1NRKA

Ygfz protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
325
structure length
325
Chain Sequence
MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YGFZ Protein
publication title Crystal structure of the YgfZ protein from Escherichia coli suggests a folate-dependent regulatory role in one-carbon metabolism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 68
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1nrkA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1nrkA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nrkA01
1YX2A 1PJ6A 3GSIA 1WOOA 1PJ5A 3A8KA 1VLOA 3A8JA 1VLYA 1WORA 3A8IA 1PJ7A 1WOPA 4P9SA 1WOSA 1NRKA 4PAAA 3GIRA 4PABA 5L46A 1V5VA 1WSVA 1WSRA
chains in the Genus database with same CATH superfamily
2YX4A 3CD6S 4C3MA 2AF6A 1SC1B 4QHYA 4AXJA 2GJFA 1GO2A 1ZH5A 1JJHA 3HP6A 3KG1A 2V34A 3SI8A 2VKRA 1RGVA 4UOCA 4OV1A 1YIJS 2CNLB 5FLXU 3QQCD 4NA1A 2JEGA 3LQ6A 1E6YB 3M8QA 2XMMA 1U49A 5DDOC 2BJ8A 3LVBA 4A8SA 2PLFA 2V50A 1XR5A 2HAFA 4QOTA 4ZVPB 3SEJA 1X5PA 3CJQA 4OOXA 2R7OA 1RADB 4O3PA 4LF6F 1LW2A 3ELHA 1GK8A 2HIQA 4TN2A 2EK6A 4NI2A 2KXHA 3C16B 4OHXA 3IG1A 2AQ4A 4TU9A 3KUEA 5LMNF 2POKA 3ET6A 5AXNA 3IBCB 4XL9A 2B7CA 4AD6A 2BJ9A 2UXCJ 1C0TB 3HLUA 1UJ6A 3TI0A 1ZM2A 1FRIA 3I5CA 4DL2A 3KLHB 1NJXA 4LF8J 1YJ9S 2GHWA 5I3PA 1LWEA 2P6TA 3R5GA 4KHMA 1UWBB 2GMLA 2OBSA 4O4GB 3FKBA 3QFTA 2FHOB 1SL0A 4H9GA 1TFYA 1S1UB 4A8XA 2JX2A 1BQMB 3KUGA 1H98A 2RRAA 4DS4A 1T0TV 4RD3A 1CULB 3H98A 5LJ3Y 2W4CA 4UUXA 3HVAA 3M30A 1VQNS 1MRZA 4RPDA 2E5IA 4DX6A 1RAOA 5T7LB 3NKYA 1RQRA 2ZZEA 1WF2A 2B8QA 2HLDA 5DDRC 2C5BA 3VGTA 2DPIA 4YOEA 3ENWA 1EHWA 2ZE2B 1V0FA 4U6PA 5GAHI 4LFAJ 1G7RA 1U1LA 3BH7B 2IAJA 2ZH7A 3CJ5A 1WC6A 2I9SA 3T41A 4WTYA 4MK9A 2RNEA 3PA1A 3ZIAA 2VF3A 2PIIA 4PG4A 2NXUA 2U2FA 3E51A 4OHZA 3W2EA 4NLRA 1NDPA 3DM2B 2KM8C 2JEIA 1R0AB 5E33A 4WP3A 5DQGA 2CJYB 4X8IA 3JXOA 3CCES 4RNFA 1DTTB 3PO5A 2R7WA 1JLBB 1EP4B 2WZNA 3OOCA 2AJ4A 4DHVA 3HI9A 1IR0A 3E3XA 1RWVB 3I87A 3BQJA 2RQMA 3R7SB 2RC6A 1XIQA 1IJFB 2UVUA 1XMOJ 3MEGA 2Y8WA 2DB1A 3M9MB 4HI2A 2E1BA 2KYZA 1TR0A 3C6UB 3AB2B 5HMYA 5CYQA 4L74A 4OOSA 2HGLA 4USVA 2EFNA 1JLCB 4DF4A 3M6UA 3CDAA 4JI8J 3H5YA 5IYNA 1LXJA 2NXEA 1H73A 3BPDA 3MDFA 2AHOB 3Q8PB 1VQMS 3Q2TC 2GGPB 1SJRA 3OFHA 3PRDA 2W8LA 3ZBTA 3PZPA 1EP1B 1D8TA 1E3XA 3HHEA 5LMUF 1HWJA 4NMXA 1S0NA 3MD3A 4DLGA 1UMJA 1TTHB 2P2CB 1JNZB 1R8AA 1RT3B 3H4BA 5HI7A 5CABA 1KQSR 1X7VA 1JLFA 1KC8T 1LW0B 1U6ZA 4IR1A 4ED0A 4DR1J 4K4YA 2DRDA 2FHJD 1NKBA 2XO6A 1RAGB 4RUBA 2IRUA 2Z58B 3NG8A 2XLKA 1Z2LA 1WPCA 2XWXA 4MJKA 1OSDA 4NLXA 3UO0A 3H2LA 3IMQJ 3L09A 1VC6A 1Y5IB 3TZYA 4C8OA 2DJWA 1OSCA 1RKJA 3OVAA 3KJFB 1VQ6B 4PC6A 6AT1B 4KYZA 2E7WA 3HVTA 3CW2A 3A4TA 4JUZA 3H25A 5CQGA 3RAXA 2X6XA 2DGUA 2CJXB 4XOTA 3M8QB 3MOZA 2IVYA 4JYAJ 4USKA 5J2NA 5E41A 3UDLA 5DM6Q 5CXTA 4WF9Q 3PW0A 4GC6A 3K89A 5IQ6A 1VQ8S 3KJQB 3PTWA 4WZKA 3LALA 1F6TA 3VMFA 4P2SA 2L41A 1BC6A 3MEEA 3R2DJ 2F4VJ 4NI2B 4TU8A 4M5MA 3QZ7A 3OTOJ 5D4NA 2CVIA 3IG1B 1LK5A 2C2MB 5B0GA 4E0FA 3CCSB 3ET6B 4WYLA 3J80U 3HJVA 4O44A 4JI0F 2B7CB 1GR1A 2VQEF 3W2GA 4PG7A 1L3VA 1F5CA 2ILYA 4X06A 4B3GA 1R0BG 4YHHF 1LWEB 5HROA 3BS9A 2RMLA 4EZ6A 4Z4SA 1UFWA 3QLHB 3CD0A 4RBVA 5D3GB 3WYAA 2DHAA 1SJ1A 3DLEB 1QLNA 4LR8A 4DV0F 4H4KC 4PPZA 1RCOB 2B4UA 4YN3B 3RBXA 5EMNA 3M30B 4KGKA 4HKQA 1FD8A 4LIRA 4P12A 2EBGA 3UD5A 3SCLE 3CCUB 5LSOA 2ZH3A 4LF2A 1S72S 3T9ZA 3HKZD 4W98A 4JI4F 3EX7B 2IAJB 1TVRA 3RGIA 1HR0J 3EM1A 1MN7A 1H74A 1V3RA 4CO4A 1WELA 1P27B 2JDJA 3G6VA 4JV5F 4JI2F 2G4BA 3Q8YA 3SQGA 2ZBQA 2DNKA 4FKYA 5CD4A 4ED7A 2MMYA 1YJRA 1I3OB 1P4MA 3SSQA 4G5GA 1UFKA 4G1BA 3OSPA 4P3IA 5MLCV 2HHHJ 4U7UK 1P1TA 4TMWA 2LQ5A 3SV3A 2HRYA 2BF4A 3CCVB 2HQIA 2QE7A 1QAIA 1E1RA 3MEGB 3DI6A 3DU6A 1AT1B 3UI3A 5TV2A 1K47A 5CYQB 2EC0A 2WCXA 1N08A 2CG8A 5KFYA 4RLEA 4MIBA 1OY6A 2RS2A 2FD2A 3JQMA 4FYYB 3F73A 3MCMA 2DIEA 1FCAA 3M8ZA 4DQKA 3IRXB 1RHKB 2AIRB 2W7PA 2HNYA 3D6MB 5HN0A 1OGJA 2R8JA 2ZH5A 2RQ4A 5ETMA 1Q53A 3PKMA 2AKWB 3KHLA 2FX3A 4UUWA 2X6WA 4RCYA 2EC2A 3T1YF 2ZBRA 4L73A 1JLFB 1T02A 4HI1A 3FFIA 3NS5A 4DFKA 2VNKA 2IMOA 3RB0A 1NSAA 4CLLA 4LF9J 1NBMA 4QR0A 2Q6BA 5DRKA 4LQ9A 3W2IA 4L3NA 4B47A 2QA4G 2CK3A 2AYGA 3NMAA 1E6VA 5DQHA 3D28A 3ZTPA 1I5OB 3QT5A 1KRPA 3N9UC 1OB2A 3D9BA 3FMBA 1TV6A 2D1CA 3VWSA 2VOOA 1VC0A 1W25A 2ATLA 3RTVA 3OKXA 3EJMA 3KLGA 3ADAC 3H7HB 3H8YA 1YJNS 5E3CA 4YAOA 3GIKA 5J2NB 4ZLLA 4CWBA 4U96A 4JI3J 1NH8A 2J9EA 3Q23A 2W2OP 3CCMS 1TK8A 4AQYF 4Z4YA 3KOAA 4J9PA 3MEEB 2MZSA 5DQIA 3HSDA 3A12A 2FVRA 4ECYA 1Q8LA 2XHWA 4HYKA 1KHVA 2M8HA 2PFDA 2R8HA 3SMZA 2FLNA 1KNZA 1JKHA 2YBVA 2RT3A 4O44B 2HS4A 4XAKA 5KT3A 3UFCX 1WC5A 4RLZA 1UMKA 5B08A 2MQPA 5KFCA 3BSOA 2EKYA 2R7XA 4ECSA 5HROB 3K2YA 3D0IE 2OAUA 4I56A 1JLAA 3CXCB 2C22A 4YR3A 3W9JA 3H5SA 2GK6A 4HDHA 3WX8A 3O5TB 4DLEA 3LH2S 4FS1A 3DRRA 3PG9A 2IM3A 2W8KA 1RYSA 4J0QA 1X9SA 3OJSA 3NLCA 4DMZA 2CBXA 4P26A 4F3OA 4W90B 3GONA 2ADCA 3WC2A 3MI7X 3PA2A 4RCZA 1X4CA 2Z2ZA 4I0WA 2PD1A 4ZPDA 3TEHB 1T03A 5I42A 1HWIA 2J0XA 1TUVA 2NR0A 2F1LA 2MZQA 1SC6A 3NAIA 1FRQA 1D9DA 1TVRB 2DH9A 1U6FA 2GW8A 1RBLA 4CLUA 