3SJZA

The structure of aif2gamma subunit delta 41-45 from archaeon sulfolobus solfataricus complexed with gdp and gdpnp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
409
structure length
409
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEETIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title HOLD FOR PUBLICATION
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Translation
total genus 95
structure length 409
sequence length 409
ec nomenclature
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3sjzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjzA01
1W35A 1IXRC 5THXA 3PFIA 1BOFA 4NYMQ 2O5VA 2O8FB 5DI3A 1XZPA 3LXXA 2IUUA 3THOA 2PEYA 2C9CA 2NO7A 4E5UA 3R8FA 2QTLA 1FQJA 3VR4A 3WYGA 1GAQA 1NVXQ 1YR7A 1T8TA 1UBFA 3MJHA 3TMKA 1HE8B 3CR8A 2J9RA 4WVFA 5AJWA 1YR9A 1AIPA 3LRPA 4K8OA 4M0LA 3TGPA 2CNWD 2YV5A 1G1MA 4B3DA 4PGOA 1KTVA 2W6IA 3QBTA 5CYOA 1BQEA 4FIDA 1OW3B 5J5CA 1U8ZA 1LS1A 1ZW6A 4FINA 5KSPA 1CR4A 1TAGA 4XSGA 4A6PA 2CK3D 5A5GA 2AXNA 4ZIRB 1ZINA 3LVRE 4RCZA 4OQMA 2VPPA 1CXZA 1SULA 3E1SA 3AV0B 2PMDA 1U0JA 4I81A 1Z0KA 3PR1A 4JKYA 4WW0A 4RD1A 1OFHA 4G5QA 1FNNA 4ZKEA 2ORVA 4BZXA 2G1KA 3TSZA 1JAHA 3BFKA 4OK5A 2ZXUA 2V7QD 3CW2A 2Q21A 1JJVA 1ZM7A 3EC2A 3KKMA 4G5RA 1KZ7B 3VX3A 4QNRA 1AM4D 3X1DA 4TLAA 3QEJA 4JLBA 3E70C 4ITRC 1W34A 4AI6A 1SXJB 2IT1A 1GNQA 2ZRHA 1N5IA 4C30A 2CJWA 1AJEA 3ZS9A 1D9XA 3ONWA 1J8YF 1JR6A 3FPKA 1HQYE 1JQJC 1OGJA 4IEIA 4F7WA 4L15A 1YZQA 2ZS7A 1OXSC 3SS8A 1JJ7A 4CW7A 4DCVA 1JB9A 4FWIB 4G5GA 1UEJA 2FJUA 2XJ4A 4EPVA 4HZIA 2G0TA 1A7JA 2CEAA 2IA5A 4JVLA 4YDHB 4AG6A 4B3FX 1UPTA 1JAIA 3BE4A 4CEIB 1GRRA 2ZUDA 5H1YA 4LJ6A 3K09C 2D2FA 2QL6A 4F38A 1II9A 2GF9A 3KZ1E 3IBGA 4B2IA 4LHVA 4Z54A 4KFUA 4EQ6A 2C04A 2ZRJA 5L3VA 5DHFA 5KSZA 4TWZA 3CWQA 1VPLA 1ZVQA 2VP4A 4XSHA 4B6EA 4EAQA 1ZJ6A 3M0EA 2J1LA 2VP5A 4KJZA 1XEXB 1COWD 4PZZA 2C99A 4CIDA 4DLSA 4Y0AA 2ECKA 1J7KA 4N0DA 1YR6A 3KXLA 3B1ZA 4DVGA 1GR1A 2FEOA 3U7GA 2O52A 1II8A 4ZDKA 1P2SA 1R5BA 3HPRA 2YWFA 4GZLA 4AKHA 4HB0A 1FP7A 2OBLA 4CVNA 2WPDA 2IXEA 3DOEA 1M1KD 2VHJA 4NKRA 4IRUB 5C2JB 3K0CC 2VSFA 4ZCLA 5JJLA 1OGIA 1S4QA 2ZRAA 3B9QA 2CLSA 1FTNA 1KMHA 3QVVA 3WXMA 2DERA 4I1OA 1XU4A 3FGNA 2RMKA 4KVAA 4P4UA 2ZPTX 1JB1A 1OV4A 2ZI9A 4D80A 4CRWB 4LC1A 3SBDA 3H2YA 2ZIAA 1QDEA 1Q82D 1QFYA 1V5WA 1UKVY 2PJRA 5H8WA 2VL7A 3U3RA 1KDPA 4DC9A 3BH7A 4XWKA 1W87A 2GJKA 2R9VA 4M53A 2EFHB 3CNOA 4FMDF 3O8BA 2IS2A 2W00A 2CBZA 1FNDA 4A82A 3ND8A 1GDDA 3ZBTA 2F1RA 2QSYA 4L9SA 2FA9A 4DKXA 2H57A 3EWSA 3LAWA 3I3SR 1RC8A 5DE3A 1RIFA 4K46A 2KBFA 4R9UC 4JLDA 4XH9B 4DRZA 1E6CA 1E9FA 1FTSA 1E2NA 2YZ2A 1TF7A 1IY1A 4B34A 3O8CA 2ZRCA 3ADBA 1G3IA 1F2TA 3GJ3A 1GKUB 3LO5A 5K8TA 1NMXA 1PLKA 1YRBA 3GFPA 1YKSA 2J7PD 3F8TA 2IK8A 4JKIA 4KBFA 4E03A 1IJEA 3QSYA 1FX0B 1FMJA 3RS7A 1VYTA 4FW9A 3QG1A 3NIBA 2GK6A 5CM9C 5JRJA 4JYCA 3VO2A 4O3MA 1S3SA 1Z0JA 1OKKD 4M9ZA 2V3CC 1SVWA 1IY0A 2HJGA 3X1ZA 1RVDA 3ZVRA 1U81A 3OJXA 3GJ4A 1E79D 1QGAA 1E9DA 1ETUA 4NCJA 3VKWA 4DDTA 2PEZA 4CEJB 2C77A 1SKYB 4C0KA 1W49A 1QUEA 2OK8A 2D74A 3HP1A 2CXXA 4JVMA 4Q21A 1NIJA 1DG3A 5EXPA 2ZS9A 1AA9A 1OIWA 2VIIA 1IBRA 3GCGA 3A1WA 2QMUA 2PLFA 2QUZA 1MRSA 4HAYA 2DCUA 5GADl 1P9WA 5TV2A 1KQSB 3NKVA 1EWYA 3A4MA 1K5DA 1OXXK 1S1MA 4RD6A 1JXMA 1DAIA 5ANRB 4HLUC 2ATVA 2BKUA 2VZLA 3WNDA 3MFYA 5FL7A 3NEYA 3ZH9B 2GA8A 4BE7B 4XWOA 1Z22A 3I5XA 4ZCMA 1KKLA 4AWXA 5F3WB 4GL2A 1A5TA 2P65A 2PJZA 3KB1A 4DSUA 1QZXA 1SXJE 2ZI4A 3VKHA 5KSYA 1KSJA 1SVIA 2W58A 3AM1A 2IS4A 4UXHA 2WAXA 3REFA 3SJCA 3CZQA 1U8YA 4NCHA 2G9NA 3VHLB 4BFYA 4K81B 1GWNA 1YU9A 2O0JA 4CGZA 2IYRA 4IKEA 1UBEA 5FOUA 4JIMA 4TN1A 1BMFA 4PR0A 4ZKDA 3Q85A 1N25A 4XTRA 3IILA 2YYZA 2BOVA 5J4YA 2CL7X 3CCLB 2ONKA 5CIQA 4OYHA 2JAQA 3MHPA 2C96A 4LOAA 2WWFA 4KLZA 4JL6A 4QGFA 2PZEA 2JDIA 4FXPA 3DMNA 1SXJA 3EZ7A 4C0BA 2FWRA 1A2BA 4OHZA 4LRWA 3EIQA 2WSMA 4DIDA 1QVAA 1XBTA 2ZR9A 2RGNC 2XSZD 4Q48A 2IYQA 4QJ5A 1KMQA 1VG1A 3QFTA 3CNLA 4WZBE 5L3SB 4P3YA 2XB4A 2ZREA 1JECA 4OI0A 1G8FA 2VP0A 3U61B 3QE2A 3CH4B 3L0OA 2QDXA 5KNBA 3B78A 4LJ4A 2OXRA 4HB2A 1OXTA 2XEXA 1OLOA 3CPWB 2BJVA 3JQPA 4BFVA 3IKJA 1OH6A 1JEDA 1XEFA 1SVOA 4BLQA 2PX0A 2RHMA 1I2DA 1ODFA 4TSFA 1OIVA 4EFMA 2CRVA 1E2GA 4TTRA 5D3QA 2ZE6A 3FMFA 2OESA 4WIAA 1XCMA 2FE4A 5AJXA 2B7BA 1XTIA 2QMHA 5DI9A 1H42A 4PTLA 3FMIA 3FVQA 1XEWY 1K5GA 3AVOA 1CRQA 1H8HA 3QUSA 3EW9A 4DSNA 1QHNA 3IBYA 4QRHA 5DISB 2ZR7A 3RDPA 2O8DA 3CRQA 2QM8A 1XRJA 4XJXA 5JWOA 2AHOA 1W7AA 4B44A 1US8B 4PAQA 2XNJA 3WP0A 4TQAA 5KO2A 4Q4LA 3IPXA 3KKQA 4KAXA 1W36C 4EPRA 2VP2A 4ASUD 3D3QA 1EGAA 3BB4A 5JHHB 3CRRA 2ZRLA 4Q7LA 3K9HA 3PUYA 1T3LA 1MO3A 2ZI6A 4KLNA 3FJOA 2VTKA 3CRW1 1CJUC 1P9RA 3BK7A 1OH5A 1EG7A 3SJZA 1D5CA 3B9PA 2VNHA 1BJKA 4PQYA 4HATA 4KU4A 4QL3A 3GLIB 1YJ9B 1N6KA 1T0JB 1XPUA 1PVOA 3GJ8A 1E4YA 3D7MA 1XD8A 5E7JA 2ZSDA 1YQTA 1CNEA 5BYJA 1G7RA 1YE8A 3VR3A 1U90A 3D31A 3OF5A 4UXIA 2AFIE 1U99A 1I4TD 3QKSB 1QG2A 3T1QA 3CM0A 1WBDA 4Q00A 5G40A 3ZQJA 1AN0A 2DFLA 4JL5A 1GG2A 4QFMA 2QY9A 4TYWA 2ZSEA 4D4LA 3L8YA 2F7SA 4F93B 5JSZB 4FCWA 2V6JA 1RRCA 1OHHD 4O2LA 2G0NA 2FG5A 2RKOA 4U9UA 2OFXA 2W6ID 