1NRKA

Ygfz protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
325
structure length
325
Chain Sequence
MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YgfZ protein from Escherichia coli suggests a folate-dependent regulatory role in one-carbon metabolism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords YGFZ Protein
total genus 68
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1nrkA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1nrkA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nrkA01
3GSIA 3A8KA 3A8JA 1WOSA 1WOPA 5L46A 1VLYA 1V5VA 4PABA 1WORA 1PJ7A 3A8IA 1WSRA 1VLOA 3GIRA 1YX2A 1WOOA 1NRKA 4P9SA 1PJ6A 1PJ5A 1WSVA 4PAAA
chains in the Genus database with same CATH superfamily
5I3UB 1RHMB 2E1BA 1RHKB 2FGCA 2C3OA 3KNGA 2GZOA 3ISND 5FLXY 4NXNJ 4DN9A 1WNEA 3DRXA 2HVZA 4ZHRA 5CQGA 4MKAA 1L3TA 4OX9J 4MAKA 2XI2A 3H42A 2A2CA 5ETMA 1RBOB 2WK4A 2ADBA 5E3RA 4H9GA 3NAIA 3LQ6A 1HKAA 1VK8A 5KFXA 1NKCA 3L7UA 3WIVA 3IP0A 3MHPA 4IW3B 2H4WB 4NA2A 3AHPA 1KQKA 1S1XA 5T7LA 3QGPA 1SJRA 5D77A 4CLTA 1ZM2A 1EKRA 4K4UA 2EWHA 3DXBA 1XB2A 4K50A 1Y00A 2V7UA 3EGVA 4P3IA 2J7WA 1YZ7A 2A10A 2QL5B 4YY3F 3SCJE 1U1KA 3T1HF 1VQ4B 4M8LA 1H0HB 2IM3A 1FRIA 2MZQA 3J80U 1AXQA 4RDJA 4NE9C 4KY3A 3FK4A 2J7UA 2PGCA 1S1VA 2VFVA 2Z58B 4RW9B 4EFAC 2OI2A 1XIQA 1YIJS 4FZVA 1XJWB 1UD8A 3MDFA 4DUZF 4RUHA 1IKXA 1OYDA 4UOCA 2JJ1A 3M8SA 1WOPA 1YG0A 1CJKB 2JVOA 3P96A 4F4KA 3R2DJ 1X31C 4O3SA 1IKYB 2HGMA 3LVBA 3E01A 4LQ3A 1REVA 1FEHA 3CT9A 2CVEA 2YKNA 4DX7A 3OHAA 4TU8A 3QT5A 2OTLS 4O23A 1SUQA 3GJQB 1EETA 3GB0A 5J1PA 1PC5A 3BH6B 2VPXB 4I67A 3JSBA 2FJDB 3MM6B 3L3CA 2W7AA 4DL5A 2B9XA 1YVFA 1TKZB 5DM7Q 4PG8A 3OJSA 4AVZA 3VNUA 1FDAA 3EX7B 2UUWA 2XS2A 1SKUB 3LAMA 1D0EA 3MEDB 2OBRA 4B43A 4TKTA 3MM7A 2VQFJ 3L09A 1IN0A 5ETKA 3Q23A 3BKFA 4ED3A 1LWCB 1PJ6A 1N05A 3AB2B 4I4BA 3ILLA 3RTVA 3G82A 4RX6A 4TN1A 1RKIA 1S0UA 1WG5A 4KHMA 2GQFA 3PG9A 5HBMB 3W65A 1KS2A 5JMNA 4J37A 4XLHA 2FY1A 4RL1A 3OPOA 1EP2B 2E9ZA 2XNCA 4WZKA 5E3QA 5KFWA 2DGXA 3BGUA 5D8HB 4XOPA 1G7CA 2FZGB 5GADU 1K9MT 1RSCA 4OYPA 2HHHJ 2FVSA 4Q7JB 1LWEA 3B8HA 4PXDA 5CCLA 1NPPA 4U8YA 3IG1B 4YN3B 1HBUA 1Q95G 2HNYA 4YR2A 1EZZB 1NSQA 2FX3A 1LWFA 4O3NA 2AHOA 3MFIA 3K0JA 4XORA 1UMJA 3GR0A 2HDNB 2FVRA 3AVUA 3BREA 2IA6A 1WEZA 2I1LA 3FFIB 2EFVA 1T95A 1IQTA 2CWKA 4CT9A 3W5VA 4QW9A 4AQYF 1TK8A 4RW4A 2F1MA 1URRA 4IRKA 5CYQA 3R9LA 3HT0A 1JLAB 1R0AB 3DLBA 2VBXA 3O2IA 3KUHA 1IJEB 4DQIA 3OW2R 4AF7A 1RU2A 1W2IA 2G9OA 2ROGA 4NCNA 3W9IA 4KQZA 4B3TJ 1TUIA 1CJVA 3SXLA 2XG8A 3BSOA 1Q16B 1HI0P 2XLKA 4NX9A 1LK5A 5HROB 4OOSA 1FTRA 1D8ZA 3N79A 4RKUC 2PLFA 4P10A 1QVGR 4B3XA 5A89A 2BQUA 4ECVA 2HBYB 4EK2A 3CMAB 2KJWA 3UNGC 2CG8A 2BUNA 1AMOA 4MKYA 4X4VA 5HQ8A 2ZE2A 2F8HA 1S99A 3FZBA 2VODA 1R7IA 1XN9A 4M0LA 3C2PA 2UXCJ 4AL5A 1PIEA 1HQEB 4IG3A 3J7ZT 1K44A 1AUDA 4CM0A 1NK4A 4ANDA 4I2QA 1TAQA 4MJKA 1LNQA 2H1YA 3A1YG 2QG9B 2WONA 4FPRA 1QUFA 2M4MA 1MRZA 1H38A 5I42A 4B3OA 3HD2A 1FRXA 1S6UA 4C8LA 2CZ9A 2AGOA 1UEVA 1RYRA 3T1YJ 2CC2A 1VGYA 2GJRA 1HQEA 4IG3B 4HYKA 2UV8G 3GSDA 4YB7A 1R31A 1UAWA 2VJIA 5AXKA 4KHRA 4ZVTB 1RAGB 2DGQA 1XNQF 3TUJC 3U6KA 2DEIA 5J2QA 3PTWA 1CQNA 2RIJA 1ZM9A 1S9GA 2PT0A 4FXUA 1IBKJ 3TA1A 4B4DA 3DDKA 1VBYA 4LF7J 2OFGX 3BY1A 3DC2A 1N0UA 5CYQB 4KO0A 4YHBA 1UTAA 4CNZA 4C2MA 5KG6A 2VDHA 2VYQA 2GJKA 3Q8PB 3GYXB 4C0BA 4ED2A 3I55B 5C5JA 3UCGA 4WYLA 4DV7J 1CC8A 2C3MA 4BPRA 2LA6A 1H2VZ 3DLEB 2BJDA 3KLFA 1WHXA 2BV3A 2B5OA 5LSLA 3A4TA 1L3KA 1TLLA 3A8EA 3E3XA 1HBOB 3H94A 5C42A 1U2RA 3CO0P 1BWVA 2CK3A 4A8FA 2N7YA 1U4BA 2KFYA 1RAEB 3PUNA 3CGIA 8AT1B 1UVMA 2CNDA 1P1LA 2IY5B 1VQMB 2XNJA 2V9WA 2YVSA 2HRUA 1KEKA 3O6QA 1VIXA 3LO3A 5H1SV 2H5JB 4QV2A 3G82B 5IM0B 1BLUA 2I5JB 2DHGA 3Q89A 4YAFA 4TLQA 5E6TA 4YOEA 1DFDA 4J90A 3R5AA 2FVQA 2ZOMA 5J2PA 7FDRA 3UDLA 2E29A 4WP8A 1VHOA 4ZP8A 2R2UA 3OD2A 2RUGA 3OL6A 1TKZA 2SXLA 4ZPVR 3WIUA 3MPUB 1RT6B 3EJMA 4M5GA 4F04B 5B0GA 2Z30B 2KFNA 4LF8J 1RT7B 1JLFA 2E66A 2XMTA 4UF4A 2OTJS 1SL0A 3CWJA 1WP6A 5HATA 4M5HA 3ULHA 2V6AA 5IT9U 4B44A 4DX6A 3KYLA 4NASA 4WK1A 1RK8A 5L9XA 3IWLA 4IYQA 1GT8A 2QE5A 1SL2A 1P6TA 5THXA 3EE3A 2ZZMA 3M6WA 2WOMB 3RB0A 1VJWA 3OLAA 2HCJB 5H9FK 1S1TA 5C25A 1XC9A 4W90B 5CZVA 2AJ0A 4YHHF 3J81j 2B56A 3W61A 2QC3A 2E1MC 2IFXA 2F3JA 2JOQA 2MZSA 1UPPA 3TP2A 2Q1LA 2B3TB 4CLPA 5THWA 1GMWD 2ALZA 1Q9SA 4OLPA 1OB2A 2Z2MA 1BQMB 3MM5A 3VTIA 5EWEA 1U6ZA 3GONA 5IZHA 2V7XA 4DF4A 2WHOA 4D3HA 5K8MA 4KGVB 1BWEA 3JU4A 2W4CA 1BJKA 3R6LB 2DHHA 2AMCB 4JI8J 5BR8F 4RW4B 3OKXA 1RTIA 2E44A 2HMIB 3HO1A 3GCWP 1FT8A 3PHTA 3W7BA 2CPEA 1H98A 3QFHA 3FFIA 5DGBA 2UXCF 1KTVA 4FPIA 3VWSA 1TFYA 4X7DA 5L46A 4WU3A 2ZH5A 3PW7A 4KJIA 4USKA 3H5SA 1YGYA 2V2KA 3KLFB 3G8QA 4P2SA 3TAMB 2L48A 4OL8A 2HZCA 3OTOJ 3CMMA 3M1VB 2MB0B 1LWEB 1J27A 5KG1A 3S01A 3WZ0A 3D0IE 3BN7A 4W92B 1GAQA 4ZPTR 4GVBB 3GYGA 1VC5A 2JDIA 4QWAA 1QVFB 1VFJA 2MSSA 4JI5J 3CB4A 2VFRA 1WEYA 3S7RA 2C5BA 1Q7LB 4CP5A 2FJEB 1YKWA 4K4TA 5KAKA 4FF4A 2W7OA 3AOCA 4IRDA 5A2QU 1W2BB 4DV1J 4M63A 4ENOA 1SXLA 4DV1F 3GFHA 3Q24A 4C8KA 1LWCA 1WC6A 4Z4VA 5GMDA 1RAFB 3W2WB 3QRRA 3HVAA 1JLBA 