3SJZA

The structure of aif2gamma subunit delta 41-45 from archaeon sulfolobus solfataricus complexed with gdp and gdpnp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
409
structure length
409
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEETIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HOLD FOR PUBLICATION
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 95
structure length 409
sequence length 409
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjzA01
1S96A 1U0LA 3I8XA 3UATA 3ZZUA 3P20A 1Q22A 3OAAD 2WBLC 2DWOA 3X2SA 3WXMA 3TAUA 4C0KA 3AF0A 5G40A 1S9DA 1AZTA 4JLOA 3CWZA 1G20E 4P4SA 1PLJA 2QY9A 2HEIA 4G1VA 1RFLA 1SHZA 4BZQA 1F6BA 2RGBA 2UVQA 3OE7D 4F7DA 2ERYA 2O8FB 4F7WA 2C5LA 4OI0A 3QXJA 5HXBA 3DZDA 4Q66C 3Q7QA 3U3KA 1W2BB 2YOHA 4ERNA 4JL8A 4NL4H 5AN9A 1BOFA 2A2ZA 3WBJA 1XCGB 4KBGA 1H65A 4FK8A 1IN8A 1JEDA 3GMTA 1SKYE 2B6HA 2OTLB 2RGNC 3GEHA 1Z22A 4EPRA 1S8FA 2JGNA 4YMSA 4TLBA 4Q9JA 3THXB 1E2HA 3SR0A 1M7HA 2VP5A 3B8HA 4LC1A 3U60B 3IKJA 4BEBA 4V0MA 1VG0B 4D6PA 3WHLA 1NP6A 3BERA 3EWSA 1AGRA 1XNJA 2RGNA 3NEYA 5DH9A 1B2RA 1DOAA 4JVNA 3C16C 4LCBA 4W5WA 4HB2A 3TUZC 1ZUNB 3G4SB 1GVNB 1XEFA 2AN9A 4Q18A 3CCEB 1E79D 1M2OB 2GEUA 5KDDA 3ADCA 4IHQA 3EPJA 5A4JA 2ORVA 3EIQA 2CMKA 2BKUA 4HLUC 2F43B 1N6LA 3GEEA 1ZUHA 4U00A 5EP3A 2O8CB 2F1HA 1FNDA 2J0UA 2ZYVX 4MGKR 2IS6A 4RY2A 3QE0A 2J3EA 2H1LA 4ABYA 2LKCA 4TYPA 3KXKA 1VYUA 4BLTA 2ZXUA 1TTTA 1VQ7B 4HLUA 2Q21A 5CITA 5DNYB 4YQFA 5AUNB 1N6IA 2KSQA 4BWYA 4XSHA 1FP6A 2EVWX 1J7KA 1ZBDA 2ZRGA 4NCJA 5E3HA 2JLWA 4QHYA 3VR6A 3Q9LA 3CRMA 2F9LA 4MUAA 1UM8A 5C46F 2XZOA 5IT5A 3ASYA 3IPXA 4N0DA 4ZDWA 2XX3A 3Q5EA 4Q01A 1NN0A 4NCHA 4CEHB 3UG7A 1KO1A 2ZVPX 3PG5A 1DDGA 1IY1A 4QNRA 5F2EA 2GKSA 2ORIA 2G83A 4DEYA 4YAOA 2RC5A 4U9UA 4K8OA 4BFTA 1XD8A 1X8JA 4PO8A 4IDNA 1KNXA 2VP4A 3K0FA 4PQRA 4BRWA 1OH5A 3EZ7A 1XD2A 1UKYA 1KJWA 5P21A 4BEJA 5EE3A 2HYIC 2AKYA 4R2IA 2A5YB 4XWKA 2AFHE 4UNRA 3FPKA 5EXSA 1CNFA 3KKQA 5CYOA 2IYTA 3DVLA 3CB4A 1JR3A 2JCSA 5CK4A 4POAA 3QXXA 2V54A 3GLHA 4KSBA 2EWVA 1N0VC 4OQMA 721PA 1SHKA 4FINA 5CLLA 2BEJA 3LD9A 1CIPA 3GLHB 1VQ4B 1T6NA 1ZM4A 2QEXB 2FJUA 4O0MA 5CB6A 3D8BA 1NMZA 4WAUA 1S3GA 2GETA 3OEHA 2F3RA 1H8HA 3UK6A 1GSIA 4IOMA 2OV2A 4A8JA 2D3WA 2RAPA 5FI0B 3MHPA 1SVSA 3EPKA 2BF4A 3GD7A 3TLXA 1ODFA 4YHBA 1QVAA 4AG6A 4IOLA 2C04A 1W0JA 1E0SA 3AF3A 1UJ2A 1G7CA 5JRZA 5KSZA 4PC6A 2O0HA 5B58C 2GJ9A 5L3RA 4FN5A 3ZVNA 3DM9B 2X2FA 1UKEA 1TU3A 1K8AD 4URYR 4TQ9A 3W3ZB 1XZPA 3HU1A 4PANA 2QM7A 1RPZA 1PLLA 3CNLA 2CNWD 4HI0E 1I7PA 3FOZA 3CO5A 3CCSB 4MRVA 1T5IA 2JLRA 4NZYA 1QHHB 4U5XA 1E2PA 3L82B 5K8IA 2OK7A 2G9NA 3ZD7A 1U9IA 2J0SA 3CCQB 1NN5A 3BGWA 2DY1A 3QSYA 2J46A 4NYMQ 2K5UA 3HU3A 1YJ5A 2QP3A 5HCIA 2PEZA 1Q1ZA 4Z8YA 3K1JA 2JJ1D 1PV4A 2CDNA 2OM2A 2OUKA 4UJ5A 2YINC 3VHLB 1QUFA 1G17A 5J4LA 1JPJA 3SHWA 3FMOB 4D26A 3N2IA 1EK0A 4QBFA 1XX6A 2GNOA 4OQLA 3SYNA 1YJNB 2PCJA 1A5TA 1KTVA 4EJSB 3CXCB 2H57A 4KLNA 3VR4A 1SVLA 3TVDA 2BM1A 1E9FA 4EJSA 1OXVA 4RKFA 3JQRA 5EP2A 3ZBUA 2CL7X 1JAHA 1UBGA 2IEYA 1G1MA 3L0IB 4M1SA 4QOSA 4ZI3A 5JWRA 4K81B 1SM4A 1N5JA 1S1MA 4LUCA 4B71A 2A3RA 2PBRA 4XD7A 3SJAA 2VNHA 1R4AA 3ZS8A 3VHXA 1N6RA 2R9VA 3E1SA 3OIUA 1W4CA 4YMVA 2EYQA 2AL7A 4GSYA 1P62B 1S4QA 2CRVA 4W5JA 3W8RA 4EFLA 4CT4B 2BJVA 2H18A 1U99A 2DEUA 3KB1A 3MRSA 4ZIRA 4YMWA 3H86A 4O25A 4PC1A 3X1XA 4M8NE 1DVRA 5CJ2A 1HH4A 2GRJA 4DXAA 3C5HA 3V00A 4EKDA 3VKGA 3LWNA 4FCVA 5L3QB 1HQCA 1G6HA 1EFRA 1U0JA 1LS1A 5BW8A 2FFBA 1E0AA 1JECA 1DAIA 2IHBA 3VO2A 4YAUA 1E2IA 2MSDB 2QL6A 2Z4SA 3A1UA 4IVPA 3LXXA 1DTSA 3UPUA 3Q85A 1X1RA 3H0KA 2VIIA 3UANA 2HUPA 3AV0B 4MYUA 1IY2A 1J2JA 3VKWA 4B74A 1IJEA 2C9YA 1SKYB 3EZFA 1EFUA 3K70D 4RZ2A 1R6BX 4LZZA 2WWYA 1YI2B 3TVTA 2BCJQ 1GIAA 4DJTA 3CD6B 4BGDA 2OXRA 4IJMA 4JKIA 3U7GA 3PXGA 5CDFE 2HJGA 1NKSA 4M9SA 3R8FA 3U5ZB 3UIEA 1FZQA 3B1VA 3FDIA 3SBDA 5H1YA 3ES9A 2G3YA 2AK2A 4XTRA 4OK5A 4EPWA 4NTZA 1EX6A 1G9XA 4Q1DA 5FOXA 4MKIA 3AP1A 5JI2E 4M2LA 5DYGA 1W4AA 2CK3D 1GITA 1OFIA 2Z5FA 3FFBA 3H2YA 4AG5A 2ZS8A 4DIEA 4Q4HA 3RAPR 2Q0HA 5E7MA 2TMKA 1XXHB 1GUAA 3ADDA 1UKZA 5EZ5A 3M0EA 4JT4A 1U8AA 4D82A 2GCNA 2FH5B 4CW7A 4W9MC 2OAP1 2WJIA 2ZI9A 1EGAA 3IIKA 1E62A 4YALA 4LJAA 3IO3A 4WW0A 3P1JA 3DOEA 2W0MA 4NDZA 4OK6A 3LLMA 4UXHA 3BC1A 2GJ8A 1TL7C 4CRWB 4RD2A 5L3SB 3U44A 1TQ4A 3AH8A 1N5LA 2CCGA 2PT7A 4KAXA 5DISB 4G5GA 3W2HA 2RB4A 2VSOA 4G1BA 2XSZA 4FWIB 5H59A 3THYA 1ZM7A 1Q44A 4BFSA 4BLRA 3DZ8A 1DBSA 2GK6A 4HAWA 1EP3B 1ZMXA 4HAVA 3OZVA 3DEFA 1BQEA 1Q81D 1COWD 3BXZA 1UADA 4PSVA 4RZUA 3KJEA 3U44B 3VU9A 3TR0A 2P3SA 3CNNA 3IBGA 2IXEA 4Q1CA 4OJKA 2B8WA 2FSFA 4NYIR 2AXPA 5FL3A 4DEXA 2PLFA 1DAMA 1VIYA 2V4ZA 4PSKA 3I72A 2ZYUX 4DLSA 5FUYA 3QPVA 3NG1A 4HB4A 2PJZA 4BQSA 3RRYA 1SULA 2FWRA 2IK8A 2VNIA 5L8VA 1W4RA 4P3YA 1YZKA 3U7FB 1BS1A 2QGZA 5EE0A 1OFHA 5IF9A 3CWQA 2UZ3A 3T06B 5J4VA 2UZIR 2EFEB 2XJ4A 1U81A 3AF2A 5AWFC 1ZINA 1G3IA 2CLCX 5CYPA 2QORA 5JZVA 1E9RA 1RRCA 2EFGA 3UWOA 5HR5A 4XVUA 4P6VF 3RS7A 2IL1A 3VR5A 1XD2B 4PZLA 2C9CA 4WXPA 1WXQA 3ZS9A 1PJRA 2J0QA 2EU8A 2JATA 2XNSA 4OHYA 5L3SA 4LPKA 3BJIC 1XCPA 