1R5BA 1S59A 3SQGB 4F3MA 3HCXA 1NB0A 2NV4A 3G2XA 4KO0A 4WXOA 1T9TA 1YGYA 3OP1A 1Y4ZB 3CMAS 3IS9A 5IZHA 2Z0GA 3MCOA 3RZAA 1K44A 4EBDA 1RA7A 2DR6A 2XZOA 2ZZFA 2LCWA 3GVJA 3FRZA 1Q7YD 3AA8A 1SKSA 1SI9A 1GMWA 4KHPF 4YS2A 2ZD1A 3FRYA 1YRUA 2DNYA 1VS3A 3KKFA 2HCJB 1HBOA 2ZBPA 1DRZA 3Q8UA 3S7RA 1YITB 1UVKA 3DI6B 2XI3A 5D6GA 2RUSA 4B9SA 3J7AN 2DEUA 4AC9A 3G6EB 1S1TA 4FWTA 3ES9A 3LTOA 1ZA2B 4CI0B 1UD3A 1TKZA 2XGJA 4ZGQB 1EAYC 1HI0P 3MF5A 5IT0A 4B9TA 3NCPA 5BSYA 2I8EA 3AJ2A 1UEVA 2HNYB 4MIAA 3BYRA 4OHVA 2XYHB 1U25A 1BUXA 2W2QP 1VC5A 5A2QY 2AGQA 2DY9A 3GJTB 3TW0A 3MUVP 3GFXA 5KFNA 5F8MA 1TQLA 4DV6F 2DXEA 2AMCB 1G7CB 1VF7A 5EWFA 1H2TZ 4M5GA 1VJWA 3FFIB 2O3DA 4HH0A 5KOWA 1RT7A 1FRHA 3VAIA 3TUJC 1U7LA 3T5LA 4OJ3A 4PWWA 1H38A 2PT0A 2W9AA 2CW5A 1E6VB 4M5IA 1I18A 1IKXB 4DV3J 3Q86A 1QGAA 4ZVGA 5ITHA 4NCGA 4J9NA 2ZEJA 1TV6B 3QGGA 2VFVA 4WFXA 3NS7B 3P5TL 4CNZA 2JVOA 2NSCA 3U6KA 3D3CJ 3VNUA 3HKWA 3TR5A 2ZJRQ 1VBYA 4PAAA 3KLGB 2HQCA 1U02A 3W65A 1IXKA 2E1PA 1RT2A 2EKNA 4Y2AA 2KU7A 4XORA 3QSIA 1NJWA 1RWOB 2F9JA 2BANA 4ED5A 2LFVA 3PXGa 2MZTA 4CLYA 2OSQA 4FS2A 2BABA 1AFIA 2AGPA 2IFXA 2YTCA 2EFGA 1YJUA 2CA9A 4HR2A 4WTOB 3I56S 4KV8A 3FCVA 2RS8A 2ROGA 1W2BR 3FEYB 2XSJA 4U9UA 3CJTA 1SV5A 4CZCA 3DDNA 5FNZA 5L1IA 3JQJA 2XYPB 3FQLA 3W5XA 1FNXH 3E2EA 2X1BA 1UVIA 1JKHB 1OY9A 3MAAA 3HD1A 2LA6A 1FRNA 4M1KA 4ZCMA 3B8HA 2BPOA 1Y5NB 2PI5A 2F8EX 4WZTA 3AQPA 1KOOA 2CXEA 3VGSA 2B5OA 1HPZA 1TFWA 2VA2A 3VAJA 4TMVA 3GCWP 1CEZA 3W8GA 3ETOA 3KK3A 3DLGA 1JLAB 3RAQA 3QGPA 4IO9Q 5K5MA 2HQ3A 2ZBVA 3JSBA 3DRRB 2VIHA 3OPOA 2KDOA 4B02A 1KLNA 5K9FA 3J7A1 2OP5A 3BNWA 3PJWA 3FCHA 3W9HA 3QO9A 5C25B 3CESA 4OJGA 1WOOA 1FERA 1T03B 4UZUA 5I42B 4DR3J 3ASRA 2RHSB 2M4MA 3Q8VA 3KMQA 3P4UB 1TMJA 1QVFR 2XO7A 1U1PA 3WC0A 2VG6A 3HMJG 4PC3A 3NRBA 1N5TA 2SXLA 3AQOA 1NRKA 4KO0B 3J81Y 2R8KA 4WYWA 3ILIA 3W2WA 4WWVA 3C15A 4KGVB 2WJVA 3PYFA 4OI1A 3CC7S 4EYHB 1Q7YT 3MUTP 5FO1A 1U8WA 3MHYA 4I6WA 4E0DA 1YI2S 2ZD1B 3H2VE 3BKFA 1HBOB 1BLIA 3M2VB 3SXLA 3LPEA 3U02A 2E29A 2NXNA 2Q1LA 2A6MA 1WEXA 4HHHA 1KLMA 2VA3A 1TMMA 2CQGA 3DGPA 4ELTA 1S1TB 2CPZA 4ZVQB 3KG4A 1HNXJ 1GMUA 1YJWS 1TKZB 1VQLS 4P25A 4F7DA 2M5YA 2QL9B 3RG6A 1NK7A 3MR5A 4F4KA 4F3QA 2GJKA 3CDUA 2Q6LA 1Q1KA 2H4WB 3G82A 4DSIA 2J7WA 5FJ4A 1NSPA 2FJEB 2DNHA 1XNRJ 2O5DA 2UUTA 2I1LA 4LF1A 3LF0A 4X4RA 4K8RA 2UV8A 1OB0A 2ZBCA 1J9ZA 3IRWP 3O3LA 1RT7B 1X4DA 1S1XA 4KH0B 3TOQA 3MCNA 1P9YA 3HXMA 4CLPA 1YX2A 3GFYA 3K5NA 3GLJA 3OR2A 2WPDA 4DR7F 2LYVA 4NCGB 4AXIA 2YKNA 1P6TA 3L7OA 1VQ5S 3AVWA 2DD8S 1KK2A 1NBEB 4IR9A 4Q2MA 3CP8A 2VUGA 4WZQA 2YQ0A 3FJOA 1RT2B 3D6HB 4A8WA 2WJYA 1NZ8A 1JWWA 3G71S 3HZGA 4Q43A 4HT7A 2DHSA 5FIUA 3IFEA 4ILMA 4L3KA 3TAPA 4FBUA 3M1VA 3C14A 4KV8B 2XSJB 4OV6A 2AT1B 4RO0A 4IG3B 2NS1B 1S0OA 1SV5B 2A1BA 4Z7YA 2IA6A 1N05A 3LGMA 3PJXA 2W9CA 4XK8C 4EH1A 1AW0A 2VNHA 3MFHA 4YR2A 1N0VC 4WP8A 5J2MA 4PWDA 2M5SA 2CRVA 4TMXA 1N06A 4J9OA 5LMZA 2IYIA 3N01A 3TRGA 2YWKA 1XQIA 1QY7A 4DQPA 1S0VA 1X5TA 1WG4A 2HS3A 2PDAA 3O6QA 1HPZB 2BACA 5KG5A 2DH8A 4DFPA 4EI2A 4RW8A 3A3PB 4B9MA 3AVVA 4DI6A 9ATCB 3KK3B 4RD2A 3DLGB 1KTQA 2LLZA 5ETKA 5IC6B 3FVYA 5K8OA 5FDLA 1L3UA 1HBUA 1HMVA 3IBWA 3LUYA 2B51A 2J5AA 4QWAA 1SBRA 3PNIA 1UZDA 2AYBA 4OYIA 3LO8A 3QO9B 2DNQA 1WG1A 2IJNA 5FO0A 5F41A 1UJ5A 1WSVA 4DCPB 3NOGA 2EG2A 3AAWB 4TU7A 4GMKA 4ENOA 1ZAVA 2YWWA 2FC9A 4P75A 2MXYA 3US5A 3OXFA 4H4KA 2OBTA 2VG6B 3BN7A 3UDEA 5E7OB 4XNFA 2PFFB 1KQGB 1M1GA 1ZBTA 1JLGA 4X0CA 2YQ1A 2IRXA 3D67A 3W2WB 3C15B 2V2QA 2H5EA 1P9QC 1HZEA 2JDIA 1NKEA 4NRUA 5KG3A 1H8HA 3GFZA 4PC1A 4C8YA 3R6JA 3OJXA 4O3OA 4QYRA 2V7UA 3PVDA 2JJ1A 4KKSA 4N47A 5LXRA 3MEDA 3A8JA 4ECWA 4DJBA 1GFWB 3KMSA 2A18A 2ASLA 3CJ8A 3IR5B 1D0EA 3ZZOA 1FDBA 3RJMB 3QIDA 2KM8B 2R8GA 4Y7CA 1RQ0A 3W2VA 4YQWA 5M2PA 4USIA 3DGPB 2UUBJ 3PDNA 1EIYB 1DDIA 1UA1A 4Z4UA 4P72A 2VFUA 1N6QB 2BEFA 1QJHA 4LRCA 3VAMA 1OIAA 3GR1A 5ETSA 3BF4A 2G2OA 3I82A 2VBWA 2IM2A 3OVBA 1RTZA 3TJAA 1HW8A 2DNOA 2HVIA 4RU9A 3U6BA 4OI0A 3A1PA 2ALYB 3I1FA 4K5SA 4RM0A 1MROA 1R89A 3W62A 4YEJA 1HHSA 3G82B 2VBSA 4IH7A 3DN9A 1ZM3A 2B56A 1C4AA 3Q8SB 2IRYA 1S9EA 4DL7A 1R8HA 2CPFA 3I9ZA 2D69A 4RW4A 2QMUB 2R6HA 1YJVA 1D09B 3E1YE 3PYDA 3MD1A 1EWYA 5KFLA 2X1AA 2MQ8A 2LQBA 1PYTA 3GU0A 5MAOA 2AP6A 4QVJA 1TAQA 1S1XB 3I0SA 3LP1A 4JI0J 2VOPA 2MLXA 1MU2A 2VQEJ 4XLFA 3M8YA 3OR2B 2CQIA 1AIPA 3ZZ0A 4CLWA 2Q6KA 2LKZA 3I0RA 3TVZA 1WWHA 2NYIA 4XLHA 4YHHJ 1EETA 4CP5A 4P2NA 3TA0A 1BX0A 3NEKA 3R5AA 2JWNA 4TYAA 3ONQA 3DDYA 4I2QA 2DRBA 2UXCF 4IG0A 3R9LA 1D9FA 4C6AA 1G3OA 2VBTA 3MR2A 4DV0J 4BCAA 2ZOFA 4B3MF 1WORA 1REGX 4LF8F 2CZVC 3M1VB 4HHUA 4UAJA 1UVJA 2BW2A 3AFGA 4ZVUB 3C14B 3W7BA 2IDEA 2LU2A 1GXTA 4I2PA 1N5YA 2W9CB 4MT1A 4ZJLA 4XDDA 3UDVA 4JI4J 5J2MB 1HNWF 4PWDB 2CPDA 1JA0A 2BYCA 5HL7Q 1G6BA 1CSJA 2RIJA 3FBCA 4JV5J 4JI2J 1KKHA 4B3TJ 1LWCA 1ZYQA 1CG2A 2FLOA 4RW8B 2VODA 2BRLA 3BR8A 4LR7A 1BQEA 3FSYA 3IXQA 5B0AA 2WSSA 3QIPA 5FDLB 2LEPA 3SCKE 3NP5A 2PSZA 1HBUB 5K14A 1X0FA 4Q7JB 3MM9A 1HMVB 2XZPA 4LBWA 5JMNA 4R8UA 4NZ7A 1BQXA 1JXVA 1WUUA 3RBEA 2AJ1A 1OWXA 2HZVA 4PXBA 3N5FA 4OJ1A 3BQ0A 4P74A 3VO2A 1WC1A 4RNHA 3OL6A 