3OR2A 4HVZA 2B7CA 1JX4A 4W98A 4RW7A 4LVNP 2FJAB 2DNQA 3DI6A 3D28A 5J2QB 1IKWA 3CCVS 1YWXA 1X4GA 1W7WA 1FWKA 2JLEA 1Q8BA 1NK6A 3QO9B 1EX8A 2MQNA 2XZLA 4U6PA 1C4CA 2B0GA 2F8EX 2JFDA 5FD1A 3OR1B 3RRHA 3FPPA 1MN7A 3MAAB 4X4RA 2CADA 1OO0B 1T03B 3AAWB 2NXJA 4B3OB 2ZH7A 2RQMA 1RT5B 3NGUA 1QAYA 4DZDA 3BM7A 1RUSA 2KT2A 4G3IA 2MHEA 3K89A 2DNPA 1VR6A 2OPPB 3M8PB 1HNZJ 3BQJA 4DPUA 4F3OA 1BPLA 4WFNQ 1U0SA 3VF0B 2E7XA 4Y34A 3B54A 2GHWA 1NAQA 3Q6QA 3OSPA 2EFOA 5E2QA 4E2FB 2BRLA 3RR7A 4OJGA 2W8KA 4NBSA 4KE5A 1JJ2B 3MAHA 3HSGA 3CJTA 3CJ0A 5IK2A 3MCMA 4ZCLA 1KZLA 1C0TB 2CBXA 1NHKL 2MLXA 1S1XB 5T7LB 2HVHA 1VQYA 3SMZA 5D78A 2KVIA 2CZ4A 4KKTA 2F65A 2ZH9A 1H7XA 5KFAA 4IKAA 4NXNF 2G1HA 4LBIA 2Y1JA 4J9VA 2W4PA 3SCIE 1N0VC 1HIYA 2X3UA 1JXEA 2A6OA 3DYAB 1DARA 4L76A 1XBWA 3FRYA 5G0RA 1KMHA 3DU6A 2VNJA 2ASDA 1HA1A 2PC6A 2VKRA 4RW8B 3MUTP 4RBTA 3D67A 1SC3B 4RNHA 4ROXA 1FESA 4BHQA 3TI0A 5CYJA 2V4JA 1EFRA 4C8ZA 1T3NA 2J0QD 2RH3A 2Q66A 3RAQA 2WB1D 3KK3A 1UMKA 2Y1RI 2R7OA 4P72A 3VR1A 2Q6KA 3KHRA 3FKSA 2Z4PA 3MMAB 3D54A 3TUPA 5C2CA 4DFMA 2OSQA 4JI8F 3BDEA 3IR5B 3G6ES 1XEZA 1FVSA 1PG5B 4O44A 2YX4A 3L95X 4JV5J 3H2LA 3LA0A 3TZYA 4OYIA 3MOJB 4M5IA 4EZ6A 1HNVB 2N3LA 1I1GA 3PA1A 2V67A 4UQTA 4OQJA 2W2QP 2XSJB 2CQ3A 5AN9A 3KLHB 3HDSA 2D3OR 3ZZRA 1OMSA 4M5KA 1WEXA 3CJSA 2M5YA 3I5CA 1UWBA 1PCAA 1VQ6B 1T9TA 5CCMA 4R5PB 2XMJA 2VC0A 4X65J 3DMJB 1RB0A 3OSNA 2B5JA 3M32A 1RT3B 4X4PA 2IBOA 1OY8A 2GGPA 1IWAA 1REGX 2L9WA 1JKHA 3BBFA 3IMQJ 3IR6B 4ZJOA 5DQGA 1QTMA 1VOMA 3GP9A 2NPFA 3PV8A 1W0KA 3OBIA 1H6KX 3MR7A 2E5LF 1EFUA 2HNDA 2V8PA 2DH8A 1FXDA 1S1UB 4ED0A 2DGWA 5HZBA 4LBPA 3BBBA 4B9LA 3SFUA 5FIIA 4DFPA 2RDIA 3E20A 2JC0A 1KK1A 5KG2A 3I55S 1M0SA 1JLQB 4WIIA 4DSLA 4ELVA 4JI3F 3L9ZA 3M8QB 3G96A 2MQ8A 2DD8S 2RS2A 1ZAVA 1NJWA 2W2OP 1KQFB 3M6XA 4Z4WA 4LR9A 2ZC3A 2K3KA 5D4LA 2RC6A 2O1PA 2ATCB 1BMFA 4OJ3A 2AJ4A 2YX1A 2XGQA 4N3GA 3PJXA 1VBXA 1B99A 3EM1A 4AL7A 2GV1A 4DNTB 4K4WA 3JTOA 5J1EA 2EG2A 3EPIA 2VBWA 5J1EB 1V9OA 3R6GB 2D74B 1HL6A 3OTBA 1WSRA 3SI8A 3R5CA 3UDVA 3QSYB 3CD6B 1HQ2A 3NRBA 2CPDA 1OJ4A 4RPFA 5HVFA 1VQPS 2GVZB 1WC3A 2BACA 2YX7A 3N5FA 1N32J 1FX4A 3PR4A 2HS4A 3ZBTA 2XB2D 3ENAA 3H4DA 4HKQA 3SJPA 4NCAA 2KT3A 4QU7A 1DJ0A 4ES1A 1MG7A 4USWA 4DU8A 3TANA 1ZA1B 4EZ9A 4DLGA 4IG0A 2C42A 4JI1J 3AH6A 4TSFA 3CC2S 2W2MP 3BBCA 3J81k 3JQQA 3Q22A 3Q8SB 2IDEA 3LGNA 4OI4A 1HA3A 2U1AA 3LQVA 1X4FA 2QFIA 4PZVA 1TFWA 4F4WA 4X62J 2VIHA 4OI6A 4ANEA 1N54B 1ZH5A 4K4SA 1HFEL 2VOOA 5AE1A 2XMKA 3C14A 1WG4A 1RT3A 3F0NA 4ES2A 2H3EB 3E51A 2XCPA 1WC5A 2ZZGA 5EMNA 1QH0A 1DTQA 2IYIA 4ZVGA 1V3RA 2XS5A 4BC9A 3J81U 3EZ5A 1D3WA 2DH7A 5D0HA 4NCGB 4CLFA 2DNYA 4M5NA 3R6KA 1N4LA 1PYOB 2MY7A 1YHQB 2RJZA 1D1NA 3EWGA 4Q44A 1S59A 3ZC3A 1GK8A 5DN6A 2GHPA 2R7VA 2MKSA 3C14B 1N8RD 2YWFA 5IQ6A 2I2YA 1DTTB 2V94A 3GVJA 5D4OA 3M8ZA 1WKKA 5K9FA 4NLDA 1OGIA 1RADB 4B47A 5JVGQ 4RPDA 2MKHA 4ZLLA 4ED1A 3CJ2A 3E01B 3CE8A 3VQTA 5A8AA 1VI7A 5A8KA 1HWLA 1JNRB 5F4OA 4ZPAA 3MMJA 5GMEA 3A8KA 1FE4A 1ZS6A 1Q78A 5E0OA 2GNKA 2BMBA 2VQEJ 4Q0BA 1KOOA 2RD5C 1YBUA 2QA4S 5ETOA 1XMOJ 3WY9A 5J35A 1YJWS 4XN3A 4A8XA 3R5DA 1B23P 1RTHA 4DL7A 2HFOA 1QUEA 2DXEA 1LKZA 1UEUA 6FDRA 2R7RA 2GIFA 4DOZA 2IC3B 3CMES 3RB4A 4P26A 3SQGA 4JV5F 2OK7A 4FXWA 2VASA 4ZA1A 2VC1A 3RB6A 3ZPNA 1JLEB 4ZLPA 1NKBA 1AYEA 2B4UA 3MF5A 2JEJA 4C8NA 4PPDA 1EP1B 4C0SA 2CQPA 1XE1A 2VPWB 2YQ1A 1OGJA 5IYWA 4G5GA 2CQ1A 2U2FA 1IQZA 4DUTA 4BWJA 4RM0A 4PGOA 3DU5A 3C6UB 3POTB 2W7PA 1U26A 1BHNA 1AW0A 1W0JA 1FNMA 2MZTA 1Q86T 3SEOA 4P1VA 2V2VA 3BZQA 1NZAA 5EX3A 3CCJB 2J8SA 5KNLA 3DLGB 1Z2ZA 2NLWA 3AVVA 2DY1A 4N7TA 2V8DA 4NEZA 2MZRA 1N33J 3CPXA 2DCLA 1VQ6S 1MU2A 1LV5A 1B0VA 1MLAA 4X07A 2WW4A 5EWFA 3HT3A 1Q0NA 3HSDA 4WP3A 3W5HA 4LF8F 4NL5A 4R0JA 1JJ4A 4QBUA 3DM2A 1U45A 1OIAA 2FLPA 2YWEA 1B0TA 2RRBA 2YNHB 4XKWA 1IBMJ 4CO5A 4EO6A 1RT5A 3NMAA 3OHBA 3SKBA 1ZYQA 3UDCA 2HK3A 2KH9A 4P6QA 2PIIA 2P5VA 4PAAA 5FJ4A 1LEOA 1NDCA 1YQHA 3Q39A 3W2IA 5KFQA 4TVAB 2M9KA 5GAEI 2EPIA 4WK3A 4DR1J 3A35A 3SZ2A 3ITHB 3KOAA 4JI0F 2HZVA 1TKTB 5KFIA 2HQGA 2GW8A 1J9ZA 3DMJA 4Z4ZA 1VDHA 4LVOP 1KBRA 1LW2A 1PBUA 1YBAA 1S4EA 2DNLA 4B9VA 4URSA 1CLFA 1R0BG 4CLLA 1H7WA 5A0YA 4QPXA 4LF2A 1T9WA 5A0YB 2XC9A 2PD1A 1YHQS 2HMAA 3D68A 2UV8A 2PFFB 2RDJA 2KVOA 3QWUA 3W66A 2JC1A 3FMWA 5LSOA 2HK2A 1NDLA 4B48A 2VZLA 4ZLNA 3AJDA 1MWYA 3LQEA 1K9MD 4DL2A 4O44B 3PVXA 4F4ZA 3OFFA 1ZOTA 1RT4B 3L4BC 4FYWB 3BDPA 1S72S 2HWTA 4X7FA 4H4OB 1PKUA 2RKIB 1LQ9A 2PA3A 3MMAA 4LC0A 4DV2F 4ZV4A 4O3OA 2DTJA 2NSCA 1E79A 1SH3A 5B08A 4FYYB 3U1NA 2YNHA 2V4QA 3HZGA 2QYGA 3BCDA 3TAPA 2KM8B 2C5HA 2R4FA 1PYSB 2ZZTA 1FRLA 1N32F 4I2PA 2R9VA 2YNFB 5IYQA 4JMQA 3EUNA 2RF2A 2WZ1A 3AOBA 1WTHD 3Q8UA 3V7AA 4Z1MA 2C2OB 2ZL7A 3C3LA 3P6YC 3LP1A 2EI5A 2HMIA 2J9EA 3ZZTA 1ZPWX 3MTKA 2OSRA 1R6YA 5DRKA 1ZM4A 1M1GA 2IYGA 4TMVA 4QIEA 4ZVRB 4DV6J 2MKCA 5EGYA 3QZ8A 4CH0S 4MK8A 1DAXA 3GR1A 4D3GA 2XWXA 1FRMA 1R8PA 3I87A 4LRAA 5IYRA 5DETA 2YPYA 2QSWA 3CF5Q 1C0UB 1EFCA 2E5HA 3PYDA 4JOUA 3UCUP 5DS0A 3GIIA 1S7IA 4WZLA 2GQCA 1QGAA 3CCVB 4OZ1A 2IM2A 2QA4G 3HZEA 1GFWB 4MYUA 4OI0A 1IM6A 1YLOA 3NBPA 3HKZD 2WCXA 