1NRKA

Ygfz protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
325
structure length
325
Chain Sequence
MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YgfZ protein from Escherichia coli suggests a folate-dependent regulatory role in one-carbon metabolism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords YGFZ Protein
total genus 68
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1nrkA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1nrkA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nrkA01
5L46A 3GIRA 1VLYA 4PAAA 1YX2A 3GSIA 1WOPA 1VLOA 1WSRA 1PJ6A 1WSVA 1V5VA 4P9SA 1PJ5A 1WOOA 3A8KA 3A8IA 1PJ7A 1NRKA 1WOSA 1WORA 4PABA 3A8JA
chains in the Genus database with same CATH superfamily
5EX0A 5H59A 4UF4A 4KY3A 3BREA 5G4DA 2P6TA 4IFYB 5G0RA 3KEWA 1FVSA 5KG2A 1M5KC 2Y0SD 3A8IA 1HBNA 5B6IA 4LF1A 4WP8A 2HFVA 1FXRA 2JH3A 1E6VB 1W0KA 1UPPA 3V4IA 3OFGA 3PZPA 1HZEA 4IDKA 3WDOA 3F44A 4J90A 2DGUA 4RBUA 1S4MA 2K3IA 3PR4A 1V9OA 4HLBA 3W5YA 4OYXA 3K5NA 1YIJB 4P73A 2R7RA 3K5PA 2C2NA 3TAMA 2KN4A 1FTCA 4Y0FA 2BMBA 3D28A 2CBXA 2V7VA 2L9WA 2RSQA 3KJFB 3KTQA 3OJXA 4Q5VA 1RTJA 3KOAA 3AXMA 1B0PA 2COLA 4OP7A 4MJKA 1WTBA 1PKUA 4QIFA 3IRXA 3PX4A 2K2PA 3Q8UA 3OUYA 1FNBA 4LF8F 4K1XA 1RWUA 4DR3F 1S1WA 2E66A 1FFWB 1TK0A 1LEOA 2MZ1A 1F60A 5I3PA 5B0BA 1YI2B 2FUG9 2VBWA 3CTRA 2MKJA 1IKVA 3RW7A 4J9SA 4DV2F 2AZ3A 1YJUA 3RTVA 2J7UA 1TVCA 1LWFB 2CZVC 4K7QA 4X64F 4ATNA 3ASQA 1N0UA 3ILOA 4G5GA 3ZTQA 3EGNA 1ZZNA 3U6KA 1RTHB 3C16A 1IQZA 2YWGA 3HDSA 5AE3A 4IG3A 4NOHA 2MXYA 2FJEB 5T7LB 1KK0A 1YDLA 2EVZA 3MM5A 3MM5B 3SDEB 3CDEA 1RT7B 3MMAA 2JX2A 2UVVA 4I56A 5GMKa 3CP2A 5DGBA 5DZ7A 4DCPB 1FD2A 3DMJB 3DRRA 2OTLB 1NUEA 3EWGA 3FRZA 5HVFA 2YQ1A 5GAHI 2ZKTA 4DN0A 2ZTGA 2X3GA 4FYVB 1U09A 1FKPA 2F1MA 3HHLD 4DNRB 1HPZB 4CLUA 4RNNA 3EZ5A 2XNJA 1Q8KA 4YB1P 3U7JA 1HL6A 1S72B 2AIRB 1H8HA 1M1HA 1BQXA 1HBOB 4P22A 4EUVA 