2KB0A 4D6PA 4A4DA 4DLRA 5BW8A 2D7CA 3L0SA 3BC1A 3SR0A 2EYUA 2IK8A 3H86A 2BN4A 5HZHA 3UWKA 1Z6TA 4B3XA 1LS1A 2B8TA 2AX4A 2XZPA 4DLUA 2R6FA 4JLPA 3EARA 3RS5A 4D81A 1OF1A 1G17A 1G19A 5EXTA 1KNQA 1AN0A 1P2VA 1SVWA 4GPTA 5FBQB 2IYRA 1CQXA 4D0LB 3I8XA 4JKIA 1KK1A 1MABA 1TUEA 2G77B 5GVSA 4YMTA 5J4VA 5C46F 1XMVA 4R9UC 3THYB 4DSNA 4AC9A 1M7BA 1DEKA 1W44A 1SULA 3CF2A 3FGNA 2V55B 1VECA 1D1NA 5JJKA 1P62B 4KO8A 1GKIA 1CJKC 4IDOA 3U4QB 1Q1QA 2YKGA 5JMTA 1GG2A 2TMKA 3IIMA 4LBYA 1NJID 5L8VA 3K0EA 1T8UA 1Z47A 1QGAA 3GLHB 2WIAA 3QF4B 3CF6R 4Q4AA 5GJBA 3ZZUA 2HLDD 2HXSA 2R2AA 4EKDA 3K0AA 3O8BA 1QRAA 4ESVA 2ATVA 1DDIA 3CMAB 5CLQA 4IVQA 1AMOA 2QL6A 2XB4A 1GJRA 2R6AA 3C15C 4G5SA 4LSGA 1UEIA 1OE0A 1FFHA 2QAGB 2OO7A 2OFOA 1ZC4A 2GEUA 3TK1A 2ZRJA 1K5GA 1FX0A 2AL7A 2D3WA 1I2MA 1VCNA 4HLUA 4PR0A 4P4SA 3VR1A 2FU5C 4XWOA 4TL8A 2JLRA 3LW8A 4C7OA 2GWHA 3CNNA 4TQ9A 2ATXA 3PENA 4C0KA 1GL9B 3W6OA 2C99A 2VNHA 3OESA 3UG7A 2UVQA 1ESNA 2ZU6A 2FNAA 2IYLD 4MGZR 4QGFA 2QTFA 3W2HA 2ZJBA 3EWAA 3A4MA 4KFSA 1G5TA 1DAFA 1DTSA 4LY6A 2GAAA 2X19A 3HPRA 1TU3A 1ZW6A 2OESA 3CZQA 3LDAA 4NYJQ 4PHFA 1N0UA 3A6PC 3JQQA 2EWVA 2PH1A 5JLJA 1QHYA 4D2IA 3V76A 3TSWA 1U8ZA 4ARZB 2AK2A 1OB5A 2RB4A 2RHMA 2VL7A 1Z8FA 221PA 3OFND 3CD6B 4Q4AB 4XD7A 1SQ5A 3AP3A 1JALA 3K0AB 4HYYA 4Q1BA 4UXIA 3KXLA 5JSZA 3LVBA 4PAMA 5BXQC 2O8FA 2NQ2C 1YHQB 2NMVA 4E09A 1X8LA 2FZLA 3OIYA 1BS1A 3TAUA 4KSCA 2BBOA 1Z29A 2VH5R 2JDIA 3PUVA 4CGZA 3OEHD 1JA1A 1J2JA 1OXSC 3HJNA 1NIJA 4DVGA 1QHHA 4KFRA 3A1VA 3QKUA 3WMGA 2RGAA 3UANA 1LY1A 4P4SB 2WHXA 2O8DA 3NBFA 2OCAA 4C7OB 4L9SA 2K5UA 3PITA 1AS0A 1XF9A 1YJ5A 3MJRA 3NH9A 2XB2A 1X3SA 4AKEA 5LD2C 1S96A 4D26A 3CCSB 2Y8EA 1Z2AA 3DM5A 2VHUA 2H92A 3OF5A 2VHJA 1NP6A 4AD8A 5HCIA 3SJCA 4TYWA 1OB2A 2VO1A 2BF4A 1D9ZA 3GLIA 1Y3AA 1E4VA 1FZQA 1S2MA 3I61A 1OFIA 3QXCA 2JATA 3GFOA 1BIFA 1A82A 1FNBA 1FRQA 3LVQE 1EP2B 1QG2A 2HJGA 1ZUNB 1EWYA 2ZSFA 3WY9A 4I1UA 3H84A 5AN9A 3P20A 4NE2A 1E9SA 3K0FA 3BAFA 5TMPA 2BBTA 1OXXK 1CR1A 5ELXA 4Y7CA 1BH2A 2O8FB 1FTSA 3OHMA 4C2UA 2WWWA 2VP5A 2RGCA 3RYTC 4JLDA 4JLNA 3DOFA 4PO9A 1N6PA 4Q4HA 1YRBA 4R71A 2DERA 4QM7A 3WXMA 1EFHA 1RJ9B 3VAAA 721PA 4POAA 1QHHB 3K9LA 3F5FA 4DEYA 2BMWA 1G3MA 4QNMA 5CB6A 3U3JA 2FEMA 1E3MA 2O8DB 1QBKC 3BH6A 3RS3A 1V43A 2FFBA 3R8CA 1P2UA 3K09C 4AG5A 2O8CA 4DQLA 4MRSA 3GJ4A 3CRZA 3M0EA 2J7PA 3LA6A 2ZJ5A 2IL1A 3LLUA 3VKWA 1ANKA 2IUSA 1KMQA 1NN0A 1NVUQ 2PL3A 4ZKDA 4GL2A 1W36C 5D3MA 1XMSA 2OLJA 2OFXA 4AYXA 4D4JA 5CITA 4AF7A 