4F36A 2VJJA 2DVIA 1X4BA 2DGOA 3OW2B 3QFTA 3CMAS 4ELUA 2IRXA 3NXZA 2QN6A 1UZHA 1FVQA 3BSAA 4XONA 2QEXS 4Q0BB 3TYTA 4ED4A 3A3PB 3TZZA 1F5CA 2BQRA 1F6TA 4YB5A 3KG4A 3ZFVA 1Y10A 2J6TA 4L73A 4PC3A 4A47A 4PC7A 1HQUA 2KZZA 2M7SA 1YJRA 3ETOA 4I64A 4U7UK 4ACAA 4UY8T 3ZZPA 2RHSB 2XY7A 2HG4A 3HHKA 4P22A 1S0VA 2Z2YB 2AEJA 3QE2A 3QGHA 3C19A 2E5JA 2Q6LA 4PPZA 1GEHA 2YKOA 4TQSA 1S79A 1I8DA 1H74A 1VCTA 5ETPA 3WQZA 2OPRB 2F1FA 3NCRA 3PJ9A 4XDDA 1O5JA 1U47A 1S6QB 2EXUA 3SSRA 2BJ3A 2Z6BD 3BYPA 2MLYA 3GIKA 2UU9F 1LK7A 2CWXA 1IUJA 2X3DA 1KJZA 3ONQA 4B9MA 4U8VA 1VBZA 1JWWA 1EQMA 3NMRA 2HFZA 5LT5A 4ILLA 4RCZA 3ZBUA 3VAMA 2PA8D 3KK2A 1EP4B 3H40A 4ETZA 2CNKB 4DK1A 3KLIA 3MR5A 1R5NA 2HHPA 3QYYA 1MMNA 5KFGA 2Q6CA 4CH1A 5F9LA 2JFKA 5DS7A 3UR0A 3GIJA 1SIZA 1T3OA 4UY85 1K8AD 2VFTA 4LT6A 3DRPA 4O4GA 1FFGB 4UOFA 1BUXA 3I4PA 5K14A 2WSSA 2MLZA 2FJXA 1OYEA 3TJAA 2VNKA 1NCLA 3NNHA 2VB6A 2LEAA 1FNCA 3KK3B 4XK8C 3THPA 1YITB 2KKHA 1RA6A 3CC7S 2WR8A 2BXJA 4AT1B 3VGSA 2LXUA 4XM3A 2Q79A 1BY9A 1K8AT 3SJZA 4C3LA 4Y6IA 1K1QA 1QAXA 2V68A 1OPIA 6AT1B 2R2SA 1I6JA 2RS8A 3OUYB 4FKYA 1QE1A 3D6FB 2KN4A 1S49A 1I7PA 3I0SB 3F73A 3W1YC 2RE1A 4DX8H 1SKRA 4FK8A 3NAHA 4LF4F 2O66A 1QD1A 1HWJA 4UT4A 2F4NA 1FJ7A 4E0FA 2B6AB 1V0FA 1P4MA 2MDAA 4YFUA 3MZIA 5L1IA 1COWA 3ZXWA 2HGLA 3CCLB 4EI2A 3CCWA 3FSXA 4Y2KA 1YJTA 4YDXA 4CLKA 3C15A 1GVHA 4N76A 1QLNA 1VISA 3RAMA 3CDBA 3O8WA 2PFDA 4OI1A 3FQLA 3FSYA 4KR0B 2GMJA 3MEEA 4HACB 2XGPA 2P8IA 3CESA 2HQCA 1IBLJ 2DO0A 3WQPA 4RR5A 3P3DA 3H5UA 3K8VA 2GS8A 2UUCF 4HIZA 2H4YB 2YKAA 2P9CA 2K7JA 4CDIA 3PX6A 5D15A 3GU0A 1VRTB 2E9RX 2FJWA 5KT7A 2R2TA 3OFHA 4B9TA 1B7FA 2DCUA 2UVVA 1GH8A 5GADI 2VNIA 1X5TA 3G05A 4USVA 1QFJA 2Z0GA 3R5JB 3MPDA 2HFVA 5H9EK 1LOUA 3GV7B 1W34A 2L3MA 3NWRA 4C8YA 3IAS9 1SQFA 2BOAA 3QJLA 4HACA 3DOMA 2X3GA 3EVOA 5J2MA 1RBLA 5GAEU 4LSZB 2BVNA 2B51A 4HE5A 2E1RA 3OFEA 1AZSA 3TJ9A 2VOPA 1D8TA 3W5UA 2HLDA 3IFEA 3NGDA 2DPIA 2UUAJ 2I1RA 1U7LA 2NYIA 2ZD1A 2GO8A 2OP5A 2AWZA 4NMXA 3T19A 1M1HA 1H85A 2CQ0A 4OI2A 1N88A 3JQKA 2LDYA 3MM9A 1P9QC 3D5MA 3M2RA 4K2JA 4NZ6A 2WSCC 3BGLA 3DGPA 3UQSA 4OZLA 1TVRA 4C8MA 2C77A 4Z4TA 3AA8A 3CVKA 4AQYJ 4RNFA 3W8PA 4JP8A 1KNZA 1V6HA 1K1SA 3HSZA 5KFOA 1FRNA 5FO1A 2QMUB 2X1GA 3DDIA 3K59A 2VFSA 3IS9A 2AHOB 3W62A 2POKA 1LWFB 2KT5A 1RBAA 3MURP 1NB2A 1XMQJ 1Q81T 4Y00A 1UD3A 4CLUA 2HHQA 4DR2F 2JNJA 2DOGA 2HIYA 1T7PA 2D69A 2Q6IA 1S4FA 3JSYA 4P3YA 1DZ5A 2EEYA 2I9SA 1R27B 2DGVA 2DETA 5AXLA 3W2HA 2DR7A 1K0TA 4K4VA 1IVZA 2AW0A 5DDPC 1WSVA 1G4CA 5KFKA 3HPOA 4IH6A 3N4WA 2W9CB 1UVIA 2GJ2A 1EB0A 3CMEB 3H59A 3ET6B 4DR5J 3KLIB 1UJ5A 4WYWA 4GC6A 3LF0A 3MM9B 1BQNB 2XO7A 3KK2B 1YK9A 3R5BA 5CDFA 3QIPA 5HP1B 5A8WA 1AFJA 3HMJG 2MHNA 4ED7A 3CRZA 2G0IA 5TR9A 4FVMA 3N6MA 4OJHA 1NJXA 3ILOA 3BPSP 2DHAA 3HHEA 2CPYA 1GXLA 2HSEB 4QUZA 4WTYA 1MWQA 4AC9A 1U6BA 3G8SA 1X0PA 4WWSA 3IRXA 2KM8C 2BKNA 1SUQB 1X4CA 2C4TA 3JQRA 3DHWC 4DS4A 2OPPA 2D3ZA 1QSYA 2LLZA 3ISXA 2ZWOA 4OZ2A 5C25B 3H0PA 2R42A 5CD4H 4KFBA 5TY0A 1HQUB 4XLEA 2OPQB 2DR8A 4X4TA 2OPQA 2VFUA 3BEGB 4LFAJ 2OAUA 1L5UA 1F3FA 1QX4A 4L74A 3PFEA 2GQQA 4KKOB 2OEMA 4DN0A 4ZP7A 4LIRA 5J2NB 4LFCJ 3A8JA 2ZE2B 5KFPA 4LJMA 1R0CB 2Q6BA 3AOAA 3EYZA 2FYXA 4OLOA 2R8IA 3BO2A 2W9BB 1S48A 1HNWF 1SL1A 4RD3A 1JLGB 2KO1A 2XMWA 3K7RA 1G6BA 2BANB 2CJKA 2WTFA 4DUYF 1LFPA 1N6QA 5F8JA 3MMBA 2IVYA 1VQPB 3FEYB 3OOCA 2AQ4A 1F9FA 1R0AA 3CTRA 4P25A 5KFZA 4HHJA 5F8GA 1TKXB 4F67A 1JIHA 1T9XA 2V4DA 4RZRA 2I38A 2XMMA 5KFVA 3IGNA 1IBCB 4C11B 4UZCA 2RF2B 1WPCA 3U1LA 3DNCA 4XPEA 4RPBA 3LOUA 3TAMA 2DGUA 3Q83A 1MMDA 1N5SA 3IG1A 4N41A 4LFAF 5A8RB 3SLNA 4TU7A 2DIUA 5LSRA 4LSLA 4ZCMA 4QJVA 1SJ3P 1G7CB 1JXVA 5HXBA 5DSZA 4KV8A 5HMYA 3FSIA 1E6YA 1TL3B 2ZZEA 1OS5A 1WF2A 4Z37A 3HVRA 4Y0FA 3UFCX 2N7CA 3MMCB 5HBMA 3CDAA 4C43A 4DV3F 4TN2A 2HLTA 2WSEC 4DHVA 1WACA 2NYHA 4II2A 3QGIA 1G1XA 1HWUA 1TUGB 2H5IB 2ALYB 5B0CA 3C8YA 2X6WA 4YB1P 4ZITA 2NPIA 2UUAF 1X5PA 3IWNC 4NLGA 1S0NA 2BBEA 1SV5B 4OYWA 1HNXJ 3IR7B 4M5DB 1GQEA 1R3NA 4YUDA 5AXMA 3CCQB 4LF7F 3CDEA 5DLGA 2G0JA 4BWMA 4LR8A 1NXIA 2OKQA 1LW2B 2ASYA 3BN4A 1LFWA 4JI3J 3BGRA 2BJEA 4EO8A 3RBEA 1S0OA 4GQNA 2KDOA 2CVIA 4R71A 4FF2A 1E6VB 4JI7F 4ID5A 5HN0A 1UKUA 2H65B 3V5RA 3G71S 1JXLA 1FTCA 2CIMA 4DU7A 1F5BA 2Y8WA 2YH0A 3DRRB 2HNZA 2BW7A 4DV6F 4IR1A 4J9UE 5KFTA 2UVWA 2QEXB 2V0NA 3I96A 1S77D 3CCES 4QFMA 5LMNJ 3CJKB 1Q7YD 2FTRA 1KHWA 1T6XA 3BQ0A 2ZH2A 1XQBA 4PQAA 2D3O1 4I56A 2CQGA 4FYVB 2MJNA 2LECA 3BH4A 3UO0A 1BQXA 5GVQA 5AJ3F 3AXMA 4KYZA 2ZWPA 3E1YE 3H90A 1HNIB 5B0BA 1IR2A 1JLFB 1ZTTA 1B64A 4X66J 4X7EA 2FJVA 2KXNB 4LF9F 1R6VA 3FMBA 1NZ8A 3H5YA 3C15B 3CJ3A 2CW5A 1KRHA 1UL3A 3VZIA 1UD4A 1FDDA 1DRZA 2QT7A 3QLHB 5HROA 2IVMA 4WZQA 4ILMA 3G4SB 2CPXA 3M2UB 3QIPB 4LBWA 1AT1B 3K5LA 5BSYA 3VO1A 4DSIA 3WX8A 4X84A 3CCJS 1GO2A 4WE1A 4C7QA 3TAQA 2PE8A 4TMWA 3M6VA 2DNGA 3CMQA 5IQQA 4WFYA 4ZN1A 2KI2A 2WSFC 3BQ2A 3AY0A 5CAAA 2PI4A 2RDDA 3MCSA 2XHCA 3QT8A 3CD6S 3C46A 3G9CA 2ATLA 4MTPA 4J7CA 2ASLA 1VJSA 1EAYC 3VAFA 4O3PA 3IGVA 1KRPA 4OOXA 2XYGB 2HQFA 1VLYA 3MWBA 4LBHA 1UCNA 3ZTOA 3T6BA 3DLEA 1T05A 3MR3A 5A76A 4RUCA 4PWDA 3GV8B 