1NRKA

Ygfz protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
325
structure length
325
Chain Sequence
MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YGFZ Protein
publication title Crystal structure of the YgfZ protein from Escherichia coli suggests a folate-dependent regulatory role in one-carbon metabolism.
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1nrkA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1nrkA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nrkA01
3A8JA 1VLOA 1PJ6A 1V5VA 4PAAA 5L46A 1WORA 3GIRA 3A8IA 3A8KA 1WOSA 1PJ5A 3GSIA 1PJ7A 1VLYA 4PABA 4P9SA 1NRKA 1WOOA 1WSVA 1YX2A 1WOPA 1WSRA
chains in the Genus database with same CATH superfamily
1EP4B 3KLFA 2JJ4D 4TYAA 2X85A 2WONA 3H2UB 3LAMA 3S8SA 1FJGJ 3OJUA 4FNHA 2WCXA 5A8WA 3CJ2A 1N06A 4Q7JB 2VA2A 1X9SA 4QWEA 1LXJA 2C2NA 1QE1A 2BA9A 2VPZB 3VGVA 1SJQA 4N8NA 5KNLA 1IN0A 3PDNA 4JI3J 5AXMA 4JI5J 3BY1A 5D6GA 2K06A 3RG6A 2J9DE 2OBSA 3CJTA 1YLXA 4L75A 3LP0B 5KFPA 3PZPA 4QFMA 3E3XA 4C8KA 2R2RA 4C98A 3W60A 1K0VA 3DGPA 4CO3A 5KG4A 3A3NB 4UY8T 4K4ZA 3WC0A 5IZHA 1TUIA 2R7SA 3HFVA 4RX6A 4XIUA 3CVKA 2YX7A 1VS3A 4A8SA 1NBMA 2E1BA 3GFHA 4RO0A 3CNQP 3MECA 4ZVUB 1FE4A 3FBFA 1TELA 1VBZA 3GLJA 3M32B 3M8QA 2AYGA 4DQKA 2HNDA 2YQ0A 2V68A 2EC2A 2VBUA 2NZ4A 1HWUA 3V6KA 3CCSS 2V8VA 4JV0A 4JV5J 5K14A 2DHXA 5HXBA 3A8EA 1C1CA 2YKPA 1S9EB 3VAFA 2C3PA 3T1YJ 1RWOB 2OGUA 1SJFA 1AT1B 2Z8QA 3QZ8A 2F4VJ 1W2BB 4EO6A 3ULHA 8AT1B 5HI7A 1FNDA 4LR8A 4H4KC 1CJTA 4S0MA 2D3LA 4X06A 3MEGB 2FJEB 1VLYA 2MQ8A 1S1WA 1YTYA 5A8RB 3M4XA 4B43A 2O5DA 2KVOA 2A3JA 3H59A 1YBTA 4JUZA 4LF2A 3E1YE 1TFYA 4A47A 4IW3B 3L09A 2F8MA 2B7CA 2J0QD 2X53S 1WHVA 3AB2B 2Y1JA 4OHVA 1S57A 3LTOA 5LSOA 1U1MA 4G1BA 3GILA 3CCES 1W2IA 2CDRB 4TY8A 3S01A 4U8VA 5I3UA 4CYUA 3L95X 3D28A 3VMFA 2XWYA 4C0HA 2FIUA 2GVZB 2JFKA 2GC8A 1IBMJ 2YKNA 3I0SB 1B70B 3SDEA 2QN6B 2CQGA 2Q1LA 3QSIA 2W7OA 2CZVC 4ZGNB 3SJPA 4OX9J 5E33A 1D2EA 1U47A 1EIYB 3PJWA 3KJFB 4B3MJ 2K7KA 3GV8B 3E8OA 3U6BA 3A12A 4L6V3 4F7VA 5I42B 1YIJB 3CW2A 2XCPA 1JNRB 5HATA 4V19X 1TKZB 2HVDA 2HHTA 1PC4A 2ZL7A 4B3SJ 3G82A 3QATA 3TRGA 2CPIA 2MZJA 2ZJPQ 3MMAA 1WF0A 2B0GA 3CCRB 1YZ7A 3T1HJ 3CC2B 1BMQB 3HULA 3W2VA 4EUVA 4B9TA 3G6ES 1S48A 3IGNA 4QQBA 3BN7A 2VNKA 3ZTPA 2KFZA 1JLGB 1U1LA 2C2EA 1SH0A 2V2KA 2ZZTA 2V4QA 2VKZG 4PQUA 2RF2A 3Q8YA 1HR0F 2H65B 2FZGB 5HN0A 3KMSA 5HQLA 2LQBA 3ZZOA 3HFZB 5DDPC 5E5NA 2B4VA 5J1PA 1R6YA 2XNQA 3B4MA 3NCQA 1TV6B 5DG8A 3UD5A 2HHQA 4Y34A 1VF7A 4DL5A 3SLDA 3V6DA 4O4GB 5DGAA 2RS2A 2DNQA 1NH8A 3UN3A 3GJSB 2ZOGA 1JXVA 5ETPA 1QX4A 3IRXA 1ACMB 1IBLF 2XMWA 2LQJA 1BHNA 1RKIA 3KXDA 3FJ2A 1C4AA 2V2ZA 1VQNS 3DDYA 1N36F 4CQJA 2JVRA 5HMYA 1I94F 1YLOA 1IJEB 1TL5A 3HMJG 5ETRA 4DF8A 9ATCB 1F9FA 2M8DB 3BGRB 2W7PA 4XPEA 2B4OA 2K8GA 1CS4B 1NHKL 5FA6A 3NAIA 4H4MA 5IV4A 4KTQA 1ZAWA 2GHPA 1PSDA 4P52A 1OYDA 3MOJB 3LQ6A 3MEKA 1QFYA 3DLLQ 3R5DA 1HW9A 2R7VA 4XLCA 1NH7A 4DV1J 2HVHA 1HBUB 5JJBA 5CD4H 3OL9A 3CDAA 4MFBB 1KKHA 1BMFA 1PBUA 1VK3A 4ZVOB 2J9DA 3O5TB 5KFHA 4GKKJ 4KSEB 3IBCB 1MROA 5J1EA 4KE5A 2E44A 2G9OA 4YXWA 4O23A 5A0YA 1UKUA 4ECYA 2CQ0A 4NCGB 4RU2A 1RT4A 1S9GB 4BLGA 3SV4A 1T6XA 3FKSA 4CCHA 4YDDB 1KRPA 1BQXA 3V6JA 4NYOA 3A35A 2WSFC 3VVTA 4JI1F 2P9GA 2X3DA 4Z7CA 4RUAA 2IVMA 2K3KA 1DDIA 1S1TA 2XY7A 3RR7A 1T03B 4HE6A 2F43A 4RU9A 2L41A 2WAQD 1BQMA 1F3FA 5DDRC 2XS2A 3A13A 3I82A 2XEXA 5HP1B 1K73T 3WNBA 3QGIA 1VQKS 1NHVA 4UZCA 4ECTA 1YJTA 4KPYA 3C6UB 1J27A 4DN9A 4OMFG 2ZE2A 3KLGA 4DV6J 3ASPA 4U7CA 2VBZA 3QT7A 1FCAA 1CULB 1KJZA 4U7UK 2ABYA 2ZXHA 2FY8A 3DLGA 3MR7A 4E8UA 4FF3A 3TA1A 1Q86D 4AL6A 2QRRA 4DDFA 2RAQA 2ZVSA 3BGFA 1B0TA 2NSBA 1CQMA 1XNQJ 2X1FA 2DEJA 2WZNA 3SQOP 2ZH2A 4IG0B 2EBGA 2GJ2A 2J8AA 4YB7A 2M9KA 3FRZA 1XJWB 1SCJB 4ES2A 5K8NA 3DLBA 4CT9A 1NZ8A 2GQCA 3VCDA 3JYTA 1XMQF 1T7PA 1OSDA 5KG2A 5KSWB 4KFBA 4CLTA 1RT5A 5LMZA 1Z1ZA 1RADB 1N54B 4K4VA 3ONQA 4X65J 3AOCA 1WSVA 4DN0A 2CQCA 3H0PA 3Q89A 2FDNA 1OQ3A 2X51A 4NLVA 2VJIA 4G3IA 3CCJB 3TUZC 1W2BR 1NM2A 3MXHP 4EBDA 4AE5A 1HIYA 1RISA 4OI4A 3H94A 4M1KA 3H7HB 1UD6A 2LQ8A 2PMWA 1RU1A 3KG1A 5C25B 2XC9A 1HBMA 1Y3JA 5DM7Q 1XQIA 3KHHA 3MMJA 4QV2A 2G2ZA 1RAFB 3PW5A 1I7PA 2XNJA 3JSBA 5H9EK 3MMBB 4I68A 2RRAA 3CT9A 3SV3A 2VOOA 4DX8H 3T51B 2GIRA 4LQ3A 3A3GA 4I2PB 1Q86T 3M8ZA 3TA2A 2DB1A 3OZUA 4RUBA 2EW9A 3BH4A 2IDLA 1G7RA 3AOAA 2R7UA 2VG6B 1NJYA 1OY6A 2BR0A 2RILA 4OZJA 1RACB 4ZDNA 3TR5A 1X5TA 2BACA 4DU8A 2HFOA 2XBPA 3ITHB 2QYGA 2B6AA 3UR0A 1K1SA 1KBRA 3HF5A 4EGLA 4K2JA 1SXLA 1U2RA 3M2UB 5ETQA 1TL1A 1M90D 4MIBA 1NK5A 3OFNA 1UFKA 2QA2A 2LDYA 5KFVA 4F0MA 2HS3A 1PYSB 3TJ9A 5BSXA 3BCFA 2B4PA 1RAOA 1UVMA 2BE2B 2M2BA 1VQPB 4DX5A 3TW0A 2FC8A 5IFMA 2NREA 3FNNA 5KG5A 4K4UA 3ET6B 3CJSA 1IKVB 1T05A 3GB0A 3S7RA 1SKSA 2BBEA 4I6YA 3ZZTA 1LW2B 3LNNA 4G7XA 4PPZA 2MPUA 3X1LB 3UDCA 4CM0A 1TL7B 2FC9A 4YEAA 5KFCA 3DMJA 1HARA 1GMWA 2EFVA 3EE3A 4N56A 4EZ9A 3QZ7A 2DRAA 3KUGA 2QLJB 4KIAA 5E3PA 4QU6A 3MEEB 4ECSA 3OT9A 1KC8D 3M2VB 1APSA 4NLSA 1TKXA 3M30B 4CH1A 1VQ4B 2QFIA 4NRTA 2ZTNA 2GK6A 4B3FX 4W98A 1G7TA 5CH7B 1PO6A 1NRKA 1FXLA 4OJHA 4LRAA 2C2RA 