5FBVB 3CX8A 1G8YA 1ZCAA 3X1ZA 4F92B 3B1YA 4KV9A 2QA4B 3WYAA 4B6FA 2YOFA 3KKPA 1MO5A 3GLIB 1QHGA 4MYUA 1YZNA 4AKHA 1KMHB 2VP9A 4S2EA 1KK0A 2PLRA 4JS0A 3CLVA 4BWYA 3I4LA 3P1JA 5JCZA 2ZI4A 4Q4JA 4A2QA 1W4CA 4EIWA 4NL4H 3K0FB 4PHGA 2IYXA 1E9CA 1K73D 1YR9A 2QU8A 4BFZA 4Y9UA 1T8TA 1OH6A 2IT1A 1W4BA 1DG1G 3AKYA 2P6NA 2QP9X 3W3AA 4V02A 3QBTA 5AJYA 3SHWA 1ZNYA 3AVTA 2WKRA 3KTAB 4MKHA 4Q21A 3W90A 3L0IB 4CYMA 1E98A 5FL3A 2O52A 3ASYA 4BFXA 1C1YA 1E96A 2GEDA 5SZHB 2AD5A 3HR8A 1GRRA 2C95A 3EZ9A 5FTNA 2Z0MA 3IQWA 3ZYCA 1WP9A 2O8CB 4ZV4A 4WA7A 4DLYA 1WF3A 4ABYA 2WKQA 2AKYA 1VQOB 4ZCLA 1F3OA 1YR7A 4B75A 3KJEA 3A4LA 4FMDF 4LBWA 1HE1C 1QDEA 2AHOA 2WWGA 3OZVA 5GJWC 1DADA 2VEDA 1YJ9B 1NJGA 3GJ7A 3B1ZA 2BDTA 1YITB 1KI8A 4OKSA 2IXEA 1HE8B 3HR7A 1Z6YA 5L3RA 1FW6A 4KI0A 1I4TD 2IXGA 1UBFA 1T6NA 1GRNA 4M1OA 2WTUA 1F6BA 2FOLA 4JLBA 4KVGA 3U5ZB 2QENA 5HKKD 2OBNA 4HUQA 4G1UC 3SI7A 1FUUA 3EIHA 1EP1B 1AK2A 3W2FA 3LNCA 2PX3A 3ECCA 3NHAA 1XPUA 3BIFA 2NZJA 4YMWA 4TMXA 1OJLA 2YWFA 5AUQA 1Z63A 3QFCA 1G7SA 2XNJA 3GQBA 2PZGA 4A8JB 2MMGA 3ZS9A 3EWSA 2WM9B 4PPQA 1ZNWA 3GJ6A 2LCFA 3ASZA 5KTYA 4G1BA 1EFUA 1TF2A
chains in the Genus database with same CATH superfamily
3P2EA 1BHQ1 3IEKA 3AMVA 3LQ1A 4M0PA 4NV1A 4DDHA 1CJVC 4BOYA 1BKDR 1VE3A 1X80A 4RE5A 2GPJA 4I55A 1QH9A 1KSGA 3VI4B 1QVAA 3HHPA 1I2CA 3WLTA 3X1DA 2NO6A 4CPDA 3BDVA 1MPTA 2HADA 3R3VA 4DMHA 4ZA2A 5LZ2A 1NRKA 3LHIA 1W52X 4HAWA 3QQ5A 4LDAA 1ZINA 2F3SA 3GQVA 3HCCA 3VKHA 1NR1A 2Z2KA 4WCVA 1UPFA 2DP4E 3LHDA 3SEAA 3DTVA 1A1SA 5FR2A 3VC7A 3DAPA 4B71A 1B6SA 1ZGGA 5CVDA 4DWWA 2HIAA 1RNLA 1HEUA 4O4HA 5J2TA 4V24A 5CH5A 1VKJA 1RE0A 3ZY4A 1KMNA 4CF4A 3DE4X 3SC2B 1N6IA 4UULA 3LUCA 3OQIB 1DQNA 1ENYA 1M8GA 5IMSA 2NO7A 1KXZA 2WU3A 1CIJA 3JR7A 4M0DA 4Q05A 4K6OA 1R0WA 3GLFA 5ENDA 1UFQA 5I7UA 1K6EA 3AW9A 1X1AA 1Z6AA 5AVRA 4BB5A 5E2BA 3U7GA 1NDUA 5EPOA 3VR2A 3OT5A 1KS9A 1PBNA 2R47A 3BD9A 4NH0A 3UHJA 4DYDA 2I1VB 3EOZA 4JXKA 5JPDA 3KB1A 1RSZA 1T4GA 2V4ZA 4MNTA 4UDOA 4V2IA 4UTOA 4FT2A 2AW3A 2BFPA 1MP0A 4X92A 3USES 3IL2A 1JQAA 3UGKA 3PLRA 4LPSA 3C1UA 4C0QC 3UPTA 2WIFA 4QWMA 4NPCA 1OVGA 1M2VB 4QFDA 4X1YB 5H81A 3S1LA 3T1QA 5MF6A 3IUEA 3SX2A 3WYCA 2VHWA 2AFHB 1ISGA 4BLVA 1MKYA 2JIQA 3GARA 3OZRA 4ATNA 4QUDA 5GONA 4DNPA 1XZNA 4HQLA 3NNDA 3UFXA 4R4JA 4JBWA 2VHCA 2CF6A 2WMNB 4OGLA 3CWCA 4KVFA 1IEQA 1U7XA 2HJSA 2JCXA 1D8TA 1Z7YA 4OL9A 2NNWB 4R5MA 2GJ4A 5ECWA 5EXPA 3QVWA 3WTBA 2JFYA 2OXIA 2IIVA 2PZMA 1Z26A 1TXGA 3O0DA 3O8NA 2WJZB 