4U02A 1XMSA 3CW2A 5FA6A 2V7QD 3RS2A 2PZFA 4A82A 1KGDA 4E03A 4C4PA 5AJZA 1WCV1 3ZDQA 2A5DA 2DWPA 4UKDA 4HZUA 4CEIB 1G8GA 3C8UA 3C7KA 4WIAA 3KDSE 4G5RA 4LY6A 3UG6A 3MAAC 4Q1BA 4R98A 2BPOA 4B75A 2CJWA 1P2VA 1ZD8A 4GOKA 1R8SA 4F4JA 2IWRA 1Z6TA 1OFTA 3GFOA 5FPSA 4DVGA 3ZIAA 2ZAMA 3BFVA 2EWWA 2P5SA 1RIFA 4KVAA 4YMTA 1NJGA 2EQBA 1FUKA 1P7CA 1W0KD 1XTIA 1ZIPA 3RRMA 2HJVA 1NRJB 2J5XA 2X8AA 2A5JA 4JLAA 3R9WA 1GP2A 1JI0A 4C43A 3AP2A 5AJWA 3W2EA 1JJ7A 4B32A 4XWOA 2JLXA 2KWIA 5BQ5A 4JLNA 5E7IA 5JJLA 1XDBA 3CC7B 2A9KA 1AA9A 2JA1A 1CR2A 3TKLA 4LYAA 3GJ0A 3OEHD 2ZI4A 2ASEA 1XZQA 2ZJ5A 4M22A 3EPHA 1HE1C 4E22A 1LFDB 2HV8A 1P2UA 1YIJB 1W46A 2ZRLA 1P73A 4QGGA 1AM4D 1KDTA 1Q21A 1S0UA 4BE7B 4TLDA 5KYKA 1F48A 1CXZA 1SZPA 1VG1A 4TLEA 5CM9C 2NO6A 1GVHA 1LF0A 4IDOA 2C03A 2CLDX 1VIAA 1OLOA 4X8HA 4C30A 2F9MA 2X77A 4F93B 1G8HA 1KI9A 5EXXA 1QH0A 2WWIA 5BN4A 2BN4A 2R6HA 2GDJA 4RD4A 2HT1A 4A2PA 3LNCA 1WBBA 3KFVA 1Z0AA 1M6NA 1KI7A 5C4MA 4Y7CA 3T5GA 3AKYA 5AJXA 3IO5A 1J8YF 1YR6A 2CE2X 3BORA 2IYWA 1R2QA 4ZKEA 2ZS9A 1F2UB 1I2MA 2W6JD 1FTSA 3QF4B 3QPUA 1ZRHA 2D4HA 2NO1A 2QZ4A 4TMZA 3FKSA 4E07A 1H8ED 4A0GA 2GBLA 2XITA 1FRQA 2QUZA 3AVPA 3U7HB 4M1YA 4DC9A 1GKYA 4DLYA 3E2IA 4I1SA 4RCYA 4LBWA 1NBMA 3I1FA 4ZGQB 3AVUA 1MO5A 2QP4A 4M9QA 4Q4AA 1YKSA 4NPHA 2GCOA 3AF4A 4Z1MD 1IY0A 5TR9A 2NO0A 3Q8XB 4P32A 1DG3A 4GOXA 3H84A 5E95A 4B33A 1GRQA 2YV5A 4MQBA 1Q1BA 1E9CA 2DBYA 2W0SA 2QMUA 2N1BA 4DLXA 6Q21A 3OFNA 2XGJA 3D3QA 1WQ1R 5DI3A 1CULC 2GTPA 3NEJA 4RD0A 2MMGA 4E09A 1QX4A 2ZYWX 1KIMA 1JR3D 4Q19A 2ZJYA 3CPWB 2OFXA 4M53A 4BASA 3ND8A 3WP0A 3B82A 2GK7A 1GL7A 1GDDA 2IC5A 1RJ9B 4QHSA 1V5WA 4TYQA 4CEJB 3LBHA 4QJ4A 4QBHA 3BFXA 3AVXA 1VG8A 1YHQB 5HZHA 1U90A 2PIAA 1FTNA 1XTQA 2QTLA 3LX5A 2OO7A 3PQCA 4YONB 2ODBA 3TIFA 4C0SA 221PA 2JDIA 1G8YA 5JS7A 1E2LA 1KO5A 4DT1A 1Z6XA 3A1WA 5KOYA 1MH1A 2H8KA 3IEUA 1ZM2A 2HT6A 3C4JA 2NZ8A 3KJHA 3RRZA 1TQ2A 2BBSA 1W0JD 4O2LA 4P4UA 1AS3A 3A1VA 5TY0A 3FFAA 1R0XA 5J40A 1QRAA 1EP1B 3NXSA 3CLVA 1U98A 1KI6B 1ZCBA 2R6FA 1HT1E 3QI2A 1XEWX 5JRJA 5FBRB 1DDIA 2R6CA 3BB1A 4FW9A 5JHGB 3F5FA 3CRQA 1JALA 3THOA 3EW9A 2GPJA 1MOZA 1BMFA 2ZUDA 3HYTA 4QGAA 821PA 1LVGA 3IPYA 2O8BB 2VLIA 3V76A 1IM2A 1UBCA 3PR1A 5KO2A 2YOGA 3HU2A 5AUQA 4C2UA 1Z83A 4QKQA 1M1KD 1AJEA 2OK8A 1E79A 2J7PD 4OKSA 1IJFA 5CM8B 5FUVA 4C0AC 1NY5A 4IXMA 3CR8A 4GT1A 4EH1A 1OFUX 3IIMA 2QU8A 3WMFA 2J7PA 3C15C 4EQ6A 4UNQA 3VO1A 2VQSA 4C7OA 4Q4HB 1RYFA 1RRFA 5EUMA 3RDPA 2VSXA 4FI3C 4WBSA 3ZJYA 2QPAA 5D3MA 4JLJA 4M0LA 1DS6A 3IHLA 4YLGA 3SQXA 3MJHA 1P9WA 2QA4B 1M74A 3ADBA 2JIZD 3NC1C 4AWXA 2NPFA 1DADA 4OI2A 4DLRA 5FTMA 2CLSA 4CF7A 1W48A 2YOFA 2IYSA 5KHOC 2RC6A 4LBYA 4QJ5A 1G21E 1JBKA 2ZSBA 3L0OA 4MA4A 2Q9CA 4P4SB 1ZM9A 5HCNA 4IVRA 4KODA 4Q7MB 3A1TA 4GBMA 5FL7D 2HXYA 1ZJ6A 2CHVA 4RVCA 4DDTA 2AD5A 2FDCA 3R9XA 3GLIE 1IN7A 2JJ2D 3THWA 1SKQA 1TX4B 2YZ2A 4ZV4A 4PO9A 4TTQA 4G5OA 2ZI5A 1OXTA 4OBEA 5FH9A 1G3MA 1A8PA 3V4RA 2WSSD 2VF8A 4LC0A 5LDDC 3EWAA 3SJCA 4UJ3A 2QBYB 3PJRA 3RWOA 1NMXA 4LDJA 3QKRA 1G3QA 1P75A 1R8QA 3AKDA 2P6UA 4C7OB 2Z4RA 1BJKA 1WB9A 1Q1QA 1ZAKA 4UNSA 1J70A 3AF1A 4MYCA 1MO4A 1QDEA 2ONJA 1J8MF 3CBQA 1IONA 4MYHA 1C4OA 1AS2A 4MYTA 1M34E 5KUTA 2OCYC 4X8OA 1CBUA 4A8JC 4HE6A 4DSUA 3WYAA 1Q3TA 4JZKA 4B48A 3KTAA 1KDPA 4RKEA 1Z0KA 1OH7A 3KB2A 4MRPA 3W90A 1JB9A 3WY9A 4LV6A 2RGDA 2WOOA 3F8TA 4DQLA 5ELXA 4BPBA 1YQTA 5ANRB 3QFCA 2X19A 2NZJA 2XNDA 3BH6A 1YZGA 4F4IA 1E1RA 4OYHA 3FKSD 3FB4A 2W6ID 2GXSA 1M8PA 2IF2A 1TNDA 1E2QA 1KY3A 1Q86D 3LH5A 3PEVA 1MT0A 1EFTA 3K70C 3T34A 2P6RA 3RNLA 3OIVA 4OI4A 1KAOA 4RD3A 1W36B 3UMRA 3WMEA 1N5IA 2A78A 4TMTA 2FFQA 1QHGA 4URXR 2ZRBA 3MWKA 4L15A 1U94A 1EFCA 4ESHA 2F55A 1KK3A 3AVVA 4N1AA 3CX7A 2CHGA 1HQYE 4BECA 4IFBA 4RCZA 2J7KA 1CJUC 2C95A 5HE8A 2OILA 4UNNA 2DCUA 1KI2A 1NI3A 2DWQA 4EAQA 1KO8A 4EJSC 4OHZA 3DHWC 2IEZA 2ZROA 2RCNA 1JJVA 4KI0A 1F60A 3K8YA 2QENA 1OIWA 2G1KA 4PX9A 2XNCA 3U3RA 2VHTA 1II8A 4OQNA 1UMKA 1D6JA 1ZC3A 3CUEF 4BFYA 3W34A 4N0EA 3C41J 3CPEA 5LB2A 4AKGA 4B6FA 2JLQA 5HE9A 3WYGA 2G0NA 1OB5A 2DETA 1XTSA 1A4RA 4NMMA 1NVUQ 4J0QA 2IT1A 3ZZ0A 3W2FA 2FSGA 1AGPA 2IS4A 2OEPA 3SN6A 3RLFA 5B57C 4FCWA 2Q6TA 2HYDA 2BJWA 1GG2A 4MGIR 2EW1A 2QNRA 3VAAA 2E87A 2GXQA 3DMDA 3X1WA 1CNEA 3U4QA 4XVRA 2VYQA 1ETUA 3EIEA 1N2CE 1VPLA 2P5TB 3B1YA 4BFZA 5L3VA 1TVCA 3UXMA 4TYWA 1NVXQ 4TL9A 3U2QA 1R0ZA 5G3ZA 1TUIA 4V03A 3QE2A 1L8QA 4ZDIA 5BWMA 4QGFA 3A4LA 1ZU4A 1BYUA 1US8A 1Y63A 2KBFA 2XTNA 3OFND 4RD1A 4MITA 5JSZB 1Z28A 3QKTA 5K8TA 4C0JA 2FEOA 3SI7A 1QHYA 3MMPA 4YAWA 1TAGA 5CK5A 1YZNA 4WZ6A 4URWR 2PLRA 3K0AB 4MUBA 3LVBA 3P26A 2GF0A 4ON9A 3RS0A 5FTLA 3CMEB 5C1BA 4CGZA 2E1RA 2XEXA 1F2UA 2YWFA 1XJCA 2H92A 2H5EA 2ZR9A 4L4UA 3GLIA 3CC2B 5FTNA 5LD2C 4HYYA 2FGJA 4OQFA 1E6CA 4YAFA 3T61A 2BMEA 1SVKA 5GV7A 3EZ9A 1KRHA 3U3MA 2D62A 3KKMA 1NMYA 3LV8A 4EPYA 4P4TA 3O47A 2QBYA 2ANCA 3I3SR 2PEYA 4IOKA 1FRNA 1T3SA 3QKRB 4Q4AB 5K8LA 4Q9HA 1LB1B 4GMDA 4NH0A 4KXFB 2CK3A 1GKIA 1N8RD 4PZZA 5H70A 5EE9A 2QROA 1UDWA 3X1ZA 4Q7JB 2BMJA 2HLDA 2BGJA 4IVQA 4WXRA 2DERA 3CF0A 2ERXA 3W9YA 4Q1AA 1W5SA 2P67A 2H17A 3MD0A 3NKVA 