1U4BA 3CCUB 4JI4J 4Q7AA 4QPXA 3LO3A 1U7LA 2YNIA 1SC3B 3MM5A 5A8KA 5E7OB 4RD1A 2J5AA 2XLIA 4ZVGA 2F7VA 4CLSA 4Z4ZA 1TK8A 2BN4A 4UUWA 2MXYA 3Q2TC 3SFGA 2PDAA 4PC2A 1YJVA 3HP6A 4N76A 3HVTB 5KFAA 1X4DA 4J0QA 4B3OB 3RRKA 3T41A 2AU0A 4HL9A 3I9V9 1NSKL 4FVMA 3QAUA 3W62A 4ID5B 1X4AA 2GZOA 5KFSA 3V6HA 4U67Q 4EH1A 4A8FA 2AX0A 1NPRA 4ANCA 3WY9A 4ER8A 4M0LA 5TY0A 3CD6S 2WW8A 1GVHA 5JVGQ 1WJ9A 2FX3A 1FKPB 4QVJA 2Y1LB 4C7QA 2IJRA 2BKPA 3CDBA 1KC8T 4OPOA 3VR6A 4O3RA 2APOA 2RC5A 2YX1A 1YJ7A 3G6YA 4PG8A 3NMRA 4DCJB 2BABA 1H42A 1M5VC 4Y2CA 3I5CA 2R7OA 3ZNJ1 4Z4UA 3LALA 3TUJC 4AXJA 1XIQA 4CH7A 1QAXA 2HWTA 1RWWB 2B56A 3CD7A 3WXMA 1OIAA 2DNLA 4Y0FA 1VHIA 1DQAA 5EWFA 3GONA 2ZZFA 2W01A 1RKJA 1E6YA 2A0FB 3N01A 3IC1A 4RW7A 2XNDA 2BGJA 1DURA 3W1YC 2AJ2A 4LBHA 1HR0J 3W2WA 3UO0A 4X7CA 2GJPA 3EX7B 4F02A 5FDLA 3MM9B 3HSJA 2D41A 4EWTA 1CJTB 3IWLA 2B43A 4DUZF 2ZBPA 1H72C 1VCTA 3M2RB 2H5EA 3D68A 1NJXA 3LQEA 2YVSA 2DNPA 3NCRA 3HT0A 2OIHA 3V2UC 3ZC3A 2JHEA 4LFAF 3H4BA 1IBLJ 1K1QA 2VBYA 4NI2B 3CCEB 3TO8A 5GAEU 3Q3AA 4FNIA 4EBCA 1YRTA 1KD1T 3R2CJ 1N36J 2HEKA 5DN6A 1I94J 2N3OA 1TK0A 1RWNB 1GMUA 7AT1B 4DR1F 3ZTQA 2DGWA 3SDEB 5FD1A 1D1UA 4DS5A 4DFKA 2OPPA 1AMOA 1Q0NA 4XN3A 2ZDPA 3G8SA 4M2LA 3K5OA 1DZ5A 2NXNA 4E2FB 4PABA 4IRDA 3BJYA 2EXUA 3C3LA 1NXIA 1GAOA 1ROFA 2DPIA 3VAGA 4YDXA 3UE2A 3GG1A 2R9VA 1KQSB 3F44A 4QR2A 5ETLA 1PJ7A 3ILOA 3MMAB 1O5JA 2RC6A 1R8CA 1YHQS 2BMBA 3TWZA 1FDNA 1V3SA 1SL1A 3H20A 2GMJA 2ZFHA 3G6EB 5TRDA 3HKZD 4TXSA 3L9ZA 4OZNA 5J2NB 2E7WA 4PYAA 4QR0A 2JWNA 1UFWA 2HQIA 4ZMMA 3GQCA 1KVIA 4PEOA 4C97A 1DHMA 1FDDA 4WBFA 4ALZA 2HHHF 1M5KC 1RT1A 4KH1B 4R8UA 2V7UA 3UCUP 2A2CA 4MIAA 2CNKB 2KDOA 3MD1A 2HWHA 2EC0A 5ETNA 1LFPA 2FUG9 4BWJA 2HBZB 1QY7A 5B0BA 4JI1J 2LU1A 2PN6A 3ZBTA 1JLQA 3CULA 2WHOA 3WYAA 1TK5A 3P26A 2I0XA 3OD2A 3BH6B 5FIIA 2FVRA 2HRTA 2DO4A 2KZMA 2W2MP 3G4SS 3D3CJ 2VNIA 2MQMA 2HMAA 1DAXA 3VO1A 1EETA 2LXFA 1VRTB 1LOUA 4BPRA 2AHOB 4RJLA 1UD3A 3IRXB 2IFXA 1I6JA 4FF4A 1F20A 1HWIA 3AJ1A 1VQNB 3JB9k 3H5YA 2M4MA 4II3A 1EP3B 3KLVA 4M5LA 1JJ2B 4TVAB 1RWKB 1JLAA 3C6TA 4X84A 5HO4A 1RAAB 2U1AA 4LF7F 2JNJA 3K2YA 2OELA 1SUQB 4B3RF 4AUKA 3JU4A 2IVYA 1XQBA 2PEBA 4IG3B 4DR2F 5FL7A 1RT2A 5I3QA 2MKCA 4RKUC 1R27B 5KG3A 3MAQA 3C16B 4OOXA 1IXKA 2BJEA 2D74A 2HFZA 1VJQA 1CQNA 2UV8G 3EZ5A 1E1QA 3IR7B 5MAOA 5E3CA 3MFHA 3NGUA 1XMQJ 3MAHA 4DQRA 4QYZK 2QA4G 1KR4A 4OZ2A 5IT9U 2KKHA 2RQMA 3QFSA 4DSEA 1K0TA 4K59A 3UDLA 5A0YB 5BYQA 2CPHA 4Y3CA 4QU7A 4KV8A 3PM9A 3CP8A 3M1VA 2V9WA 2VNHA 1SJ1A 2Y0BB 2ZWPA 3RR8A 4OYBA 5DRKA 2UU9F 1HNIA 1XTZA 4H4OA 3M8PA 1ZM3A 5L1IA 1KOHA 1JIHA 2RRNA 1CPZA 3NXZA 3MOZA 4RLEA 1NK9A 3QRPA 3LP1B 4FN5A 1F0XA 2VJJA 4DL3A 2R8GA 3IR6B 4JBCA 4LF9F 2L48A 4UT4A 3DN9A 5B0FA 3CJKB 2FHMA 5BR8F 1R0AA 1J5OA 5T7LA 4CNYA 4P7VA 1AUSL 1VQKB 4XOPA 2FVQA 3QFTA 2RT3A 4O44A 3CIZA 4NRUA 4UOHA 4II2A 5IYRA 3W9JA 3M7VA 1KFSA 2W9BA 1S1VA 4QHYA 1MMLA 4YR3A 3D5MA 2ADCA 2HNZA 4CIOA 2RS8A 2BRLA 2J76E 4DLEA 3ES9A 2JLEA 4LF4F 1N05A 2O66A 2YNFA 3ZZYA 4ELVA 4USJC 5C7PA 3EYZA 2L3MA 2ZD1A 4ZCMA 4YHBA 2WB4A 3LF0A 1FRQA 2VYQA 1X5SA 1JNZB 1YRXA 4EFAC 3RBXA 1OHHA 2OTJB 2MSSA 4NLUA 4J9LA 3QSYB 2DIUA 4EK2A 1T0TV 3JYTB 3QT8A 3B54A 3OKXA 4Z4SA 1FWPA 1Q8KA 1RT5B 2IRXA 2RH3A 3NKYA 5GMEA 1PJ6A 3OE7A 2IBKA 1Q1KA 4PWDA 2OPSB 3HHLC 3UI3A 3HCXA 1YZ6A 3VAKA 1DDGA 1F60A 3H2LA 2OEKA 2YNHA 1YVFA 1FX0A 3IA0A 2MKJA 4C8OA 2D3O1 1IQZA 4TKOB 3LP2A 2IPOB 5FO1A 1I18A 3MM6A 1KDNA 3M8WA 5EX0A 2HIYA 1DFDA 3PW2A 2FJXA 1YJNS 3C15B 1VI7A 3BN4A 4DCOB 5DETA 1FRLA 3J7Z5 3FZBA 8ATCB 4ES1A 2LECA 1WOSA 3JQPA 1R0BG 3SI8A 3OSNA 4TLQA 4B48A 4N47A 2D9OA 3OUYA 2V50A 1A7GE 1URRA 3DYAB 4TU7A 3R5JB 2UZAA 2VG5B 3HKWA 1LEOA 4KBIA 1RYSA 3N28A 1U24A 3O1LA 2Z30B 5IT4A 3MMCB 3N5BA 4DV4F 1B2RA 2OFHX 3MPYA 4EBEA 4F3MA 1KVKA 3LUYA 2HLTA 2CQ2A 3MTKA 4XK8C 1S0OA 4XONA 1TL1B 2ROEA 1OS5A 1QG0A 2EI5A 1RHQB 4J9PA 1NK4A 1DLOA 1UD5A 2HCJB 2IA0A 4LBVA 2LVWA 4RDJA 1QDUB 1YGYA 2X8KA 3OR1A 4FXVA 2Y8WA 1GH8A 3OEHA 4DQQA 2RSQA 3NS5A 1EXMA 3J81Y 2WBMA 2XMKA 5K20B 1ZTWA 5BYRA 4OL8A 1ZH5A 3QLHA 4FKXA 3HPOA 1BWEA 3FCVA 5CQGA 4J9OA 4KGXB 1N6QA 4LBZA 1JKHA 2ASYA 3DMJB 2W1BA 1MW7A 5ETSA 2EKNA 4LQ9A 1QGAA 4P2NA 3I55S 4ENOA 1U0HB 4CO1A 4DG1A 3IBFB 1JLEB 3GFYA 3QGHA 4DPOA 2HQDA 3D0GE 2D3UA 3MR6A 1HI1A 3UDEA 3HSZA 3OFEA 5E0OA 3VAHA 3KLIA 3CXCB 4G6VB 2RU3A 1IR0A 4X7FA 5KAKA 4DL0C 1W9XA 2K7JA 2C28A 2W8KA 2OPRB 4DUZJ 2MZRA 4G65A 2ALYB 2PEHA 2XM3A 4DR6F 2YNIB 2FB0A 5A8KB 2VC1A 2QLXA 3GMGA 2WSEC 2BSAA 4FBTA 3MHYA 5GADU 4YAFA 2ZH6A 4LFAJ 2AJ4A 2OUGA 3K5MA 3M6VA 3IGVA 2WSCC 1G7CA 4H9GA 3TZWA 3U1LA 4IUFA 2V9KA 2MLYA 2JN9A 3VGTA 4LFCF 3ZIAA 1RT3B 3DOMA 2YKMB 4DR1J 3PFEA 3PYDA 3OQ2A 4J9SA 2NPFA 2V2QA 2IDEA 2VC0A 2CJ9A 3PJXA 3CD6B 3K0JA 1PC5A 1FRNA 2DCUA 4P74A 1SV5A 3BQ1A 4WYLA 3LAKA 4KKTA 2C5HA 2LU2A 1N56A 3HLUA 2OLWA 2R6HA 3DOLA 5KFEA 3WNDA 3DFEA 5ITHA 2AJQA 2HHPA 3KWMA 5CYQB 4IDKA 1IVZA 2HMIB 3CPWB 2DD8S 4WKYA 2QE7A 3BYRA 1J2VA 5L1LA 3AQPA 4C0BA 5A2QY 1XMBA 3T5KA 1U09A 2DH9A 3T5JA 4JI8F 2DCLA 4WP8A 2NSCA 1QVFB 2DRBA 1FEEA 2G0CA 1X7VA 3SEOA 1VQOB 3T9ZA 2XY5A 3QT5A 2Z56B 