3GJSA 5EEHA 1MX9A 5F33A 5K3BA 2R87A 3NWBA 4INAA 4KC0A 4M8SA 3LY7A 4CU2A 3WLAA 5IC5A 2HH9A 3PDUA 3NOXA 4G63A 5GWXA 4BWGA 3NT2A 2G7MC 5E6UA 3BT7A 4E5PA 3NYWA 4N54A 2NT4A 4TKZA 5JYDA 1M8FA 3SZMA 3NHBA 3JARB 4P8RA 1FNDA 1ZI9A 2O4UX 3VU8A 2C83A 2F1KA 4LECA 3UPDA 2OAEA 4EA7A 4NC9A 2JCVA 1L1QA 4XORA 4FZVA 1CUUA 4P58A 4E46A 5DE3A 3ESDA 1ZEJA 4PZZA 1RP7A 2C2BA 2YIVX 3LLSA 4KMMA 3HUDA 4CIXA 3REFA 5DGDA 3AFHA 3KM0A 1YGYA 4O4JF 3ZD6A 2J0EA 2B9VA 3ADOA 4E2WA 1HG0A 4UUMA 3S2FA 1FYWA 1MOSA 3T61A 4WLNA 3MT0A 5KTRA 1NFQA 1JMKC 2IELA 2QUJA 5DCUA 5IDVA 4EG1A 1N5JA 4N5LA 1P5RA 4W9NC 1ZOOA 3QVGA 3EGIA 4F3NA 3ITKA 5AI5A 5KTTA 1P75A 2J3JA 4Z2AA 3BWDD 4YRDA 3B1FA 1NKVA 1MTZA 4KJXA 4HDQB 3TRKA 1XDSA 4HBGA 2I4LA 3G7SA 3WWYA 1UFOA 1Z0JA 4PC7A 1Z2OX 3CXCB 1PTKA 2V9CA 5LLSA 2BFFB 1L4GA 2Q3MA 5EPEA 4TVSA 2QTTA 5BW6B 3D8RA 4GYYA 1HTWA 2DFLA 1CR4A 3PNVA 5L3ZA 3ZU6A 1JE1A 2I2XB 4DNOA 2WFAA 5GAJA 4DXHA 2VJLA 2VJKA 4BP8A 2HY7A 2PRSA 3N2NA 4RL4A 3KEWA 1EAMA 3SJ7A 1GDHA 3JYHA 1Q20A 3BQMB 1Z38A 1S3GA 5BSWA 2QPAA 4LW8A 2BM8A 4MP8A 4WUVA 2JANA 1RXIA 1U2ZA 4RGYA 3H0EA 5JPIA 3ZVMA 1W4RA 3V7AA 1NVDA 4IWNA 4MJLA 3KG2A 2I29A 3WV4A 2JKZA 3MTAA 4XDHA 1EIWA 2VC2B 4E5UA 1NE7A 3LBNA 1BMFD 2OM6A 1Z88A 4PPGA 1YMVA 3E1SA 2YWGA 1P6XA 2PV0A 4TOIA 4YFYA 4PYIA 5IH7A 4V1CA 1HM5A 5JROA 1D4ZA 5F3DA 1ZSYA 2ZT8A 3P9PA 3URKA 4H9GA 3PEWA 1Y9AA 2RBKA 2P79A 3CF4G 4TQUS 3UV3A 1A8IA 4R6WA 5KNCA 4X63A 2R9VA 2YJGA 4NWIA 2N46A 3IUJA 3ECAA 5ALPA 5J2UB 3RQIA 4CL0A 1JSRA 5L95A 4D0GA 4CF7A 2ZIFA 2PNFA 1FQWA 1H5UA 1W85B 3H3JA 3N7AA 3O4IA 1CS4C 1LVHA 3WQSB 1HDIA 4P7JA 1N0IA 1QE0A 1NXTA 5SYMA 1HDGO 1R18A 1VA5A 1VIDA 1QK5A 2RGEA 2X42A 3G5LA 3GFVA 4KGVA 4R69A 3FBTA 4PYJA 2OECA 5FL7D 4PAOA 3AR6A 2VDJA 1NJ5A 4HUJA 3OF3A 4KVZA 1RZVA 2FX2A 2XOKA 1O0BA 4JJIA 1E2GA 1U6KA 1BA3A 3A3GA 1EVLA 4JEMA 4B44A 1OIWA 5CJ2A 4EUFA 1M2FA 5AR1A 2DQYA 4H3KB 3ZLBA 1ZAYA 3N75A 3NMUF 5BUQA 5DHQA 4MYTA 2Y76A 1KDYA 1A04A 2P77A 2CD9A 4ZVOA 2P41A 3LD9A 1KJZA 2E4AA 3EY4A 3OLQA 4WKPA 5B2ZA 4Z5XA 1EFKA 3RUFA 4CN8A 1M1ZA 1C1XA 4EYOA 1Y1QA 3RVOA 1HR0B 5GJCA 5HDBB 1A7JA 3E2IA 2CWDA 2B8JA 1I8DA 3E3AA 4UM9B 4K1XA 2PIAA 3PQ2A 3H8JA 5CX1B 4DN6A 4UATA 5HQ3B 3D26A 1PFVA 2W6IA 4ZHQF 1U2RA 1IIBA 4UAUA 1W5FA 2ZQYA 4FCWA 2PZKA 2QMZA 3U9LA 3LSYA 3U7QA 2V9PA 1DHRA 3INNA 2F9FA 2IOFK 2C61A 1MTOA 4MUGA 1SG6A 3L8HA 2NXWA 3O31A 5B58C 3ORFA 5CR9A 5BW4A 2FMTA 2J3MA 2FETA 3KZ1E 2H1RA 1MC4A 1J8YF 1NBOA 2EFHB 2YC4C 4C3ZA 5KOJB 1WDMA 2I76A 3JZAA 1DAMA 