4OBEA 1SKYE 2BBOA 2NPIA 2ZYWX 4YLGA 3TQCA 4AY2A 4XVQA 3REGA 4CDGA 2IS1A 2JASA 1DS6A 1JXOA 2EW1A 4BFWA 1E2FA 2GHIA 2OV2A 2QA5A 1XB2A 2WWXA 1OH8A 2ZQ5A 3K09A 1N3BA 2GWHA 2PBRA 1FX0A 1UEIA 2G77B 4Q02A 2JLRA 2ZRPA 4QHTA 1SHKA 1ZNZA 1KDRA 1YI2B 1G7CA 2GF0A 2R44A 1G20E 4DCSA 4DEYA 1NVVR 1KJZA 1F2UA 1NSFA 4DZZA 1AZTA 2OCPA 3AVXA 2GXQA 5EZ5A 3PEWA 5IDVA 1U0LA 3MWYW 2ZETA 1GZSA 2OHFA 3AF3A 1TADA 2RAPA 2YC4C 2V4ZA 1NJGA 2OTJB 2OLJA 1Z83A 4WZ6A 1CR2A 1C9KA 2ODBA 5EXSA 3DO6A 1EK0A 1UDWA 3GJ5A 4FCTA 4BEJA 5HR5A 4BFXA 2EU8A 2ZYUX 2OK7A 2E87A 3BD9A 2HXSA 2XZPA 2HF9A 2HEIA 1W36B 1RPZA 2XOKD 1E99A 1W2GA 1XJ0A 4BFSA 3O47A 3BRWD 2CDNA 4HAUA 1HH4A 3KX2A 5DO9A 1A1VA 1ZCAA 4GSYA 1P2TA 5DYGA 3X2SA 3VHXA 2YWEA 3ZZ0A 5FR2A 4OKSA 4OQFA 1Q3TA 4MKIA 1ONBA 2GZAA 3MUFA 2GETA 4DB2A 2P5SA 3DEFA 1BX1A 3JZMA 1HT2E 2GKSA 3KJGA 4GOKA 1TVCA 4LGMA 3RWMB 4A0RA 1Z6YA 3M6AA 3NWJA 1IN5A 4URYR 4YHBA 2OAQ1 2ZI7A 4UNRA 3BB3A 3L0IB 1IN6A 4K1XA 3DPUA 3QFRA 1TU4A 3VO1A 1KJYA 2PT7A 4P4TA 1G18A 4CZ2A 1EWQA 1MO4A 2W83A 2QENA 3MJRA 4ZDJA 1EX6A 4BASA 1JI0A 3SE0A 3KQKA 2D2EA 2OBMA 4D82A 4W9MC 1TTTA 3DMDA 1VYUA 2O8BB 5EE0A 1W4CA 4TLBA 4OL0A 2DWPA 2OLKA 4RFSA 5GVRA 621PA 2F1IA 2MMGA 1AS0A 4HSEA 1GSIA 2WPDD 1TQ2A 2JIZA 3RRYA 1KAGA 4NDZA 2WBLC 5KDOA 1KIMA 2NZ8A 4U5XA 2J5XA 1G4AE 3RYTC 4IFBA 5FTLA 5TXGA 1G19A 4HDOB 3AGPA 4URUR 1W4AA 2GXSA 2V54A 5CB8A 5L3SA 3HU2A 3A1SA 4ERNA 3AVYA 1DDIA 3SJAA 1ZNXA 2HYDA 3DKPA 3V00A 2GESA 2Z83A 4BGDA 5F9FA 1ANKA 1VQ9B 3A4NA 4DUGA 3P32A 3PUXA 3W34A 2AWNA 2OAP1 4DDWA 1G41A 1ZNYA 3AGQA 1FNBA 1TEVA 2VF8A 2VH5R 2QA4B 1SHZA 3W5IA 4HZUA 3FPAA 3AQ4A 4MRSA 4X8OA 2GBLA 1OF1A 4JBWA 4NYIR 2NO1A 3PEYA 4ZI2A 1FZQA 5H70A 3AVVA 4EPYA 3LW7A 2QP9X 3RAPR 4HLUA 5CITA 3GEIA 4WQMA 1TUIA 1N6PA 4JYBA 2DYKA 3UKDA 3UWOA 4AD8A 2VQSA 3D8BA 1E63A 3GLIE 3A1UA 1MV5A 4QC2A 4YAOA 1PV4A 5B58C 1LY1A 3KXIA 2XB2A 3G82C 2WJJA 2GEUA 3TSWA 4AG5A 4U00A 1R5NA 3FHTA 3OIVA 1BIFA 4M1OA 1M34E 2O8EA 4O0MA 4Q47A 5E3HA 2CJWB 3QEOA 3RC3A 1HTWA 4L5BA 5J4KA 4QJ3A 1KK3A 1E2KA 4PFSA 3CCVB 2RH5A 4D2IA 4KFSA 3K70D 2BIFA 1CJMA 3SEAA 1B0UA 5CK5A 1YZLA 4POAA 2F9MA 2Q3FA 3M4YA 4LPSA 4DB4A 2JA1A 5B2ZA 2HLDA 5BW8A 4TMZA 1XMSA 3GLIA 1LV7A 1EX7A 2QZ4A 1X8LA 1LVGA 1NF3A 2XGJA 1KI3A 1MR3F 2FNAA 1XE1A 1Z6TA 4EQ6B 2ZRNA 2RGNA 3QKSA 3GPLA 1YHQB 1NBME 2EFGA 3QKUA 4YAUA 2A5FA 5HCIA 4B32A 5JSZA 4LJ9A 1HY3A 1B2RA 5FL7D 5BN3A 3U4QA 5FTJA 4D4MA 2C2HA 1YZUA 1M2OB 2OCAA 3S1AA 3RANA 1II8B 4PPFA 3PG5A 3ZZTA 1N5JA 2LWIA 2Q0HA 4LDJA 4M1WA 1QVRA 4M21A 3KFVA 2W2TA 3T15A 4DDUA 1J8MF 3KB2A 2J46A 5FPTA 3VR1A 5LB4A 1M7GA 4TT3A 3B85A 2A5DA 1KI2A 1KO4A 2F3TA 1GTVA 2CVFA 2FSFA 4MYTA 3WRYC 2OBNA 2GRJA 1P2VA 5LPNA 4TL7A 4M1KA 2WWGA 4PPNA 5CLQA 3WNBA 4Q19A 3R7WA 5EXXA 5F2EA 1T8UA 1NBMA 4J0QA 2VSXA 5IK2A 1Z3IX 3C7KA 4F92B 1OXUA 3MRSA 1Q20A 3B1YA 3ASZA 3SI7A 2RGDA 2ORWA 2OSBA 2JDID 5AJZA 3TR5A 1SXJD 2HV8A 2NO9A 2QNRA 2ERYA 1XWIA 3ZGXA 4AKIA 1VQ6B 1NN3A 3A37A 3FDIA 2RCNA 4LWZA 3VKGA 4C0SA 1Y3AA 3TAHA 5JHGB 4RVCA 1PUJA 4GBMA 4YDSA 2QG6A 3SU8A 2D4HA 1NLYA 3BORA 4MYHA 3A8TA 1W4BA 1R6BX 1HEIA 2IC5A 2WOOA 1J70A 3LH5A 2KSQA 1FP6A 1M74A 4Q18A 3K0FB 5J4LA 5FOWA 2YC2C 1H8ED 1XXHB 4LYAA 4TSFD 3T34A 1F2TB 1YZGA 1N5LA 4DT1B 1EESA 3DHWC 4BRUA 5BN5A 4QGGA 2CE7A 3ZDQA 1ELOA 1IQPA 1XD2A 4PX9A 3P20A 5GV8A 3RC8A 3EIHA 2QMOA 1H8HD 2JGNA 4R98A 3SHFA 2B5OA 4TLCA 1G9XA 3QOFA 5AWFC 3P27A 1SVLA 3OE7A 1CP2A 2RC6A 2F1JA 2ZUBA 2GNOA 1KI1A 1XZQA 2WVJA 1CJKC 2QORA 1LW7A 1VQ8B 3CPJB 2ZROA 1KHTA 4TMKA 4ZV4A 1DG1G 1M90D 3HR7A 4A9AA 1E9SA 3LVQE 1CJTC 2BMDA 1WMSA 2QAJA 2IYYA 4EFLA 2MMCA 4WBSA 3EX7C 1HA3A 3AF0A 2KWIA 2ZJ5A 4LHXA 4QM7A 1TF5A 2N42A 2J7KA 3B1XA 1TLLA 1UMKA 2UVQA 4M1YA 1JNYA 3QI2A 3QPVA 4NPHA 2L0XA 3X1WA 3CIOA 5JRZA 3B1VA 4C0AC 1G3MA 4N0EA 2IHBA 2V9PA 4BLTA 3PV0A 4MRPA 4EPXA 5JLJA 2VA8A 1NRJB 4LK2A 2UZ3A 3Q7PA 2FEMA 1XD9A 1VCOA 1WCV1 2ORIA 4L16A 4Q7KA 3NDBB 2ZI5A 4TTPA 1NN0A 3X1YA 1CQXA 4KITB 4XOIA 2ZJOA 2QN6A 3C5CA 1KY2A 3EC1A 1QHIA 3GMTA 4EKDA 5DNYB 1ZNWA 2Z0MA 3M1IA 4TYYA 4R2IA 3PITA 3EIEA 4HAZA 1K8AD 3AH8A 1FPMA 3W2FA 2V55B 3DKVA 4TYPA 4FMDB 1R0XA 3CPHA 1XMJA 4CYMA 4NE2A 3BOSA 2BM1A 5KPJA 1DELA 1UKZA 2IL1A 2HT6A 4A6XA 5KTYA 4QNMA 1C1YA 5KSOA 4Y9UA 5DH9A 1Z07A 3DVLA 2XITA 5HTKA 3CMAB 2QP4A 3QPWA 5H5JA 5E7MA 4MH0R 4KSCA 3THXA 3OZXA 5FPKA 1NJFA 4B75A 2WSSA 3ADKA 1PUIA 1DAGA 1ZC3A 3B5JA 1XP8A 3T35A 1FMLA 4RZUA 3K1JA 4GMXA 2RHDA 2RGBA 2TMKA 1JR3E 4NP6A 4V0LA 1HT1E 1RW4A 1U2RA 2BF4A 1VIYA 2PZFA 4US1R 3ADCA 1FNMA 4LV6A 1UBCA 1QHGA 1TEXA 1UBGA 1JPJA 3THYB 3KKNA 1N0VC 5EMNA 3I1FA 1G8GA 2QP3A 5LB2A 5IHPA 1UFQA 4UNSA 2EFDB 3LV8A 2HMAA 3U7HB 1I7PA 2OFOA 2I1VB 1Q22A 1AMOA 2ODNA 1VCIA 1F5NA 2O8DB 421PA 3OEHD 2FPLA 2PT5A 3W2GA 1QHHA 4MGYR 3IEUA 3CX6A 1W2HA 3K0EA 1GKIA 3LX8A 4IFEA 5FBVB 3IHLA 1Z6AA 3DM9B 4LV5B 1EP1B 2J0QA 1E0AA 4G01B 1DAFA 2W0MA 4IDNA 1EFHA 2VNJA 1JR3A 1G8HA 4QG7A 4FCVA 2CHGA 4TL9A 4D0LB 2FPMA 2ZM5A 3PENA 4BQSA 3W6PA 4IOLA 2CNDA 4LCBA 2KJQA 4EJSA 4GMDA 5EUMA 1IB0A 1HYQA 5DN6D 4KFTA 1XXHE 5HXBA 3ZIAD 2QE7D 5FBRB 3DZDA 3BH6A 3OZUA 4PC2A 3MWLA 1AS2A 4PPQA 2XXAB 4DQLA 