1NRKA

Ygfz protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
325
structure length
325
Chain Sequence
b'MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YGFZ Protein
publication title Crystal structure of the YgfZ protein from Escherichia coli suggests a folate-dependent regulatory role in one-carbon metabolism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 68
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1nrkA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1nrkA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nrkA01
1PJ6A 1WOOA 3GSIA 1V5VA 4P9SA 3A8KA 1VLYA 1PJ7A 3GIRA 1WOSA 1YX2A 4PABA 3A8JA 4PAAA 1NRKA 1VLOA 1WOPA 3A8IA 1PJ5A 1WSRA 1WORA 1WSVA 5L46A
chains in the Genus database with same CATH superfamily
4CIOA 1W35A 1S99A 1N07A 1K73D 1VRQC 4N77A 4Y00A 2XLKA 3KLFB 3C6UB 2HVZA 3MECB 5BR8J 4LRAA 5AXKA 2MKJA 4ECTA 1OJ4A 2V4JA 4X07A 4JI0F 2AX1A 3SJZA 5LMNJ 4CO0A 3CC7B 1Y5IB 3ENVA 2C3MA 2DIUA 1G4CA 2BM1A 2MKYA 2CQGA 2BW7A 2IC3A 2YXLA 1R5NA 3T1YF 4MK7A 4A8FA 1N33F 2GV1A 3GSIA 4PWDA 4B3OB 3M8QB 1PO6A 3RRGA 2CQ4A 3JAMY 2C5BA 1JLBB 3M9NB 1FVQA 1XIQA 3R5CA 2KZMA 1PJ5A 3BGUA 2UUAJ 4O3SA 3VZHA 3W64A 4LSLB 1ZZFA 3QAUA 3WYAA 2NSCA 1R7IA 3QFWA 2PFDA 3HT0A 1RWNB 4NA3A 4DL5A 4DR1J 5H5JA 3M8ZA 1ZTWA 4ER8A 4C8NA 5D0RA 4K5SA 3UCZP 3M2UB 5BYSA 1FXRA 2DHAA 5GMEA 5ETPA 3M30B 1RCXB 1S6OA 4J9KA 4ECQA 3R5JB 2HKEA 2HIQA 2J7UA 2AJFE 2OEJA 3UD3P 4WIIA 2UV8G 2RHSB 4R8UA 1HA1A 2PIIA 3N28A 3FFIA 2DGSA 2WB1D 1UMKA 5KFWA 2CPZA 2K06A 3HAGA 2H5IB 2JZ5A 3OBIA 3I0RB 1MWQA 1LWEB 2X7IA 3QGHA 3ZBUA 2RDJA 2Z2YB 1R6VA 4DK1A 2GK7A 4GKKF 3MMBB 2CG8A 3SEJA 5HMZA 1HNIB 1IBMJ 4DV4J 4L76A 1A7GE 2ZUAA 3N6MA 4ECZA 2AHOA 1DARA 3GIRA 2UVRA 5HROB 5KT6A 1TL3A 4I7FA 3UI3A 4JV0A 2WONB 3M8PB 5KT3A 3T1HJ 3N79A 1FX2A 3VF0B 2MZQA 4G65A 5EHHA 2GGPB 3UN5A 1BX1A 4P7VA 2G0CA 1NDCA 1PYSB 5HO4A 3OQ2A 4HYKA 4RW8B 3F73A 5D0GA 4N56A 1H72C 1RYSA 1V0EA 4AYBD 2DNPA 5C42B 1SV5B 4Z4UA 4ZLJA 2DPIA 1NJWA 2KFNA 4CLYA 3MM5B 2MQNA 1V0FA 4HI2A 3CDEA 3RG6A 2OPPA 3NWRA 3DFEA 5K8PA 3DLBA 2L3MA 3VQSA 4ES2A 3LP1A 4B4DA 3KK3B 4YAOA 4JUZA 1JNYA 5L38A 2OTLB 3FNNA 2QTZA 3FJOA 1EFCA 5HP1B 4TU9A 2MQPA 2ZH2A 2JLGA 3WBKA 2DPJA 4YAFA 2HBYB 3U02A 4R5PB 3D68A 3Q38A 1B70B 3KLIB 5B7WA 4H4KC 3KUHA 2MGZA 4NXNJ 3MAQA 4LR8A 3PYEA 4UOHA 2IY5B 1EX8A 3D28A 4ZCKA 4PWUA 2ZJPQ 1WEYA 2XQCA 2UUCJ 3N6NA 4X4QA 2ZE2B 1GMVA 1VQPS 3PHTA 1OPZA 1OB5A 2UXBJ 4XR6A 3NBPB 1E6VB 3TI0A 1EETB 3NXZA 1X9MA 5KG2A 4P6VF 3QFSA 1K8AT 1RAOA 3K5PA 4QU7A 4Z4RA 3OZUA 1GR1A 3SFUA 2F8EX 4I2PB 3A8EA 4TQRA 2CJ9A 2M2BA 4Y65A 3CP8A 1KK3A 3MWBA 4OYOA 2OIHA 3QMQA 2CPJA 4HTIA 2V8VA 3OT9A 2VV5A 4PG5A 3AD8C 1UA1A 2ALYB 4FF4A 1WTHD 3M7VA 1FERA 3LVBA 3VAIA 2XZWA 4KGKA 4E0DA 2B4VA 4OJ1A 4DPUA 2P2CB 4TMVA 2KT5A 1DHMA 3BM7A 3FEZA 3VR1A 2CJYB 4BCAA 4OYPA 3SV4A 2AZ3A 2JX2A 2OTJB 4NYPA 3L95X 4GC6A 2V94A 4GO7X 2JRSA 1DTQA 4HT5A 3J81j 1RHQB 4QW9A 3BYPA 3F56A 2C22A 4XLAA 4X66F 5I3UA 2CWKA 4X0CA 3MMAA 3DKDA 2A0FB 3OL6A 3PZPA 1FDAA 4M5JA 4TVAB 1EP3B 4PGOA 1NHUA 1P9YA 3RW6A 3MZIA 4OYIA 5A6PA 5LT5A 2QFIA 1NH7A 3HDSA 4YB6A 4OZJA 1NDPA 4QOTA 2QMWA 1SPBP 4DV0J 2ZZMA 2FHMA 4CTAB 3CCEB 1KLMA 1RLCL 5DQIA 1D8TA 3FUYA 4QZVB 3OKXA 3MD3A 3NMAA 1KFDA 4DL6A 4YOEA 1FWPA 1JJ4A 2I5JB 3BS9A 1S49A 2HRTA 2MKSA 1SKUB 3ISNC 3H5XA 4HACA 1BQMA 3VGVA 3W2FA 3TJ9A 4C8ZA 2QX0A 4PQUB 4P7TA 1UPMB 3UO0A 4LRFA 3RB3A 2A6MA 5EGYA 4WFYA 1FRJA 2C2NA 4OPSA 4ASUA 2HNYA 1FFWB 2W9CA 3SCKE 3BYRA 3GE9A 2OFGX 3HO1A 4RD4A 5HKKA 1VHFA 3FZBA 3X3UA 3DMJB 5CAAA 5AXMA 3THVA 3R2DJ 3D66A 4HE6A 2CQ3A 3W5YA 3KL9A 1T8EA 4TT3A 4ZVPB 3N9UC 1QGAA 2KN4A 4J9UE 2HHWA 1FRKA 3M1VA 3MM7B 5E3RA 4EU0A 2AT1B 2GHWA 3W2EA 4FYXB 4EO8A 2O66A 5T7LB 1SQGA 1NKCA 2CNNB 3AVXA 4Z4TA 2E5LJ 2AGPA 2N7CA 3JSMA 4CLLA 1RTIB 1AFIA 1WG5A 1JLGB 1CC8A 3VGSA 2MZTA 1RHKB 3TWZA 3N4WA 3MOJB 2NQPA 3ASPA 5L46A 1S4EA 4AQYF 4CLUA 4TYAA 2MQMA 5HLFA 4C8MA 4X4SA 2CDQA 4JI3J 2I6WA 1T9VA 4RNFA 3HKZD 4DL0C 4ROXA 1Y0HA 1EKSA 4UF4A 3VGUA 3CD6B 4PC2A 1TFWA 4B43A 2ALZA 1KTQA 1U02A 1WG4A 3A3GA 1VQYA 4P9SA 2HK3A 3PJWA 2Z57B 3IS9B 2BRLA 1J9ZA 3NE5B 2QTWA 5D8HB 4ZIVA 4DL4A 3AT1B 1SC4B 1RA7A 2EXUA 4KBIA 2ZNZA 1NKEA 4UZEA 3US5A 2EEYA 4ECXA 1RT5B 3IRXB 3KLGA 2IDLA 2ZDOA 2OD4A 4H4MB 3CCSB 3JTPA 1N4LA 1S0VA 8RUCA 3GR0A 4OZ3A 2C2WA 1N32J 2Z2ZA 2IJRA 2QL5B 1WC3A 2OEMA 2DRBA 2ZKUA 1JK9B 1NH8A 3C15A 2OBSA 3CIMA 1D3WA 1RLDA 3OL7A 5A0YB 2R2UA 1RT6B 1XQIA 2X53S 2IJFA 2MB0B 4G1QB 1REVB 1TKXA 2CBXA 1N5SA 4M94A 4E8UA 2L41A 1KRPA 2B6AB 3CC7S 4DUZF 1FTCA 2ROPA 2ZWPA 1SKWA 5ETOA 4I64A 4DWIA 1TVRB 2HBRB 4J9RA 3TZWA 1S5ZA 5L1LA 4B3GA 4OYWA 4DPTA 2FJEB 1KEKA 1R0CB 2V2KA 3OTBA 2ERRA 1D09B 1H8EA 4FS2A 3PM9A 3V2UC 5KG0A 4NLRA 4KKOB 2Z4PA 3CD5A 2RKIA 2XG8A 4X64J 1SL2A 4HDHA 3A3BA 3MUTP 1UTAA 1QSYA 4ICLB 5L39A 4DQSA 2AJ4A 4NLPA 2CIMA 1NK5A 3HHLC 2UZAA 4LRBA 2YNFA 2E1PA 1V5VA 4LR9A 1TK5A 4EUVA 4J9OA 2MZRA 3AVYA 3AFGA 1BQXA 2HVIA 2LA4A 3BR8A 1FKAF 4DX6A 1FXLA 1OGJA 2YPYA 4PRFA 1PCAA 3DDNA 2BQUA 1VQSA 3PA2A 4ZVFA 4DV2F 2O01C 3Q6QA 1SBRA 3OV7A 1RWUA 2B43A 1KVKA 4DR2F 2FX3A 1YLXA 2NYIA 