3RSCA 1U0TA 1AKUA 2IHTA 1Y6FA 1U7UA 1EFPB 4S1OA 4BZZA 4EPRA 3FOEC 4EPVA 4XLEA 1U0LA 4H27A 1G5HA 2WG0A 1W59A 1ZIPA 4N3CA 4DA8A 4M4SA 2Q49A 4KIFA 2GBLC 1IVNA 1F38A 2I2CA 4GSYA 1U98A 4K9PA 4Q1EA 2I9PA 4AQDA 4F46A 2G63A 2PAFA 5A8AA 1UUFA 5F76A 3GZ4A 2VG8A 4J0JA 3GLVA 3Q39A 1UMKA 3IXQA 1II0A 4LAFA 3SMQA 5KYWB 3ICQB 2FI1A 3GVCA 1ISSA 2RHDA 3BSSA 3QNUA 4GLFA 4LOHA 4V0QA 1OC4A 1XEWY 5CT4A 4OJKA 3AB8A 4E4TA 4JSYA 1XKXA 1NQWA 1Y5RA 3JPWA 4MAAA 4REQB 3D7NA 2IV7A 3TTVA 1G8MA 3CINA 3KNZA 1YIOA 3BB3A 5AOCA 4AMZA 5TQJA 4P3XA 3EZ7A 5I7WA 3GI1A 4X8LA 1AKVA 4ZVPA 3BJIC 3B6MA 3L4BA 4G25A 2AKAB 3FMOB 1CS0A 1OIXA 3KBBA 3R24A 4HLQB 1H85A 1AZLA 2XCLA 3GJQA 3MUFA 5J5CA 4C88A 2PANA 5EIAA 5JZOA 1K9SA 3LY8A 4BQRA 4F2HA 1K4KA 3PLNA 5DBGA 1LPSA 3P27A 1Z39A 5EWMB 5C8ZA 2JIOA 1CLUA 3WGMA 1EBBA 4ZYZA 1T5TA 3FJYA 3IFSA 3MG9A 4OM7A 2BEKA 2HO4A 4QVAA 4JT4A 1WTAA 2JEOA 2FKNA 4HATA 4V0NA 4D6XA 5JADA 1CEXA 3AHHA 1A9YA 2IDKA 3CO5A 2JARA 3I9LA 3URMA 3UW1A 3C1AA 2QM8A 4MDFA 3BFJA 1X1CA 1IM5A 3QUSA 4K6MA 1CQIB 3JTMA 2PZEA 4NPHA 3LSTA 3BA1A 4IIBA 4XJTA 4Y1GA 3QJ5A 5AVJA 3TNLA 5ENZA 5EHZA 5JRJA 4MXDA 3UGJA 2GBCA 1ID1A 3KZXA 4NV3A 4UU8A 1NC1A 4HEA1 4YR9A 3LCRA 1KH3A 3EXG2 2CB9A 4MW7A 3DZCA 3NFRA 1QP8A 4Q9JA 1BMQA 2C9BA 4R2MA 1UC8A 3GT0A 5ALTA 1MFPA 1OZAA 2D6FA 4G6IA 1VDZA 4P3YA 3DUFB 3SZRA 5JXJA 1NY5A 3QFTA 2I7DA 1I3KA 2ECKA 3UK0A 2W4QA 4AURA 1FFXB 3MXTA 2AYXA 2NZ8A 2QTWB 4MS4A 2OCPA 4B73A 2XE7A 2WAAA 3NU1A 5KOHA 2ACKA 4ZCQA 2GPYA 4CQLB 4QXAA 3H2KA 1Z34A 1V1MA 3SEJA 2B5VA 1G0NA 1CX9B 4KO4S 5ETJA 4G24A 3ACDA 2ZRMA 2J5BA 4TVOA 4Z49A 4JV5B 1VJRA 2QAGA 1CUHA 4R8RA 1HO3A 1T0BA 3TR6A 4ALIA 3JVUA 1D0IA 3OEYA 1SIWA 4LQLA 3CIOA 4FWTA 4LYAA 1Z4OA 2LDXA 2QRVB 1DBWA 2WMDA 3U19A 1TEXA 1CYEA 4XUCA 1BVUA 2ARKA 5LA6B 1D2NA 1ULSA 3BD8A 3RVRA 4ZCMA 5JZBA 2Q5OA 3HY4A 3ONWA 2Y4OA 3EQ8A 4PFJA 3ANYB 2BW0A 4ZVVA 4JAVC 1YS1X 2X4DA 1M1KD 2H9IA 1SVMA 1FDWA 2WW8A 3OC0A 4HNHA 5LKRA 5CA1F 3TZCA 3H2IA 4JU9A 3EH2A 2RONA 1NOKA 3PQDA 1UJ6A 4E11A 1VRCA 4ZO4A 2C03A 2QPTA 3F6BX 5FHQA 3C6YA 2DPYA 1BE1A 3MTDA 3RQSA 5I5EA 1S7GA 3HWX1 1UC5B 1GGKA 5K0SA 1BGXT 3R0JA 1B0AA 2O2XA 3G2QA 3OZFA 1WB5A 2ZYWX 5JZ9A 1W1WA 2OQIA 3GUZA 4IEIA 5F4ZA 3I5YA 5JY6A 4I5GA 3NATA 1XL0A 1KJWA 1OHHD 1UPUA 3HCEA 1Y8QB 1ABBA 4L51A 5JAOA 3LOQA 3AF2A 3ZHYA 4FN4A 3NBAA 2GXQA 4QJIA 3HAGA 4EKGA 4Q39A 4NE9A 3AHIA 4HEA6 3RNOA 3K7EA 2JI7A 4J0GA 1NSFA 1CRWG 4LVUA 1M6WA 4WLEA 1VQNB 4OUDA 1E7WA 1XKTA 1XTZA 1JEEA 2JA2A 2ODWA 2C9YA 