5E4FA 2IYTA 4V0ME 2WWHA 2D06A 2IEZA 4OJQA 3ZYCA 3GJ6A 4AYWA 2C8VA 2GCPA 2VEDA 5FTMA 3AB3A 3CO5A 3UWKA 3WMFA 2AR7A 1E1RA 1W0KA 1CTQA 2GEDA 2GJ8A 2IYLD 3LQQA 4LHZA 3W8RA 1ZU5A 4H1VA 2C9OA 4QHYA 2ANCA 4LV8B 3K0FA 3K9LA 4DIEA 3B7GA 4QJ4A 4DUGD 1NVVQ 4FWTA 1WA5A 1XXHA 2N1BA 3OAAD 3FWYA 4H1UA 3AP2A 4DT1A 5B30A 4IXMA 3FKSA 3TUZC 2J59A 2GDJA 1C4OA 4ZDIA 1DARA 3W5JA 1FUKA 4KI0A 2IYUA 1R10A 4V0MA 4TLDA 2OCYC 3SHWA 4II7A 3TNFA 1WE2A 2W2XA 2ZJAA 1F2UB 1SGWA 1MABB 2IW3A 2PLRA 2ODEA 3SJBA 1VQNB 1ZC4A 4GP7A 3FKQA 1T91A 2A5GA 4M1SA 3ZVNA 1QG0A 1UKYA 1YR8A 5HPYB 2X19A 3AVTA 1N2CE 1EP3B 1VG8A 5G41A 1P9NA 2UKDA 3W2IA 3IQWA 4IXNA 1TF2A 1X8KA 3AKYA 3KQHA 5HKKA 3CF6R 4MRNA 3U2QA 1BO6A 1G8PA 1G3UA 4BLOA 2EIXA 3GP8A 2FGJA 4M1MA 3P1JA 2WOJA 2GBLC 3RLFA 3RVBA 3KUDA 2LKDA 4NMMA 3PJRA 3QPUA 1O3YA 1VQKB 5JCPA 2QI9C 3FFAA 3CCQB 2F6RA 4IVPA 3SFVA 4BWYA 3H4MA 2HLDD 4OI4A 4ZPXA 2RGEA 5J4HA 5KU1A 4Q03A 1KK1A 3VU9B 1KI7A 1OSNA 3CRZA 1E2JA 2O0HA 3C4JA 4YXWA 4R2HA 5AR1A 5CDFE 2AKYA 5EZ6B 4TYNA 1S0UA 1P61B 4JMPA 1XTQA 2ZU6A 3QXCA 1QVFB 1P75A 3EARA 4Q9IA 2ZAMA 1GAJA 2RGCA 1E1QA 2ZEJA 3HJNA 4PHFA 4UJ3A 4JVSB 1VMAA 1QRAA 5G3YA 1X1SA 3LXRA 2FPKA 5FOTA 3UPUA 2ZRBA 1U8AA 4W5HA 521PA 2BSAA 4Z8YA 2QGZA 4HE6A 5FUWA 2D62A 4DBLC 2F3RA 3NH6A 3EZFA 3Q5DA 2XTNA 4JJZA 4RFSB 1E2HA 4X8HA 3TVDA 3FE2A 2WJHA 5SZIA 4N3GA 1AK2A 4Z1MD 5K8UA 5KOYA 1T9HA 3RABA 4C0JA 5IT5A 3LA6A 1QHXA 4ZGQB 3MGCA 4OHWA 5LD2C 4G1BA 2ODWA 5CDFA 3EPLA 2OG2A 1R4AA 1S96A 2Q6TA 4PC7A 1E2LA 2PH1A 1ZAKA 1NBMD 2WTUA 2NO0A 5KSWB 5JFGA 2BN4A 3B60A 5FBWB 1CS4C 2EVWX 2E9SA 4A4DA 4EH1A 1XCGB 4XD7A 5FTNA 3W8NA 1OFUX 4NYIQ 2ZANA 3GLFB 5FI0B 2SHKA 1AGPA 3THWA 3NG1A 4B3GA 2FX3A 1MKYA 3LO8A 1NVWQ 4FD2A 1FDRA 4LZZA 2EYUA 2H1LA 2ATXA 3G6EB 4E09A 1W36D 2FDCA 1CRPA 4S2EA 3KFXA 1OH7A 4HLQB 2DBYA 2ZITA 1ZM2A 4HZUB 5JWHA 3UIEA 3THYA 3EAQA 3UMRA 1X86B 5BXQC 4B48A 1HURA 4TMTA 1RJ9A 2ZSBA 3T1OA 1GILA 2IYZA 3DDCA 1O87A 4DDVA 2FMXA 2C95A 2ZSAA 5FA6A 1VCNA 1FQKA 4ZO4A 2FOLA 4XVUA 1OFTA 4PC1A 1EFRA 1XCPA 3U4QB 2NQ2C 1DDGA 1WP9A 3P4XA 4XVRA 2IEYA 2Y8EA 3IIKA 1SKQA 5CJPA 1GL7A 4ON9A 2QRZA 3ZLJA 5FPYA 1T0HB 4XIGS 1M6NA 3AUXA 4MA4A 4MGZR 2O8EB 2WIBA 4AKEA 2ZJYA 3QENA 1Q1ZA 2QPTA 3ND9A 1J9ZA 2QAGC 1DAEA 1CLUA 1E98A 3CUEF 3RWOA 5AUOB 3E1YE 1Q44A 4D26A 3TJZA 2WKPA 1E2PA 3OE7D 4Q5IA 1Z28A 1VQLB 2ZTSA 4PO8A 4XWAA 4WXRA 2VSOA 2DFKB 2J87A 4IVRA 3UMSA 4JL8A 3CKLA 2XXAA 3MD0A 4JJKA 3Q9LA 2WWIA 5LD2B 4UXJA 1IHUA 1XJQA 3N5CA 3B82A 4FK8A 3GD7A 4CT5A 3Q72A 4QHSA 2P3SA 2QTHA 4R7ZA 2BGIA 5K8IA 3T5DA 4RJLA 1S72B 4Q9LA 1YRAA 4Q1DA 4F4CA 3QIAA 4BLPA 2CNWA 2J41A 5AUNB 3MAAC 2VP6A 1P3JA 1P62B 4JZKA 4TQ9A 3S1AB 4Z51A 4DLYA 4I4LA 2P2LA 1PLLA 1DBSA 3CX7A 4IEEA 4MGKR 1DAMA 1ZP6A 2V6IA 3B13B 2WMNB 2XX3A 2JEOA 3EPKA 4PAOA 2CK3A 4Q4AA 1DEKA 4F4IA 4PO1A 2FGKA 3AP1A 4D81A 5SZHB 4B33A 3KL4A 5EP3A 3F5FA 1E62A 2ZJ2A 2JLSA 5FUYA 3ZVLA 3G4SB 4QBGB 3MWJA 3PXGA 3WBJA 2I1QA 1MABA 4Q1AA 2H5EA 3R7WB 2Z43A 1JJ2B 1E9RA 1XNJA 1F48A 5B57C 2F9LA 2QGNA 2RGAA 1G7SA 2H7VA 2V7QA 1KI8A 1LTQA 5IRCD 2JLXA 4YMWA 3PEUA 1ZD1A 4LJ8A 2QTVB 4YMUA 1KSFX 3SFZA 3WNCA 3UMFA 3OW2B 3KJIA 2GAAA 5FL3A 2A9KA 3HPQA 1SVSA 3QJYA 3JZAA 4MKGA 1PZNA 2Q9CA 1TQ6A 3A36A 3EASA 4BPBA 3NHBA 2BGJA 1UF9A 2QAGB 2ASEA 4QBIA 5DHAA 1NKTA 1AZSC 1GVHA 3JVVA 1GM5A 1DO0A 3V4RA 2F55A 3UG6A 2Z6VA 2QROA 2R6FA 3PQCA 1G7TA 4LX0A 3FHCB 4LHYA 4A0HA 2EQBA 1T3SA 2NG1A 2YHSA 3TW4A 3LBNA 3VU9A 2J0VA 3BWDD 3OFNA 2CHQA 3E2IA 2EFCB 1N0WA 1NMZA 3L2OB 2P5TB 2O0KA 1XD2B 4MUBA 3K9NA 2F43B 3CCRB 3EPJA 1E96A 1COWA 3QNUA 1F3OA 4QGHA 5CJ2A 3W90A 3GLFE 1YITB 2QEQA 4KYIB 3CF0A 3RS4A 3Q7QA 4HDQB 1S3GA 1E32A 4PZLA 5TARA 5EE1A 4EFNA 4DCTA 5C4MA 1JR3D 2WJYA 2ZAOA 3CNNA 5LBIA 721PA 4P31A 4A36A 1HQCA 4Q9JA 3CMEB 1E2MA 2RC5A 1YHNA 4HLCA 4MQBA 1KO7A 2JJ1A 4A0GA 1Q12A 4MDFA 1NP6A 3EA0A 3R8CA 1KI9A 4JT4A 4DLRA 3N2EA 2ZJZA 3TUJC 3GLFA 1M7BA 2Z4SA 1VYVA 2REBA 2GAOA 2R62A 4HAWA 4URZR 1VDZA 1S8FA 2X3UA 1NLFA 1NG1A 3KKPA 2HJVA 1ESNA 1F6BA 2YWHA 1J2JA 3R9WA 4W7SA 4DLTA 3QF4A 2OFWA 4BFZA 1Q86D 3QY0A 1E1RD 1W0KD 4AK9A 3I73A 5AJYA 3UANA 3LY5A 1KC8D 4ABYA 5BYKA 1QBKC 1VCMA 3AEZA 1D9ZA 4EJSC 2NOAA 2ZE8A 4XTCS 4DCUA 3H86A 3PUZA 3A4LA 4P4SA 5BWMA 1XFAA 3K8YA 3RS3A 4URXR 2C98A 2Q3MA 1G5TA 5TB5A 2MSDB 3OEEA 5JJKA 1G4UR 2QTZA 1LB1B 4N1AA 3FKSD 5C18A 3PCRB 3IIJA 5AN9A 4ZDWA 2J7PA 3KQLA 4GDFA 1AS3A 4A0FA 4RD3A 2JLWA 2XNDA 2H17A 4L4UA 4LI0A 5D3MB 3TIFA 1NG9A 1ZMXA 2QU8A 1CR0A 1IONA 2X2EA 3ECCA 2WIAA 1N0UA 2CCKA 2BWJA 3VNUA 1Z0DA 2CCGA 3WYFA 2REOA 1YZNA 4X8LA 1VG9B 1GRQA 3THXB 3QVUA 2ZE7A 4G1UC 3W2HA 3F0TA 5G53C 1E79A 4FMBB 3AVQA 3BXZA 4Q1EA 2GJAA 1K8RA 4BLRA 2ZRMA 2PX3A 3D6TB 3UXMA 3FMPB 3BBPA 1IM2A 2HYIC 4RD0A 1IY2A 2QPOA 1DTSA 1Z0FA 5KHOC 3ASYA 1AQUA 4FMCB 3WMGA 3ZD7A 2YOHA 2F1HA 2ZJBA 4KODA 2PCLA 1JA0A 1ZBDA 1SM4A 5CIWA 4B3BA 1KO8A 1MH1A 4B71A 1KJWA 1QX4A 2AWOA 3VR5A 1CF4A 2KI5A 3T1VA 4DQKA 3K0SA 4WZAE 3VMFA 5SZJA 3SBEA 1ZUHA 5FOXA 1RKBA 4YXWD 1R0YA 4FI3C 1QHHB 1GL6A 2NGRA 3K0AB 4LY6A 4UNPA 5GVSA 1AQYA 2HXYA 1TX4B 5C1BA 2GXAA 4DCNA 4Q4HB 4OHXA 1TPZA 3NHAA 3TH5A 5JCZA 1G6OA 1KAOA 