1D3WA 1D2EA 4DX7A 3ZZUA 2O01C 4O4RA 3WXMA 3TAMA 3ASPA 2UVRA 1JX4A 1XMOF 2ZFHA 1DBDA 1VBKA 2NXCA 1JLGB 3V76A 3SV4A 1JB0C 1IKYA 2DIUA 4NBSA 3HVRA 2CADA 3ZTSA 2HBQB 1KVJA 1W2IA 4ZLNA 5HQMA 3T1YJ 1CJUA 3IR6B 1AXQA 2R7RA 3VZHA 5I4MA 1UL3A 3MEDB 4BPRA 4OZ3A 1B7FA 1VHEA 1FJCA 2DEJA 1WTFA 4OYOA 5HQ8A 1XBWA 4C3KA 1M0SA 4E8UA 3J7YI 2ZH9A 1W87A 2DNGA 2C2WA 4F0HA 2WONA 2LU1A 4YHBA 1O6XA 4OX7A 4ZVSB 4J9SA 4IQMA 4FYVB 2GVZA 5B09A 3ZO7A 1FNOA 2H48B 2FZGB 4LSNA 1HIYA 2BX6A 1CC7A 1VQPS 1C0UB 1RU1A 2B0GA 3RRKA 3EXCX 3O1LA 3K8VA 4ROXA 1MROB 2AJ0A 4EZ9A 2AEMA 3W5YA 1U24A 3NS6A 4HDGA 1HD1A 4RD6A 1FF2A 1S9EB 2LDYA 5JBQA 1CQXA 3ASQA 4FPIA 4RW4B 2BM0A 4C97A 2G2ZA 2CJAA 4Y2KA 1S7IA 1RP5A 4CLTA 1FFGB 2R3VA 4ZN3A 2YWGA 4MKYA 3G4SS 2YNFA 5TR9A 3I0SB 3LP1B 3UPFA 4LSLA 3LP0B 2AGOA 2QGGA 1VRUA 2CQPA 3D3BJ 4WU2A 5AE3A 3AODA 3CP2A 1QGZA 2XGPA 2BE2A 3BH6B 4X4NA 2BV3A 2BQ3A 2XNDA 3BQ1A 1PGZA 4CLFA 3KLFA 1YLXA 1Y7PA 2QYCA 2QEXS 4OOVA 5H9FJ 2WOMA 3I0RB 3KYLA 4JI7F 1PKUA 1EETB 3JQPA 2MSTA 2XZDB 2PMDA 4DSEA 4ZPTR 2DGTA 5A88A 3T5HA 3RBDA 3CCJS 3NWRA 4V19J 4I2QB 4ZP9A 2XM3A 1N48A 1WKKA 4DV1F 1FX0A 1UD5A 1S79A 1XMQF 1T05A 3CC2B 4XONA 4Z4RA 4RDKA 3PHTA 4YB5A 2N7CA 3D1OA 2RB7A 2Y1LB 2UU9F 5LSRA 2HVHA 4HEA9 3N5BA 4GVLA 1FJGF 1U0HA 1MABA 4XN3A 3DLHA 1UVMA 4X4UA 2GQCA 3SLDA 2OK7A 3R3TA 2RUGA 3BSAA 4J7CA 3CCQS 5KT4A 1S6PA 4Y3CA 2R42A 1Z1ZA 2QSWA 4K4TA 2CQHA 1DQAA 2W4PA 1FT8A 4ANCA 2ZITA 4NZ0A 4CDIA 3VNVA 2XS7A 3RRGA 1ITPA 2FY8A 5AJ3F 4G1PA 4WCEQ 2KT2A 2E5HA 1LWCB 1FX2A 1B3TA 4K4UA 1TKXA 2WRMA 4NXMJ 3CE8A 2ZDPA 1M5VC 5CA5A 1KSPA 3T19A 3Q89A 2D3LA 1BXNA 3EZ5A 3X1LB 1S6UA 4IKAA 5CH7B 3MMPA 4RR5A 4UZEA 5H1SV 2BXJA 4H4OA 4PWUA 5J3OA 5K14B 5D15A 3NGDA 3M4XA 1S4MA 4LJMA 1TL1A 5FA6A 4C11A 3MWBA 4RUAA 4KFBA 5L8RC 5H9EK 4P71A 1T11A 2IJRA 3FDSA 4Q0BA 4ZITA 1HW9A 1N8RD 2XMVA 3LQEA 4CIOA 1BX1A 3AHPA 5B0FA 2NYHA 4Y34A 1VMBA 2DETA 1DARA 1K1SA 3CJRA 2ILZA 2X1GA 3GFHA 3MM7A 2UV8G 4EU0A 3TAMB 2MLYA 3RUBL 5F3TA 1TAUA 4DFMA 1W2BB 1F9EB 2J0WA 4LFCJ 1PBUA 5F8NA 1VJQA 3UR3C 1VRQC 1IKYB 2VONA 4EEYA 3NGUA 4DV6J 5EN1A 2WVBA 3OZWA 2NPFA 2ASJA 1WHWA 2J7KA 1CJUB 3KJVA 4PG8A 3CMMA 1S9GA 3R5DA 4QWCA 1E64A 4KBIA 1SM4A 4WFZA 2MEWA 1S10A 2VPZB 2V8PA 2L9NA 3QNWB 3CJKA 3SCJE 1UFLA 1TK0A 4B43A 1COWA 1Y00A 1REVA 1NNDA 2WONB 4GKKJ 2KRRA 4XR6A 2NQPA 2V67A 3CPXA 1B7YB 2GVZB 2HK3A 3MAHA 1WHVA 4WE1A 4LF9F 3TUZC 3QZ8A 4C3LA 3J81k 4C0SA 1YRXA 2HDNB 2HZCA 2QT7A 2OMOA 4PYAA 3WDOA 1Q95G 1V0EA 4P3YA 3PJ9A 4QR2A 4O3QA 3NOCA 2F8HA 1YBUA 1FWLA 2A10A 3W1YC 1CNFA 1VQ9B 1FVSA 1KK1A 4YDXA 1QVFB 1YJ7A 2W6JA 2Y1IA 2C2OB 4HT5A 4FK8A 1IB0A 4U8YA 2CDQA 1TL7A 3NBPA 3LO3A 2VPWB 2DISA 1VYAA 3DDKA 4LSLB 1P8GA 2N3LA 1VRUB 4JI3F 5E3PA 2KG1A 1S49A 2VPYB 3DMJA 3PW7A 2H3EB 1OJ4A 2BE2B 2CJBA 1PJ7A 2OSRA 4XLEA 2Z2MA 4EK2A 2I2YA 5KFSA 3KLFB 3MMJA 2HHQA 4OYMA 2WOMB 1RWKB 3AJ1A 2J9DA 1LWXA 2NREA 1J27A 3MECA 4DWIA 1FK9A 4FDFA 4TN1A 1RAAB 4F4ZA 3ONYA 4ES2A 4GVBA 4Y65A 2N7YA 4DL4A 5DG7A 4FKXA 1T05B 1U2CA 1Q79A 4IO1A 2LVWA 1NPPA 2A2DA 1S4FA 2CQ0A 3MR7A 2EBEA 4NRTA 1EB0A 2JHEA 4YMEA 1VCTA 4DX8H 5IWAF 2DHXA 1FI4A 1U0HB 2KB2A 3ENVA 1NB7A 2ZBIA 1LNQA 4C0OC 3CC4S 3MMCA 2Y3YA 2R7UA 1S6PB 5KFXA 4DQRA 1L3SA 4K4SA 1LWFA 3P6YC 3VR1A 1KR4A 4ZVTB 3P27A 4MMOA 4URQU 5ETLA 2V9WA 1GX6A 3MEKA 2OFHX 2X3DA 5KFQA 4BWMA 2CQ3A 3V81A 2FB0A 2C28A 2UVVA 2CQ2A 3HD2A 4L75A 2WSCC 2HQDA 5E3RA 3HFKA 4J5OA 4Y0FA 3TX8A 1VK3A 3RAMA 3JSMB 2BQRA 3T56B 1BGXT 2JOQA 2LQ8A 3CTRA 2RDJA 1CJKA 1Y0RA 1MSWD 1NHUA 1H2UX 5I3UA 2CJKA 1RAEB 1TL1B 1UPPA 4C11B 4ZHRA 1UA0A 3KWMA 3NNHA 2L3MA 2ALZA 4Q0BB 1NXIA 4MK7A 2KJWA 1N8RT 2B7BA 2M2BA 2BN4A 1RTHB 1RTIA 1IBLF 4QPXA 2QFIA 1HQ2A 2VFTA 1CS4A 3KHGA 4C98A 2OTLS 1VQ7B 4QUZA 1NJIT 2IMWP 3MM7B 2L9DA 3F44A 5HATA 2VDHA 1KS2A 1BMQB 2E7VA 3PW2A 3E20A 4BLGA 4M5HA 3AXKA 1V6HA 1X4EA 1BQNB 4DR4F 3CEDA 3OW7A 1N0UA 3W66A 3BY1A 1SUQA 1VHFA 4Y2CA 3KJVB 1R7IA 2FTRA 1RI7A 2MJNA 3UNGC 4ED6A 3THPA 1S9GB 4F4WA 3EDQB 3MMBA 1SB6A 3QFWA 2HMIB 3CMQA 3CJKB 1V9OA 1TELA 2QE5A 2FC8A 1P1LA 1REVB 2KT5A 4OI4A 3W5HA 1LKZA 5KFEA 2XMKA 4ES1A 4H4MA 1NEEA 4JOUA 1QM9A 4N8NA 3AD8C 4IOCQ 4Y2MA 1FXLA 4K59A 3VQTA 1WI6A 4WE1B 5HMXA 4TVAB 1PILA 4XOPA 2IC3B 1A6LA 2QLFB 4FVCA 2RQCA 3ENAA 1HNZF 3BKTA 3SEOA 5GV7A 2E5LF 1KONA 4N3GA 3Q6QA 4DV3F 4FBTA 1NHKL 3BREA 2KN4A 5HVGA 1Q82D 2K06A 3MMAA 2K2PA 3U2QA 4B17A 1F2GA 4X4OA 2VPXB 2XI2A 1H8EA 1F5BA 5G0RA 3G6YA 2IPOB 5B0BA 1FEEA 1I8DA 1QTNB 1N52B 3RR8A 5B0DA 1YDLA 1TL7B 5A8AA 1Y5LB 1U1KA 2WVFA 3X3UA 4L76A 1SL2A 3KK2B 3ONUA 4X4PA 2QYGA 2KVIA 3I96A 3GG0A 3TQEA 3E8OA 3V4IA 1NJZA 4LBYA 3D0GE 2EVZA 2OTJB 3D68A 3T53B 5LXYA 3KHHA 3MECB 5DDQC 4WPAA 2BJ7A 1W9XA 4M53A 1KHWA 1XB2A 1ZS6A 4NLOA 4GVBB 2DXFA 1IWGA 2JFDA 1KMHA 3QRQA 4M94A 3SLNA 2P9EA 4K5RA 4N3NA 1VQYA 5EHHA 4DSFA 2KYXA 2LXUA 2I38A 2F8MA 4KGZB 3W61A 1YTYA 4QIGA 4CM0A 1B70B 1HA1A 1FKOA 4I7FA 2BR0A 4RW7A 1Q0NA 5CYJA 1GAWA 2CJ9A 1GT8A 3MMCB 2VNIA 2WW4A 3EGZA 2IA0A 4G3IA 1WP6A 1LWFB 4TQRA 4OIXA 1XERA 1RAFB 1WDTA 4FF1A 2FGOA 1H72C 2V6AA 3GG1A 5GAEI 3GCXP 2ZUAA 3V81B 1FWKA 1T9UA 2H1YA 4Y9RA 3KLEA 3VGVA 4DR3F 1O8BA 1VFJA 