4USUA 2BE9B 1WF1A 5GMKa 2BM1A 3HVTB 2CUYA 4LF6F 1FJCA 1FK9A 3QNWB 4YAWA 3JQMA 2R7XA 1FO1A 2COLA 3V4IB 2ASJA 2LCWA 4NWBA 3QIDA 4ECZA 2XZTB 4OZ3A 2QL9B 2R3VA 3G6VA 3BSCA 2D3NA 4P75A 1HNXF 4ECYA 3HP6A 1UD5A 3WBJA 2GREA 4ILRA 5HVHA 4USTA 3HX9A 3KLVA 2QV6A 3CIZA 3MM7B 4LREA 3FNNA 1HR0F 2BJ1A 1DQ9A 2MKKA 5DG9A 4MK9A 1BC6A 1JQGA 2MEWA 5D4PA 2DRBA 4G65A 2X8KA 5ADZA 2YWGA 3HHLC 1FKOA 1OWXA 4MIBA 2EFNA 3FRZA 4MT1A 5A2QY 5BR8J 2KXFA 4ZMMA 2UUBF 4NCBA 4P2XA 1H3DA 3IC1A 2KZMA 4C3MA 1PYTA 4TMTA 2GAGC 1BX0A 4G1BA 2QSFA 2CPZA 1IKYA 3UVJA 4B3TF 3GTYX 1UWAA 4K5RA 5B0FA 2MQOA 2K2PA 3AODA 3LWMA 2UXBJ 4YEJA 1BX1A 4EWTA 4L8JA 4C8OA 3UN3A 4DCPB 4X66F 1UZDA 3FDSA 3CD7A 1F9HA 2CF4A 2IPOB 5E41A 1UVKA 4FNHA 2DYAA 2XEXA 4HEA9 3MR6A 1Q53A 1KLMA 4II3A 2QLXA 4P2MA 1T0TV 4CQ1A 2BYCA 1KHVA 4CT8A 2C2KB 3RU0A 3NS6A 2XTJP 1VRQC 5HLFA 5GV8A 4LRBA 4CNYA 2ZHAA 1S10A 3VGVA 1U1MA 3PM9A 1QG0A 3IBCB 4HHHA 2C2NA 2HIQA 4HTJA 2CPFA 2JVRA 2ZUGA 5KFSA 5HMZA 3SQGB 1KP6A 1SQGA 2RQKA 4DV7F 3JB9k 4KH0B 4NLXA 5B0DA 2JLGA 2NS1B 1YLXA 4DR2J 3IWXA 2MXYA 2R7UA 3AVWA 2HRTA 2RAQA 1IBKF 3QFWA 4RD2A 3X1LB 4YXWA 1U48A 2P2CB 4YS2A 2BKPA 1XK8A 1G2EA 3JAMY 3DOKB 3OZUA 1VQOB 2DB1A 1C1CB 3ENWA 1RWOB 1Y4ZB 2Y0SD 2KHCA 4OYAA 3ENQA 2HFUA 2QGFB 4L72B 1HARA 3CCEB 3NEKA 5HK4A 1RAAB 2YNIA 3V76A 1FDNA 2LQ5A 3LH2S 4R25A 1XNRJ 3FBEA 1MROB 4KAIA 1FKOB 4YQWA 4FP9A 2DHSA 2EFGA 4HHUA 3QPIA 2DRAA 1X4HA 3T5HA 1H8HA 1OY9A 4Z4YA 1VRUA 2C4UA 3OL8A 4JI6J 2W2PP 1AA1B 1MMLA 1UWBB 5BJRA 3BC9A 3ISZA 3BSNA 1FA0A 3H9NA 4ECXA 2MJUA 2HQDA 4CH7A 5SZTA 3NLCA 4OHZA 5J1NA 1GNKA 2OO4A 2OEJA 1S6PB 2XS7A 3OTCA 1HNVA 1MROA 4OOVA 4YY3J 2FJBB 1K0VA 3GILA 3ZC4A 2ZL6A 3W9JA 2X53S 4IFVA 1ZUNB 4LF9J 4X8IA 1UW9A 3U6BA 2CJ9A 3GMGA 4ZIVA 1NNDA 3VVUA 3PO4A 1QFYA 4GKKJ 3Q3AA 4CTAA 2HPUA 2LMIA 1BQEA 3DOKA 2VG6A 1FXLA 5D0RA 2LVWA 4ECWA 4JI4J 2WZPP 4HDGA 4KC5A 4K4XA 4KTQA 5HMWA 1X7VA 2Y8YA 1WHYA 3VALA 1QVFR 4PCQA 4OX7A 1FWLA 4C6AA 2V7WA 2E7WA 4OHWA 4OP7A 2MZ1A 2XQCA 5CYMB 3I82A 1EP3B 4RDKA 4IDKB 4Q5VA 1CJUB 5IFMA 4KBIA 4OYMA 5EUHA 2EBEA 1N36F 2RNEA 1YJWB 2YKPA 2ZL5A 3DLGA 2GVZA 1G3OA 2ZDPA 4DSFA 1D9AA 3C16B 1TK5A 5EDWA 1ZPVA 2BJ7A 2OYNA 1X60A 5HSPA 3A12A 4NZ7A 4QYZK 2V34A 4PQUB 2A6MA 1B3TA 3R97A 1NK8A 2ZEJA 3CCLS 3VAKA 4HH0A 5EX0A 1VHEA 4YDDB 1C1BB 4I69A 2G0CA 2OD4A 4NNJA 1KC8D 1CSJA 1TMJA 4M53A 1KLMB 3VAGA 1NSKL 3DKDA 3Q2SC 4FBTA 3J7A1 4X4OA 2VPYB 4DR3F 5A88A 2FHJD 4EYHB 4NPOA 2E9TA 5ETTA 5K8PA 2V5HG 2V7VA 4OZ5A 1NJID 2XHWA 1M5VC 1X4AA 5B0AA 2CNNB 2LEPA 3GQCA 4P2FA 2R7TA 2VBYA 4NXMJ 3QFRA 2VQEF 4IO1A 3ZTQA 4WP9A 4PC2A 3AA9A 4NI2A 5KFYA 4QVJA 1ZBTA 5LXRA 3DRRA 2KU7A 1S57A 3FUYA 3BPDA 1RT4A 3QO9A 3CIMA 3PX0A 2KG1A 3K57A 2Y3YA 1E6VA 1DBDA 3LP0B 5ETLA 2B5JB 3M32B 2JJ4D 3QAEA 3P49B 1W25A 1P27B 4RW7B 1UFLA 3PNIA 2M88A 2GCFA 2WBRA 4B3SF 2XYPB 4G6IA 1S1WB 3TEHB 2M3DA 4FDFA 3B82A 3KUEA 2XSJA 3GV5B 4DQLA 4C98A 3G87A 3A3NB 4OZJA 1GMWA 4OPSA 1S7HA 2HQ3A 3AJ2A 1UD2A 5ITHA 4X62F 3A3GA 3CCSS 2C2MB 2DITA 2C28A 4IR9A 2RRNA 4RNNA 1T9VA 1W2BR 4NYZA 4HDHA 1H2UX 1E1RA 5EWGA 2XY6A 4ZS6A 2NXCA 4USHA 4DR4F 3JXOA 1F2HA 4ASUA 1HNWJ 4K2XA 2AEMA 4XIUA 5HAOA 5U47A 5AT1B 4KB7A 5D0EA 3NP5A 2AX0A 5KOWA 2CPIA 3WYAA 2GIRA 3DOLA 4Q45A 5LJ3Y 3VQSA 2ZFHA 3NNCA 2AYMA 4A8WA 1NH8A 5KFJA 4C11A 1Y5IB 3VMFA 3VAIA 4QIFA 3JSRA 1NM2A 4RW8A 4PEOA 1SJQA 4O0NA 5E5NA 1VQ8B 1VQMS 4CO0A 3OJWA 2XYHB 1IXKA 1U25A 1VQ5S 1TKXA 3CNQP 2EFPA 2WVBA 3GIMA 2JEIA 3VR6A 3G6EB 3DLJA 1RZMA 1ZETA 3POTA 4YMEA 4JI6F 3BV8A 3I0RB 4DLEA 2IMWP 4JV1A 3AQPA 4PQUA 2BJ8A 3OTOF 2CRVA 1TP7A 4K59A 1JLEA 3MM5B 4CO3A 4L6V3 4UTGA 3OVBA 1HHQA 2BKOA 1NK7A 1FJGJ 3MECA 4E8UA 1PC4A 4LSNB 5IYNA 1HNIA 4XLAA 1D09B 2XNRA 2VG5A 4UUXA 4Y2CA 3A3OB 5HVGA 1Q7YT 1RWKB 3M8PA 3S1TA 4NLPA 4OIXA 3KLEA 2YWHA 4TXSA 3H7HB 2HHHF 3MCNA 2CQDA 1FRJA 3KWMA 3QAUA 4DXLA 3PKMA 3IO1A 3DHXA 2CFXA 4LIWA 5CH7B 3J7AN 4G7WA 1QVGB 4ZVOB 2Y1LB 2YY3A 3EPGA 3UVJB 1T03A 3MAAA 5A8KB 3RW6A 3MXHP 2IAJA 4RLZA 4EH1A 1YJ9S 1M5SA 1GX6A 4EGLA 1T02A 3ZO7A 3PZPA 3CCMS 1E64A 2XZWA 4WJBA 3PW5A 2UUTA 4URGA 1SC1B 4LF1A 4RCYA 3D0HE 1PGZA 2NREA 4MKVA 1W26A 3G86A 4I6AA 4WFBQ 4GVLA 2XCAA 2OTLB 2KG0A 3QFSA 2DNHA 1KOHA 4CLYA 1KQSR 4M5DA 2NZCA 2X85A 3OR2B 1H42A 3T1YF 3WBKA 2GMLA 3OFGA 4UOGA 3CULA 2R6HA 1WELA 4XDCA 2BF4A 2JX2A 3QGGA 2D9PA 4C0OC 2HGNA 3H25A 5K8NA 2HVDA 2LQJA 1TR0A 1BXNA 5KFUA 2P6TA 4QOTA 2DEJA 4XR6A 2I8EA 3IA0A 4X4NA 2DHXA 1PAEX 1M5OC 4P73A 2FVPA 2YNIB 4BC7A 4ZVHA 4WFXA 5G4DA 1I5OB 4DG1B 4LFCF 3HHNB 2KL8A 2QLBB 2JL9A 1U0HA 3MD1A 5E33A 1SH0A 4ZPDA 5ETRA 1KFDA 5A8RA 1CJTA 4QR1A 4EBCA 2CPHA 1KONA 1RLDA 4RJLA 2KRBA 4XQFA 3KJVB 1NUEA 4QW8A 4LQ9A 1RYSA 1VJQA 1UJ6A 2XBPA 3MCOA 1KK2A 2MPUA 2QMUA 1DQAA 1VQ8S 1WKLA 1RCOB 2PEBA 5KSWB 3W5XA 3SCKE 1JA1A 1F0XA 1NJYA 3V6KA 5IV4A 1FERA 2IJFA 3MM8B 2ZBPA 3PW4A 4BBYA 1X0FA 4C0HA 2V8GA 1VQKS 2R8GA 1M1KD 3ZZOA 4R8UB 4YELA 4LF5F 4DI6A 4LFBF 1OY6A 3T1HJ 1YJVA 5F3ZA 3CPWR 2DT9A 3W2GA 2D74A 3CW2C 2RT3A 4ED5A 2LU2A 5HLFB 5TV2A 1ULRA 1KK0A 3W9HA 5KFDA 2NV4A 2YWWA 5I3PA 3FEXB 3EZOA 4NA1A 2ZD1B 4L3NA 1JLGA 2RUSA 3UN2A 2C3UA 1BE4A 3R7SB 2AIRB 3IAM9 