1S9HA 5DIFA 4PHGA 1XX6A 3LD9A 3VR6A 4BZPA 1T4GA 5FH9A 1Q81D 3I55B 1Z29A 3OIWA 1BMFD 1K6MA 3MSXA 3O8RA 2VYFA 1E94E 1XDBA 3RHFA 4EPTA 1BH2A 1D2NA 4NHOA 4EJSB 2ZRFA 1R5OA 2KB0A 2QT1A 2YOFA 4LHWA 4B4DA 1I4DD 2X77A 5C4GB 4DJTA 4YMSA 4US2R 3U6BA 3E20A 4V0OA 1QG4A 3AVUA 3J81k 1FRQA 2GK7A 1E0KA 121PA 4C3ZA 4G1VA 1TNDA 2CLCX 2ZVQX 1IOZA 3IGFA 3QXJA 4Z8XA 2DFTA 1CKEA 1CBUA 3HR8A 3SR0A 3QXXA 3QKRA 1GFIA 3ZC3A 2QAGA 4PHTA 3WMEA 4XD7D 2KE5A 2NO6A 1KI4A 4E07A 1I2MA 3PUVA 3B2EA 4EPWA 3L0SA 1KD1D 2IF0A 3EA5A 1E9CA 1MT0A 4UQOA 2C03A 2JJ8A 2ZUCA 4Q7MB 1SVMA 2BMFA 4P6VF 1GUAA 3LDAA 4PHHA 1X3SA 3RS5A 3QXSA 3BGWA 4C4PA 1YZKA 1ZIPA 2FZLA 3CRMA 2ZYTX 4CF7A 4OJKA 2OTLB 3B1WA 1KNXA 3WRXC 3P4YA 2R6AA 5UKDA 4FN5A 2F43A 1MO5A 3BH0A 3SYLA 4GP6A 4PAMA 2BMWA 3HU1A 3U5ZB 5AJVB 3I61A 5JEDA 3AF4A 2JLVA 2AD5A 1NY6A 5FTKA 3PEVA 5FBLB 2JLYA 5CYPA 1NMYA 1UDXA 3B6EA 4X8MA 4JBXA 4NYJR 4KYUA 4Q4JA 1FFHA 1FRNA 3VTKA 4ZGNB 3EZ6A 2VF7A 1FL9A 3RRZA 1E9AA 3NBYC 1N8RD 2VLIA 1KSHA 1N6OA 3NC0C 4B2PA 2V1UA 1DOAA 3HYTA 3E5HA 1RYHA 3AF2A 3G5UA 1DADA 2P0EA 5GV7A 1CJVC 2QQEA 1GL9B 3B8HA 1TQ4A 1VECA 2DFNA 3LLMA 1II0A 2J3EA 1EP2B 2QBYB 2WJIA 4NCIA 2IS6A 2IF2A 1D2EA 2GJSA 3TK1A 1RRGA 3CX8A 1ZD8A 3QBVA 3NH9A 3C16C 4HLDA 2IYVA 3SDZA 5JECA 2FN4A 3NBXX 4JLJA 4WA7A 1JALA 2A7QA 1GO2A 4OI2A 1ZCBA 3V76A 4Q1BA 4IDQA 1R2QA 2B92A 2WJVA 5E95A 3K53A 1XEWX 3DL0A 2REXB 2NMVA 1WB9A 1E2DA 1RYFA 5FR1A 3QFSA 2JLQA 2NIPA 8OHMA 1G17A 2CLDX 1I4LD 2MSCB 3BERA 1FW6A 1GKYA 2QT0A 1X8JA 5TMPA 1P60A 2RGGA 5KNCA 2BCGY 3W3AA 1HUQA 1UKEA 4JLPA 1OHHA 3AP3A 3ICQB 1G3QA 4KO8A 3FFBA 2FSIA 5P21A 5JS8A 2UZIR 1N6NA 5GJVC 2OE2A 1NKSA 1BS1A 3A1VA 2FF7A 1SVKA 1QHYA 2IXFA 821PA 3CLVA 1VKJA 2GCOA 4BECA 1T5IA 4QXAA 4M9SA 5HCNA 2R65A 2H8KA 1DE0A 1NI3A 4YMVA 1IXSB 4AF7A 4RZ3A 5D3MA 1R8SA 3WYAA 3IDQA 3CC7B 2FFHA 3MWKA 1RE0A 3H1TA 3TLXA 1TUEA 2OT3B 1Q57A 4V0KA 4YAFA 3LBHA 4F4JA 1NNEA 2QPAA 3L43A 1VTKA 4UNQA 3OZWA 1UM8A 2DEUA 4V03A 1Z47A 1VQMB 4OK6A 2FV8A 1YJNB 1W48A 2AN9A 4GNKA 4Q1FA 4JLKA 2WJGA 4UKDA 5KNDA 3IPYA 4IDHA 4MRVA 3THWB 1DVRA 4CT4B 4ESVA 1UAAA 2ONJA 2PCJA 3IO3A 3ZQ6A 1ZYUA 4OHYA 1GOTA 1U9IC 4LBZA 2XOKA 3KUCA 3GLHE 2GJ9A 5HZKA 4MRRA 1RJ9B 1EFCA 2BC9A 3CCMB 4LYFA 1EXMA 2JJ2A 2R6GA 3WP1B 4GT1A 3W6NA 2MSEB 4L8GA 4WAUA 4M9QA 3RS0A 4D4JA 3R20A 4HUTA 5JI2E 2WHXA 3NBFA 5FBQB 2BJWA 4TLEA 1VQOB 2ZE5A 4EIWA 3ADDA 1GNRA 2YJTD 4PQRA 2QTFA 5F9HA 3OFND 2C5LA 3K0AA 2BV3A 5GJCA 3T1TA 4Q4HA 4DXAA 1WDTA 2IYXA 4G3XA 1RRFA 2B8WA 3RNLA 4DSOA 1Q7YD 4TMWA 4I1UA 3W2EA 1N5KA 1LF0A 2G6BA 2IX3A 5SZKB 1P6XA 2G88A 2DY1A 2QSZA 1Z6GA 3GLHA 3SYNA 2OEPA 4O2RA 4W5WA 1BYIA 3GEHA 4AIIA 2AL7A 1EFUA 2XTMA 1XMVA 1HE1C 3KTAA 3NBZC 1KDOA 3W9YA 4NCNA 1FOEB 2JIZD 3UG7A 4QBHA 1SQ5A 4LYJA 3NXSA 1KSGA 4MDEA 1CEEA 3P26A 3CONA 3I5YA 2VNIA 1XTSA 2WAYA 3I56B 1OE0A 1K73D 4HE5A 5AUQA 4IHQA 3CR7A 2GZDA 1KY3A 2WM9B 2JJ1D 5JJIA 1L4YA 3LVBA 2VP9A 1JA1A 4KBGA 4C0QC 3KDSE 4C2TA 3L0PA 1CULC 5EXTA 3U3MA 4JLVA 2C78A 4HAXA 4LC0A 4C0HA 4D6PA 4WXPA 1M8PA 4BFUA 4JLMA 4DLVA 4F7DA 3NTUA 5H59A 2NTYC 4NH0A 4URVR 1E9BA 3RSOA 4TZ6A 4TYQA 4AKGA 2IUSA 2D3WA 3U3JA 3A58B 2O8CB 4Q4AB 3K70B 2VNKA 3CD6B 1IJFA 2C9YA 1OB5A 1W1WA 1YVDA 3BFVA 3IUYA 1XPRA 3R9IA 4B43A 4ESHA 3TBKA 4M8NE 3QE0A 4IOMA 5JEEA 4G5SA 1GNPA 5E7IA 1W0JA 3NVAA 1AGRA 2VHTA 4HUQB 2GZHA 4IDOA 3T61A 2YWGA 1P72A 4RD4A 2IHYA 3OEED 4W5JA 2OXCA 4A92A 4CEHA 4M9XA 1K9MD 2AK2A 2HT1A 4BEBA 1M7HA 2YKGA 4R71A 3CXCB 1Z06A 5LDDC 2NZJA 3U7FB 3EXAA 2XNDD 3DM5A 3N70A 3A6PC 1NVUQ 2OZEA 3BS4A 1E64A 1TMKA 2WKRA 4Q01A 4ACBA 2XNSA 5DSZA 2FFQA 2W6JA 1CIPA 1IN7A 3IQXA 3SN6A 1CR1A 2QBYA 4C7OB 3CC2B 3W5VA 1E69A 1IN8A 1H65A 3GEEA 3OIUA 5FOVA 2WKQA 1QGZA 1DAHA 2W2VA 4LJYA 1VQPB 4A8JC 1ESMA 1KO1A 4PO9A 2O8FA 5DGXA 1ZM4A 5TDHA 3FMOB 3NEJA 4YONB 3I32A 1W46A 1KNQA 4UAJA 3QKTA 2EWVA 2PZGA 1P4SA 3U3KA 2A5YB 3L8ZA 2XZLA 2QM7A 1R7RA 1KGDA 2OO7A 1VQ5B 4GZMA 3U3OA 3TE6A 4IW3B 3CCJB 1R0ZA 2G3YA 1XTJA 3QQ5A 3TRFA 1WRBA 2GVZC 4NYMR 1HV8A 1NY5A 1CNFA 3H0KA 5FPSA 1NLZA 3W5UA 4QOSA 2EWWA 3TAUA 2XTZA 2A2ZA 3MG9A 3SYKA 5GJBA 1Z63A 4PC3A 1AKEA 1Q3HA 2CL0X 3CBQA 4EDHA 4DSTA 1CU1A 3SQWA 1QVGB 1W4RA 5GJWC 3G71B 3AKEA 2GVDC 3LW8A 4ZIRA 3AF1A 2DB3A 5L3QB 4TT3D 3EPHA 5M04A 4LJ5A 4RD2A 3HDTA 1S9DA 4JLAA 1P5ZB 3CZPA 4TTQA 5DYIA 1JBKA 1GP2A 1W47A 1ZUIA 1G5RA 3C5HA 2BEKA 3RRNA 2Q3HA 2X2FA 4B2LA 5AUPB 5IK2D 1QF9A 1KDTA 3RSLA 4D0GA 2JLUA 3EZ9A 4RZXA 4YC7A 3H84A 2WWWA 4AURA 2X8AA 1QUFA 2GXUA 2QRNA 1YJ5A 2XJ9A 1Q1EA 2HCJB 2JLZA 2GCNA 3TQFA 1D2MA 2WV9A 3ZJYA 4A2PA 1JQLB 4ZCIA 1YJWB 2P6RA 3Q3JB 2CL6X 1G6HA 2R6DA 4B47A 4OHVA 1FNCA 1J99A 1KOFA 4M4SA 4A1FA 4MYUA 1N6HA 3QF4B 2ERXA 2XNCA 1QHSA 3TW8B 1IAQA 5CM8B 5FOSA 5FUVA 3W5HA 1RRPA 4PANA 4IOKA 1VQ7B 2Q9AA 1IN4A 2B8TA 1RFLA 2VBCA 5K8LA 3OHMA 4P4SB 3I4LA 2PIAA 3K9GA 3JVUA 2AK3A 2FFAA 4A8JB 4TL8A 4C9BA 4LJ7A 1E2IA 1H8EA 1ZUNB 5TVKA 1UJ2A 4CEIA 3FOZA 2JCSA 2WICA 3KXKA 4Q7JB 1LNZA 3PIRA 4V0NA 4ZI3A 1L7VC 4B3XA 4KXFB 1OJLA 2ZRGA 4DEXA 1OYYA 1XEXA 2VRWA 1QFJA 2QMEA 3AUYA 1Z8FA 1S2MA 4PZYA 4TMVA 1VHLA 4Q1CA 2GILA 1A82A 4NU0A 1N6IA 4JS0A 4QBFA 3QG5A 2V1XA 