4GRSA 3K0JA 2D9PA 2XLJA 4F2SA 3AXMA 5BYRA 1B23P 2LMIA 5CDFA 2LU2A 1JJHA 1N34F 1RI7A 4M5DA 4J9QA 2BUNA 1JLCB 4RNHA 1N8RT 2ZHBA 4K50A 2F9DA 4B3MJ 1R0BG 1C0UA 1UD3A 2EKYA 1FJGJ 2E5IA 3FMBA 3Q2SC 4CNYA 4RLZA 3GR1A 2QMUB 4ETZA 4RNNA 2HWTA 4II2A 4RDJA 2GJPA 4USWA 5IXUA 2FLLA 2OYNA 2W4PA 1YJ9B 1IBLJ 2I9SA 4C9DA 5CD4H 3WX8A 3J80Y 3P96A 3NS7B 2VPYB 3GCXP 5HMWA 1EFTA 4LC0A 5L1IA 3V6KA 3M8WA 3KJVB 2F1FA 2BJEA 3IC1A 3CE8A 4FVCA 5AXNA 1JLAB 4KHPJ 2QC3A 5CH7B 5E3QA 2XCAA 2ASJA 4EK2A 2W9AA 2DCUA 2BE9B 3GFHA 2OK8A 1BUXA 2DJWA 4C4WA 1DQAA 3QNWB 1CJVA 4B9VA 3TX8A 1RADB 1FWLA 3CP2A 4OFZA 2R4FA 3ES9A 3QSYA 1CJUA 4HEA9 3R7BB 2OEKA 3OLAA 5KSWB 5KG7A 2MKHA 2XNQA 1X4CA 4B3XA 4XLCA 3FKBA 4KJIA 2NZCA 1L3SA 4F50A 1LNQA 1R8BA 1NJID 3K5OA 2KKHA 1KOOA 2GQFA 1L5UA 2FJDB 4J0QA 4ED2A 3NGUA 1TR0A 2CDRB 3CCVB 2EFQA 2WTFA 4YR2A 3FBCA 1U1RA 1GMWD 2IC3B 3NGTA 1MABA 1P8GA 4KGZB 3N5BA 1TLLA 1QAYA 2DH8A 4HVZA 1RAAB 3IGNA 2QA1A 4OX9J 3W5HA 2NYHA 3GLJA 1SL0A 4PWDB 4DR4J 3KLVA 3T19A 2B51A 2IBKA 2ZC4A 2LU1A 2F63A 3I1FA 1VJQA 2GAGC 1UFLA 4D3GA 3C6TA 1PKUA 1RAIB 2PMDA 3MMPA 4LF9F 4NA2A 5A8RA 2I8EA 4HR2A 1PC5A 3P26A 1K1SA 3K57A 2J9DE 3GVJA 3ICLA 2YPZA 3IGVA 1RAHB 1S1WA 2OTJS 2B56A 4JYAF 2QV6A 4AF7A 1X60A 1XNRJ 4R8UB 4OZ5A 1X4BA 2QA2A 3FFIB 4LRDA 2ZM6J 2QFJA 2CPFA 4YQWA 1CQMA 1RT4A 1X5TA 3G86A 3OFEA 1FJ7A 2FJWA 2DNKA 5ETVA 4UOGA 4B47A 2ZBPA 4OHYA 2CJAA 4XN0A 2DY9A 1URNA 1VQKB 2HLDA 1M1GA 5E7OB 3TA1A 3W9IA 3EDQB 4LBPA 1KFSA 3TANA 3FK4A 1FDNA 2V6AA 4YP3A 3DOLB 2DGXA 5DG8A 2BOAA 3HX9A 5D4NA 3V6DA 2DIVA 2M7SA 4P74A 2YWGA 3FZ2A 3PX6A 4ID5A 1FRIA 5J2NA 1O8BA 3MMCA 4DJBA 5KT7A 4KYZA 3P5BP 5KFHA 3DLHA 5IK2A 1UJ4A 2C2ZB 2PC6A 6AT1B 2F4FA 5D3GB 1JQGA 4I7FB 5D0EA 1PILA 5HSPA 4CO4A 2JH3A 5AJ3F 2D3NA 4C2MA 3R27A 1HHQA 3BGRA 4JI8J 1GFWB 4ITSA 4IDKA 4FNHA 4DS5A 4J9SA 2HMIA 1HBNA 4M2LA 5D0HA 1NRKA 3BV8A 4HE5A 4PQAA 4BWMA 4C8LA 2B4UA 4DG1A 3R7SB 1N5VA 3K17A 2KG1A 3P6YC 4QU6A 4XN3A 2XSFA 2HDNB 4RBUA 2VIHA 2DY1A 2CQBA 2Q1LA 3BQ1A 2DNHA 3TEHB 1WEXA 3MAAA 2OBTA 4P25A 4MK8A 5FL7A 2D3O1 1KC8T 3ULHA 1VQ7S 2MGZB 2IHR1 2MY8A 4IFYB 3DLGA 1UD5A 2ACMA 4W98A 1R43A 2FLPA 2ZBRA 2B0GA 3MUMP 2BX6A 1C1BA 2M88A 3NKYA 1PJ7A 2X1FA 1FCAA 3T5KA 2HHTA 1HVXA 2XNCA 1GO2A 4FPRA 2WAQD 3ONQA 4ED3A 3VCDA 2ZEJA 2MSTA 3H9NA 2R8KA 4NLYA 4DR5J 3KLEA 5LL6d 2HHHF 4NLXA 4ILRA 4P71A 1UPPA 4EWTA 3DNCA 2DNGA 3T6BA 4WXWA 1CG2A 4RL1A 2KM8B 1T3OA 9ATCB 3A1YG 4BS2A 4RDLA 4ZP7A 5E5NA 2AYMA 2QRRA 1G7SA 1EWYA 4OYXA 1YSJA 3DGVA 1CEZA 3Q8SB 5HZBA 2Q79A 4NWBA 1AB8A 1MN7A 5KOWA 1RE1B 4I6WA 2IYIA 3OVAA 2M70A 9RUBA 2F4VJ 1GVHA 1Q95G 4FNIA 1F3VA 1Q86D 4M53A 4X65J 3A3PB 4DLGA 5RUBA 3QAEA 3WY9A 1U1OA 1RBAA 3K7RA 1F6TA 1ZBTA 3JXOA 2JVRA 4ZP8A 4RU9A 4X8IA 1W9XA 4B44A 1IQTA 1QUFA 5KFLA 2W2NP 2HVDA 5C7PA 3SI8A 4DFPA 3O8WA 3PVXA 3CUNA 3L9ZA 2XMJA 1E64A 1D8ZA 3QQCD 1U1LA 2IA0A 3SDEB 2E7XA 4ZVRB 2HLTA 3GV5B 5FD1A 1U1NA 4UTGA 4JBCA 2ROEA 1RAJA 3OTOJ 3HCXA 3OVBA 4PABA 1FKOA 4J9MA 1WU8A 4OZ0A 1VRUA 2VKRA 4EO6A 1ZETA 3I4HX 3HHKA 3IR7B 1APSA 1D0EA 3TA0A 1IM4A 2Z0GA 1HNZF 4KV8A 1FEEA 4TSFA 2C2MB 3ZIAA 3HFKA 1VBYA 3QT7A 1WF2A 4IH6A 4DSIA 3ZZTA 4FF2A 4LFBF 2RE1A 1FX0A 4USMA 1N5YA 2XS2A 1QUVA 2XMTA 4HACB 1BQMB 2UXDF 1DQ8A 2W2OP 1XQBA 1VGYA 4FP9A 3B54A 5DLFA 1KK1A 2C3UA 2CNLB 2JFDA 3CMES 4RDKA 4ELTA 2R2SA 2HNYB 1PJ6A 2DRAA 3GILA 3BR9A 4JI4F 3H4DA 3BY1A 1D9FA 4KFBB 2HNZB 1W0JA 3G87A 2UU9F 2LQBA 5D4PA 3P49B 2E29A 3PKYA 2F9JA 3V4MA 3H59A 2K7JA 1T6YA 5LMUJ 1I3OB 5F9NA 1VQLS 3DOMA 5KFNA 4Y2AA 5KFAA 2HGLA 1E3XA 2EFPA 4TKOB 2GJFA 2P6SA 1TP7A 4IOBA 2EWHA 1QSLA 1U1KA 4X4OA 2FVPA 1N6QA 2VJIA 3CCRB 5KFQA 2E5JA 4IO1A 4X4RA 2OPSB 1TVCA 2FJAB 5ETQA 3MCAA 1MMLA 4QIEA 2V8PA 1TAQA 1HIYA 1IXKA 1YBTA 5HLFB 4KH1B 2A18A 2J8SA 1F3FA 3ILJA 5KT5A 5IS2A 3AH6A 3MCOA 3HSZA 2HPUA 4NA1A 2ZZFA 3GG0A 3R5GA 4QWAA 4X4UA 4H4OB 1R5OA 1VDHA 3LGNA 3NRBA 1B7YB 5TV2A 3BEGB 2VU5A 2DHHA 3QLHA 4F3MA 3ZC3A 2MZSA 2DGOA 3BQ0A 2HHUA 3NNAA 2ZBIA 4IG3B 1JNRB 2ZXIA 3HJFA 2PN6A 1A8PA 3BDPA 1Y0RA 3KLGB 3ZZPA 3OD2A 1RDRA 1H85A 1K0VA 4RD3A 2N3LA 4P72A 1B0TA 1Q1KA 2C3PA 1X4AA 4A8SA 2XGJA 2GO9A 3C15B 5HMYA 1U4BA 4Y2MA 2JOQA 3WIVA 4F0KA 2XMKA 1DG1G 4QUZA 2AWZA 5DQHA 1CNFA 3M9MB 3P8BB 2GHPA 5A2QY 4ECSA 1TKXB 4YEJA 1CPZA 1D1UA 4HL9A 3LP0A 2M52A 4OLOA 5J2PA 3CCVS 5EUHA 5F4JA 3NCPA 5SZTA 5FDLA 2WYRA 3DXBA 2I1RA 3H94A 2DHSA 4OI4A 4TNOA 3KJNB 5HBMA 4RNOA 1AA1B 4N3GA 3T41A 3ZZ0A 3IFEA 2B4PA 4ZJLA 2RKIB 1T95A 5KFUA 2DH9A 3K5MA 3I55S 4IG0A 2C42A 1SH3A 1NK7A 3RUBL 2CF4A 2YKPA 4MMOA 1R8CA 2YNFB 4YS2A 5DRKA 4DSFA 3QO9A 4DV6J 3WZ0A 2HVEA 3PO5A 4JI1J 4K4TA 3KK1A 3CC2B 2R9LA 3H0PA 2C2OB 4X7DA 4PCQA 5H9FK 2VG7A 2PEHA 3WQPA 3SYZA 5LSRA 2E66A 2WRMA 1VQ6B 3UVJA 3BO3A 1K8AD 2OGUA 2DRDA 2VZ9A 4KO0A 3UNGC 1TL7A 4PEOA 3U6KA 2J7WA 3G82A 3RAMA 2CZ4A 5DS7A 1JB0C 1Y4ZB 2EFOA 3Q8RB 1C0UB 4LF8F 4CQJA 1KD1T 4G7XA 1W26A 2V2QA 2XZPA 3Q8UA 2K8GA 2VBSA 2GMJA 2CPEA 1QJHA 1XERA 2ZXHA 3NOCA 3JU4A 1W2BB 3U1LA 1S7IA 4DV7F 2J0SD 2JC1A 1EFRA 4ZJOA 4WBFA 3R5DA 1PC4A 5LMZA 2VBXA 4KIAA 4Z37A 3CSKA 3GPAA 3PFEA 4V1Ak 4M5HA 3P3DA 5IV3A 4TXSA 3SLDA 3OR1A 1VBKA 1CULA 3KMQA 