3AVOA 4GF5A 1P1CA 1SUSA 4RJKA 3QTBA 5IZCA 4DWOA 3MWFA 4FBLA 1OFVA 4OMFG 3T7TA 1ONNA 1IN5A 2E4UA 3VX3A 4Q1CA 4UNIA 1C8LA 4ZJUA 3DO5A 3IPAA 3WGTA 1MU0A 4KIJA 1PZEA 3ZHTA 2IYOA 3DTTA 1G2IA 1MJ5A 3EMKA 3HBAA 4YQYA 3V1LA 3X1KA 5IF3A 4LF4B 5C7YA 4Z4IA 2AWOA 1E43A 3AUFA 4XEHA 1B41A 1WA5A 1P1HA 2ZB7A 1VQ6B 4OOFA 1YACA 3PX3A 2DF8A 2FZWA 4PHCA 3NORA 2IW3A 1SKYE 1RWQA 3G2LA 4YRIA 2OYNA 1LSOA 2NZXA 2XNHA 2YNMD 2E49A 3DDNA 4GVPA 1YQTA 1UD6A 1F12A 3DC2A 4YIKA 3TZ6A 2DWPA 1G8SA 1SA0B 5HMLA 5LPNA 1T2CA 3WJ1A 2QMUA 2MSCB 3CZ5A 4TRMA 4EW6A 1YE3A 2G83A 1P7CA 1KI9A 3IVXA 3LBHA 1IJKA 3GRYA 1ELOA 3E5MA 1RKXA 4YUAA 3CRVA 1YC2A 4DSUA 4DDMA 2R6HA 2C94A 4N7BA 4X20B 3AUXA 3ZLUA 4AZ0B 1X1EA 2QUAA 4LF7B 4FSDA 1QP4A 3OTQA 4MMZB 5ECGC 2ACEA 3SYNA 3M4JA 2P67A 1USGA 1HX7A 4CQNA 2AXNA 3CGWA 8ADHA 4Z4ZA 4LJ4A 1MAAA 4JR2A 3RASA 4Y9RA 1WXFA 4Y67A 3RARA 1HYHA 1RTKA 2HB6A 4GL4A 1B8VA 2HWYA 4RYDA 4ASUD 4GDFA 1GZSA 1OTYA 4P33A 1X14A 2VH1A 2HU7A 4D25A 3W79A 2YY5A 3SGLA 3ZU4A 5CD9A 1N2EA 3UB2A 1RJ9A 5BWNA 3PQ7A 1W9HA 2BJVA 3AETA 5EWJA 3WWZA 4LKRA 2YZMA 3AP2A 4JUCA 4QQ8A 1DIAA 1CJTC 1N6LA 1QJ4A 4GBMA 4F2GA 4NZ9A 1NZJA 2DTEA 3PR1A 3LUBA 1QGOA 5D01A 1PQPA 4WADA 2YZNA 3WIOA 4A73A 4MI6A 1WZIA 4E12A 3HKEA 1FP6A 1PR4A 3FIUA 3FLMA 4PPYA 2ZJAA 4Z0TA 1MB0A 4JA0A 2FR1A 2Y1LA 1MB3A 3I1JA 4MWDA 3ZGNA 2Y9MB 1IVSA 4PO3X 1VLHA 1N3LA 2VSYA 3F90A 3HM2A 4DSAA 1ZL2A 3DZHA 4URXR 4R41A 1C14A 3T8YA 2GEBA 5J23A 1IL0A 5C3UA 4BVEA 2XB6A 3OOWA 1HYBA 3ONVA 4EVRA 3SSMA 2I3DA 4G5HA 4HWKA 1UFRA 3J81A 4II2A 1WQ1R 2IXTA 2X86A 5AK3A 4I81A 2D13A 2LW7A 1R6UA 3AKZA 1OIVA 3BVPA 1KMHA 5BWOA 3OJ0A 2JGKA 3QK7A 5KX5B 1YL7A 4IX9A 5IVHA 4OI0A 4XYLA 1SEVA 3GJ3A 3TGLA 1U0JA 3L0DA 3EVEA 4MP3A 2ECFA 3KEQA 4HMPA 1VIYA 5KB3A 3PYMA 1F3LA 1IJBA 3VPSA 1HLGA 2DHRA 4RMHA 5B1YA 2WJVA 2EF1A 1T0PA 4K6GA 4UDYX 5DBEX 2P3SA 3NTUA 5DP2A 5KWEA 3CVYA 3P97A 1Z36A 3RUCA 2NTNA 1TTTA 4LISA 2QAIA 4TTQA 4AUNA 3GJRA 1YJXA 1W5EA 1DC5A 5JECA 1FEZA 2CNBA 4Q3BA 4RLFA 1W2WB 2OV3A 4R8LA 4ZVTA 5H70A 1NJ6A 3VU9B 3DE6X 1ODTC 3R7AA 3QF7A 1CETA 3DYVA 1L7XA 3WQRA 2FP4A 2R8EA 2WEKA 4KH1A 2W2NA 3ZJVA 1EGMB 1V45E 4U2KA 5CBPA 3P2YA 4PTZA 4TKVA 4M38A 3UC9A 3RC3A 4ALKA 2VTDA 2NT3A 3CUTA 3ZY5A 1TYCA 4U4AA 3B5IA 2Q99A 4B9EA 1CRQA 1SBCA 4K9OA 3H1TA 5CTJA 4CV3A 1JH9A 1C7RA 1D09A 1UM8A 1U04A 2QTVA 3BE6A 2WTNA 1KWGA 4TVKA 2UYQA 4RPGA 1O3YA 2DTXA 2J7KA 1IG3A 5KWVA 1I2ZA 2H2HA 4XJSA 1ZPDA 2XX3A 1WXXA 5D1NA 1Z5VA 1ZAKA 2WD9A 3E9QA 4P34A 3RAJA 3RK1A 3ESCA 