1Z0IA 1AKYA 3FB4A 5JWRA 4GI7A 3RS2A 1XF9A 3FTQA 2ZI3A 5AK0A 1G8YA 4NCKA 2FSHA 3I8SA 1YZTA 1V43A 4LJAA 4OQXA 4Y0VA 3GFOA 2WZQA 1G291 1Q21A 3CCSB 3FHOA 1QGYA 2VHQA 4IDPA 4H9GA 1R8QA 1S1CA 3PUWA 2G83A 3OIYA 3O8DA 2BHRA 1D6JA 5KDDA 2K5UA 5JBQA 1J90A 3IIMA 2HDNB 4QGAA 3WBKA 4YAWA 2A30A 2OUKA 3G0HA 3VAAA 2DETA 4HEJA 1X6VA 3TUIC 4Y7CA 3KJHA 1ZM9A 3GFTA 4D0NA 4JVNA 2O8CA 3CPEA 1GJRA 2OM2A 4ACAA 5EJEA 4Q9HA 1U9IA 3L82B 4Q9KA 1ZD9A 4C2UA 2J0SA 3WHLA 1A8PA 2WMOB 2ZR0A 1KO5A 3RRMA 4C43A 2BKEA 3OESA 4C0LA 3ZZUA 4D25A 1GIAA 3LFUA 4HUQA 3BC1A 1NJID 1T6NA 1A4RA 3AVPA 2D7CA 5FUXA 3KQUA 3X1XA 4Q66C 3CWZA 2A5JA 4G5OA 1X1RA 1UADA 1D8TA 1P73A 2OCBA 4AYTA 3NDPA 2J0UB 1KI6B 3OJWA 3JQQA 2LCFA 2CCJA 4NL4H 1N6RA 2OILA 3GJ7A 5H68A 2XAUA 1GRNA 1U94A 4NONA 4GPTA 4YMTA 3BAFA 5TR9A 3QKRB 4C7OA 2I4IA 3ES9A 1E4VA 3BB1A 4P32A 4GOXA 4KCGA 3QXHA 4NZYA 2FZ4A 3UATA 4AC9A 1W5TA 3ZVMA 3N2IA 1BYUA 4UNNA 2W0SA 2WSSD 4MKFA 5A4JA 5HE9A 3CB4A 1G16A 2AKAB 4CEJA 2X1VA 1JEEA 1OXVA 4LYHA 4LSGA 4DLUA 3LBIA 3AKDA 2NPFA 2AD1A 1MRNA 3FYHA 4A2WA 2G1JA 1N6LA 2ZS8A 3K0CA 4GFDA 5JI3E 3LQRA 4U02A 4EUNA 3GLGB 4NYJQ 4IOJA 2N46A 2PL3A 1DO2A 4BFTA 3GJ0A 4OK3A 4S35A 2BVNA 5DLQC 2QQ0A 3WHKA 4RY2A 2BDTA 5CK4A 3EZ2A 2JJ2D 1U98A 5EE5B 2P67A 3AKCA 4LUCA 1Z5ZA 4B73A 4F91B 2RGXA 1GVNB 2CVHA 4D4KA 1E0SA 4HI0E 4HDCA 2IXGA 4ARZB 1LS6A 1XTKA 4MYCA 2AFHE 5EE3A 3TKLA 3OEHA 5B64A 3BFXA 1DPFA 4Q4JB 4KFRA 2B21A 4TZ0A 2DR3A 4P0TA 2ZYVX 3WY9A 4GRAA 3W3ZB 4KVGA 1ZIOA 3LWNA 4DWJA 3ETLA 5L3QA 2ZJ8A 2GEVA 4N3NA 3QF7A 1SZPA 5J40A 3CH5A 2IWRA 3T12A 2CMKA 2ZRKA 1VQ4B 1XTRA 1VG0B 3U44B 3VQTA 4OI1A 4UJ5A 4JLOA 4PSAA 4QKQA 4DLWA 3ZS8A 2VYQA 4US0R 4M22A 3T06B 3BIFA 2J45A 5KYKA 4RSGA 3LX5A 5DN6A 1VHTA 1NDHA 4HAVA 3ZIAA 4I1VA 2EYQA 2QE7A 3A1TA 4RFVA 3C15C 3SNHA 3CC4B 4IJMA 4NTZA 1GITA 5DI3B 4BRWA 3IHWA 3V4FA 1ZRHA 3U7EB 1G3RA 1LF5A 2AX4A 2I3BA 3EWAA 2BMEA 3JQRA 5BQ5A 5FI1B 3IO5A 1WF3A 3EG5A 3LLUA 4URWR 2IYWA 4WOPA 4RZ2A 2B6HA 1BKDR 2VHCA 1W2BB 1VIAA 5EUQB 4B3CA 221PA 2FU5C 4PSVA 1M1YE 2PMKA 2E1RA 1G21E 3Q8XB 4DHEA 1E2QA 1MO6A 2H92A 4A8JA 2BBTA 2IUTA 1OPXA 3QFCA 3F3YA 3OAAA 4M1TA 5CB6A 3R9XA 1YIJB 2CHVA 4HB4A 5G3ZA 1NL3A 4LBYA 1G5PA 1TU3A 2BBWA 5L8VA 2GPJA 2GCOB 3HU3A 3TVTA 1B23P 4RCYA 1XMIA 1TQDA 4O25A 1F60A 3VR2A 2HCBA 1E2EA 3W6OA 1NN1A 1W0JD 2P6NA 4IVQA 2R8RA 2A3RA 1OKKA 4JSTA 1QFZA 5EE9A 3GQBA 4KHZA 2ANBA 2DWQA 1KK2A 1WBBA 1US8A 5HE8A 4YALA 5KUTA 4JSYA 2QEXB 3CCUB 4M2LA 4LBVA 4G0NA 5HKKD 1E3MA 2BBSA 3C14C 4B35A 5IF9A 2BPOA 2BEJA 4A15A 3SZRA 2R6CA 1U0HC 5EP4A 4HYYA 5ELXA 2Q9BA 2Z5FA 1Q0UA 2HUPA 2W6JD 3CRVA 1H85A 5FFMA 3MCAA 1D1NA 3SC3A 1L4UA 4HB3A 5CLLA 1KZGB 4L9WA 4V02A 2GTPA 3DZ8A 5EP2A 1A2KC 2ZVPX 4E22A 1OIXA 4RKEA 4AF6A 1R0WA 2D7DA 4I1SA 1KRHA 2DWOA 5KDLA 1TL7C 4BLSA 3VNVA 3KJEA 2B7CA 5L3RA 4GOJA 3AVWA 1P7CA 2ZSFA 4P33A 5EQTA 4NBSA 2A78A 2FH5B 2IBMA 1E1QD 2ZRIA 1W44A 2V8OA 4LPKA 4RKFA 3BJIC 2FSGA 3LNCA 4PPGA 1OYWA 3DOFA 1OFIA 3CF2A 1XPOA 1LFDB 2ZRDA 4BZQA 1Z08A 4A2QA 3GLHB 3VX4A 3MMPA 4TMXA 2ZU0C 2H16A 1T5LA 1Z2CA 3C8UA 3HYRA 3IEVA 3SQXA 1KKMA 4OQLA 1W5SA 3K70C 3ZD6A 3KTAB 1WQ1R 1F20A 2GQFA 2R6HA 4TQUS 1E9EA 1KYIA 4PC6A 4Z1MA 2J0UA 2XZOA 1KI6A 3GLGE 1G64A 2FFBA 5C46F 1OT3A 4MGIR 1NN5A 1Z6XA 1KMHB 1NSTA 1EFTA 5BN4A 2R2AA 1NIPA 2CE2X 3MLEA 5J4VA 4DLZA 4PXAA 3U6KA 4TL6A 2XSZA 1E0JA 2VO1A 5EP1A 1XJCA 5A0FA 2BM0A 3V9PA 2YNMA 3VFDA 5FPHA 4BUJA 1DAKA 2P6UA 1L8QA 4PQFA 4MUAA 3I92A 1OB2A 5JZVA 3ICEA 2VHUA 1Q1BA 2YOGA 2IYSA 3TR0A 1FUUA 2LKCA 2DHRA 4OQNA 3UK6A 2DPXA 4QM6A 3U60B 4BPRA 2YINC 2RB4A 1MOZA 3GLGA 3T5GA 4AYXA 3ZBUA 1JPNA 3GJXC 4LBWA 1Z0AA 1Y63A 1KK0A 3I8XA 4Y9RA 1Q1QA 2HF8A 4JBYA 2WWYA 1T3HA 4ILEA 5F98A 3I62A 4JT2A 3TSOA 2JATA 2BMJA 2BCJQ 2H18A 4KSBA 1EFRD 1RZ3A 3I72A 4ARZA 3KQNA 4CEHB 2AXPA 2Z4RA 3NC1C 1IXZA 2YVUA 4MKHA 4MITA 1P2UA 5J47A 1SXJC 3SOPA 5HZHA 4YQFA 4I99A 2KBEA 5KPDA 1PLJA 3CCEB 3OZVA 3U44A 1ZM3A 3PVSA 3Q5EA 1PJRA 1QH0A 1EWRA 4B74A 4ASUA 4B76A 1ZU4A 4JLNA 1Z2AA 4B6FA 4DLXA 4PSKA 2O8BA 3HWSA 1BX0A 3KKOA 2IWHA 1L2TA 4FMCF 4U7DA 5TY0A 1WXQA 3C41J 6Q21A 5JS7A 2EFEB 5JMTA 1GAWA 4KV9A
chains in the Genus database with same CATH superfamily
1W35A 5THXA 5JO0A 2YHBA 4F9FA 2C82A 3FDFA 1F2DA 2O5VA 2CC2A 2IEIA 4P08A 1WB6A 4YQYA 1KAMA 4JP1A 5DI3A 4AWBA 4QODA 3THOA 5A1JA 3EGXA 1QYDA 2PVCA 4UUQA 4IHKA 1UODA 5KYWA 2VPTA 5I6DA 1M0EA 1K9VF 3RCBA 1JN0A 3DDUA 1YR7A 3LCJA 5JO9A 3WA7A 3CNQS 2P40A 2VF4X 4IIUA 5AHWA 5AW8A 1ONOA 1QIDA 2B61A 3LRPA 4O4HB 4OIMA 2CNWD 3FVWA 2YV5A 3GRRA 4Z4SA 4TZTA 3VYWA 1G1MA 3H13A 5CBKA 1KTVA 3OZGA 2HWKA 4DJ5X 5FCDA 2W6IA 3QBTA 4FIDA 1U5BA 2YHIB 1F8YA 3LGXA 4IWXA 4YT5A 5J5CA 4BUZA 1C5KA 1DHTA 1ZW6A 4GMHA 3RF7A 1E5QA 2X41A 1F7VA 2W5UA 4XLZA 5IMBA 1ISIA 2AXNA 1SBTA 4BC0A 4ZIRB 4DA4A 4C3VA 3E1SA 4BNZA 3FHLA 2VDKB 3UHPA 4BMZA 2A0WA 1OFHA 3ECSA 5KNBH 1LVUA 3FRIA 4ZKEA 1GSHA 3GPBA 1V9LA 2ORVA 3NPMA 2ZW9A 1J24A 1L4EA 4J49A 3TSZA 4MQ5A 4CM9D 2V7QD 5DTJA 2C83A 2FX5A 2O8NA 2OYSA 4QQFA 4XLTA 5FT9A 1U3VA 1P1IA 2VT2A 3DXXA 1KZ7B 3QE3A 4G5RA 4JUCA 1X1BA 5DWVA 5MN4A 1Q7BA 2HHCA 1DIBA 4QNRA 3TRDA 3X1DA 4ZGGA 3QEJA 