1OMSA 3GFZA 2FB0A 4U6PA 2ZH3A 2UUBF 4EEYA 2VA3A 2DCUB 4QVJA 4U9RA 2B8PA 2Y3YA 2XB2D 4DF8A 4DFKA 1QD1A 1ZOTA 4MH8A 1DBDA 2BDPA 2KL8A 5KTQA 1CJVB 4K59A 2X1BA 3DXSX 2VODA 2AKWB 2R7OA 1RHMB 3ZFVA 1CJUB 3QSYB 2ZL5A 5KFFA 3UNYA 3D54A 1CC7A 4W4MA 4A8MP 3E8OA 2UVVA 4LFCF 1XMOF 5E3CA 1YITS 2MLXA 4X62J 3OP1A 2AYGA 2QA4G 2YH0A 3MMJA 3AD9C 4YAWA 1TKZA 2NCKL 4LBVA 2KHCA 2FHKA 2XGQA 2RU9A 2RSQA 2IAJA 2BF4A 2ZVSA 2PE8A 1FFGB 4CH1A 3EWGA 1QM9A 1S0NA 2C2EA 5KFTA 4DR6F 2BZ2A 3BBCA 3JQKA 4Z1MA 1RGVA 2BE2A 4WKRA 3K5NA 3G6ES 4ED7A 2DHGA 4QIVA 2AU0A 3QJJA 2FJBB 4Z2XA 1KRHA 1FK9A 3ZTQA 4DPXA 2O5DA 2GFFA 4XORA 2ATLA 1WHVA 2ZFHA 4AVZA 5D15A 1ZAVA 5ETMA 1JJCB 1VQOB 3M8YA 1ITPA 2CYYA 1U8SA 5BJRA 5A8RB 1S72B 4DUYF 3CXCR 3N5FA 2IVMA 3LA0A 4PG6A 3A8KA 2NPIA 3J81U 4DI6A 4LF5F 2HS4A 1N33J 3EXCX 1S1WB 1XNQJ 1IUJA 3PA1A 1Y3KA 4DQRA 1RBLA 2VICA 5KW9A 4HDGA 4K7QA 1G7CB 3LQ6A 3H40A 2R8IA 1YRTA 5A6WA 2LEPA 1I51B 4NRUA 1VC0A 5GV7A 1BMQB 4LF6J 4ILMA 5HQMA 2IM2A 1ZAWA 3MEDA 1XBWA 3L7PA 3FRYA 2CQHA 1M90T 2VH7A 1QTMA 1YJWB 3TJ8A 5HQLA 1F60A 4FYYB 2VBVA 4MKBA 2RF2A 5F0WA 1NB9A 4USUA 4F4ZA 1RTHB 3V6DB 2EC2A 4ID5B 5J2NB 3MMCB 1ZAXA 1KS2A 1V3RA 1SH2A 5GMKa 2FVGA 2AW0A 5BR8F 3OFHA 4WJBA 3IBCB 2OO4A 4JI7J 4EBEA 2PLFA 3TOQA 3G6YA 2HHQA 5IM0A 2ASLA 3C19A 3CTAA 5LMNF 1YJRA 4RD2A 4HH1A 2XI3A 2AJ1A 2FZGB 4IFVA 1UD8A 3BGRB 2ZITA 1VLYA 1XTZA 1UWBA 4B9MA 3G71B 4YMEA 3HFVA 4ZK7M 2HMIB 4GKKJ 4NLSA 1HW8A 1QY7A 2FC8A 3BPSP 3IM8A 5THWA 3NGSA 4Y34A 5A8KA 2KT3A 1RXOB 3Q23A 4FKYA 4FF3A 4DG1B 1CSJA 1B99A 4AXJA 1L3VA 4IRKA 4RW6A 2UUAF 1YWXA 5ETKA 4Q5VA 4ZVEA 1WOPA 2ZNYA 1KZLA 4FK8A 2QLWA 3FMWA 1FF2A 2X3DA 1Y00A 1I5OB 4Y7CA 3NWGA 1LOUA 2XSJA 1F9EB 5FA6A 1YX2A 4DSJA 3MI7X 3C16A 2GW8A 1SI9A 3DLGB 1FDBA 1EQ0A 5L1KA 2MKKA 3WNCA 5D4OA 1C1BB 3HJVA 3OPKA 3HP6A 5DG9A 5MLCV 1RAFB 5CYMA 2BN4A 1S1UA 1IKYA 1S1VA 4W90B 2DR8A 4CH0S 4ANCA 2AD9A 2WW8A 3Q8QB 2QLBB 2J5AA 4QW8A 2RNEA 1ZA2B 3JSYA 2W2PP 1QDUB 5HXBA 1FD8A 2XNDA 4ID8A 4USKA 5F8MA 3V6HA 2HLUA 1IKXA 1IBMF 4DV4F 1RT7A 2NUHA 1FT8A 3P27A 1SQFA 3MHPA 4F7DA 1Y11A 1D8YA 3FRZA 2EBEA 2CQPA 3VWSA 2A6OA 3T5LA 4FXVA 3FGVA 1C2PA 1CQNA 3HZEA 3WC2A 4V19X 3LAMA 2W8LA 3G8QA 4P6QA 1P27B 4WK3A 1RAEB 2FDNA 5DGAA 3T1HF 3MPVA 4CO1A 2MQ8A 3IWNC 1NMEB 3JTNA 1TMMA 2N4CA 1P9QC 1YIJB 4CRJA 4U7UD 4Z4ZA 4OHVA 4M5GA 4M5KA 2VFUA 4OX6A 4O4RA 5DM6Q 4DXLA 4GKJJ 3G6VA 2BEFA 1Q0NA 3CJTA 3HMJG 1WPCA 4RCZA 2IBOA 4OYBA 4X84A 1LW2B 5MAOA 4JMQA 1EKRA 5KFCA 4DL2A 2E1BA 4N7TA 2H3EB 1NB7A 1RACB 3DLKA 4ZPAA 5DDPC 5K14A 2VZLA 3MR5A 1VMBA 1YJTA 3W62A 1FKOB 1Q7YT 4XO0A 4RW9A 2F40A 5GADU 1Y0YA 4X4PA 1VRUB 1REGX 4NCGB 1TELA 3KG0A 2EK6A 2AGQA 1T02A 4NL5A 1C4AA 5C24A 4KV8B 4NXNF 3LO8A 2DNQA 3CD7A 2HK2A 5D6GA 4CZCA 1H0HB 1X9SA 3FBBA 2QN6A 3DDKA 4O3QA 2E9TA 4PYAA 4Z4WA 3OTEA 2UUCF 1KOHA 4P52A 1JA0A 5IT4A 2DK2A 2UXBF 3T9NA 3W1YC 3BSOA 2KT2A 3Q3AA 1YDLA 3QPIA 4O3OA 2R7VA 4MIBA 1T7PA 1ZM9A 3RBZA 1RP5A 4B9LA 4XLFA 2CXEA 3C3LA 2VOPA 1QUEA 2X6WA 2YNIA 1XMQF 2ZOGA 1OSDA 3HHEA 3TAMA 4I67A 1S7HA 3HHDA 3TRGA 2W6JA 3V4IA 2J6UA 1ZM4A 3CW2C 3R7NB 1YKWA 1LK5A 3LP2A 1H7XA 1QFYA 3DOMB 3HVWA 3OR2A 2FPHX 2V7TA 4OQJA 4OPOA 4DCOB 3POTA 1VRTA 4O44A 4ZPDA 3EGZA 2DCLA 1N6QB 3Q39A 1VQ4B 1CS4A 3ZZYA 3DRXA 3Q2TC 2LXFA 1HWJA 3SMZA 1A6LA 2E1MC 1ULRA 1C0TA 1KJZA 2KYZA 2WHOA 1K44A 5HN0A 1COWA 3P4UB 1HR0F 4OHWA 3TYTA 3UDCA 4DFMA 4TQSA 1NNDA 1WD6A 2HFSA 4XLHA 1KWMA 1DLOB 4D3HA 5J2MB 4ZPWR 1TV6B 3DRPA 4K2XA 2VASA 2CFXA 4K4XA 4WE1B 2PSZA 1WG1A 4IH7A 1P1TA 4IQXA 1FA0A 2RH3A 3G8SA 4O4GB 3KNAA 2R6HA 4I2QB 3M6VA 3MR6A 1BE4A 4R0JA 1JJ2B 3EICA 3HLUA 3M6XA 2F3JA 3QLHB 2V69A 4TLRA 1PIEA 2XZDB 1RQRA 1U2FA 1YLOA 4NMXA 2MKIA 5H1SV 3MF5A 3NY0A 5C25A 2LQ9A 1VQ5B 2PIAA 4NRTA 3PRBA 2WSFC 2K3IA 2XS5A 4CLKA 2JLFA 2B3TB 4DCPB 2BSAA 4NEYA 4NYZA 4AD6A 3K89A 3CCTA 1VJSA 3U27A 4EBDA 3AXKA 2ZZNA 2F7VA 4PG7A 2YNHA 1QG0A 1WWHA 1IBCB 3KLHA 1U1QA 2YKAA 4WQMA 1NEEA 5J2PB 2VD3A 3CXCB 1K73T 5FDLB 2V4RA 1S6PA 3FC9A 1WUUA 3CCLB 3IR6B 1GQEA 2K7KA 2MJUA 1HQUA 2JC0A 3BH7B 2QZ8A 4ZDNA 2FJVA 1S9FA 4CH7A 4PC7A 4RD6A 3M6UA 1IVZA 1FVSA 3NGDA 4KAIA 3W2HA 1HBMA 1D9AA 1FXDA 2E5LF 4OI3A 4IG0B 1SIZA 4YN3B 5ETTA 2KO1A 4TU8A 3NAIA 1KC8D 3J81k 3PX4A 1FJEB 2IMOA 1K0TA 4A8YA 2MXYA 4URSA 4QV2A 4NCBA 3ZBTA 3KK1B 5LJ5Y 1HWKA 1S72S 1OWXA 2AJ2A 4TMZA 2VG7B 4JI3F 3M32A 5K8OA 3PIPQ 4OX7A 1BQNA 1NSKL 1CLFA 3OFNA 1J2VA 1UA0A 1MLAA 3UVJB 3AD7C 1YJVA 3PW7A 3FQLA 2LYVA 4F0MA 1VQ9B 3EGWB 2ADCA 4OLPA 2ZBUA 4KO0B 3PW2A 4RW7B 1TL7B 3IXQA 1AZSA 4WPAA 4Y9UA 1DURA 3G82B 2V0NA 4FDFA 4QWDA 2Y0SD 2YWWA 3CJSA 1G7RA 2G2YA 1S1TA 4C97A 5DM7Q 4ED5A 1AFJA 4QYZK 2OK7A 5J2QA 2VFRA 1T9YA 3WC0A 5BSYA 2R8JA 2OI2A 4ZPCA 2VBYA 4HH0A 5KFEA 3JSBA 1N32F 1YJWS 1X0FA 2V7QA 1S79A 1KONA 3PUMA 5TY0A 1RCOB 3KUGA 1DAXA 4N3NA 2JFKA 4Y2CA 2QEXB 4C8KA 1A0OB 1SCJB 3OJSA 1S0OA 2EKNA 1Q8BA 3DLJA 4LBYA 2NXJA 4Z4SA 3JAMU 4RBVA 1JKHA 1H3DA 4RUAA 3WNBA 3C14B 4Z4YA 4PAAA 2D9RA 4U95A 1F2GA 3ET6A 3NEKA 1Q8KA 3OR1B 1CULB 3G96A 4ENOA 3AA8A 1N36J 3C66A 4ELVA 4NLOA 2BOPA 1KHWA 2W2QP 2ZL7A 5AT1B 3GYXB 4CO2A 4E2FB 1GAWA 1RT3A 4QFMA 1VQMS 1E6YA 4X64F 1RK8A 