3R2DJ 1FDBA 2HHHJ 3J7YU 4RW9A 1E6YB 4FYWB 2OJ3A 5HK4A 4RW7B 4ZLNA 4K2XA 3IN5A 3JTPA 1JLBB 4PRFA 2M8HA 3HHNB 1TU0B 3L7UA 4Q5VA 3MR5A 4DEZA 2ZZNA 1P4MA 2HG4A 3UCGA 4ECQA 1UZDA 2X1GA 5EX3A 1T9XA 1VBXA 1JLCB 1SBRA 1GR1A 1YG0A 2CQ3A 1MWZA 3T9NA 1UA0A 1GK8A 4Y28C 1FK9A 2DH7A 3QGGA 2BXJA 1IBKJ 4IRKA 2QZ8A 3ZBUA 1KS2A 3QNWB 2OMLA 2B9EA 1M5HA 3KKFA 1Q7LB 4LF7J 3PYEA 5FNZA 1I3OB 1M5SA 2BX6A 2VA3A 2EFPA 4B3RJ 4KHPF 2DKOB 2DISA 2CPJA 4DR2J 1L3VA 4DSFA 1XR6A 2F8EX 3DRRB 2FJWA 2H51B 4FWTA 2ZH1A 2MGZA 4G1IA 2DNYA 4UOGA 4WZTA 2CVIA 1ZM4A 4AFFA 4OJ1A 3MCAA 2GREA 1VJWA 1YHQB 4OX8A 1SKYB 2AGPA 1I1GA 2VG7A 4CLLA 1TMMA 4DOZA 5HBMA 2Q6OA 1FRIA 3J81j 4RW6B 1ZOTA 4F36A 4ZN1A 4RD4A 2NUHA 1YWXA 1B99A 3ZZZA 3KLHB 4DF4A 2V4JA 3W5XA 4C11A 2CWKA 1Y10A 3FGVA 3IS9A 2ZHOA 1GX6A 2DH8A 1A9NB 2Y3YA 3CMES 4OI1A 3PY8A 3JQMA 4M53A 1VYAA 2OMOA 1IKWA 1CJUB 1TVRB 1DTTB 1UAWA 2UU9J 2RVJA 1OB2A 5L1KA 5DQHA 1BGXT 5KFNA 1XFOA 2XMAA 3W66A 2B9YA 3RB0A 3RAXA 4RW4A 1D8ZA 2C2DA 2XHCA 1NDPA 1KEKA 3G4SB 1WTHD 2MQPA 3ELHA 2VV5A 3LO8A 3QE2A 1QFJA 1SJRA 3WZ0A 3RBDA 4CP5A 3BKTA 1TQLA 2YPZA 2DNGA 2HGLA 4LF9J 3RW6A 2YKQA 1TUGB 1X0FA 3CJ3A 4X66F 1TAQA 2V7VA 3UCZP 2MLXA 5BR8J 1IR2A 3VNVA 2CK3A 4B9MA 5F3TA 5A6PA 3H5XA 1FERA 1LK5A 3TX0A 4Y9RA 2QMXA 4X0CA 3VALA 2EPIA 1UD4A 4DBQA 1A6LA 3TVZA 3CMAS 2ZITA 1L3UA 2N82B 2K3IA 4ZITA 2MQOA 2OBRA 3T6BA 4F3OA 1EFCA 4F3QA 1SKWA 4OHWA 4MIWA 4XKWA 2U2FA 4LF4J 3M9MB 2G2OA 4QIWD 4C8ZA 3OSPA 4P72A 2JOQA 1H3DA 3T1AA 1C0TA 5B08A 3EJMA 2RQKA 2UXCF 4OP7A 1BUXA 1Q81D 3P49B 3T19A 1OY9A 2H3EB 2AW0A 4ZS6A 1T9UA 3RB3A 3FEZA 3A8KA 3BS9A 3MM7B 1FXRA 2BM0A 1FWLA 4C4WA 3H25A 1RCOB 4TMZA 5E3AA 2HFVA 4FYVB 4YB5A 3V81A 4PXEA 3PRBA 4WYWA 5ETTA 4PPDA 1Y4ZB 1S9FA 5K8PA 1KVJA 3QGPA 1IKXA 3CXCR 1HNIB 4BC9A 4B08A 2AEJA 3MM8A 3OLBA 1EKRA 4RNMA 2XI3A 2CJKA 3MCSA 1HQEB 4X62F 2J6UA 3KDOA 4Q43A 5G4DA 3VWSA 4CNZA 3DLKA 2GQQA 1TL3B 2WTFA 1KHVA 4G7WA 3CC4S 4Y9UA 3UDVA 4LIWA 3W5ZA 2XZDB 3CESA 3C14A 2AJFE 2XZOA 1HBOA 4JI6F 3ASQA 4HDGA 3MFIA 4DFMA 1PCAA 4IQXA 4IR9A 3G71B 2C42A 3R7NB 4N41A 4KKUA 3OR2B 2F8HA 1S10A 1U2FA 3HZGA 2ZJQQ 2LEPA 1Q81T 4ED1A 2P9EA 2DR7A 2KXHA 3PX4A 4RM0A 5IM0A 4DV4J 1OY8A 2W7AA 2UUTA 3K8WA 2W9BB 2Z58B 4XPCA 5C24B 1VC6A 2HNZB 3K8VA 4U9RA 3W5VA 4WFZA 2POKA 3ETMA 1UPMB 2PSZA 4GRSA 2YNFB 3OJWA 3K89A 4B9LA 2ZD1B 3DU5A 4OHXA 4U8YA 4NZ0A 3RBZA 4NEYA 3KEWA 3G8TA 3CPWR 1XERA 4CTAA 2YTCA 4QUZA 1RE1B 1B64A 1K28D 3DXSX 2V31A 3BY2A 1YITB 2VD3A 3FQKA 3GG0A 4MK8A 1BX0A 4Y65A 3HO1A 4Z1MA 5DG9A 1GT8A 5KW9A 1CSJA 4B4DA 3GSIA 4CLYA 3EVWA 3KDNA 4ZGQB 1GMVA 1FESA 1KFDA 2VZLA 1U1QA 1S97A 4X4NA 2LQ9A 3IP0A 2XZPA 4PAAA 2ZKUA 2YNHB 2HWIA 4KO0B 4EO8A 2KFNA 1D1NA 5HMXA 1VFJA 2M7SA 2VZ9A 3I4PA 2RMLA 3JS9A 3P5BP 3FJOA 3HDSA 5TV2A 3BO4A 3CRZA 1SVDA 3MM6B 2MZTA 5LJ3Y 2ASJA 4DV7F 3ENQA 4M94A 2IMWP 2GHWA 3SIPB 4X4VA 2W4PA 2F9DA 1OO0B 1NPKA 2BE7D 2XQCA 2KM8B 2ZL6A 4DNRB 5GMKa 3SCKE 2ZVIA 1RWMB 2VPWB 4P3YA 8RUCA 4ZVRB 4DR6J 2BW2A 2EIXA 3GIRA 4YELA 1ELOA 1E79A 3I87A 3LANA 4LSLA 2ZKTA 3WQZA 4ZP7A 3KL9A 1GTEA 3UR3C 3KYLA 3E2EA 2HVIA 2VNJA 4KYZA 4LFCJ 4A8OA 4MMOA 4LVNP 1SC6A 5HAOA 3DDNA 4BCAA 4DV3F 2KHCA 2M5YA 3PR5B 4XN0A 2I1RA 3OR1B 4HIZA 4TMWA 1HNVA 4E98A 3HJFA 2R3VA 2BV3A 2ZH4A 4DR4F 4B47A 3CCMB 1DQ8A 3AODA 5HQ8A 1HD0A 2RQCA 2X7IA 1U25A 3Q6RA 3QLHB 5LMNJ 2R8IA 5KFTA 4X4UA 5LXYA 1T9TA 1ZAXA 3KNAA 1YK9A 1TKTA 2HFSA 1F3VA 1TUVA 3NCPA 4XTTA 3JSYA 2E7XA 4JOUA 4P6YA 3N0VA 1C0UB 5F8LA 4HDHA 3QFCA 4ZPAA 3ISND 3VR1A 1H7XA 4ILLA 3OXGA 3I55B 4JI8J 3IG1B 1UVKA 4DG1B 4MKVA 2X6WA 3P45B 2XGPA 2HS4A 4OI2A 3D2WA 2VJUA 5GAHI 2LLZA 3WX4A 2IJFA 1OSCA 4AF7A 4IH6A 3JAMU 3FC9A 1URNA 1VQ6S 2MMYA 4N5SA 3DLEA 5HQMA 3KLIB 3KK3B 1MWQA 1XE1A 3PHEA 1WEXA 4OYXA 1HHTP 2MEWA 1H73A 4P2FA 1TLLA 2D9RA 4E0FA 1SQGA 3BF4A 1QTMA 1RK8A 4K0KF 4HKQA 5J35A 3CCVS 4PC6A 4DR5F 3BGUA 5H9FK 3VAJA 2CC2A 4IRCA 4YUDA 1S5ZA 1MG7A 5IS2A 1AB8A 5D77A 2BM1A 1UJ4A 4B17A 5KFOA 2HBRB 3GIKA 4FXWA 4WK3A 3PUMA 4KKOB 3MAAA 2XZLA 4YHHF 5HROA 1SL0A 2KYXA 1TKDA 2XSFA 3I4HX 2VBXA 3H4DA 1IQTA 1VC0A 4QR1A 4AC9A 4KHPJ 2OSQA 2DGXA 1RDRA 2B7BA 2ATCB 4M5NA 1SV5B 3H42A 2V4DA 3SCJE 1FXDA 5IYPA 1S1UB 2A18A 4O3NA 1YKWA 3A8JA 5F8JA 3FSIA 3R1LA 4USKA 2OYNA 1UFLA 4IDKB 1GMWD 2GIFA 2QL7B 2E1RA 2V0NA 3CSKA 1MU2A 2NLWA 3NP5A 5DGBA 1CJKB 3HHEA 1XEZA 1BQNA 2HRYA 4DFPA 2KI2A 4ED2A 1VQMS 1WD6A 2G0IA 1Q78A 3I31A 4A8WA 4RW9B 3MCMA 1UTAA 1V9OA 3I96A 4YR2A 4EU0A 3FMWA 4RL1A 5A8AA 1I5OB 1G1XA 3EPIA 2AP6A 2ZZEA 1RAHB 4L76A 1RTDA 3V4MA 1RTHB 2DYIA 4N77A 4LRCA 2IC3A 5AE2A 5HVFA 3CW2C 1WDTA 1AROP 2VFRA 1N88A 4X66J 3I32A 3N79A 4DPWA 2COLA 4LF8F 4WK1A 2BANA 2IYGA 1FT8A 2MZ1A 1HWLA 2B5OA 2KB2A 1RZMA 1B7YB 4B9VA 3DI6A 2OH2A 1UWAA 5DSZA 5J2QA 4I64A 1FRJA 5D78A 2XS5A 2DXDA 1EHWA 1W0JA 4B02A 4JV1A 3UVJA 5C2GA 2X3UA 2PA3A 3RJMB 2ACYA 4RDLA 4K8RA 5KFRA 2VIHA 4QPTA 1LWCB 2W24A 1IHMA 3UN2A 1AUDA 3ZZ0A 4KB7A 2E29A 3WDOA 4IOBA 1NDKA 1EZZB 2O1PA 3MCNA 3VHQA 4NE9C 2MGZB 3E01A 4P1VA 2RKIB 2UXCJ 3RB6A 2HZAA 3Q2SC 3OLAA 2YH1A 3CCWA 3JSRA 2VG7B 3DRPA 2NXCA 3A3OB 1GXTA 2N4DA 3HHLB 3CCTA 2JJ1A 3W5UA 1N5YB 1EP2B 