1N2ZA 2E4VA 2PV7A 3E70C 3G2JA 1FDUA 4MVJA 1W34A 4E0BA 5IX8A 1X80A 4W4TA 1UPCA 2P62A 3VDQA 2DR2A 1OWPA 1Q83A 4C30A 1PFVA 3W8FA 2Y0DA 3ZS9A 1K6XA 3ZK8A 3IE0A 1IHYA 2WFZA 3MM4A 3UKOA 2H7XA 2X14A 2VDRB 5EKSA 4O02B 4IEIA 4J6FA 2AJ8A 4D74A 5BURA 4F7WA 4L15A 4P3NA 4U6NA 4DEVA 1HVXA 1S2GA 2FWIA 3FNHA 3SS8A 1XALA 2ZIEA 1G6KA 4LTDA 5KYTA 3E84A 3KSZO 4FWIB 4DCVA 4EPVA 2GEKA 4HZIA 2I6QA 2CEAA 1UWKA 5F5XA 2IA5A 2CYAA 3MF4A 5KYYB 1JHVA 2RK4A 1K88A 1W96A 1Y5IA 4X07A 2YJ5A 2ZR8A 3KPUA 2PBLA 3PUJA 4P93A 3RKUA 3UAOA 4BKPA 1GRRA 1KTIA 3Q2IA 2D2FA 1N4AA 1II9A 1ODLA 4B2IA 3IBGA 3JY6A 3OPVA 2VDJA 1WCIB 2Q4DA 3GNQA 1DWOA 2PGJA 3ESXA 2C4VA 4IH4A 4TWZA 5DHFA 4ZQIA 4XSHA 5ALGA 2P3LA 2M6KA 4XZ3A 4A8TA 2NSDA 2J1LA 5HK8A 1TTQB 2QSJA 2JIQA 3S1LA 4BBZA 4CIDA 3ZPXA 1N92A 2BR5A 4TV8A 2P0AA 1IG3A 2Y1KA 5FBHA 1YR6A 4QYXA 3B1ZA 2EBWA 4C4RA 3BDAA 4DVGA 1FEZA 2PX5A 2Z8YA 3KELA 1V5GA 4P92A 3U7GA 1II8A 3QJ5A 1AK9A 3IVXA 4R0VA 5CGZA 1R5BA 4J0DA 3HPRA 5TGZA 4AKHA 2OL4A 4GHWA 5KKCA 1DL5A 3ZHYA 4QJBA 5C2JB 4RQAA 3L1KA 4U6SA 5JJLA 4K9MA 1S4QA 1RXCA 1PEKE 1RE1A 3CG0A 2F3UA 3PXEA 4LQDA 5T4HA 3I9V1 1DG9A 1JLLA 1K4MA 1ZH0A 4JMQA 1QC5A 2AN5A 2MDTA 3HJUA 2JIOA 4QASA 3EFHA 1AMUA 1RQPA 5K0BA 4KPUB 5CG1A 2HNBA 2ZPTX 3WYDA 3KTOA 2OSVA 2HWXA 4G0OA 3S2UA 2V7GA 3C3BA 4CRWB 1GXSA 3SBDA 1HFJA 4YO8A 1V5WA 1DJNA 4Y1FA 4YT4A 1IUKA 4Z0NA 5DYNA 1GN9A 3PUMA 4YLEA 4XWKA 2JBAA 3B1FA 3V32A 2EFHB 3RIHA 4MEJA 3QVWA 2W00A 4MRMA 1DIOB 4BIIA 5D00A 1LD3A 1DJLA 3G05A 1TK2A 1K6EA 4LYGA 4G5FA 1YRLA 4LF9B 1GDDA 3I12A 5F73A 3VR2A 1GTRA 4E5YA 3Q4GA 1U6KA 1WL8A 3S2ZA 2EGGA 5TRTA 1RIFA 4F12A 2IHUA 2Y0BA 3QYJA 2KBFA 3K71B 4JLDA 4PRYA 1L7BA 5DCYA 5I4CA 1NXWA 2WKSA 1KZ1A 2OAGA 2YZ2A 4GLBA 3NZEA 1XMOB 2VQEB 3KBOA 1XHLA 1I6WA 5DF1A 4B4VA 2RDMA 3U7IA 5AXAA 1IK6A 3TTWA 1F2TA 2Z57A 4LXXA 3AUTA 3L02A 5EPEA 4NS4A 1YKSA 3F8TA 1E3DA 4AS2A 4EQZA 5A4KA 1UM9B 1BLIA 7ADHA 1IJEA 3A6ZA 3E7PA 3QSYA 2OV8A 4WBNA 3DDOA 2B2NA 5AESA 1GZ5A 3KKLA 5AKEA 4MQLA 4GOOD 2B20A 1UBRS 2ONZA 1O97D 5JRJA 9ATCA 1L5VA 3ENWA 4JYCA 3VJMA 1EUDB 5BSUA 4BJ1A 4O3MA 1S3SA 2HWUA 1Z0JA 1EK6A 1RIIA 4M9ZA 4HVLA 3OOYA 3JQGA 3P2MA 4MP8A 1Y33E 3PFGA 5AH0A 1CCWA 3ZVRA 3X1ZA 3UH1A 4XQ0A 3OJXA 3S70A 4ILKA 1XOIA 4UVIA 4EBFA 1QGAA 4NCJA 3RBXA 1RR6A 1NRXA 1KR2A 1SKYB 3K5HA 4C0KA 2PJDA 3G1UA 2OK8A 3HP1A 1ZFNA 2CXXA 4REMA 4WY5A 4LXTA 1T4MA 2DKOA 1UT8A 4CMEA 3ZNNA 1E5DA 1AA9A 3L4JA 1M1NB 5C8VA 3SX2A 4JB3A 5CT4A 1ZK0A 3UO8B 4GBGA 1KZ6A 1G1AA 1TM2A 3A1WA 2OBRA 4FC7A 3V4PB 1O0BA 2PUWA 4B7UA 4HAYA 2DCUA 3JR7A 2K2WA 3WL8A 3AM5A 3UK1A 4EW2A 3EVAA 5EIFA 4UARA 5JVDF 4MV8A 4O2BB 1L9XA 4H1TA 1ZI8A 3PDWA 5FL7A 5CW1A 5HKLA 2VRCA 4XWOA 1G9SA 4XUDA 5I9SA 4GL2A 1JI3A 3E9YA 3PXXA 4F5WA 3CVVA 2ZI4A 4B83A 5KSYA 5ALPA 4KE9A 1F8UA 3AERB 1SKAA 3B7WA 3GWZA 2IS4A 1GZ7A 4UXHA 5FDFA 1RI5A 3DBRA 5JU6A 3LP5A 1HLGA 4IUCS 4F8JA 3BXEA 4DLLA 4FZRA 1V37A 1E1DA 1WV1A 3QUBA 3N8GA 3AI2A 2AJBA 5KCMA 1IEVA 2NVOA 4L5YA 1EIWA 4CGZA 2IYRA 2PKEA 1NF2A 1NVAA 4WFIA 4IXWA 1KRXA 1ZIYA 4BXOA 1BMQA 4TN1A 1GT6A 3MS4A 2P9TA 4WA8A 3V8PA 4G89A 1IZYA 1EX1A 1QH8B 4MLDA 1TT5B 2O19A 1Z5PA 2YYZA 4WKOA 4YFYA 3ZQ4A 2CL7X 1PGQA 1QGED 4J1TA 4MVJP 3AONB 5CIQA 4G5HA 2JAQA 3SF8B 3OX4A 3MHPA 1JT2A 2EGHA 3TOZA 2H9IA 1PIWA 4LOAA 3V8NA 4YIHA 4AUEA 2BP7B 4QGFA 1ZNQO 3NUGA 2JDIA 4FXPA 4KR9A 1SXJA 2PG3A 4C0BA 4XD2A 3NMUF 1BOOA 4OHZA 1K28D 1XZEA 2EFYA 3KCQA 3ZGZA 1I7LA 1MAWA 2NU7A 4DIDA 5ITVA 2RGNC 2C3PA 4MEAA 4WZBE 1W52X 4MPTA 3CNLA 4Q12A 2YZ7A 1OILA 4TKVA 1DHRA 2CZGA 2YVQA 2BT4A 3GZNA 3R6LA 4LW8A 1IVSA 1F3LA 3HM2A 2W9XA 3FWPA 3NIWA 3P0FA 1C4WA 1D04A 1GG9A 4KN9S 5AKLA 3KQTA 5H83A 3A3NA 4LMPA 1V0JA 1QK3A 1S7CA 3AIMA 3PFKA 1OLOA 2BJVA 3CPWB 3A4VA 3PZBA 4L0DA 4NPCA 4BFVA 4E5KA 5IYPA 1JEDA 1XEFA 1ZCZA 4XARA 4HFMA 1V7CA 2W7TA 4XPZA 1EG2A 1Q0LA 1QWOA 2ZE6A 4DJEC 1T3ZA 1W25A 2GGSA 4BWVA 2OESA 1XZNA 1XCMA 2X5KO 3DTTA 4KQCA 5FB3A 2ZCJA 3B6IA 2LCIA 3F97A 5DYYA 1LC0A 2X5OA 4WLEA 4JJ8A 1Y0RA 1K5GA 3DC2A 3ZNPA 3AVOA 1P9LA 4ARVA 4M76B 3WZ2A 2O8DA 3DTYA 1M2VA 1R4ZA 5D84A 5JG7A 3CRQA 4KRGA 4XJXA 4X7PA 3W1VA 4BNGA 1GTL1 3GLRA 1W7AA 4B44A 4L9AA 2MINB 4UDXX 3HDHA 2CNBA 3C4QA 4H59A 4JHXA 4KMMA 1PWHA 4KZPA 3GMIA 4MV5A 3WP0A 1TW2A 5JCJD 1OAOA 4Q4LA 4BNDB 3I61A 2QX6A 4WZKA 1K66A 4WZEA 1MT3A 2BTQA 4KAAA 4ASUD 4OBBA 3D43A 1Q7TA 1SFRA 1XK7A 3GYGA 4LVOA 2I1LA 3BB4A 4BVFA 5K0JA 2PIDA 3EQ7A 1F0NA 1EVYA 1PT6A 1EK5A 1QRUA 3OLZA 4RPJA 4B6JA 4B79A 1R0CA 3NHRA 1AA6A 4ZRDA 2ADMA 1YS7A 2XGMA 5JV5A 4BO1A 1RKQA 2O7VA 2H08A 3CRW1 3WK6A 4J16C 2VNAA 1R00A 2PPLA 1VGVA 1CY7A 3QVLA 3IJRA 3N86A 3B9PA 4IFTA 1J9EA 2HKIA 4H3SA 3NOVA 4I1RA 4PQYA 4K28A 4KU4A 4QL3A 4U1RA 2XNHA 4BHTA 3LY9A 4UD6A 5E6RA 5A5FA 3T9AA 3H11A 5JATA 1JFFA 1XPUA 4FE3A 4CG1A 2ECFA 1UMBB 3N7UA 2BTOA 4JLSA 2JZNA 4F9TA 3H2IA 1XZIA 2C88A 1U99A 3QKSB 3T1QA 1QG2A 3CM0A 4Q00A 3EQ9A 1NV8A 1M34B 3K2IA 4I9UA 3IAXA 4R3NA 1N3LA 4XB2A 1B6SA 3AZPA 3I2KA 4YJ3B 2QRUA 2ZSEA 3NONA 4JEIA 3RVRA 5LP6F 1CQIA 1MLDA 5IM4A 3SZGA 4KMOA 3VMMA 1SOMA 2OFXA 1VLZA 2XCQA 6REQB 3IPAA 1YJCA 1Q84A 3PNLA 2FN7A 3HJBA 4XW2A 4GO1A 4BFWA 1OYVA 1O2DA 2OV2A 