1NRKA

Ygfz protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
325
structure length
325
Chain Sequence
MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YGFZ Protein
publication title Crystal structure of the YgfZ protein from Escherichia coli suggests a folate-dependent regulatory role in one-carbon metabolism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 68
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1nrkA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1nrkA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nrkA01
1VLOA 1YX2A 3A8JA 1WOOA 3A8IA 1NRKA 1WOPA 1V5VA 1PJ6A 3A8KA 1WSRA 1WOSA 1WORA 3GSIA 1VLYA 5L46A 3GIRA 4P9SA 4PAAA 1PJ7A 4PABA 1PJ5A 1WSVA
chains in the Genus database with same CATH superfamily
1WKJA 4RCZA 4RM0A 1RACB 2E5JA 2GJRA 4G6IA 1I51B 2DH8A 3JQKA 3MOJB 3W5XA 1JLAA 3QFRA 3GR0A 3J7ZT 1DTTA 2DITA 2I5JA 2B43A 3WNBA 2WSCC 1ZM9A 5HVFA 4DR1J 3A35A 5ETSA 4DWIA 1MABA 3BJYA 2VF3A 2ZNYA 3IFEA 1MMLA 2VH7A 3VGVA 2I2YA 3KLFB 4F7VA 1B99A 3K8WA 3RY8A 4MMOA 2F63A 1OQ3A 2M5YA 3OD2A 2IM0A 3DNCA 3M8SA 5KFJA 5FO1A 1DZ5A 3MTJA 4IOBA 3I9V9 5B08A 5KT4A 3KLHB 1NUEA 3LP0A 1I3OB 3AB2B 2F3JA 5HN0A 2AEMA 3TX8A 4QPXA 2DK2A 3GSIA 4PYDA 4H4OA 1RYSA 3PTWA 1VISA 2F1FA 4UF4A 3PHEA 1FF2A 2V50A 1S1XA 3D2WA 1MLAA 3HJVA 4Y2MA 1RT7A 1T9YA 3PJXA 5A76A 4HDHA 3N6NA 4P2MA 2QLWA 1JLBB 2OKQA 4WK1A 1WD6A 1VK3A 3MEDB 2JC0A 2OFGX 3GLJA 2Q43A 4ZVOB 5ADZA 1S79A 1YZ6A 2HQCA 1WC6A 4WP8A 5AE3A 1UWAA 1GFWB 5B0GA 2P6TA 5LSOA 3MMBB 2XYPB 3LGNA 4HLBA 4K4XA 3VZHA 3UR0A 2ZOMA 3NNHA 2VJVA 3M05A 2ILYA 2HQ3A 3MM5B 3CTRA 3R5CA 3CW2C 1S4FA 4JI4J 1O0PA 4CWBA 4TYBA 4NCAA 1HLWA 4USKA 4X4UA 2RAQA 1OSCA 3VNVA 2FC8A 4BLGA 4CLWA 2GJKA 2FGOA 2JEIA 3KLEB 1Y10A 5F8LA 3Q8RB 2PMDA 3LNNA 3K8VA 2DY9A 5B6IA 1GT8A 3ONYA 2JVOA 2ZZEA 1SJFA 1NB0A 1FD8A 1Q5YA 3AAWB 3C16A 1IKXA 3A1YG 2HQDA 2N3OA 1XMQF 1DJ0A 4ED0A 4XR6A 4DFMA 5D0EA 5F9NA 1E3XA 3SI8A 4AC9A 1KD1D 1UJ5A 7AT1B 1WPCA 3BH7B 3CT9A 4WZMA 2ZOGA 2XNRA 1UPPA 2XNQA 2BZ2A 4F26A 1HPZB 5LXYA 4XONA 4DR4J 1URRA 3BQ2A 1NB7A 2JVRA 4ZK7M 3GVLA 4MIBA 2Z4PA 4DQIA 3NBPA 3CCMS 4QVJA 3CD0A 3HZGA 1PJ5A 3BSNA 4NXNF 3OKXA 1PG5B 4JB8B 4PXBA 1NDPA 2BM1A 1MU2B 4X4NA 4KGZB 2ZHBA 4K4WA 3R5BA 5IC4B 4IRCA 1N8RD 2AJFE 4Z4ZA 2FC9A 3DMJA 3BQ0A 4AL5A 5ETMA 3W62A 3THVA 3G71B 3ZC4A 2HMAA 2BEFA 4C6AA 1HHSA 1A0OB 1N08A 1X4GA 1X9MA 2YNIA 4BC9A 2YNFB 4J9KA 4M5KA 2UVWA 4NLRA 4IFYB 3NP5A 1HVXA 3NGDA 1EFRA 2XG8A 3KK1B 2GJPA 2WTFA 4O3NA 2ZWOA 1CJTA 3P26A 2C2MB 2BGIA 1JJ2R 1W25A 2J6TA 2FY8A 4UT4A 5CHCB 2OUGA 1QGYA 3CO0P 3TZZA 1S4EA 4AF6A 1KK2A 2P9CA 1GH8A 2KG0A 3I5CA 2ILZA 4YAWA 2DH7A 2OJ3A 2Q6KA 3QLHB 1RHQB 2WW4A 4ED4A 2N7YA 2PE3A 4NLOA 2ASLA 2HRTA 3MXHP 1IVZA 3DKDA 3DOKB 2GPJA 1XWLA 2MKSA 4K8RA 4N76A 2DOGA 2GMLA 2JJ4D 1C0TB 2B51A 4YEJA 3TYTA 1KQKA 3AVUA 1SUQA 1RA7A 5LMUF 2H65B 1X5PA 4Z7CA 1OGIA 3UD5A 1TV6B 1ZAWA 3VAHA 4XPCA 1V5VA 4UZBA 3MM7A 3DOMB 2VFUA 1TVCA 1KQFB 5ITHA 3LGMA 3RB6A 1U1QA 1RKIA 3TW0A 4OJGA 3K5OA 5IOLA 3M32B 2C2DA 4AF7A 4PQUB 1X0FA 4DCPB 1E43A 1UJ6A 3QRQA 3MOZA 4CDIA 2ZOFA 3CCUS 1X9SA 1CQNA 4WYLA 2R8JA 3C14B 1L3SA 3ETMA 1PJ7A 3P49B 3CDEA 1F60A 5LMZA 1WHVA 2W2NP 3PIOQ 4H54A 1HQUB 4K4TA 2QDXA 1UW4A 2WAQD 4AL6A 1KLMA 1HMVB 2DO0A 1G4CA 1TU0B 5J2PB 5HLFA 2KT5A 5K8OA 1XQBA 2UXBF 2XWYA 4XLHA 4CLPA 2B7CB 2AT1B 1IKYB 1FRXA 1GJRA 1P27B 4USUA 8RUCA 1KBRA 2AWZA 3ILJA 2YH0A 3NGUA 1HBNB 3CJ0A 2C3UA 2QFJA 2CNLB 4RJLA 1HBOB 3GIIA 4ECQA 2K1RB 3DGPB 2HMIB 1FVSA 2Q3PA 2CNKB 2E5LJ 3V76A 3NMAA 3W8GA 2OTLS 2AD9A 4O3RA 1IJFB 5KFSA 3LF0A 1CNFA 4XKVA 3R1HA 3NS6A 1BQNB 2QV6A 2CC2A 4FBUA 3PENA 4PUOB 3OOCA 4ILMA 1X0PA 2O5DA 5IM0B 2MEWA 4OMFG 5DRKA 4OZ3A 4LBZA 3CPWR 2N82B 4LUBA 5CYQB 1PILA 1U02A 4QFMA 2YQ0A 2OEJA 2ZBCA 4NLXA 3DRPB 4K50A 1G2EA 1S9FA 2YKAA 1S6QA 2WJYA 3KDNA 1UAWA 2KZMA 3CGIA 2KXNB 5CD4H 1QGAA 2Y9HA 4UQTA 1UL3A 1ZYQA 1DQ9A 3BH4A 1RLDA 2YVSA 1VQLS 1NHVA 2B56A 3EVWA 4KQZA 2CPFA 5I3PA 3CJKA 2BGJA 1Q8KA 3W61A 3CCMB 2BF4A 4LF8F 5IQQA 1KQSR 1K9MT 2KO1A 3S8SA 4LFBJ 2CJBA 2OHDA 3DYAA 1TQLA 4QYZK 1CS4A 3UDCA 3K59A 3AVXA 1WOOA 2F8MA 3GU0A 2UV8G 2DBBA 4OZ2A 3OZWA 2IA6A 2OTJB 4U7UK 2KXFA 2DO4A 3NCQA 5KTQA 2IM3A 3US5A 1NRKA 3PA1A 1S6OA 4ERDA 1UZHA 2R2RA 2DYAA 3R6JA 4B02A 4YHHJ 4OZ5A 3OW7A 4LF6J 2KFNA 1H8EA 1MMNA 1TL3B 1T05B 2Q66A 3PO5A 1MRZA 3HCXA 3PIPQ 2GK6A 5HKKA 2W9CA 3M8PA 2NS1B 5F8GA 5KSWB 4DV3J 2W9BB 1OJ4A 3T6JA 5A2QU 4Y0FA 3V7AA 4TN2A 2VICA 1VJSA 2VKZG 3M2UB 4B3XA 5D4PA 3MD3A 5CZXA 2GK7A 1YBAA 1CQMA 2R42A 3M9NB 4ZITA 1HWIA 1UP1A 1U0SA 2B0GA 3AA9A 4USHA 5GAHU 4YOEA 5F8JA 4TMZA 3GPAA 4J5OA 1RABB 3IA0A 1YRXA 3DLKB 4OPSA 3UI3A 4JYAF 5E5NA 3TAMA 4X06A 5J1NA 2LZJA 3X3UA 3EX7B 4DPYA 2L48A 5IV4A 1OYEA 3BKFA 4FP9A 4M8LA 3PW7A 4ZLLA 4B44A 4NOHA 1XN9A 1APSA 3SCIE 2XNCA 3ENQA 3CCVS 4KPCA 4HT5A 4AXIA 2CQ3A 1SI9A 4DR6J 1RU2A 4OI0A 4O44B 5KT7A 2Z0GA 2G2YA 2IJFA 2GJ2A 2G9OA 4M5LA 1F5AA 3HKWA 2ZH2A 4QIWD 2BV3A 2DB1A 4RWXA 3GJTB 3V4IA 4DV5J 2M0GB 1HNWF 4ED1A 2FVSA 2CQ2A 2R8IA 2OPQA 3UN2A 3UD4P 2OD4A 3W5VA 1YSJA 1GAOA 1EETA 5ETKA 1YK9A 4LVOP 4J7CA 4X0CA 1Y3KA 1B70B 4DNRB 