4DR6F 2F1FA 3DYAA 4OI6A 4DNRB 2YXLA 2PE8A 3ETMA 1CJKB 1Z4UA 3I4HX 1RTJA 4TY8B 5I3UB 3M7VA 2RHQB 4ZHRB 1WACA 4OYPA 1E63A 1NAQA 3O44A 1KBRA 1NK4A 3B4DA 1E62A 4PG5A 2B7BB 1HNVA 2OKQA 3M6VA 4NWBA 3PV8A 2DYIA 3OHBA 1RTIB 4ZPCA 4II2A 2IM0A 4KPCA 1CS4B 3IA0A 5GAGU 2C2DA 1ZTWA 1VDHA 2C3MA 4NCBA 2XMTA 4LMZA 2AD9A 2B9XA 2V2ZA 3OZUA 1N33J 4AL5A 3KDOA 4KB7A 3T1AA 1XR6A 2G9OA 5KG2A 3PYEA 2QTLA 1HBNA 1WC4A 2DR9A 3R6GB 1RT5A 3UNYA 2RDIA 1DFDA 1S7HA 5GMEA 1HNXF 4IYQA 1UWAA 4ATNA 3SDEA 2ZL7A 3K57A 5B0CA 2H4YB 3MMBB 3SSSA 3N28A 1VQOB 3ZZPA 5THXA 4PR6A 4QIWD 5M2RA 3I55S 5ETVA 3SYZA 2BQUA 3JS9A 3MTKA 3C46A 4ECRA 4FNIA 3A3NB 2HK2A 4P10A 1XQBA 3K7RA 4P7TA 3HHLC 3T6BA 2NZ4A 1XNRF 3CCLB 1HFEL 1M5HA 2WR8A 4H4MB 3PVXA 2AJFE 1NZAA 2M3DA 2OPRA 5IC4B 4WFBQ 1EP3B 3ILJA 2BKPA 5LT5A 8ATCB 2BE9B 1RT1A 4K2JA 1WF0A 1T9YA 4Z1MA 1IHMA 2JZ5A 5DS0A 1X4HA 1ROFA 2PGCA 2M8DB 2ZH6A 1XEZA 4ECXA 1OYDA 3AVTA 3D5MA 2RE1A 2BDPA 4ZPBA 4NLTA 4B3MJ 1Q82T 3MMAB 2ZOMA 4HTJA 3LGNA 2I0XA 2XCAA 4FXWA 5G0RB 4ID8A 1YHQS 1J2VA 4F2SA 4K4VA 2KI2A 4B08A 2D74A 2M0GB 5B7WA 3R6LB 1GMVA 1SQEA 1NMEB 1FO1A 3EGVA 2QA4B 1LFWA 2B6AA 5A8WB 2V8HA 5D8HB 1HNWJ 3QRRA 3CF5Q 4ACAA 3W2HA 1L5UA 2YWEA 2WVDA 4EYIB 4DN9A 1S9FA 2R7SA 4O0NA 5A6WA 3BZQA 1JB9A 2LXIA 4GQNA 3M2UA 3GMGA 3V4IB 1H2VZ 2HFVA 5AXKA 3M9NB 2V63A 2R2RA 4FXUA 4LREA 3SIPB 1T9VA 5K8NA 2RKIB 2BA9A 2YKOA 3N4WA 4RW6A 2V9KA 4ZKAA 3DXSX 2PA8D 1VHIA 2RQKA 2V2VA 2BGIA 2ZWPA 1FNCA 1X4GA 4ICLA 2BMBA 3CCRB 1U1MA 4ZVRB 4U67Q 3A8IA 4OZNA 1IKWA 3OTCA 1NK5A 1T8EA 4HLBA 4DL0C 3C8YA 2IVFB 1V3SA 3KJNB 1PYSB 1VRTB 2C78A 1FKOB 4I7FB 2WW8A 4RW7B 3I4PA 3RBZA 3OZVA 4PQUA 4JBCA 5HVFA 4K4ZA 3WX4A 3UN5A 3PEJA 3Q8RB 5BJRA 1U6BA 3H4DA 4J9MA 3PRVA 3M8RA 1S57A 2CF4A 1K28D 1U0SA 4KAIA 1APSA 3ZZRA 1R0CB 1GXLA 1TU0B 3KLEB 4F0MA 3BGRA 3HSJA 4USMA 2BKOA 1S97A 1S1WA 4KC5A 4IFVA 4G65A 1N34J 3CNQP 2KFYA 1KFSA 2CQCA 2NZCA 3CWJA 3HX9A 3MR6A 2I6WA 1RTJB 5C2GA 2MZ1A 2NXJA 1N56A 4ZIWA 2MKJA 2DTJA 1PJ6A 1F9FA 2A2CA 3T1HJ 4PPDA 1HNVB 4OZ1A 4ILRA 4LBHA 3AD9C 4X7EA 1CQMA 3UWTA 2DRAA 4F7VA 3KUHA 4OX9J 1Z2ZA 2ZH8A 1OO0B 4XQFA 2P6SA 2Z4PA 2PE3A 3C6TA 4Q44A 4AVZA 2R7VA 3PR5B 3ZTOA 2HHVA 4O23A 3ISNC 1VQKB 2UUBF 2WSFC 2CNOB 1J5EF 4WBFA 3DNCA 5L9XA 1MMDA 1RT5B 3B54A 2XEXA 1MMLA 3CJSA 4I64A 4KT0C 4WZEA 2GPJA 4DV4J 1IBKF 4ELUA 2AV5A 3AJDA 4F2RA 4HVZA 3W5ZA 3QPIA 2HG4A 2X0KA 2V4DA 3OL7A 5D4OA 2D7SA 3TP2A 3M2RA 1QVGR 1I51B 2HKEA 1HARA 2OJ3A 1VQ4S 3HPOA 4DUTA 1NDCA 1LW2B 2OPRB 4PXEA 1D8YA 5EX0A 3OT9A 4JI7J 3IGVA 4F25A 1RT1B 3WNCA 1RWNB 4JV0A 3WHIA 5ETRA 4ECTA 4URGA 5HO4A 1KP6A 4DV1J 4YB6A 1XMQJ 4NYZA 1R31A 2OUGA 3BC9A 4QFMA 5E3AA 2D41A 4ECUA 3CMES 5TY0A 2V4RA 5CCMA 4WXWA 1CNEA 4PXCA 3D6TB 2QL5B 3K59A 4X84A 2UU9J 2CDRB 3CPWR 1PBAA 4B3SJ 1D9AA 2V69A 5THWA 3OXLA 4KHRA 3M6WA 1FJGJ 2MLZA 1U48A 2OEJA 4ZDNA 2HBZB 3M8PA 4O3RA 2RD5C 1RE1B 3ZC3A 2D74B 5T41A 1R8CA 1I94J 3UN3A 2HWIA 3W63A 2YX7A 2J8AA 2RU9A 1FRXA 2GV1A 2B6AB 2HNZA 2ZKTA 2YNGA 2ACYA 8RUCA 4CQJA 3PENA 3UN2A 2K7JA 1E1QA 2UP1A 5AJ3J 3M2UB 1CJTA 4Q7AA 1H85A 4RD0A 1BPLA 3I5AA 2DIVA 1IN0A 4M5LA 1FKPA 3VAKA 1FFSB 1FXDA 3GV8B 4XPCA 3WBJA 4QZVB 2VJIA 1RJJA 2CPHA 2HW3A 4DQSA 3IWNC 4RW6B 5IT9Y 2WZPP 1N54B 2ZH2A 3E01A 1HWKA 4DPXA 5DGBA 1MWZA 1VK8A 1N36F 4JMQA 4NE9C 3BYPA 2HMAA 3V6KA 3GJQB 4B3TF 2AYEA 1LXNA 1V5VA 4KTQA 1GH8A 2HVZA 3Q6RA 5KFKA 2J6UA 3BCDA 4TLRA 5KAKA 2V7XA 2IM1A 2KXNB 4EUVA 1JQGA 1NDHA 5DZ6A 2MQLA 3CD6B 1NK0A 4OI3A 2Z6BD 2XLIA 4PQUB 1F0XA 4KSEB 5A89A 2HRTA 3CDBA 4E98A 2HAIA 1T3NA 2B3TB 3BSNA 1WEYA 4MK8A 1GX5A 3DLBA 1YIJB 4LF4J 2FY1A 5HQLA 1RDRA 3BGRB 1E79A 1QAYA 1OPZA 1S1WB 4IFVB 1T5EA 2HLUA 1SC3B 3ZNJ1 2RF2A 2VZ9A 4F02A 2H5IB 1TTTA 3KG0A 1UD6A 2CAJA 5IFMA 3CCWA 4QQBA 3WQZA 4YALA 1ZM9A 2OIHA 2KL8A 2C2NA 3PKYA 5GAHU 2UUCJ 1T95A 2M9KA 5KFZA 2CWKA 2FJAB 4G1QA 4ECVA 2UUAF 2LP4A 1C4CA 4RZRA 3CB4A 3OW2R 4X7FA 5KOXA 1IWAA 1F5AA 1G1XA 3OHAA 2AU0A 4USWA 5JVHQ 1O5JA 5HZAA 1WC3A 1XR7A 3N6MA 3GV7B 3T6JA 1WTBA 2EXUA 3UCUP 2CPIA 2N82B 2C5HA 5GAGI 4A47A 1YJ9B 2RRNA 2GMHA 3PX6A 5KFOA 4Q45A 1TKTA 4R71A 4RNMA 3C6TB 2VKZG 3F41A 3J7Z5 3UVJA 3RU0A 2GK7A 1EKRA 3OTEA 2O66A 4X4SA 3D1HA 2RAQA 3L7UA 4N56A 2VASA 4CO3A 3PHEA 4NLDA 3C19A 1VQNB 3BGFA 3KLVA 3HVTB 3VV2B 3RR7A 1Q5YA 2X8KA 3EDRB 1MLAA 2XZWA 5GMDA 3TZWA 5EX3A 1HI8A 3ZXWA 2B9EA 4Q8FA 3GIMA 2FLLA 2H65B 4WIQA 2ROEA 3BBBA 2W9BA 3R7NB 1K73D 1HI1A 2JLEA 5C24A 2VB6A 2MJUA 4QVAA 3NGSA 3H2UB 3O2IA 1F3FA 2F40A 4NLSA 2DT9A 1HWLA 5J2QA 4OZ0A 3H42A 1DY3A 2UZAA 4G7WA 2ZXHA 3LWMA 3PW5A 4Y6IA 4LR9A 4CO5A 4TT3A 1HBMA 1TVCA 3CCEB 1N32F 5F4OA 3CCZA 3SKBA 5FD1A 4DK0A 1TL5A 3EWGA 1UVNA 1C1CA 4BDPA 4DPOA 1ACMB 2XB2D 3FCWA 1UVLA 2C2KB 1KEKA 1GMWD 3J81j 1OB5A 5IWAJ 1XMBA 3M8PB 1EFRA 1D1UA 3VR6A 3MURP 1AB8A 3ULHA 3T3FA 1YZ6A 5J1NA 3NXZA 4WFYA 4DCJB 3GJRB 2W7AA 4M5KA 3AD7C 2HNZB 2BVZA 4ZVEA 2YNGB 3P3DA 2V8DA 4XN0A 4C9DA 4B4DA 1KVKA 1Q81D 4ERDA 3HF5A 2QZ8A 1UETA 3TX0A 4R5PA 3DOLA 1VQMB 1CJTB 1VJSA 3EZUA 1WTHD 1FKPB 5L39A 3R1LA 1Y0HA 1U4BA 2IVMA 1PYOB 5KT2A 2FVCA 4F4YA 1OMSA 5K8PA 1BE4A 4OYBA 4XTTA 4Z4TA 5SZTA 3E01B 5HBMA 2Y1JA 4HE6A 1N4LA 