1YZ7A 2CPDA 2RIJA 5I42A 1L3UA 2XULA 2C4UA 1HHTP 1R0AB 2H4YB 1OPIA 1AW0A 5IZHA 1YRUA 1SIWB 2IMWP 4LJMA 4G7WA 5DETA 4K5RA 1WEZA 4DSKA 4N41A 3HF5A 4FN5A 1M5HA 3W2IA 4NASA 2LA6A 1U25A 1PBUA 3GFYA 2KRBA 4K0KJ 1TKZB 1T94A 4X4VA 4IYQA 4U67Q 1WORA 4Y9RA 2Y0BB 4P10A 3WX4A 3KJFB 4NZ7A 2IAJB 2KFZA 1LFPA 1TL1A 3AODA 4N8NA 4KHRA 3UDVA 3A8IA 1CQXA 2KM8C 2BQRA 3D67A 4LR7A 3AQPA 1XFOA 2BE2B 3AVTA 1B0PA 3D5MA 4L75A 4M5MA 5ETLA 2XCPA 4B3MF 2Z2LA 3GSDA 2WJYA 1FJGF 2HZVA 4ZLLA 1BWEA 4YY3F 1NO8A 2E5GA 3M2RA 1DZ5A 1AYEA 3B8HA 4G1IA 4DQKA 3MAHA 1NZAA 3ENAA 1YHQB 1YJUA 2UXCJ 4U7UK 2ASDA 3GWCA 4FXWA 1RT1A 2R7SA 1SQEA 3VTIA 4B3RJ 2H1YA 3DRRB 1RHRB 2BKPA 4B3SJ 1IBLF 1EP2B 1YJNS 3KFWX 1EJ7L 2DYIA 4WP8A 2VA2A 1KKHA 4DV3F 5DG7A 4NBSA 5IYNA 2C4TA 4Q7JB 1QE1A 1KBRA 1U6FA 5EWGA 5F0UA 2EC0A 2OP5A 2HQIA 4KKUA 1Q5VA 2NXCA 1AMOA 3CCUB 1YIJS 3BQ2A 3G05A 3K8VA 2MSSA 1LKZA 4C8OA 2N7YA 2JL9A 2CW5A 5U47A 4Y0FA 2YWHA 2XBPA 3KDNA 2R7QA 3MEDB 3B4DA 2BXJA 2JJ4D 2JEFA 2EI5A 2B9EA 2V8DA 4U7CA 1B0VA 2RF2B 2YKMA 4GMKA 2B7BA 1X5PA 1OB0A 2B9XA 4RNMA 2GS8A 5KFXA 1GAOA 2ZH8A 4JYAJ 4MAKA 2XYPB 4HKQA 3WBJA 3TVYA 4AL5A 3D0HE 4UY85 4G1PA 1JNZB 2U1AA 4NEZA 4IFVB 4E0FA 3GQCA 1G6BA 1HA3A 3UD4P 4Q0BA 1TUIA 1IR2A 1FDDA 5DSZA 3KG1A 3MM6A 1S1XA 4RPBA 3VAKA 4RJLA 4OX9F 3DHWC 1UL3A 2O1PA 5A8KB 4DR4F 2BW2A 2KFYA 2D7SA 3HT3A 1NSPA 1BY9A 1LW0A 8AT1B 2PEBA 2DNZA 1OB2A 3FPKA 3N01A 4RW6B 4OOXA 1Q82D 1HQ2A 3KLFA 3C6UA 3SFGA 4YELA 4M95A 1RTDB 2R2TA 3S01A 1BQEA 2CNKB 5KAKA 2CPYA 3QYYA 1EFUA 5IWAJ 3SQGA 3OJWA 1K47A 2EVZA 5DN6A 5CZVA 2XSJB 2VFTA 2L9WA 2H5EA 3UCGA 4F2RA 2H5JB 4UY8T 3U1MA 3C16B 3L3CA 2ZD1A 4QIGA 1Y3JA 3MEEA 1FEHA 3W8GA 2ZBQA 3GB0A 2GAHC 4P2MA 4B3OA 1F9FA 3H20A 3M8QA 2ZJQQ 4QJVA 3EYZA 4YR3A 2UUWA 5IQ6A 5GAEI 4N5SA 5CYMB 5F8NA 3MDFA 1JLBA 1IKYB 2JHEA 2ZM6F 1VBZA 2IFXA 3RBXA 4MJKA 1NK8A 2COLA 1JX4A 2LQ8A 4OYAA 3NGKA 1FRXA 2OSQA 4J9NA 3MXHP 2XI2A 4WYWA 4UT4A 4UUXA 2DGUA 3OXFA 4DU8A 1U49A 1RT7B 1Y5LB 2JEGA 1PKVA 4FYVB 3T6JA 2VNHA 3TA2A 3W5VA 1YGYA 1QVFB 1N48A 2HQCA 3ASSA 3G4SB 1M5KC 2Y8YA 2BGJA 2LXUA 3QFRA 4DV5F 3GU0A 1VQ5S 1WC4A 2HFZA 3PRDA 5CXTA 2AX0A 3W2WA 3W65A 1FRLA 2IYGA 2XO6A 3PW4A 3TAPA 4JV5F 1BD6A 1LWEA 2DGQA 5J3OA 3I31A 1NAQA 3PR4A 3GJSB 3RTVA 2DO0A 2GZOA 1JLEA 2OSRA 3UD5A 1HI8A 1RTJB 4UW2A 3NCQA 3MMBA 4Z7YA 1ICEB 2KI2A 2ZWOA 4GVBB 3L09A 1R8HA 2WB4A 4DHVA 2N4DA 3NL0A 2YQ0A 5KFMA 1WC6A 5IYQA 3QRQA 3I9ZA 1X4DA 3SCJE 1XN9A 3DHXA 5HROA 2DEJA 1HNXJ 3NOGA 2QA4S 2WONA 3I0SA 2BVZA 4XPCA 3RB4A 3TUIC 3K58A 3GP9A 2JN9A 2R42A 2GGPA 5IOLA 3AAWB 2H65B 4FPIA 3QZ8A 2QN6B 1RISA 4IQMA 3U7JA 1VCTA 4RW8A 3WHIA 5K20B 2F43A 5C42A 4WTYA 3B78A 2LVWA 4HHUA 4P2NA 1HWIA 3TUJC 5DO2A 4IKAA 3C8YA 4UOCA 4ECWA 1EP4A 3A8JA 4WFZA 2WSEC 3CMAS 2DEIA 4PYDA 1FKPB 3PHEA 1BC6A 5SUHA 4OOVA 1HMVA 2ZOMA 2M0GB 3DDYA 4DR5F 2MLZA 1MRZA 2ZH7A 3CCMS 2P9GA 3LW5C 4R5PA 3GVLA 1UW4A 2XO7A 4DLEA 1Z2LA 5FJ4A 4LQ3A 3V4IB 3A3NB 5L8RC 2R8GA 1T11A 3CULA 3LP2B 2CPHA 3NAHA 2UVWA 5A8AA 1VQNS 3PW5A 3OR2B 3DLEA 1WC1A 4ILLA 3FCHA 2CRVA 3T9ZA 3POTB 3R9LA 2BJ3A 2ZTNA 3NBPA 4G1VA 2W8KA 1CS4B 4X65F 4H9GA 1U48A 4XAKA 2HMAA 3HK2A 1C0TB 2HBZB 3JQJA 4RO0A 2CADA 2ZKTA 3OLBA 1GNKA 1UCNA 3SJPA 2QE7A 4LF7F 2FLNA 3JYTB 3GJQB 1XR7A 2WZNA 4URGA 1MU2B 2QSWA 4YXWA 7FDRA 3DRPB 2I0XA 1NBMA 1R5BA 1MMDA 4ERDA 3ELHA 3B82A 3OTOF 1YI2S 4DK0A 3GIKA 1WI6A 4LIRA 1MSWD 1T03A 5BXIA 1ZZNA 4OL8A 2AEJA 1E1RA 2YY3A 1QUPA 2BMWA 4OYZA 2HHPA 1Y10A 1F20A 2X3UA 1VS3A 1GXTA 3R6KA 1WELA 4ALZA 3UFCX 2OFHX 1AT1B 1RT2A 3UDLA 3R6GB 2V7XA 1NM2A 1NJZA 4F02A 3R6JA 1EIYB 2ZBVA 2DXDA 2KH9A 1YG0A 4YDDB 2AV5A 1N08A 4J5OA 4Q2LA 1UAWA 3RRKA 5T14A 4XQFA 4PXEA 5A76A 3MEKA 2WOMA 4XOTA 4P26A 4ELUA 2VONA 4F8RA 2XZTB 3EX7B 3CCJS 3AGQA 1W25A 2VG6B 2DR7A 3RGIA 3ZTOA 2MQLA 4NCNA 1RTZA 6FDRA 2L9DA 2VJUA 5LMUF 5HAOA 4OPVA 3QGGA 1NJIT 1HQUB 3TAQA 1JXEA 4WP3A 1RYRA 4IUFA 3BKTA 2E7VA 4PR6A 2IA6A 1HBMB 3J80U 2OPRB 1UD6A 3IRWP 2QLJB 5CYQA 2NLWA 2BBEA 3BGLA 5FIIA 2W01A 5EMNA 1TKDA 2VBTA 1XK8A 3HSJA 3TJAA 5H9FJ 4PG4A 1JXVA 2GJRA 3OPOA 2F8HA 4WCEQ 1VR6A 4O0NA 2LFVA 4OI1A 1MN9A 5I3QA 1OYDA 3GIMA 1E63A 4KKTA 3A35A 3DMJA 2WBRA 5IT9Y 3SV3A 1WSVA 3OSNA 2R7UA 4EBCA 3M32B 3J7A1 4F4KA 5C2CA 2G0JA 1AUSL 2V9WA 2X51A 1BQNB 3FQKA 5E3PA 4PZVA 3TQEA 1WOSA 2VNJA 1T9WA 2DERA 2EBGA 5KFGA 3MEGB 3HZGA 3VMFA 2XGPA 3HFZB 5LXRA 3CCUS 1ACMB 1RTIA 3CJ8A 2LECA 1S1TB 3A1PA 3EJMA 4GC7A 1DTTA 2RU3A 1NHVA 3QGIA 2MZ1A 1I94J 1CJKA 1RB0A 4NMLA 2KYXA 2HHSA 1U45A 3W2GA 2V63A 1NB2A 3AB2B 1S57A 1FRMA 3H4BA 3SXLA 3DI6B 2K2PA 3OUYB 3U1NA 4F04B 2W7PA 2FYXA 1SKSA 2HS0A 1RA6A 5FNZA 2VPXB 4P2SA 2HQ3A 4C3MA 3IS9A 1JKHB 1KK0A 4IR9A 4WZTA 4OZNA 3ET6B 4FZVA 2YVSA 2YWFA 2DIEA 4TY9A 5DZ7A 1HWLA 4TKTA 1FNXH 1T05A 1JLFB 2G0IA 4Q8EA 3PXGa 3OXLA 1FRNA 3H25A 3LPYA 3IRXA 4KE5A 3O44A 5DJBA 4JI6J 5M2PA 2FHJD 4WZEA 3TQ1A 3VV2B 1R27B 2BKNA 2ZZQA 5I42B 1TL4A 2CNOB 1KN6A 1RT6A 1V3SA 2XHCA 4C43A 4I68A 2BJDA 4P73A 2I2YA 2MHEA 3WXMA 3CVKA 1N5TA 4DV6F 1REVA 2KG0A 2OHDA 2RQKA 2B6AA 1IJFA 3BF4A 1GEHA 5CCLA 1RJJA 4U9UA 1RKJA 3MCMA 3BC9A 4LBWA 3DLLQ 1TVRA 2UUTA 3M4XA 3NLCA 4FWTA 1TUGB 