3SIPB 4ZLLA 3MMBB 1N56A 5F0UA 1X4CA 4U8VA 4MYTA 1P4MA 1MLAA 3VWSA 4XLAA 1KP6A 2VPXB 1IJEB 2R8KA 1N08A 4DU7A 2MZTA 2V4DA 3BGLA 3V81B 4KFBA 3OSPA 4IG3B 1UZDA 1SVDA 4WF9Q 3A8KA 3M1VB 2MJNA 3OXGA 5KFWA 1PBUA 4TU7A 1H2VZ 4DUYJ 2J6UA 4URQU 2WTFA 4FVMA 1X0FA 3E51A 1SH0A 3FQLA 4ED6A 3L7UA 3PJWA 2MDAA 3ZBTA 4DDFA 3NKYA 1WF2A 3W65A 4B3GA 1SC4B 4CZCA 1XC9A 4DMZA 2KVOA 1HBNB 4CLWA 2YWFA 3JAMU 6FD1A 2MKIA 1SC3B 4CTAB 5EX3A 3IMQJ 1IKWB 3D67A 1BUXA 4DF4A 5IM0A 3J81U 1VHEA 3NNHA 1G7TA 1I51B 2AEMA 3DRPB 3W66A 3ETOA 1HBUA 4XORA 4DV2J 5I3UB 2V7QA 2UVRA 4U7UK 5T14A 4IOCQ 4RD1A 4RWWA 4CIOA 3SCLE 4IOBA 3TA0A 2RJZA 1IKYA 2CJQA 2Y0BB 1TMMA 2YWEA 3OL9A 3BJYA 2QLXA 4R0JA 4X62F 4J9LA 4JV5F 5IFMA 3V4IB 1UFLA 4NLYA 1T6YA 1L3TA 1S59A 4QYRA 4NASA 1VLYA 4X7EA 1S9FA 4KRWA 2DISA 1FFSB 1F5AA 2XNRA 1CJKA 1VOMA 2OPPA 4F36A 2ZHAA 1ZYQA 2H65B 4DR2J 4V19X 3NBPB 1YG0A 3BY1A 1VJSA 2LQ8A 3ZPNA 4OPSA 4Y2CA 4MK7A 1ZOTA 1OO0B 1EARA 4M2LA 3G8QA 2XHCA 1NK8A 3ENWA 3T6BA 2Q3PA 3T1HF 1F3FA 1T3NA 3ENQA 4EO8A 5A8WA 4A47A 2OPPB 3D26A 3L09A 4PQUA 3QIPA 2VKRA 2V0NA 1BY9A 2ASYA 4B3OA 1C0TB 3DLJA 2OD4A 3CNQP 2WBMA 2D1CA 2OMLA 4PGOA 3B82A 3QQCD 1RT2A 3MPDA 2XZTB 3MUMP 1KLMA 1C2PA 4Z7YA 4X64J 2OBSA 4B17A 4FYDA 5KFGA 3J7A1 4DSKA 1XTZA 2J6SA 1AT1B 2R3VA 4ZVQB 1HA3A 2PO4A 1B70B 4ZVFA 1DTQA 4MK8A 5CYMA 3ONUA 3RB6A 4J5OA 3ASRA 3HFZB 5BR8F 1BE4A 1XEZA 3ITHB 2WONA 1S10A 3PY8A 5HATA 2OHDA 2MKYA 3CT9A 3SMZA 2VFRA 4P2NA 5GAEU 1S77D 3LAKA 1TKZA 3CO0P 2XMKA 2RDJA 4Q0BA 2RF2B 1RAFB 1VBZA 2DK2A 4M5MA 4X65J 5ITHA 1NDCA 4B3MJ 3IM9A 5BSXA 2QE7A 1KK2A 4B48A 4ECXA 3BF4A 5HMWA 4I64A 4LRBA 2VNJA 2I2YA 2E9RX 3NNAA 3X1LB 4MIBA 1HD0A 3BBFA 5U47A 3CCQS 3M9NB 1NB2A 2LDYA 4QPXA 1ZAXA 2AD9A 1URNA 4DUYF 2MZJA 4J7CA 1F1BB 3FK4A 3DNCA 3T9NA 4X0CA 3GFXA 4C8MA 1EJ7L 4QQBA 2OAUA 4EGLA 3OOCA 1N6QA 3I56S 2J0QD 3NAHA 5HSPA 2E7XA 2VBSA 4XR6A 2XGPA 2V31A 1KHVA 1S1TB 2YWHA 3V81A 5B0AA 1QX4A 