3CF6R 4JVLA 5EZ6B 2EFCB 3UMFA 3VTKA 3VX3A 1KZ7B 3H1TA 4GMXA 1D2MA 3BB3A 2PJRA 3I92A 1NJID 4MKFA 2KBEA 2IXFA 1OJLA 5A0FA 1E9EA 2ZJZA 1CKEA 1Q0UA 4TL6A 4IEIA 2FZ4A 1L2TA 3CCLB 1FP7A 3A8TA 3QVUA 5JWHA 3PV0A 1BKDR 2WPDA 4TSFD 2O8BA 2E9SA 1RC8A 2GA8A 3MG9A 1N3BA 3ZGXA 3FHTA 2YWEA 3FE2A 4LBVA 3GLIB 3SJZA 3ZVRA 1VQKB 2WPDD 4TSFA 2G6BA 5FI1B 2Q3MA 4X8LA 1VCMA 1XMVA 2ANBA 2GBLC 2OCPA 4PAOA 2D2EA 4V02A 4TMWA 2FF7A 3C5CA 2XXAB 4B2PA 3HR8A 1YZQA 2YNMA 1E2NA 1T3HA 2RGXA 5EQTA 2HDNB 2R44A 2XOKA 1ZNXA 1Z0JA 2F3TA 3AUYA 2C8VA 1XPUA 1EG7A 4HDQB 1LV7A 1UBFA 4ITRC 2I4IA 3QNUA 3FVQA 3A4MA 2CBZA 3K9HA 3BK7A 4JMPA 2IYUA 2ZJAA 3ADKA 2P2LA 3UMSA 1OF1A 3W6OA 3GP8A 5AJVB 2OXCA 4DDVA 4G3XA 1N6PA 1JQLB 4MRRA 4D4JA 3KXLA 3DPUA 1KSJA 3QOFA 4B3BA 3W5IA 1BH2A 4A1FA 5FBLB 1FX0B 3G6EB 1B23P 1II8B 2BBWA 1D9ZA 1OHHD 5DGXA 4A0FA 3K0SA 2OZEA 4LV8B 4GDFA 3B85A 4JT2A 4HATA 5CB8A 1LNZA 1M7GA 2OTJB 4US2R 5FOWA 1FMJA 4BLQA 3LW7A 3CONA 1MABA 1CJKC 4BFWA 3ZH9B 2REBA 3BIFA 3B7GA 3JVUA 1A2KC 1MABB 3T1TA 2DFNA 1OH6A 1TU4A 1GZSA 5DLQC 2YC2C 4YDSA 3FHCB 5IHPA 4PXAA 2CL0X 4PC3A 2BM0A 1NNEA 2D74A 5FR2A 2ODNA 3SQWA 2YWGA 2Q3HA 2ZRMA 3ASZA 3TSOA 1S2MA 1Q1EA 1XP8A 4CIDA 2GEVA 4MH0R 5THXA 3T35A 1E69A 1EFRD 4A36A 2OFWA 5FL7A 4KVGA 5AJYA 1A2BA 3SHFA 3H4MA 4GZMA 4AKIA 1KJYA 1LY1A 1VQNB 5F3WB 4D4LA 2WV9A 4LJ7A 5DYIA 5B30A 3I62A 4RZ3A 1IHUA 2VPPA 2GJAA 2F1RA 2QG6A 3RANA 4EIWA 4Z1MA 1IAQA 3VX4A 3RC8A 2NO9A 3EA0A 3NHAA 3KL4A 3SE0A 4TN1A 1QZXA 3SEAA 5DHAA 1XPRA 3WP1B 1AKEA 1H8HD 3TGPA 2RKOA 4TMKA 4M1KA 521PA 2O8EA 4I99A 4Q7LA 3GJ5A 3CZPA 2WTUA 5GV8A 1E63A 4D25A 2VHUA 1NLFA 3U3OA 2WWXA 4KO8A 5BXQC 2VP9A 1FDRA 1K6MA 2RGGA 1ZVQA 4OK3A 2ATVA 2F6RA 3V9PA 3THYB 3RSLA 4IFEA 4HUQA 2B7CA 2B92A 3HR7A 2VP6A 5FPTA 4PFSA 4ZDJA 3B60A 4Q1FA 4YMUA 5J4HA 3A58B 3KXIA 1G291 5JHHB 4S2EA 1KO7A 2DHRA 1HEIA 1OIVA 2GZDA 3GQBA 5DIFA 2F43A 3VR2A 4A9AA 1ANKA 4EFNA 3REFA 4W5HA 1NN3A 2WIBA 4ZIRB 5FOVA 2GXAA 4ARZA 2QAGC 3NBXX 4I1OA 1TEXA 3ZVLA 3MCAA 1NVWQ 2VF7A 5F9HA 2Z43A 1E2JA 1KQSB 4MRNA 5GVSA 3BH7A 1CEEA 2JLSA 4F92B 1KOFA 2VNKA 1F3OA 1D1NA 4OHVA 5SZIA 1KDRA 4GP7A 5JCPA 2NO7A 2R6AA 3FMIA 2ZRHA 3LVRE 1JNYA 1Z29A 2FFAA 2RGAA 3P27A 4PGOA 1ZNWA 4FMDF 3AGQA 4TLCA 4ILEA 3TBKA 1CRPA 2B5OA 3B1XA 5BN5A 4EPXA 1KK1A 1XTKA 4EDHA 1R7RA 4B6EA 4KSCA 4A92A 4B73A 4D80A 3SJBA 3GJ3A 1SGWA 3NBFA 1U8ZA 1R5OA 1LS6A 4M21A 2ZIAA 5TARA 4I1VA 1K9MD 3MJRA 1CJVC 2GWHA 1W4BA 1CLUA 1FFHA 4BRUA 2QEQA 4FXPA 5FPHA 3WBKA 3LDAA 2HF8A 1E4VA 1OPXA 3DKVA 1KKMA 1D5CA 2WKQA 3KJIA 4B3CA 2W83A 3KQUA 3KQNA 3QKSB 4PHGA 4FD2A 1NIPA 1KI6A 3F3YA 4EFMA 1E9BA 2BKEA 3AKEA 4LPSA 1QG2A 3KFXA 1HUQA 3QXHA 3RS4A 5HKKA 3EARA 1G7TA 1RVDA 5G41A 2WVJA 4PAQA 3ZYCA 3THWB 2BBTA 3FMFA 1H42A 2ZRIA 1CJTC 4B3DA 3U4QB 1KKLA 1XFAA 5F98A 4PHHA 1ONBA 3OE7A 1NBMD 5JCZA 1X3SA 5FUXA 1YZTA 4QHTA 1P2SA 1NBME 2FV8A 1GNQA 3Q72A 4ESVA 4YC7A 5JSZA 2VL7A 1A7JA 3EZ6A 2VEDA 4HAYA 1P5ZB 1NJFA 1DE0A 1R10A 2FZLA 3KQHA 1W5TA 3I5XA 4H9GA 2FPKA 4Q03A 2ZUCA 3FMPB 2R8RA 4IDPA 3CZQA 2BVNA 4L16A 3IEVA 5EP4A 3I56B 2ZSFA 1DAEA 4XWAA 3VMFA 2OBMA 4HAUA 4DB4A 3KKOA 4WVFA 4URVR 1W7AA 1N0WA 4DLTA 5IK2D 5JEEA 4IW3B 3SZRA 1II9A 4LJ8A 1E32A 2VH5R 2I3BA 4A8JB 4QC2A 4QXAA 1GFIA 1T8TA 1I2DA 3QFTA 4D81A 2BMWA 1XD9A 4AK9A 3FWYA 1SXJC 4DCUA 2GCOB 2VRWA 4JJZA 4WQMA 1SXJD 3QY0A 1S9HA 4TQAA 5FBQB 3SYKA 1S72B 4JVMA 1SVIA 5H8WA 1EFHA 4HUTA 1EX7A 4EPVA 4BFVA 3W5UA 2CCKA 3NTUA 4TMVA 1G5RA 4PTLA 1W49A 3KQKA 4A2QA 5B64A 2D7CA 4TTRA 2QQ0A 2YWHA 2C99A 2R6GA 1CR1A 1T0JB 1NSTA 3NBYC 4QBGB 2QAGB 3A4NA 3OZXA 4OJQA 1YITB 1QBKC 1VHTA 3TUJC 5BYKA 5TMPA 2JLUA 2ZE5A 2QSZA 5FTJA 3AB3A 5FR1A 4ZDKA 3PUXA 1Z63A 1UBEA 1FUUA 2ZS7A 3GLGA 2R65A 3ONWA 4DBLC 4LJYA 4PHFA 2XB2A 4DZZA 2ZI7A 1HT2E 5F9FA 2OBNA 4HAXA 1XU4A 2O8DB 5DO9A 3I61A 2A5GA 5EXPA 2OCAA 2ZETA 4LX0A 4QL3A 3WYFA 3W2GA 1BYIA 1KMHA 3OZUA 4B76A 1FNMA 4NYMR 4AKHA 4NE2A 5IDVA 1JXMA 1KI4A 2IX3A 1W35A 1XEWY 5GJWC 3KTAB 3ZQJA 3HWSA 1IB0A 3CCMB 1QGYA 5TV2A 1N6HA 3HP1A 3NC0C 1GOTA 2NOAA 3QG5A 4Q9LA 3OEED 5FPYA 4K46A 3SC3A 1ZUIA 4V0OA 3LO8A 2FGKA 2O8EB 3CM0A 2ZPTX 3WNBA 2IYVA 2GAAA 2VHJA 1EP2B 4AKEA 1XTJA 2REOA 3RVBA 4Q21A 2DFTA 2AXNA 3JZMA 2IA5A 3N2EA 5KPJA 2HMAA 1VG9B 4ZKDA 1GJRA 2ZJOA 1MRSA 3AVWA 2ZJ2A 2QQEA 1P4SA 1KJZA 4DSTA 3L8ZA 1VKJA 4LOAA 1FPMA 1K5DA 1TF2A 5J4YA 2ZJBA 3LFUA 5LB4A 1JB1A 3LRPA 3ZIAD 5L3QA 2ORWA 4M9XA 3W5JA 4XD7D 3D6TB 1QVRA 3T1VA 3N70A 5BYJA 3ECCA 5DI9A 1E1QA 4L9WA 4Q4JB 2KB0A 3GFPA 2ZITA 3NH9A 1YVDA 2A30A 2KE5A 1N0UA 2BEKA 3FPAA 1GAQA 2OE2A 1E98A 2WHXA 3X1DA 2GHIA 4A2WA 5CIQA 4TL7A 5DE3A 1OW3B 2C77A 1MRNA 4QNMA 2AFIE 1QF9A 1Q82D 1CJMA 2JLYA 4FMBB 4KV9A 2QTZA 1UPTA 2GEDA 2J41A 1MO3A 4WA7A 4FMCB 1US8B 3TQCA 1Z0FA 3KX2A 1UEJA 3WNDA 1EWRA 1P3JA 1OHHA 1TF7A 3KZ1E 1IXRC 3MWJA 4Q4LA 3KJGA 3QF7A 1VECA 5JBQA 3A6PC 5D3MB 1PUIA 1ESNA 4D4MA 4AC9A 4KITB 1WF3A 1W0KA 2IYZA 2O0JA 3CPJB 3E70C 1ZM3A 3M4YA 3KQLA 4HDCA 2XJ9A 4C0HA 3W2IA 2H16A 4QM6A 3GLGE 2QPTA 1NG1A 1DELA 3VR1A 2WJGA 4BLPA 2O8FA 4DKXA 1ZNZA 3O8RA 4P0TA 4V0NA 4QG7A 1ZIOA 1T91A 1GAJA 5KU1A 1E96A 1NLZA 1J90A 1EXMA 1G3RA 