2RIJA 3AA8A 2QGFB 4C11B 3MTJA 1HPZA 3GVKA 4CLUA 2F1LA 1TAUA 1S6QB 4ZPCA 1RTZA 1HA3A 4NA1A 4NPOA 4M5DB 1J5EF 1WG5A 3OXFA 1VQ7B 3CMMA 2E9RX 3KK2A 4P2XA 1U2CA 3NAHA 4RW4B 3OJSA 4ITSA 3PW4A 1RA7A 4X62J 2ATLA 4PYDA 4ED4A 5A88A 1TTHB 3POTA 5BSYA 2MY8A 3H90A 2C4UA 1SH2A 5CDFA 4M5IA 3VVUA 5HANA 4ELTA 4UTGA 4JI6J 4DL7A 1UEVA 1OQ6A 1FNBA 1X4CA 1L3KA 2AGOA 4OZLA 2BJ3A 3CPXA 1P8GA 2YKOA 3PYGA 1RQPA 2VHGA 2YNGA 2CWXA 2WYRA 5EWEA 3GVLA 5BJRA 2R9LA 1R8AA 2OTLS 4OJGA 2BF4A 4X7DA 2B5JA 1MSWD 1K47A 1MABA 1YJWB 4HI1A 2GO8A 3HHKA 4OX7A 2N7CA 2JJ2A 4AXIA 1NB2A 2AJ1A 4YY3F 1SKUB 2JEFA 2QO3A 3KK1A 4FF2A 2W6IA 3TAQA 4U96A 1U02A 1RU2A 4Y2KA 1N5VA 3MPUB 3Q8RB 2ZWOA 4ZHRB 1R0CB 4A8YA 2ZH3A 1PG5B 2UXBF 2YWEA 1M1KD 2M88A 3SEJA 4N7TA 1ZM2A 5IQQA 4R5PA 3DXBA 3NOGA 3EXCX 3NS6A 1RLDA 3IXQA 2UVVA 1RJJA 1QGZA 5E6TA 2W2QP 1KLNA 2HNYB 1F9HA 5LJ5Y 1IKYB 1V3ZA 4WFBQ 3QO9B 1JQGA 1ZZNA 3OL8A 3N9UC 3VQSA 1NJZA 7FD1A 1RHKB 1R7IA 2AV5A 2UV8A 1JA0A 1GX5A 4DV7J 2P3MA 4KT0C 3DLKB 4LBWA 5FO0A 4ACBA 3CC4B 1Y5NB 2QA4S 2DHGA 2ZC3A 4XR6A 2XO6A 1X8DA 3PRVA 2WVFA 2QTLA 2P6TA 1HBOB 4F4XA 3OHAA 2ZZGA 5B0CA 4BC7A 4P6VF 3M05A 5D4PA 5HSPA 2WJYA 3D66A 2WJVA 2YH0A 1DRZA 1KK2A 1YI2S 1N0UA 1WEZA 3IWXA 1X4EA 1MMDA 5L8RC 1HNZF 2EFOA 1UWBA 4J5OA 2DR9A 5IK2A 1M1KT 4F50A 4UY85 3V5RA 3EMTA 1H8HA 3ISZA 1KK3A 2F5GA 2AEMA 3GIIA 4NLDA 2C1EB 3Q8UA 4UW2A 4DV3J 1OPZA 3AA9A 1ZUNB 4ERDA 2CJYB 4F04B 1GJRA 5C42B 3PIPQ 6AT1B 3BSOA 4NASA 5EHHA 4NZ6A 4PG4A 4QWCA 5E41A 4DR4J 5AJ3F 2VONA 4XDCA 2LEAA 3IM8A 1UCNA 2V8HA 3CO0P 3DRSA 4LIRA 3I56S 1ZA2B 1ZYQA 4DSKA 4WU2A 3BCDA 2VDHA 1NPPA 3ILIA 2XULA 1N5TA 3MPWA 2WOMA 5J2PB 4PUOA 1C1BA 1T9VA 2CZ4A 3RGIA 4WXOA 4NXMF 1BWVA 1N07A 3TQEA 2N3LA 3MEDB 1VQYA 4I69A 1L5UA 3FPPA 1D3WA 3L3CA 5KFZA 2MKKA 2QSFA 4MKYA 1LW0B 1FNCA 2OPQA 1JJ4A 5CXTA 2ZH7A 2ZHAA 3BR8A 5KT5A 4KJIA 3MF5A 2E66A 1VHOA 2EKYA 3PHTA 1PBAA 1GQEA 3LWMA 3CB4A 3ENVA 4K0KJ 4CO0A 4JI2F 2HDNB 3GYNA 4DR5J 2KVQE 4M5GA 1HA1A 1WKLA 1FA0A 4LR9A 4IYQA 1WWHA 4OI0A 1RAJA 1XC9A 4DX7A 5L9XA 4FXDA 4J9UE 4ZJLA 2UVRA 2AYBA 2GAGC 3IM9A 1R5BA 4YHHJ 1X9WA 1VK8A 4AT1B 1NO8A 1A8PA 4AVZA 3PA2A 3ZTOA 2CQHA 2JX2A 3JQQA 2DGOA 3FKBA 2CNOB 2IVFB 4J9RA 2FYXA 2WVEA 2QEXB 1FDRA 3BGLA 3ZZUA 1TL4A 2DXFA 5KG0A 1NJWA 1KOOA 2D9PA 1BX1A 4OZ3A 3NNHA 1EP4A 3W7BA 5D8HB 4GO5X 4X05A 2G1HA 3DRXA 2H9ZA 2F1FA 4QWAA 3ZTRA 6FDRA 2FHKA 4HHJA 1D0EA 4KR0B 4Q8EA 2V7TA 4CLFA 5I4MA 3GWCA 2GFFA 1EAYC 5DS7A 3CEDA 4C8NA 4DI6A 4NCBA 2XG8A 4F26A 5KT6A 4IKAA 2HURA 3QIPB 4WP9A 4LREA 1E1RA 4PQAA 4ANEA 3LP0A 3V4IB 5HLFB 4EMDA 1ZAVA 3RU0A 2IHR1 2CPZA 5LM7E 3BQ0A 4XMYA 1KLMB 5K5MA 4OYMA 4A8KA 3KUEA 2HYIB 3OTBA 3WC2A 1E3XA 1LWXA 4LF8J 4PC7A 3M6UA 3X3UA 3D9BA 3FVYA 2PLFA 5FLXU 1NSPA 4TN2A 2PI4A 3M32A 1YRUA 3JAMY 2MZSA 1S79A 4DPYA 4LR7A 2KVIA 3TAMB 3UNGC 1TR0A 2BQ3A 3FBCA 2W9CB 3EGVA 5IWAF 2DOGA 1SC4B 4Z4WA 4FYDA 2D1CA 3BDEA 1QLNA 1B7FA 4P73A 5A6WA 2VKRA 2B7BB 2J9EA 3ZO7A 3LW5C 4NCNA 5L46A 4D3HA 2JC0A 1B4SA 5H9EJ 4RPFA 5A8RA 3MR2A 2QSWA 4LSNA 2JC1A 1QAYA 2FJDB 3BEGB 2PA8D 3ZPNA 2DTJA 3M6XA 1WKJA 2YBVA 3O6QA 3G86A 1W7WA 2GVDB 4LRFA 1TVCA 1HI8A 3UW1A 3VGSA 3TAPA 4C3LA 3UFCX 4WFYA 2LDIA 2QLFB 4ZVFA 4WP3A 1WKKA 3W9IA 3BDPA 2R42A 2DRDA 1BQNB 2V6AA 1B0PA 2FY1A 3PACA 4YB6A 2CQ1A 2I9SA 2GVZA 4JI3F 1AA1B 5E2QA 4JI5F 2QN6A 3ONYA 3ZXWA 1JLFB 2FGCA 2H4WB 2JDIA 4P2MA 1N5QA 1U45A 3AVYA 1J5EJ 2PO4A 4YAUA 3D6FB 4OJ3A 2H1YA 2C2KB 4NYPA 2HZCA 5I42A 1M0SA 4BS2A 1K9MD 1PYOB 1R5OA 1Y11A 1CLFA 3QRRA 2Z57B 2K1RB 4Y7CA 5ADZA 3PJ9A 4MAKA 5CYMB 1R43A 2AMCB 5D0GA 2KH9A 4G5GA 4UZEA 4C43A 4YOEA 4PGOA 4X07A 1AFIA 1FNOA 3Q83A 3CCRS 4A8QA 2KFYA 1P9QC 3CC2S 3C2PA 3AVUA 1VIXA 4GMKA 3BO2A 4TN1A 3AY0A 2DIVA 1VQ5B 4DQLA 5KFDA 3GZ7A 1K44A 4USHA 1JLGA 2QL9B 3ENAA 2B51A 3W63A 4DZDA 1D09B 2WVBA 4V1Ak 4O3SA 2CF4A 2V63A 5FIUA 2FLPA 1PKUA 3GIMA 2NXEA 4WFXA 1FRHA 3HM9A 2NQPA 4Q0BA 2MYFA 2CRLA 1Q53A 3KHLA 3UD3P 4YY3J 2NR0A 4IO9Q 3GYGA 4GVBA 1NDHA 2AEFA 3A4TA 3E01B 2ZH8A 4WPAA 2XYHB 3TX8A 5KFBA 4O4GA 3CCLB 5IXUA 4OI6A 2A1BA 1UMKA 1AZSB 4ANDA 4RR5A 2YWGA 4ATNA 2IMOA 4L3NA 3TYTA 2UXBJ 4FYYB 4ED6A 3OVSA 4ECUA 3UNYA 1UEKA 3L4BC 4UUXA 3J81U 4FS2A 4J9NA 1IJEA 1S7HA 1W26A 2LYVA 1IBMF 3FMBA 3BGRA 4QWBA 2PIAA 1CS4A 4YAOA 3NLCA 1EARA 5B09A 4PXCA 2FLLA 1NB7A 1NKEA 4YAWA 3V7AA 4ZLPA 1W34A 1DTQB 3KK2B 5DJBA 1JJHA 3AOBA 1HBUA 2CQDA 1G2EA 5B0GA 1HQ2A 4U9UA 2DNOA 3ASRA 2HS0A 4QW8A 4KHMA 1VR6A 5DZ6A 3POTB 4CI0B 3DCAA 1UJ5A 4XDDA 3MUTP 4LJMA 4DNTB 3F56A 3P6YC 3RB4A 5IOLA 2HGNA 3EM1A 3T1HF 4DFJA 1LWFB 3SCIE 3DC2A 3OZWA 4NCGA 4HACB 1S9GA 4LBIA 4RBUA 2QLWA 4PC1A 2YNGB 2ZUGA 1HNZJ 2E7VA 2DHAA 2I5JB 4Q2MA 5GVQA 5DDQC 3MUMP 4Q45A 2NPIA 2F4FA 4QOTA 1AIPA 2ZTGA 1QAIA 5J3OA 3M9OB 1Q8IA 1RWVB 3FEYB 3QIDA 5LSRA 5AE3A 3BSNA 2ZJRQ 4ZN3A 2KRBA 3JQRA 3MHPA 2F3JA 3GCWP 3SXLA 5AJ3J 2JZ5A 3NBPB 3WBZA 3BBBA 3QBCA 2BW7A 5GADI 3UWTA 4WE1B 4EYIB 2EWHA 4KY3A 3R8YA 2ZBUA 3OL7A 1M90T 1T94A 1Z2LA 1RBAA 2GHVC 3TNVA 3EXYA 3QWUA 5HP1A 3KLFB 1N08A 2WONB 1FF2A 2HIQA 4L8JA 2MKYA 4NXMJ 1WOPA 5A8WB 2WR8A 5KFMA 4ZPDA 1WEYA 1Y00A 3MGJA 2WRMA 3CMQA 1CULA 1HW8A 4TU8A 3GVJA 1QE1B 