2UUBJ 2H48B 3QRRA 3EPIA 3JSRA 1HBOA 4Q7AA 2KHDA 4I6YA 2JDJA 3CCQB 2HG4A 1TL1B 4C7QA 5JVGQ 5L1JA 3Q22A 2J0QD 1NDHA 2OTLS 3GONA 2DVIA 4YHHJ 3ZC4A 4M0LA 5K5MA 2NSBA 2CRLA 3L7UA 3CMQA 2V4JB 4O3PA 5M2RA 1X4HA 2XY7A 1KMHA 1WKKA 3QSIA 3GZ7A 2GJIA 5FLXY 2G13A 2FY1A 1QAJA 1HKAA 1DQ9A 1RT1B 1KR4A 1HYSA 3T5HA 4ECYA 4KHMA 5GAGU 3G4SS 1TK8A 4LVNP 4A8XA 4RPDA 4CP5A 4ZKAA 2F4NA 2ZH9A 2XM3A 3RRHA 2BJ8A 2QL7B 4A8KA 2V4QA 4LBHA 1RSCA 2ZVIA 4ZLNA 2P6TA 2RB7A 3TARA 3O2IA 1QE1B 1WTFA 3O3LA 1H2VZ 1JLCA 2PO4A 4XL9A 3MPUB 4B9SA 1WP6A 4G1BA 2GREA 2UV8A 1WF0A 2RC6A 3RR7A 3WNDA 2AMCB 3JTOA 1TU0B 3G6XA 2RMLA 4ACAA 4X7EA 1C4CA 1L3KA 2LEBA 2OD6A 3JS9A 1Q86T 3PNIA 4O0IA 1M1KT 5F8JA 1NKBA 4RLEA 4Q8FA 2YX4A 1W2IA 1KQGB 4DX7A 3LH2S 5J1PA 5KG1A 1BWVA 2VYQA 1KQSB 1IBKJ 3ZUGA 2RD5C 2H51B 5D4LA 4K4ZA 3MR3A 2HYIB 4AF6A 2MLYA 4LF5J 2CQIA 3B6BA 2QO3A 2VL1A 2QGGA 2C5HA 1NPRA 1SKQA 2ZH4A 3FEYB 4DL3A 1Q79A 3MFIA 2ZHOA 1P1LA 3D6MB 2X8KA 3Q6RA 2F5GA 3OEHA 3V5RA 2V5HG 4KT0C 1W7WA 1NPPA 2C2DA 1TQLA 3MGJA 5AN9A 3FSIA 4QIWD 4P2XA 2NXUA 4QWCA 5E33A 3Q86A 2C78A 2UVUA 4LFAJ 2EFVA 4Q0BB 1HQEA 3PDNA 1VK8A 1UVJA 3JQPA 4USJC 4KGXB 2PI4A 3MM6B 4Y28C 1Q81T 1S1XB 1IWAA 4MT1A 3ASQA 2HFUA 2DEUA 5KFBA 4TMTA 4C0BA 1GXLA 3VAMA 1T3NA 2E9ZA 2AHOB 3UCUP 1J5EJ 1LW0B 3CCES 4FXDA 4K4UA 3ZNJ1 1LWXA 5C5JA 1I1GA 1TL3B 3E51A 1T9TA 3N6LA 6FD1A 4OIXA 1H74A 2M3DA 3I56B 3SQGB 1R6YA 2RHQB 4WFXA 1UKUA 1E1QA 1U26A 1TK0A 3NP5A 1ZM3A 3E1YE 3H42A 4PWWA 5G4DA 2ZD1B 1RZMA 2B7CA 3CD0A 3MEEB 4EH1A 4LBZA 4OI0A 4UQTA 5ADZA 4MIAA 1QAXA 1U8WA 5KFJA 1W2BR 4L73A 1XNQF 2OPPB 2R7RA 1MMNA 3CCWA 1OSCA 2X1GA 4DQIA 4KPYA 3SKBA 3LP1B 3BKUA 3LQVA 4OZ1A 2KDOA 2BV3A 4XOPA 3J7Z5 1HNWJ 3EDRB 4PUOA 2LQ5A 4LF6F 1Q53A 5IQQA 3BN7A 3CT9A 5IT0A 2ABYA 3BSNA 1EQMA 3B4MA 1UJ5A 1XJWB 1UP1A 2B5OA 3V7AA 2BKOA 4DPWA 2XS7A 1VC6A 1HI1A 4CLWA 3CGIA 3VAGA 1SJ3P 2PMWA 3PYDA 1SC3B 3EGVA 2X3GA 2BJ9A 4JI7F 1GK8A 1OIAA 3CWJA 1UW9A 2HZAA 4J90A 4KQZA 5BYQA 3FBEA 2M9KA 4DCJB 4JI5J 3W2WB 3D0GE 2I38A 3IR5B 3J7ZT 3W9JA 2OH2A 3CD6S 1JLEB 2IIHA 2GNKA 3QATA 4P1VA 4XK8C 5KG4A 1S9GA 4JI2F 2HNDA 3PRVA 3X1LB 3OTCA 1VBXA 4O3RA 3IP0A 1EP1B 4XNFA 3DOLA 4J7CA 4FBTA 5F8HA 1FNOA 3TR5A 4LQ9A 2MHNA 2GCFA 3CNQP 2WSSA 5HI7A 2HW3A 2RC5A 4ZPVR 1NPKA 1H2TZ 3CCSS 2B9YA 1RABB 2OELA 5D3GA 2KB2A 3HVRA 3M8SA 1DTQB 3I0SB 5LM7E 4GVLA 3KHGA 2WVBA 2AZ1A 1QAIA 2ZUGA 1JB9A 2NS1B 4QVAA 1S9EA 3R97A 4WF9Q 2KZZA 3PVDA 1YQHA 3W60A 4J91A 4F36A 2G2OA 2GX8A 2JNJA 3PKMA 5I3UB 2C1EB 4RWWA 2RJZA 2LKZA 3MMAB 4ANDA 3LF0A 4KB7A 2IVFB 4V19J 1SH0A 1BJKA 2IVYA 4EZ9A 2CQ0A 4DBQA 3R1HA 1N06A 1EP4B 2E5HA 1LK7A 3F0NA 3S1TA 4AUKA 3R6LB 4IR1A 3M8RA 1HMVB 2LEAA 1KLNA 3TNVA 4XMYA 5GAGI 1QX4A 4J9LA 2D41A 4DSLA 5IYRA 2LZJA 4EFAC 3PUNA 1KLMB 3OL9A 3ILIA 5AE1A 4MKYA 3ISXA 3W5XA 2DD8S 4XDDA 3LAKA 4M63A 3JB9k 3D7SB 1S97A 4DF4A 2L9NA 3QIDA 1RWOB 2YQ3A 4IFYA 4CO5A 1FFSB 3V81A 5IC6B 3JQMA 3KJQB 2W2MP 2QG9B 3VNUA 2YKOA 2DTJA 3DLEB 2DO4A 2GVDA 2BYCA 1WI8A 5A2QU 3MPDA 3UQSA 1U1PA 5KOXA 4DPOA 4KGMA 2W9CB 3ADAC 2AYBA 4MK9A 4BLGA 4ED1A 2DNNA 1K9MT 1TKTA 4NXMJ 4DUTA 4K4WA 3HD2A 3TX0A 5CD4A 1XMQJ 3GJRB 3LNNA 5HZAA 3SQOP 4Q2MA 3T51B 1M1HA 1FRHA 1VISA 4GKJF 2KU7A 4WZMA 3A13A 3M1VB 5KFRA 2R8HA 1JIHA 5K8NA 4YR0A 3H5YA 3MPYA 5ETNA 2G1DA 3K59A 2R2RA 3SBMA 4I6AA 1PYOB 2XZLA 4QWBA 1T03B 4X2BA 3JSMB 1CBKA 4HTJA 1T0TV 1HD0A 5M2UA 2V34A 3OE7A 2ZBCA 4QR2A 3S7RA 3KHHA 5DS0A 5A8WA 2Y1JA 3QBCA 1YBUA 3HM9A 1X7VA 2VQFJ 1RT2B 2ACYA 4PC3A 1P6TA 4DV1J 4N76A 3AVVA 2RQCA 3OJXA 1HR0J 1YJ9S 2QIFA 3AHPA 1SM4A 1XE1A 2J6SA 2P8IA 2CJQA 5FO0A 2PMHA 3FCWA 4BDPA 5E6TA 3OHBA 3AB4B 3SDEA 3RB0A 2XTJP 2WOMB 3G8TA 1JXLA 4BHQA 1RWPB 3D6TB 3GVKA 3CCZA 2OUGA 4RKUC 2NPFA 2ZZGA 2J76E 5AE2A 1U0HA 4LSZB 3DGPA 4X4TA 3VAFA 3KOAA 2V67A 5L9NA 2CZ9A 1NDKA 2WZPP 1RWKB 4ZPBA 3SSRA 3W5UA 3H2LA 5F41A 3QRPA 2Q6LA 3EUNA 3BO2A 3CCQS 3M9OB 2R3VA 5CABA 3I5AA 4FF1A 1KNZA 4AL7A 5EX3A 2MMYA 1HFEL 3PX0A 3PYGA 3O6QA 4FYDA 5IC4B 3GCWP 5DQGA 3ETMA 3HD1A 1T6XA 4UZCA 5CYQB 1AUDA 2CQ1A 2Z58B 4II3A 5E3AA 3HI9A 4A4JA 1OY8A 2APOA 2FVRA 1IN0A 1FE0A 3MR7A 4CQ1A 4NOHA 4F25A 3CMMA 3GJTB 4KFBA 5EWEA 3FCVA 1WKJA 2HNZA 4DR3J 1FDRA 3MCNA 5AE3A 4HHHA 4F4XA 5IV4A 4ZMMA 1M0SA 4B3TJ 1SXLA 2WJVA 1VQ7B 4G6IA 1S12A 1HNVA 4WU2A 3GQBA 4B02A 4QYZJ 3CEDA 3IO1A 2VBUA 5KFZA 2OPQA 1H6KX 4EGLA 2SXLA 4TN2A 4ZJQA 2OPSA 3SIPB 4QWEA 2W7OA 1KP6A 1U09A 3PEHA 1DTTB 5CQGA 2RUSA 3I5BA 1KHVA 1CJKB 2HURA 3DRYA 3T56B 3AOAA 1N5QA 3OFGA 5J1NA 3SSQA 2V4DA 5HJXA 2MQQA 3BNWA 1Z2ZA 3CJ0A 5DDRC 4NI2A 4DZDA 3OL8A 3E20A 4RJVA 2DNRA 5HVGA 1P4MA 4NYOA 3FSXA 3L4BC 4H4OA 1HLWA 3I6PA 4M5DB 3HSDA 3HHNB 2UP1A 2VQEJ 1YZ6A 4XPEA 4B9NA 2FIUA 3GFXA 2YX1A 3MPWA 4ZVGA 3MM8A 1HHSA 2YTCA 4H4KA 1EB0A 4IG3A 3DCAA 1T05B 1VQKS 3ZPNA 3KHRA 2PFFB 1GX5A 3DN9A 3CF5Q 4JOUA 2E9RX 5H59A 4ZN1A 4HI1A 3SSSA 3DYAA 4ZVHA 1Y9OA 1IKWA 3CJ5A 4WTOB 3CO0P 4OZ2A 3CIZA 4YEAA 3BZQA 1F0XA 2RQ4A 3RW7A 2FLOA 4XLEA 5KFVA 4NLWA 4C0HA 1W0KA 3I56S 4KC5A 1MWYA 3F44A 4P12A 2QJ3A 2FGCA 5G0RA 2E44A 3BH6B 1IJFB 1F5CA 2IM3A 5I4MA 3LQEA 1UVMA 4IW3B 3KWMA 4DR7J 4OJGA 3NNCA 1LWFA 3IAS9 3IAM9 2CPXA 4MTPA 