1W34A 1M1YE 1KMQA 1Q3HA 4B43A 1CTQA 4LHWA 4CYMA 1YHNA 1RRPA 1OYWA 2HLDD 1G64A 5D3QA 3VU9B 3G0HA 4QGHA 2RHMA 1A1VA 3CX6A 1ZP6A 2XOKD 4HB0A 2QRZA 2HF9A 2GJKA 4IOJA 2W2TA 2QE7D 3X1YA 1AQYA 2VSFA 2WKRA 1Z6AA 1C9KA 4Q5IA 1Z07A 2CXXA 2H7VA 4QBIA 3SOPA 1U9IC 4B44A 2R6DA 2WJHA 4NONA 5CIWA 5G3YA 4A6PA 1P61B 1Z0DA 2REXB 1U2RA 2MMCA 4NP6A 4LHZA 2W58A 1NN1A 3OF5A 2ZSEA 1KO4A 1KSGA 3LBIA 4PPNA 2CJWB 2VO1A 1NSFA 4PC2A 3ZQ6A 3ICEA 4IDQA 1G41A 3IQWA 3VNVA 1X8KA 2IS2A 2QT1A 2VTKA 4HLCA 4B3GA 1Z6YA 4KYUA 3U6KA 4AF7A 2QMOA 4UXJA 4D0NA 5LD2B 4M4SA 1TADA 4LJ4A 4M9ZA 1OKKD 2XTZA 4BLSA 2X1VA 4Q48A 5KNBA 1TQDA 3TW4A 5H5JA 1W2HA 4HDOB 1ZC4A 4NCNA 4B2LA 4A4DA 5LPNA 1VCOA 2J0UB 5CJPA 2OCBA 1OKKA 3K0FB 3P32A 2XNJA 1QFYA 3SFVA 1LF5A 4LBZA 4D4KA 4AI6A 1RKBA 4ASUD 2MSEB 1IBRA 2EIXA 4DCNA 2FX3A 2F1IA 2NTYC 3LA6A 4Z51A 4DT1B 2RH5A 1NVVQ 1HYQA 3PUYA 1KC8D 4FCTA 4GPTA 4KU4A 1U0HC 4MGYR 5J47A 1V43A 2QE7A 4ZCLA 1Y3AA 2ONKA 3P4YA 5LBIA 4HLDA 2LWIA 3O8BA 3QQ5A 4TQUS 3RHFA 4CEHA 2WICA 4H1VA 1VMAA 4L5BA 2ZUBA 3G5UA 1YZUA 3HJNA 1OB2A 2OESA 1UDXA 4C9BA 1AK2A 3ZD6A 2R62A 3QUSA 3AGPA 2IYYA 4D0LB 2WJVA 3GLHE 2P6NA 2I1QA 1XTRA 3U61B 1OGIA 4M1WA 3CX8A 5KDOA 1PZNA 4JS0A 1WE2A 1F2TB 1I4DD 2WM9B 5GVRA 4B3XA 3QFSA 1JXOA 4JL6A 5FOUA 1XMJA 3G82C 3W3AA 2PMKA 4LHXA 4R7ZA 1KNQA 4C2TA 3OW2B 2WMOB 2NGRA 2Z83A 1YU9A 3GJ6A 3QF4A 3C14C 4E5UA 3NIBA 4AF6A 4LYFA 4DLWA 1XXHA 2ZEJA 5GJVC 3RS3A 2V1XA 4NYJQ 2JJ2A 3LAWA 3OIYA 2W6IA 1E9DA 3GLFB 1A82A 1WRBA 4FIDA 1XMIA 3QFRA 1CQXA 3W8NA 4ZGNB 1AZSC 3I8SA 3A1SA 1KI3A 2PX3A 1CF4A 2QDXA 1KD1D 2IBMA 3F0TA 2GXUA 5EMNA 3HPQA 2IF0A 1VYVA 5JEDA 3WHKA 1D9XA 2ZE8A 3NDPA 4AIIA 4DSOA 1SVMA 3W6NA 4CEJA 3WRYC 2PH1A 1X86B 2ZU6A 4NYJR 1FNCA 1OT3A 2OHFA 2GQFA 4DIDA 2FSHA 4TZ6A 1TF5A 1G4AE 4XTCS 1W47A 3S1AB 1P9RA 2QRNA 1T5LA 3BB4A 3T1QA 2O8CA 2BGIA 3GPLA 1E1QD 3I73A 4JLMA 1DAHA 1G7SA 2P0EA 3RYTC 4BLOA 1OV4A 2ZRDA 4Q47A 3QENA 2QTFA 4AYTA 4Y0VA 1Z47A 2R2AA 1DG1G 1M90D 1NY6A 4G1UC 4Q4JA 3VR3A 1CS4C 4YXWD 5EE5B 1NKTA 4ZPXA 4US0R 4WZBE 2OG2A 3UKDA 2ZTSA 4ZO4A 2LCFA 4JYBA 5KTYA 1ZU5A 4LYJA 4R2HA 3U7EB 4CZ2A 2J87A 2ZSAA 1XJ0A 4G5SA 1Q20A 1ZW6A 2OSBA 4DB2A 1G16A 1FQJA 3FKQA 5CDFA 4ZI2A 3CRW1 5J4KA 1T8UA 3CPHA 1N6OA 4IKEA 1GR1A 4DLZA 1R0YA 4N3GA 2JIZA 1FNNA 2MSCB 3DO6A 3ETLA 3EZ2A 4P31A 3JVVA 5GJBA 5KNDA 4BFUA 1GL6A 1G5PA 2ZR7A 1CP2A 5TXGA 3GLFE 1HTWA 2G0TA 3EG5A 4BUJA 1UAAA 4TYYA 2IXGA 4US1R 2JAQA 1OXXK 2X2EA 1FQKA 1T9HA 4F4CA 4KYIB 4B4DA 4BZXA 3G71B 1BX0A 2ZI6A 2IW3A 3DL0A 3QBVA 2ZRPA 3B1WA 1G3UA 2ZJ8A 3LLUA 4Z54A 5AK0A 4TMXA 2HCJB 2QTVB 3A36A 4PQYA 3DDCA 2ATXA 3QEOA 4LI0A 3LO5A 1KK2A 3HYRA 4JLVA 2IUSA 1RW4A 3IDQA 2SHKA 4LWZA 1G18A 4TT3D 2QTHA 1NF3A 5JECA 3EXAA 3MWYW 3AVOA 3DMNA 2N46A 4C0BA 1PLKA 4LJ9A 2WWHA 1WA5A 1K5GA 3HPRA 1G5TA 3BD9A 4RFVA 1BO6A 1AS0A 4B3FX 1K8RA 4Z8XA 1E2DA 1GKUB 1IN4A 1Z08A 1G8PA 2BBOA 3NWJA 2JJ1A 2ZE6A 1ZNYA 3W5VA 1XE1A 2QGNA 3FTQA 3MUFA 3SDZA 4IDHA 2GILA 1GM5A 1XCMA 1JQJC 4GZLA 1BMFD 3L0SA 3QXSA 4V0KA 1FW6A 4C0LA 2X3UA 1Q57A 3SU8A 2WMNB 3L43A 1UEIA 1QHXA 1J9ZA 5KSYA 1CRQA 2ZRAA 3DOFA 3LQRA 2ODWA 3BS4A 1KI1A 1FMLA 3SYLA 3OJWA 4M1TA 2VBCA 1E3MA 4NYIQ 1E99A 3GJ8A 4HLQB 4LJ6A 3VFDA 4MDFA 5JFGA 1P72A 2VHCA 4CT5A 2DFLA 2WJYA 3RRNA 4DHEA 4TZ0A 4ACAA 4JLPA 4HB3A 3I32A 5FBWB 1FX0A 2PL3A 3B9PA 5GJCA 2RGCA 3TW8B 2CEAA 4KFTA 3TNFA 3JZAA 4XOIA 1K73D 4FWTA 2J45A 1E2FA 2C2HA 3OEEA 4OHWA 3NH6A 2GVDC 3PENA 4TTPA 4BZPA 1X6VA 2CNWA 2XB4A 3PVSA 3U3JA 4YXWA 4C0QC 5EE1A 1I4LD 3T5DA 1W36D 3PUVA 3MWLA 2OT3B 3AKCA 3RC3A 3AP3A 3TRFA 1W1WA 1OGJA 1MO6A 1E0KA 1E2MA 1X8LA 4RSGA 3CCRB 1QGAA 4GNKA 2FSIA 3K09C 4LV5B 1TQ6A 4M1MA 3GJXC 5K8UA 3Q7PA 5DHFA 5DN6A 4ZCIA 4OHXA 4XSGA 1TUEA 4PR0A 3OZWA 3A37A 2PCLA 4D0GA 3MGCA 1S1CA 4JLKA 3PEYA 5UKDA 3OESA 2CNDA 1CR0A 3TSWA 3ZZTA 3IGFA 1W44A 4MRSA 4RFSB 3RS5A 1W2GA 3L2OB 2WZQA 3K09A 2G88A 5HKKD 1GRNA 2WWWA 4GI7A 1LW7A 5TVKA 1GRRA 5J5CA 1H8EA 3TAHA 5AUOB 3T15A 1JR3E 1YRBA 2IYXA 2GF9A 2ZRKA 4K1XA 5KPDA 3K0CA 2EFDB 3BH0A 3PUWA 4EPTA 1O3YA 2AR7A 4XJXA 2ZI3A 4DCTA 3B78A 3VQTA 3R9IA 3R7WB 3CH4B 4LRWA 621PA 4A0HA 2I1VB 2FN4A 4ACBA 1VCNA 1VDZA 4M1OA 4UNPA 4IRUB 5E4FA 2FPLA 1BIFA 4I81A 1W36C 4HE5A 2NIPA 2QP9X 2YC4C 5JMTA 1NLYA 1DARA 1Q12A 3R7WA 1GO2A 5JJIA 4LYHA 5IK2A 2RMKA 3S1AA 1ZYUA 2ZREA 1W87A 1Z8FA 2C98A 3OAAA 5DSZA 1MR3F 1IXSB 1GL9B 3RWMB 4AY2A 4Y9RA 1IXZA 1OXSC 3EIHA 2ZANA 4PHTA 5FOTA 4NU0A 2IUTA 5FTKA 4KFSA 2WJJA 1JR6A 3GLFA 1XRJA 2XZPA 1L4YA 3NVAA 4LHYA 4ARZB 1AMOA 5TDHA 1VYTA 2N42A 1TLLA 3EC1A 4NHOA 3D31A 3BRWD 5C2JB 3LBNA 4LK2A 1XEXA 2A5FA 1GWNA 2DPXA 4RFSA 3EC2A 1GILA 4Q7KA 1EWYA 1GNRA 1WP9A 3PFIA 3R20A 2GESA 1OIXA 1KYIA 1U8YA 4FMDB 4NBSA 3B9QA 3Q3JB 4CDGA 4QFMA 2DB3A 5HZKA 3I55B 1G8FA 4Y9UA 3TUIC 2NPIA 2RGEA 1VHLA 1IOZA 2OAQ1 1F2TA 5HTKA 1MKYA 2G1JA 1XJQA 5FOSA 3I5YA 2YYZA 1L4UA 2BHRA 4JYCA 4RZXA 3PCRB 4PSAA 5KNCA 4AYXA 1N5KA 3QEJA 5JLJA 1H85A 1HY3A 2QMEA 4DDUA 2XSZD 1B0UA 2F1JA 1TEVA 2PZGA 2WIAA 5HPYB 3IIJA 1TMKA 3K0AA 3AVYA 1RYHA 1MV5A 2BMFA 1L7VC 2C9OA 3I4LA 4V0ME 1VQMB 3QG1A 1Z3IX 2W2XA 4Q9IA 4NCIA 2VP0A 4Q9KA 4KFRA 