4HE5A 2F1LA 1KJZA 1CJKB 3R97A 3Q8VA 2X6YA 2N82B 2DRBA 4OFZA 3WC0A 1OIAA 2BN4A 4A8QA 4OYOA 3I4HX 1R0BG 3GMGA 3PHEA 5ETQA 2PIIA 3DLGA 1RU2A 4TKTA 4QWAA 1YJWB 2PE3A 3LVBA 4HT5A 2J9DE 2POKA 2MZSA 3U2QA 2ZJPQ 3M6VA 4PUOB 4EO6A 1HIYA 5C24B 3OVBA 1UVMA 1H2TZ 1P9YA 2FTRA 2H51B 1WDTA 4RW9B 3TAQA 2CNLB 3SJPA 5CAAA 2ZEJA 3H7HB 3P3DA 3RRGA 1RT5B 3M2VB 2PDAA 1ITPA 3H9NA 3W2GA 1RZMA 3T51B 1GVHA 2OD6A 1IKXA 1RI7A 4NZ0A 1U0HA 2DH8A 5J2PA 2G0JA 4KGZB 1FJGJ 3HKWA 4ITSA 2AGPA 3BCDA 4ZGNB 3NWRA 3I1FA 4DCOB 1S1XB 1MU2B 2RNEA 3RU0A 2DHSA 1HHTP 1Y5IB 3E1YE 1FDNA 1HWUA 4C11A 4ZLJA 3T19A 1E62A 1V3ZA 1RAOA 2DNHA 3THPA 2Q6CA 3DHXA 2W2PP 4KHRA 2MGZA 5IYNA 2LCWA 3HVTB 1EHWA 3POTB 5J3OA 4IQXA 5IV3A 1U49A 3BH7B 4RKUC 1FDDA 4P2MA 2X6WA 3OUYB 5CYJA 2I1LA 2A2CA 5IC4B 2F8MA 1LW2A 4YAUA 1RHJB 3NCQA 2MLZA 3UCGA 1NSAA 3CJQA 1H2UX 1ZTWA 5HJXA 4UAJA 2NUHA 2QC3A 1FNDA 2B6AB 4PR6A 4XTTA 1I5OB 3M05A 2W8KA 2XMAA 2ZBUA 3CC7S 2VBZA 3EZUA 2VPZB 2ROPA 1UD8A 4LBHA 4EZ9A 3BDEA 5CQGA 2DYAA 3TRGA 1MU2A 2VYQA 2NXEA 4XONA 2B7BA 3BGRB 3RB3A 1NB9A 3MM9B 2DXEA 3GVKA 1DY3A 3W2WA 1S1VB 4NZ6A 4RNFA 2H1YA 1BQNA 1FERA 2VG5B 4TNOA 2B4PA 3JQKA 1F5CA 4PG8A 1JLEA 1M0SA 2V8VA 4DK0A 3E3XA 1TL1A 2DPIA 2HHPA 3AB2B 2M5YA 2W7AA 4OYBA 2W4DA 2DHXA 1K1SA 3P6YC 4P75A 4DOZA 4ANDA 1FO1A 1VRTA 1UETA 2P9CA 1GAWA 1VQ6S 3EXCX 2UUAF 4DR1F 5E3QA 3JSBA 4XQFA 4Z4ZA 4ZCMA 1S6UA 2A2DA 4AVZA 2AJ2A 2MEWA 3HSZA 2JEIA 3BPDA 3HI9A 5D15A 4Z4SA 4DR6F 2PD1A 1COWA 4RBTA 3MCMA 3O3LA 3FSIA 1U1KA 3ZZZA 2PEHA 5D8HB 3Q89A 1NBEB 1NHVA 4FNHA 4RW4A 3DFEA 4WP3A 1B23P 5DN6A 3KHGA 1TL4A 3VNUA 2QE5A 4TVAB 1R27B 3W2IA 2N4CA 4ELVA 2KRBA 2ZL7A 1KWMA 4JI4F 2G4BA 2AJQA 4DJBA 4DF8A 3T1YJ 1VQ8S 5I3QA 5GMEA 2XMWA 4K4SA 2J7WA 1H98A 4ECQA 2W9CA 2K1RA 1W87A 2F5GA 1E6VA 5KT4A 3RUBL 1WOSA 1V6HA 1F9HA 3TO8A 1IWGA 1SKQA 4OYWA 2JVRA 3KMSA 2B51A 2P5VA 3NS7B 4QWBA 1SCJB 3N5BA 3RW6A 4ZPVR 1CS4B 4ZS6A 3T9ZA 2C22A 3JQQA 