1HBOB 4PKDB 2FC9A 3D1OA 2Y9HA 5LSOA 2Q3PA 2QL9B 2Y1RI 2DXFA 2HEKA 3DOKA 2AIRB 1XEZA 2VDHA 3W2VA 4XKWA 1MROA 1UZHA 2CVEA 4LF4J 2J0XA 5A89A 4AL6A 3R1LA 5HQ8A 4RD1A 1ZM2A 3CMEB 4YB1P 2VC0A 3LO3A 1JJ2R 2BJ7A 2R7XA 1FI4A 2A3JA 3OW2R 1NK6A 1BMFA 2RRBA 2QSFA 1RWXB 3Q0AA 1SVDA 4DU7A 1CNEA 1DY3A 3WQZA 1HYSB 2FY8A 2Q6OA 1Y7PA 3D1HA 4M1KA 3I4PA 1XR6A 4B9TA 1VQLB 4ZIWA 3W8PA 4X4NA 1M5SA 4BC7A 3H2VE 2B9WA 2GHVC 1S10A 1IJEA 3D4JA 1ZUNB 5A88A 1WC5A 1N36F 3D3BJ 1QVGR 4OI2A 3BO4A 2VKZG 2IM1A 1WC0A 4QR0A 5TR9A 4Q45A 4OJ3A 1NZ8A 2U2FA 3AGPA 2V2ZA 3D0IE 3C6TB 4JI0J 2IM0A 1H7WA 4YY3J 1PAUB 2KJWA 1HI0P 3ILLA 3ETOA 3IA0A 2ZH1A 3AVWA 1H38A 1WTBA 3HVTA 4RUBA 3V76A 3T1YJ 1RKIA 2Z30B 1S6QA 3PYFA 2HAFA 1JLQA 2CQ2A 1FRQA 4K1XA 3UR0A 2EG1A 5J1EA 3NGRA 4DV3J 3UN3A 3BY2A 2HQFA 3RJMB 2Y8WA 1GJRA 1PG5B 4ECVA 4K0KF 1RT4B 4C11A 2VJVA 3G2XA 3G9CA 4ZN3A 3ZNUA 2PE3A 4CLFA 1S4MA 4X7CA 2Q6KA 5B0AA 5DZ6A 3DRSA 3J7AN 4I4BA 3AJ1A 1I6JA 2Q6BA 1UMJA 4FKXA 2BE7D 1YRXA 2M5SA 1WJ9A 1HQEB 1UEUA 3ILOA 3I9V9 4X06A 4JV2A 4LSNA 3HVAA 3QJLA 4FYWB 1E62A 3GMGA 4G5GA 2V31A 4L72B 3Q8PB 4USVA 3EPGA 2WW4A 3IG1A 3PO4A 2YNGA 2DR6A 1SC1B 5T41A 5EDWA 4DPYA 3OXGA 5IFMA 5B0FA 4URQU 1GAQA 2PA8D 2UXCF 4IOAQ 1WOOA 4YHBA 4W92B 3I82A 2QMXA 4WKYA 1NU4A 3QFTA 2H54B 4B3RF 4IDKB 4TY8A 2BJ1A 1U0SA 1HBNB 4B3SF 4ZPTR 2B7CB 1M5OC 4KKSA 1I18A 4CI0B 5EWFA 3ZZOA 4ZCIA 2HFOA 4UUWA 2ILYA 4P2FA 2OAUA 3U2QA 1S4FA 2MQOA 4F67A 3I55B 1TTHB 2IDEA 3MAAB 2DOGA 4PUOB 4DR1F 1PSDA 4KGVB 2FHJA 4F26A 1RU2A 3TUZC 5JUMA 2QYCA 4WU3A 1NSAA 4ECUA 4C0SA 3H98A 3E01A 1T6ZA 1XC9A 1U47A 3IBWA 3CCRS 4B17A 1F9HA 3W5ZA 3CJQA 2XHWA 3JQQA 2YWEA 5DDQC 3QIPA 4L6V3 2XWXA 2W25A 3NNHA 4WZKA 2FHOB 1G7CA 1LXNA 4TMXA 4LBIA 4N47A 1QSSA 2GVZA 4C3KA 4E98A 1PYTA 5GV8A 1D9DA 1FE4A 5IYPA 3KLEB 1XR5A 1RUSA 2W9BA 4YFUA 2V7UA 8ATCB 4FXUA 3PEJA 3CPWR 1UJ6A 3J7YU 2ZH6A 1S9GB 4YUDA 2N3OA 2V8HA 4NLQA 1KVJA 4M4SA 2HNDB 3HHLA 2QE5A 1N8RD 3MTKA 2Z56B 2A10A 5KT2A 2AJ0A 2ADBA 1Q8LA 1RTHA 2FGOA 1T5EA 3EMTA 3THTA 2LLZA 1VYAA 2C2RA 5LJ3Y 1U6ZA 1PAEX 1KDNA 4OZLA 2YH1A 4F7VA 4RW4A 2FZKB 1LWCA 1LEOA 3BBBA 3F41A 4DV5J 2WK4A 3O5TB 4C8YA 2N82B 3H2UB 1LV5A 5IWAF 1FJCA 4PC6A 3AOBA 3UN2A 3CO9A 3OEEA 3VVUA 1O6XA 2H4WB 2M8HA 5C2GA 2ZC3A 3KK2A 2XEXA 4C6AA 4JV5J 1S9EB 1HD1A 4NE9C 4KRWA 1VI7A 3CC4B 1WHXA 4DDFA 3D26A 1JMTA 2GMLA 1RBOB 2JDIA 2HHVA 5AXLA 1S0UA 1NBEB 3THPA 3RAQA 4CLSA 3ZTSA 2ZL6A 3D3CJ 1SKYB 4B3FX 2K1RA 2YX7A 4NCAA 4LUBA 3LWLA 4DQPA 2VB6A 3EZ5A 4DSEA 4Z7CA 3MR2A 1YITB 2KXHA 3VR6A 2F8MA 1SL1A 2CVIA 4ZHRA 4MKVA 4C0OC 4RM0A 1WACA 3KHLA 3V81B 1SUQA 4F3QA 4LMZA 4X66J 1N5YB 1OQ3A 1NHKL 4LRCA 3KNGA 3Q83A 2WZ1A 3H7HB 2GVDB 4ES1A 1ELOA 3QT8A 5HJYA 2FUG9 4U8YA 2VUGA 4XM3A 2XYHB 4WZQA 3CC2S 2J0WA 3BSCA 2I1LA 1BHNA 4QHYA 3UW1A 3QFHA 3G6EB 3FJ2A 1Z1ZA 1TKTB 4IRCA 2EPIA 1VQ6S 1QFZA 1QLNA 2Q43A 3DC2A 3SCIE 3I87A 1R3NA 3RU0A 1HBUA 1BLIA 1Z4UA 1RHUB 1NJYA 4MYTA 1SKRA 1DRZA 3GYNA 1GMUA 3H90A 5CZXA 1YBAA 2DR5A 2JLEA 3RBDA 1UFKA 3TZZA 2DKOB 1OY6A 5LSLA 4NPOA 4IOCQ 5JMNA 2J9DA 2PMZD 1HNXF 1V6HA 1HWUA 2WVCA 1MWZA 2GIFA 1ZPVA 2GO8A 4DQQA 5J35A 2AEFA 5A8WB 2Y1IA 4ED0A 1M1KD 3QT6A 1R89A 2VOOA 1WHWA 2E1CA 2CWXA 3ISZA 3VALA 1OY9A 3KG4A 1Q9SA 2F1LA 2C77A 1S59A 3ITHA 3PFOA 4LF7J 2CJBA 3R8YA 2J6TA 2K3KA 2G2ZA 3OHAA 3ENWA 3OAAA 5D78A 2CQCA 3NS5A 1VF7A 3QWUA 2HBQB 1IQZA 5KFYA 1LW2A 3PY8A 2GIRA 2P3MA 2EK1A 4DZ6A 3CDWA 4LF1A 4A46A 4EYIB 2D9OA 3OW2B 3TZYA 3CESA 4DV0F 3SLNA 3GV8B 2DHXA 1U0HB 4NCGA 2J7KA 2CPIA 3FKSA 3VO1A 3FEXB 3KYLA 3DGPB 3OZVA 2EFGA 1X5OA 2NREA 2WPDA 2MY7A 4WFNQ 4R71A 3WDOA 1HPZA 1Q81D 2F1MA 4AQYJ 4ZGQB 3JQRA 2XLIA 1SJRA 1AXQA 2C3YA 3VAJA 4OX8A 1QVGB 3R5BA 2VPZB 2W4CA 3Q24A 1CJTA 4F0HA 1DDIA 1B64A 2V50A 2RRAA 1E43A 4CYUA 4HHJA 2VPWB 3LP0B 3SCLE 1QVFR 3CJ3A 5BSXA 4ZCLA 1X4FA 1WDTA 1FD2A 5HBMB 1NCLA 1RHJB 3P45B 2D3OR 1NDLA 4R0EA 3UWTA 1OHHA 1NB0A 5JBQA 2VNKA 4HLBA 3CPXA 1HNVB 2GA7A 4OMFG 2BMBA 4ZVQB 2CJKA 2HS3A 3RR8A 1XMBA 1X5SA 3DU6A 2JJ1A 2F65A 1WDDA 3TP2A 3CJKA 2OPQB 3NS6A 3EGNA 4M5IA 3QO9B 1X0PA 1G7TA 1GX6A 3HPOA 1LXJA 3DM2A 4CM2A 3J7YI 2DGVA 4KTQA 1VQOS 4DUZJ 1VIXA 4J9PA 4DL7A 2WR8A 3VZIA 4UZUA 4BPRA 2VG5A 5EX0A 1N88A 2DNLA 2XMMA 1N05A 4KH0B 2VF3A 3KMSA 4K4VA 3I96A 4NI2B 1H73A 2NZ4A 1C1CA 1DLOA 3ZZZA 1X9WA 5J2MA 1TV6A 1KSPA 4WE1A 2XOKA 2POKA 2VNIA 3IN5A 1B7FA 3EM1A 2A1BA 1NK4A 3SZ2A 4O4GA 2V9KA 4I2QA 2IRYA 5HMXA 4NLTA 5KFDA 1JWWA 2ASYA 5DGBA 4WP9A 3MM8B 1RAGB 4RX6A 3UR3C 3CB4A 1F1BB 2P9EA 4EZ6A 3PTWA 1BGXT 1M5VC 3D9BA 2AQ4A 3AOCA 1EXMA 3BBFA 5EN1A 4R25A 3QGPA 5KG6A 3IBFB 1U6BA 4ACBA 3GV7B 3DYAB 3UE2A 4DV2J 3CDAA 5F8IA 3AVUA 1OO0B 1IKWB 5GADI 2GJ2A 2E1RA 3HKWA 4DR2J 1U7LA 3CDUA 2CA9A 1AIPA 4RCYA 1UVNA 4FBUA 4WZLA 4DNTB 1N34J 4HIZA 2IRUA 1BXNA 3M2VA 1UWAA 2FZCB 2B5JA 1T9XA 1A9NB 1VIOA 1QFJA 5G0RB 3GTYX 1DFDA 2W1BA 1SJ4P 1QGZA 3G71S 5KFSA 3BGFA 1Q82T 1G1XA 4N8OA 4PC1A 1O0PA 3VGTA 4DS4A 1FNMA 1LWFB 1OGIA 1SJFA 1OQ6A 5GAHU 1E3ZA 3EZUA 1UEKA 3R5AA 2Z2MA 4YAUA 3W66A 4XTTA 2DETA 4XKVA 2OLWA 1GH8A 5HANA 3DOKB 3MFHA 2QLFB 1YTYA 1H42A 2BRKA 2YKNA 3K8WA 3W2VB 1MROB 5F3ZA 4NLGA 4ZVTB 1I94F 5KNLA 