5GGYA 5JMPA 3CONA 3M81A 4PQGA 4E32A 1TEVA 1GYRA 4IDHA 1ODIA 3MWEA 4KZKA 3V7UA 4YMLA 5KNDH 1MAWA 2A9RA 1H8HA 5I48A 3ORHA 4JXJA 1MB2A 1YCDA 5EIHA 1GXSB 4EJ6A 1QQAA 4ZD6A 1EWRA 1O94D 3OD5A 4R05A 1AHIA 2PVSA 1VYUA 4YHHB 2NADA 3WAJA 4BMNA 3DLAA 1G7RA 3EJ6A 3QEAZ 4PO8A 1XZIA 2AC7A 3BCDA 1KAQA 4U5XA 4IZ6A 3V80A 1LLCA 4C4PA 3NAQA 3T3IA 3JQEA 4BMDA 3W2GA 3GPIA 4DUPA 2F9LA 4X0CA 5EZSA 4Q3LA 2V7UA 3ES9A 1T8WA 3PXUA 4R2HA 5DCYA 3QU2A 1U7PA 4EQ6A 2FDXA 3NBYC 5AKYA 2Q1XA 5IKMA 2WIBA 3BIXA 4HN2A 4O2BF 1IVYA 3Q2KA 4FHDA 4DF3A 4EUNA 5I7SA 1U8YA 2IYWA 3L7YA 1G9SA 4LX8A 4D79A 4OU4A 2A9FA 2PS9A 3A3NA 4MV5A 4BBPA 3U81A 3N6VA 1IIRA 1U63A 2P40A 1S2IA 2HQRA 4J29A 4ZXFA 1UK8A 4EHNA 5K05A 4HVAA 1BMTA 1A2KC 521PA 2YW9A 2IQ5A 1FJHA 4QRIA 4Y9TA 4U3JA 3O90A 2CXOA 3P26A 2RAPA 4OJQA 2M2IA 5KAPA 3SJZA 3SR4A 1K8RA 3DWEX 4BNXA 1EHIA 1CUCA 1SQSA 3ENKA 4MUJA 5DX8A 2CMKA 4M1EA 1H9BA 5GZ3A 4EA9A 4M8LA 1KWKA 1HK7A 3BWCA 2PBRA 1DL5A 2UUPA 1D6JA 2V0NA 4UTVA 4ZI2A 2CLKB 3BCUA 5D00A 1GGHA 5ALLA 1OXUA 4HDOB 1WTHD 4WOBA 1LJ8A 2G88A 2Z3ZA 3Q3JB 1XXHA 5EOVA 3VJLA 1U0GA 4M89A 1F2UB 4JP1A 1W30A 1N8NA 1X39A 1M0WA 4BUZA 3BHIA 3QZUA 2EZUA 4P0PB 1PJSA 1NVVR 4TROA 1COZA 1TFUA 3PNKA 4QOSA 3AFIA 5AJUA 5GV7A 2IDZA 3SC6A 1UKCA 2PUTA 4JNCA 1CY7A 1U65A 3GPDG 2RH9B 2NACA 1T2UA 3DHYA 2BFCB 1WNFA 2GM9A 4PAGA 1UMCB 4O0LA 1EUZA 3H16A 1YVRA 1AKNA 2I6QA 3KTOA 4E51A 1ECBA 5DYGA 2C4KA 3WGGA 3WGJA 3LO5A 1XAJA 3ZHXA 3D6JA 1IQUA 1CULC 1Q2UA 1N6RA 3QPWA 5BSVA 5CLJA 1YJ8A 2PWBA 3OTWA 4KQ9A 5BMVF 5I9SA 1XTIA 3MAGA 5IJ9A 2HW8A 2J0QA 4DAOA 2WLSA 4YJGA 3L4SO 4LTMA 5JASA 4DR3B 1TA9A 2EP7A 3EXIB 1ZGZA 4GH5A 4NPAA 4N3AA 5JSFA 2PL1A 3AEYA 3HG7A 3M4YA 2ZR0A 1BCSB 2WICA 5A9SB 2GBIA 1Q0RA 4BNUA 1DZIA 1VB5A 4MUBA 2BBWA 1ZVMA 3ZZMA 4KO3S 4LF9B 1NAIA 1NPDA 4IICA 5AKHA 4DMFA 2XYHA 1FS4A 1N1EA 1P2GA 1UADA 2J30A 4OU5A 2IIQA 3F6SA 3NO4A 1GY8A 1PJ2A 4MVJH 1MJGA 3VZQA 2GXAA 1VP3A 3JARA 2Q4TA 4UXHA 4MQLA 1X7HA 4WCFB 3EBLA 3LUKA 4ZQGA 1JFVA 2EW1A 3SOZA 1Q3TA 1ESEA 4LY0A 2R4UA 3D4IA 3TIIA 3VYTB 1ZISA 4AL4A 3OCXA 2BPOA 3UAGA 4IZIA 5AUOB 4A6DA 4ZTUB 4DT1B 4MVJE 1DAOA 4IGKA 4JYZA 2JGMA 3C1TA 5KYGA 1YBMA 1YK0A 3B2NA 5FQNA 3ICWA 3DWIA 4CQJA 2F62A 4I08A 4W8GA 4BNWA 3HXOA 1H3EA 3FKSD 2ECPA 4GVLA 3FUCA 1G4AE 3WLKX 1JJ7A 4N12A 3QW2A 4IV5A 2AR7A 4ZI7B 1GNRA 3NHSA 1T9CA 1SZPA 1U8FO 2FLVA 2I3BA 2QGZA 4Y9DA 1EZ1A 5DF1A 5C8YB 5ICEA 1G9TA 3ADKA 3FYUA 1E62A 1R50A 5IWCA 2JHAA 5DNUA 4KRGA 4Q3DA 3WOHA 4MITA 2OD9A 3I6MA 3JALA 