3QYYA 2Z30B 4OP7A 2Z8QA 1FE4A 4UQGA 1SQFA 4NXMF 4P9SA 2QX0A 3VAFA 2GQ2A 4CTAA 3M05A 3MM6A 5ETQA 2JC1A 1HQEA 3M8SA 1IBLJ 1JNYA 2VC0A 3Q24A 3CD5A 2HHTA 1U1QA 1RZMA 2B4VA 4ED1A 5RUBA 3JQRA 3BO2A 2DGOA 3PO4A 2JLGA 2Q6IA 4QIEA 4NLUA 4X4VA 4DUZF 3AY0A 3ZTQA 1KFDA 4YEAA 3SCIE 2OI2A 4O4GA 7FD1A 2J0SD 4EGLA 3U27A 1VOMA 2E1RA 4DR4J 2WBMA 4RKUC 3WIUA 2Y0BB 2EFPA 3OBIA 5KG7A 4ITSA 1VQ6S 2HBYB 4MH8A 4DL5A 3Q8QB 1TK5A 1JLEA 2A6OA 2RF2B 2GREA 2VBVA 1VQ8B 5GV8A 3B78A 2CNNB 4DCOB 4TSFA 4FF2A 1KTVA 2MHNA 1YG0A 2ZZTA 3IO1A 1RWMB 1JK9B 4LFCF 3DLKA 2BGJA 2X51A 3NWGA 1GTHA 5HP1A 4G1QB 3BH4A 2ZE2A 5KFGA 3LANA 4AL6A 1KJZA 2HRUA 4PRFA 3PR4A 1GQEA 3OFNA 2NPIA 4HHJA 4RDLA 2HS0A 5HK4A 2XNCA 4PUOA 5GVQA 4V1Ak 2JC0A 4USHA 4WFNQ 4OZLA 3JAMU 1WNEA 2R2UA 1NSKL 2ZNYA 3CCSS 3EVMA 2MQQA 3DRXA 1W7WA 3LA0A 1HNZJ 4R0EA 2E5LJ 4GKKF 1VHOA 3UVJB 1X60A 2DY1A 3JTPA 5A76A 4HE5A 2XG8A 4Z4ZA 2C3PA 1RTDA 4LFBF 1W26A 2F1MA 1X4FA 1UD2A 4IOAQ 3GILA 2CWXA 1HQUA 3C6UA 2C2ZB 4KKUA 1TZ0A 2E1CA 3QT8A 1JLCA 2CC2A 4QCLA 1S72B 3DOKA 1I7PA 1N07A 3J7ZT 4RNOA 3GP9A 2W9BB 1Q4RA 1K73T 4Z2XA 1PKVA 2AJ2A 5C24B 3G6XA 4PC7A 3GWCA 5FLXY 2HFUA 4NA2A 5E0OA 5DSZA 2MQNA 2H51B 1QUEA 3CCUS 5KFJA 3K0JA 4OX6A 3AGPA 2G0CA 3QT6A 2OD6A 5BSXA 2UXDF 2VBUA 2HPUA 5LL6d 1HBMB 1GXUA 3HHLA 4FVMA 4C8NA 1C1CB 4LUBA 4LIWA 3WZ0A 4L6V3 2LQJA 4IDKA 4AF7A 2AEFA 4FP9A 1AZSA 4DFJA 1JLQA 2ZZGA 3ENQA 2B43A 3HT0A 3EGWB 4EFAC 3VGUA 2GX8A 4RJVA 1EX8A 3OVSA 3A1YG 3CCVS 1SKRA 2UXBF 4OYZA 3OR1A 2HBRB 2CQBA 1Q81T 2WSEC 1IVZA 2EWHA 4R5PB 3DOLB 4AE5A 2KRBA 5SUHA 3DCAA 3NL0A 4YAFA 3CD7A 4DR6J 2GHPA 4YELA 4C0BA 4DPUA 2QA1A 4DL3A 4TKOB 4LF5J 2LDIA 4P6YA 2ZC4A 2ZM6F 5HBMB 4II3A 4ZCLA 2V7WA 2DBBA 4OYAA 3VAGA 3S1TA 3BY2A 1B23P 3QGIA 5IXUA 1U26A 2MKCA 1MMNA 3BGLA 4RBUA 1JJ2B 2A3JA 1OGIA 1IQZA 4AF6A 2M88A 2KHDA 3IS9B 3NE5B 3HHDA 1QE1A 2R7TA 4MFBA 4LF7F 4CTAB 4B44A 3Q39A 3CIMA 3OAAA 1WU8A 3MM6B 2FDNA 1CBKA 5J1PA 1HQEB 3BGUA 5HVHA 3BCFA 4FN5A 2DK2A 1S0UA 3GIRA 3ZFVA 3DFEA 4ZS6A 2X3GA 5M2UA 1S99A 2F4NA 4DN0A 5D4PA 1E43A 5E6TA 1W0KA 1JXLA 2K7KA 1Y3KA 3QLHA 3B6BA 4Q5VA 1YJNB 2RSQA 4KR0B 2EI5A 2COLA 4YB7A 5D3GA 3DLEA 4Z7CA 3HT3A 4MAKA 1JLEB 2BJDA 2HHXA 3N6NA 2WAQD 1BMFA 3D6FB 1EQ0A 4DV7J 3CCMB 1WKJA 1JJCB 3I31A 5KFHA 4P1VA 4L8JA 2HQFA 4ZLJA 2OEKA 2AW0A 2MTLA 3ISND 2Q66A 3DLKB 3J81U 1FA0A 3L3CA 4YAWA 5HP1B 4M63A 2K3IA 2NLWA 4OMFG 3GB0A 5GADU 4DS5A 4ALZA 3FBEA 4TMZA 4PUOB 3DHXA 3OJWA 3R5JB 3N0VA 2KZZA 3W8PA 2VH7A 1IKVA 4GRSA 1BWEA 4X65F 3AB4B 5C5JA 4WQMA 3SBMA 3NAHA 1RT6A 3S01A 1RHQB 3P96A 5HKKA 2HYIB 2H54B 4DG1A 1M90D 1PJ5A 4GO5X 1VIXA 1ZM4A 1FHTA 2KFZA 5EWEA 1RACB 2R8IA 1HNIA 1RTDB 1F9HA 4P2MA 1EZZB 4DSLA 2OLWA 1YBAA 1HQUB 5D78A 3D1QA 3THTA 3GV5B 2OD4A 2BANB 3QSYA 3DOKB 4TQSA 3H5XA 2U1AA 1R27B 2UUWA 2IHR1 4DL6A 1SH2A 2J0QD 2AEJA 4ZA1A 2FJWA 4X66F 3ZTRA 4J9KA 3HSZA 2VJVA 5KG4A 1RHUB 2LMIA 3IRXA 2FJXA 2HIYA 2B9WA 3GTYX 4WK1A 5IV3A 3CMAB 4KY3A 5L1JA 3LAMA 4FXVA 3MPVA 4NLGA 1KD1D 1N5VA 3DHWC 4F4AA 3Q22A 3HHLB 3MAAB 4DR5J 3TYTA 1W0JA 3BO3A 1PAUB 3C66A 5BYRA 4NLVA 2WVEA 3GYGA 4UOFA 3OPKA 4M5DA 4BS2A 3K5LA 3QFHA 3PFOA 1I1GA 2VFSA 3PM9A 4IDKB 2B5JA 4LQ3A 3J80Y 4OI2A 2QN6A 1AZSB 1JLQB 2XBPA 3V2UC 5I3QA 1A8PA 2AYMA 2OPPA 4RJLA 3BGOP 2DXDA 4U8VA 4LRBA 3A13A 3TA1A 4EWTA 3RB3A 4B9LA 3I6PA 1FDAA 1SPBP 3FKSA 4DV5J 3OR1B 2MKKA 4OLOA 3DKDA 1Y10A 2MY8A 1YITS 1LEOA 3CDEA 1B64A 4E2FB 2HVDA 4RD1A 3LPYA 3KEWA 1UZHA 4EMDA 3G6ES 5F8IA 1GEHA 5JVGQ 1NDLA 5HANA 1QVGB 1QAXA 2Z2LA 2AZ3A 2ACMA 1XNQF 9RUBA 4PZVA 4N5SA 3OFGA 4J9RA 2E5GA 1HA3A 3T51B 5CYMA 1NPRA 2MKIA 3A8KA 1UP1A 2FUG9 2ZHOA 1QE1B 1SH3A 2P3MA 2VZLA 1B99A 2FQQB 3AOAA 4TYBA 4MFBB 1YK9A 3AVYA 2FHJA 4ZPVR 1SVDA 5HJYA 1DAXA 5KG0A 2LECA 1WSRA 3R5CA 2QLXA 1DTQA 3VVTA 1UJ4A 2QMXA 4AL7A 2XLJA 4R25A 4ES3A 2GJ2A 3UQSA 3SFGA 1L3TA 2V68A 1B0VA 5IM0A 1QAJA 1RISA 3CPWB 3CVKA 2MPUA 1KLMB 4OPSA 4XLCA 2OPQA 4G1VA 3IC1A 4LSZB 2W1BA 1SIZA 1J5EJ 1MWYA 3BKUA 3OL8A 1M1HA 2X7IA 3HSGA 5KFMA 2IY5B 3G05A 1QFJA 4K1XA 1M5OC 1IBKJ 3OLBA 3A3GA 3I56B 1NCLA 4EO8A 4KGXB 2KVOA 2W25A 1N33F 3QJJA 4B3RJ 4WIIA 3FNNA 4X64J 4OHWA 3BEGB 2V7TA 3M8WA 1MN9A 2V94A 2H5JB 5AE2A 1WF1A 4P2FA 1EARA 1VR6A 4C8ZA 3G8TA 4ZV4A 4X7DA 5A8RA 5U47A 3BDEA 1IKVB 4CM2A 2APOA 3V5RA 4NMLA 3MCAA 4XD7A 5AXLA 1YBTA 4YDDB 3SZ2A 4BHQA 4AT1B 2QLWA 1W34A 1VGYA 1RT6B 5HZBA 2KJVA 2DO4A 3D0HE 4C48A 1LK7A 4JV1A 4DG1B 1M90T 3L7PA 5DETA 2GS8A 5LJ5Y 4QW9A 4NYOA 4ZK7M 2J7UA 2YKNB 1RWWB 3IWXA 4IRCA 4CH0S 2E1MC 2GVDA 1HNIB 2CZ9A 3K5OA 3C3LA 3ILLA 4CYUA 2GO8A 2KVQE 3LAKA 3CJ0A 2YNIA 3UCGA 2FHMA 3OXGA 4JI5F 2VBXA 4C8LA 4YUDA 4J9UE 1XE1A 2VL1A 4ED3A 3QSYB 2DKOB 2GFFA 3N79A 3BPSP 3GYNA 3ZBUA 2E7XA 3IM9A 4TMTA 2ABYA 1ELOA 4ILLA 1SKWA 5C7PA 5J2PA 5F3ZA 3U1MA 4OHYA 4MTPA 1QUPA 1U2RA 2ZZMA 2XHCA 3IAS9 3W64A 4M8LA 1H0HB 2J76E 1HLWA 1URNA 4YY3F 5KFAA 3LP2A 4NLPA 2ZJPQ 3CC7B 1KD1T 1R43A 5JUMA 1G7CA 3OW2B 2RILA 1DJ0A 1N36J 1X5OA 4U9RA 1YI2B 2KG0A 1EFCA 3NGTA 4EO6A 3JTNA 3H40A 3TNVA 4M5DB 5B6IA 3TQ1A 1TP7A 3VO1A 2N4CA 1ZAWA 2B5JB 2GJRA 5KTQA 2L08A 4PEOA 2QN6B 3VVUA 4JB8B 1UCNA 4DPWA 1YLOA 2OPPB 3HFVA 1IKXA 4NPOA 