2I38A 3QFRA 1TZ0A 3TP2A 3CJ5A 2ZBQA 3TUIC 4PCQA 5A2QU 3IAS9 3BR9A 4IFYA 2WZPP 1SKQA 2KL8A 2CNDA 1N52B 2NYHA 3HAGA 4ZVQB 2QA4B 4KPCA 1NK8A 3T56B 2Z4PA 4MK9A 4RD2A 2VFUA 4HHUA 4GKKF 3GTYX 3DGPB 1T95A 3VNUA 4X2BA 2DBBA 2UXDF 3BGOP 2OKQA 1U1RA 3QAEA 4X4TA 3GCXP 4OX6A 3T5HA 3MECB 1YI2B 4ZIWA 1CBKA 4B44A 2IJNA 4LBPA 1RT6A 1TFWA 4K5RA 3M8QB 4L74A 4C2MA 1LWEA 3M8RA 2HNDB 4ZP6A 3CCSB 1WC4A 5IC4B 4UAJA 4OLOA 4A8XA 5C25A 5K14B 3QFHA 1U48A 1C1CB 5T14A 2QIFA 1VQLS 1WUUA 1KONA 1IWAA 2BVNA 2DVIA 4P12A 3R3TA 2BYCA 2JRSA 3I56B 3OTDA 1C4CA 3DLHA 3LOUA 2KM8C 1S1WB 3EWGA 4I2PA 2GS8A 1PAEX 3R5CA 2MLZA 2BQUA 5L39A 5D15A 2WOMB 2B7CB 3AD9C 2CXEA 4JB8B 3K57A 1C1BB 3OBIA 3SLNA 2EFGA 4I67A 1D9AA 1VRQC 4RLZA 1U6ZA 1NBEB 1VLOA 4C8YA 2ROGA 3Q8QB 2GMLA 3ONUA 4TY8B 5I3UB 2VL1A 1H74A 4CYUB 1NMEB 4OFZA 1DJ0A 5K9FA 3BO3A 4ZCIA 4CO4A 4MKAA 2YKNB 3G9CA 5E3QA 2W25A 5M2RA 1UVIA 2FJBB 1E6VA 4W90B 2FTRA 2MSTA 2OPQB 3W3SA 4DMZA 5EDWA 1TP7A 1N32F 1VQPS 4FBUA 4PG6A 2Z2LA 3H9NA 1X5OA 3GIJA 4GC7A 3ZC4A 2HK2A 4MYUA 3OW2B 3SYZA 1IKVA 4N3GA 4USIA 4QYZJ 1U6FA 1RGVA 3G82B 5HKKA 5IV3A 3BC9A 1LW2A 1EFRA 3WBKA 2FLOA 4OHZA 2X0KA 1RHRB 5ETKA 2YX4A 4DL2A 2VFVA 3G87A 3DOKA 2J6TA 2QDXA 3W2VB 3ZFVA 4LRBA 3UPFA 2DGVA 1W25A 5MLCV 2DNRA 3MEEA 1H2VZ 4DPUA 5IWAJ 1X4BA 1T3OA 2GGPA 3M2VA 2D69A 1QD1A 4WFNQ 2HAFA 3DHWC 1YDLA 1FHTA 3M30A 5CCLA 2XMUA 2C3YA 1LV5A 4F4KA 4NEZA 4PQUB 2RF2B 2J7WA 4KQZA 1NKBA 3UQSA 3LH2S 1GEHA 2UP1A 2DT9A 4F2SA 2X1AA 2FLNA 5KT7A 4RNNA 4L3KA 5BXIA 3R5AA 3KLEA 4CLWA 3J80U 3CCUS 4AD6A 4KGMA 3V6DB 2R8JA 5EUHA 2GJKA 2C5BA 4ROXA 2HQCA 3CD5A 3W8GA 1VC5A 3OL6A 4C3KA 2XCAA 5J1NA 4F67A 1FFSB 3HVTA 4QIGA 3R7BB 4B3OA 4WCEQ 3HT3A 4RPDA 4RNHA 4ID5A 2DGUA 2E1PA 1XR7A 1TMJA 1BE4A 3VGUA 2SXLA 1UZHA 3CJQA 9RUBA 4O4RA 3VAIA 3SQGA 2RQ4A 1F2HA 4H4MB 2V67A 1YBAA 1YQHA 1EFTA 3NWRA 2JIZA 4P10A 3MPDA 1FKPA 2HHWA 3EZUA 4P9SA 2HQGA 1FE0A 1MRZA 1GTHA 4AQYF 2R2UA 1ITPA 3MD3A 3QT6A 3W5HA 1EB0A 1RTJA 2R8HA 2WVCA 3BYPA 2VOPA 4I2QA 1MROB 4C6AA 2IRUA 5KFJA 2HQ3A 5J1EB 1R3NA 3O44A 3TZYA 1H38A 1S12A 1ZETA 3DRYA 5KG7A 5KFYA 2GJFA 3NL0A 1RT4B 1Y3KA 5B0AA 3R6JA 3B78A 3NGKA 1WTBA 1LQ9A 1RB0A 4NLQA 5THXA 5JBQA 3GR0A 5THWA 3RRHA 3N6MA 3MM9A 1RQRA 3WHIA 2FJVA 4ICLA 2PE8A 3P8BB 4JI4F 1S1TB 4LSNB 5FLXY 3RW7A 1FX4A 3M2RA 1WC6A 4ETXA 1NB9A 1BQMB 5D0EA 3GSDA 4NI2A 1GAQA 2LA6A 1VOMA 1P27B 3US5A 4PXDA 4NLGA 2Y1IA 1H85A 1QUFA 1QVGR 2GX8A 4LT6A 4OPVA 1XMOF 1HHSA 3PVDA 4ZCKA 4FS1A 2XHWA 3JXOA 4ZP9A 3OPOA 2E5GA 3BKFA 2ZE2B 3KTQA 3KLGB 3RAQA 2R7XA 3AHPA 2V8DA 2JEJA 1XBWA 3ILLA 3KJVA 4C0SA 5A76A 4DQIA 2XNCA 3D4JA 3NMAA 2J7KA 2GMHA 2RDIA 3DLGB 2ZNYA 1T9YA 1BXNA 4Z4RA 4YR0A 3LGMA 3FUYA 5KFWA 4W4MA 3ZTSA 2HPUA 1OWXA 4J9MA 4GC6A 2DETA 3BKUA 1F9EB 4FK8A 5IQ6A 2MZQA 4DHVA 4B9NA 2D3ZA 5KTQA 5EN1A 3J7A1 3AAWB 4KAIA 3A1PA 3ENWA 1U49A 4KFBB 1HWKA 3C8YA 2MJNA 1NDLA 4P75A 4QWDA 5J2NA 1IUJA 3W61A 3U6KA 2DEUA 2GIQA 4L73A 4J9KA 1V5IB 3D1QA 3OPKA 3AJ2A 3RAMA 4CLKA 2GJRA 2AKWB 3I5AA 3LGHA 2CPDA 1R6VA 3P27A 2KU7A 4C8LA 2VUGA 5F3ZA 2CZ9A 3RTVA 4GVLA 2YWWA 2VF3A 3CE8A 4Q0BB 1R31A 3L7OA 3PW7A 4DV5F 4QCLA 1FWKA 4B3XA 1YSJA 1WF1A 4XLFA 4GVBB 4K5SA 2I6WA 1HBMB 4LFBF 3FBBA 1WHXA 2OD6A 4NBSA 4ZIVA 3BREA 1NDCA 1HZEA 2CRVA 2JLFA 3PG9A 1VRTA 2LKZA 2AHOA 2B8PA 5BYSA 2V69A 1VGYA 3Q0AA 2NV4A 4ZLJA 2GAHC 4KGZB 3SJZA 4DR7F 2AT1B 5EWGA 3SMZA 3A1YG 2G1DA 2A6MA 5DO2A 1EKSA 4G1VA 4CM2A 1NUEA 4PKDB 1SUQA 4RD3A 1PKVA 2B6AB 1T6YA 3RBEA 3T5LA 5CYJA 2HLUA 2LQ5A 4IG3A 2AZ1A 1IR1A 5GAHU 3OW2R 2AF6A 3PO5A 1K73D 4OIXA 3C16A 1Q8LA 3BBCA 2I8EA 1FD2A 3R9LA 3KHGA 2GPJA 5D0HA 5KG1A 4O3QA 3MZIA 1OGIA 4NLOA 1DG1G 2UXDJ 3EGNA 1T05B 2WVDA 2CNNB 2ZDOA 5I3PA 1FX2A 4V19J 4DUYF 3PTWA 1N4LA 3TA0A 4KH0B 4F0HA 3OP1A 3SSRA 2KXFA 2ILZA 2VASA 1S0NA 2CPFA 1MLAA 4OOVA 5GMDA 4RWWA 2QMUA 4IO1A 2WPDA 3LP1A 1TKXB 3ASSA 2XGQA 2MTLA 2J9CA 1ZPVA 4XNFA 1COWA 1CG2A 1QFZA 2EK1A 4NX9A 2CNLB 3CJKA 4ELUA 4ZV4A 4WZQA 1B0VA 4M4SA 5KFLA 3D67A 4HEA9 2XSJA 4O3PA 3MM5B 4ECZA 3JQKA 3LVBA 1W0KA 3NRBA 3PV8A 2GQFA 1ZZFA 2BMWA 1H0HB 3FDSA 5CZXA 2C2WA 4XQFA 1WHYA 5D0RA 2CG4A 6FD1A 2X1BA 1X4FA 1NK6A 4ZK7M 2CPYA 4MK7A 2ZNZA 1FRKA 1X31C 2DR5A 3ETOA 3CP2A 3B4DA 4NLXA 1FD8A 4IFYB 2UUBF 1HMVA 4G1PA 5IYWA 5AXNA 2VB6A 2HQFA 1N32J 1WSRA 1S4FA 2ADBA 3QSYA 3TEGA 4I0WA 1WF2A 2J0WA 2OTJS 5L1JA 5LMUF 1VQ9S 3H5UA 5F8GA 4C0OC 1RYRA 4PR6A 3OJXA 4LVOP 2AYEA 1JWWA 3HVRA 2OPSA 4Y2IA 2P2CB 3O3LA 1KRHA 4FP9A 1Y0HA 4DQSA 2HVEA 3VZHA 1FRXA 1KSPA 1Z2ZA 2PGCA 4DXLA 1FKOA 1U6BA 1RWPB 3D6HB 3QQCD 1RT6B 3EUNA 4KGKA 3HZEA 2GCFA 3CTAA 1LWEB 1WACA 3PR4A 2CQ4A 1SJ4P 3U1MA 1LK7A 5DM6Q 4P25A 4P3IA 2ZBRA 1G4CA 2AZ3A 1WI6A 3P4UB 1S49A 1Y0RA 1YJ9S 3A8IA 4P2SA 1VQLB 3C15A 1RT7A 4USWA 2IBOA 2CQIA 3R6LB 4HVZA 2KXNB 3D1HA 1PGZA 3KMQA 4H4KA 3W2WB 2X6YA 2VQFF 2FVCA 3FEXB 4YMEA 5FDLB 2MKIA 4JMQA 1U26A 2JFDA 4I7FA 4M5MA 2BPOA 1WC5A 1S59A 4DPXA 5C5JA 3DYAA 4ZJQA 2CJAA 3Q8SB 1N33F 2VG5A 4USVA 2DERA 4PXBA 4ZVHA 3THPA 2C22A 4WWVA 5J2MA 4TY9A 2VBTA 3NGRA 4DV2F 1SQEA 3MMCA 3LA0A 1T5EA 4DZ6A 4NYZA 2QL5B 1U1NA 2ZXIA 1S72S 3DHXA 2ZH9A 4LBYA 3L7PA 3IMQJ 2EFNA 3PRDA 