4MCIA 4IOLA 2ZRNA 3U40A 3WRYC 1VJGA 5FUQA 3R6TA 5TS2A 3T3DA 5SYAA 4CMBA 2DGDA 3PQEA 5BMVA 1DS6A 3W06A 2X85A 2BBSA 4N8SA 3AZQA 4LN1A 3DOCA 4BFYA 4FFOA 3HB5X 1EI9A 2J33A 1L9KA 3UOGA 4ZDWA 4ALMA 3LQEA 3H2BA 3RVPA 3QG5A 3HKBB 4PAAA 4HV4A 4PXAA 3UGQA 5HX7A 1IN7A 2JJ1D 3DCYA 3NBKA 4HL6A 3VKUA 2OV6A 1M72A 3VH1A 1OR8A 2G1UA 4FX2A 4LHVA 1P9NA 2C42A 1E2LA 1FW8A 4IIJF 3TQTA 4EJSB 2R11A 2ZJYA 3DOJA 3I6IA 3V1TC 3TVTA 1VSTA 3WK5A 1UD8A 4B8ZA 3HYLA 3TOXA 5IULC 2Z5GA 1FLNA 1JUDA 4NOJA 5EHXA 3VR4A 3S27A 3P0HA 4XOIA 1HQCA 4Q34A 3PWKA 1EDEA 3AY6A 5SY4A 1ETUA 4E7OA 3TKAA 3SKXA 1IC6A 1RRGA 1K06A 5EJ9A 1DAPA 1BO6A 1HMYA 2R25B 3O8QA 4QBGB 1IFXA 1KFEB 2QN7A 3EGVA 2HIHA 1JAIA 2PS3A 1T2VA 3K16A 2XCRB 1E2UA 4EGCB 2ZSUA 3AXSA 2OCBA 1KGDA 1KJYA 4EA6A 2Z6VA 1ONSA 2ZAOA 1Y8RB 3KSDO 4EG8A 3L8EA 3U7HB 1DJPA 2CXUA 1YQGA 5FWXB 5GY7A 1D0SA 4IM7A 3VOBA 2D1TA 3DJYA 3ZQ4A 3CSDA 5KQSA 4YLEA 4K6CA 2C7VA 1E0SA 4X7BA 1R64A 4B3MB 1ZHHA 1KI2A 5G41A 1MW9X 3MJTA 1E77A 4XGQA 3E48A 3EXG1 4DZZA 4V3CA 2F6RA 2FH5B 2YS7A 3LXUX 3UICA 1BXRA 1D1QA 1L4LA 2ANBA 2L82A 3AI2A 3A9UA 3K5PA 3LP8A 4RX1A 5H3HA 3S2YA 2BSQA 1BTOA 3PFCA 3LC7O 1TK3A 4WZBE 4BNHA 2OWDA 2Q8PA 3PHJA 4HY3A 3H2GA 4PM4A 4UBOA 5TX7A 3WLPA 5HZGA 1KFKB 2V54A 4MRAA 2YWXA 3QBDA 3QU5A 1GADO 4ZQCB 3KKOA 4AQ7A 4JX9A 3LKZA 1RVV1 1D5CA 3AFNA 4OFBA 3ZV3A 4US2R 4RF2A 2B8EA 5A4FS 1ZM9A 5KNBH 1TL7C 3ZY3A 2Q8NA 3MUEA 2VDQB 3T5CA 5JNWA 3C8DA 3N3AC 3C6XA 5EZYF 2AZMA 1T8RA 1Y1LA 2EG5A 3EIEA 4QDXA 1BEEA 3E7PA 4J1SA 3WDMA 5HQ3A 4EK9A 3LU1A 2QX7A 4TN5A 4X3PA 5E38A 3TW6A 4AXXA 3GLQA 1W49A 3PKZA 1SUEA 4MGYR 3P5BA 4DJTA 5TF4A 2DUMA 2NPFA 1T1IA 2FWRA 3AY0A 2W37A 4QU0A 4WEOA 4GWKA 4TWBA 4C20A 1EFTA 4ZICA 5IBQA 1YONA 3ETNA 3SQOA 1IN6A 2X40A 1E1YA 3ZVLA 2Z8ZA 3ZGYA 2VXBA 3M1YA 1FDRA 1U7TA 3V8NA 2BKUA 2ZJ3A 3ETHA 3TX6A 3RLIA 5IVKA 2QX6A 2XGMA 1YDMA 2AZ4A 3M3HA 4OSPA 5AIAA 1EFPA 1THGA 5LUBA 1O6FA 1CY4A 1OBFO 4IMIB 1SRQA 1QIJA 2C4WA 4NBVA 5EP2A 2WWXA 4F4IA 3COZA 4MW0A 3IV9A 4RV9A 4P35A 3EG9A 1DKNA 3DDSA 3DEYX 3OM8A 4TUYF 1GUDA 2JHCA 2ZWMA 4DCVA 4DLZA 4MUAA 3DZFA 4FDVA 2AGVA 4I66A 4YYZA 1PV2A 4O3FA 3TAXA 4AP9A 5JCOA 4DA6A 3CSSA 3WBBA 1SN7A 4CMKA 1A95A 1NNI1 1OREA 2CXNA 2RHCA 3KSBC 2PMKA 1K7CA 2XRFA 4UVGA 1DWPA 4ZOCA 5TGDA 4Z7QB 1QYVA 1KI1A 2B1IA 4LFCB 4UKDA 3QU7A 1XTPA 4LBZA 4RAQA 1UZAA 1KFCB 1MAHA 1PYOA 1YKGA 4H0CA 3DKIA 3HDHA 5EHIA 1SU7A 1GEEA 2O3JA 3JVEA 2WY2D 3F4BA 1XTJA 2B4QA 1XZAA 5DM1A 2RE8A 2WWHA 4HE6A 1JNYA 3BFKA 3R0XA 1E4EB 