2EK1A 2UVWA 2QJ3A 4V19X 1NHVA 5FIIA 4U95A 1S76D 1YJWB 1VQLB 1S4EA 4UF4A 2FIUA 3PEHA 1M1KD 1O0PA 2ZL6A 2PO4A 3AVXA 5ETNA 1K8AD 2YWHA 1ZZFA 3RW6A 2BM1A 1QUVA 4JP8A 5L46A 3OLAA 1GNKA 2MYFA 2N4DA 2VQFJ 1JMTA 5F0WA 5C42A 4LC0A 4UT4A 1PAEX 2Z57B 5AE1A 4DQIA 2XMJA 1LOUA 4NEYA 2YPZA 4ACBA 4P7VA 2XOKA 2MZRA 5CYMB 5IV4A 3QJPA 4PGOA 2JJ4D 3ITHA 5K20B 2UUAJ 5LM7E 3M6XA 4C7QA 4P22A 5CHCB 5AXMA 1N34F 4PCQA 2MZJA 2K1RA 3WIVA 3WNBA 3L9ZA 5B0EA 3RB4A 3I9V9 3ISXA 1UW4A 1DTQB 2P5VA 4BC7A 1BWVA 1AA1B 3FSXA 1SJQA 3QMQA 3G86A 2ASDA 5E3QA 1VQ5B 1T9WA 5IM0B 4WZLA 4P73A 2QG9B 5T14A 1EP2B 4Y9UA 3PACA 4A46A 4D3HA 1RAIB 2CPYA 3W2VB 1IJEA 3T1HF 2OPQB 3BO4A 2BRKA 1U1RA 2BJEA 2D9PA 3UR0A 1NKCA 2MKHA 4J91A 1TUIA 3G71B 3OEHA 3QRPA 1MG7A 1T6XA 4OX9F 4CO0A 2IIHA 2HFZA 3ZNUA 1D8ZA 2CNKB 2QTWA 1NPKA 3LQVA 5C25A 1F20A 2DCUA 5KNLA 1XJWB 4TLQA 2F43A 5IYQA 2VDIA 3OSNA 4UY85 2G13A 1NUEA 4C8KA 4BC9A 4NYPA 3DOMA 3QFRA 4DUYJ 1FKAF 2I1RA 4ZCIA 4J37A 4DV4F 1CC8A 2DO0A 5GADI 5A8RB 4MKVA 2F9DA 3OTBA 3GIJA 4KKOA 3MAQA 4JI6J 2NSBA 1VLYA 3SQOP 2GIQA 2WHOA 5DDPC 1MWQA 3H20A 2F3JA 4B3OA 5DLFA 1AFJA 1MU2B 3L95X 1G7SA 5ADZA 2CG4A 4ZP6A 1N32J 3HO1A 3B82A 2QMWA 3H59A 3GR0A 2F5GA 2ASYA 2F7VA 2BSAA 3MM5A 2DOGA 2GVDB 3G8QA 3JAMY 3FQKA 3M2VA 3GSDA 1BLUA 4UTGA 3R97A 4CYUB 3NMRA 3P45B 1OQ3A 2BMWA 1WI8A 2YNIB 1SCJB 2RC5A 4G1IA 5BR8J 3KNAA 4IG0B 4X07A 1TLLA 5HJXA 4GKJF 2PEBA 4OL8A 5HMWA 5HAOA 5CCLA 1XN9A 2JNJA 5DLGA 2X85A 3CDWA 4CH7A 4B3SF 3HULA 4M5JA 1EJ7L 4I2PB 2DERA 5J2PB 1KRHA 2X6YA 1GAQA 4JV2A 1NSQA 1N5YB 1I94F 4RBTA 2GMJA 2ADBA 1JNRB 3LP2B 4DEZA 3D66A 1CLFA 3PY8A 4LT6A 5DJBA 4NLQA 3GZ7A 4NA3A 4WP9A 3D4JA 3W2FA 1RWPB 3W5VA 2LEAA 4FYWB 4CH1A 1K0VA 3KK1A 4A48A 1YVFA 1YSJA 3IR7B 1FDDA 3DRYA 2Q3PA 2XSFA 4XIUA 5D0GA 2PI4A 2ZL5A 1KDNA 3MCSA 3PX0A 3QT7A 1AYEA 3KTQA 2FJDB 4TXSA 2ZOGA 2BUNA 3PUNA 2OFGX 5D0RA 5IS2A 3MZIA 1Y11A 3TJ8A 3V6DA 1XWLA 5H5JA 1WOSA 1ZPWX 2BVNA 3EVWA 4F04B 4G6VB 2RU3A 2OYNA 3QIPB 4DSJA 1R8PA 4DUZJ 3MM9B 4R8UB 4K0KJ 3Q2SC 2JRSA 3OFFA 3IBFB 3OTDA 3W5UA 2GO9A 1M1KT 4YB1P 3CO9A 2XCPA 3TARA 1TL3A 1YZ7A 2L48A 2DHGA 2RH3A 4A8FA 2F4FA 1K8AT 1QUFA 2C4UA 4A8YA 4MYUA 5DO2A 2DITA 2QA2A 1JXEA 3CCTA 1NJID 5C42B 2RVJA 3PFEA 5F8HA 4LRFA 5EDWA 2XGQA 2XZTB 2MY7A 3B4MA 4IG3A 5KFDA 4LF4F 3ITHB 1ZPVA 5EUHA 3KXDA 3NGRA 1GTEA 3TWZA 3R2CJ 1C2PA 1RK8A 2PMHA 2K1RB 3MGJA 3MTJA 1HL6A 3FJ2A 1DLOA 5CZVA 4DQQA 3POTA 2YKQA 3QWUA 2XYGB 3UD3P 3EICA 2LA4A 3ICLA 5KT7A 1AROP 3FPPA 1YQHA 2W24A 4DZ6A 3BDPA 1AUSL 4WKYA 4Q8EA 4X05A 2UUCF 1J5OA 2LZJA 4I68A 1FVQA 3GVLA 1IJEB 4WKRA 4LBPA 1KZLA 4RUHA 3OEEA 2F63A 4RW9A 4KIAA 4OFZA 3ZC4A 1RUSA 4I69A 2E1AA 4OZ2A 2Y9HA 2M7SA 4LSNB 3CRZA 4LFBJ 2FLPA 7AT1B 1ZOTA 5A6PA 4XKWA 1T9XA 3V4MA 2K8GA 3SSRA 2FPHX 1QSSA 2DCUB 2RDDA 4OZ5A 1U45A 1WEZA 4C4WA 3KL9A 2BJ3A 4X62J 5KFWA 4K4XA 2KO1A 2PEHA 3FZ2A 1GAOA 3MR3A 4ID5A 3DOMB 2QRRA 3TO8A 1W35A 4ETZA 2XMAA 5CD4H 4KKTA 4TNOA 2G1DA 2OHDA 3AGQA 4KKOB 3GPAA 2YNFB 1RAHB 2OELA 1WD6A 3P5BP 2UXDJ 4B3OB 2BJ1A 4O3NA 4JI1J 1PCAA 2GNKA 5KFBA 4B3FX 4Y00A 4UY8T 5D0EA 3JYTA 1FRMA 3LW5C 1Q9SA 2VG5A 3MM5B 4F0KA 4WU3A 2E9ZA 1SH0A 3JB9k 1FTRA 1QX4A 5H9EJ 3J7YU 4ED8A 2HHSA 2GCFA 3R7BB 2HURA 1ZAXA 3VALA 2V7QA 4IFYA 4O0IA 4A8KA 1N6QA 3TJ9A 1Q7LB 1EKSA 2UXBJ 2BKNA 1HYSA 4IH5A 3F56A 5J1EA 1B4SA 2YH0A 3ILOA 1VQSA 2YQ3A 4QJVA 5F8GA 1NK8A 3FBFA 1IBCB 1WDDA 3HZEA 1R3NA 3BV8A 4UZFA 2MKYA 2XNQA 4EBCA 2MGZA 1RBOB 3R6KA 2M70A 4CLKA 2ZM6J 3D26A 2OK8A 3EUNA 1B0PA 2R9LA 1S5ZA 3NNCA 2BW7A 4R0JA 5AT1B 2FVSA 4LF6J 3KK1B 2QMUA 4DU8A 3THVA 4PKDB 2DGXA 1GJRA 1TKXB 2D3ZA 3MUMP 5L1KA 3CULA 2PA3A 4LF7J 3HHKA 2CPJA 5LMNJ 1SJFA 1URRA 3V6DB 4OLPA 5KT6A 2VC1A 4DR2F 2DGSA 1V5IB 1QG0A 5IT4A 2ZHBA 1F3VA 3FEXB 4H4OB 4QW8A 6FDRA 1HHTP 1PIEA 1TKDA 2R2TA 4KFBB 4A8MP 1VQPB 3JU4A 5DS7A 4FZVA 2KKHA 2PMWA 2HQGA 4CT8A 3CJ3A 3FGVA 4D3GA 4CLSA 1TL3B 2FHKA 1G2EA 2OO4A 1KK0A 1T7PA 2IYGA 1PO6A 1X5SA 1T3OA 2ZC3A 8AT1B 3LWLA 1QDUB 5LSLA 3S6EA 1ICEB 3VAHA 2Z2YB 4B3XA 1FDNA 3G4SB 2XY7A 4B48A 2XMUA 3QGHA 1FNDA 1FNMA 3T9NA 1DLOB 2GA7A 3P49B 4ED4A 2J6TA 2QO3A 2VD3A 3U7JA 4M4SA 3S8SA 3POTB 1MW7A 3KDNA 5CZXA 4WZMA 1KQSB 4ZJQA 5J35A 2QEXB 2CPEA 4X65J 2VHGA 1J5OB 1DHMA 5KFVA 1EFTA 4RWWA 3CCJB 4FF4A 2QC3A 2CFXA 2YH1A 1Q8BA 3UW1A 4DV2F 4RW9B 1RWXB 4WK3A 2IBKA 1UTAA 2FZCB 4OX8A 1U2FA 1H3DA 3GJSB 3PX4A 2LQ9A 2GZOA 1BHNA 4QWBA 4F4XA 2V5HG 3P26A 4ELVA 2RRBA 2FZKB 4ED2A 4XKVA 1U09A 2PIAA 1UW9A 3CC2S 2AX1A 1R6VA 2CJQA 4USTA 3PCOB 3CCQB 1FEHA 4ID5B 4WJBA 4ZVOB 1U8SA 3CT9A 4I67A 4UZCA 4X66J 1UAWA 2G1HA 4F36A 4K2XA 1FJEB 2DYAA 5FL7A 3NBPB 2VBYA 3V7AA 1Y3JA 3BJYA 2WB4A 4RX6A 1A9NB 4C8MA 2YKPA 1NDKA 5LMUJ 4CRJA 4NXNF 2J6SA 2D3OR 3DMJB 3FMWA 2BBEA 4RL1A 2GIFA 3JYTB 3D2WA 4ZP8A 1LV5A 1KVIA 2HHUA 2YNHA 2VG5B 3TEGA 1VLOA 3K8WA 5HMZA 4NZ6A 5DG8A 4DDFA 1RCXB 4LRAA 1Q86D 4OYWA 3MPDA 1FK9B 4Z4WA 3FUYA 3M32A 3ZZZA 1UEKA 1K9MD 2L9WA 1T6ZA 4ZMMA 4UQTA 1YJTA 4FXDA 4IFYB 3OJUA 5F8JA 4HACA 3K17A 1IBMF 5CAAA 1HYSB 2JVRA 1M5PC 2E9TA 5J1EB 1UKUA 2HLTA 1C0UA 4W4MA 1Q8IA 1VBXA 2ZTNA 1A0OB 4ZIVA 3HJFA 4I6AA 4S0MA 1UPMB 3QATA 4YFUA 1LQ9A 5IYWA 