4Z37A 1IM4A 1HNWF 4CZCA 3VZIA 3AFGA 1O8BA 1CJVA 5H1SV 5DQIA 4F4YA 2PE3A 1JK9B 1BJKA 2B8QA 2OPPB 1E6VB 2C3UA 1N8RD 2IYIA 1EX8A 4G1QA 1KTVA 2VFSA 4ED8A 2OFGX 1FJ7A 4H54A 2CJQA 2DNMA 2PFFB 1UVJA 3NEKA 4TQRA 4AQYJ 1HI0P 5GAGI 2DK2A 2DGSA 5F4JA 3MWBA 4ZA1A 1D9DA 2J0XA 4LRDA 1UEUA 3M6WA 2NUUG 4X64F 2I1LA 1HQUA 4ZVPB 3ZZRA 2DR8A 4WIQA 2WK4A 3DOKB 1U0HA 4RW8A 3TZZA 4DSIA 1JLEA 3NS7B 1H6KX 4DCPB 4KRWA 2XY6A 2GGPB 1RT1B 4R8UB 4IH7A 4M95A 4NA3A 4BBYA 1KQKA 4F25A 4UQGA 1SQFA 3JQJA 3HHLD 1JLQB 1JB9A 1FJCA 1VBKA 2IY5B 2OPRA 2XI2A 1E3ZA 3KLEB 1L3SA 3ZZPA 1G3OA 2HW3A 3D26A 1IBCB 1AFJA 2HHUA 2OD4A 3P5TL 1EETB 1N8RT 1GAWA 4XORA 4WU3A 1EP1B 4C9DA 1X0PA 2ACMA 4WZKA 3MR3A 3PX6A 5HVHA 2G13A 1RHJB 1MWYA 2DNZA 3QJPA 4I4BA 4CH0S 3R6KA 2A10A 4UZBA 2QT7A 4NMXA 1RT3A 1KK1A 1XMOJ 3UD4P 3CC7S 2YKMA 2Q6KA 3H2VE 2VBWA 2ZOFA 5D3GA 1JLAB 3C6TB 3R1HA 1EWYA 3SQGB 2VPYB 1RSCA 2UUAF 3J80Y 1T11A 4IFVA 2UUCF 3K5NA 1SIWB 4UOFA 4K4WA 1S0UA 3QPIA 1RLCL 1RT2B 3OTOF 4EYHB 2VU5A 4RPBA 4UF4A 3CTRA 4QVAA 1NZAA 1KD1D 3PNIA 2RHSB 2RUSA 5CYQA 2WSSA 4OPSA 2D74B 1RTJB 2BVZA 2HMIA 5AT1B 3BPSP 4I2QB 3MMPA 2XNRA 4J9QA 2GNKA 2JEGA 3SZ2A 3E51A 2RU9A 3BSCA 3BNWA 2FHJA 3AH6A 1RHUB 4YP3A 2XGJA 1VQOS 4KV8B 3M1VB 3F0NA 4DR3F 1HYSA 4D3GA 3TEHB 4Y00A 2GK7A 2R7TA 3MCOA 1FTCA 2E1MC 4H4OB 2M52A 1K8AD 3M8PB 2XTJP 2ZC4A 5HMZA 3CO9A 1JLBA 4DV5J 2MKHA 1U1OA 5H59A 3C46A 4O3OA 1NCLA 2XYPB 2XLJA 4ICLB 3P96A 5CCMA 1CC8A 4LFBJ 4ECXA 4K50A 4ZPVR 3RRGA 1RUSA 2O01C 4PC3A 1JLCA 4M8LA 2N4CA 1R5NA 1NEEA 2Z2ZA 4OQJA 1R0AB 1J5OB 5T7LB 3VTIA 4TMVA 2VICA 3OTCA 1WDDA 2JSXA 4DR7J 2VBVA 2WZ1A 3FQLA 2YWKA 3B8HA 3QJJA 3TVYA 1Q7YD 1U1KA 4O44B 1CEZA 3KJNB 1S7IA 4LF5F 2ZZQA 4RBTA 3ICLA 2BJ1A 3CUNA 2HK3A 2QC3A 2KT5A 2A6OA 4YQWA 2HVZA 4FXUA 3G6VA 5M2PA 1S1VB 3PIOQ 1NJID 3DKDA 3I0RA 3I1FA 3KJVB 2NCKL 2ZZMA 2OI2A 4ZOSA 4LUBA 5AXKA 2DIEA 3TUPA 3DRRA 3B82A 2Z2MA 3W2FA 3RZAA 2C2MB 1QUEA 3CDEA 4DJBA 1OPIA 2ZM6F 1V5VA 4N8OA 2P5VA 4USTA 4OYIA 3QYYA 4J37A 2L9WA 4OYZA 2KJVA 3LGNA 2AWZA 4YFUA 5B6IA 3W2GA 1K8AT 3AJDA 2MB0B 2YPYA 4RW6A 4R0EA 1UL3A 1X5PA 1IM6A 3KLHA 4ZVTB 1Q9SA 2V94A 1S0VA 2JVOA 4PWDB 1H2TZ 2ZBVA 4DUYJ 5CZVA 1Q8BA 2R8KA 2D3NA 4WZEA 3TQ1A 1F60B 1S4MA 1KHWA 1CJUA 1TVRA 1DTTA 2P8IA 2Y1RI 1R8BA 3OXLA 2QLBB 3LP2B 4QJVA 2ILYA 2W2NP 2XMMA 3G05A 3KNGA 4DUTA 1OMSA 5F8MA 2DJWA 1Q7YT 5L38A 1YJNB 4CLPA 3DM2A 3I6PA 1KP6A 2QYCA 3AD8C 3GJQB 4WF9Q 2O3DA 2NS1B 1NJIT 1RWUA 3EVOA 5H9FJ 3DGVA 2O67A 2XMVA 2AQ4A 2P6SA 4FDFA 1IBKF 1U8SA 3OUYB 2CADA 3IAM9 2IM0A 1QUPA 2DR6A 1VHFA 3WBJA 2V7XA 3AD7C 3GR1A 1QGYA 3G8QA 2F65A 3DNCA 1FDAA 2IAJA 1WNEA 3PXGa 1S76D 3PYFA 1B23P 3BM7A 4I6WA 3FFIA 1MN9A 2FPHX 1VHEA 1F2GA 3Q6QA 3KG0A 1W35A 1DLOB 5DS0A 4NNJA 2CJBA 1M5PC 2UUBJ 1HBNA 2HSEB 1VDHA 2DNKA 1JX4A 1YJUA 5C2CA 1WORA 2FQQB 2CBXA 2ALZA 3OZVA 3HJVA 3OFGA 5LMUJ 3TANA 5KOWA 3N6LA 4UOCA 5FJ4A 4RCZA 3BZQA 1KTQA 3HI9A 3FRYA 3BQ2A 3PO4A 4WTOB 4RZRA 1NNDA 3NOCA 3MM7A 2JL9A 2PFDA 3W5YA 1P6TA 4RWXA 4XM3A 1N6QB 4R25A 2NXJA 2AJ0A 1F1BB 1JKHB 1V0FA 1FVQA 5HZBA 1FFWB 2EK6A 4DSJA 3GE9A 2QA1A 3ADAC 1HVXA 2WW4A 3W64A 5L9NA 2H4YB 1HD1A 1ZBTA 3K59A 3T53B 4NXNF 1GXLA 3R27A 2FGOA 1HQEA 3GPAA 4NLTA 3CDWA 2QMUB 1RBOB 4TQSA 3HVAA 3PENA 2YQ1A 2AGQA 2X6XA 2W6JA 1TL3A 2BJDA 2VQFJ 4HH1A 3TZXA 4F4WA 2EFQA 2XB2D 2HHSA 5SZTA 1B3TA 4K1XA 5AE1A 2L08A 4K4XA 2XSJB 1N33J 4LF6F 4DSLA 3G71S 1BLUA 3OR2A 2CQPA 1FRMA 4DV2J 4URGA 3IFEA 2CG8A 4HI2A 3OW7A 1M1GA 1RXOB 3Q24A 1G7CB 3OVAA 2HHXA 3S1TA 4TT3A 1J9ZA 5C24A 1ZA1B 3D0IE 4RDKA 1VRUA 4OHYA 1HNWJ 3DOMB 2X3GA 4M63A 2E9TA 4CDIA 1RAEB 3P3DA 2XO7A 4HHHA 3FZ2A 1S6PA 1X60A 1HMVB 3AVTA 1HNXF 2QX0A 1WG4A 3GV5B 3IBWA 4OYAA 2DY1A 2DCUB 1VQ9B 2IM1A 2LP4A 4PG7A 5T41A 4RD6A 2G2YA 4DX6A 1U8WA 4U6PA 3DDIA 1YITS 4N3NA 3GV7B 3DOLB 4OZ1A 3K7RA 4JI0F 3PFOA 4PZVA 1HFEL 3NWGA 4X64J 2VBSA 2XYGB 5KFFA 3VAMA 3OVBA 3J7ZT 2IRYA 5AN9A 4A8MP 4J9VA 2Q6LA 1FKOB 4KO0A 2E5LF 3WNCA 1HKAA 1NKCA 4ZKAA 3MPVA 2G0JA 4R0JA 2N7YA 2XLKA 2Z0GA 5F8HA 2MQNA 1O0PA 3V76A 5F8NA 3PKYA 5JVHQ 1YJ9B 2XS7A 1WC0A 1RTIA 3EICA 2H5IB 1X4HA 1RT7B 1S6UA 1FNMA 4P7TA 5CHCB 4NZ7A 3RY8A 1LXNA 3FK4A 1UMJA 4I7FB 1E63A 1VJSA 2W2OP 4CT8A 1S6OA 1QH0A 2DGTA 1EJ7L 4ED5A 3EGZA 1UD2A 1VQ8S 4CRJA 3MUVP 5J2MB 2DHHA 5CD4A 1XK8A 1SM4A 5DLFA 5KFIA 1FK9B 3CF5Q 1S72B 1QSLA 2KTQA 1QTNB 3WX8A 1PILA 2R7QA 1FTRA 1ZS6A 1P1TA 7FDRA 1DQ9A 2BOPA 1PIEA 4JP8A 5H5JA 2VFTA 1CJVB 2PC6A 2QE5A 3VO2A 5D4OA 2UUAJ 3QFWA 2PT0A 1KQSR 2OK7A 1FVSA 4ECVA 2BJ7A 2UUCJ 3JTNA 1U0SA 4J7CA 5ETOA 1SH3A 1JJCB 4G1QB 3ILJA 3CCMS 3R97A 4ILRA 4KHRA 2CJXB 3NGSA 3OTOJ 4KGVB 4C3MA 2CVEA 1T02A 2R4FA 1Q5YA 4Z4TA 3SSSA 2M3DA 1RAGB 4ASUA 3W2EA 3NGTA 4FF1A 1UETA 4DV0F 2E1AA 2MKSA 2YKAA 1ZTTA 2EBEA 2F40A 4FPRA 1TTTA 1D8TA 3FPKA 1HQUB 1C0UA 4WIIA 1CNEA 2QGGA 5B0DA 4AL5A 5HBMB 2FVPA 2AIRB 2C78A 4QIEA 1DY3A 2Y8YA 2KO1A 2DNNA 3IG1A 5F9NA 4RW8B 4X4OA 4C48A 2V4JB 5IYQA 3IS9B 3CMEB 3PCOB 4DR3J 3IWNC 1XN9A 1FFGB 3R6GB 5F41A 1IKWB 3KFWX 3LPEA 5IC6B 1T3NA 1REVA 2ERRA 3KK3A 4PWUA 2OBTA 3KOAA 4WKRA 2H5JB 1WHWA 4F8RA 5KOXA 4O0IA 4A4JA 5KT3A 1FJEB 2Q6IA 1JJ2R 2KHDA 4NWBA 4U95A 