4J9LA 1U6ZA 2WOMB 3ADAC 5GADI 4IR1A 2FHKA 1QVGR 2W24A 1SJ3P 3BO4A 1D8YA 1QG0A 4OIXA 2MQLA 4QIFA 1B7YB 1J5EF 2AJ2A 3NNCA 4WIIA 2PC6A 2DETA 5FD1A 1HNIB 1RWMB 4HR2A 2DISA 3BPSP 4U8YA 2Y1JA 2GHWA 2DGWA 4ENOA 5DG9A 6FDRA 1N56A 3H4BA 2RDJA 3VAJA 5KFBA 1M1HA 1U2RA 4ZCLA 2HFNA 1IR0A 4OYXA 5DS0A 3EE3A 4I7FB 3QIDA 2ZH3A 4YB5A 5JMNA 5HBMB 2OSRA 4QVAA 4L3KA 4PCQA 2G2ZA 1QD1A 3BB5A 5GMDA 2E1CA 4A8XA 2CWKA 4I64A 5U47A 4JI2J 2CQ4A 4QU6A 1VQMS 3CB4A 1QSYA 4FVCA 1UVLA 3LWMA 1OWXA 4PWDA 1VQLB 3G82A 2JLFA 3IGNA 1U1KA 1E6VA 1OQ6A 1ZZNA 1RE1B 3FMBA 3SBMA 2COLA 1FJGJ 5IT9Y 3LAKA 3U1NA 3CCRS 4CLFA 4JI6F 1N52B 3PR5B 1S99A 3OE7A 3NGTA 3GV5B 4HH1A 5CA5A 4ID8A 2ZM6J 4I2QB 4X4PA 3ITHA 2Y0BB 1S59A 2B9EA 4X62J 4J91A 3J7Z5 1Q78A 4X7CA 1VQPB 1TTTA 4OOVA 3MM8B 1K9MD 4BC7A 4WZEA 3DI6A 1UWBA 4ETXA 4DQPA 4L3NA 1U4BA 2VQEJ 1B0TA 1U1LA 2YKMA 1FTRA 3PYFA 2OK8A 3L9ZA 1N34J 5CZVA 2EC0A 3MD1A 1BHNA 2VODA 3KKFA 3VZIA 4QIGA 2K2PA 2ZD1B 1ZA2B 1WC1A 2UXCJ 1XB2A 2WSEC 2CQCA 4QIVA 2XOKA 1CPZA 4AQYF 3PACA 1D9FA 5LOQA 1FK9A 1OMSA 5GV7A 3FBFA 1OB0A 4YALA 2QJ3A 2XS2A 4QWAA 3GB0A 3R8YA 3W60A 3FDSA 2DEUA 1UZDA 2RUGA 3QT7A 2X1BA 3KK3A 5D0HA 3IWLA 1LW0A 4Z4WA 1TKDA 1XQIA 4HH0A 4PG7A 4DF4A 3RZAA 5DDRC 4PG5A 1ICEB 4DV6J 2C2EA 2XMJA 2RDIA 5FL7A 1EKSA 4O4GA 2JWNA 4ZIVA 1BD6A 3U2QA 4BPRA 5D4OA 4EYHB 1RTDA 1UEVA 2FVGA 1RKJA 1RT4A 3O1LA 2MXYA 4WYWA 1S6PB 1YJNS 3OL7A 5GAGI 1URNA 2CNNB 1T0TV 1T9VA 3LP1B 5D3GB 4Y2IA 1JA0A 3IR6B 1FX2A 3AGPA 5BJRA 4TU8A 2DR7A 3CCVB 3R5DA 3RBZA 2AGPA 3UR3C 4RJVA 2R4FA 4DN9A 3EVMA 2P2CB 3PJWA 4ZIWA 3IRXB 3AVWA 1GO2A 2R7UA 1H2VZ 1PIEA 2Z2YB 5K8MA 4DV0F 2XY5A 4LF9J 2MZRA 3OSPA 2DIVA 4Y2CA 4CI0B 4DL5A 2E7XA 4LR7A 2V2QA 2GIRA 1R5BA 4Q43A 4OYIA 3BGFA 3TAPA 3IGVA 1BMQB 2XTJP 2RRAA 1M5KC 3HSZA 1TMMA 4DPOA 3GJQB 3J80U 2WSSA 5FA6A 3TVYA 3O2IA 2Y1LB 1YJVA 2CZ4A 3GYGA 4EUVA 2VZLA 3M8QA 3P5BP 2XHWA 4J9MA 1GXTA 2BANB 4DR5F 1PAUB 3SZ2A 4K4UA 1JJ4A 1Q4RA 3DRYA 3DRXA 1X4FA 3MMCA 3RBXA 3JAMU 1SBRA 4ECSA 3J7AN 3CXCR 4X2BA 1S12A 5FLXY 1IBLF 2QTZA 4BHQA 3LVBA 2ZBPA 3HD1A 2BJ3A 4JI7J 1VFJA 3SDEA 3SV4A 3MECA 3PYGA 3CCQS 4HI2A 1S1WA 1IWGA 1RCXB 1K44A 3EGNA 2UV8A 1H3DA 4RUAA 1DTQB 4FZVA 3HD2A 2BJ1A 3O3LA 5KFCA 4CCHA 2PGCA 2E5GA 3KLIA 1CJKA 3ICLA 3R5JB 1S72S 1FRQA 2F65A 2FJVA 1D1NA 1W87A 1VQ9B 4GMKA 1LXJA 3DLBA 1UA0A 5J2NA 4NLSA 5HZBA 3PKMA 2RQMA 2I8EA 2CQ0A 3LWLA 5F4OA 2RMLA 3W65A 4YMEA 3IS9B 3ZNJ1 1TKTB 1S1TA 1EJ7L 1BQXA 3CCTA 4WZQA 4GVBB 2XMMA 1VC5A 3J81Y 5KG3A 1JQGA 3CD5A 2KL8A 2HAIA 1F3VA 4LF5J 3SEJA 2ZWPA 2HFZA 2QMUA 2QA4G 3CE8A 4PXEA 4ZLJA 2V8GA 3W2VB 1RWWB 1LOUA 4WFXA 4KKUA 4O0IA 3EVOA 3MMAA 4TQRA 3BY1A 2LFVA 3QT8A 1MWQA 1PC4A 2FHOB 5F9LA 3E01B 3ET6B 3EDRB 3KL9A 3I0RB 4QHYA 4B08A 4UZFA 2GMJA 1OPZA 4H4KC 3G8TA 5HROB 1EX8A 4ES3A 2GQ2A 1U8WA 2LKZA 2PO4A 4Q5VA 3KOAA 1T8EA 1S9GB 1BX0A 3TZYA 2KTQA 1U0HA 3RG6A 1JK9B 1RT6B 4P6QA 2R7RA 1T11A 3QT6A 3SMZA 4JV5J 2FVQA 4A47A 4NE9C 2EC2A 4DV2F 3M2RA 2G2OA 3JS9A 4OV6A 3T56B 4KPYA 4OLPA 5FDLB 4WFYA 2ZL5A 4G7WA 3CJ5A 3PRBA 3T1YJ 3KG1A 4IH7A 2R8HA 3T5HA 2V7VA 3KJVA 1TLLA 2HLTA 3HFKA 3AVYA 1IKWB 2GO8A 2GQFA 3Q8YA 3DOLA 4BCAA 1Y0RA 4OI6A 1RT3A 3OTBA 4LBVA 4RLZA 2LA4A 3MHYA 1M0SA 2CPJA 1RT1B 3MEEA 2R8GA 3GVJA 4CLSA 3K7RA 1A7GE 2F4VF 3Q2SC 4HTJA 2AEFA 2H48B 4ED3A 4OP7A 2NXNA 1AW0A 2MZQA 4CT9A 3QSIA 1QLNA 2DCUA 3L09A 5T7LB 2JOQA 3HK2A 2U1AA 4ID5B 4DG1B 4YN3B 4JV2A 4DSJA 3RR8A 4I6AA 2GMHA 1VRUB 3HJFA 3Q8UA 4KTQA 1BQMB 1WG5A 4GKKJ 5HO4A 2OK7A 4ANEA 1SJRA 4NZ7A 4G6VB 4HHHA 4C3LA 4DLGA 5C42A 4C43A 1E62A 1ZH5A 2D41A 2YPYA 5C24A 3UQSA 4KKOA 4JBCA 4IFVA 4B9SA 1R31A 4DX5A 3M8RA 2ASDA 2HGMA 2XLJA 3UN5A 3MR6A 2GHPA 2FGCA 1VC0A 1S1UB 4JOUA 5KFQA 3FJOA 2EK1A 5EDWA 1X60A 3R5GA 3W5UA 3H7HB 3A3GA 3BPDA 1EKRA 3VV2B 3OR2B 1RDRA 2VPWB 2XMKA 1SV5A 2X7IA 2EFGA 1RISA 3A4TA 4RW7A 2EI5A 1FNBA 4LQ3A 4CM2A 1SC6A 3CCQB 5JVGQ 2MGZA 1YJ9S 2OBRA 3MAQA 1H72C 3RAXA 2D9PA 3KUEA 2V68A 1HHTP 1FKPB 4ED7A 4ZV4A 3ZC3A 2DCLA 2UUWA 1UD5A 4H9GA 1S72B 1RAFB 2FVRA 2B4UA 1PSDA 1X4HA 2RT3A 2ZBRA 1C1CB 4X05A 3AOBA 4QOTA 1Z2LA 3HLUA 3Q6RA 2FX3A 1LXNA 4P75A 4MK9A 3CDBA 1TKXB 1D9AA 4FYDA 3CCJB 2HHUA 4Y6IA 4MKBA 1OO0B 2NREA 4UUXA 4JI3F 2P9EA 1CJUB 3OFEA 4X4SA 1BLIA 3M1VB 1AFIA 1UPMB 2JEFA 3E2EA 4N7TA 1RQPA 2DNYA 2J5AA 4MYUA 1F9EB 2ZH7A 2RS2A 3PXGa 2WVCA 2UXDF 2ADCA 4ED6A 4JUZA 3CJ3A 2F7VA 2WBRA 4ZPBA 4B3OB 3OJSA 2WHOA 4NLDA 2LCWA 5ETVA 1MMDA 3RBEA 1S0VA 3OEHA 1BWEA 1WC3A 5F4MA 4PWUA 1DQAA 3KG0A 5IC6B 1FDAA 2C22A 2MSSA 4X4RA 3VVUA 4CLYA 4Q7AA 2M70A 1Y0HA 3NCPA 2CQBA 2D3NA 4Y2KA 3E8OA 4USWA 5J2QA 4A48A 2EFQA 2OPSB 2IVYA 3QIPA 4GO7X 4C0HA 3IAM9 2VV5A 2QGGA 3QJLA 1NK4A 2GGPA 3HX9A 1UD4A 4DDFA 4LFCJ 4IG3B 2M88A 3NLCA 3I56B 3IP0A 1YLOA 4LF2A 4DSFA 3QYYA 3OXLA 4C11B 2E1AA 4KY3A 5LSLA 4OI2A 2C4TA 3WIUA 1TL1B 1ZETA 2ZL7A 4XL9A 4G1VA 4DV4J 3GCWP 4DX6A 1NPKA 2PSZA 4ZLNA 4B47A 3ZBTA 3FK4A 1WORA 1F6TA 5E3RA 3WX8A 5HI7A 3L95X 2LQBA 3CJ8A 4EO6A 2JL9A 1UFLA 1W2BR 4XN3A 2V9KA 4KFBB 2BVNA 3KLEA 4LR8A 3JQRA 4X4VA 4EEYA 3CP8A 3RB3A 2IJRA 1U8SA 4QBUA 2PI4A 4B9TA 3A8EA 4DR1F 2CIMA 4P7TA 1EWYA 4DCOB 4HE5A 2MMYA 1MWZA 1RWKB 