1Q7TA 2PTHA 1Z0FA 1C9MA 1B23P 3CBGA 3OJOA 4D9JA 1N3IA 2AVNA 3HYTA 5ES3A 5LA6F 5EZYA 3CX3A 2ZUTA 3ZGLA 1NLZA 1MQAA 3I5UA 4RA9A 5AK6A 5EWMA 5MHTA 1ZJ6A 1YR1A 4Q01A 3PV0A 4BKQA 5I7AA 4CEHB 2ORED 3KVYA 4LI0A 4C3UA 4HUTA 4GKBA 2QVBA 3K70C 2HSGA 2FFAA 5HIKA 1IHPA 1EM8B 2CJFA 4B3SB 2YDXA 3DAGA 2EKLA 5UKDA 2Q6OA 2CJPA 4L22A 2O1WA 3K05A 4IS3A 3A14A 3RE1A 4GT1A 2R8XA 2HWWA 5DYWA 1I1NA 2EBFX 1UQTA 2HDWA 1CQIA 4E22A 3KKMA 3GGSA 3SJBA 2HHAA 4FIDA 5T6BA 1IXKA 1VG1A 1Q1GA 2KE5A 3BGDA 1N2XA 2B3DA 4YBRA 3S2IA 4A0RA 5E9WA 3QIAA 4BB9A 1N0VC 1SKYB 1XUOA 3K9HA 3CW2A 5T8KA 5KYYA 2PZAA 1UBUS 2QPLA 3TH5A 1VJ0A 2HC9A 1J5EB 1PL8A 2QKYA 4XIIA 4S1TA 3ASTA 5F3WB 1USUA 1SHZA 3L7IA 4Z6KA 5LQCA 2X3YA 5LQMA 2NSHA 1B74A 2DFPA 1EQUA 5IVDA 2OAQ1 4DSZA 1FFXA 4AWBA 1VPWA 4FSXA 3ADPA 4IW3B 2VJCA 1GFWA 2ERCA 1GZHB 1HI9A 1NZDA 3CPEA 5TQ2B 4Z4QA 2V7PA 4ZGQB 1SIOA 1T2NA 1P19A 4MUNA 2QZZA 3SX0A 4DLTA 1GQYA 5AK0A 3W6ZA 4D9GA 2JG3A 1X3LA 5TY0A 3LUHA 4XGKA 1HRDA 1KJQA 4Q93A 1QS0A 4R2IA 1H6AA 4MQUA 3I1YA 1WPCA 2FZ5A 2PKWA 3NYRA 2NVUB 4YJHA 5CT5A 1QPGA 4MB0A 1NXWA 2XDQB 4ID9A 1L5HB 5AKGA 3DLBA 1GGJA 1AH2A 1ORRA 3DL4A 4YT5A 5LA6A 2PKXA 4MV8A 1ND6A 4BFUA 4C4RA 5H9WA 3J7TA 1J8DA 1PHPA 2JA1A 1K9MD 2LP4Y 1O6ZA 3HB4X 4IR7A 1ATZA 4Y1RB 2YWHA 3Q7QA 3W6PA 1A1VA 5IG2A 3RO7A 3Q8MA 1L4NA 1AQLA 1DQPA 4HLDA 3SG0A 4UU0A 4TTRA 2IYQA 2ZUCA 3RYFB 4DLXA 4DJAA 3MD0A 2GD0A 4U7FA 3P9XA 1M2GA 4OH1A 4RANA 4YWHA 3P9NA 3GP8A 2KLBA 4YUVA 2OTCA 3GT4A 1GVNB 5JHHB 2VSNA 2WZCA 2OXFA 1CRLA 3BJZA 1CZLA 1FQJA 3QBEA 3L41A 2HBRA 3LUGA 3IBTA 1LEHA 1CUEA 2OC4A 1AB6A 4FGUA 4EHBA 2GYUA 4KH0A 4F6RB 4O4IF 4ENPA 5EJ6A 4ANFA 1UWCA 4F9FA 3JQCA 2HMVA 3IKJA 3K72B 1NVKA 1NMQA 3PQ5A 1TAQA 1YR3A 4K86A 5DNAA 5ARCA 3PC6A 1GG8A 2OENG 4W5WA 4WHMA 4KXFB 1CB7A 4EBBA 3WJAA 4H7EA 1G3UA 1D5WA 3RPEA 2ZRBA 2EZ4A 1W1UA 5FBLB 1Y8ZA 1MAUA 2CGEA 1NG1A 2AN3A 3F9IA 5E4JA 4H1TA 3BMXA 3QMPA 3L84A 2Z2XA 1CSEE 1E6EA 3O74A 3DZDA 3E9ZA 5ERYA 2Z2YA 5AWFC 1J8MF 2G1KA 2X53S 2J7PD 2KBFA 3I9JA 3SF8B 3TZQA 3ZJUA 4MRRA 1JEYB 2W8ZA 3ASVA 2JGIA 3L4KA 4CDNA 2X8AA 2Z8YA 3WL3A 4N5HX 2BMAA 3SZ3A 3WKBA 1KL7A 1VHWA 3AL2A 4B35A 4HH0A 4XMYA 4BN4A 4OQZA 2E21A 2DBRA 1NIPA 2LIVA 1EVZA 1BXGB 3KAPA 1JYEA 3ZHCA 5TARA 2F3RA 1GFZA 3KQMA 2QRLA 1RHJA 4FFSA 4OXIA 5F73A 4YT2A 4DFDA 1H5QA 1HURA 5F2KA 1ZG3A 1FXWF 1BMFA 3KYBA 2OG1A 1RCTE 4JK3A 4OTZA 4CMCA 4Z8XA 1GR1A 1DXYA 3A6KA 4FOTA 3L7MA 3HN2A 4N7RA 2P6UA 3PSAA 1SA0A 1DX6A 3I2GA 4WNIA 3TMKA 4C7BA 4ZJYA 4R9NA 4XTRA