3TQFA 4ZCMA 4JBWA 4PPGA 3TH5A 3DKPA 5G53C 4QRHA 2AKAB 1VQ9B 2AWOA 1VQ5B 3JQQA 4RJLA 2V6IA 1KAGA 1Z06A 3M6AA 3NBZC 2FOLA 3B5JA 2J1LA 2ODEA 4U7DA 3TK1A 3FGNA 1QG0A 2QN6A 2WKPA 3L0PA 4Q02A 4PC7A 2QMHA 5A5GA 4DCSA 5GADl 2V1UA 2OFOA 3K0EA 4G01B 1QVFB 1NIJA 5EXTA 2IYLD 5DN6D 4MKHA 3LQQA 2AX4A 4MKGA 2OBLA 2V3CC 5FFMA 1DO0A 3AVTA 1RRGA 1XF9A 2GVZC 4EUNA 3CCVB 4A15A 1QFZA 3CCUB 3SFZA 4HZIA 2BOVA 5KSOA 2DR3A 3PEWA 3E1YE 2PT5A 1HA3A 2ZQ5A 1XXHE 3V4FA 2J59A 3PUZA 1AIPA 1YRAA 1QUEA 3JQPA 4DLUA 1FL9A 4L9SA 4URUR 121PA 4DDWA 1DO2A 4Q1EA 1XB2A 4HSEA 2WAYA 1WBDA 4GL2A 5KSPA 2RHDA 4LJ5A 4O3MA 2XTMA 4S35A 5BN3A 2YKGA 3VNUA 1C1YA 1CR4A 2AK3A 4D2IA 1N25A 1F5NA 1ELOA 1G19A 2JASA 4OI1A 2ZRFA 3CC4B 1N6NA 3CRRA 2V6JA 4DUGD 4JJKA 1P9NA 4V0LA 2O0KA 2D7DA 2NQ2C 1R5NA 1NL3A 1JJ2B 1II0A 1QHIA 1QVGB 5AR1A 3RABA 2J9RA 3BOSA 2IYQA 3M1IA 3EASA 4UAJA 3KKNA 3NHBA 1F20A 3CF2A 1RJ9A 2Q9AA 5KSWB 2YJTD 4IEEA 4QM7A 1IN6A 2FFHA 3QBTA 4TL8A 3DM5A 1E2GA 1NG9A 2IYRA 1LTQA 4RD6A 2ZU0C 1XBTA 4XVQA 4TYNA 1VQLB 2VYFA 2BSAA 4R9UC 5DI3B 4I4LA 1PUJA 4B2IA 2IS1A 4KBFA 4ASUA 5IRCD 4MDEA 1VQOB 1AKYA 4DWJA 2Q3FA 2ZRJA 4LGMA 3SS8A 1QFJA 4X8MA 1AN0A 3LY5A 3K9GA 1Z5ZA 3D7MA 3CMAB 3T1OA 2O5VA 2XXAA 4R71A 2L0XA 4OQXA 3Q5DA 1N6KA 3BWDD 3PITA 3BFKA 2KI5A 4PO1A 3TE6A 3TSZA 2EFHB 4GRAA 1E64A 2CCJA 4C3ZA 2PX0A 4NCKA 1RE0A 2YHSA 1YJWB 2BC9A 3KUDA 3GEIA 3TMKA 4YDHB 3CRZA 3N5CA 2FNAA 2GCPA 1EWQA 1DAGA 2Q9BA 3LVQE 4KLZA 4UQOA 3THXA 1D2NA 1GTVA 1JA1A 1UFQA 4PQFA 3AM1A 2Y8EA 1VQPB 4JSTA 1X1SA 2HCBA 2QAJA 1FNBA 1S3SA 3ZBTA 2FEMA 1ESMA 2V7QA 1XPOA 1D2EA 3U6BA 1QHSA 1GAWA 1DEKA 1YJ9B 2VZLA 4JBXA 1XEXB 2W6JA 3QKSA 2ZSDA 1T3LA 4IXNA 2XZLA 1T0HB 4LSGA 2IHYA 2FMXA 1KSHA 2BIFA 2OLJA 2QSYA 1HURA 2FU5C 3EAQA 1SQ5A 4DSNA 2G77B 3EX7C 4B34A 1NVVR 1JPNA 1OSNA 5KDLA 3QJYA 1NDHA 4DCVA 2EYUA 2W2VA 2A7QA 2CHQA 5C18A 2NG1A 2AWNA 3CCJB 4EQ6B 2FA9A 3O8CA 3CNOA 2OLKA 4MGZR 3AUXA 3BBPA 3UWKA 3WRXC 2V55B 1E94E 4JIMA 4O2RA 3AVQA 5JS8A 1CU1A 8OHMA 1OE0A 2D06A 1R5BA 3CIOA 3J81k 3GFTA 1I4TD 1VQ8B 2YVUA 2GJSA 5JJKA 1UKVY 1WDTA 3QPWA 1KDOA 4AURA 4Y0AA 4WOPA 2JLVA 4G5QA 1XWIA 1OXUA 3QKUA 4PPFA 4JKYA 2B21A 3B2EA 4BFXA 2DYKA 1KK0A 3PIRA 1VTKA 3O8DA 4A6XA 4F38A 1FOEB 2BWJA 3IBYA 4H1UA 4OL0A 1YZLA 2VP2A 5FUWA 1OH8A 3IQXA 5EP1A 4KCGA 3PEUA 1QGZA 2QPOA 4KHZA 3CR7A 3K70B 2JJ8A 2JEOA 2WAXA 5SZJA 4TWZA 1D8TA 4N3NA 1VCIA 2GZAA 3LX8A 3REGA 4HEJA 2AHOA 2AD1A 4HZUB 4B47A 3AEZA 1G7RA 4A0RA 1O87A 3AQ4A 1KZGB 4PAMA 4JVSB 1E4YA 2GAOA 3FHOA 5JI3E 2QM8A 1T4GA 4P33A 3WNCA 1TPZA 2CVFA 3VKHA 1SXJA 3LW8A 4AYWA 2GZHA 4HUQB 2QAGA 5JWOA 3HDTA 5M04A 1JA0A 4DRZA 1BX1A 1ZCAA 2LKDA 2VA8A 5SZKB 2WSSA 2QI9C 1KHTA 3FYHA 1ZD1A 2XAUA 1QHHA 3LXRA 2IWHA 3K9LA 2ZR0A 1YE8A 3BE4A 4PZYA 2FE4A 5E7JA 4II7A 2WSMA 1YR7A 1OYYA 2V8OA 1KMHB 2QT0A 2JDID 2BCGY 1SXJE 2W00A 2O8DA 3ZLJA 2J0VA 3SBEA 3EPLA 5CLQA 4URZR 3EA5A 4G0NA 3L8YA 2ZM5A 4L8GA 2VNJA 1VQ6B 3R8CA 3WMGA 4B35A 4W7SA 1E0JA 3GLGB 2P65A 1E2KA 3QIAA 3B13B 4KFUA 3QVVA 2Z0MA 1QHNA 2BV3A 1P6XA 3MSXA 2ZYTX 1G4UR 3IHWA 1Q7YD 3KKPA 4Q00A 4CEIA 4GP6A 2B8TA 1Z6GA 2UKDA 2JLZA 3K53A 1J99A 1KI8A 4QJ3A 3CRVA 2Z6VA 1M7BA 2ZRNA 4DQKA 2ZE7A 1ZD9A 5SZHB 3OHMA 3IILA 4GOJA 4JLBA 3ZC3A 2PZEA 2FPMA 2BMDA 4XIGS 5C4GB 2D2FA 4GFDA 5FBVB 2C96A 1AQUA 5EJEA 4TT3A 2B7BA 2CVHA 1SXJB 5EUQB 2C78A 2KJQA 2O52A 2CE7A 2QA5A 421PA 2ECKA 2F7SA 3W6PA 4JL5A 1COWA 1JEEA 4AD8A 4PPQA 3B1ZA 4JBYA 1P60A 1WMSA 2WWGA 2FG5A 4DUGA 1DAFA 1E9SA 4NKRA 4KJZA 1E9AA 2WOJA 3T12A 4I1UA 1E1RD 3E5HA 1UF9A 1KSFX 3E20A 1R0WA 1QG4A 1RZ3A 2V9PA 2XNDD 3MLEA 3QXCA 3TR5A 5FPKA 1SVWA 5H68A 1GNPA 1G6OA 2IUUA 1E2EA 2DFKB 2VHQA 4FMCF 4LHVA 2PMDA 1Z2AA 1DPFA 1P2TA 2ZRCA 3OJXA 3CKLA 1JAIA 1YR8A 4UXIA 1IN5A 1HV8A 2ZVQX 2WWFA 1HE8B 4TLAA 1DAKA 1SVOA 2NMVA 3K9NA 1Z0IA 3NDBB 4JSYA 1IQPA 3K0CC 4DLVA 2HXSA 1Z2CA 3BAFA 3IUYA 3OIWA 5TB5A 4HAZA 1EESA 3SNHA 5AUPB 1KY2A 1YR9A 3B6EA 3GJ4A 3ZVMA 2BDTA 1PVOA 3MFYA 4JLDA 5B2ZA 2ZAOA 3GCGA 3W5HA 3ND9A 3TJZA 2CL6X 4CVNA 3ICQB 3RSOA 4BPRA 3KUCA 4XH9B 4F91B 3CH5A 3GJ7A 4WZAE 3FJOA 3P4XA
chains in the Genus database with same CATH superfamily
2QRUA 3I8XA 1C3OA 4JUDX 2JPDA 2XUAA 3ROQA 3UATA 3VNAA 4MW1A 2DWOA 1ZICA 2P4SA 1VHQA 1RXIA 3N75A 4I50B 1A5AB 4JCCA 5G2OA 3TAUA 1RYNA 1S9DA 1JJAA 4CM9D 5LLDA 2G9QA 4DR3B 4QBKA 5AW6A 2CXUA 4MR9B 1KYYA 4UU7A 1OCEA 2YMPA 1UOEA 2HEIA 4KOEC 1NUQA 2E48A 1VXOA 3ILVA 3PC2A 2RGBA 2UVQA 2Z8YA 4F7DA 3KE9A 5T3UA 5BR4A 1UC4B 1KEKA 5CTJA 4OI0A 5JTTA 2NT3A 3ASSA 4A0QA 2QAIA 3DAHA 4XQFA 3RYFB 4W82A 4ERNA 4RJTA 1BOFA 2XVXA 4KBGA 4HYEA 1IN8A 3FPGA 1JEDA 1C4XA 2B6HA 4CKCB 2O6LA 5JTUA 4B7ZA 1S8FA 4C0XA 4KO3S 2AN1A 3HXQA 2R1UA 2JGNA 4ZQIA 4EL5A 5ALSA 2HDWA 2RGYA 4AU1A 3NGLA 2O1SA 2HA7A 1E2HA 4I9FA 3PA6A 3SR0A 1THMA 1ZDMA 1ZI9A 1GA4A 3C1UA 3QPCA 3IKJA 1VG0B 1WCIB 4IIYA 4V39A 3TCNA 3OTOB 3UAOA 4RXMA 5I47A 3BRCA 3K5IA 4I6GA 1XNJA 5DH9A 3NEYA 1XPJA 4JVNA 2P2NA 2WE8A 2WFZA 3L8MA 4X7BA 1OLUA 4HQ6A 4CU2A 1AV6A 3SS9X 5ECGC 5KBYA 2AFIA 3W6UA 3X44A 3ZDFA 3G4SB 4B6PA 4JI2B 1RYBA 5C7OO 1YMQA 1E79D 1NJ1A 2GEUA 1NVTA 5TMBA 2LW7A 3AETB 3FBWA 4U2FA 