2H1WA 3DL4A 1MUUA 3G2OA 4A8PA 3LP6A 4N6GA 3UOAB 3MRVA 2PBRA 3WQQA 4KO1S 4NR0A 4Q02A 4EJ6A 5L4NA 1HOTA 4TUYB 2FRVA 1KDRA 1YI2B 1DNPA 2GF0A 3F1KA 1G20E 1XVVA 2C1EA 3KT6A 4QVKA 3UJ7A 4F06A 1NVVR 5I45A 4DIOA 1YULA 5IDYA 2XYGA 1SKMA 1AZTA 5JH7B 3MWGA 5E1OA 4Q3EA 3NB0A 4FR0A 1X15A 5IDVA 4K5QA 1V2GA 5DHQA 5KC8A 1GZSA 1MQSA 3THRA 1KWGA 1TADA 3BE5A 4WDQA 2QTWB 5B6PA 3HO6A 5IWAB 2YC4C 1RWOA 1NJGA 3BWCA 5K03A 5DBFA 3I5MA 3FZNA 3VYTB 2BR3A 1QR2A 3IOBA 2PH3A 3MCZA 3MEQA 4BJ6A 4X7DA 1PAUA 4FCTA 3TXAA 4RXMA 4X95A 2B1RA 4H60A 3KETA 3BXFA 3V6MA 1H2RS 4J0IA 3QW4B 2HEIA 3L4BA 4TLLB 1VXOA 3STXA 5J2TB 3LQ6A 1A3CA 1E7WA 1E99A 4WGGA 4QZVA 1T24A 2EBHX 1RPZA 2Y9MB 3WWDA 4C08A 4DRYA 4X63A 5IUKC 3ACCA 3KX2A 1C2YA 3BVPA 4FCCA 4GSYA 4GPZA 2I91A 2YWEA 1L1QA 5I7EA 3VDNB 1XQXA 4OKSA 4MKIA 1U3FA 1P81A 2V0NA 1J97A 3VVBA 3QVTA 4DWOA 2PS0A 1FE8A 2W6OA 3UWDA 3KJGA 1BX1A 1PN3A 1TVCA 1G4HA 4LGMA 5LFAA 3Q5GA 2IXDA 3M6AA 4URYR 3H0CA 3A8IA 5BN5B 3L8CA 3UGQA 3VSEA 4UNRA 3BG5A 1CUDA 4WK0B 3H5IA 1IN6A 1PR5A 1YV9A 2SNIE 3QFRA 3D6MA 3ZEIA 1ACJA 3P0JA 3SOZA 1EDOA 4A6EA 1KJYA 4E08A 4P4TA 5F2KA 4JUBA 1G18A 2Q50A 1APBA 1MO4A 1ZOOA 2OB2A 1XTUA 3MJRA 3JSAA 3R2JA 4DR2B 1IWBB 2X53S 1CZHA 1MCZA 2GEFA 3SE0A 4F5YA 4D82A 4W9MC 1LI5A 1W4CA 1GL3A 5LR6A 5AT1A 1SU7A 1R6UA 4YWHA 2P1DA 2OLKA 1ISFA 4RFSA 3GT0A 5FULA 3TCNA 4E4TA 4F97A 621PA 1U5AA 5AM1A 4WLOA 3FYDA 3RVMA 1GSIA 5C80A 1ZI6A 3ZVKA 2ADFA 3OFJA 4JI2B 2WBLC 5KDOA 5IFKA 4FVTA 3SNKA 3RYTC 2J4DA 3EGXB 3QU5A 3EIWA 1L7PA 4PAGA 5L95A 2XMGA 5CFLA 1G19A 4D3DA 2QD2A 4HDOB 4P98A 5DHSA 1H0RA 2ESRA 2GXSA 3ENVA 3O7MA 4LOKA 5CB8A 3GBPA 5FWDA 3SC4A 2HNKA 3E5MA 1C0IA 4V2UA 4JROA 5F7ZA 1JQKA 2ECQA 1ECLA 4QOEA 3SJAA 5LUAA 3AEQB 2H9YA 1UWVA 4AUMA 1NSYA 3QXGA 2J9YB 4D8TA 3RK4A 1UXJA 1V6AA 5F35A 2YS7A 3CO0S 4TXHA 1J00A 4ZCSA 4G0PA 1U5BB 3OZBA 3I76A 3HGQA 3PUXA 2OAP1 1YB5A 4BNWA 2VJPA 5E6TA 4L75A 4MUYA 3L6DA 4DDWA 4HC4A 4G56A 3AGQA 1DXYA 2PAFA 4WHMA 2OP0A 2VF8A 2O20A 4I19A 1OD6A 2WYHA 3AZQA 1U3UA 2XQFA 3AQ4A 4MRSA 5LU9A 4QTUB 2FEWB 1KIFA 2AA3A 4NYIR 4OFBA 3PEYA 3MMNA 2OVFA 5H70A 5DK4A 4H1WA 1NQTA 1MVNA 3GZ4A 4P3XA 4Y18A 1PE0A 5HNKA 3I4FA 1TUIA 3UWOA 1TCAA 2RB5A 2HRRA 3A1UA 1OWOA 2HSWA 1MV5A 5B6IA 2XCOA 4AU1A 4J9UE 5ULLA 2XB2A 3G82C 3O26A 3CUTA 3T4PA 2C7VA 1KEWA 4RW0A 2P8JA 3JPWA 16PKA 3DC7A 3VZPA 2FSPA 4XQGA 1HTTA 1KF0A 3RG2A 3FHTA 3OIVA 1H9BA 4M1OA 4O0MA 2FTKE 3RC3A 2D3NA 3PSAA 3M1AA 1CUCA 2B4KA 4J90A 2FQ1A 4UUAA 5J4KA 4QJ3A 5I8ZA 2TMDA 3QM1A 3C6KA 3L3BA 1YS1X 4CDNA 4EO9A 4WLUA 2Q28A 1Q0SA 3EBLA 3CCVB 4IS3A 2OXTA 2NZXA 4GWLA 1Q7CA 1B16A 4MGHA 4DJFC 2PUGA 2C31A 4BEVA 3HUDA 3M4YA 1ADYA 4X7EA 3DHNA 4IDCA 4LPSA 1XFOA 2HLDA 1A5AB 3F4LA 4OLHA 4CNBA 5CA1F 1QGDA 2NV0A 4IICA 4ND6A 2HMUA 1VFPA 1Z68A 3AIKA 4TZKA 1J06A 4I9GA 2ZZMA 3NTXA 5EQFA 2XGJA 4GLFA 3DR5A 3UXEA 2FNAA 1XE1A 3OCCA 5HMLA 1IAVA 1YMQA 4L4YA 3UJAA 4OUKX 3RK0A 4A5OA 3UUWA 4EYOA 4ABTA 1NBME 2EFGA 3QKUA 2CXSA 4RDIA 5JSZA 1X7YB 3P4UA 1B2RA 1WMBA 1YHYA 2VJMA 2EARA 2ETXA 3H5AA 4FFDA 4HDAA 3B2NA 2BELA 3KKKA 4XL9A 3U4QA 4RK1A 2GNAA 1T3TA 5A0VA 3RANA 1II8B 3IUNA 4PPFA 3ZZTA 1N5JA 3KB8A 3KOUA 2Q0HA 4LDJA 2YIDA 4M1WA 2DM6A 4D9EA 6PFKA 1K1EA 2Z9DA 4GH5A 3FW1A 4YRKA 2DPLA 1HG0A 2W2TA 2A5LA 1UK6A 1J8MF 3LUFA 3WI7A 3DF9A 5EMKA 3EF0A 4W9RA 5LB4A 2HB6A 1IVNA 4TT3A 1CYDA 1M7GA 1Z8NA 1IOLA 1JHRA 1Q91A 2OWDA 1M1XB 4NICA 3C3MA 5ADVA 1KI2A 1D2AA 2Z2JA 1P33A 1L5OA 3ZY5A 3PXBA 3R0IA 5LPNA 1L3IA 1QC5B 3PKIA 4BMVA 2Y99A 4BJ3A 1NGSA 3WNBA 4RV4A 2E82A 4MB6A 5AVJA 4BKMA 1XU7A 3D4LA 4HDSB 4FFPA 1T8UA 4D9NA 4RTKA 4B3HA 2OD9A 5IK2A 5ICCA 2ABWA 4G4SP 1V5IA 4AMBA 4IYJA 4CQLA 3TE7A 4OAOA 1LU9A 2Y3IA 3MRSA 1Q20A 1BS9A 3SI7A 4JQCA 4E2XA 3HBMA 5JPCA 4NOMA 4OJTA 5GIPE 3LSYA 5IZCC 2HV8A 1DGQA 3WLPA 2PWAA 2JBAB 2ERYA 3G2PA 1QANA 4F5DA 1GNSA 1T6ZA 1PGJA 2CZCA 3A37A 2HA2A 3TDMA 1D03A 1V9SA 4MRMB 1KR5A 1JR4A 2XPCA 5B1HA 2AN1A 4C87A 5KYNA 1KP3A 5E38A 1Y3AA 3W2TA 3F78A 3BC9A 2VF2A 5JS6A 2XB8A 2PGAA 3HU5A 1NLYA 3BORA 3A8TA 1R6BX 4O0LA 2IC5A 5KNBD 1UJCA 2WF5A 1M74A 2ZWMA 2P9CA 5H9WA 3I6QA 4J1TC 3GT3A 5J4LA 5FOWA 2DOKA 3ULKA 4LYAA 5BSYA 5EJ9A 1F2TB 3E9MA 1U2PA 4GPIB 4BRUA 2ZQZA 2CXPA 2XMQA 4JI8B 3SXPA 1QO7A 2ZG6A 1VE9A 5HDBB 4FIZA 1NR7A 4OU4A 1SQ0A 3WLAA 4QUZA 4I6EA 1PQ4A 4XM3A 1LI4A 2CYCA 4WBNB 5CW2A 2EF0A 4O4JF 2I6GA 1VE6A 4V39A 1M10A 1KEPA 5BSEA 3C8DA 1Z18A 5H3HA 1KAQA 1PCXA 2CJFA 1GCIA 1JAZA 3LGSA 3QH4A 1FS6A 4NF2A 1H8HD 2Z09A 1PZMA 3JQGB 4R98A 4YO7A 3BNWA 2B5OA 2CJXA 1SVLA 3WLIA 1CP2A 4AJ4A 1KI1A 5SYMA 3SZOA 4WCFC 1CJKC 1UPAA 5IG2A 1YJXA 5B4VA 5J58A 4JEHA 4DBVO 3WVNA 1QVWA 4BNLA 3GEGA 1VQ8B 3M8KA 1WULS 3LDFA 3PFWO 3A26A 3CPJB 3PKZA 5DM70 2AOVA 1YDEA 4ZJUA 4KH0A 3OZCA 4NU5A 1HYEA 1M90D 3D7NA 3HR7A 4A9AA 5EJ4A 3LPNA 3OCZA 4X1KA 1NRIA 3FAZA 1WUHS 3NWBA 2AG6A 2MU1A 2PMWB 2V03A 2BMDA 3P9YA 4G8JA 4L0CA 4V2IA 4EFLA 2MMCA 1OZAA 1XTZA 3QK7A 4WBSA 4AX4A 3EX7C 2R6ZA 5EIXA 1YGPA 2KWIA 1UC8A 2ZJ5A 1U2GA 3E9EA 1TF5A 3HY4A 2J7KA 5DEIA 3BCHA 1DOHA 4HH3C 2JFXA 4BKUA 2UVQA 2R5NA 4P5DA 4BIMA 3QPVA 3I6BA 5A9RA 3HZZA 4TTIA 3CIOA 5JRZA 3EYWA 1DKNA 1XQ9A 4CKXA 1GTG1 