2JRSA 1IJFA 4DR4J 2KHDA 3GB0A 3Q6RA 3JYTA 3M2UA 2R2UA 2MZRA 4LFCJ 2KRRA 2BE7D 1TV6A 1QAIA 4C6AA 5LSLA 2HHQA 2CF4A 2EI5A 4DPTA 1X31C 2YH1A 4AFFA 3D54A 4B3TJ 2KZZA 2Q66A 1WC5A 4OI3A 2R7OA 2K3KA 2QJ3A 3AH6A 3W8PA 2Z58B 2GJFA 4I7FA 3TR5A 4P7TA 4O44B 1JJHA 3SV3A 1E64A 2ZOFA 1UA1A 2CW5A 1PG5B 3RRHA 3C6TA 1EFTA 2ZL5A 4C3KA 2LQBA 4NI2B 2F4VF 2KKHA 3F0NA 1TL7B 2DH9A 2VFUA 3IGVA 3HHNB 5DRKA 4Z1MA 2DXFA 3A13A 3CVKA 5A2QY 1DARA 2XMJA 5AXLA 1IM4A 1HFEL 1A6LA 3ASTA 3OTBA 3VAJA 4Q43A 4FWTA 2DTJA 1NK7A 1YQHA 1SV5A 1BWEA 4LIWA 4EH1A 3MEDA 4ZN1A 1WKJA 1K44A 1RWMB 2QMUB 1VHFA 2BKNA 3L4BC 3ZZUA 1EIYB 4U7CA 1UA0A 1R0AA 1K0TA 4KKUA 1H73A 4BC9A 1OSCA 1WG5A 1KOOA 1S1VA 2M5SA 4DNTB 3DGPA 1UP1A 1P9QC 1RBOB 3EUNA 2BOAA 1S57A 1KK1A 3J80U 4TLRA 4BWMA 5KFIA 2JFDA 2RUSA 3UFCX 2KT5A 3FFIB 4D3GA 5DQGA 1NK5A 2JHEA 1F5BA 1JXVA 1SKYB 1T9XA 3IWLA 1NJZA 3B78A 5M2UA 4XIUA 2JWNA 3AJDA 4OZNA 4ILMA 3FNNA 3KLIB 3QAUA 3GV8B 3CB4A 3M4XA 3JTNA 2ERRA 4CWBA 2GQFA 3MEGA 5EWEA 2PC6A 3NLCA 1TR0A 1HBMA 2BANB 2RKIB 2VQFJ 1PIEA 4X66J 2MY8A 1HQUB 2UUBJ 4MTPA 4O4GB 4YHBA 1Y9OA 2G2OA 5BYRA 5AXMA 3OTOF 1HWLA 1FTRA 4O3PA 5T7LA 2VC1A 2XS2A 2KG0A 3TJ9A 4EYHB 2VH7A 3J7ZT 4LF8J 3LGNA 3ZNJ1 2AU0A 2X6XA 4LJMA 2MQMA 1TKTB 3FCHA 2MKCA 1TTHB 3OW2B 4DCJB 2HK2A 4PG4A 1J2VA 2DNQA 3KL9A 1IQTA 1VC6A 3K2YA 4FS2A 4P3YA 3JQRA 5KT6A 5CA5A 2VONA 3WX8A 4CO5A 2NR0A 4OI2A 2YNGB 1R8CA 1HWIA 3MPVA 3J7AN 1UEVA 5C2CA 2V2QA 2LQ5A 2ATCB 4MFBA 1CJTA 1SJRA 2IVYA 2C2EA 2C2OB 3FCVA 4U95A 4XDCA 5IC6B 4O3RA 2CPIA 2B43A 2KM8C 1FJGF 1QTMA 4RPBA 4RU2A 3GYXB 3R6LB 1MWZA 3UDCA 3L3CA 5KFFA 3SBMA 5AJ3J 4ZLNA 2UUTA 3NAIA 4ID5A 3UN5A 2ATLA 2AWZA 1VQ7B 3P27A 1WF0A 1D9DA 3U27A 1ZS6A 4OI6A 3G6VA 2HGMA 4QIGA 1N36F 4WBFA 4EBDA 5ETSA 2CPYA 1Q5YA 3QZ8A 3BH6B 3UD3P 2VL1A 4V19J 2JZ5A 4IH7A 1IR2A 1M5HA 1U8WA 1VQLS 3OVSA 2FY8A 3DGPB 3NS5A 5DG7A 4JI3F 1IBMF 1VQMB 3IG1B 1ZM9A 4Y65A 1IM6A 4IFVB 1SKSA 2WVCA 