2JN9A 3EIQA 3M7IA 2CMKA 3PEFA 2FJ0A 2D54A 1N6LA 2C58A 2G71A 3I04A 2WHPA 5E8JA 5HKLA 3TPZA 2XMPA 1FMTA 1E6UA 4KN8A 4UEWA 3LVFO 4V0QA 3K32A 5TQJA 5KTRA 4RY2A 1JVSA 4U9IS 2ZJ6A 3CURA 1GUZA 4F72A 5I3CA 2H1LA 5IDWA 5LUBA 5F4BA 3H3JA 1R0LA 4E2XA 2ZXUA 3NLLA 5CITA 3ABQB 4WLNA 1Q7EA 2X4LA 1T8RA 3OP1A 3EMKA 5AHOA 5E4YA 2JGLA 4FDAA 4EKIA 5AUNB 5KQRA 1RZRD 4XSHA 1FP6A 2IJGX 1J7KA 1THTA 1ZBDA 3DEHA 3OMLA 3Q6NA 4I5GA 3OKPA 4R2MA 2I6GA 1NXSA 1S2OA 4GO1A 5AW2A 4CKEA 4MUAA 3Q3EA 4WY2A 5DBHX 1NI5A 5AVSA 3SZOA 4EEZA 3ASYA 3IPXA 4I8XA 4ZDWA 4B6JA 1ISIA 1SU7A 3UG7A 3Q3AA 2NXEA 2ZVPX 1DDGA 3G2PA 1UP6A 1DBIA 3FPCA 1TCAA 3PC8A 4ITVA 5FOQA 3A25A 2BDEA 2G83A 5EOVA 4YAOA 2FFRA 4L8WB 2EDCA 3GUCA 2RC5A 2CKMA 4U9UA 1I2BA 2M9MA 2XTAA 3DLAA 1F4PA 1K89A 4KKSA 3AJEA 5AOAA 5HMLA 2VP4A 4BRWA 1S8OA 2AC2A 4CV1A 3LCUA 3GGGA 1KJWA 1Q0HA 4R68A 5P21A 3DJFA 5EE3A 2AKYA 2VJKA 4R2IA 4IH1A 1XLTA 3STUA 2RH8A 3FPKA 2W43A 3HCRA 3KKQA 2IY7A 2IYTA 5B7GA 2NZVG 4Y2PA 4RF4A 2TECE 4NEGA 5CK4A 2OXTA 2EZUA 3NTOA 3QXXA 721PA 5F2NA 2EWVA 1ABBA 1OZGA 3JQGB 3ZDEA 1ZR4A 2BEJA 1G5HA 2QTGA 3GLHB 1VCHA 1PEYA 3AR6A 2QEXB 2FJUA 4HNAB 5CB6A 4G0MA 4YP6A 8MHTA 4RJJA 3RU7A 2EV9A 3OEHA 1AKNA 1PZXA 1X19A 2R48A 2OVFA 2E4UA 2WU0A 5SYAA 3ZW8A 2RIRA 1JIXA 5GOTA 2V6BA 5KJ1A 2OV2A 1E61A 1LJUA 5HFAA 1A4XA 3SR4A 3TLJA 3FYUA 4FJ1A 4PIMA 5FI0B 2J5KA 5FP0A 4ER6A 8ABPA 3KVNA 1T8PA 2OBXA 1BROA 3C85A 4NU5A 3BXXA 2OHXA 2HPVA 1HL7A 4EGSA 1W0JA 1E0SA 3AF3A 3GVJA 1UJ2A 4GKAA 4L50A 4A8HA 5ALXA 1A8QA 4H6XA 2YMMA 5KSZA 4GI3A 5L6LB 2YXNA 2AZXA 1WZEA 3F96A 3BWBA 3D8SA 2DR0A 5EQJB 2GJ9A 2Y4OA 3EMDA 4FN5A 4M0EA 4RH1A 4JDPA 4UQPA 4QVGA 5DOVA 4AZTA 4BKRA 2ZDQA 4Z1OA 4NY1A 5C4IA 1X94A 4I55A 3FFWA 1PT7A 4X3CA 2L42A 5EZSA 1K86A 3DZJA 3CNLA 1V6CA 5JCJD 3PQEA 2CNWD 4XGQA 1L7EA 5LXTF 3FOZA 1FP4A 2JLRA 1QHHB 1XQ1A 4MP3A 4XI9A 4RF3A 5EWMA 5K8IA 2J0SA 1YBFA 3CCQB 2F62A 1F7VA 2DY1A 4UPEA 1JQKA 2J46A 3L41A 3DHVA 4NYMQ 3UC9A 2XYHA 3HU3A 1H4QA 1YJ5A 2EC5A 3R75A 1VKNA 1NX9A 4RHUA 4Z8YA 2CDNA 4TUYA 4IRMA 2PIDA 4Y2JA 3EIOA 1QUFA 1AU9A 1JPJA 5AW0A 3FMOB 1DFGA 2HPHA 1EQUA 2Q50A 4A16A 4QU0A 4DM4A 3DT9A 1ZLYA 3AUTA 3IE0A 5HEKA 1T2CA 4QBFA 2EP8A 4MPPA 2GNOA 4D4GA 2G4CA 1VJSA 1A5TA 2QJRA 4QX6A 5FV7A 3CXCB 1YTLA 3EDMA 4JHXA 1O6ZA 4H77A 4FOLA 3VR4A 1SVLA 1TJPB 3TVDA 1JH9A 2IP4A 4EJSA 3C8DA 4RKFA 1YQEA 5J59A 3JQRA 5EP2A 1Z5NA 1XRSB 2C2WA 2CL7X 1UBGA 5FIUA 1G1MA 1GSOA 2NXWA 5DZSA 4BNNA 5JWRA 1KEPA 1XALA 4K81B 1RQNA 3FNFA 3OKFA 1KFCB 4LUCA 1L8LA 4QWMA 4RHTA 2MR6A 3PHBE 4UM7A 5CT9A 3DPSA 2WNIA 3W7VA 3NFYA 3RIYA 4B46A 2R9VA 2I0FA 1W4CA 2RAUA 3VC3A 4YMVA 2EYQA 3F8SA 1MX9A 4W5JA 5F77A 2CRVA 1BE6A 3LZCA 2HPZA 2QMZA 5DXAA 5A3JA 3U4DA 1U99A 2IEBA 2PX4A 5JS8A 4GP9A 4B6OA 3H7AA 2HLPA 3FDJA 4YMWA 5B4UA 4O25A 4EKDA 1WUTA 2VSNA 3B6MA 4PAAA 3NDIA 1GSAA 3KPYA 3E9CA 3LWNA 3MCZA 3UW1A 4EMTA 1GA1A 1M2FA 5BW8A 4BJ3A 1XTZA 2FK8A 1TGVA 2OZLA 4BGEA 4HGZA 5I8WA 1X87A 1I7LA 3IP6A 3TLGA 4YAUA 1A69A 1E2IA 4LJLA 4NICA 2X4IA 4GVXA 3UFXB 4IVPA 2MT9A 2D5BA 4EK9A 2OO5A 3LDHA 2VKTA 3H0KA 1TQHA 4CIYA 1P8JA 3WI7A 5AI8A 3AV0B 3CW9A 1UKCA 4MYUA 5JUWA 1MQAA 2YIMA 1AHHA 2FMFA 4MVJM 4N6GA 4ZP1A 2HRDA 3VKWA 4B74A 5I7OA 5BQOA 2VVTA 1RWQA 5B1SA 5LJLA 1R6BX 1XK6A 1NBHA 2PZMA 2OG1A 3QEBZ 2JI7A 4BGDA 2GN6A 5A88A 4JKIA 1PE0A 4M9SA 4FS3A 2R86A 1TZMA 1E9VA 1MNAA 3CN9A 3RYHA 4DREA 1OR8A 3PWTA 1DXOA 4XTRA 4AJKA 3OP4A 1KC3A 3KQOA 1G9XA 1WZUA 3UK2A 3TJRA 3UKOA 4ALKA 1QQ5A 5CFMA 1M72A 5JI2E 2ARKA 4M2LA 3HY3A 2CK3D 1HTTA 3IV6A 3FFBA 1ESCA 2E4YA 3H2YA 3MIIA 4MS1A 3W9BA 4AG5A 4UD2A 5DCLA 1K92A 4DIEA 1WUHS 3PRHA 2YVKA 2A14A 3P2MA 4WDRA 1XXHB 3UMGA 3JALB 1NYRA 2NXNA 4JT4A 1S3IA 4A0SA 5HSGA 5JARA 2GN4A 2HJHA 2H1CA 4TXHA 3PVCA 4IUBS 3PQ8A 2OAP1 1TA9A 2WFLA 4K9PA 4YALA 4WESB 3U9LA 1L5RA 1K2VN 1YRYE 4IZHA 4WW0A 3R7SA 3DZFA 3EZLA 3P1JA 4Y7DA 2WU3A 4FW8A 4NDZA 3U4AA 3LLMA 1R0KA 3O83A 4UXHA 5L3SB 4RD2A 3OC0A 3AH8A 1N5LA 2NADA 4YTEA 1TA0A 4G5GA 3W2HA 2RB4A 3GA7A 1R0CA 1TYEB 4J1NA 4LE0A 2WUVA 3UJCA 3HKCB 3ZKWA 4D9GA 3OOCA 3THYA 2BI8A 3GRUA 4Y2QA 1UP7A 1ZMXA 3ENQA 3Q3GE 3DPIA 4WZTA 4HAVA 4HDAA 2HQBA 3S3TA 2M32A 4CMGA 1BQEA 4D92A 1Q81D 1T9DA 4XVCA 3JQ8A 3U44B 3KJEA 1RD4A 3VU9A 4HFJA 3QU9A 1JFLA 3VOSA 4Q1CA 3HMQA 2FSFA 2HDHA 2VPXA 3L7LA 4DEXA 1JQDA 1DAMA 1ZLXA 3PRJA 3O4VA 1D1PA 1NDUA 5EIOA 4PSKA 4JN6B 2H29A 3M83A 2VXCA 1IG0A 1HNXB 4AMYA 2ZYUX 4KVFA 4NFLA 1VKOA 2GN2A 1YBHA 3QPVA 3E5MA 2PYZA 3G1UA 1LXCA 4R31A 2GWRA 3O21A 9GPBA 1ST2A 1SULA 5DBIA 4AJLA 2VNIA 1EKXA 2W22A 4LY0A 5E9QA 1BS1A 3WLNA 2JAXA 4P93A 4N48A 1ISGA 1J23A 2HMWA 2OAGA 3T06B 2UZIR 5J4VA 1ZRMA 4II3A 3IRVA 3W7BA 1BE8A 2F90A 1ZINA 1G3IA 2CLCX 4FFVA 5HRAA 4RTSA 3GO4A 2CV1A 1YS4A 3MGGA 3UWOA 3FZQA 4YJ3F 2ZIWB 2P9YA 3UK0A 4P6VF 3RS7A 4KNYA 4FYIA 2QY6A 3LLVA 4PZLA 2C9CA 2JFBA 5HIMA 5CIYA 3A6EA 3CF4A 1K8ZB 4U2BA 5IJ9B 2BFBA 4DBLE 4UTNA 4FX2A 1SO8A 4Z4RA 2C4KA 4LPKA 4Q3DA 3HDHA 1M76A 3JV7A 1V7ZA 2G7MC 3NATA 4DIKA 1XMSA 2H7CA 2V7QD 2AJTA 3E1GA 3RS2A 4E03A 4RDKA 5KNBD 3TZBA 4F86A 1LNQA 3OCVA 3ONUA 2ZWAA 2A5DA 2DWPA 2EEZA 3G0DA 4CEIB 4QUZA 4HNRA 1I6WA 4PGFA 