3CPWB 3A12A 4DOZA 5HL7Q 2BABA 4NLDA 2RAQA 1X4GA 3BDEA 4MFBA 2OBRA 4ZP9A 4DX8H 2ATCB 4RWXA 2MKCA 4O23A 2BA9A 1MW7A 1BX0A 3OZWA 2OMOA 3PV8A 3EZOA 2FTRA 4UZBA 2M4MA 1KVIA 2PD1A 4PPDA 2AYEA 2XNJA 4ANEA 2RQMA 3BCDA 5K8MA 4CCHA 2D74A 4RW7A 1TFYA 1K9MD 4ED8A 4B48A 3QE2A 1IJEB 3IWLA 3PACA 1D1NA 3VVTA 4F4AA 1FK9B 1O51A 2VC1A 4QIFA 1FWKA 5H9EJ 5CA5A 1NK0A 4JI6F 4PG8A 3OTDA 3U6BA 2BR0A 2DBBA 3BJYA 4QCLA 1VFJA 3HVTB 1IR1A 4X7FA 1B2RA 5IYWA 2DNMA 3E2EA 1DJ0A 4UZFA 1S6QB 2C28A 3GYGA 3OJUA 1JLQB 3HULA 4LVOP 3M05A 2DNYA 3TUPA 2DNOA 3PCOB 3C14A 5J1EB 4KHPF 2HCJB 2HWHA 1PGZA 1W34A 2D3UA 3VO2A 1I8DA 2ROGA 1FNBA 2D3LA 4CT9A 2KXFA 4C11B 3AQOA 1KTVA 3Q8VA 1IKVA 4U8VA 1F5AA 3CC4S 1X4EA 4NX9A 2QGFB 2G9OA 2CK3A 5DDOC 3DRSB 4UAJA 2QLXA 2MZJA 1VHEA 3MURP 4LF9J 2Z8QA 3FBFA 4ZLPA 1ZS6A 4EYHB 5D77A 3T53B 3QJPA 2ZH5A 3OOCA 3HSGA 1F60B 3A3OB 2ZHAA 2JJ2A 1KQKA 4ZV4A 3TZXA 5JVHQ 1FX4A 2CUYA 1OS5A 4WWSA 1R0AA 4ZP6A 1S77D 4RPFA 4LSNB 4RR5A 4F4WA 2M5YA 4QPTA 2CJXB 1VLOA 4I69A 4YHHF 5ETRA 1R31A 5HVHA 4MKAA 2QDXA 1EAYC 1TZ0A 3IG1B 4NZ0A 2YNGB 1VQ8B 5IM0B 1K1QA 2J8AA 2WVEA 1UZDA 3QFCA 2FQQB 4QR1A 4DEZA 5B08A 1VHOA 4ZVUB 2BANA 4LT6A 3MM9A 4DFJA 4CM0A 1Q8IA 4AFFA 1UWBB 4TY8B 2E7WA 3ZZRA 1KQFB 3VAHA 2EIXA 1J5OA 4KY3A 1LQ9A 2HGMA 5B0DA 3TVZA 4ZVSB 4AT1B 1Q78A 2YKQA 3MECA 2C3OA 5JXSA 2FD2A 4K2JA 3PR5B 2DR9A 2MJNA 3ONYA 5L9XA 2ZZTA 5F3TA 4MIWA 4PXDA 1QTNB 1G2EA 5CYJA 3RBEA 1U2CA 4OV1A 5AJ3J 4USTA 2QYGA 4RD0A 4YB7A 1YVFA 3ASTA 3UDEA 3D1QA 4CLTA 4KR0B 3E01B 1U2RA 1LFWA 2DGTA 3DRRA 2HQGA 4IRDA 1IBKF 1VQ4S 1RWMB 4Y3CA 4A47A 3KDOA 2DH7A 2ZJRQ 3C46A 1Y5NB 1N0VC 1XNRF 1EZZB 1SJ1A 2YBVA 3K5LA 4GQNA 2WVFA 3QIPB 3FPPA 1RWVB 1S1UB 1S1VB 2QT7A 2D1CA 1V5IB 1K28D 3MUVP 4ZVOB 2NXNA 4P3YA 1ROFA 4LSLA 2WVDA 2GQCA 4FS1A 2FVCA 1ZH5A 3RYLA 2GVZB 1T9UA 2BPOA 3P5TL 4LREA 2W9BB 1GTEA 2CQDA 1S48A 2XY5A 2KXNB 2MDAA 4LFAF 3M2UA 1QGYA 4DMZA 1MNEA 1IKXB 2BQ3A 1Q7LB 2X1AA 1B3TA 3M30A 4OHXA 3HHLB 1NLKL 4K4YA 4PPZA 4NLVA 1U24A 5B6IA 3LTOA 1H8HA 2JEJA 1YJ7A 1KD1D 1J5EF 3W7BA 1EARA 2LCWA 2O3DA 1Q5YA 2PA3A 3BH4A 3K2YA 3OW7A 4Q43A 4CLZA 4RW4B 1LWCB 4F4YA 2NR0A 4OYMA 1J27A 5GAHI 4QYRA 2RT3A 5DLGA 1S6UA 1BLUA 3I0RA 2XMVA 4JI8F 2XC9A 1GXUA 2HFVA 3RAXA 3KK2B 4Y2IA 1N54B 2HHHJ 2KVQE 1TAUA 4DNRB 1HNIA 5GMDA 2EW9A 3VHQA 4YALA 2EG2A 2OMLA 4JI2J 1UEVA 5ETSA 3CDBA 2MPUA 1UVIA 1VQMB 2WBMA 2GK6A 4EMDA 3HXMA 4L3NA 3UPFA 1BPLA 3DLKB 2GQ2A 5K14B 4LF2A 1UVLA 2W6IA 4RW9B 1HNWF 2K1RB 3CCLS 4B08A 1RTDA 3MOZA 2V8GA 2JEIA 4USIA 1WSRA 3M8PA 5F8GA 2X6XA 1I7PA 4QQBA 5C24B 4AE5A 2HSEB 1WHYA 1SC6A 2IJNA 4ZHRB 2JSXA 1X31C 3PG9A 4NLUA 4BC9A 2RILA 2R7WA 4XONA 2KTQA 1HL6A 1SUQB 4JP8A 1SV5A 3ZTPA 2KVOA 5THXA 3LWMA 2VDIA 2VHGA 2JVOA 3MM5A 2ILZA 3VQTA 2B8QA 2RS8A 4P22A 4C98A 3LANA 4IH5A 3TW0A 3J81Y 2HGNA 4H54A 1GT8A 3KK3A 1S0MA 1JA1A 4OOSA 2ZOFA 1YK9A 4L8JA 2E1AA 3BPDA 1KQSR 5F4OA 5F9LA 2JIZA 2OJ3A 4JI5F 4CNZA 5HP1A 1F2HA 2YNIB 5B0GA 3TAMB 4WFAQ 4P3IA 3GIJA 4WYLA 1Q4RA 3KLIA 1HNZJ 4NNJA 1U1MA 2CKWA 2VFVA 1VQ9S 3IMQJ 4RZRA 1HBUB 1AROP 1TTTA 4LFBJ 3AJDA 2Z6BD 2ZE2A 3BCFA 4S0MA 4ED6A 1VRTB 4O44B 2UXDJ 4A48A 1UD2A 2F4VF 1DDGA 1E6VA 1EETA 4J37A 1WNEA 4P6YA 3EVMA 1YJNB 1ZTTA 1WF1A 2HRYA 2W7AA 2HWIA 2P5VA 3BSAA 4I2PA 3BGOP 3A4TA 5IT9U 1PBAA 2LQJA 5B0BA 4JI4J 3D6FB 2PI5A 2V7VA 1GMWA 1EHWA 3MD1A 1RU1A 2QEXS 5E0OA 2UU9J 1NUEA 3V6JA 4ZITA 1F5BA 1RQ0A 3ITHB 2Q6IA 3ZO7A 1RTJA 1UVKA 2AGOA 2VJJA 4GVBA 5CHCB 1W87A 2G1HA 1NJXA 3T5JA 4ES3A 3ASRA 5JJBA 2NXEA 3BREA 4CO3A 2CZVC 1HARA 2BM0A 3DDIA 2M8DB 4DQLA 1D2EA 4CDIA 4B9UA 1VHIA 5C25B 1M90D 3H5SA 4BWJA 2CG4A 2BGIA 2CNDA 1V3ZA 2X0KA 2LDYA 2XMUA 2MYFA 2NV4A 4ZGNB 2FVQA 1HPZB 1VJWA 2W4DA 1CVJA 3CTRA 2VBZA 4TN1A 5KFKA 2RRNA 2MTLA 4OI6A 5F4MA 2CC2A 2D3ZA 3KUEA 3FVYA 1CJTB 5KFOA 4X05A 1XWLA 2A2DA 5B09A 4ZA1A 2YNHB 3NG8A 4CYUB 2IPOB 4HT7A 3KLHB 5HK4A 1FKPA 3TEGA 3CRZA 3R2CJ 2R9VA 2P9CA 4NXMF 4CTAA 2DISA 2RDIA 2HFNA 1S76D 5E41A 2HVHA 3R3TA 1S6PB 5LOQA 4F3OA 3W63A 2AP6A 4RUHA 3GIIA 2I5JA 4RU2A 3E3XA 3WBZA 3ISND 4BBYA 3KKFA 5HATA 4AC9A 1FTRA 2DT9A 4PQUA 1R8PA 3AA9A 2VFSA 3PIOQ 4A8OA 1NSQA 3TVKA 3S8SA 3CJKB 4KPCA 1GTHA 4I1TA 3LGMA 4UOFA 1SJQA 2HHXA 1HW9A 3WIUA 4OV6A 2RDDA 1YHQS 3OVSA 5KFIA 1FNCA 3EVWA 3DM2B 1H98A 2J9EA 4IO9Q 4OP7A 2VQFF 5FIUA 3N0VA 2DGWA 4DV1F 4P75A 2XNRA 2VG5B 1SB6A 4QBUA 3JYTA 1IB0A 2XZOA 4Q44A 3ONUA 1MU2A 2WCXA 1C1CB 3BN4A 4L3KA 4I56A 1ZYQA 5F8LA 3MM7A 5LXYA 2RVJA 5KG3A 1N56A 5B0CA 2DB1A 3W61A 1L3TA 2H9ZA 5T7LA 2DITA 3CJ2A 4O3NA 1AZSB 2O67A 4YDXA 3GG1A 2AEMA 7FD1A 1VQPB 2HRUA 4K4SA 1JLGA 5J2QB 3LOUA 5GVQA 4TU7A 4DX5A 4M5LA 3IWXA 5FLXU 2HIYA 4J9VA 3OSPA 2YQ1A 4PXCA 2GIQA 2DYAA 2WSCC 3O1LA 3QWPA 4WXOA 1FNDA 3T3FA 2LP4A 3RY8A 3PENA 2VBWA 1ZA1B 3I5CA 2ZZEA 4MYUA 2AJQA 2GJKA 1M5PC 2QTLA 2BACA 4A8QA 4Y2KA 2XMWA 1VQ8S 4C3LA 1UFWA 3M2VB 3AJ2A 3EE3A 4C48A 4XIUA 1TL5A 2VG6A 2ZDPA 2B5JB 2LDIA 5B0EA 2Q6CA 1IWGA 1RT5A 5FO1A 4DR3F 4LF8J 1OYEA 4H4MA 3H8YA 2A2CA 2D69A 4ED4A 1E79A 3M6WA 3L7OA 2LXIA 2QA4B 3BKFA 4WFBQ 2FVSA 3MCSA 1RT3B 3TO8A 4ATNA 1FO1A 1E6YB 4B3TF 4XDCA 2ZTGA 4Z4VA 4RUCA 4DV7J 3W9HA 4CWBA 4RBTA 5KG5A 3I32A 