2CYYA 4M5LA 1D1UA 3JSMB 5J2MB 1W87A 3SDEB 2GX8A 2W4DA 3Q38A 2ZOGA 1YI2S 3R2CJ 1NBMA 4DR3J 4NLRA 3N0VA 1I94F 2VF3A 2ZXHA 2PI5A 1VLOA 5MLCV 2RU9A 2DCUB 2WOMA 3CJKA 2O67A 4P6VF 5KFMA 2R8JA 2A2DA 4ED6A 1RWXB 4OHXA 2EW9A 1YJ9B 4XN0A 1S9EA 3KTQA 3W2VB 4J9OA 2HS3A 1HBMB 3K5OA 2AYEA 4ZGQB 2X6XA 4XLCA 3F44A 2NSBA 1ZTWA 1RTDB 2WVEA 3TQEA 1JKHB 4IOBA 2QDXA 5HZAA 1TV6B 3NGSA 1F3VA 4HH1A 1N5YA 3MFHA 2QLJB 4P7VA 1XNQJ 3K5MA 3UCZP 1RCXB 4A8QA 3PFOA 4G1QB 4NOHA 4A8SA 4DPXA 2Z8QA 3K8WA 1X9WA 5L38A 1Y11A 2ZNYA 1NJIT 4YHHJ 4OHVA 5T41A 2WBMA 2GPJA 1SV5A 1ZZNA 2LP4A 1FDBA 3QQCD 3KG1A 2B4PA 3Q8RB 3PY8A 3VV2B 4PG5A 1BQNA 2ZJPQ 2MGZA 1RA7A 1Y0YA 4K5SA 4RW6B 3R5GA 1Z2LA 1SKSA 3KHGA 4TQRA 4X4QA 4DL4A 2BMWA 1H2TZ 5IYPA 4WCEQ 1TVCA 2LFVA 2XM3A 2ZKTA 4FBUA 1E6YB 2GK7A 3HFZB 4AXIA 1Y9OA 2QE7A 2AF6A 4AF6A 4TU9A 1X5SA 1K47A 2EVZA 3LO8A 5D3GB 2F8MA 2MQMA 5H9EJ 2BE2B 2JEFA 3DRYA 2KHDA 1WKJA 3LP2B 2W2NP 1T05B 3CCTA 2YBVA 1ZAXA 2H54B 2DIEA 3OVAA 1HMVA 2ZUAA 1HMVB 3WNDA 2AKWB 1EHWA 1HD1A 1RDRA 1X9MA 2X1BA 3D3CJ 3VAJA 4PC1A 1U0HB 3KHHA 4DEZA 5IC4B 4ZGNB 3QZ7A 2UVUA 2AJ1A 4ZVUB 4LMZA 4I7FA 1TZ0A 4YEAA 1RTIB 2KYXA 3K5NA 1VMBA 3WNCA 3PDNA 2OMOA 3PYGA 1E3ZA 4CLWA 3QRQA 1AUSL 1QUVA 2MSTA 3KL9A 1Y5NB 3MMBB 4J9NA 2VNHA 4F25A 4NRTA 2D41A 3RY8A 3M2UA 1WC0A 2D1CA 2PSZA 3KK1A 4LUBA 4K4YA 4KPYA 4G1IA 1C0TA 2ZTGA 2QA1A 2W9BA 1Q79A 4F02A 4CO1A 4Z2XA 1RXOB 3I56S 1WOSA 1KVKA 3SYZA 1N5YB 2WJVA 4ZCKA 4H54A 1CULB 1NMEB 3JQPA 1XERA 1T11A 1J2VA 2C2RA 4IRCA 2OUGA 2OLWA 2Z57B 2OPSB 3H5XA 1HZEA 1REVB 2IIHA 2XLIA 3NWGA 4F7VA 2X6YA 3C6TA 3QATA 3R6JA 3MEGA 3NG8A 4URQU 5I42B 4TKOB 2LYVA 2A3JA 3MEGB 3A1PA 4FNIA 3ASRA 1UFWA 4KFBB 2J6UA 4LR7A 1O51A 4ICLA 3HK2A 3CC4B 2BVZA 3OR1A 2J76E 3KLEB 2EC0A 3ASQA 3QWPA 5FA6A 3RZAA 1NHUA 2B9WA 2BSAA 2DY9A 1L3UA 4BDPA 3OPKA 4J9KA 3PKYA 1S76D 4ZKAA 2MQQA 4DR6F 2FHKA 2QIFA 2YKMA 5KG4A 4K0KJ 3CP8A 1RT7A 2JZ5A 3B4DA 4X65F 2OFHX 3MECB 3P27A 3NCQA 4FN5A 4TY8B 1N56A 2V63A 2W8LA 9ATCB 3LANA 1ITPA 3PA2A 4Y7CA 4N3NA 2QLFB 2Z56B 2ACYA 4JI4F 4X4SA 1B70B 1YRTA 4O3QA 1R8CA 4DL6A 4DQQA 1O0PA 2HLUA 2W6IA 1KD1D 5J2PB 4CM2A 4Z4RA 2LQ9A 1YJ7A 1F20A 5LMUJ 3WHIA 4ANCA 4LBYA 1ELOA 5L1KA 3OW7A 1NH7A 1JLAA 2VL1A 4HLBA 3MMCA 3I0SA 4DCOB 3M8YA 1FHTA 4FWTA 5DGAA 1KLNA 1M5HA 2ZBUA 2DGTA 4KKUA 3OJUA 1OB0A 1DLOB 3MM8A 5M2RA 3MAQA 4AUKA 3WNBA 2OK8A 4Z7CA 5LXYA 1V0EA 3H2VE 2ZOFA 4MFBA 2QTLA 5GAGI 1HBOA 5LOQA 2ZHBA 4PWWA 5DG8A 2G2ZA 1CS4A 2HNYB 2IBKA 4NYPA 1K28D 3I9ZA 2AV5A 3CC2B 3T53B 3I5AA 2VA3A 2B9EA 5LMNF 1A9NB 4UOHA 3A13A 1MSWD 3LNNA 3IS9B 1DG1G 1J5OA 5HKKA 4DG1A 1O6XA 2G2YA 4DPYA 3DRPB 1D8YA 5DM6Q 3FGVA 4B02A 1RTJA 4XNFA 2MQPA 1IWGA 4Q2MA 4YR0A 3CJRA 4U96A 2QYCA 2NUUG 3OJXA 1N6QB 5DJBA 1RWVB 3J7YI 2MTLA 2NQPA 2K06A 2HQIA 3JYTB 1OPZA 3GJRB 4TY9A 4KGZB 2WRMA 3HJFA 1MNEA 3UW1A 3I56B 2ZKUA 2V69A 2J0SD 1DDGA 1UVNA 1S6QA 1AZSB 3B6BA 2LEBA 4KKSA 2J9CA 2OGUA 2DK2A 1EETB 5SUHA 4KKOA 1NSAA 4B08A 1Y3KA 2ZBQA 3VGUA 3PENA 1CQMA 1SC4B 3BH7B 3G8TA 1HW9A 3THVA 4HR2A 4GKJF 4IOAQ 1WJ9A 4I6YA 3W2VA 3LTOA 1W9XA 3UE2A 3RAXA 4PG4A 1QFZA 2UUCJ 1CJKA 3R7BB 2PE3A 4UZBA 1F1BB 1KTQA 1VRTA 3CC4S 3G6XA 3D4JA 2X7IA 1RWPB 4QPTA 5E3CA 1ACMB 1YRUA 2JN9A 3NS7B 4J9RA 1BLIA 4RW9A 5KT6A 3SLDA 2R7WA 4FS2A 4IUFA 1WORA 1OB5A 4OPVA 2JJ2A 5DZ7A 1A8PA 1HNZF 4F4XA 3R27A 4LSNA 4O0IA 4PXEA 2LKZA 3J7YU 2ZBVA 5BXIA 1RT6A 5FDLB 3JSMA 1XMBA 1KVJA 1HD0A 1FRKA 4JI0J 2Y9HA 2N82B 5LMZA 4QU6A 1YX2A 3E2EA 4J9SA 3SSSA 5KT3A 4FF3A 3P5TL 1YJUA 3C6UA 2FQQB 4MIWA 5D0GA 4AE5A 4CYUA 5KG5A 3I0RA 3KK1B 5A8WB 3AGPA 2IHR1 2JHEA 2I5JA 2LU1A 3UD3P 5F4MA 2W01A 1EKSA 4P74A 2HVEA 2CDRB 3P8BB 3V4MA 1RE1B 1R8HA 4RD4A 3LP1B 7FD1A 3RJMB 1SVDA 1SM4A 2E7VA 2ROEA 2W1BA 1SCJB 1U1QA 1RISA 3ICLA 5ETNA 1E63A 1MABA 3NCPA 5F3TA 1U1OA 2C2DA 5C42B 3KDOA 5KFBA 4J9PA 3CCZA 1D9FA 4USIA 3AFGA 1DY3A 4PABA 3CPWB 4RUAA 1M90T 3D1HA 2AJFE 2M5SA 1A0OB 3RGIA 2FLLA 3J81Y 8ATCB 3LP2A 4IO9Q 4CTAB 1TQLA 4ZJQA 2HURA 3PRBA 2KXHA 2JH3A 3DCAA 3QFCA 1RHUB 4GMKA 2MMYA 2UUBJ 5D3GA 2GAHC 1FKPB 4E98A 5KFFA 2LXIA 1TL7A 3AB4B 5F9NA 3T5JA 1UEKA 2VONA 4A8OA 4AYBD 4CLZA 2VBVA 3ASTA 4F2RA 1KDNA 4NLYA 3M2RB 1S6PA 3FQKA 2F40A 1E1QA 2RQCA 2ZNZA 4WBFA 2M8HA 3Q8VA 4X06A 4LBZA 2E1AA 4YP3A 2ZITA 2DR9A 3SCLE 4N8NA 6FD1A 3TOQA 3EGWB 3N01A 3UR3C 3CCUS 2NCKL 1FX2A 2BA9A 4RD0A 2ILZA 1LWXA 2AYBA 5DQIA 3V81B 3TVYA 1IKVB 4C97A 2D7SA 4LBVA 4U7UD 3DOMB 2DNZA 2GVDA 4Y3CA 3TZWA 4QWEA 2ZTNA 4WZEA 4JI2J 4DFKA 2G1DA 2OTJB 1WI8A 3F56A 3GSIA 4LRCA 4CO4A 2BDPA 3OL7A 2PN6A 4UZEA 4OX8A 2E1PA 3OXGA 2QL7B 2K1RB 5AE2A 2WW8A 3WC0A 1VQ7S 1IKXB 2DERA 1MWZA 2RMLA 4N77A 2V31A 4ACBA 1QDUB 4I2QB 3Q8QB 4V1Ak 4X7CA 1R8BA 3V6JA 2ADCA 2J9DE 2CPJA 2Y0BB 2E5GA 2XGJA 3QT7A 2QGGA 3AVYA 3LUYA 3KG0A 4ZVSB 2YXLA 1QGYA 4L75A 4DSEA 2O01C 3OXFA 4NLVA 4ECUA 2XMUA 3D6TB 1E43A 2J8AA 1N52B 3LPYA 1Z4UA 1SC6A 3UNYA 1SBRA 2V9KA 2FPHX 2B6AA 3I32A 3AD7C 5FL7A 1FNBA 1V5VA 2W24A 1NJZA 3UN5A 3Q0AA 4R8UA 4K1XA 2DNOA 4NLTA 5AJ3J 3GFZA 5L8RC 1JNYA 3T9NA 2HHSA 3PRVA 5F0UA 2IC3A 3GPAA 4N5SA 1YI2B 4DV3J 3S8SA 4TMXA 2V2ZA 3AD9C 4XOTA 5FNZA 4JI2F 4JB8B 5LM7E 1N06A 4QCLA 