4N77A 3GIIA 2MGZB 1VI7A 4QYZJ 3PW4A 1XNQJ 1D1NA 1T94A 3VZIA 1CJVA 4PQAA 3AA9A 3MOJB 2Q79A 3A35A 1F1BB 1XTZA 4LVOP 4ZLPA 3LNNA 1H7WA 4DF8A 4IQXA 4FF3A 2VFRA 3UDCA 4LBZA 1PC5A 3U1LA 2OBRA 4Y2IA 3FZBA 3C2PA 1DG1G 4LF5F 3LP0A 1IR2A 2C3OA 1RLCL 2D3UA 3T5JA 1TUWA 5A8KA 2WZ1A 3TUIC 3CJ4A 2VJUA 4CT9A 4DX5A 1S48A 1CQNA 3I32A 2DNRA 1U1NA 4QPTA 2QIFA 1RYRA 2KTQA 2HNDA 2B8PA 3QBCA 3IGNA 3NCRA 4M2LA 3GSIA 3IP0A 4KGMA 5L38A 3Q38A 4H54A 2ZUGA 1X9WA 4DBQA 4C0HA 4X2BA 1ZUNB 4PC2A 3PYGA 3BB5A 4QWEA 4CO2A 3IN5A 4U7UD 4YXWA 1XFOA 5KG1A 5JJBA 5IYRA 3OD2A 2D3O1 3JQKA 4BBYA 3JTOA 5E5NA 4CLZA 2CUYA 2H9ZA 2G2YA 2ZH4A 4PG6A 2Y8YA 1BD6A 1SUQB 2W7OA 2GHVC 4AFFA 1VQ9S 4J9LA 2JIZA 2KXFA 2DNNA 2HGNA 5D4LA 2HEKA 1NM2A 2ZDOA 4NNJA 4DV7F 4ZPWR 1PSDA 3TA2A 2CQ4A 3DDIA 5LOQA 3MM8A 4UOHA 3UE2A 1OS5A 3OV7A 2ZVIA 2VNJA 3Q0AA 2LEBA 2OPSA 1DQ9A 1AMOA 2R7QA 4LFAF 2D9OA 3BM7A 3NCQA 3CTAA 3V6JA 4EBEA 1TL4A 4KQZA 2FVQA 1FRJA 1FRKA 1CPZA 1JJ2R 3GVKA 1DDGA 3ZUGA 3WBKA 3TZZA 1SJ3P 2D3NA 5EGYA 5F4MA 3AT1B 5H9FK 3RY8A 2JJ2A 4QR1A 4CNYA 1AUDA 4ZJOA 2OH2A 2V0NA 4JI5J 2WYRA 5BYQA 3CO0P 1FE0A 4FNHA 1WHYA 3CC4B 5KFFA 2GQFA 3DGVA 3EXYA 2V4QA 2QTZA 4URSA 2HWHA 3HAGA 3ZZYA 2FVGA 3QWPA 1E3ZA 5KW9A 1NLKL 3BN4A 3R27A 2W2MP 3OFEA 3KHRA 4G7XA 5IK2A 5KT5A 4YY3J 3BR9A 2CYYA 1QSYA 3H94A 3NGKA 1IM6A 4JI8F 4N76A 3PIPQ 2MQOA 2FYXA 2DNPA 2HWTA 4RDJA 2AX0A 2YNHB 3W3SA 4G6IA 1NK6A 1ZZNA 1B2RA 2Q6CA 2C3UA 1A7GE 2DR7A 2EW9A 4OYXA 1R5NA 4NEZA 1QSLA 2W4DA 1Q86T 2XNJA 3CJ2A 1GVHA 1S6QA 4LBIA 1QD1A 3M32B 4YR0A 4RPFA 3Q83A 2JSXA 1K9MT 2V2KA 4OZJA 2FGCA 2HSEB 4HACB 4DR5F 2PC6A 1FTCA 4Q2LA 2ZZQA 4OPOA 2OTLB 2BOPA 2YKMA 4DR1F 2PMZD 2VV5A 3MPWA 2NUUG 2E9RX 3TVKA 2MDAA 4FPRA 3HK2A 1NB9A 2W6IA 3AXMA 2XTJP 2CVEA 3BSCA 1YRTA 4UZBA 2DPJA 2P8IA 4ANEA 4HL9A 1VQ7S 3WNDA 5IYPA 1RQPA 2JLFA 1OYEA 4DV5F 1JIHA 4RUCA 1CJVB 4ZVFA 2YVSA 3QFSA 4AQYJ 3DU5A 3JSYA 1H7XA 1JA1A 2B9YA 1RWUA 2XULA 3TZXA 3QFCA 2EFQA 4DK1A 1RLDA 4HH1A 3DLJA 1WOPA 3N6LA 4JYAF 3DYAB 1FWPA 2QLBB 5F0UA 2P9CA 4TY9A 2GJPA 5A8KB 2ZXIA 3MPUB 4YP3A 2J8SA 1RBAA 3VTIA 3EE3A 1DQ8A 3MXHP 2ZH1A 1HWUA 1NO8A 2DGWA 2F4VF 3OTOF 2VYQA 1WHXA 4L72B 5KSWB 4RPBA 1FDRA 3H9NA 3BQ2A 2MSSA 2IJFA 2HNDB 4F26A 3R8YA 4Z4VA 4USUA 3AVUA 3FSIA 2FJBB 5L9NA 5H59A 1EXMA 3NNAA 2CNDA 2J9DE 4DPTA 1PC4A 1HBNB 5KFUA 5DGAA 3EZOA 5DZ7A 4XMYA 1X8DA 4DPYA 4I6YA 3DXBA 5JXSA 2ROPA 4ECQA 2FVPA 3SDEB 1C1BA 5GAEU 4I1TA 2ZJQQ 4P6VF 1S1VA 4F8RA 2VBZA 5ETOA 3PIOQ 3MM8B 3G8SA 3G9CA 2KH9A 4B3RF 3SJZA 1HD0A 1KOHA 2YX1A 4X64F 4WFAQ 3EVOA 4QWDA 2OPSB 2EPIA 1VBZA 4OQJA 2OMLA 1N88A 4J9QA 1M5SA 2CIMA 4ECZA 2QV6A 5F9NA 1HR0F 2D9RA 4P52A 4KHPJ 4A4JA 5GMKa 3JSMA 4I4BA 1KQKA 1RU2A 1F2HA 1OY8A 2EG1A 1XC9A 4RWXA 2J9CA 2XQCA 2CKWA 5KFTA 2OTJS 1DURA 4NLWA 2HHPA 3NY0A 4QV2A 2Y0SD 1B0TA 4RD4A 4KH1B 3M9OB 3KFWX 2WB1D 5IOLA 3BBFA 2XS2A 4P2XA 3G96A 2GAHC 3D7SB 4XLAA 3CUNA 2V8GA 4GKJJ 3RB6A 1RTHA 2HHHF 3EMTA 2GC8A 4LBVA 2VU5A 3H90A 1SKUB 3EYZA 4ER8A 4M0LA 2ZNZA 3A8EA 3CW2C 1ULRA 2KT3A 4W92B 2WVCA 2B4PA 1SKQA 2YWFA 2R2SA 1Y0YA 3VCDA 4AUKA 2JFKA 1NH7A 4XO0A 2XNRA 2EEYA 1JJ4A 1QH0A 2NUHA 4DOZA 1BQNA 3QAUA 3RRHA 4B9UA 2R4FA 1G7TA 3ZZTA 2O1PA 2A0FB 4ETXA 3HDSA 1X9MA 2MKSA 2CZ4A 2C1EB 1K1QA 3SFUA 3W60A 1RABB 4J9VA 2XY5A 3KLIA 4OPVA 4ZOSA 2ZTGA 2AJQA 2HMIA 3GQBA 2ZZNA 3BBCA 1RHMB 3VQSA 2HGMA 1S6QB 4DSKA 4K50A 2Q43A 4PYDA 2GJIA 3SJPA 5ETPA 1IUJA 4GO7X 4IRKA 5D0HA 4ICLB 2YKMB 3V6HA 2I5JA 2ZBUA 5E2QA 3LGHA 1IKWB 4N7TA 2IC3A 3R5BA 1U1OA 2ATCB 4B9VA 1R8BA 2C42A 2XZLA 4CCHA 2WK4A 4F67A 2YKAA 4FYXB 4HTIA 4MKAA 2ERRA 3WBZA 3OL9A 1N5QA 1S77D 2XC9A 2Z56B 5A0YA 2GAGC 4U7CA 3I55B 4XM3A 4NLYA 2HZAA 3K58A 1SJ4P 4B9NA 3ASSA 4QIFA 3KK2A 2VQFF 3WY9A 5C2CA 1OQ6A 5IT9U 3GQCA 2XY6A 2W01A 1IQTA 7FDRA 2Q6OA 4ZVHA 1F60A 1VQOS 3K5MA 1ZETA 3P8BB 2C2EA 3VF0B 2F65A 4FYDA 4DXLA 2OGUA 3RYLA 1H6KX 3MFIA 2O67A 4USJC 1Q5VA 1SKYB 4M95A 3CCLS 5DG9A 1K0TA 1KQFB 4DQLA 2C4TA 2V4JA 2MHEA 2QGFB 3O8WA 2Y1RI 1RT4A 2MB0B 1NU4A 2E5JA 1NK9A 3CIZA 4XPEA 1RA6A 1SC4B 3QJLA 4MYTA 1X0PA 2HFOA 4DZDA 1XK8A 2HVEA 2BZ2A 4ZN1A 2W2PP 1UD4A 1ZTTA 5HSPA 1YHQB 4CQ1A 3MPYA 3PRBA 3AH6A 3GYXB 5F8LA 3JSRA 2CQDA 3DRPA 1Y9OA 2G0IA 2DR8A 1VIOA 4Y28C 2DEIA 5EWGA 1QFYA 1WG5A 3DRSA 3HVWA 2YY3A 1NB2A 1C1BB 4K7QA 3OUYA 1KWMA 1S1VB 3JQQA 1KN6A 5IQQA 5KFRA 4PXDA 1WJ9A 3HM9A 4HIZA 2DH7A 1HVXA 1FESA 2GIRA 3I5BA 3M2RB 4UOGA 2E66A 4WWSA 3PUMA 2QA4S 3DC2A 3UD4P 1O51A 2WTFA 4KE5A 4X4QA 5HLFA 1HHQA 1RAJA 5F9LA 4DUYF 1BJKA 2VG7A 1RXOB 2VICA 4KPYA 1HKAA 4ZGNB 4QU6A 2LXFA 3L4BC 1FRLA 4TY8A 2JL9A 1FXRA 2V7VA 1R5OA 4X7CA 4JI6F 3A3BA 5L1LA 5KFPA 2DNMA 3FEZA 4GC7A 4IW3B 2HHWA 2XMWA 3GE9A 2JN9A 5AN9A 1S0MA 2OEMA 2N3OA 4F50A 4IH6A 2XWYA 4Z37A 3CCRS 1M5KC 4ANDA 1IM4A 1RKIA 4ZCKA 3ASTA 4K4WA 4QU7A 1S6OA 2DR5A 2V31A 1EFUA 1UEUA 4M5NA 3CXCR 5BR8F 3MHPA 2ZKUA 2JEJA 2HFNA 1I6JA 3IAM9 4QYZK 2KFNA 2GQQA 2DGVA 1FX4A 4YAUA 1KK3A 4UW2A 2QLJB 2W2NP 1CVJA 3KLIB 1Q78A 4IOBA 3RW7A 4N8OA 3CSKA 1E6YA 2K3KA 4RNNA 3EGNA 2CRLA 4CO1A 1R6YA 2JH3A 4OJHA 2IDLA 5ETTA 1T6YA 1G4CA 3D54A 2PN6A 5BXIA 4DR2J 3W9IA 2DNLA 1BY9A 3AOCA 1LFPA 2FJVA 4DR7J 5TRDA 