4GO7X 4HHJA 3PIPQ 1HQEB 4I2PA 2KL8A 2OIHA 3SDEA 4WZEA 2ZDPA 2ACMA 2FY1A 4AL7A 1EQMA 1FXLA 4KHMA 4PG5A 3WNCA 3PW4A 4Y6IA 3OAAA 3WBKA 3FSXA 1FE0A 3CCUB 1HNXJ 4O0IA 4JI5J 3SQOP 2QX0A 2E1AA 5KTQA 1VIXA 2WZPP 2XCPA 3Q8PB 3VGTA 4OJ3A 4USVA 4CH0S 1N5VA 4O4RA 3QJLA 1LK5A 1QGYA 1EKRA 4K50A 3H20A 2ALYB 3ILIA 4KGMA 2HHXA 3UVJA 1JNRB 2V69A 3MOJB 1SL2A 1TUIA 4RUBA 4PEOA 2DR6A 2OPSA 4KPYA 3V6KA 5LMZA 2AYMA 1VCTA 2J6TA 4CNYA 3MEGB 3EDQB 1A8PA 4WZTA 5J2QB 2V7UA 3DXBA 2CQBA 2ZBQA 2VOPA 2YPZA 1GJRA 4KJIA 3CD6B 1U26A 5CD4A 3LQ6A 4LVOP 4FF4A 2QG9B 1L3SA 1T9VA 1U45A 4WYWA 1QGZA 4LSLB 3Q39A 2FHJA 2CA9A 2RDIA 2AX0A 1FFGB 3CJ3A 1RUSA 2WZ1A 4C4WA 5K8MA 2CJKA 2LMIA 1XR5A 2GGPA 2VG7B 3V6JA 2M70A 2IVMA 4F2SA 1FWLA 3C15A 2CQHA 2R7UA 1TKDA 1BQMA 3R5GA 1XQBA 1U1QA 3EZOA 4NLWA 4MAKA 2BRLA 2EFNA 4LRDA 3HXMA 1SKWA 4HH1A 1Y7PA 3QSYA 5BXIA 1WC3A 2PA8D 4B3SF 2A6MA 1KFDA 1JA0A 3MR7A 2IAJA 4UT4A 4UTGA 1G7SA 1JLCB 2HQGA 2KFZA 3GIIA 4RLZA 5J1EA 3O1LA 4X4QA 1UFWA 1LFPA 4GVLA 1MROA 2KZMA 2BX6A 2DNPA 3RR7A 3AJ1A 1RWKB 4W4MA 1S6PB 2F3JA 2VBYA 3K5OA 4WKYA 1LWEB 3JTOA 5MAOA 2HYIB 3Q8RB 3C3LA 4DV1F 2L41A 1Q8LA 2ZH2A 4X62J 1KONA 4C8NA 3SFGA 2HSEB 3TYTA 1GXLA 1XN9A 2BF4A 4DV0F 1SPBP 2VIHA 3G9CA 1AZSB 2C3MA 2YNFB 1MROB 3L9ZA 1RKIA 2CQCA 5I3UA 3BBBA 2M3DA 2UXBF 2JVOA 2NZCA 4NYOA 4JMQA 2ZD1B 7FDRA 5F3ZA 1DTTB 3CDBA 2CJBA 2MB0B 2ZBVA 4AC9A 2XG8A 4LFCF 3QATA 1M90D 1N54B 3WC2A 4JBCA 3CULA 5C7PA 3A8EA 2Z2LA 3JS9A 3OT9A 4BWJA 2CPHA 4DPXA 5IZHA 4QR0A 3CPXA 3DYAB 3S7RA 3MUVP 2OTLS 2EWHA 4J9PA 1YRXA 6AT1B 4IR1A 1UTAA 3I9ZA 2X3UA 1RQRA 4OPVA 3QGIA 1UW4A 1MSWD 1JLGA 1ZPWX 2ZOGA 1C1BA 4FXUA 1NEEA 2CWXA 3NE5B 1LW0B 2E7VA 1YJ7A 2FPHX 2F4FA 2OEMA 3Q6QA 1YBUA 4P10A 1B64A 2OYNA 4EWTA 3K59A 5ETLA 2FHOB 3RG6A 2KFYA 4NX9A 2ZNYA 3NGKA 3MHPA 5L1JA 3VVUA 1YJWS 1RLCL 3TARA 4X4TA 2WVFA 4IUFA 1U2CA 5GAHU 1RTIB 2VDIA 3H42A 5F4JA 1GT8A 3MURP 3MR2A 2XMMA 2DIEA 3CTAA 4ES1A 