3MZIA 1JNYA 4OJ3A 1DRZA 3W66A 3DLEB 1VQ8S 2YWEA 2HNYB 4B3SJ 4CLTA 3TJ8A 3VHQA 1FNCA 1KS2A 5GVQA 1N33J 2N3LA 3S1TA 2YNHA 1HPZA 1FKOB 4DBQA 3S7RA 4DQKA 1GMVA 2H3EB 4OZJA 3W5YA 4FPIA 4YFUA 2VA2A 4DCJB 1OYDA 2BYCA 3RW7A 3OZUA 3MUTP 2HNZA 4XN0A 3N6LA 2J0WA 2AZ3A 3FEZA 5L9NA 1TKZB 4XOTA 4CLZA 2HHVA 3KHRA 1HD0A 4DUYJ 4UY85 3G96A 3KMSA 5G4DA 1LWXA 2DNNA 2HFSA 4K1XA 5F4JA 1MSWD 3EMTA 2FLPA 1D09B 3TAQA 3MCNA 2J9CA 5CYMB 1SKYB 5KG6A 4F67A 2BMWA 3MCAA 1HW8A 4LRDA 4AFFA 3MWBA 3KK1A 3LA0A 1F2GA 3SJZA 1XEZA 3S01A 1NDLA 4NCGB 1HBMA 1ULRA 2ZNZA 1YJ9B 3ZO7A 1PYSB 4DR7J 1YI2S 4NCBA 3DDYA 3O5TB 4ES2A 3CJSA 5KG0A 4X7EA 3OPOA 1IXKA 4RLEA 3HHDA 3KHLA 4JI4F 4OYBA 2GNKA 1N54B 3FFIB 4ZGQB 2VU5A 2MZ1A 4F4XA 1X4DA 1M1KT 2PE8A 1LK5A 1VYAA 1VRTB 1C0TA 2VQFJ 4J9NA 2BX6A 3RB0A 3N5BA 1R5NA 5KFFA 2ZZFA 2CAJA 4KH1B 3OTCA 3QJPA 3GG0A 2YX1A 2R7OA 3PCOB 2KJWA 1D1UA 3QNWB 1EB0A 2CA9A 4MH8A 2FB0A 1CLFA 1LWFA 1CULA 2GIFA 2XGQA 4KHPJ 2CDRB 4ED8A 2ASJA 5KOWA 4Y00A 2Q1LA 3M32A 1QFYA 1C1BA 4DR2J 2QYCA 3VGUA 2R6HA 1FCAA 2V31A 1S0MA 2W4PA 2Q6IA 3C14A 3M30B 4PPZA 3PUMA 4EMDA 1VR6A 3FKBA 2DEJA 4RNNA 3R7NB 3MR3A 2JEJA 2EW9A 1R0BG 2NYIA 1U48A 5E3CA 1AUDA 1YJWB 3DM2A 4II3A 3FEXB 1GTEA 3BDEA 1VIOA 1R8PA 2ZH8A 3TUJC 4FF1A 1Y0YA 1RTJA 4EGLA 1R6YA 3HVAA 2QMWA 3LOUA 2AZ1A 4DI6A 2BM0A 2VDIA 4DU8A 4ZCIA 1DG1G 2PI5A 3Q23A 3H59A 2ZXIA 1HBUB 2AGOA 4OV1A 5IFMA 4G65A 4DV7F 5E33A 1G1XA 2ZH4A 1U26A 2E1RA 2ZC3A 1G6BA 3GJRB 4RBTA 5EWEA 1P9YA 2P5VA 2M2BA 4M94A 5KFKA 2IM1A 5IQ6A 3C8YA 4TKTA 1HI1A 1S5ZA 1CJVA 1IJFA 5JXSA 5RUBA 5E6TA 1YITS 3DRSA 4N77A 3PM9A 4Q2LA 4QWCA 1XMOJ 3J81j 3RU0A 5AXKA 4ZJQA 1FDBA 3KYLA 5CYQA 3TWZA 2RC5A 4QQBA 3QRPA 3OTOJ 2HW3A 4B3MJ 1B3TA 2CW5A 2RS8A 3PX0A 1SC3B 2V8HA 1VQ8B 3IWXA 1ZM3A 2VDHA 2V2ZA 2A18A 2M8HA 2M5SA 1XMBA 4B3TJ 4LIWA 4Q8EA 1REVB 4RW8A 1FT8A 4C2MA 2KZZA 2CPDA 3P27A 3VMFA 2GVDB 2HBZB 4G1QA 3L3CA 4NMLA 2GAHC 5HP1B 2OI2A 1VQ7B 2DVIA 2K7JA 4FKYA 1VHOA 3QFWA 3MAAB 4LRCA 4X64J 3OW2B 1WTBA 1RSCA 4TLQA 1LWEA 1HQEB 5KFIA 1KVJA 1FESA 2C2OB 2AV5A 2EFPA 2W9AA 2QLJB 1LFWA 2YTCA 3FRYA 3ZIAA 1S77D 3M9OB 3O6QA 2XS5A 1E3ZA 5I42B 3G9CA 1HHQA 3MAHA 3HVTB 3TO8A 4DSEA 1JKHA 1HWLA 2DRBA 3NGKA 1XNQJ 4OPVA 4NX9A 2KJVA 3P3DA 1HL6A 1VQNB 3LO3A 1NU4A 1FFSB 1TL3A 2WONA 1P6TA 1UVIA 4FXWA 2YH1A 4XQFA 1DLOB 1NDCA 5DZ6A 1DBDA 2VOOA 1YI2B 2F8HA 3K2YA 2KU7A 2EBGA 2VFRA 4FK8A 3OL8A 4ROXA 1KOOA 4DPTA 4NLWA 3TRGA 1TR0A 1MWYA 4F36A 1YJUA 4C8LA 4HIZA 4YDXA 2F1LA 2E5LF 5D0GA 1W34A 4EBCA 4FN5A 1R8AA 1BE4A 1NEEA 4HKQA 3M2UA 1SC4B 1FRKA 3EGWB 2LLZA 3BSAA 4HL9A 4LF7F 4EH1A 3EWGA 4R8UA 1AROP 3VAGA 5KFPA 1HFEL 2RSQA 3FSYA 3HHLC 3SQGB 4NBSA 1TVRB 1PYOB 2JDIA 1M5SA 3HT0A 3D9BA 1WKLA 2RQCA 3D66A 4ED2A 5IT9U 5F8NA 3MEGA 2B4PA 1J5OB 4OHYA 3DLKA 1M1KD 1GX6A 1A6LA 5DN6A 5HMWA 2AIRB 2VBSA 4LBWA 1T6ZA 4KSEB 4P2NA 2H54B 4TY8B 2ZL6A 1L5UA 9ATCB 1LW2A 3QO9A 5K8PA 3CDUA 3FZ2A 5DO2A 4IDKB 3UW1A 1RWNB 4O44A 2E29A 2IC3A 1N5YA 1B2RA 4TYAA 5MAOA 5DLFA 1TFYA 3D4JA 3AQPA 4A8KA 1NH8A 1NJXA 2XLKA 1VC6A 6AT1B 3N4WA 1HNXF 4MFBB 3W2WA 1RAGB 3H2UB 2BVZA 3U6KA 1RU1A 4OJ1A 1YGYA 1NDHA 4PC6A 1YTYA 1LQ9A 3W8PA 3A8JA 1S9EA 2XEXA 1ZAXA 3CCWA 5IYQA 3MM9A 3GIKA 2XHCA 5J1EB 1S49A 2Y0SD 3KFWX 3MURP 1YIJS 2AHOB 4TKOB 5B0EA 1S7HA 4WE1A 4K4YA 1S0NA 4Y34A 4I67A 1HYSB 2KVIA 1FA0A 4G1PA 2LECA 3EXCX 2WOMA 1VLYA 1N5TA 1JLAB 4F2RA 2CADA 4LF6F 1X5SA 1AYEA 1RBAA 3QWPA 4RU2A 2NR0A 4OI3A 4I2PA 1TK5A 4OYWA 1ZS6A 4CH1A 3JQMA 1FD2A 5HMYA 2BBEA 1HNIA 1NSQA 5D0RA 1QAIA 3PVDA 4DSIA 4LBHA 2P9GA 2GQQA 2DGUA 2CK3A 1SL1A 1WP6A 2ACYA 4YQWA 1NSAA 2HRUA 3JSBA 4JI8J 1XFOA 2IIHA 1YVFA 2RILA 4Q44A 2WB4A 2F4NA 5A6PA 3TP2A 3ENAA 2WSFC 5HQLA 1RA6A 2HVHA 3AT1B 3GWCA 1Q82T 4EYIB 3LP0B 4DX7A 2ZC4A 2L3MA 4EK2A 2YNGA 4WIQA 4TXSA 3DFEA 3DCAA 1MW7A 3ISNC 4R0EA 3PRDA 4NXNJ 5F8IA 3BBBA 4C4WA 3TZWA 4RW9B 1K47A 1EXMA 3SFGA 3I5BA 4QU7A 4BWJA 4WPAA 3KEWA 4PGOA 2OPRA 5DLGA 4D3HA 5L1LA 3BGRA 5IYWA 5GAHI 1RT7B 1F3FA 4RDLA 2HQFA 1XNRJ 2CJQA 4F2SA 1IHMA 4XKWA 2DNGA 4RO0A 2FLLA 4PAAA 5G0RB 4DR6F 3D7SB 4F4ZA 4MTPA 3G6YA 4CNZA 5HMXA 2XMAA 2X85A 3K5MA 4CQJA 3RB4A 4XTTA 2E44A 2LEBA 2OH2A 2GZOA 4B43A 3K17A 1IR1A 4DV5F 4Z4YA 4URQU 1SKWA 2XSJA 2HVIA 2V4JA 4N8NA 3ASSA 1RTZA 1BWVA 2HZAA 3W1YC 2LXIA 4NLVA 1Y11A 1NK0A 4PC7A 1IKVB 2QT7A 4DQSA 2DR6A 3HFVA 1FXRA 1PBAA 4A8SA 1FRMA 2GVZB 5HVHA 1SJ4P 5JUMA 1T9XA 1ZUNB 4U9RA 4F50A 4TN1A 5F41A 4CLUA 2C5BA 1OS5A 3F44A 2CQ1A 5LMUJ 3SYZA 2C42A 3RR7A 2CG8A 2MLXA 1IKXB 2J8SA 3MCMA 4KYZA 1Y00A 3VQTA 5CYJA 3JYTB 1QGZA 2QN6B 5A8KA 4ECXA 2HURA 1V3SA 1D9DA 3B78A 3I82A 2DRDA 4AE5A 1WG4A 5EUHA 3RW6A 3T5JA 1KHVA 2DR5A 4J9PA 1ROFA 1Q7YT 5TY0A 4P2XA 3CJRA 3F73A 3SSSA 1AB8A 1LFPA 3VAKA 4GO5X 1D8ZA 4JI2F 5C2GA 1AZSA 3ZZYA 2CKWA 1HD1A 4MKYA 3DMJB 1B23P 1W35A 1JXEA 1RZMA 2F40A 3ILIA 4K4ZA 2UXBJ 4DEZA 1R0CB 5HJYA 2DGOA 1JLGB 1WI6A 2YNIB 5KFOA 1FJGF 1D0EA 1X7VA 3OR1A 2NXEA 3RAQA 1FFWB 2YKNA 1NNDA 4CO3A 3MMPA 5C25B 5D4NA 3R7SB 1KQGB 4LSNA 2ZM6F 1CJTB 5TV2A 4X62F 2WPDA 1YIJB 1IM6A 2V9WA 4TY9A 5F0UA 2VQEF 2XBPA 1Q81T 2QA2A 4OFZA 2I9SA 3TA1A 2ZTGA 5DQIA 1M90D 4PEOA 2VBTA 1Q7LB 2PDAA 2NXUA 