5CDFA 3TUPA 5D77A 4IUFA 2QL7B 2I5JB 3TAQA 3C16A 1UD8A 4PABA 1EQMA 4NASA 1FNBA 1IR1A 1C0TA 2ZHAA 1QFZA 1L3KA 3H0PA 1SIWB 1DZ5A 3EPGA 3KLHA 3F0NA 3A3OB 1RHRB 4J90A 2E44A 4K0KF 2V8VA 3DLLQ 4XDCA 1UWBA 3TANA 3OQ2A 1RSCA 2KZMA 5A0YB 4C2MA 1S1UA 1YWXA 2X1FA 1VQKS 1FFWB 2DHHA 2RJZA 3FC9A 1QTMA 1BQMA 1Q16B 1X4BA 1Q8KA 2G0JA 3CGIA 5G4DA 5A8WA 3FK4A 1CULA 2QFJA 3Q3AA 1VQ4B 4QBUA 4KRWA 4C43A 1FJ7A 3IM8A 5T7LA 2IBOA 1F60B 1MNEA 1X4AA 3TVYA 2EFOA 1VISA 4NCAA 3R1HA 3AOBA 2RKIA 5F4JA 3FBBA 1WC0A 2CPXA 2AZ1A 4RU2A 2YPYA 4DV2J 2V4JB 5KG6A 2ZVSA 2DCLA 4N41A 1RT4B 3CMEB 3LOUA 4O3SA 1QGYA 2XS5A 4NX9A 2DNZA 2EIXA 2WBRA 5K8MA 3KNGA 2C2RA 3G87A 2CQ1A 2JEFA 1V3ZA 3DM2A 1R0AA 3K5PA 1TKTB 3HHNB 3HHLD 2VJJA 1VRTA 2C3YA 1DTTA 2ZWOA 2M52A 4ZP7A 5KFIA 2NCKL 3DRPB 1JLBA 1EP4A 3QAEA 3OE7A 1S12A 2MQMA 1SL1A 3U1NA 4ZPAA 3ISZA 3QE2A 3DRSB 1NJYA 1IJFA 2DVIA 3HFZB 2X3UA 3OUYB 2B4OA 5DM7Q 1PG5B 1X31C 4QIVA 4DU7A 2EFVA 1ZA1B 4NOHA 4NCNA 3WQPA 3ZPNA 4X62F 4TKTA 5A2QU 4IRDA 2C77A 3T5KA 4NXNJ 5HLFB 5HXBA 1WKLA 2P9GA 1TUGB 6FD1A 2VG7B 4DNTB 4LRDA 2AHOA 2GGPA 2BOAA 2QSFA 4P6QA 1SXLA 4LVNP 2X53S 4A8OA 5J2QB 4X4TA 2QDXA 4MKBA 1OHHA 5DN6A 1SQGA 3FPKA 3H5UA 2HFSA 4KJIA 4ASUA 1FD2A 2AWZA 1RB0A 1H42A 2DGQA 4JI1F 3VHQA 4BWJA 4MIWA 1N5SA 1RT3A 5BYSA 1U47A 1OPIA 1IBMJ 1KC8D 2BE7D 4AYBD 2R9VA 1LW0A 4A8QA 4NL5A 3EPIA 2KHCA 3UCZP 1YKWA 3IWLA 1RHJB
chains in the Genus database with same CATH topology
2YX4A 1D9FA 4KSEB 3V4MA 2K8GA 1G3OA 3MR2A 3SSRA 2FPHX 3CD6S 3CDBA 4BCAA 2ZOFA 1QSSA 4E98A 4C3MA 2DCUB 4OZ5A 1U45A 4B3MF 2HAIA 1T3NA 1WORA 1WEZA 4C4WA 2B3TB 3BSNA 4LF8F 1WEYA 2AF6A 2CZVC 1GX5A 3M1VB 4MK8A 1UVJA 2BW2A 3DLBA 5KFWA 4K4XA 2KO1A 2FY1A 3W7BA 4AXJA 2LU2A 1ZH5A 1RDRA 1JJHA 2PEHA 1GXTA 3BGRB 3FZ2A 4I2PA 3HP6A 1E79A 1QAYA 1GAOA 3MR3A 4ID5A 1OPZA 3KG1A 1S1WB 3SI8A 4IFVB 2VKRA 2QRRA 1RGVA 4UOCA 1T5EA 1N5YA 3TO8A 2W9CB 4OV1A 1YIJS 2HLUA 4ETZA 4XDDA 4NA1A 5CD4H 4KKTA 4TNOA 2RF2A 2JEGA 2G1DA 2VZ9A 1E6YB 3M8QA 2XMMA 4KKOB 1U49A 5J2MB 5DDOC 4F02A 4A8SA 1HNWF 5IFMA 3KG0A 1UD6A 4PWDB 2CPDA 3CCWA 4QQBA 2BYCA 5HL7Q 1G6BA 3WQZA 1CSJA 1ZM9A 2YNFB 2RIJA 2OIHA 1XR5A 1WD6A 4QOTA 3PKYA 1X5PA 2R7OA 5GAHU 4B3OB 4O3NA 1T95A 2M9KA 4O3PA 2GNKA 5KFZA 1LWCA 2FJAB 4G1QA 4LF6F 1LW2A 4ECVA 5KFBA 2UUAF 2HIQA 4B3FX 4TN2A 4Y00A 1C4CA 4RZRA 4UY8T 2EK6A 1ZYQA 3CB4A 3JYTA 1FRMA 3OW2R 2KXHA 5KOXA 1CG2A 2FLOA 3LW5C 2VG5A 4OHXA 4RW8B 2VODA 3MM5B 1F5AA 1G1XA 4WU3A 3OHAA 2AU0A 3IG1A 2BRLA 3BR8A 5JVHQ 2AQ4A 2E9ZA 1O5JA 1SH0A 4TU9A 3JB9k 1FTRA 3FSYA 1XR7A 3N6MA 3GV7B 5H9EJ 3T6JA 3J7YU 5LMNF 4ED8A 2POKA 1WTBA 2HHSA 3IXQA 2GCFA 3UCUP 5AXNA 2CPIA 5B0AA 2WSSA 3QIPA 2N82B 5FDLB 1ZAXA 5GAGI 4XL9A 2LEPA 4A47A 2RRNA 3SCKE 3NP5A 2GMHA 1C0TB 3HLUA 2PSZA 1HBUB 5K14A 3PX6A 5KFOA 4Q45A 1X0FA 1UJ6A 1TKTA 3MM9A 3VALA 1HMVB 2XZPA 2V7QA 4RNMA 3TI0A 4R8UA 1ZM2A 3C6TB 2VKZG 4NZ7A 1FRIA 4IFYA 3F41A 3I5CA 4O0IA 4DL2A 3KLHB 4A8KA 1BQXA 3J7Z5 1NJXA 1N6QA 3RBEA 2AJ1A 1YJ9S 2GHWA 1Q7LB 1OWXA 5I3PA 3RU0A 1VBZA 4PXBA 2GK7A 3N5FA 1LWEA 4IH5A 1HYSA 2P6TA 3F56A 4KHMA 5J1EA 1UWBB 4OJ1A 2GMLA 3BQ0A 2YH0A 4O4GB 3OTEA 2O66A 4RNHA 3OL6A 4X4SA 3D1HA 2FHOB 1SL0A 1TFYA 4N56A 1S1UB 4A8XA 2VASA 1D3WA 4CO3A 3PHEA 1VQSA 4NLDA 2YQ3A 2JX2A 1BQMB 4QJVA 3ZZUA 3BGFA 1H98A 3KLVA 5F8GA 3HVTB 2O01C 2RRAA 1NK8A 4O4RA 4DS4A 3RR7A 3TAMA 3HZEA 2UVRA 1R3NA 2X8KA 1JX4A 1XMOF 2ZFHA 1DBDA 2XNQA 3H98A 4EBCA 5LJ3Y 2XZWA 2W4CA 2MGZA 4UUXA 2M70A 3HVAA 3M30A 1JLGB 2E5IA 5EX3A 1VQNS 1HI8A 3EUNA 1B0PA 2R9LA 3SV4A 4Q8FA 5T7LB 3NNCA 1JB0C 4R0JA 3GIMA 3NKYA 2FVSA 1IKYA 2ZZEA 2DIUA 1WF2A 3KK1B 2FLLA 2HLDA 5DDRC 3HVRA 2ROEA 2W9BA 1KVJA 2DPIA 1HI1A 1W2IA 3THVA 2JLEA 4YOEA 3ENWA 4PKDB 2DGXA 5C24A 2VB6A 1TKXB 2ZE2B 1V0FA 2MJUA 4U6PA 5GAHI 2D3ZA 3IR6B 1AXQA 3MUMP 5L1KA 1U1LA 3CULA 3H2UB 3O2IA 2IAJA 2ZH7A 2F40A 4NLSA 2DT9A 2PA3A 2R7RA 3CJ5A 3VZHA 3HHKA 5I4MA 2I9SA 1HWLA 1UL3A 5J2QA 3MEDB 2CPJA 4WTYA 4OZ0A 4MK9A 1SJFA 1B7FA 1URRA 2RNEA 3V6DB 4OLPA 2UZAA 5KT6A 4G7WA 3ZIAA 2VC1A 4DR2F 1FJCA 2ZXHA 1WTFA 3LWMA 2PIIA 2DGSA 3PW5A 4Y6IA 4PG4A 5HQ8A 2NXUA 2U2FA 3E51A 1XBWA 4OHZA 4CO5A 5IT4A 4C3KA 4TT3A 1HBMA 4NLRA 1M0SA 2ZHBA 3FEXB 4H4OB 4E8UA 4QW8A 3J7YI 2ZH9A 3DM2B 2DNGA 6FDRA 2KM8C 2JEIA 1HHTP 1N32F 1R0AB 5E33A 2WONA 2LU1A 3CCZA 1TKDA 5FD1A 2R2TA 5DQGA 4DK0A 4KFBB 4A8MP 1TL5A 1UVNA 1C1CA 4OX7A 3JU4A 4J9SA 5DS7A 3CCES 4IQMA 4FZVA 2KKHA 4DPOA 4BDPA 4RNFA 1DTTB 3PO5A 2XB2D 4CT8A 5B09A 2R7WA 3CJ3A 1JLBB 1EP4B 3FGVA 1UVLA 1FNOA 4D3GA 1KEKA 4LSNA 3OOCA 1TL3B 2FHKA 1XMBA 2AJ4A 1CC7A 4DHVA 1VQPS 2OO4A 1G2EA 3HI9A 1IR0A 1C0UB 3E3XA 1EFRA 3I87A 3M8PB 1D1UA 3VR6A 3MURP 2RQMA 2B0GA 3ULHA 3RRKA 3T3FA 3EXCX 3O1LA 1IJFB 5J1NA 2UVUA 3K8VA 3MEGA 1T7PA 4WFYA 2W7AA 2DB1A 1MROB 2AJ0A 4EZ9A 2IYGA 3M9MB 2HNZB 4HI2A 2BVZA 4ZVEA 2E1BA 2KYZA 2YNGB 1TR0A 1PO6A 3C6UB 3P3DA 2V8DA 3AB2B 1X5SA 4XN0A 1T3OA 2ZC3A 5HMYA 5CYQA 1U24A 3NS6A 3LWLA 4C9DA 2HGLA 2EFNA 4HDGA 4ERDA 1JLCB 3HF5A 1HD1A 5LSLA 2QZ8A 1UETA 2LDYA 1FF2A 1S9EB 3S6EA 3M6UA 4DF4A 3CDAA 4R5PA 3DOLA 3H5YA 3VAHA 1VJSA 3EZUA 1LXJA 4RW4B 2BM0A 4C97A 1FDNA 1WTHD 1FKPB 2CJAA 4Y2KA