3MUMP 2KJVA 1HYSB 1KD1T 4AD6A 2OELA 4F2SA 4V19X 4AL6A 2B43A 1F5AA 1Q8KA 3KJVA 2FIUA 2PO4A 4U95A 1N48A 4IH7A 4P6YA 2BQ3A 3VGTA 1PAUB 3LALA 4Y2MA 1EFTA 4XKVA 2VKZG 2RKIA 1QM9A 3RYLA 3SIPB 4N47A 3HJVA 4ZN3A 4OI3A 1SH2A 1FRHA 3FJ2A 2UXDF 1G7RA 4B3RJ 2CJQA 3VAHA 2K8GA 3KMSA 4QIWD 2QMXA 5A6PA 3MCAA 2QMWA 4HT7A 1Y7PA 3BGOP 2FGOA 2BOPA 4RBUA 2DO4A 3JAMU 2ROPA 2BABA 3CJ4A 3BQ1A 3T5LA 2ZC4A 2PMDA 4NMLA 4E0DA 2N3OA 1S1WA 2JDJA 1PJ5A 1Q5VA 4WQMA 3AJ1A 2VBZA 3OT9A 4DMZA 3K17A 3MEDA 3AVXA 2B8PA 3TARA 3EMTA 4C3KA 2F4VJ 2F1LA 2N4DA 2X51A 3OXLA 1C2PA 2N4CA 5C24A 5DZ6A 4X05A 3TR5A 2IJRA 1VQSA 2LA4A 2QO3A 1TL7B 5IT4A 2DR6A 1FKPA 2IAJB 3WC2A 3H4BA 4CQJA 4EUVA 4DS5A 3GZ7A 2GA7A 2VU5A 2X0KA 5DDRC 2C78A 3GLJA 5GV7A 3KLGA 2AZ1A 3HFVA 1TL5A 4WKYA 3OV7A 3MD3A 4NA3A 4I0WA 2V4JB 2VA2A 5HQMA 1HPZA 2Q43A 2ZH6A 3R1LA 4KHPJ 4H4MA 3T51B 1XMQF 1YTYA 1U1RA 3UD5A 4G6VB 1A6LA 5CHCB 5BYRA 4DSJA 2VG5B 1C4AA 3NS5A 4PUOB 4EU0A 2J6SA 1IR1A 1K73T 1TAUA 4PXCA 2HHXA 4K7QA 4N8OA 5DDQC 3OE7A 4KGKA 5EHHA 3M8RA 4F0MA 3CJ8A 1YJNB 5IS2A 1Q81D 2UU9J 1XWLA 1H72C 3NGTA 3ELHA 1WWHA 5JUMA 2KB2A 2YPZA 3CP2A 3U2QA 4C4WA 1F2GA 2XNDA 2VG7B 3ILIA 3TEGA 4QR2A 1XQIA 3PCOB 1VF7A 2AGPA 4WFZA 2HKEA 5ETVA 4WFAQ 4ZHRB 3M05A 7AT1B 4RUBA 3M2VB 4GC7A 3P5BP 4H4KA 1RTHB 5KT4A 3TVKA 3FCVA 4H4MB 1NK5A 1JLQA 3O44A 1NU4A 1VBKA 3MTJA 4XD7A 5GAGU 4DV5J 3T41A 3VO2A 3MPYA 5HL7Q 2FVCA 2UXBF 1KQGB 4Z4UA 2CZVC 2F7VA 1S1UA 4DL3A 2V2QA 4HT5A 2HNDB 2Q3PA 1T6ZA 3FVYA 2E1CA 4M5JA 2VBSA 4OPOA 2BZ2A 1N5TA 3SEJA 2NXEA 1WI6A 2ZM6F 2IM1A 4NZ0A 1JJHA 2M52A 4DZ6A 2ZM6J 3ZIAA 5KT2A 4QWBA 3EGNA 4O4RA 4ALZA 4V19J 4R5PA 4I6WA 2FUG9 3DI6B 4K0KF 3PO5A 3MEKA 1P9YA 3HAGA 3BR8A 2WVCA 1RKJA 1JLBB 1S97A 1F60B 2YNGA 5IT0A 2GJFA 2BE7D 1YDLA 4NCGA 2ACMA 5HI7A 1ZAWA 2BR0A 1H73A 1EIYB 4QWCA 2XI3A 3L7OA 1PBAA 1ROFA 3MHYA 2QTWA 1DTQB 4ZP9A 5FIUA 2AU0A 2PMZD 4ECTA 3HKWA 4HI2A 2MY8A 2GC8A 1N34F 1RT2B 3AT1B 2EK1A 3QJPA 2D9OA 5CA5A 1FK9B 2ZZQA 2A1BA 1J5OB 1UD6A 4P9SA 4FF1A 5K20B 1KK3A 2F9JA 4WZTA 1KC8T 2RRAA 2CJXB 4DUZJ 4ZP6A 5L1LA 3L7PA 1UA1A 1GTEA 2AEFA 4C48A 2D9RA 4DR7F 2EFQA 3W63A 1N36J 4MIAA 1LXJA 2LQBA 4AFFA 1UETA 1T9UA 3B78A 1HI8A 4ZJLA 2PIAA 3M2VA 4BLGA 4IOCQ 3IM8A 1U1NA 3OEHA 5G0RB 2VH7A 4G1VA 1FX0A 5KFRA 2DPJA 3DYAA 3W5ZA 1FI4A 4NLWA 4B3FX 2XZPA 2WB4A 2VG7A 4WE1B 1WU8A 3OTDA 2ILYA 5B7WA 3MUVP 2LXFA 1S12A 1JB0C 1VQLB 2QLWA 3KJQB 2UVRA 4NLSA 3D6MB 4WXWA 4HL9A 3QLHA 4M1KA 1WC4A 4CRJA 2UP1A 5JXSA 2B8QA 3PUMA 1IBMF 4UUWA 3EZUA 1RHJB 4EEYA 2D3LA 5FDLA 4LF4J 3LWLA 2CG4A 3BCFA 3BNWA 1CJUA 2WAQD 3JS9A 2RVJA 2IVFB 4JI5F 3M8QA 4X64F 2V50A 2VJUA 3DLKB 2FHOB 2DEUA 2OHDA 2HBZB 4I1TA 1S1TB 1HPZB 4B3SJ 3BY2A 1M90D 2QJ3A 2M8DB 1WDDA 1SI9A 1SJ1A 1VQOS 3Q86A 2CNLB 3WX4A 3KLGB 3PACA 1A7GE 1NHVA 3D26A 4ECQA 3DGVA 3ZZYA 3HFKA 3EXCX 4PG7A 5L39A 1WG1A 3DDYA 1IJFB 5KFHA 4Y28C 2GO9A 4H4KC 3KJNB 1SIWB 2OPSA 5HJXA 2GVDB 5C24B 4IFVB 4ID5B 1S6OA 2GGPB 3M8WA 1WDTA 4KIAA 4RLEA 1ZM3A 3EVWA 1FEEA 2DNRA 1TL1A 1U49A 3BR9A 3U7JA 2UXDJ 2J9DA 4ID8A 3N6NA 2M2BA 4C9DA 5KFCA 3IRWP 1NB7A 3K5PA 1U6FA 2IA0A 3M4XA 4ZIWA 3RRGA 4W4MA 3UDEA 3W2WA 4F8RA 1ZA2B 2FDNA 3DXSX 3CXCB 5HP1A 3DDNA 4FYXB 3OZVA 4YALA 5IWAF 4OJ1A 4F0KA 2YQ3A 3H2UB 3CCUB 3HSJA 2XY5A 5T14A 3WDOA 5GAHI 2EBGA 1OSDA 2M70A 3J7Z5 1EXMA 3DN9A 5K5MA 2M0GB 3SV3A 3O5TB 4X4UA 4K8RA 3PVDA 4OV6A 4DDFA 3FC9A 2HYIB 5IC6B 4KV8B 2MKJA 4R0EA 3N5BA 1RTZA 2K3IA 4FXVA 4QWDA 2YTCA 2C3YA 2ZHOA 3TW0A 4PWDB 3JTPA 4ITSA 1FF2A 1P8GA 4OZ0A 4TYBA 3VHQA 2FLNA 4MK7A 3I31A 2V8HA 1CS4B 1VS3A 3X3UA 2R8HA 2HBQB 1HR0J 2OIHA 1HYSA 2DNMA 1WOOA 4L3KA 3M6UA 3TA0A 1YITS 3T1AA 1J5EJ 4Q43A 1U1LA 4Q8FA 3MI7X 3M30B 1TU0B 5CABA 2R7SA 5IXUA 2F63A 4QQBA 5EN1A 1X4DA 2KVQE 4WWVA 1DLOA 1VIOA 1N5VA 1IM4A 1DDIA 5F41A 2CA9A 5ETSA 3ZNJ1 2DIVA 4I68A 1Q4RA 3R1HA 3CEDA 1G7TA 1HWKA 2NUHA 3I9V9 4RW6A 2MQLA 4PWUA 1RGVA 2PDAA 2VPZB 2ZH8A 4ZCIA 2HHTA 4RWWA 2B7BA 2ZDOA 2WVDA 3CCQS 4CYUB 2W6JA 2IMOA 5IWAJ 1N5QA 3HI9A 2KFZA 1RABB 1CVJA 1VQ9S 3PW0A 2DBBA 4JI7J 5LL6d 2YH1A 4TY8A 1M5KC 5J3OA 1T9YA 3ZZ0A 4UAJA 1NKEA 5J2NA 1E62A 2R2RA 2HRYA 2ZBRA 2XO6A 2RILA 1XFOA 1QGZA 4O3RA 2P3MA 2WPDA 5K8OA 2ABYA 1PILA 3GG0A 3BO3A 1Q8LA 1R5BA 1PJ7A 4XPCA 1S0MA 3G71B 3MR2A 3QJJA 1R5OA 2C2EA 1SKQA 5BYSA 3EDQB 4OYXA 2K1RA 2P9EA 1QY7A 3ONYA 2UZAA 4F3QA 1PKVA 1SJFA 1U09A 2OMLA 4Y2IA 3OFNA 1U1PA 2WONB 2ZH3A 2Z2ZA 4PKDB 4Z7YA 4K4ZA 2PEHA 2C2WA 1CULA 3ZUGA 4P7TA 3KUGA 2VHGA 4Z4SA 3CD5A 1CNEA 1B7YB 1T8EA 2DXFA 1KFSA 4KGMA 3GWCA 3AGQA 2XOKA 4B9UA 4QIGA 2R7QA 4CI0B 3D3BJ 4IFYA 1FFSB 3RBXA 3C66A 3AQOA 5A6WA 1RAOA 2CQ4A 4DPOA 3JYTA 3PJWA 2B7BB 2F4FA 1CJVB 3O1LA 1FD8A 1IR0A 4ECSA 4DCJB 4U7CA 2K7KA 1U8SA 2QRRA 3AVTA 1HWIA 4ZLJA 1NDPA 4GO7X 1RTJB 3CD0A 1D2EA 2GMHA 1TELA 2KTQA 4DPWA 4GVBA 4S0MA 1U8WA 3M30A 3TUZC 4M95A 3R7NB 3GCXP 3I1FA 4KGXB 4LSLB 1Q5YA 4DK0A 3OP1A 4J0QA 3TNVA 3LAKA 2HWIA 3CO9A 3S6EA 2J7KA 5JVHQ 4PC6A 4RNMA 4DX5A 4USJC 1HBUB 2ZH4A 2P9GA 2BN4A 1GX5A 4DWIA 3TZXA 5GAHU 3PIOQ 4QIVA 3VNVA 3HHLD 2HAFA 2GJIA 1R8AA 1WD6A 1Z1ZA 2BE2A 4M5MA 4FYDA 1RAJA 1S5ZA 1R89A 2IM0A 5L1JA 1RHQB 2YWKA 1DURA 4DR1F 4OYBA 