2V9PA 1O8BA 2BH9A 5HG0A 1U11A 3P0IA 3VPBA 3VR3D 4EW3A 2AT1A 4UMVA 2G4CA 3SR4A 4K87A 2WB4A 3FLAA 3NDBB 1UBNA 3IMEA 2X0EA 2XGSA 2QN6A 2ZWOA 3EC1A 3OJCA 2KHZA 3GDOA 5DNYB 1E3MA 3SY8A 2IV2X 4HWKA 4RK0A 4E6EA 2CUZA 1FF9A 5JZVA 2PKXA 5DULA 1R27A 4MWBA 3W2FA 1ISGA 2V55B 1T8YA 3FA2A 4IX9A 4RSRA 3UMJA 1XMJA 4CYMA 3QBDA 4WEOA 3RSFA 4GWKA 5LDHA 3BOSA 4N7RA 2IL1A 3ZCPA 4RF5A 1HDYA 2W48A 2YWBA 2PSJA 4S04A 5ECYA 4E4YA 1Q1GA 1F8XA 1WABA 4Y9UA 2VQ3A 3JQ8A 2NU7B 3DVLA 4O4LF 5DH9A 2G80A 4H17A 3ZV7A 1GEEA 5CVEA 3BSWA 3GP3A 4OUDA 4AMYA 4AVYA 1Z9BA 4Y7DA 3NHJA 3TEFA 4ZVKA 3CVWA 4YV0A 1DT5A 2GLUA 3HMKA 3THXA 3OZXA 2O23A 3C8HA 1JDSA 2L82A 1DB3A 2WSSA 2II6A 2X5XA 1VKHA 1PUIA 1WDMA 1YDMA 4WCFB 5AHKA 5DNWA 4LKOA 3GH1A 2A58A 5CDHA 1W4ZA 1A5SB 3FLEA 4GMXA 4QECA 2RGBA 1F6DA 5TE9A 3WOHA 1N2XA 3V7NA 3VO8A 1IEWA 3L8DA 3L40A 2ZFUA 1RXVA 1NQ5A 4G07A 1I2ZA 4KQKA 5MN6A 1XYYA 3MJEA 3KKNA 1N0VC 5EMNA 3I1FA 1JG1A 3DR3A 5IHPA 1Z0SA 3WAGA 3TIGA 2ZDQA 3DDHA 2HMAA 2OFOA 2QM3A 2I1VB 5GGXA 2R8YA 1B3RA 1EVQA 3BJMA 3FFWA 1YQEA 1VCIA 4X3PA 4OYRA 1S6YA 5A5VA 2O8DB 3SKYA 421PA 3GRFA 2ZPAA 4OGLA 1M2KA 2ENUA 1O54A 1JDVA 5AM2A 1ECGA 1S3FA 3E1GA 4CBVA 4L3VA 3OT4A 3ICOA 4NDAA 4O3FA 1YR3A 3ZWDA 5FBVB 3IHLA 1JR2A 5GGYA 4EB6A 1U8TA 4G01B 3T7TA 4IDNA 4AECA 1T5SA 1JSCA 2BTQB 4FCVA 2IELA 4KJXA 4Y30A 3HVRA 1FVFA 3BF7A 4TT8A 1GN8A 4BY9E 3PENA 3NS7A 3KDAA 3L7OA 1P0QA 2WJ6A 4IMIB 1CDEA 4IOLA 4PX5A 3K8ZA 4RL6A 4GMDA 4ZXFA 4XOTA 2IGTA 2WQ7A 2W37A 4KFTA 2DQSA 2JKVA 3ZIAD 2V5VA 2Z1DA 5LA6F 3E6AA 2EBFX 4Z4IA 2XMDA 3EGOA 1R0LA 3BH6A 3OZUA 1L5RA 3DKRA 1BWPA 2JAPA 1AS2A 2PWBA 3ASQA 2CHFA 4X62B 2EKDA 3TBFA 2CD9A 2IYTA 2TSYB 1JFFB 2G72A 3H11B 4NOJA 2IZOA 1JU3A 4V0ME 5CPFA 4E2FA 2Y1WA 4F3KA 1KXJA 2XWQA 3GJ6A 1WPCA 3D8TA 2ZWIA 1TJ5A 4OREX 2FE1A 2M98A 5FTMA 3CO5A 4G85A 1N75A 3AIIA 1HG1A 2J6CA 1CTQA 1KMCA 1FRZA 2GJ8A 2H5JA 3LWBA 1V4VA 4HRAA 4LHZA 3T3MB 3W8RA 4FNGA 1FIUA 4H1VA 4F96A 4QHYA 1B42A 1AY0A 4UDYX 1CWUA 5HIAA 3N3BC 4PZCA 1XXHA 4LTNA 3OAAD 4YA6A 3PJDA 3WB9A 1GQSA 2RHWA 4DT1A 4TQGA 2FVXA 2JAUA 1WY7A 1GYRA 1XLVA 2PLWA 3FKSA 1Y3FE 1U7HA 3N05A 2CBXA 4IXMA 4OXKA 3PE3A 1YJQA 2C7PA 5JJ5A 2WLSA 4Q3BA 5E6UB 3W5JA 5F7OA 3GGSA 2AUTA 3ZG6A 4TLDA 2CXUA 3BREA 4NH4A 2EOAA 4YGYA 2D13A 1WE2A 3I5UA 5SICE 1KE1A 5BNZA 2B82A 2W2XA 4I3GA 3UXHA 2VXYA 2XCIA 1K3FA 1NUQA 1Z17A 1SZDA 3HA3A 1HKHA 2HRBA 3HE3A 1M54A 4IZHA 2PS1A 4QQRA 5AJUA 2JH3A 3U1TA 1DEOA 1T91A 2JFPA 3QHQA 1QG0A 4NJEB 5HPYB 2P91A 3CLHA 3FROA 3AVTA 4G84A 1KP2A 1VG8A 4HHEA 2Y77A 4ZALA 1P9NA 4L22A 4IXNA 4BU0A 4ZMBA 1T36B 1PBTA 2CLIB 2FPGA 1U8FO 1X8KA 2Q0QA 3SQNA 2RKBA 3CLTC 2VHEA 2VQ6A 4IDGA 1M6VB 4RZSA 1ZVKA 1EVEA 5FEMA 2O2JA 2YIVX 1E1KA 3M3HA 4UUNA 1ZMOA 2EIXA 3E27A 4DMLA 1JHMA 3PHGA 2APJA 2D1QA 3C6YA 4UDNA 3F6RA 1MG0A 3VISA 2XA9A 4QTTB 4PZAA 5C34B 5JY1A 4OY3A 3B9RA 1XDZA 3QPUA 3PJRA 1ZJ5A 4ZYUA 1ENOA 3HJHA 1MF7A 3H1EA 4UBOA 1QMGA 1KU6A 4RV9A 3SFVA 5FWAA 3H4MA 3AV3A 4G36A 3IKMB 2RGEA 4BJ5A 5KU1A 4C0WA 1H5NA 5IAKA 1IIBA 1PWEA 3EVTA 1RM0A 2O59A 1IJKA 1KK1A 3WIDA 2J6HA 3HAGA 3CRZA 1E2JA 1Z2NX 2VWQA 4RMHA 5AR1A 2EC5A 1D0VA 4I5GA 4Z4FA 3N0VA 3WNVA 1P61B 4PYRA 1XTQA 4QATA 1YBHA 3ZUGA 1P75A 3KVVA 4LRSB 2ZAMA 4NPAA 4DADA 2HC9A 1IYZA 2FUG6 2ZEJA 1Q7RA 1HZJA 2Z9CA 4PRKA 4R2MA 1TO2E 2A1UB 2ERCA 2R6R1 1V8DA 3AYZB 4FQ7A 2FPKA 1U3DA 3U62A 4EM6A 1KQFA 3NAGA 2ZRBA 1JQBA 3UPUA 5EPOA 2BSAA 3TW0A 3Q87B 1UPBA 3SHVA 5A02A 3QU7A 4WTOA 2F3RA 3QRWA 3JVDA 3Q5DA 2XTNA 4RFSB 3ECAA 3S0JA 1ORTA 2M2IA 2OQRA 3I01M 3MPUA 1V26A 1RWKA 4K1LA 4YASA 5SZIA 3K6RA 4LXQA 4LWOA 4C7KA 5H9VA 1T9HA 3O92A 1DC6A 3Q3VA 5T4BA 2CXNA 3LA6A 4XIJA 4R3UC 1XCLA 5LD2C 3QEAZ 1C1DA 5CDFA 5IDXA 4J91A 5HIMA 1KJ8A 1N1GA 1O6ZA 1S96A 3ZPNA 2Q6TA 2XTAA 3ACDA 3DE0X 3K1AA 4NU8X 3PGLA 3K30A 4X84A 1E2LA 1WHTB 2EKLA 3KOOA 1ZAKA 1GPUA 4HGYA 2ZIUB 5DCWA 3TI7A 1TRKA 3IPLA 2WWRA 1RM4A 1H2ZA 1YCHA 3CSSA 1AUXA 1TCVA 3OC6A 3SX0A 1CS4C 4LCEA 5JJCA 1X87A 2CNKA 1XCGB 2E9SA 3PFCA 5DVZA 3ZQUA 4A4DA 2D3LA 3GLFB 2VCYA 2BMVA 1QCCA 3THWA 3KSBC 1MKYA 3LO8A 4WJLA 3PA8A 4MINA 1RZRA 1BQ4A 2EYUA 2I22A 5G1OA 2H1FA 4DMHA 2FDCA 1B6GA 4ZJYA 4S2EA 3KFXA 1GGHA 1ICEA 3CXUA 3PQ2A 4B82A 3T52A 2ZITA 1ZONA 3H4IA 4BB6A 1O9GA 4K6HA 2VZEA 3EAQA 5AP9A 3UMRA 5ALHA 2ZSBA 3Q98A 4FUTA 3TNLA 4ZEMA 1SCUA 2YQZA 5ILOA 1WQ3A 1GILA 2IYZA 4LOHA 4DDVA 2FMXA 1E6UA 2C95A 4YUZA 5FA6A 1VCNA 3MOIA 1MN6A 2FSVA 4JENA 4N01A 4XVUA 3STWA 5AW9A 1QIGA 5JSYA 4P5EA 1OFTA 2WAMA 5TGTA 2ZTLA 3P4XA 3PB3A 2Y8EA 3IIKA 4EB8A 1EJ6A 2IHVA 3VZRA 4F5ZA 5CJPA 1GL7A 5BOSB 2RHCA 3DP7A 2WUDA 1VLMA 2P69A 3QNMA 1ORHA 1T0HB 1UMCA 4Y6PA 4C4OA 2G08A 4MA4A 4MGZR 5A7FA 3MLBA 2WIBA 3PX3A 5JVDA 2ZJYA 2BW0A 3QENA 5KTRA 1DJMA 2O3QA 3ZWVA 3NP7A 3V7UA 1IWOA 1Z26A 5AUOB 2J3KA 3DCJA 3ZZNA 5EQJB 2NYRA 1EJ2A 2WKPA 4FLFA 1ZCFA 3JVIA 3OE7D 3TJZA 4BTEA 2NV2B 4X65B 4E5VA 1PUXA 3HM9A 1VQLB 4NK4A 4QEKA 4XWAA 4D4GA 3NX4A 3WK4A 3RU7A 3OPMA 1H2EA 4WXRA 2VSOA 2J87A 4DREA 4IVRA 4WADA 3K3PA 1T9DA 3UMSA 2YY6A 1QOZA 3DKKA 3EE6A 3E03A 4R1PA 4K9RA 2NQTA 2H2GA 4B8YA 4BAGA 2Z3WA 2WWIA 3DVSX 4LTMA 5LD2B 2LDBA 1FK8A 1OV6A 1RFGE 5F4BA 1U2QA