1NJIT 3W2IA 2UXCF 2Y1RI 1SQFA 3RRGA 1WUUA 1KRPA 2RC6A 4NLPA 4ES1A 2HWTA 2C4UA 1H74A 2HFVA 4X84A 3QZ8A 3J81k 2LVWA 2WCXA 1NK8A 1Q1KA 4ZP9A 2YY3A 1WU8A 1SUQB 2DGQA 4IO1A 5ETRA 5TR9A 4F4WA 3G71S 3CD6S 1HQ2A 2ZITA 2Z57B 3OBIA 3IBFB 3CC2S 1PAEX 1IBKJ 2Z2MA 3MM7B 4RW4A 1KSPA 4Z4VA 2WVEA 1K1SA 3G87A 3CW2A 1U1MA 4ZPWR 4OYAA 4C8MA 2HQIA 4OYOA 1R7IA 2HEKA 3M8YA 8ATCB 2HLUA 3W9HA 2BJ8A 2LMIA 3D6HB 3DN9A 4DL0C 2D3UA 3BV8A 1Q82D 2KT3A 2XCPA 4MK7A 1N07A 4ZVPB 5HK4A 3IS9A 2JEGA 2VD3A 3Q24A 2G4BA 1X31C 4YEAA 2HS0A 4V1Ak 3HVRA 4GVBA 1HZEA 3G6XA 4LQ9A 5LMNJ 3SQOP 2CQDA 3G4SS 5CD4A 4KKSA 2FUG9 3DRRA 1Q8LA 8AT1B 4NRUA 4XDDA 3L4BC 3X1LB 2AJQA 2DGVA 3DXSX 1H7WA 4LSLA 3VR6A 3U1MA 4RD1A 2ZE2B 4I4BA 5DG7A 1FXLA 4XOPA 1REGX 1RHUB 2W7OA 3IC1A 3C66A 2HDNB 3ET6A 4EBDA 2HGNA 3AH6A 4LBPA 4IH5A 3I0RA 2UUAJ 3LANA 2A2DA 2XZWA 3R1LA 2A0FB 2EKNA 3NS5A 1F2HA 1OY9A 3TQEA 1JLFB 1RWXB 2VKRA 5B09A 2D74A 4J9QA 2CWXA 5HANA 1WDDA 2W6IA 3A3OB 3VALA 2QFIA 1NDKA 1RT6A 3BH6B 1SH3A 1N6QB 4ZMMA 3W63A 1QUEA 1GTHA 2GV1A 2XZPA 3BYPA 1WDTA 2E1BA 2G0CA 2OEMA 4BS2A 4DUZJ 3OFNA 2NUHA 1E6YB 3Q8VA 3R2CJ 1BY9A 5ETTA 3IM8A 3I32A 3OJWA 1NO8A 3H8YA 1S6QB 2AYGA 2J6UA 4JI7F 2YQ3A 2KT2A 4NWBA 3QWUA 3A3PB 1RAAB 1CC7A 3DC2A 4NLUA 4Z4SA 3OJUA 4NZ6A 3FNNA 1KFSA 3MPVA 3D6TB 2BQUA 4GQNA 1JLCA 3K58A 3VR1A 4I56A 2A3JA 4QCLA 4L75A 2H9ZA 4M5HA 1ZM2A 5KFDA 1AA1B 1T9UA 4U96A 4O3PA 3CIMA 3DYAB 2QTLA 3NE5B 1HNWJ 4DHVA 1CS4B 5T7LA 3U7JA 3I31A 1K73T 1RWVB 1U1OA 1Q7YD 1FERA 1H8HA 3ZZUA 1BUXA 4DV1F 4Z1MA 1Q8BA 4E0FA 5B0AA 1G7SA 3R2DJ 2HLDA 4ICLB 1T6YA 2XZLA 1RTHA 5DGAA 3HP6A 5EGYA 1VRUA 3NS7B 1R43A 2ASYA 4DL6A 1T03A 5IYPA 1Q5VA 2VA3A 3EZUA 3ONQA 5H9FK 4F0KA 2F9DA 4LF5F 1C4CA 4OPOA 5A88A 1JB9A 4L6V3 4HEA9 2E9TA 3ZPNA 2ALZA 2UUBJ 5AJ3F 4TMWA 3GTYX 2QLBB 1BPLA 3CMAS 2W9CB 3A3NB 1UVJA 1S10A 1S6UA 4B4DA 5HVGA 1TTHB 1DHMA 2XZDB 5DETA 1S1UA 3IRWP 5THWA 3NGRA 2W7PA 1N0VC 1O6XA 4PRFA 1JXLA 1F0XA 4KT0C 3GFHA 4RD4A 5FIUA 4ZA1A 1DAXA 3Q8PB 4JV5F 1Q86T 4N56A 1O8BA 1H42A 2ZVSA 3DLLQ 2HFUA 4X66J 2EFNA 3LP2A 3QBCA 3CD6B 1NHUA 3S6EA 4WFZA 1QJHA 2L9WA 3T1YF 3RRHA 2QTWA 3CC2B 1DURA 2OTJS 2MKJA 3E51A 1FKPA 3TAMB 3SIPB 5HQMA 2CFXA 2PA8D 1CBKA 1MNEA 1XR7A 4DMZA 4HE6A 4GRSA 1C1CA 3Q0AA 2DHSA 4XORA 3O44A 2K3IA 3N79A 3CJTA 1WG1A 2W2QP 4PC2A 1FNMA 1JJHA 2B7BB 1TKXA 3KLGB 2JH3A 4UTGA 2JSXA 1G7CA 1B0PA 4ELTA 1NKCA 2XSFA 2BW2A 4JI5J 1JB0C 3HT3A 2W1BA 2UVUA 4K2JA 3Q8QB 2KFYA 1Q16B 1VHEA 2JLGA 3V4IB 2C2WA 4Z7YA 3AD9C 4RNFA 4WP9A 2NCKL 2MZTA 3NWGA 2ATLA 3G4SB 2BE9B 4DS5A 3HM9A 2VNKA 4KGVB 2DR8A 5JVHQ 3E20A 4ZGNB 4GKKF 2X3GA 4IO9Q 1NBMA 3ZNUA 1B7FA 1Q8IA 1I7PA 2LP4A 4R5PA 2EG2A 1FJCA 3IBCB 3OP1A 4FYWB 2C2NA 3V6KA 3I0SB 4RW6B 2UUCJ 3FBEA 4WU3A 2A10A 3HAGA 1IR2A 1GVHA 2C3YA 1MG7A 3QQCD 5BSYA 1RWPB 2RQKA 5KFMA 1R89A 3VAMA 3CIZA 5F8HA 4OHZA 1SVDA 3W2GA 3QT5A 2VFTA 2E1PA 5BYSA 3BF4A 3LW5C 4OZ1A 1L3UA 4CT8A 1VQ4S 2GAGC 3MPUB 1Z4UA 1EP4A 2FZGB 1WOSA 3PR4A 3FRZA 3Q8SB 1RP5A 1FX4A 4C11A 3POTB 1TL1A 2HWHA 4J90A 2R3VA 2WZ1A 2L08A 1QM9A 3FMWA 4GC7A 2KB2A 1AIPA 3OLBA 1XERA 4Q0BA 3TVKA 5IK2A 4TMTA 2ZJPQ 4WP3A 2K8GA 5AE2A 2J0SD 2ZH1A 2IAJB 4PWDB 1ZPVA 3VWSA 1WACA 3G82B 2DTJA 3FZBA 4CO4A 4W98A 4HHUA 3H20A 1JLQA 2IRUA 3CPXA 1EQ0A 4IQMA 3ILOA 3TUZC 3LALA 1H98A 1NK7A 3R6GB 2B8QA 4IW3B 2FY1A 4ZOSA 2CJAA 2VFVA 3OFFA 2ZH6A 2ZJQQ 2Z58B 2E7WA 1UCNA 3DLEA 3K57A 4DU7A 4JV0A 4XM3A 1RT5A 3DI6B 1UWBB 2DNRA 3HHLB 3EUNA 4Z4TA 1QAJA 1SKRA 2YKMB 1K73D 2L9DA 2VC1A 5KG2A 2DHXA 4QWEA 4USJC 4ED5A 4MYTA 2R2TA 2GFFA 1KDNA 4XD7A 3I55B 5KT6A 4ECWA 1VQ5B 5AXLA 2X51A 2AP6A 1HWKA 1TKZA 1FK9B 3CMAB 3BN4A 3M7VA 4ILRA 2ZKTA 1LWCA 4F02A 5AT1B 1PGZA 3M6WA 4AT1B 3OL6A 1H85A 3AXMA 3C6TA 1Y5NB 4DL7A 4YR3A 1U25A 4DQQA 2ZVIA 1GAQA 2WK4A 3KK3B 1KNZA 4NYZA 1KK3A 4M2LA 4QV2A 1FXDA 3C15B 4ZVEA 1S7IA 2BPOA 4RPDA 2RQ4A 1TL7A 4WBFA 4J9SA 4O4GB 4LFCF 2MZSA 4QPTA 5AN9A 1MROA 2N4CA 1RTDB 1FKAF 1UFKA 1E63A 2CQGA 1V0FA 4XK8C 2DNHA 1RT4B 5C2CA 1VQPS 3NOCA 3OJXA 2EBEA 4DV4F 1RQRA 1YBUA 3BS9A 4ZJOA 5GAEU 1Q86D 2D7SA 9RUBA 1S1VB 3L7PA 1RYRA 3JSMA 4G5GA 2ZHAA 3WYAA 2D69A 3H98A 2BJDA 2VG7A 4FYXB 3EXYA 1HNVA 2WW8A 4G7XA 4ZN3A 2BN4A 2AYMA 2G1HA 4WF9Q 2JIZA 1VRTA 4ZPVR 1U7LA 5E7OB 4M5MA 1KR4A 3MCSA 2LQ5A 4C9DA 2DHGA 3TA0A 2GJFA 4URSA 4M5DA 3JB9k 4X07A 4DL4A 5KFNA 2V0NA 4N5SA 1K1QA 1VHIA 4NEZA 1I94F 5HXBA 3W3SA 1UKUA 3UCGA 3WY9A 2CZVC 4TMXA 5J2MA 1L3TA 3V6DA 5CCMA 5ETPA 2H5IB 4ZLPA 4KAIA 2HS4A 2PMHA 4MIAA 4XLEA 1EFTA 3W2FA 4ELVA 3M8QB 5AXMA 4NXMJ 1T3NA 1ZM4A 3UPFA 3MR2A 3NAHA 4I69A 3M30A 2HRYA 3D28A 4CQ1A 2R2SA 3EZ5A 2J0QD 4RD2A 5HSPA 3AY0A 5E2QA 5ETQA 3MMCB 4UZEA 2B4VA 3VAIA 3KHGA 4C3MA 1CSJA 3AJ1A 4MAKA 5CAAA 1CNEA 4ECYA 2FQQB 4DUYF 4OYMA 1Q95G 5DSZA 4C97A 1FRJA 3SDEB 3FBBA 2I6WA 1RADB 1KVKA 1QUFA 1VQ4B 1S1WB 2CJXB 1Z2ZA 1CEZA 1Q9SA 1TUWA 1R6VA 1IBMJ 4FF4A 4PWWA 1JWWA 3I4PA 3MR7A 2BW7A 4DFPA 3OXGA 3P5TL 1NZAA 4II2A 1UD2A 4DPWA 2K06A 4C8OA 3KUHA 2B8PA 4OX7A 4DR7F 1YLXA 4N41A 2RNEA 3GFZA 2J8AA 2N7CA 3MM6B 4K2XA 1Y4ZB 1U49A 1KN6A 2UUTA 2JN9A 3MMJA 3P8BB 4P2SA 1CG2A 3MTKA 1S1TB 2VB6A 1Y7PA 3IM9A 3DDIA 2EXUA 3PG9A 1EHWA 