3CJRA 1XB2A 3KXDA 5I3PA 5A0YA 1Q7YD 2OPRA 4NZ6A 4U96A 1FESA 4G1QA 3Q89A 1N52B 3IM9A 4OHZA 2B4OA 2V68A 2YKNB 4JI1F 5CCMA 4ZS6A 1B4SA 4CLPA 3KTQA 3RB6A 3KEWA 4USHA 3Q8YA 1VC5A 3CMAB 4TMWA 4MFBB 2G4BA 3LUYA 1IR0A 2V2VA 4G3IA 2BVNA 3LPEA 3CCMB 3D6HB 5TRDA 2XMAA 4KKOA 4K8RA 4ZCMA 1NXIA 2KVIA 1RQPA 4KSEB 1R8AA 1URRA 5ITHA 4WK1A 3MEGA 4PXBA 2HQDA 3PW0A 4XD7A 4ICLA 3RZAA 3HHLD 4CT8A 2VQEF 5HVFA 3S6EA 2Q66A 4ETXA 2D74B 1NK9A 2PDAA 1VQNB 2EFNA 3ZZUA 2XYGB 4JB8B 3FSYA 5KFPA 3PJ9A 4LFCJ 1XMOJ 2YWKA 4TYBA 1HZEA 3QZ7A 4M5NA 2Y1LB 1TUVA 5KT4A 3M2RB 3QT5A 4GO5X 2GMHA 2OKQA 5GAEU 4LIWA 3ENQA 4WWVA 1ZPWX 3SEOA 3DI6A 1IHMA 1RWWB 2NUUG 3LALA 3OUYA 5E2QA 2HZCA 4I0WA 1UD4A 1TMJA 2L08A 3EVOA 3D2WA 1KK2A 2XY6A 2MEWA 2FJXA 4DN0A 4DR6J 2CAJA 4TLQA 3NMRA 1VK3A 1WKLA 1X8DA 3BB5A 4WIQA 1YI2B 2IRXA 4EI2A 3ZXWA 4DR7F 1JLFA 2R7TA 2V7WA 3CW2A 1Q16B 2PT0A 1IKVB 2W24A 4Y6IA 2PGCA 4QPXA 1H2UX 2RS2A 5H9EK 2QMUA 2KJVA 3CJ4A 3MHYA 4DUYJ 3MTJA 4JV1A 1O5JA 2KRRA 1V9OA 2YKMB 2B7BB 1MG7A 2JWNA 4UQGA 2X85A 4LF4F 4DN9A 4YB5A 3KJVA 4X62F 3ZTRA 4M8LA 1G3OA 7AT1B 3C2PA 1JLAA 2L48A 3H5UA 2RUGA 4ZOSA 3EXYA 3W3SA 1TUWA 2C2KB 3T1AA 2DXEA 1UETA 3CCJB 4OJHA 4FVMA 3FDSA 5K9FA 4ECRA 2BANB 2AF6A 3LGHA 3MM9B 4G6VB 4AXIA 2XWYA 3NCRA 2J9CA 3AY0A 1QH0A 3BQJA 3DU5A 1J5OB 4L74A 3VNVA 2GC8A 4A8WA 1N0UA 2X6YA 3OFFA 2GQQA 1FHTA 2GPJA 1VOMA 2HAIA 1IM6A 3PJXA
chains in the Genus database with same CATH topology
3GIKA 1WI6A 4LIRA 4PCQA 4CIOA 1MSWD 2VG7A 2XEXA 2PEHA 1T03A 1S99A 1ZZNA 1S9EB 1HD1A 4N77A 4Y00A 3SYZA 4KRWA 2XLKA 1VI7A 3KLFB 4OL8A 5LSRA 1WHXA 2HVZA 3C6UB 1E1RA 3MECB 2E66A 2YY3A 2WRMA 1QUPA 4DDFA 1JMTA 2HHPA 2GMLA 5AXKA 3BO3A 1VS3A 2MKJA 4ECTA 1GXTA 2JDIA 2V4JA 2HHVA 1WELA 4ALZA 4JI0F 2VZ9A 2OFHX 4KO0A 5AXLA 2AX1A 3UFCX 1RT2A 3UNGC 3UDLA 4CO0A 1Y5IB 3THPA 3ENVA 3RAQA 2C3MA 1NJZA 2DIUA 2J7WA 2BM1A 3V2UC 4F02A 3RAMA 1SKYB 4B3FX 2CZ4A 2CQGA 5DS7A 1JB0C 1Y4ZB 2K1RA 2IC3A 2KH9A 2YX7A 4NCAA 1YG0A 4LUBA 4YDDB 3LWLA 2EFOA 2AV5A 3T1YF 3V6DA 3Q8RB 4DQPA 4MK7A 1C0UB 4A8FA 2VB6A 4J5OA 3EZ5A 4DSEA 4LF8F 1KD1T 4G7XA 4Q2LA 1N33F 1UAWA 2GV1A 2XZPA 3MR2A 3RRKA 5T14A 3GSIA 2K8GA 4PWDA 4XQFA 4PXEA 4B3OB 2KXHA 2GMJA 3M8QB 2WOMA 2CPEA 1QJHA 3MEKA 3VR6A 1XERA 2F8MA 1SL1A 2ZXHA 4XOTA 2CVIA 1PO6A 3RRGA 3JU4A 2CQ4A 4ZHRA 3JAMY 4C0OC 4ELUA 2VONA 4F8RA 1WACA 3U1LA 3EX7B 1JLBB 3CCJS 4DV7F 2J0SD 3M9NB 3KHLA 1FVQA 2JC1A 1EFRA 3R5CA 2KZMA 1PJ5A 3BGUA 1W25A 2VG6B 2DR7A 3R5DA 3V81B 4O3SA 1SUQA 3VZHA 4F3QA 4LMZA 1PC4A 1N5YB 1OQ3A 2VBXA 4KIAA 1ZZFA 4LSLB 3KNGA 3QAUA 4Z37A 3CSKA 2MQLA 2NSCA 3PFEA 6FDRA 1R7IA 4ES1A 2L9DA 1ELOA 4NA3A 4DL5A 5LMUF 1ZTWA 2FUG9 3P3DA 4TXSA 2VUGA 4XM3A 4C8NA 3QGGA 4K5SA 1NJIT 4WZQA 1HQUB 3OR1A 3TAQA 1JXEA 3CC2S 3UCZP 2J0WA 3BSCA 3M2UB 5BYSA 3KMQA 1FXRA 2DHAA 1RYRA 4IUFA 3GFZA 2FB0A 4U6PA 3M30B 4PR6A 1S6OA 2IA6A 3UW1A 1HBMB 4J9KA 4ECQA 2OPRB 1UD6A 2ZH3A 2UUBF 3IRWP 2HIQA 2J7UA 4EEYA 2AJFE 2VA3A 2DCUB 3UD3P 3FJ2A 4U9RA 1Z1ZA 1TKTB 4IRCA 5CYQA 2EPIA 4WIIA 2UV8G 1VQ6S 2XB2D 4DF8A 4DFKA 2NLWA 2BBEA 3BGLA 5FIIA 1ZOTA 4MH8A 4R8UA 1QLNA 2Q43A 1DBDA 3DC2A 2BDPA 3SCIE 1TKDA 1HA1A 2PIIA 3I87A 3N28A 5KTQA 1R3NA 1XK8A 4K59A 3FFIA 3RU0A 1HBUA 1BLIA 1Z4UA 2DGSA 2X1BA 3DXSX 5H9FJ 2WB1D 4PG4A 2VODA 1NJYA 4MYTA 1SKRA 2R7OA 5KFWA 1DRZA 3ZFVA 2GJRA 3OPOA 2CPZA 2F8HA 4WCEQ 3GYNA 4OI1A 5CZXA 5I3QA 1YBAA 3HAGA 2JZ5A 3GIMA 2DR5A 5KFFA 4KKTA 3A35A 3DMJA 2WBRA 5IT9Y 3OBIA 3I0RB 3SV3A 2JLEA 1LWEB 3RBDA 3D54A 1CC7A 1WSVA 3QGHA 4A8MP 3OSNA 3E8OA 2R7UA 2RDJA 4EBCA 3M32B 5LSLA 4NPOA 3J7A1 4F4KA 4DK1A 2V9WA 2X51A 4IOCQ 2GK7A 2UVVA 4GKKF 1BQNB 3MMBB 4LFCF 1XMOF 2J9DA 3FQKA 2PMZD 1HNXF 5E3CA 1V6HA 1YITS 1HWUA 5E3PA 5HMZA 1WOSA 1MWZA 1HNIB 1ZPVA 2GO8A 4DQQA 2AYGA 2QA4G 2YH0A 3MMJA 2EBGA 5KFGA 3MEGB 3HZGA 1TKZA 1A7GE 5A8WB 2Y1IA 2XGPA 4ED0A 3N6MA 4ECZA 1R89A 2VOOA 1WHWA 2E1CA 2KHCA 3ISZA 3VALA 2FHKA 2XGQA 3KG4A 2RU9A 1DARA 3ITHA 5LXRA 3CCUS 3PFOA 2RSQA 2CJBA 2J6TA 2K3KA 3GIRA 2IAJA 1RTIA 3OHAA 3ENWA 2LECA 2UVRA 2ZVSA 1S1TB 2PE8A 4GC7A 5HROB 3OAAA 5KT6A 4CH1A 1DTTA 5D78A 2RU3A 1TL3A 2CQCA 3NS5A 1VF7A 1NHVA 3QWUA 4I7FA 3QGIA 3UI3A 2MZ1A 4JV0A 4NMLA 2KYXA 2HHSA 2WONB 1U45A 1QM9A 3M8PB 1S0NA 1IQZA 5KT3A 5KFYA 1LW2A 5KFTA 2C2EA 2GIRA 3PY8A 4DR6F 2BZ2A 3N79A 4Z1MA 3VF0B 2MZQA 1RGVA 5EHHA 2BE2A 3AB2B 2GGPB 1FRMA 3H4BA 2EK1A 4WKRA 3CDWA 2G0CA 4P7VA 4A46A 3K5NA 4EYIB 2D9OA 5HO4A 3CESA 3SXLA 3OQ2A 3G6ES 4ED7A 3DI6B 2DHGA 4QIVA 4HYKA 2AU0A 4RW8B 4DV0F 2K2PA 3OUYB 3GV8B 3F73A 3QJJA 4N56A 3U1NA 2FJBB 4Z2XA 2W7PA 2DHXA 1RYSA 1V0EA 4AYBD 2DNPA 1FK9A 5C42B 4NCGA 1SKSA 2J7KA 1SV5B 2CPIA 3FKSA 2HS0A 1RA6A 3FEXB 3KYLA 2DPIA 2O5DA 2GFFA 1NJWA 4XORA 2ATLA 2EFGA 2KFNA 1WHVA 2ZFHA 1X5OA 4AVZA 2VPXB 3MM5B 2NREA 2WPDA 4P2SA 2MQNA 1V0FA 2HQ3A 3CDEA 4HI2A 2MY7A 4WFNQ 2OPPA 4C3MA 3DFEA 3IS9A 1HPZA 3WDOA 1JKHB 5K8PA 2F1MA 1ZAVA 3DLBA 2L3MA 3VQSA 4ES2A 3LP1A 2CYYA 1U8SA 3KK3B 4IR9A 5BJRA 5A8RB 4OZNA 2XLIA 1SJRA 1AXQA 4FZVA 2YVSA 2YWFA 4DUYF 4JUZA 5L38A 2DIEA 4TY9A 3FNNA 3CXCR 1HWLA 2C3YA 3VAJA 3N5FA 4TKTA 5HP1B 1FNXH 4TU9A 4OX8A 2MQPA 1T05A 2IVMA 2ZH2A 1JLFB 3R5BA