4QZVB 2W9AA 4F2RA 1T9WA 1LKZA 4XL9A 2C3MA 4RJVA 2JDJA 3SSQA 1D9FA 5K8MA 3ISXA 2OEJA 1E64A 4DK0A 4KKOA 1V0EA 2ZEJA 1JMTA 1XB2A 2NZCA 3CC7B 1S1XA 2C4TA 2HRUA 4M5HA 4LF5J 3CMAB 1UD8A 3GJRB 1QSSA 2YWHA 4JV2A 2LFVA 5D3GB 1O6XA 4EI2A 2ASLA 3G6XA 2Q79A 1AYEA 4IFVB 2HBYB 2V5HG 2KYZA 1BPLA 5KFUA 4ZP8A 3SKBA 4UQTA 5M2UA 2LZJA 3PX0A 4PG5A 1S0MA 1S1UA 3OEEA 1CVJA 5LMNF 2ZM6J 1WOOA 4U7UD 3KG4A 1C0TB 2XZWA 4MYTA 2DXEA 3GQBA 4CWBA 1Q79A 2BOAA 2R7WA 4JI7F 5G0RA 1OGJA 3DLJA 2CFXA 1LNQA 4B3TF 5F0UA 1EFUA 4P22A 3PW0A 3D1OA 4MT1A 2H54B 1L3TA 1QAJA 4O0NA 1CJKA 3LPYA 4AYBD 2VQEF 2V7WA 1ULRA 4CO5A 1WPCA 4AF6A 1QSYA 1G6BA 3V81B 3U7JA 2JEIA 4EZ6A 4AL7A 3W8PA 1NB0A 1F5BA 1HYSB 4L72B 3THVA 3AXKA 2OO4A 3GFXA 1IKXB 2LXUA 2M70A 2BDPA 3TI0A 2RE1A 3DDKA 3MM8B 1SC1B 4EEYA 5RUBA 1ZM9A 1UPPA 2PIIA 3CJ8A 2GO9A 1RTHA 2W4CA 4USMA 2JH3A 2DNHA 1HWJA 2QV6A 2XMTA 1FNXH 1BC6A 5HL7Q 5CABA 2VODA 2JLGA 3H8YA 1CQXA 1OJ4A 3C14B 1Q82D 5KG6A 3M8SA 3IR5B 2EVZA 1NK0A 2FVSA 2BJ8A 2I2YA 2HKEA 4HH0A 3FCWA 3O8WA 3CDUA 1T6ZA 3MDFA 1KN6A 5CA5A 4ID8A 5IM0B 2DO0A 3BV8A 1LWCA 3AVWA 2HAIA 2V8GA 5JXSA 2FVGA 5LXRA 4ED3A 3I0RB 2Z6BD 1HL6A 1IJFA 2OSRA 3WIUA 2CQBA 2H48B 3CWJA 4RBVA 3CIMA 3ISNC 2RKIA 3GP9A 3SFUA 4Q44A 4Y2AA 2E5JA 1NAQA 2MJUA 2J8SA 4CTAB 2V8PA 4P6QA 1SIZA 1N48A 3PEJA 5U47A 1WC1A 5GAEI 2Y9HA 3HHLA 3OFHA 2DITA 3JSMA 1N5YA 1SI9A 1QUVA 3W65A 1QM9A 3I5BA 5LT5A 4DLGA 4GKJF 3FSXA 2RD5C 4UZUA 1S6QA 2QTZA 3FSYA 2AYMA 1F5AA 1RA6A 4P26A 1P1LA 1XNRF 2CW5A 1Q82T 2D7SA 4OI3A 4M5DA 1IB0A 1H7WA 4GO7X 2DPJA 2ZUAA 1VQ7S 4Y2MA 5TR9A 4DK1A 4X4QA 1SB6A 4NXNJ 4RUCA 3W2HA 5KFQA 4MJKA 3DM2B 1N34F 3HD2A 4A46A 5F8IA 3EVMA 1UVLA 1YBUA 2UVWA 4DWIA 4IOAQ 1WU8A 4CLZA 4J91A 2L9NA 5EMNA 2W4DA 2QTWA 2QJ3A 3NE5B 4LF6J 4BWMA 5KFKA 1H2UX 2RB7A 1WI8A 1GXUA 3BSAA 4LSLB 2LA4A 4NMLA 3H40A 2IAJB 3NNCA 4OZ0A 4OV6A 2BUNA 2BQRA 3FFIB 3RYLA 2FJAB 1N5SA 1YJWS 4DS4A 2LMIA 1V3RA 4ACAA 4I1TA 1VMBA 2MQQA 3CCQS 1SKRA 2XWXA 3EDQB 3EGWB 4X4RA 1NHUA 2OK8A 1HBNB 1HNXJ 3BQJA 1HNVB 3C19A 3G96A 3A3PB 2NYIA 1Y7PA 1WELA 1BLIA 2LXIA 4OV1A 3KHRA 5KFGA 1HLWA 5DZ7A 4ZHRA 2PMZD 1UW9A 3Q8VA 3VF0B 2Y0SD 2E5HA 4RNOA 2ZL5A 4RCYA 3T6JA 1V6HA 3BB5A 4UZFA 1MNEA 2Q43A 4JI0J 1N0VC 5GV7A 1TKTB 4WQMA 1QJHA 5F4OA 2OP5A 1FO1A 2ROPA 2V7QA 3EZOA 1M5OC 4XO0A 2BJ9A 4OYOA 3PUNA 2HNYA 2IM2A 1VIOA 1JA1A 2E5LJ 3D6MB 2FZKB 2M5SA 2B3TB 4KKSA 1IKYA 1D8YA 2Q66A 1VQSA 4HT5A 3QO9A 4Z4YA 4TSFA 4NL5A 3ZUGA 1KQFB 2WBRA 5KT4A 1WTFA 3VQTA 4X4PA 1WG1A 2BKOA 2LCWA 3Q23A 5IT9Y 1I51B 4DU7A 1VQ6B 2OHDA 1R8HA 3BPDA 4J90A 1X4GA 1C2PA 5HZAA 3GU0A 2EG2A 3DLEB 1F5CA 1IWGA 3CJRA 4HTIA 3IRWP 2BZ2A 4LC0A 1KK0A 2Z2YB 3KUHA 2IIHA 3H98A 3HK2A 3DU6A 1R89A 3CCVB 2V34A 1BY9A 3OOCA 2KG1A 2C2ZB 4WZMA 5HVGA 3HSGA 3WIVA 5JMNA 5IT0A 4JYAF 4QBUA 1EQ0A 2K2PA 2B9XA 2RDDA 2YQ3A 3BBFA 5DG7A 4CQ1A 3MAAB 4ES3A 1SJ3P 5LL6d 1VRUB 5HROB 1OB0A 4W92B 1MN7A 5C42A 4LSZB 1S9EA 1S6PB 4RUHA 3AGQA 4YS2A 2CDQA 2M0GB 4TNOA 3AVVA 1M1HA 1CNFA 4XLEA 2RRBA 4ILMA 2OAUA 3MEGA 4ZJOA 1QVFR 1Q5VA 3CCZA 4DV0J 2LEBA 4X8IA 5J2PA 2Q3PA 1WP6A 4DQPA 1Q95G 3N6NA 1OB5A 5IYNA 2GW8A 1NK7A 1FJGF 4M5KA 1BD6A 1NSQA 3AGPA 4NLPA 1XWLA 1Y9OA 2HGMA 3K17A 3MEDA 1AXQA 1MU2B 3AXMA 4Q8FA 4RD0A 3QWPA 1VQMB 2Q6CA 5CAAA 2V4RA 3HSDA 4YN3B 2UVUA 3I0SA 1I8DA 5F0WA 1RTIB 4ZVEA 3R5GA 2EEYA 2KT3A 5KT2A 1FEHA 1LW0A 3HVWA 4A48A 4WFAQ 2D3OR 4PWWA 1YX2A 1FI4A 1RWXB 2VH7A 1RTDB 2WB1D 5B7WA 1KNZA 4B3GA 2E1CA 1YIJS 1TKZA 2CPXA 4ZPBA 4IOCQ 2IC3B 3T3FA 4M5JA 1VQ8B 1F6TA 4Y6IA 5K8OA 2C3OA 3AVXA 4YEJA 3TARA 3PEHA 3N5FA 4FKYA 2PMDA 4FZVA 1RP5A 3VV2B 2RHQB 3M8YA 2BANB 2ZOMA 4IQMA 2NXUA 5EGYA 3Q86A 4Z4VA 4OOSA 2DY9A 3DI6B 1EQMA 3K58A 5J2QB 3N4WA 1UA1A 5B0EA 1JXEA 3EDRB 3UVJB 4JV5F 3HX9A 2F9JA 5HMWA 1YJRA 1UJ6A 1PAUB 5GV8A 3T1YF 1E43A 1RQ0A 5DLGA 2QEXS 2F4VF 5HJXA 1Y5LB 2BE9B 4WJBA 1KMHA 4ZLLA 2ZHBA 2GA7A 3HXMA 4ECWA 2R2TA 1TV6A 1DBDA 1GO2A 1WC3A 4Z2XA 2E9ZA 1Y5IB 2OEMA 1Y0YA 4WTYA 4MH8A 2QMWA 4JI7J 2FHOB 2J0SD 3UN5A 3OTEA 3NNAA 3MURP 1KZLA 4B3TJ 1S77D 3DRPB 1U1PA 3FBEA 2FD2A 3PA1A 1K9MT 2HBQB 5DDOC 3AQOA 2VQEJ 3D6TB 4QYRA 4ZPWR 4I56A 3U02A 3NG8A 5LOQA 4ED7A 2C77A 3CD0A 1HPZB 2ZBIA 2W8LA 3Q22A 4NLYA 4BDPA 4DL4A 1W87A 2KT2A 2B4UA 3QIPA 1VISA 4WWSA 3V4IA 5HLFA 2XZTB 4HT7A 4USUA 1REVB 1O51A 1S4EA 2RUGA 4OX9F 1RAIB 3PVXA 4TU9A 4B3MF 2GJIA 1KLMA 3D7SB 4KC5A 4F4AA 4XKVA 4ED0A 2AX1A 4MFBA 3JTOA 4B3SF 2PD1A 2YXLA 3AB4B 4B9SA 2CKWA 3R5BA 2UUWA 5SUHA 5JUMA 4B9UA 1P9YA 4ZCLA 4LF1A 1UP1A 3RUBL 1G7SA 3TAMA 1S1XB 2DEIA 2W9CA 4OLPA 4XOTA 2R7RA 3TJAA 1OYEA 2OTLB 2VDIA 4WZLA 1H98A 4Q2LA 3OHBA 4Z7YA 1JNYA 2B5JB 3ZNUA 3K5PA 1R8PA 4F0KA 4G6IA 5F4MA 4LMZA 5E3RA 1RBLA 3TOQA 1MMNA 5HJYA 4TMTA 1CC7A 4FVCA 2QG9B 4ZPTR 2GQ2A 3KK1B 3GYXB 1NLKL 4XLHA 3U27A 2PI5A 2R2SA 1T03A 3BH7B 3QMQA 4HR2A 3E20A 2BRKA 2CA9A 2GVDA 5G0RB 2YWFA 2BKNA 2KN4A 2C2OB 2XMJA 4HTJA 1REGX 2QFJA 4NLWA 3THTA 2G4BA 3G2XA 4X4SA 1UVNA 4R5PB 1S99A 4GKJJ 4HLBA 3C6UA 1FKAF 2B9WA 4XLAA 1JLFA 3LWLA 1XNRJ 1UW4A 2MDAA 3H5SA 1X9MA 3HFKA 4TYBA 2ASDA 3CJ0A 1QVGB 1HHQA 4DV1F 2BGIA 4URSA 3D54A 4ETZA 3NY0A 1N34J 2K1RA 2CYYA 1SL2A 4ECRA 