3QT6A 4OZNA 4G1PA 5H5JA 4UW2A 3EGZA 2DXDA 2NXNA 1QSSA 2XZDB 1M1KT 1W35A 1NB9A 4TMZA 3DGPB 1KVIA 1OQ3A 3OTEA 1RWWB 2LZJA 2CKWA 4FKXA 1B0PA 1EP4A 1XR6A 4ER8A 1X4EA 1TK0A 1YJNS 1H8EA 2YKQA 2BANA 4UZFA 4F26A 2ZVIA 1KSPA 4G7XA 1TUWA 3MPWA 2CJAA 4IFYB 1SKWA 2FB0A 4QR0A 3K2YA 1I51B 3D6HB 2X1FA 4XTTA 2ERRA 1N33F 4DR6J 2F9DA 1ICEB 3D7SB 2H5EA 2RC5A 1N8RT 1TL1B 1GMUA 3IXQA 1FKAF 1TV6A 1AROP 3BKUA 2YKMB 2BRKA 2MYFA 4EBEA 1XR5A 1QAJA 1KKHA 2GJPA 3UWTA 3OL9A 4ZVFA 1JMTA 3IBWA 1Q8IA 2W25A 5E3AA 1IJFA 4JYAF 4ICLB 4WKRA 2DJWA 2BPOA 5DDOC 3H20A 1QJHA 4DR7J 2EG1A 5M2PA 3C6TB 4PRFA 1X9SA 1TTTA 1ZZFA 4WPAA 4ZPBA 1B4SA 1FFWB 3OEEA 2ZZNA 3FPKA 2HNZB 5C7PA 1CPZA 1S1VB 5IT9Y 1V3SA 5DQHA 2JIZA 1J5EF 4XL9A 2Q6OA 1HVXA 2QZ8A 3GQBA 4F0HA 2HBRB 1QSLA 1FXRA 1T94A 3PYEA 4RD6A 2CQCA 4KPCA 2R9LA 2CXEA 4ZOSA 3W64A 1IBLF 1IKWB 5F8IA 4DR5F 2L9DA 4RBVA 3FKBA 1NK0A 2FHMA 2BX6A 4XO0A 1RACB 1N34J 1UP1A 3E8OA 4J9QA 3NNAA 3BS9A 2C2ZB 4TLRA 2BGJA 5I4MA 2B7CB 1HHSA 2RQ4A 1VQ5B 4JYAJ 2RU3A 3M7VA 4PYDA 1VC6A 5F8HA 2AJ2A 2C22A 2X1AA 4IH5A 2FVGA 4DQRA 3SV4A 4WU2A 4CCHA 1SKYB 4DJBA 1IJEA 2IJNA 1UVLA 4U9RA 1K73D 3HD1A 1RAIB 3ET6A 4P2NA 2W9CA 4MKBA 3GG1A 2VICA 1HHTP 2C3PA 3TVZA 4I7FB 4FS1A 3OQ2A 4X64J 2RB7A 4B3MF 4OV1A 2VBTA 4A8KA 3OAAA 1NPKA 4OX6A 1TKDA 3THTA 5KG7A 2YNFA 3KEWA 2CNOB 3K58A 3D2WA 3R3TA 2VV5A 4EYIB 3TA2A 3ILJA 2BJ9A 3M1VA 1N08A 1PO6A 2OJ3A 3W2EA 2EC2A 2LQ8A 4EMDA 1LW0B 3ASPA 4NEYA 2Z2LA 3HF5A 1CJTB 1JLCB 3GJTB 1BGXT 3KJFB 1KWMA 3ONUA 4BCAA 4ERDA 4MFBB 4KSEB 1CQXA 4ZPWR 4DNRB 3P4UB 4ECRA 4WZMA 4ZK7M 3A8IA 4H4OA 4O4GB 3RB3A 2A18A 4A8MP 5M2UA 2CQ2A 3RRKA 1X8DA 2OEKA 3F41A 5AE3A 1S9FA 1EJ7L 3BO4A 2O5DA 4ED8A 3M9OB 1RWMB 4A48A 5L9NA 2LDIA 2R8KA 3HLUA 5TRDA 3A3BA 1U2CA 3UPFA 4X0CA 3OLBA 4RO0A 1QAIA 1JK9B 1VQLS 3GYNA 1F60A 3TRGA 2PMHA 4JV0A 2B4VA 1N07A 1RAHB 1QUPA 4NLQA 3NOCA 3T9ZA 2HW3A 4DQPA 1BQMA 4ZDNA 3DFEA 4RNOA 3LP0A 1RHRB 5ETQA 4ZPCA 2CRLA 2ZJRQ 1OSCA 4B3MJ 5KFLA 3Q2TC 3BF4A 2FC9A 1VQ4S 1SPBP 1RTDA 2JEGA 4OX9F 3PIPQ 4U67Q 1OQ6A 1GXUA 4WTOB 1S9EB 2L08A 1VHIA 1O8BA 1CBKA 4NYOA 1U02A 3BGFA 1FJEB 1YIJB 4CIOA 5HANA 4DPTA 4ELTA 3HULA 1KQSB 2HFNA 4KHPF 4JI1F 2B9YA 2CQBA 4B9NA 1YZ6A 3W2FA 4YR3A 3TX8A 5I3QA 4YAOA 3TJ8A 2ZBCA 1PSDA 3NGKA 2AT1B 2VBUA 1MU2B 3H8YA 2FHJA 3IRXB 3NGRA 2WZNA 2MKYA 3ASSA 3G6YA 5F4JA 1XNRF 3CW2A 3BYRA 4NRUA 3DLLQ 3SFGA 5DLFA 2AYGA 3Q8YA 2G2OA 1C1BA 4TNOA 1NEEA 4TYAA 2XMVA 1F9EB 4J9MA 1JJCB 4OFZA 2XMAA 4PXBA 4DFJA 2AZ3A 1VQKB 3KKFA 3KDNA 2OH2A 1Y3JA 1WUUA 4BS2A 5IM0A 3FBFA 2V7TA 3T56B 1S72B 3O3LA 1I18A 3C16A 3EXYA 1JB9A 3G4SS 3Q6RA 1NBEB 4F3MA 1P1TA 4DQSA 3QBCA 3SBMA 2HHWA 3I4HX 2I0XA 3OUYA 5AXNA 3MPVA 5KOXA 3GFXA 4UZUA 3SSQA 4IDKA 4PR6A 1FD2A 4PUOA 4TT3A 1NB0A 4M94A 4LRDA 4YAUA 5KFNA 2CQIA 3D66A 2JWNA 4JBCA 3PX4A 2GK6A 3DOLB 2ZH1A 3OZWA 1RQ0A 1Y0HA 2CAJA 3GFYA 3VZHA 2QTZA 1AFIA 5LMUF 2H9ZA 1MW7A 2QA2A 2O3DA 1RLCL 1DHMA 3MGJA 3KFWX 4RJVA 1UPMB 1FWPA 1HBNB 4DV0J 4X2BA 1JJ2R 4QVAA 4LRFA 3CUNA 4DV0F 4LFBJ 4CWBA 4Q8EA 1L3VA 1BD6A 1TVRB 1DTTA 3BB5A 4KO0B 3M9MB 3TUIC 4GO5X 1U24A 2GIQA 3LPEA 1GR1A 4HTIA 1B2RA 4B17A 3NKYA 1Q82D 2A0FB 3PHEA 2L9NA 2MGZB 1FCAA 3J80Y 1IHMA 3TWZA 1GTHA 2HFSA 1L3SA 4GKKF 2QFJA 1HW8A 2JRSA 4YB6A 5E7OB 1FNOA 2YNGB 5H59A 2OD6A 1I3OB 2EK6A 1OHHA 2GFFA 1S9GB 2VDIA 1VRUB 5H9FJ 3VVTA 3W8GA 1D9DA 4G1QA 3TQ1A 5B0EA 1NDHA 1VQNS 4QYZJ 5DG7A 3PR5B 1FNXH 3MM6A 4WF9Q 2BGIA 4KRWA 2F4VF 2RSQA 3W5YA 3T3FA 2WJYA 3W3SA 3ZZZA 2IDLA 2ZZFA 3V6DA 4ZVQB 1HBMA 5HO4A 2EIXA 1EWYA 4NI2B 1NDKA 2HHVA 1C1CA 3IBFB 4Q7AA 1AIPA 2PMWA 4A46A 1G7SA 4DBQA 2G13A 3CTAA 3DM2B 5B6IA 2DR5A 2FLOA 4IQXA 2QN6B 3DLKA 4P52A 3HM9A 4UQGA 2QA4B 1V5IB 3SDEA 5KFEA 1Y0RA 5KTQA 3N28A 2DRDA 3NBPB 3CCRS 3MEEB 2HVIA 3RUBL 2HZAA 3PEHA 4B3RF 4P12A 2ZJQQ 3JTNA 1RU1A 2GHVC 5E3PA 3R8YA 2AJQA 4USMA 5HJYA 1NSPA 1GMVA 5BYQA 3QSYA 1YRXA 3JQJA 2J0WA 1C0UA 1URNA 5RUBA 5F8NA 3WBZA 4KH1B 3PXGa 4DV2J 1KR4A 1GAWA 1XR7A 4MMOA 2B4OA 5C2GA 3V2UC 2AGQA 3MMPA 1MN9A 3GJSB 1QTNB 4OHYA 2ZBIA 1UW4A 4QHYA 4J5OA 1CNFA 2OBSA 5IOLA 4ETXA 4N56A 1QE1B 3HCXA 3G2XA 1BMQB 4M4SA 2D3UA 9RUBA 4QZVB 3RBDA 1T6YA 2XWYA 2CDQA 5I3UA 3CC7B 2IRYA 5CYMA 3EVMA 3GVKA 3UI3A 2ZXIA 2AX1A 4DR4J 3D0GE 4OYOA 2V8VA 4ATNA 1KN6A 3EICA 1GXTA 4HI1A 3D9BA 5F8MA 5KW9A 1CEZA 2XZOA 1FE0A 4GRSA 3TX0A 3FZ2A 3LW5C 2H51B 3FBBA 4FXDA 1EQ0A 2HEKA 4F50A 4CO2A 1VHFA 3PYFA 2CJYB 4DSKA 1APSA 2NZ4A 5K14B 2WYRA 1NPRA 1YBTA 5JJBA 3FJOA 1JA0A 2VD3A 2DNNA 5HQLA 3UD4P 1RT2A 1IB0A 1UFKA 2AP6A 1WC1A 3IM9A 2HAIA 2CQHA 1TMMA 1TTHB 3LGHA 5FLXU 3CCMB 3V81A 3VCDA 4NLUA 3GVLA 4J9LA 2J5AA 3DRSB 3ZTRA 2WVFA 2VQFF 4B3GA 4EBDA 4RU2A 1I94J 3RG6A 1RQPA 1NRKA 1VQNB 3HHDA 3NL0A 3AXKA 2VJVA 3HVWA 1XMOF 3U27A 3SQOP 2EKYA 2VZ9A 2V7QA 4ZVPB 4DQKA 3ZNUA 2OPRA 4Y9UA 5DO2A 1TKTA 1Q1KA 3QRPA 2ZVSA 1CC7A 4F4YA 1M5PC 2C1EB 2FY8A 3ES9A 1RT1A 3CDUA 3CJ5A 2YKNB 1UJ4A 5MAOA 1UA0A 5F8LA 1RP5A 4JUZA 4WXOA 1GJRA 3TO8A 3N6LA 1VQ7B 1VC0A 3D1QA 4IG0B 1X5OA 2IRUA 2DNKA 2FD2A 4CZCA 3HXMA 4DV4F 3IN5A 4CLSA 2Y1IA 3MOZA 4DV4J 1VYAA 3CCRB 3CDWA 5BSXA 3WXMA 2KRRA 3FCHA 1U2FA 5F0WA 2DKOB 2AD9A 4F7DA 3T5KA 