4R5PA 4TMXA 4WPAA 5DM6Q 5CD4H 2BOPA 1S9EB 4FNIA 1JLFA 2GIRA 4DR1J 4UZCA 2IJRA 2AYGA 4BS2A 1SJFA 1VLOA 2I5JB 3NOGA 3M30A 3OKXA 2VNHA 4P12A 1AIPA 2B0GA 4NEYA 4M53A 4OLOA 5IK2A 3O5TB 3PEJA 3J81Y 2FJXA 2C1EB 2UV8A 2FC8A 3I5BA 5HJYA 2X7IA 4K4VA 2HFSA 2WJYA 1RHRB 3MEKA 1OQ3A 5AN9A 3N28A 3BS9A 4X06A 4QVAA 3BEGB 2CKWA 2VG5A 1NPRA 1SKUB 2D3OR 3UE2A 3GWCA 2OKQA 2J5AA 1YRUA 3LP0A 3OBIA 2W1BA 1Q86D 1R8PA 5HAOA 1X0PA 4B02A 5F8LA 3NNCA 1B7FA 1WDDA 5JVHQ 1X8DA 3SZ2A 2HLDA 3VAKA 3GP9A 1PJ7A 2LXIA 1PSDA 2QRRA 2DHAA 1X9MA 3W5VA 2NSCA 3QSYB 1IBKJ 1E63A 3HHLA 4NLSA 1WKKA 4OYMA 4K8RA 2HVIA 2Y8YA 1U2FA 3SSSA 2FB0A 3RBDA 3QFCA 4CO0A 4RNMA 5JVGQ 2XI3A 3W5HA 3DYAA 1FCAA 1FRLA 6FDRA 1CC8A 4L75A 4P2SA 3SEOA 5LJ5Y 1YJNB 4Y34A 3J81k 1T9WA 1S1UA 3CCQB 2CNNB 5F3TA 1O5JA 2M8HA 3PA1A 1DRZA 2EKYA 1KNZA 4LR9A 3JU4A 1RAIB 2V7TA 5RUBA 2J0WA 1M5OC 2XSJB 2RT3A 1D1NA 4CO4A 3CCMS 4AL6A 4K4UA 4JI2F 1NJID 3THTA 4HVZA 5ETVA 1TFWA 4DV6J 1XERA 2AX1A 3AA8A 3W2VB 1KVKA 2WCXA 4NXMF 2XY5A 3ETMA 3OHBA 2PFDA 3N9UC 2W2QP 3N5FA 3MCSA 5M2RA 5C25B 3KJVA 1VBXA 1JIHA 4GC6A 3OL8A 4CM2A 4LC0A 2GA7A 2ZH4A 3C46A 7AT1B 3AQOA 5DDOC 5A6WA 4O4GA 2YY3A 1C1CB 1KZLA 3HZGA 4BHQA 3MXHP 2DNZA 4NLUA 5AT1B 1SJQA 2EC2A 1RXOB 1P1LA 2JLFA 2R8GA 4I0WA 4J9VA 2CJAA 3AD9C 2GHVC 3MCAA 4ZIWA 2XYGB 2BYCA 1H0HB 2DCLA 1QSSA 2YKMA 2JLGA 4X7FA 1KQGB 4ED1A 3WBJA 4HL9A 1JMTA 4QWDA 2CZ4A 3FFIA 3LH2S 4CO1A 1S7HA 4GVBA 1RT1B 4NEZA 1M5VC 1KLMB 4C9DA 3TANA 4C8OA 4K2XA 4TY8B 1FKOB 2CJYB 5IYPA 2YKOA 5J1PA 4GVBB 1TMJA 3ONYA 5ETTA 4DUZF 2LFVA 2FLLA 4HIZA 2LLZA 3D0IE 1RYRA 4WZKA 3G8TA 1NSPA 1UFKA 3CIZA 2ADBA 4DV0J 4X4RA 3ZFVA 1T9TA 4LF5J 1UWBA 3CPWR 4WZMA 4F02A 1S1TA 2R7SA 4OZ1A 1LQ9A 4NYPA 3AY0A 5L1LA 1HR0J 1SV5B 1MWQA 4XKVA 4USTA 3BB5A 3HD2A 4ALZA 2A3JA 4G1VA 2M88A 3FEZA 2IMWP 1C4CA 5D4OA 3UNYA 3HT3A 3FQKA 3C19A 2JEGA 3K8VA 4PPDA 3OZWA 2GAGC 2DR7A 3AHPA 1N05A 5HL7Q 4RDJA 5IYQA 2YNHA 