1NSAA 3OV7A 3Q38A 4IG0A 2Q6BA 2DHSA 5CYMA 1NU4A 4XD7A 1SPBP 1GFWB 2MHNA 3A3BA 3Q8PB 2KJWA 4JI2J 2CIMA 2HLDA 5D4LA 1E62A 3HHDA 3TVKA 4TLRA 1VQ5S 2CAJA 4I6AA 2VJVA 1ZPWX 5DQGA 4FPIA 4XAKA 2CUYA 3J7YI 2DGQA 1UWBB 3PKMA 2MQLA 3S6EA 3CCJS 3C66A 2FZCB 4DL6A 3OAAA 3I9ZA 3KJQB 1BQEA 2RNEA 1IJFB 4FYXB 2XOKA 2PMHA 3OFFA 2HHVA 3R7SB 3MI7X 4ZVSB 2RJZA 2ZH5A 1Q4RA 2DYAA 5D4NA 5ETVA 2KG0A 1DARA 4TKTA 1RI7A 4IH5A 1RABB 3QJLA 4K4YA 2V2VA 1ICEB 3CCLS 1AZSA 4WXWA 2P9CA 4QW9A 1PJ5A 3CGIA 2IA6A 1KQGB 2FHJD 3MMBA 2F4NA 2L9DA 2KZZA 1JB0C 3DRSB 4R71A 3D3BJ 5GAGU 4OYPA 3JSMB 1Z4UA 3LQVA 4QIFA 5LSLA 4PUOB 1XR5A 2HFUA 4RNFA 2VG6A 5AXLA 3IO1A 2MHEA 3D0HE 4OZ5A 4HE5A 3W9HA 2F63A 4OYWA 4TMXA 3GJTB 1Q16B 4MTPA 4DV6F 5KFXA 4YALA 3O2IA 3GFZA 3ITHA 2MY7A 4P71A 4E0DA 2ZBCA 1PYTA 1KWMA 1DTQA 5F9LA 1A0OB 3M2UA 3QRQA 2GV1A 3HD1A 3AT1B 4GQNA 4NLRA 3EPGA 3M9NB 2RDJA 2BE2A 1XNQF 2YY3A 1VBYA 5A89A 2VPXB 3U2QA 3F73A 2KRRA 2CPEA 2A2DA 3ET6A 2BEFA 4F4ZA 1LWFA 4BHQA 4F7DA 4X65F 2W2PP 1JXLA 2AD9A 4YB1P 5ETMA 4HACA 3WQPA 1H8EA 2J6SA 1RCXB 4URQU 3F41A 2HFNA 1AW0A 4JYAJ 4K4SA 1TL7A 2HZVA 2J7UA 3SBMA 3J81k 2EG1A 2I5JA 4MKBA 3Q39A 3NGDA 3TJ8A 4NCAA 4DPTA 1T8EA 3J7AN 2E5IA 1GNKA 3B6BA 4NOHA 3CCQB 3U1NA 2F1MA 4IR1A 4QIVA 1LFWA 2IM3A 3CJ4A 4HYKA 1VQ4S 4CO2A 3NBPA 3K5LA 3FCHA 4K4TA 4X7EA 3SCLE 3ASTA 4WE1A 1TUWA 4NA2A 4K7QA 4C8MA 1RHMB 3W2IA
chains in the Genus database with same CATH topology
1EP4B 2O67A 2XMVA 2JJ4D 3KLFA 2KH9A 4TYAA 2X85A 2AQ4A 2P6SA 4YOEA 1AFIA 1FNOA 2WONA 3H2UB 1IBKF 2HMIB 1U8SA 2DD8S 4WKYA 3OUYB 2QE7A 3LAMA 3CCRS 1J2VA 4A8QA 5L1LA 3S8SA 3IAM9 3AQPA 3OJUA 4FNHA 4C0BA 2IM0A 2WCXA 2KFYA 1P9QC 5A8WA 3CC2S 5A2QY 1XMBA 3C2PA 1QUPA 3CJ2A 1VIXA 4GMKA 3T5KA 1U09A 3BO2A 2DH9A 3AY0A 3T5JA 1VHFA 2VA2A 1X9SA 2DIVA 4JI8F 3GR1A 4QWEA 1LXJA 3G8QA 5KFDA 2DCLA 3GZ7A 2NSCA 3DNCA 4USHA 2DRBA 1FDAA 1FEEA 2IAJA 1JLGA 2G0CA 1X7VA 3SEOA 1WNEA 2B51A 3T9ZA 3PXGa 2XY5A 1S76D 1QE1A 2BA9A 2VPZB 1FDBA 3BM7A 1SJQA 4N8NA 5KNLA 1IN0A 3PDNA 4I6WA 3FFIA 4O3SA 2FPHX 5AXMA 3J7YU 4RW9A 2FLPA 1E6YB 5D6GA 2OJ3A 3GIMA 4WFXA 3HM9A 1FRHA 2NQPA 4RW7B 1F2GA 3KG0A 2J9DE 4Q0BA 2MYFA 1DLOB 4K2XA 2CRLA 3IN5A 1Q53A 3JTPA 4NNJA 3LP0B 5KFPA 2CJBA 3KHLA 1M5PC 3UD3P 1HBNA 2NR0A 4IO9Q 3PZPA 1JLBB 3E3XA 2DNKA 1JX4A 4C8KA 1YJUA 2R2RA 4PRFA 4C98A 2M8HA 1K0VA 3E01B 3HHNB 1WORA 3DGPA 4CO3A 2ALZA 5KG4A 4Q5VA 3MR5A 2ZH8A 4UY8T 4K4ZA 3TX8A 3WC0A 4DEZA 3OFGA 5KFBA 4O4GA 5IZHA 5IXUA 2R7SA 3TANA 4OI6A 5KOWA 2A1BA 3N6LA 4RX6A 4UOCA 4XIUA 2HG4A 2ZZNA 3UCGA 3CVKA 5FJ4A 2YX7A 4ECQA 1VS3A 3BZQA 2X1GA 1KTQA 3HI9A 2YWGA 5EX3A 4ATNA 1VBXA 2IMOA 1JLCB 3FRYA 4L3NA 1SBRA 3TYTA 3BQ2A 3PO4A 1YG0A 2CQ3A 4A8SA 1MWZA 1NBMA 2E1BA 3GFHA 3T9NA 1NNDA 4RZRA 3MM7A 2JL9A 1UA0A 4ED6A 3MECA 1FE4A 4Y28C 3OVSA 1VBZA 1FK9A 2DH7A 4ECUA 3QGGA 1P6TA 2BXJA 4UUXA 4RWXA 4FS2A 4XM3A 5CYMB 4J9NA 1N6QB 4IRKA 4R25A 2AJ0A 2QZ8A 3M32B 3M8QA 1JKHB 2AYGA 1S7HA 2LYVA 1IBMF 3FMBA 1V0FA 3BGRA 1FVQA 4QWBA 1KS2A 2HNDA 2EK6A 3NLCA 4DSJA 3GE9A 2QA1A 2NZ4A 2OMLA 1HVXA 5B09A 1M5HA 4PXCA 2FLLA 1HWUA 3V6KA 3CCSS 3KKFA 1NB7A 1Q7LB 1NKEA 2V8VA 5L9NA 4JV0A 4ZLPA 1HD1A 1ZBTA 3K59A 1M5SA 3T53B 4NXNF 2VA3A 5K14A 2DHXA 3A8EA 3VAFA 1C1CA 2EFPA 1DTQB 1GXLA 1S9EB 2YKPA 4KHPF 2C3PA 2FGOA 1HQEA 3R27A 4NLTA 3CDWA 5DJBA 3KK2B 1JJHA 4TQSA 2DISA 2CPJA 3HVAA 1HBUA 2CQDA 1G2EA 5B0GA 2AGQA 2X6XA 1SJFA 1L3VA 2Z8QA 2W6JA 3QZ8A 4EO6A 1TL3A 3ULHA 4DSFA 1XR6A 2F8EX 2BJDA 3DRRB 2DNOA 2FJWA 2HS0A 5HI7A 4QW8A 2ZH1A 2MGZA 4G1IA 4H4KC 4KHMA 2DNYA 3POTB 2D3LA 3MEGB 4HH1A 4CI0B 3DCAA 1UJ5A 1VLYA 2FJEB 1S1WA 1YTYA 5A8RB 3M4XA 4XDDA 4F4WA 2EFQA 3MUTP 2O5DA 2KVOA 2XB2D 2A3JA 2HHSA 2CVIA 3H59A 4LJMA 1ZM4A 5SZTA 4JUZA 4AFFA 1TFYA 4OJ1A 4DNTB 4A47A 5AE1A 1VJWA 3F56A 2F8MA 3L09A 2L08A 3P6YC 3RB4A 2J0QD 4OX8A 2X53S 1WHVA 3AB2B 2HGNA 4K4XA 1SKYB 2XSJB 2AGPA 1I1GA 4LF6F 2VG7A 3T1HF 4DFJA 4DSLA 4DOZA 3G71S 1BLUA 5HBMA 3OR2A 2Y1JA 1LWFB 1FRIA 2CQPA 1FRMA 4OHVA 3SCIE 3DC2A 4RW6B 1ZOTA 4URGA 5LSOA 4NCGA 1U1MA 3GILA 3CCES 1W2IA 1S9GA 3IFEA 2NUHA 1YWXA 4RBUA 2QLWA 3ZZZA 3KLHB 2YNGB 4TY8A 4HI2A 3S01A 4DF4A 3OW7A 2V4JA 2ZUGA 5I3UA 3Q24A 4C11A 1G7CB 3FGVA 3OVAA 3IS9A 2HHXA 3S1TA 3L95X 3D28A 2ZHOA 2XWYA 4C0HA 1GX6A 2DH8A 4TT3A 1A9NB 3CMES 5C24A 2FIUA 2DHAA 3D0IE 4OI1A 3PY8A 2JFKA 2I5JB 2GC8A 2YKNA 3I0SB 4Q2MA 5GVQA 5DDQC 1VRUA 3SDEA 3MUMP 4OHYA 2OMOA 1IKWA 1TVRB 2CQGA 4Q45A 1DTTB 2Q1LA 2X3GA 1UAWA 4M63A 2CZVC 2W7OA 2NPIA 2RVJA 4QOTA 2E9TA 2ZTGA 3P3DA 2XO7A 3FZ2A 1QAIA 1S6PA 5L1KA 3M9OB 1Q8IA 5DQHA 1BGXT 1HMVB 5KFNA 5E33A 3FEYB 1HNXF 2B9YA 3RB0A 3RAXA 1U47A 4RW4A 1D8ZA 3PJWA 3QIDA 5LSRA 2C2DA 5AE3A 1WG4A 2K7KA 3GV8B 3GV5B 3IBWA 3BSNA 3E8OA 2ZJRQ 1KEKA 2KRBA 4L6V3 2DCUB 2F3JA 1WTHD 3SXLA 5I42B 2MQPA 2VV5A 2IM1A 2JZ5A 2XCPA 1JNRB 4PG7A 1SJRA 5T41A 3WZ0A 4V19X 3NBPB 3RBDA 3WBZA 1TKZB 4U6PA 1TQLA 5GADI 1PC4A 3UWTA 2DNGA 2HGLA 1YITS 2HHTA 4WE1B 3RW6A 2YKQA 4EYIB 1X0FA 3GV7B 2EWHA 3DOLB 3CJ3A 4X66F 1TAQA 4OZ1A 3OL7A 1M90T 3K7RA 1T94A 1Z2LA 3PFOA 4JI0F 3TRGA 2CPIA 2MZJA 3UCZP 2ZJPQ 2GHVC 3TNVA 3EXYA 3QWUA 1HFEL 3NWGA 5HP1A 3MMAA 3KLFB