4QYRA 1YSJA 4Q2LA 3NOGA 1R43A 4Y65A 3AD8C 2F43A 1NK9A 4LF5J 2H48B 4DF8A 3GE9A 4F4AA 4FVCA 3OVSA 4XLFA 3DLHA 4A8YA 2NXUA 2QX0A 1WHVA 4PG6A 4DV5F 2HS0A 1RI7A 5LJ5Y 2XNQA 3P45B 3H98A 1FDRA 2F5GA 5KG0A 3P26A 1HI1A 1VQ9B 1NLKL 3ISNC 3I5BA 3KMQA 1NO8A 2J0XA 3US5A 3QMQA 1SQEA 5CZXA 2E5IA 1AB8A 3B4MA 4OYZA 2OBTA 2L41A 1SJ4P 3PRDA 2RHQB 2MKIA 1HLWA 1Q86D 1Y5LB 4HE6A 4RU9A 3FBCA 2MZJA 4B9SA 3U02A 2G4BA 2BEFA 3ENVA 1WHWA 5D4NA 2HWHA 4OMFG 3NE5B 4RD1A 2XULA 4I2PB 1FJGF 4RDLA 3NY0A 3ADAC 4P71A 3W60A 3PW2A 1T5EA 2DH9A 1WTBA 2VG6B 4RWXA 1DQ8A 1JNZB 4J91A 2P6SA 5KT5A 1RWUA 4DUYJ 4WIQA 1FRQA 1RWNB 5FO0A 1VK3A 4A4JA 8RUCA 3CXCR 3V6DB 3ZTSA 4ES3A 2VUGA 3KXDA 2CJBA 2JSXA 4ZVEA 1RT1B 3RW7A 3ETMA 2E5LJ 3EDRB 1LXNA 3RBZA 1IKVA 3BGRB 1TUVA 3KNAA 5KG3A 5CD4A 2FZCB 3HHLB 3M9NB 3RR8A 5D6GA 5IV3A 1S4MA 4JV2A 4KT0C 3CJQA 1RQRA 4U9UA 3U1MA 1FNDA 2DYIA 4GKJJ 3FEZA 1E3XA 3QSIA 4MYTA 1Q82T 3CCSB 3KLHA 4XMYA 4DL0C 3N9UC 5B09A 2DISA 3DRSA 1RJJA 3D1OA 3HHLA 2YQ0A 4NXMF 3CSKA 2HHUA 2APOA 1TL4A 2I6WA 2XLJA 3I6PA 2BW2A 3ITHA 4Y2AA 3T6JA 2JLFA 4Y9RA 1XTZA 3V4IA 1TL3A 2BM0A 1EARA 2GQ2A 3V6HA 5JBQA 3ZTPA 3BJYA 1WTFA 3LGMA 1V3ZA 1HBNA 2V4RA 4NLOA 4MH8A 1SB6A 1CG2A 3HVTA 2DGSA 3BKTA 1JLCA 5HMXA 3FCWA 1LW0A 1WF0A 3PEJA 4IQMA 2W9AA 4M2LA 2FC8A 1GAOA 3KHLA 2XSFA 4LF6J 1UVJA 5CXTA 2EKNA 3GIRA 4PYAA 4XAKA 2NR0A 3ZZUA 4AXJA 2KYZA 2FZKB
chains in the Genus database with same CATH topology
3VAIA 1WTHD 4QIFA 3B78A 5I3UB 1HI8A 2E1BA 2FGCA 2C3OA 3KNGA 3JSRA 3M2VA 3ISND 4RW8A 4Z1MA 5FLXY 1SJQA 4IOCQ 5E5NA 4DN9A 1VQMS 1U1NA 1WNEA 3OEHA 5G0RB 2VH7A 4CO0A 3DRXA 2HVZA 1FX0A 3C3LA 4ZHRA 5CQGA 5KFRA 3P6YC 2DPJA 1IXKA 1U25A 3DYAA 4MKAA 1L3TA 1VQ5S 3LP1A 2EI5A 1TKXA 2HMIA 4MAKA 2XI2A 2J9EA 2A2CA 2WK4A 2ADBA 2EFPA 4NLWA 4B3FX 3ZZTA 5E3RA 1ZPWX 2XZPA 2WB4A 3GIMA 2JEIA 3MTKA 3NAIA 2VG7A 3VR6A 2OSRA 1R6YA 4WE1B 5DRKA 3OTDA 2ILYA 3DLJA 1ZM4A 1ZETA 2IYGA 3POTA 4QIEA 4YMEA 5B7WA 1VK8A 3MUVP 5KFXA 2MKCA 5EGYA 3QZ8A 1NKCA 2LXFA 4CH0S 4MK8A 1JB0C 4JI6F 1DAXA 2QLWA 3GR1A 4D3GA 2UVRA 4NLSA 2XWXA 1FRMA 4WXWA 4NA2A 3I0RB 4HL9A 3AHPA 1R8PA 3I87A 4DLEA 1KQKA 1S1XA 5T7LA 3QGPA 3QLHA 4M1KA 5DETA 2IMWP 4JV1A 1SJRA 3AQPA 4PQUA 2QSWA 5D77A 3CF5Q 1C0UB 2E5HA 4JOUA 3OTOF 1TP7A 1ZM2A 3UCUP 2UP1A 4K59A 5JXSA 1JLEA 3GIIA 3MM5B 4K4UA 4CO3A 4L6V3 2EWHA 3DXBA 4K50A 2GQCA 3OVBA 1Y00A 1IBMF 4OZ1A 4UUWA 3EZUA 2J7WA 2IM2A 2QA4G 3HZEA 4EEYA 2A10A 4MYUA 4OI0A 2D3LA 5FDLA 4YY3F 3SCJE 1U1KA 3NBPA 3T1HF 1NK7A 3MECA 4E8UA 3LWLA 1PC4A 4M8LA 2CG4A 3BCFA 4LSNB 2WAQD 3HKZD 1H0HB 2WCXA 2VJJA 4XLAA 1HNIA 2XNRA 2DVIA 1X4BA 2IM3A 2VG5A 4UUXA 4Y2CA 1FRIA 2DGOA 2MZQA 2RVJA 1AXQA 2IVFB 3CMAS 4ELUA 4JI5F 3M8QA 4X64F 2IRXA 1Q7YT 2J7UA 2PGCA 1S1VA 3M8PA 2VFVA 3S1TA 4NLPA 3DLKB 4OIXA 1FVQA 3BSAA 3KLEA 2FHOB 4RW9B 2YWHA 4EFAC 4XONA 4TXSA 2QEXS 4Q0BB 1YIJS 4FZVA 4I1TA 2HHHF 1S1TB 3TYTA 1HPZB 2CQDA 1FRJA 3KWMA 3QAUA 1UD8A 3MDFA 4DUZF 3PKMA 3IO1A 2M8DB 4RUHA 1F5CA 2BQRA 1SI9A 1IKXA 1SJ1A 1VQOS 3DHXA 2CFXA 3KG4A 4LIWA 4YB5A 3ZFVA 5CH7B 2J6TA 4UOCA 2JJ1A 4G7WA 3M8SA 1WOPA 1YG0A 3WX4A 3KLGB 2JVOA 3PACA 1A7GE 1NHVA 4A47A 2YY3A 4ECQA 1HQUA 3P96A 3EPGA 4F4KA 2KZZA 2M7SA 3ZZYA 1IKYB 2HGMA 3EXCX 3HFKA 1T03A 4PG7A 1YJRA 4O3SA 5L39A 1WG1A 3ETOA 5A8KB 3RW6A 4I64A 3DDYA 4U7UK 1IJFB 5KFHA 2IAJA 3E01A 3MXHP 4Y28C 2GO9A 4H4KC 4LQ3A 1REVA 4UY8T 1FEHA 3ZZPA 1YJ9S 1SIWB 1M5SA 2XY7A 2HG4A 2OPSA 3HHKA 4P22A 3CT9A 1S0VA 2CVEA 1GX6A 2YKNA 4EGLA 1T02A 3OHAA 4TU8A 3QGHA 2E5JA 2OTLS 4PPZA 4O23A 1SUQA 3PZPA 3CCMS 2YKOA 5C24B 2XZWA 4TQSA 4WJBA 1S79A 3PW5A 4IFVB 1EETA 2UUTA 3GB0A 1I8DA 1PC5A 4ID5B 2VPXB 4URGA 5J1PA 4I67A 3JSBA 1S6OA 2FJDB 3D0HE 3MM6B 3L3CA 2GGPB 2W7AA 1PGZA 4KIAA 4RLEA 2NREA 3WQZA 1ZM3A 2OPRB 1FEEA 2DNRA 1TL1A 1U49A 4DL5A 2F1FA 3NCRA 3BR9A 4XDDA 3U7JA 2B9XA 1YVFA 1O5JA 3G86A 4I6AA 1TKZB 5DM7Q 1U47A 2J9DA 1S6QB 3N6NA 4ID8A 3SSRA 2M2BA 4PG8A 4WFBQ 2XCAA 3OJSA 4C9DA 4AVZA 5KFCA 2KG0A 3IRWP 1NB7A 3K5PA 2Z6BD 1U6FA 1FDAA 3EX7B 3GIKA 2DNHA 2IA0A 2UUWA 1KOHA 3LAMA 3M4XA 1D0EA 2XS2A 3MEDB 2UU9F 1LK7A 3RRGA 1KQSR 4M5DA 1IUJA 2X85A 3MM7A 3OR2B 4TKTA 3ONQA 3T1YF 3W2WA 4B9MA 3L09A 2GMLA 1IN0A 3OFGA 1VBZA 1JWWA 3Q23A 4F8RA 3CULA 4ED3A 2FDNA 3NMRA 1LWCB 1WELA 3DXSX 4XDCA 5HP1A 2HFZA 5LT5A 1PJ6A 2JX2A 3DDNA 3QGGA 4ILLA 2D9PA 4C0OC 3VAMA 2PA8D 2HGNA 3H25A 3AB2B 3KK2A 4I4BA 1EP4B 5K8NA 5IWAF 4OJ1A 3H40A 2LQJA 3RTVA 3CD6S 1TR0A 4ETZA 4RX6A 1RKIA 2YQ3A 4DK1A 3H2UB 2XY5A 5T14A 5KFUA 1WG5A 2P6TA 4QOTA 3WDOA 2I8EA 4XR6A 3KLIA 4KHMA 2EBGA 5GAHI 3IA0A 1OSDA 3MR5A 4X4NA 2DHXA 2HHPA 2M70A 3J7Z5 3QYYA 1M5OC 5HBMB 3E2EA 3DN9A 1MMNA 5KFGA 2Q6CA 4CH1A 5F9LA 1KS2A 2JFKA 5K5MA 2FVPA 4J37A 4XLHA 2M0GB 2YNIB 5DS7A 2FY1A 4BC7A 3SV3A 3O5TB 4ZVHA 3UR0A 3GIJA 4X4UA 3OPOA 1SIZA 1T3OA 4DDFA 4UY85 4WFXA 5G4DA 2HYIB 2VFTA 4LT6A 2E9ZA 3DRPA 5E3QA 5KFWA 2DGXA 4KV8B 3BGUA 4O4GA 2MKJA 4R0EA 5D8HB 4XOPA 3N5BA 4DG1B 4LFCF 3HHNB 2K3IA 5GADU 3I4PA 1K9MT 4FXVA 5K14A 4QWDA 2JL9A 3MD1A 5E33A 1SH0A 2WSSA 4ZPDA 2FJXA 2YTCA 2FVSA 2C3YA 2ZHOA 3NNHA 3TW0A 1LWEA 3B8HA 4PWDB 2VB6A 1KFDA 2LEAA 3JTPA 5A8RA 4ITSA 4PXDA