3C14A 2WK4A 2CVIA 2CXEA 4X4NA 3Q38A 3VAFA 2XMUA 4KGVB 3JTPA 4YB7A 2VBUA 4OZ0A 4GRSA 4ZVEA 5J2MB 5LMNJ 1EQ0A 1N0VC 2UUCJ 2B4OA 4KO0B 4C3LA 4TU8A 2QO3A 2R4FA 3LP1A 2DO0A 2A0FB 3AOBA 4Y2MA 1I94F 2JNJA 2B9XA 3DDIA 2ZITA 2XZLA 2KFNA 4G7XA 2X53S 1I18A 1H6KX 4WZQA 3BSAA 4ZPAA 3IO1A 2NREA 4M4SA 1Y0HA 3W5XA 4PZVA 1IJFB 1BGXT 1W2IA 5A8RB 1RQPA 1JJ2R 1YVFA 2P9EA 3D7SB 1WTFA 3IS9A 5GAEI 5F9NA 3HSDA 2BJ3A 3OR1B 3KK1B 4OV6A 1TELA 2J0SD 2V7XA 2E1PA 1LFWA 3V6DB 3KDNA 4NPOA 2MYFA 2XTJP 4PWDB 4IW3B 4M1KA 5THWA 3FSYA 1XMQJ 1IBCB 5K8PA 2XO6A 2ZWOA 3G4SS 1OQ6A 5KG0A 2RILA 1MMLA 4R5PB 3RRKA 5F4MA 4LF4F 4HHUA 5E33A 4ETZA 3HM9A 3LGHA 3ILLA 4X2BA 2HNZA 2HGNA 2F8HA 3CJSA 3CMQA 3CC4B 4GC7A 4ZN3A 1R5NA 3QGPA 5HLFA 2AP6A 4KKOB 1ZETA 3W64A 2W25A 3HHEA 2ZZFA 5KSWB 3NG8A 1RJJA 2EW9A 3LF0A 1HQ2A 2F43A 1Q8BA 4NLDA 1Y10A 3KLHA 4P9SA 1CEZA 1ZA1B 3LWLA 5LMUF 2E29A 1RAJA 4PCQA 3A3OB 1Q79A 2XEXA 2KXFA 3NOCA 4Q7AA 3C66A 2F8EX 1KSPA 2VU5A 1VGYA 4RW8B 3GFHA 2PMHA 2DETA 4C0OC 3H2LA 3OR1A 2HDNB 1KVJA 2UV8G 4IO9Q 2DGWA 3S01A 2HNDB 4M5LA 4DZDA 4J91A 4HACA 3BNWA 3SXLA 3AB4B 2V5HG 4J9MA 2XHWA 3JSYA 5F8GA 4B3XA 1TKZB 3KUHA 3MFHA 2Y9HA 4IYQA 4I69A 5JXSA 1H72C 1ZA2B 1T02A 2DH7A 2YNIB 4B9TA 5KFEA 3I56B 2BJ1A 5KFCA 5EN1A 3R6GB 3AVVA 3VQTA 4CT8A 3NGSA 5LXYA 4NLVA 4ED8A 1C1BB 3TUJC 5L9NA 2BE9B 4CP5A 4YELA 4FP9A 5LXRA 3CRZA 2Y1JA 1OS5A 1LWCB 4DV5F 3V76A 1C0UA 5TR9A 2X51A 1HI8A 1XWLA 4WFYA 1U47A 4CH1A 1XR6A 3NGUA 5HP1A 4I6YA 1ZM3A 1TUGB 5ETOA 4NA2A 4DSIA 4KHPF 4XDDA 5FIUA 3AOCA 3G05A 3LTOA 2VD3A 1FNXH 1APSA 2WVEA 1GXUA 2W7PA 2MQNA 2OSRA 4HYKA 3QRPA 2C2DA 3OFHA 3MM8B 3M2RA 4TQRA 2J8AA 3V6DA 3HVTA 4QFMA 1X4EA 4CLPA 2AYBA 3RB0A 2CQDA 3H5YA 2KXHA 4KBIA 1VQMS 2WSSA 2CPDA 2AHOA 3T5KA 1AUDA 2RHSB 5F41A 2ZH3A 3HK2A 3PW0A 2VG7A 2H48B 1PCAA 2HRUA 4J9RA 4NMLA 4IR9A 4LSNB 2WB4A 2DIUA 1U1MA 2W01A 3IBFB 2UU9J 1RADB 1QLNA 1D9AA 3Q8YA 3CJKB 1KFSA 1J27A 4JV1A 3H94A 