4Q8FA 3WHIA 3IXQA 2X53S 2C2RA 4WWSA 3QGGA 2VQFF 4HHJA 4CYUB 3MMAB 1R0AA 3CCZA 2BRKA 4WTOB 4NA1A 4P72A 3WIVA 2H4WB 2BJ7A 4ALZA 4N47A 2JJ2A 3OUYA 2QSFA 2VG6B 4UY8T 5K9FA 3OT9A 1QX4A 1M5OC 4TLRA 2AGQA 4N8OA 3UFCX 2R7TA 1UD6A 1R5OA 4P6VF 1SIZA 4OI1A 2ZDPA 4EFAC 3ZTQA 1VQ9S 1U0HB 4DR2F 2XO7A 4YUDA 3D0GE 3RUBL 3AQOA 5HQ8A 3SXLA 1RK8A 3NY0A 4ZS6A 2V7WA 3PNIA 5L1JA 3UVJA 3ZZOA 3CCES 5I42A 1UTAA 2P8IA 4P22A 3EICA 2MQMA 1GR1A 3HHKA 2B6AA 3KJVB 3HVTA 3OFHA 2P3MA 4G1BA 4DN0A 2A6MA 3G8SA 2RF2B 1SQEA 5J1PA 1WHWA 2QGFB 2NZ4A 1T9TA 1RT3B 3BBCA 1KFDA 2XY7A 4K0KJ 3MEEB 5KW9A 3BGLA 2UVRA 3Q83A 3AD8C 2OBTA 4CO1A 4JV1A 4M4SA 3THPA 2XI3A 2X0KA 1X9WA 1W0JA 4MIWA 2V4RA 5DQGA 2DCUB 1BX1A 4Q2MA 2K3KA 2RKIA 2WVBA 4M0LA 2IVFB 1ZA1B 3ZTRA 4KGMA 5I3UA 5IZHA 1QFZA 1F9HA 4RDKA 3KUGA 3IR5B 5L1KA 1NH7A 1FTCA 5M2UA 5BSXA 1D3WA 4RDJA 1VQKS 4R0JA 4B48A 5GMKa 4CH0S 4AD6A 5B7WA 2EK6A 1FFGB 2D9RA 1QUVA 1XMOF 2CNDA 3QGHA 3SQGA 3CMMA 2KN4A 4KR0B 2Y3YA 5D15A 2XYGB 2GS8A 3OQ2A 2XNDA 4ZPCA 4OHWA 3WDOA 2QRRA 5C42B 3ONUA 1RWUA 3MCOA 3OTOF 2GC8A 3BGOP 4B3MF 2ZDOA 2AJ0A 1FVQA 1V0EA 4ZJLA 1RT2B 4WXWA 4IFVB 5GV8A 5KFXA 4B3TF 1JXVA 1OB2A 4IDKA 1QDUB 1OHHA 3NWRA 4NMXA 4F0MA 4NRTA 2BUNA 4LIRA 3H5UA 2V7XA 1DQ8A 2AX1A 4TU9A 5THXA 4LC0A 4NI2A 4MFBA 3GSDA 2FLNA 3QSYA 3KNGA 4RKUC 2HZVA 3MUMP 1SV5B 5J1EA 3LTOA 4OI4A 4V19J 1N32J 3HXMA 3GR1A 2KFZA 5K8NA 5ETLA 5KG7A 3GYXB 2QA4S 3H4DA 1HYSA 1VJWA 1FJ7A 4FXVA 3FPKA 1MN7A 1XNQF 4KIAA 4RX6A 1PBUA 1RBOB 1U1PA 3TA2A 3JQJA 3ZUGA 2ZZMA 3WXMA 2DXFA 4KO0A 2FDNA 2V7UA 3VAFA 4OX9J 3D0IE 4IQXA 4H4KA 1YRTA 5KT5A 1RI7A 4HACB 3Q6QA 4WU2A 2HCJB 3FSXA 2PFFB 3G8QA 2O01C 3FCHA 4NPOA 3N0VA 1PKVA 1T7PA 2IM2A 3KJFB 1NKEA 5SUHA 1PYTA 1HI8A 4OZNA 2HHHJ 4C7QA 3BGUA 2WZPP 3M8WA 4X4QA 4OZLA 3VTIA 4UOCA 1RAJA 1NB9A 2VHGA 4ZVUB 1K28D 1GX5A 3EGVA 3Q39A 4RW9A 1NB2A 2ZH5A 2OMOA 1V3ZA 2HK3A 4P9SA 4WKRA 1JJCB 2IPOB 3CO9A 4R71A 4LSZB 2XB2D 2WR8A 4MK8A 5K14A 3IMQJ 5EMNA 2A6OA 2VG5B 5DDOC 2K7KA 5LL6d 2EIXA 4FPRA 3KJNB 1IQTA 3IBWA 1NJWA 2BABA 4USVA 4L76A 4LT6A 4ECRA 3D6FB 4FS1A 5J2QB 2VNHA 2OEKA 5G0RA 2BE2A 2VBUA 4XLFA 3QIPB 2OIHA 1FNDA 2HVEA 5KFAA 1IJEA 3R6KA 2GGPB 1U24A 3OTEA 3Q22A 4N3NA 5TRDA 5HAOA 4RPBA 3LPYA 3VCDA 4W4MA 1D8TA 3CCJS 1EFUA 4LMZA 4B3FX 3RAMA 3ES9A 3CCEB 2E7VA 2JFDA 3N5FA 1IN0A 2ZBUA 5D4LA 4Y2AA 5EX3A 1RTIA 4F3MA 2MJNA 1KKHA 3PDNA 3KDOA 3RJMB 4DSKA 1IKVA 3VGSA 4TQSA 3QFSA 4K5SA 3B82A 3CTAA 4HT7A 4UOHA 5H9EJ 5C7PA 3C3LA 1VMBA 4ACAA 2XNJA 2GVZA 2OO4A 4DLEA 3IG1A 3MFIA 2IMWP 3QFTA 2IBOA 2R7WA 1O51A 3R97A 1NCLA 1KOHA 3HO1A 1CQXA 3V81A 1R27B 4FDFA 4CLKA 2ZFHA 1YX2A 1QAYA 3DDKA 4U9UA 2MQNA 3H90A 3JYTA 2AYEA 2QN6A 1C0UA 1VQKB 3C2PA 1SB6A 3TANA 1NHKL 1LEOA 4JI8F 5M2PA 2KXHA 3SLNA 3ILLA 2NXCA 2YNHB 2CPZA 2CPEA 3I56S 2YWKA 4ECTA 3KJQB 2HKEA 2JHEA 4DPUA 1AT1B 2LXUA 3EJMA 4F4YA 2V94A 4ZHRA 4O0NA 3B54A 2HNZB 3PKYA 4LF4J 4QR2A 4L8JA 2RDDA 3OL9A 5E41A 5C5JA 3H5YA 2AEJA 3MHPA 3H2VE 3KK2B 3AVVA 3BBFA 1GXLA 3HVWA 5DJBA 1M5PC 3DLGA 4LRFA 4CO5A 5IWAF 3OW2R 2DJWA 2QE7A 4UZUA 4B9MA 2WVFA 1AUSL 2Z8QA 5IT0A 1XNRF 1JLGA 4C98A 2MY8A 4O4RA 2MQ8A 1N88A 2R8KA 2E9ZA 2FJWA 5BR8J 3NNAA 4DV7J 2B5JA 5E3QA 4F8RA 5C25A 2ROPA 2V6AA 1RHRB 4E98A 1HBMB 4ECZA 5A8RB 4Z4UA 2KVQE 2CJYB 3ASPA 3I1FA 2VFSA 4YB7A 2QA4B 1YBTA 3TOQA 3H5SA 2C3MA 1U09A 3M4XA 1XK8A 2ROEA 3HKZD 4CP5A 3JSYA 4KHRA 3PZPA 1J9ZA 1CVJA 4PQAA 2J6SA 3PJ9A 2BSAA 4ASUA 4M5GA 1Y3JA 1EARA 3FCVA 3M6XA 2NLWA 2YX7A 3CUNA 5J3OA 2DERA 3A12A 3N28A 3T6BA 3KG4A 3H5XA 4ACBA 2LDYA 4EO8A 5LXRA 4RWWA 2LQ9A 4TNOA 4JI0F 2C2ZB 1LNQA 2HHXA 4YY3J 2V5HG 1XIQA 2UP1A 3BEGB 3A8IA 3P4UB 2RHQB 4DX8H 3FGVA 4DQLA 3N6MA 2CYYA 3D3BJ 3J7A1 1KP6A 2DXDA 1LWFB 1CULB 1N5QA 2V67A 2XZOA 2M52A 1SQGA 1QVFB 2OPPA 5D78A 3J7YU 3OVAA 4B3RJ 4IOCQ 3T1HJ 1KK0A 1NBEB 1C1BB 4P2FA 3D67A 5SZTA 2UZAA 1NJYA 5FIIA 4ZVFA 1PCAA 3R27A 4OHVA 3DM2B 1I6JA 3HDSA 3HHEA 1AFJA 3G6VA 3D1HA 2X1GA 3CMES 1RTJB 1GK8A 4X4OA 2BMBA 1P9QC 3SV3A 3FEYB 4UOGA 2EFOA 2XCAA 4GKJF 3PO4A 5HL7Q 1B64A 3KLFA 3D68A 2ZE2A 1S76D 2HS3A 2D9OA 2DNLA 2BOPA 5T14A 5E3AA 4DZ6A 2UU9F 2WZNA 4C8ZA 2HHQA 1Y5LB 2NXJA 2PA3A 5E3PA 2XM3A 1F5CA 1FRIA 3DU5A 4NA2A 2PIAA 3KLHA 1JLFA 4UUWA 1JA1A 1BQEA 3HI9A 4B9UA 1CJVB 5KNLA 2RH3A 3CC4S 5DS7A 1FE4A 4LF7J 4Z4RA 1F20A 1SKSA 3DRSB 5EWFA 5I4MA 2XMTA 1N6QA 3FVYA 2MKYA 4CZCA 1KONA 1EQMA 4DL3A 2KM8C 5K20B 3ZTSA 2MHNA 1UEUA 1VF7A 5BXIA 2DXEA 2V63A 2KI2A 4O3SA 1E6YA 1IB0A 4U7UD 1HNZF 1YJWS 3BKUA 3NL0A 4AXJA 3M2VB 1JLBA 3HSDA 2APOA 1HKAA 3M9MB 3DHWC 4QR0A 3MEDA 5H5JA 1WI8A 4X8IA 3K5LA 2CZ9A 2QLXA 1PC5A 4RW8B 3TZXA 3OVSA 1IBKF 3C6UB 3AJDA 1QUPA 3MMBA 4G1QB 2W2PP 4ANCA 4DR3J 4RBVA 2RUSA 1YKWA 2O66A 3KHHA 1ZAVA 2HNDB 1HNXJ 2NZCA 4DF8A 4ZP7A 4HYKA 3MM5A 1N48A 1P4MA 3GP9A 1LWEB 2RE1A 3CEDA 2E9RX 1WHXA 1RWOB 2GW8A 1EIYB 1OB5A 1XE1A 2FD2A 5FJ4A 4EI2A 1XTZA 1RAEB 5KAKA 1DY3A 5D6GA 2DIUA 2W8KA 4ICLA 4WKYA 3ENVA 1SIWB 1KLNA 1NJZA 4YS2A 3IO1A 2X1AA 4OYZA 2ZJRQ 2C2KB 3DXBA 2O1PA 1WSRA 1JKHB 3MEKA 5LMNF 4KC5A 3TJAA 4EZ6A 2VPXB 1LKZA 4C0OC 3ELHA 1WC5A 3W2HA 1SCJB 3GV8B 2XLIA 3WBKA 1GEHA 5FO0A 2FVPA 2WONB 2FJDB 1E1QA 1WC0A 