4R98A 2IU4A 2BPOA 4YRCA 4BMDA 1ZD8A 4KGXA 2PD4A 1R8SA 5B1EA 5LQUA 4CL2A 4TYMA 3NHZA 4PCUA 1GQRA 4G0UA 1VA4A 3OH8A 6LDHA 1CY6A 2FUG1 1N8TA 1OFTA 3G2IA 1MX1A 1RIFA 5JR3A 1G9TA 2WF7A 1W0KD 1PGPA 3KV1A 3RPEA 3T56B 1NRJB 1RHQA 2A5JA 1PS0A 2J5XA 2X8AA 2XCOA 3RODA 1FJGB 4PG5A 1SCKA 2IP2A 1NQXA 3TZHA 1EGQA 3W2EA 4RNCA 3G49A 3ETCA 1P0FA 2GB4A 2GZSA 3LK6A 4H7IA 4L6AA 5ALOA 5BQ5A 4DCGA 3L3BA 2OCGA 1FSPA 3DYIA 2EP7A 3TOZA 1VSVA 4WCDA 4MW4A 4AVYA 1LCIA 2RG1A 3KHSA 1CIVA 3IEIA 2ZJ5A 2C84A 3OEHD 3RG8A 2V03A 3T5PA 2QTBA 3C97A 1HE1C 1W6RA 5HTOA 1IWOA 4QGGA 4BGVA 1QPBA 5ADUS 1CRZA 3CMMA 5CD1A 1CY1A 1S0UA 2W8BA 4IXTA 5KINB 1NJ5A 1SD5A 4YJFB 1F48A 1CXZA 1LC0A 2ACEA 1E7MA 2HWUA 2C03A 4BO8A 1DBVO 1N2BA 4GE0A 1VIAA 2OV6A 5FNVB 1SRRA 2IDMA 5DMHA 4DJFC 3T7AA 2XAAA 3HNRA 3QHQA 3EEYA 4C30A 4I66A 2X77A 5AXAA 3VR2D 5DWVA 1KI9A 1MQ9A 2Y05A 5BN4A 1Z5WA 2UZ1B 4RD4A 1U1FA 1Q0LA 2FG6C 2G5CA 2RHLA 1ZA2A 5AK3A 4DGSA 1Z0AA 4EARA 1M6NA 2ZBQA 2G9UA 2Z2KA 5A5DA 1HYHA 1T8WA 3K94A 3ZE8A 3RBAA 1EDEA 3TBFA 1NPYA 4O3FA 3T5GA 4CPDA 3S68A 2V7XA 2YUIA 4JX9A 2BH2A 1CJCA 1JBEA 1YR6A 3MVEA 2ZXIA 2DQKA 2AJBA 2IYWA 2YDXA 1KEZA 3QYPA 4WFQA 2ZS9A 1F2UB 1YA4A 3RHSA 1IY9A 3QPUA 2QZ4A 3BL5A 4G0ZA 5IUJC 2ADMA 5EMLA 4TXJA 1T8SA 1WXDA 2D1QA 1RWOA 3I4CA 5G0SA 4PN7A 3FUTA 1D0SA 2B8NA 2FN8A 2XITA 1Q7GA 2ISQA 2QUZA 4GI5A 4J9VA 2RH9B 3OX3A 2Q7OE 4WKBA 3IBSA 2QXYA 2LR0A 4J9UE 1GKYA 4BJ1A 1JTEA 3BHMA 3HCWA 2IVZA 3AT1A 3PGLA 4DLYA 3IPRA 4LBWA 1EAMA 1MOPA 1QF6A 5E6UB 4JASB 4F4DA 2X9LA 2ZDHA 2QP4A 3G17A 4EG6A 1UODA 4MVXA 5AM2A 3ACDA 1EFAA 4D4HA 1L4MA 2PFGA 1Q7BA 4R83A 3B9RA 4Z1MD 4HN2A 4BQPA 4K88A 3NKFA 3A2LA 4LWPA 2K7FA 2B2NA 1L4FA 3QEKA 4E5YA 5AVRA 4WKCA 4O4LF 4MQBA 1WSBA 2V58A 2XUPA 2P2SA 3THRA 3TRHA 5AI5A 4DLXA 6Q21A 1CEYA 4K6HA 4BNUA 3OFNA 2AI2A 1U31A 1WQ1R 4KXVA 1CULC 4H1HA 4ZAYA 2PRIA 3BPSA 1NOKA 1JMYA 4UHKA 4E09A 5LMCA 5K0ZA 2ZYWX 3M3DA 4R8KA 1JR3D 4Q19A 3WGMA 2ZJYA 3CPWB 3SIPA 3JRXA 4YUWA 2OFXA 1PKEA 1REQB 1WD7A 4ZT2A 5CLJA 3B82A 2HU8A 2TSYB 4ZO6A 1P0IA 3LBHA 1GPUA 2NV4A 2CVQA 2JFQA 4MK4A 2ZR8A 3BFXA 1SU8A 1U90A 3RUDA 3OZDA 3LX5A 2OO7A 4LWOA 3D3WA 4YONB 5C9ZA 1SKBA 2FR8A 4BL5A 3CLUC 2GFHA 4CKBA 5CX1A 2HNAA 3H9QA 5FCDA 1G8YA 5IJ0A 5I7HA 4HD8A 1X1AA 2X0RA 1F8XA 4K9DA 4FBLA 4U3JA 4HXYA 1Z6XA 3A1WA 4ND8A 4N47A 3F7OA 3SJUA 4GS5A 4E3ZA 5ITZB 5JNUA 2PKQP 1JT9A 1CUXA 3RRZA 3TTUA 5MF6A 2BBSA 2D13A 4O2LA 4E94A 3D3KA 4R69A 1AS3A 4NZNA 3HVKA 4RY9A 5TY0A 3AI7A 1R0XA 2CN1A 4IDEA 4MWTA 4X24A 4GICA 4OBXA 1U98A 1KI6B 2IYFA 2H54A 4CR6A 1G0OA 3DR3A 2FVGA 3VVCA 1HT1E 1XEWX 3JQBC 5JRJA 5FBRB 1Y4ZA 2PSSA 1JYFA 2R6CA 2H52A 4FW9A 3EGEA 4F4UA 5AVWA 3THOA 2GPJA 1MOZA 3M81A 1J2UA 1YDWA 2BZ1A 3BXOA 1LVGA 3IPYA 3QUAA 4JJ8A 1IM2A 1UBCA 1OTHA 4U6SA 3LF2A 5FI5A 3B2QA 3CTMA 3RUHA 3S2IA 3M89A 1G1AA 2YOGA 3HU2A 4X94A 5AUQA 3H18A 3T9DA 4BO6A 1A8IA 1ZL2A 4L8LA 5ARCA 3GDHA 1HE4A 3HFRA 3OG9A 4C0AC 4F2WA 4XB1A 4IXMA 1B0ZA 3ZJ4A 1U63A 3WB0A 3ZW7A 4D6XA 4XEUA 1ZOPA 4IIEA 2YCLA 4MI3A 4REQA 4RENA 3BTOA 5JPDA 2OV8A 3W1VA 1JHMA 2WA1A 3OT5A 4M8SA 4P80A 1XSEA 5TX7A 3ETNA 1XVIA 3C15C 5C0OE 4UNQA 4N7BA 1GYQA 4UUAA 5I7VA 4C7OA 3QV2A 1RRFA 4KP7A 2YY6A 3BHNA 3EGCA 4L07A 4X60A 1YK1A 1GGVA 4E5NA 4Z4ZA 4X0EA 2C3MA 1JTVA 1C7RA 3N8IA 4RDIA 3AHCA 3HTXA 3LDUA 3PI6A 4LHEA 1P9WA 2QA4B 2VBSA 1ZEMA 2IUEA 2JIZD 1T4DA 1YBMA 4GOOD 3SKVA 4BX9A 1DADA 3H16A 1DTEA 4MDHA 3K0HA 1NQAO 2W90A 4IG9A 1P1HA 3U40A 1XHEA 3A3NA 5FTMA 3A0RB 4HV4A 5K20A 3C6MA 2I4MA 2HC9A 4LBYA 1S6YA 1ISSA 3EZNA 4GPZA 1IPFA 2PWZA 3L0OA 3GJSA 2Q9CA 3FFTA 1XEAA 3GLSA 4XUCA 2O20A 4LDNA 2F8MA 4P7FA 1IJBA 1ZM9A 5C37A 2Q6OA 3NOXA 3CINA 2X4DA 4IVRA 4D3FA 2QL7A 3VU1A 1Q7TA 4KODA 4Q7MB 3TZLA 3HMKA 5KC8A 1H2HA 2QUKA 1ZJ6A 3GLRA 1YS6A 1TK3A 4FKMA 4DDTA 5KU7A 2PUGA 1JWAB 4ZHQB 3DCJA 1XVLA 3C1TA 3EEBA 4H2DA 1Z6QA 5DHPA 2G25A 3ZE6A 4ZV4A 4OXIA 4PZ9A 3LYUA 1V8ZA 5CT5A 4OBEA 1QIHA 1NURA 1G3MA 1UBLS 1A8PA 1AUQA 2FPWA 3V4RA 5CNKA 2VBVA 3UWDA 3JATB 1IWPB 1KKUA 1UL1X 2A1UB 1Z88A 1JEAA 1V39A 4C3VA 3BHJA 4LDJA 5D84A 4KWIA 1Y5IA 2GVNA 3VR5H 3M6IA 3D0QA 5TF4A 5BNWA 1XU7A 2HL6A 2Z6UA 1DGQA 3ZQ4A 2YS7A 4YWHA 4GVPA 3CEPB 2Z4RA 4MUGA 2HMUA 1Q1QA 5AW8A 1WB9A 2PLNA 3AL3A 3FMVA 3GL9A 3AF1A 2C9DA 3W6ZA 4I3FA 1MO4A 5I7EA 5AI9A 2ADFA 3CBQA 2BUCA 3LG2A 4MYTA 4QGBA 1YIAA 3ETEA 1FFSA 2PNFA 3DQQA 4IIJA 3RU3A 1ATIA 4FMPA 3ZBQA 4OLBA 3KCNA 4A8JC 2V4MA 2XWBF 3ZZNA 3IV7A 4G1MB 1T25A 4JZKA 4DSUA 1H2AS 5HXAA 4Z9XA 4N76A 4PYKA 1NTRA 1SU4A 2PBZA 3BYZA 4X1IB 4DMHA 3JQAA 5A6SA 4KO2S 2C4WA 3R7FA 3C6XA 3WK6A 1T4CB 1SQFA 3K05A 5ANRB 4BNDA 3HCEA 2P35A 3OECA 1PVVA 2BGMA 2NZJA 3JTMA 4LGCA 3VI3B 1YZGA 2OXIA 2BHLA 2C97A 2G7ZA 1IM5A 1DG9A 2XE8A 3FRHA 3WA7A 4RDJA 3BKXA 1TRKA 2VWGA 2A4MA 2BM8A 3CJQA 3T7IA 3HDVA 1QF7A 3T9AA 1E2QA 2HR1A 3GFRA 1T2DA 1UT8A 3VXKA 1RBZA 3OD5A 1JHPA 4H08A 1I3NA 1BKYA 4UUNA 2D9RA 5L6MB 2V7WA 1YI8A 3D0RA 5TMEA 5EJ7A 1U3CA 4IX9A 1LBEA 4BO9A 2P6RA 3I58A 5ALYA 4KPYA 2WHEA 1KAOA 3FGZA 3HJUA 1YRQA 2N1MA 4OAPA 1IEWA 1DRKA 2WM8A 1YFJA 1R0SA 2HFJA 4FHZA 3Q1LA 3AIKA 4K5QA 2A78A 5CEFA 2ZRBA 3MWKA 4L15A 1ULBA 1Y3DE 4XOPA 