4DJBA 1FRHA 1QE1B 1NLKL 1FWKA 1KRHA 2CUYA 4XMYA 2UUAF 2CNOB 2OYNA 4IKAA 3TVZA 5KFEA 3M8ZA 2VJJA 5A0YB 4L74A 4LREA 4PC3A 4Z37A 4OZ0A 4RR5A 1X8DA 3RYLA 1VQ7S 1F1BB 1NM2A 4ZVTB 3A13A 4RUCA 3EYZA 4R8UB 1MU2A 4Y9RA 1RHJB 2DD8S 3JTOA 2QMXA 1TUVA 4TU7A 2NSBA 4P1VA 4KGXB 1T5EA 2F43A 2YKQA 5GMEA 2G1DA 4QIEA 4DUZF 2XWXA 1C2PA 1P1TA 4X65J 2ZUGA 3MEGB 2DNOA 2YNFA 2X6XA 4IFYA 4NLQA 1Y9OA 3PUNA 2F5GA 1LW2B 2Z2LA 3QO9B 2IMOA 1VQNS 4P3YA 1DARA 2OELA 4FKXA 2JZ5A 3MGJA 2IC3B 1N5YB 2FJEB 3CCUB 1XR5A 2B7BA 3KLGA 1QY7A 2MKHA 2X1FA 4ELUA 2YQ1A 2HGLA 3BR9A 3GONA 3MF5A 3BCDA 1RXOB 1X5OA 4NEYA 3W2WB 2JNJA 1EZZB 5A8AA 4BWMA 1S9EB 4M1KA 3MM9B 3QLHA 5BYQA 3CMEB 4J9UE 1GXUA 4RBUA 3CSKA 2DNMA 7FD1A 5F3TA 2WYRA 3DOKA 2AYBA 1IBCB 4WE1B 5E0OA 2HBQB 2V2KA 2DKOB 1PO6A 2KYZA 1VQ6S 2FZKB 4C0SA 2J0XA 1S0UA 1BMFA 4ZPAA 4H4MB 3I0SA 4L72B 2MQQA 4I2PB 3CMQA 1TV6A 4RW6A 1HR0J 3QFHA 1ITPA 2EVZA 2MKIA 2B9YA 2D3LA 1RAIB 2UUBF 3AOAA 3DOMA 3BQ1A 2OTLB 2M4MA 3G05A 1KMHA 4ANDA 3PEJA 2U2FA 2C3PA 4IG0B 2ZZQA 3CC4B 4ZKAA 3CVKA 3G2XA 3W7BA 4ZPDA 1FJEB 2XYHB 2KRRA 4PQUA 1NSKL 4DR4F 1OY6A 2AJ4A 4W90B 1EP1B 3POTA 1KK1A 4WJBA 2R7XA 4X7DA 1TUIA 2JDJA 2YNGB 4AVZA 2LDIA 3CNQP 1HQUA 4OJHA 2ERRA 2HBYB 3DGVA 4URGA 1EP3B 4LBIA 1HMVA 4X66F 1G7TA 2GJIA 4NNJA 1NK6A 3D1QA 5J2PA 1WEYA 2IAJA 2YWHA 3PFOA 2OPRB 2B7CA 4LFAJ 3BGRB 1IKYA 3JTNA 3NOGA 1SKUB 3UDVA 1ZOTA 3LQEA 3QATA 1SXLA 3KMQA 3HHLD 4KV8B 1HBNA 2FHMA 2QC3A 1HBOA 4IUFA 2CJ9A 1VJQA 4CM0A 4MKAA 2YWFA 2K1RA 3DGPA 2HMIA 3PVXA 1RGVA 2H5EA 4JI5F 1T6XA 4AL7A 2QSWA 1DDIA 4WK3A 3HHLA 4F25A 5D77A 4M5NA 4RZRA 5ETOA 4CTAB 3UDLA 1BQNA 4FS2A 4MJKA 2XSJB 4PUOA 2V4JB 4A8FA 5IM0A 2DPJA 3D1OA 3WQZA 3V6JA 2MLZA 4FYVB 1WF2A 3FBCA 1UVNA 1HI0P 1LV5A 1EFCA 1H2TZ 1YRUA 1H73A 4Q7JB 3DRPA 4JP8A 4IH6A 1RLCL 1W2IA 4KE5A 2XULA 4F4KA 5IV3A 3PW4A 1IUJA 1T9WA 3TUIC 2RRBA 4KH0B 2J9EA 2UUCF 2JJ1A 5M2RA 4JI1J 3OV7A 2AJ1A 4TT3A 3CCSS 3T19A 3T5KA 1LK7A 4LRAA 5A8KB 2GA7A 3C15A 1P1LA 4IRKA 3HSGA 4PZVA 5KFWA 2HHSA 2ZZNA 1K8AT 3MDFA 1TL5A 2VZ9A 4ZVGA 2CG4A 4UW2A 2XMVA 2ZKUA 3PFEA 2DGSA 2ZBIA 4DQRA 3MUVP 1N36J 3DU6A 5A8WB 5HZAA 3CJ4A 3EZOA 2C3OA 2OBSA 1H7XA 4C8NA 1AZSB 4DPXA 2X3DA 5KFRA 3ASQA 1YJ7A 1NMEB 1S1VA 2NV4A 2LEPA 1JJ2B 2W7AA 4F7DA 4A4JA 4JMQA 2PMZD 4ZVHA 1S4MA 1T05A 4LF1A 1JLEB 2HIQA 2Y1IA 5LJ3Y 2J7KA 2VPYB 4IR9A 3KTQA 3ETOA 3ISND 3KWMA 4O3QA 3OR1B 4RD6A 3H9NA 2MTLA 4HTIA 2J7WA 1WC4A 2YKNB 1W0KA 2AF6A 4P52A 3KLVA 3D0HE 2W9BA 3TR5A 4FYYB 2QEXS 2DYIA 2MSTA 2YX4A 3PHTA 4LSNB 1S48A 4XPEA 4OX8A 1VOMA 1SH2A 4P7VA 1RJJA 2PFDA 2CPHA 2X8KA 1H6KX 3BR8A 5F3ZA 5LT5A 2ZH9A 2QE5A 1VQ6B 1FE0A 4B9NA 1WHYA 2KVOA 3PYEA 2AKWB 3T5LA 3PW0A 2KHDA 5KOXA 3I96A 1FWLA 3G6ES 4ZN1A 4B17A 4RD3A 1KJZA 3JU4A 3OHAA 2B9WA 5KG4A 2LA6A 2Q79A 3H2LA 3CC7S 4ATNA 4RPFA 5MLCV 3H94A 4AUKA 4LBYA 2BKPA 1DDGA 1L3KA 1T3OA 3GCXP 2FJAB 4M53A 3T51B 1W9XA 4RW4B 4LFBF 3NEKA 2D3ZA 1B4SA 1OIAA 2VNIA 1VQSA 2W4CA 3UO0A 3Q86A 2X6WA 1VQMB 1AMOA 3U02A 4HDGA 3M6UA 2HVDA 4OYPA 4C8YA 4Y9UA 4QWDA 2H4YB 4DV1J 2D3O1 2W2MP 5DM7Q 3MM6A 3VVTA 4DSLA 1R3NA 2N4DA 4YB6A 3TEHB 3OXFA 1F5BA 4NYOA 5GAEI 3M6VA 2FZCB 3AVTA 4YHHF 3CCRB 1YZ7A 2GCFA 1U47A 1KTQA 1DTTB 2I5JB 4TVAB 2XMWA 5CXTA 4NZ0A 1Q79A 2VC0A 3DRRB 4IRDA 1W26A 1UD3A 4R25A 4WQMA 2QG9B 1XMQJ 3JXOA 5AJ3J 4LSLB 4CYUA 3VF0B 5B0CA 2WB1D 4C8KA 1SH0A 5H9EK 2VASA 2IDLA 3P45B 1VQOS 4DV3F 4QR1A 3CPWB 5IYNA 2ZXHA 3B6BA 4K4SA 4I7FA 2IJNA 3BO3A 2VG6A 4USIA 2ZHOA 2HYIB 3OSNA 2Q6CA 5HBMA 2D74B 4ZCKA 4CRJA 1WSVA 2CPXA 1UETA 3FPPA 3K5PA 1WEZA 1WF0A 2Q6BA 2KH9A 3T53B 4PG8A 4P12A 4NXMF 1UEKA 4H4OB 4V19X 4A8WA 4KJIA 4M63A 3Q2TC 3BSOA 1WELA 1S1XB 4PG4A 5A89A 2BA9A 1WTHD 3Q89A 1KQSB 4FXUA 3CCSB 3R6LB 1K0TA 2RF2A 3PX4A 3TARA 2LEAA 4J9OA 3WNDA 2EEYA 2V69A 3MI7X 3L7UA 2E5HA 2CXEA 1N5SA 3ISXA 5AE1A 1VK8A 1M5HA 2GREA 2IY5B 4I2QA 3T1AA 3AA8A 3CJQA 4USTA 1IBMF 2WVDA 3BKTA 1H38A 3WNCA 1JLCB 1FWPA 3MM8A 3WQPA 4YR2A 4ECUA 3ZBUA 1YJNB 2Z30B 3P6YC 4P10A 4YXWA 5B0DA 2XC9A 3TI0A 1K8AD 3T3FA 3RBDA 1UD8A 1A8PA 2MHEA 5JBQA 5FLXU 5CABA 2ZD1A 2Y8YA 3PY8A 3MPWA 3IWNC 2PT0A 3AODA 3OHBA 1RTHB 2ADBA 5F0WA 1T03B 1WKKA 2BACA 4RCYA 1XBWA 3LQVA 4RNMA 2MKCA 2VUGA 1JNRB 4PG6A 2QEXB 3BC9A 1U1RA 4FVMA 4P6YA 3C16B 4W92B 1TMJA 2YKPA 3GYNA 2HAFA 2BQRA 2HK2A 3K0JA 1RT2A 3QPIA 1UVKA 2CDQA 3QAUA 4ZP8A 4RNHA 2JLEA 4FF3A 3F41A 2ZEJA 3EM1A 2HQGA 1VIXA 2HVZA 1SPBP 3CULA 4D3GA 1Q0NA 2JC1A 1R8CA 2IA0A 1TK8A 3FUYA 1S6PA 1UW9A 3G6EB 3NBPB 3J81U 3UNGC 1VBZA 2ZZTA 3CDWA 1SL2A 3LP1A 5D3GA 2BKOA 3THTA 4OQJA 1OPIA 1FRLA 3CC7B 3B4MA 3BZQA 4I1TA 3SCJE 3ZFVA 5EN1A 3LP2B 1HWJA 2MQOA 5DQHA 2QIFA 4EZ9A 3C46A 3IRXA 3V6HA 4F04B 3ULHA 1I8DA 1WF1A 4F3QA 1QH0A 1RUSA 3TQ1A 2CPYA 2RHSB 1T02A 3HHNB 4K0KF 3AGQA 2DNQA 5CQGA 1UMJA 3ASRA 3PW5A 4HACA 1G7CB 4MT1A 5KT3A 3T9NA 3UDEA 4A8MP 2AW0A 1B0VA 3QE2A 1FHTA 2DGXA 2RU9A 2KM8B 1N34F 1QVGB 3QZ7A 2OFHX 1AXQA 3QFCA 4YDDB 4U7CA 4DFJA 2BANA 2OD6A 4ETZA 1GMUA 1RB0A 2X6YA 2CRLA 5H1SV 4ZVRB 1HWUA 1ZBTA 1N4LA 2FYXA 3HMJG 1ZPWX 2KKHA 2Z56B 2LQ8A 2DT9A 3Q3AA 4X7FA 1RBLA 3OPKA 4KB7A 4ECVA 4DS4A 4R5PB 1VQOB 1TP7A 4GC6A 3SKBA 2HSEB 3NCRA 5DDQC 3UN3A 4YP3A 1V9OA 1KC8T 2VG5A 1W7WA 2O3DA 1DTQA 5LM7E 2PD1A 2X3UA 2ZZGA 3MFHA 1H2UX 1SJ1A 4DV6F 4K7QA 3BREA 4LF8J 1RCOB 3ZTOA 3ZZZA 2XO6A 3BDPA 1N0UA 3BN7A 5K5MA 2GIQA 4OHXA 2QO3A 1I1GA 1YHQS 4U95A 5DGBA 4WTYA 4DOZA 1FI4A 1Z1ZA 3FSIA 2YXLA 1EP4B 3HSJA 1RAOA 3SFUA 3LPEA 3SEOA 3QGPA 1SL0A 2DNKA 1F60B 4WZLA 4XAKA 2OAUA 2C78A 1TKTA 2KYXA 1N32F 4Q0BB 5KFZA 1FX0A 1BJKA 1KLMB 2EPIA 3HFZB 1X4CA 1ZTWA 4IOAQ 2DR9A 2HFOA 2W4DA 5HLFB 4E0DA 1JMTA 2M8DB 3GE9A 2A1BA 3W2VA 3ZZPA 1JLQB 4PC1A 4LF9F 4PYAA 2CF4A 1XR6A 1WNEA 1TK0A 1FNOA 1T95A 2XMUA 5B0BA 3ZZRA 2QYGA 3E01A 4PABA 4XDCA 3AOCA 3PEHA 4XO0A 4OX9F 3GJSB 1R8BA 3ZXWA 2Z6BD 3E3XA 2PMWA 1I94J 1HW9A 4NL5A 4ZCMA 5HROA 2LU1A 1RT5B 1U6BA 2R7SA 1S9GA 2MPUA 3NRBA 2ATCB 4P73A 1KVIA 4WFAQ 2HHHF 3R3TA 3NGSA 2YPZA 3TUPA 3R5AA 1PKUA 5FDLA 2BJEA 4TSFA 2LYVA 3HPOA 2Q6OA 4X4TA 3E1YE 2CQIA 3NG8A 3KK2A 4JYAJ 4NLGA 4E8UA 1IKWA 4QWBA 2ACMA 1LWCB 2W6JA 2VJIA 1QTNB 3OVBA 4WXOA 4RU9A 3DLHA 3C6TB 4QYRA 4A8QA 4KKTA 2MLYA 5J35A 1FEHA 1Y5IB 1RT1A 4Z2XA 1HA1A 2BDPA 3BM7A 3U27A 4YELA 1O5JA 2L9NA 1YWXA 2AMCB 2VBWA 3ZZ0A 1VDHA 2MJUA 2V8DA 3VO1A 2QL7B 3CJKB 4C0BA 4LRBA 1NAQA 1VRQC 2P6SA 2M9KA 2FHJD 1SC1B 1TL7B 3HF5A 4MKVA 3DLJA 3I5AA 2D3OR 1MROB 4FWTA 5A8RA 2F1MA 5L1IA 4PKDB 1L3VA 4ID5A 4DG1A 3R9LA 2VPZB 3GQBA 3OFGA 4U6PA 2BXJA 2H51B 5H9FJ 2LQJA 3V4MA 1WTFA 2FHJA 1OY8A 1BQMA 5GADU 2EWHA 4G1IA 4ZPTR 3CF5Q 1VQYA 3PYDA 3UCZP 3JSMB 1RQ0A 2QL9B 1J2VA 2HIYA 1SKQA 3GFYA 4P71A 3I55S 2VG7B 1VQ5S 4NA3A 1U2CA 3BNWA 2V7TA 1NK5A 4C3KA 1COWA 1BGXT 2XI2A 1HNVB 2BQ3A 4RUBA 1J5EJ 2KRBA 1WWHA 2CJKA 3M8PB 1JNZB 5IYRA 3DHXA 2GX8A 2VBXA 4B9LA 5I3QA 1KWMA 4M5DB 2IBKA 4E2FB 4RNOA 2DIEA 2BRLA 3CXCB 3AHPA 2V4QA 4FBTA 2RD5C 4UQGA 3OTDA 5J2MB 3MPYA 3V6DB 1Q81D 3OR2A 2ZUAA 2NPFA 4XLAA 5ETNA 5HMZA 2DRAA 2M7SA 1TFWA 3PA2A 1RHKB 5KFGA 3LH2S 4YAUA 2MKKA 1NJID 2OGUA 3SLDA 2XY6A 1C4AA 2FTRA 2W25A 3BYRA 4LF4F 5KFHA 4ILLA 3LO8A 3SSQA 2XS7A 3QJJA 3CP2A 1F9FA 5CCLA 1QSLA 2E66A 2CRVA 2ALYB 3OLAA 2DEIA 3ENWA 3BSCA 3UNYA 1V6HA 1VBYA 2B3TB 4JI6J 3ISZA 3GV7B 3AD7C 3OAAA 1YHQB 6FD1A 2RU3A 2GO9A 4YB1P 1KC8D 3F56A 5DZ7A 1U1NA 4YR0A 2ROGA 3GIRA 4F0HA 5BR8F 4F3OA 2AQ4A 4OLOA 1GNKA 4BDPA 3NXZA 1MN9A 1CJUA 5JJBA 4Q45A 4I68A 5CH7B 1HA3A 3M1VA 1KHWA 3I4HX 4K59A 2OPQB 1EETB 2EFVA 4EBEA 4B3GA 2A2CA 5A6WA 1J27A 1FNXH 5L39A 4P3IA 2ZTNA 3ZZTA 2CVEA 4Y65A 4ZVQB 5KG5A 3HZEA 4LJMA 4AQYJ 2MQPA 5D8HB 3CDAA 1DFDA 2GQCA 3FJ2A 3T9ZA 1TAUA 4I0WA 4XLCA 4B3OA 4KRWA 3JSRA 5KFLA 3CJ2A 4M5IA 4CH7A 2NYHA 2XZTB 4DXLA 3GQCA 2J7UA 2DGTA 2Z2ZA 2G13A 2VL1A 2R2UA 3M2VA 3A3BA 2JX2A 1QTMA 2ZBVA 1IQZA 3CD7A 1UA1A 1TL4A 4DK1A 1RHMB 3OZVA 3KXDA 5KFYA 2OPSA 2HWIA 3U6BA 3NKYA 3UE2A 1R0AB 4KBIA 2C1EB 1JX4A 3H25A 4YY3F 5EX0A 2VJUA 3UWTA 4IG3A 4IYQA 1M5VC 3K5NA 2JFKA 3NMRA 3LQ6A 3C6UA 1VHFA 2AU0A 3PX6A 2I0XA 2QX0A 3OUYB 2I1LA 3VQSA 4FF2A 5GAGU 2BR0A 4U8VA 2HNDA 2VIHA 5A2QY 4B3RF 2HHTA 4NCNA 5L8RC 3T1HF 1U2FA 3W9JA 3J7YI 1E64A 4S0MA 3TX0A 3GFXA 2QL5B 1XJWB 3V2UC 4M5JA 4KFBA 3UVJB 3H42A 2DNPA 3SJPA 3SCKE 2IVMA 4TMVA 3GZ7A 1E6VB 4OOXA 2B6AB 3CESA 4P25A 4DV0J 4OOSA 4N3GA 4RL1A 1GQEA 2G0IA 2MY7A 1XC9A 4A8OA 2UVVA 2VBVA 3QRRA 2KDOA 4LVNP 2F4FA 3RGIA 1R8HA 3ITHB 2RIJA 3EDQB 1QE1A 4FNIA 1TZ0A 2HNYA 4J9VA 1SM4A 3LUYA 1WJ9A 3CCLS 2C28A 1VGYA 1FKOA 1KZLA 2V7QA 3BY2A 2RKIB 3CWJA 5A0YA 4WFBQ 5I3UB 5L46A 3W5ZA 4DR5J 4ZP6A 3QMQA 3D54A 4GVLA 3ASTA 3D26A 2XGPA 5FNZA 4YAOA 3BCFA 2M3DA 1NKBA 1IBLJ 3GG1A 3QAEA 3SCLE 1NK9A 2DHAA 2DNZA 4NLTA 2EG1A 2EKYA 1FDRA 1BLUA 3UD3P 2RB7A 2FJBB 5T41A 4DZDA 1GMWD 5KG1A 3V5RA 5CYMA 4QYZJ 3N9UC 5DM6Q 1LW0B 2GHVC 3A8KA 1I18A 3W5HA 1S97A 3U1LA 3AB4B 4EU0A 1EAYC 2DH9A 4UOFA 4P74A 2IFXA 3CRZA 3I87A 2D1CA 4O3OA 4DNTB 4I6WA 5KFUA 4QUZA 2VNJA 2LXFA 2O67A 4NCGA 2FPHX 1GMWA 2Y8WA 3IAS9 4DR3F 3C19A 2F8EX 1G3OA 4ZDNA 3N01A 4NI2B 1ELOA 2YBVA 5KT2A 2VBYA 3QSYB 5HJXA 1NSPA 1E1RA 1A9NB 1M90T 3R7BB 3FFIA 2NQPA 3W9IA 1S57A 2MZJA 3F0NA 2NPIA 2HHPA 2IRXA 3A1PA 1P8GA 3L7OA 4UAJA 3WC2A 1N05A 3JQQA 2VOPA 3JTPA 1S0OA 4H4MA 2QA1A 1FDDA 4P26A 1D2EA 1IWAA 4C48A 2WRMA 4KO0B 2ABYA 1N06A 1OGJA 4YAFA 2R7VA 2SXLA 2FIUA 2AX0A 1ZZFA 4B3SF 1UJ4A 4IG0A 1UMKA 1YITB 3VGTA 5DG8A 2XGJA 1N33F 5HATA 2E5IA 2PEBA 5LSRA 1UVMA 1BXNA 4OL8A 4QJVA 3I9ZA 2RVJA 4ZVSB 4I6YA 2H5JB 4NLYA 2CPIA 4UZCA 4DV2J 4EWTA 2JRSA 4NASA 1NPPA 2E1MC 4M95A 2MYFA 3FCWA 2HHWA 2RJZA 3WBZA 4A8YA 3KNAA 4QZVB 2VYQA 3PRVA 5EHHA 4CO0A 3FC9A 2V8VA 3TEGA 1KEKA 1QVFR 5IWAJ 2C77A 1FDNA 1UFWA 1U6FA 2B5OA 1VCTA 3MECB 4X65F 2MB0B 5K14B 2V34A 3D3CJ 4USMA 1HBUA 4HI1A 2V8PA 4WZKA 2F4VJ 1G7RA 1TELA 4AYBD 3VNUA 2WBMA 2YWWA 4CO2A 3FKSA 2R7QA 3KLIB 4KV8A 1RAHB 4PR6A 1CJKB 1QFJA 4U67Q 2BE2B 5DDPC 2IYIA 2YWGA 2FVCA 5AXNA 1N5VA 5J2NB 1IJEB 4F4AA 4L73A 4J9RA 2G0JA 1FO1A 1W2BB 2NUUG 5B0FA 3IN5A 1TUGB 1VBXA 2BKNA 1NXIA 1V5IB 1YQHA 5F8MA 2I38A 4QW9A 4XNFA 4CTAA 3TJ9A 1Q53A 1VBKA 2F9JA 1VI7A 1RTIB 3SSRA 3EGZA 3PW2A 5IS2A 1HARA 4ER8A 5L9XA 3GMGA 2QLFB 1BC6A 1OSDA 1T94A 4PXDA 2MDAA 2PEHA 2QMUB 4KGKA 2J9DE 2Q6LA 3EPGA 4NYPA 2C5HA 3GIMA 7FDRA 3FQKA 1WOPA 3MPDA 3IG1B 4CLLA 2R9LA 2CBXA 2XQCA 3O8WA 