1SY7A 1IZ7A 4E7OA 2WDZA 4RJIA 4N1AA 5CGZA 4DRYA 5IXJA 2RHHA 4AMGA 3IR5A 1QMPA 2DGDA 3CYFA 3DZKA 4OD0A 5CM2Z 4E46A 2JKYA 5DOZA 2C2YA 3QWAA 4L95C 4AKTA 1GGHA 4YEDA 3GFGA 1KPHA 3DHWC 2FZ5A 2IEZA 4OHZA 1JJVA 4YUYA 1FFYA 3L8EA 4YT4A 5TSDA 1N2CA 4PX9A 2CW5A 5K0NA 4D43A 1DC6A 1CQPA 1UMKA 4OQNA 1D6JA 1ZC3A 5H3LA 3ELDA 3A3KA 2WRZA 1HNZB 3C41J 4GW3A 1VGRA 2JLQA 4BAUA 3WYGA 2G0NA 3KO8A 3G79A 2ZYRA 3E35A 4YEJA 3K9WA 2A9OA 3NJRA 4NMMA 1IIRA 4NJMB 4BZWA 4J0QA 4KREA 3ZZ0A 3W2FA 2W6NA 3E61A 3M2TA 3DW3X 3PQ3A 3VH2A 3KSRA 2WM2A 2IVFA 4S1NA 4Q7QA 2IS4A 5A7GA 3STYA 3RLFA 2XE7A 3HL0A 2Q6TA 3TW0A 3MS2A 1EHIA 4CDRA 1GEGA 2QNRA 4WJKB 2E87A 3ON5A 4NZOA 3ZV7A 3QNWA 1WP4A 2BKAA 2Z2YA 5AJUA 2G1AA 2PKWA 5ALTA 1WPGA 3EVNA 4BO7A 2P5TB 1VPLA 4OCZA 1NBOA 2ECFA 2GOYA 2IZ5A 3N05A 4OYYA 3AW8A 3IDOA 2IPMA 3P2IA 4MVJP 1YVRA 1IPEA 1CX9B 4WESA 5LLSA 3SS7X 1WOMA 1KOLA 3H75A 3T0FA 1Y4DE 5AHWA 2XDYA 2CKDA 4GIBA 2UYCA 4QGFA 1Q0TA 2D6FA 1KVSA 1LWNA 1Z37A 2IE0A 2KBFA 2VK2A 3AIOA 1Y9DA 1L5YA 1YQDA 1Z28A 4N0QA 4EB8A 4X1OA 3ESBA 1IK6A 3PQFA 3PRKE 1T9KA 4GQIA 4MUFA 4C0JA 3MMPA 4YAWA 1FIUA 3F5SA 2FUNB 1M67A 3R5HA 2PLRA 2VPYA 4LHSA 1X7DA 4QDTA 4MUBA 1P0PA 4URWR 4PBRA 1ZZGA 4PGGA 3AYZB 3DO8A 3L6CA 3ZCUA 4E08A 5C1DA 1ATZA 2I3ZA 3DZGA 3QHAA 2F8LA 5M29A 1QP7A 4CGZA 1AC5A 1QU3A 2E85A 1F2UA 2YWFA 1Q92A 1XJCA 3NUGA 3GLIA 3ZGNA 1X7HA 1JEYA 1DAPA 2B69A 3QU7A 1N1DA 2CSXA 3EFEA 4X6YA 3PCXA 4B31A 4XQGA 4CHGA 4E5SA 4IH4A 3R24A 2BMEA 2J32A 5DTMA 2ST1A 3ABZA 3IAAA 4W1PA 4ZD6A 4CHTA 3H17A 2D62A 4I4TB 1CIJA 3VBEA 1HRDA 1NMYA 4OOXA 1U5CA 1GGMA 4EPYA 1A9XA 1GGNA 4RTJA 2I29A 1V1MA 3I3SR 2PEYA 3NO4A 5JVDF 3KEOA 4O2AF 1FRNA 3S28A 2CMGA 2JBAB 5CFQA 1VJRA 1QIKA 1Z13A 1LB1B 4UUMA 3ELUA 2J6HA 1NXWA 4Q9HA 4GMDA 1D4ZA 1GPH1 4MQUA 4PG6A 4KR3A 1GKIA 3W05A 1N8RD 3PFHA 1OTXA 2JBWA 2CLEB 5EE9A 5H70A 2QROA 2QKYA 3WGQA 1C7FA 2ZB3A 2CC2A 1UD8A 4XPIA 4Q7JB 1S3FA 4WXRA 5IBQA 1I0LA 1ZHFA 3BVPA 1W5SA 4G2TA 4P83A 5EZ6B 5CHYA 4TRNA 2BGNA 4LEIA 4U7PB 1BVHA 3I92A 4ZZ2A 4CMBA 4TV8B 2R7KA 2IXFA 2P27A 3UAXA 4ZU3A 4FFWA 1E4EA 1EMDA 4D6YA 3OETA 5TMDA 1C30A 2FZ4A 3V48A 1L2TA 3EZYA 7MDHA 2VF5X 4DJDC 3HUDA 3LJKA 3X2FA 4EI9A 3PV0A 4CL3A 2WPDA 5KMGB 2NO5A 2NT4A 3MQ4A 3OSZA 2J4CA 2XIQA 3K6KA 3EGDA 3R5TA 3E9MA 2Y1LA 3KOMA 5DEIA 5BY2A 4RHFA 3GJTA 4DV5B 3N2ZB 2XWQA 1Z2EA 2O23A 5IDXA 4WN9B 2PS0A 2OCKA 2L19A 2O1XA 3F74A 3F3SA 2OCPA 3PA2A 4PTZA 3UMMA 4RULA 2OHHA 3BRQA 1O7JA 1L8AA 4LOHA 1TO2E 1G20B 4QOHA 4ZYVA 2QW0X 2XXAB 1L1RA 3BHIA 3IVAA 4UHHA 3ADDA 1JA9A 1L3BA 2B4RO 5EQTA 3TQOA 1PBNA 5FWYA 2XOKA 4LKRA 3ZE7A 3PXUA 1PWZA 2Q9UA 2C8VA 5DHUA 3LUJA 3N76A 1YS2X 4PCVA 2P78A 1ADFA 1PDVA 2E2WA 5LKAA 4IFTA 4CQLB 1C7EA 3WFIA 1W8IA 3I52A 2XUHA 4BIMA 3FVQA 3ZIUA 3HI6A 3L46A 3SC4A 1ZVVA 3DTYA 4BTLA 3MUOA 5F7ZA 4IMIB 3ADKA 2FUEA 1OYOA 1OF1A 5INTA 4DGQA 3GP8A 5F1PA 5F5LA 4PIVA 2DU8A 1N6PA 2H7XA 4Y1RB 5KTKA 3JWEA 1JQLB 5G0TA 3BCSA 3NRBA 4MRRA 2VNSA 3PDWA 5FRDA 2PXCA 4G09A 4B3BA 5D8DA 3O8OB 4K9SA 4FGLA 4P25A 2ILVA 2VUIB 1CF9A 5FBLB 3LQYA 2X13A 4LC9A 1DUIA 1D9ZA 1OHHD 4L4RA 1PZHA 4KR0A 4A0FA 5J2TA 5AVXA 1QYXA 2OZEA 2FPOA 4LV8B 3QMWA 3F98A 4DCJA 5CB8A 1U7HA 2OTJB 3C3XA 5FOWA 1FMJA 3R2JA 1SBTA 4BLQA 2IH2A 2BISA 1CJKC 3CBGA 1ZH8A 3SVZA 3P2KA 2FQXA 3B7GA 2Q1YA 4ZK6A 2J33A 1NQWA 3B9BA 1U8UA 4MPJA 4BO2A 1GZSA 4IHJF 5DX1A 1Y1SA 4I6JA 3RE1A 4YV0A 2NZYA 2XV1A 3FHCB 1OXMA 4PXAA 4RLQA 2NZWA 5EXEA 1Y3IA 4KR7A 3HY6A 1W9HA 3U5TA 3SQWA 2YWGA 3ASZA 4X95A 2JFNA 4TM8A 3QVLA 2XCUA 1EFVB 3I9FA 1E1YA 3OQ6A 4ODIA 5J1SB 1IG3A 2C9BA 4QYSA 4BNWA 1M66A 1QRUA 3WHIA 1IWBB 1OBVA 1URPA 4MH0R 4TKVB 5IFLA 4JI3B 2OFWA 2JI4A 3U0BA 2HZ7A 4Z7QB 1Q2UA 1A2BA 3H4MA 3OCWA 2A0XA 4GZMA 4YECA 4BNHA 4RZQA 4AKIA 1ZJYA 3ZU3A 2WV9A 4D4LA 5B30A 3L04A 3I62A 1VL6A 3WYDA 5DDIP 4Q12A 4ZU6X 5EHGA 4BZZA 5G0WA 4LK3A 1YMUA 1BXRA 2BGRA 4WMLA 4KRYA 4WINA 3VOAA 3NHAA 1C9EA 4YAIA 5BUZA 1YGYA 3HL4A 2WZPP 4QICA 4DDMA 2QRVA 1UDBA 1YC5A 4ZVKA 3JQAB 4RVSA 5A6SB 4ES6A 2WJAA 3DKIA 1XPRA 2ZKIA 5E6RA 4NQRA 5EQDA 2A9VA 3ZIDA 4M1KA 1Z9BA 2AR0A 3WL4A 521PA 2Q2OA 1NZFA 1UFOA 3PTLA 3CZPA 2WTUA 5GV8A 1CFJA 1Z4IA 1NLMA 3U3OA 1QZUA 2UXDB 2O4CA 5BXQC 2MYPA 2VP9A 4AG3A 3JZFA 1ZVQA 4EY7A 1W6UA 4YJHA 5EWJB 3HBNA 1Z8NA 5I48A 1PT9A 1H93A 1Y1QA 3UOGA 4YT8A 4GC5A 3N0RA 2JJQA 1XZIA 1GCUA 3HR7A 4EMBA 1TZ2A 3I1YA 5EKSA 3MWFA 3RASA 4GD3Q 3WIVA 4B2YA 5EKUA 1SBIA 5J4HA 3AR4A 4XLFA 3ZWAA 3KXIA 5TC4A 1JQ3A 3LC0A 1QO7A 2DHRA 3NM6B 3ZI0A 3GQBA 2F43A 2EBHX 1D4FA 3BGOS 4ZIRB 5FOVA 2K2QB 4QFCA 1MORA 3NBXX 4GOMD 2GXAA 5F9HA 3MCAA 1XG5A 2G8NA 4ZXPA 2P77A 3SZGA 4XQCA 1UBJS 3VV3A 2WZBA 3U9TA 4BMOB 4QG3A 4MRNA 5GVSA 1ZG3A 3OTWA 2JLSA 4RCVA 4RM3A 2Q41A 1F3OA 1D1NA 1Z8HA 4J7XA 3RARA 1EA7A 2XEDA 5D86A 5DX8A 1FUEA 5SZIA 1MHPA 2R6AA 2R68A 1XVUA 2AI1A 2NNWB 2VXYA 3LVRE 5A0VA 1SCUA 3IOBA 3MHTA 2A9FA 2H4WA 3CUSA 3DMFA 2JFZA 4PHCA 4QPZA 5F3DA 2EBUA 2YZ7A 5EUBA 1IMOA 5CCEA 5HKOA 1EXDA 1KXZA 1EBBA 3GX1A 1C8KA 5D3KA 1H2WA 2NTEA 2IY8A 4PLZA 4QD3A 4WCVA 4ZOLA 1XTKA 3ZHTA 3ENWA 9LDTA 1M0WA 2DOKA 4B6EA 3LUKA 2BONA 3HGQA 4UBLA 3FSGA 2YWRA 5ES4B 2GNPA 3FPHA 1U8ZA