1JIHA 3CCLB 4DUTA 3AJ2A 4JI0J 4RD0A 1REVA 2J9DA 3BO2A 4FNHA 2W2OP 1HR0F 1YDLA 3V81B 2VONA 1VLOA 2PN6A 2R9VA 2GVDA 4K4VA 4PXCA 2DY1A 3WBJA 4DL2A 1C0UB 5HP1A 2OP5A 4KHPF 3MAAA 2LU2A 3D6MB 3GILA 1K0VA 5KFTA 1IM4A 1X4BA 2FJXA 1HQEA 4Y3CA 1WEXA 2IHR1 2IDEA 2CQPA 2V4DA 3J80Y 3M2RB 1VS3A 2CVIA 4ZHRB 1M1GA 3RTVA 5A8WA 4QW8A 4DFKA 4KHMA 1X4EA 1QAXA 2B9XA 4J0QA 4FXDA 3G86A 3LGHA 3K89A 1PJ6A 3BQJA 3UCUP 2OSQA 2B4OA 1I5OB 3JAMY 3B8HA 3DOLB 3DLGB 3AFGA 5IT4A 4XIUA 5L38A 2PIIA 2I1RA 1JLEA 2IYGA 4LFAF 3ZTPA 3NAIA 1DLOA 4GKJJ 2BJ9A 2HPUA 2HZCA 2DPIA 1KD1T 1GAWA 2ZBQA 4J37A 4G3IA 3JQPA 1CC8A 2B5JB 3WZ0A 4ITSA 4RUHA 1SJQA 4JI3J 2PLFA 2UU9J 2HG4A 3FQLA 1YG0A 4Y7CA 2J76E 5LJ5Y 3GVKA 3AXKA 4WFNQ 1YJRA 4CIOA 4Y28C 3GIJA 5KFVA 2KG1A 3QGIA 1TAQA 1X5TA 4WWVA 2NSCA 4B9VA 2CQHA 2H1YA 3P96A 2FLOA 3WX4A 2UXDJ 3D5MA 1X4AA 4A46A 2WJVA 5BYRA 1E79A 1TVRA 3LAMA 1N8RT 2OLWA 2DHHA 2W8LA 4CNYA 2BE7D 1HIYA 5H59A 1J5OA 1FEEA 2IRYA 2KHCA 5CDFA 1HNZJ 1YJTA 2W01A 4HVZA 5C24B 4TY8A 3H0PA 3W2EA 4KKOB 3DDNA 2RRNA 4DK0A 4YHBA 1NZ8A 4WZTA 3OEEA 2BOAA 4WCEQ 1EP2B 3H40A 5IXUA 2L41A 3W64A 2VBZA 3TNVA 4JI1F 1H0HB 1KTVA 4K5RA 3PV8A 4O23A 2OMLA 3T41A 1FRNA 4X64F 5EWGA 1NPRA 3VO2A 2OPPB 3WC0A 4BBYA 1ACMB 4LR9A 1V3RA 3MR5A 3RRKA 3HULA 3IR7B 4RW7B 2YKOA 2POKA 2V2VA 3Q38A 2HBRB 1N36F 2AHOA 2MGZB 3B4DA 3I6PA 1U45A 4PPDA 2QZ8A 4OX6A 1QSSA 3EPIA 1ZTTA
chains in the Genus database with same CATH topology
1UD4A 4DDFA 2QEXS 4IG3B 2M88A 3NLCA 2MSTA 2E5JA 2YX4A 2GJRA 4G6IA 1TKZA 2DH8A 3MOJB 4LSNB 1S48A 4DSFA 1FK9B 3BN4A 3QYYA 4ILRA 3OXLA 2ZKTA 1LWCA 4F02A 1JLAA 4XPEA 3GR0A 4C11B 3M6WA 3J7ZT 1PGZA 2E1AA 1DTTA 3OL6A 2DITA 5LSLA 2I5JA 4OI2A 2B43A 4OX8A 1TL1B 1VOMA 3C6TA 1Y5NB 1SH2A 2WSCC 4P7VA 1RJJA 1ZM9A 1ZETA 4DL7A 4YR3A 2CPHA 2X8KA 1U25A 1H6KX 4XL9A 3A35A 4DQQA 3BR8A 4DWIA 1MABA 2WK4A 3KK3B 3BJYA 5F3ZA 5LT5A 1KNZA 2ZNYA 2ZH9A 2QE5A 3IFEA 1MMLA 2VH7A 4NYZA 2PSZA 1FE0A 2I2YA 1WORA 3KLFB 4B9NA 5E3RA 1WHYA 1FXDA 5HI7A 3L95X 2LQBA 2KVOA 3K8WA 4ZVEA 4EO6A 3T5LA 3PW0A 2JL9A 2KHDA 1UFLA 2RQ4A 5KOXA 3I96A 4MMOA 4J9SA 4O4GB 1W2BR 1OQ3A 3G6ES 4XN3A 2M5YA 2V9KA 4LFCF 2IM0A 2MZSA 4KFBB 3DNCA 3KLEA 4B17A 4QPTA 3M8SA 1MROA 2N4CA 3JU4A 4X4VA 5KFJA 4EEYA 1RTDB 3CP8A 3OHAA 2B9WA 1DZ5A 1FKAF 3RB3A 3MTJA 4IOBA 2CQGA 2LA6A 3I9V9 5KG4A 5B08A 2Q79A 3H2LA 5KT4A 1V0FA 4XK8C 3KLHB 1U8SA 4QBUA 2PI4A 2DNHA 3LP0A 1RT4B 3CC7S 4B9TA 1VQPS 4ATNA 3AB2B 3A8EA 2F3JA 5HN0A 4DR1F 5MLCV 2EBEA 4DV4F 2CIMA 3H94A 4AUKA 3BS9A 4P7TA 5GAEU 2MMYA 3TX8A 1L3KA 2D7SA 4QPXA 2DK2A 1MWZA 3MZIA 1T3OA 4OJ3A 1S1VB 3L7PA 2FJAB 1RYRA 1DRZA 3GSIA 3T51B 3JSMA 1W9XA 4RW4B 3DLEB 4H4OA 1VQ8S 2ZHAA 1RYSA 3H98A 2F1FA 2YWEA 3PHEA 1FF2A 2HNYB 4LFBF 1S1XA 2BJDA 2VG7A 2D3ZA 3D2WA 1KS2A 3EXYA 1OIAA 1RT7A 2N3LA 4Y2MA 5GVQA 1HNVA 3S1TA 4PRFA 1VQSA 2YNHA 2W4CA 2WW8A 3PJXA 4G7XA 1HPZA 2X6WA 4HDHA 2AYMA 3N6NA 1FKOB 4DBQA 3S7RA 3U02A 4WF9Q 2JIZA 4HDGA 2QLWA 4OZJA 1JLBB 1VRTA 1U7LA 2OKQA 4WK1A 4ZPVR 3M6UA 5E7OB 4YFUA 2VA2A 2BYCA 1KR4A 3RW7A 3MCSA 3MUTP 2LQ5A 4C8YA 1WD6A 4QWDA 4C9DA 1VK3A 3MEDB 2JC0A 2DHGA 2OFGX 5DM7Q 2Q43A 3MM6A 2HNZA 4XN0A 3TA0A 4DSLA 1R3NA 2N4DA 4M5DA 4URSA 4YB6A 5ADZA 3JB9k 3N6LA 5KFNA 4DL4A 2V0NA 2J0WA 1S79A 1K1QA 4N5SA 3FEZA 3OXFA 5L9NA 1I94F 1TKZB 4XOTA 1F5BA 4NYOA 5AE3A 5B0GA 3M6VA 5GAEI 3KHRA 2P6TA 1HD0A 3W3SA 5LSOA 4YHHF 2HHVA 3MMBB 1UKUA 2GCFA 3UCGA 2CZVC 3G96A 1U47A 4UY85 1KTQA 1DTTB 3KMSA 2I5JB 5G4DA 5J2MA 2DNNA 1L3TA 3V6DA 2XMWA 3LGNA 4HLBA 5CCMA 4K4XA 5CXTA 4NZ0A 3VZHA 3UR0A 1Q79A 2ZOMA 2VC0A 1MSWD 4ZLPA 3DRRB 4KAIA 2FLPA 4IRDA 2HS4A 2PMHA 4MIAA 4XLEA 3NNHA 3M05A 3TAQA 2ILYA 1UD3A 4R25A 2HQ3A 3MM5B 2J9CA 3CTRA 3R5CA 5CYMB 4ELVA 1SKYB 5KG6A 4F67A 3M8QB 5AXMA 1T3NA 1HW8A 1ZM4A 3UPFA 3MR2A 3NAHA 4LSLB 1S4FA 4AFFA 3VF0B 4I69A 5B0CA 1O0PA 2WB1D 2HRYA 3D28A 3M30A 4CQ1A 3EZ5A 4TYBA 2R2SA 2J0QD 3MWBA 4C8KA 1SH0A 4NCAA 2VASA 4X4UA 3AY0A 1OSCA 5E2QA 3KK1A 4DV3F 1VQOS 2FC8A 3MMCB 4QR1A 2B4VA 1F2GA 3VAIA 3KHGA 1XEZA 4C3MA 2ZXHA 2GJKA 2FGOA 2JEIA 3KLEB 1CSJA 5F8LA 3S01A 3Q8RB 3AJ1A 4MAKA 4NCGB 3LNNA 3K8VA 1HBMA 4K4SA 1ULRA 4I7FA 4ECYA 2IJNA 4DUYF 3BO3A 1GT8A 2VG6A 4USIA 2ZHOA 2ZNZA 2HYIB 3OSNA 1YI2S 2JVOA 2Q6CA 5HBMA 4C97A 4NCBA 2ZZEA 3DDYA 1FRJA 3SDEB 1SJFA 2D74B 3O5TB 4ZCKA 1FD8A 1S1WB 4ES2A 3AAWB 1WSVA 2CPXA 1IKXA 1UETA 3FPPA 1Z2ZA 3A1YG 3K5PA 1CEZA 1WEZA 5KG0A 1WF0A 2N3OA 2Q6BA 2KH9A 3T53B 1DJ0A 4PG8A 1XMQF 4NXMF 3OPOA 1IXKA 4RLEA 4ED0A 3HHDA 3KHLA 4XR6A 4JI4F 4DFMA 5F9NA 4FF4A 1E3XA 4H4OB 3SI8A 4V19X 2GNKA 1N54B 1UJ5A 3FFIB 2MZ1A 4A8WA 4KJIA 4M63A 3Q2TC 3BSOA 1WELA 3I4PA 4F4XA 1JWWA 1WPCA 1S1XB 4PG4A 2BA9A 3CT9A 4WZMA 4DFPA 2ZOGA 2XNRA 1X4DA 3OXGA 1WTHD 3P5TL 2XNQA 1NZAA 4FXUA 1M1KT 2BZ2A 4F26A 1HPZB 4II2A 1UD2A 2PE8A 1LK5A 5LXYA 4C8OA 1VRTB 4XONA 1C0TA 1URRA 4J9NA 3BQ2A 1K0TA 2RF2A 3PX4A 4OX7A 3TARA 1NB7A 2LEAA 2JVRA 4DR7F 4J9OA 4ZK7M 4N41A 3GVLA 2RNEA 3RB0A 3N5BA 3GFZA 4MIBA 2J8AA 2Z4PA 3MI7X 3MM6B 2N7CA 4DQIA 3NBPA 2ZZFA 5KFFA 2E5HA 4K2XA 3CCMS 3CD0A 3HZGA 1Y4ZB 1U49A 1N5SA 1PJ5A 3BSNA 1KN6A 3OTCA 5AE1A 4NXNF 2UUTA 3QJPA 4PXBA 3GG0A 1VK8A 1M5HA