1HBUB 4NRTA 1HMVA 1WTHD 3O6QA 4QU7A 5D0HA 4M5KA 3LQVA 3PDNA 2RQKA 3D4JA 1QFZA 4LR8A 2ZHOA 1V0FA 1RKJA 4XL9A 2E5JA 2ZC3A 3MI7X 2KDOA 4AL5A 4H4OB 2X1FA 2D74B 5HMXA 2L9NA 2IYGA 4DFMA 1YLOA 2LEBA 2I0XA 2VFVA 4PUOA 3I96A 1X9SA 1QVFR 4Z37A 1D8ZA 3AVUA 1TFYA 5F8JA 3M8QB 2VNIA 2C3PA 2GVDA 1IBLF 1HNZJ 4M0LA 3A8JA 3M8PB 4B08A 1XMOJ 3VV2B 2EBEA 3GFZA 4P71A 4CLYA 4Y7CA 2C5BA 2ALZA 1NJYA 1WD6A 3PX6A 4G65A 3FGVA 3RR8A 3QWPA 4MK9A 3OPOA 5LMNF 5A8KA 3MF5A 4NXNJ 1EETB 2R2SA 3I55B 4X4OA 2U1AA 1VQPS 4E0DA 1JLBA 1JJCB 2IJNA 4TYAA 2B3TB 1VQSA 1T7PA 4NLRA 5KFUA 1Y4ZB 2OFHX 1H8EA 3ASSA 3MGJA 2C3OA 4I68A 2MKKA 4GQNA 3SYZA 2I1RA 4FKYA 1J5EJ 1FRKA 2YKNB 4LFAF 2M2BA 4C11B 5KFNA 2JFKA 4UOCA 2W24A 3TUPA 1OHHA 4DL3A 4F04B 4HTJA 1X9WA 3L7PA 4C0HA 2AEJA 1R8BA 4OJGA 5I42B 1D9FA 4U9UA 2YNIA 3NCRA 3VGSA 3FPKA 4A8KA 2WONB 2HBZB 3AODA 1RT7A 3MMAB 5J2PB 2QFIA 1RHQB 3OE7A 1L3UA 1F2HA 2ZH7A 4B3TF 2IC3A 3FBCA 4ECYA 1YX2A 1GMWD 1T8EA 4ENOA 3M2VA 3EVMA 5DDPC 2HHHF 1TAUA 4G1PA 2PEBA 2WRMA 1R8HA 2HNDA 3GLJA 1N32F 4RWXA 2HFZA 3FDSA 1KBRA 1N5SA 1A9NB 3UQSA 1F3VA 1LK7A 2DNGA 1Y0RA 2LYVA 4S0MA 3GFYA 2FJDB 3M30B 1VQ8B 3M2RB 2FHJD 3RB4A 4LR7A 2X85A 3CJ2A 4Q8EA 1QD1A 1S0UA 4K0KJ 5HANA 1QAXA 3MPUB 2RRNA 2DGOA 3GCXP 4KH1B 1DDGA 1UMJA 4RJVA 2EIXA 1S1UB 1N07A 3DKDA 1OWXA 3DU5A 5F8IA 3UPFA 1FD8A 1CLFA 1RT6B 2DITA 1Q82T 1SM4A 5D0RA 5H1SV 2P2CB 3TAMB 2F1FA 2C3UA 1V3RA 4P6VF 4NXMJ 4BPRA 4TSFA 3KK3A 1R7IA 3OVAA 3LP2A 4ED7A 1REVA 3CCSB 2C2MB 3R6KA 3H59A 2OK7A 3MMPA 1CJUB 2DY9A 4F0HA 2ZH9A 1DZ5A 1GEHA 1VQYA 2G13A 3BZQA 1VK3A 4X7DA 2YQ0A 1WJ9A 2DCUA 3UR3C 2HBRB 5KFKA 2X1AA 4M5HA 4GKKJ 2DR8A 3KJNB 1WSRA 3FJOA 1VBKA 1JLQA 1HNVB 4P1VA 2BA9A 1DQAA 4ZVPB 4Q45A 3ISND 4OZ2A 2V9WA 3LA0A 3EMTA 2V34A 4TT3A 3MMJA 1Q7YT 5HQLA 1S48A 4ZIVA 1JLQB 1HNVA 3K7RA 2ZD1A 3TA2A 4GKKF 5BYSA 4RDKA 4PWWA 5FDLA 1QSYA 2BEFA 2BPOA 4M5DA 1K73D 3AGPA 1R0CB 4KV8A 4FXVA 1N34J 2EK6A 3RY8A 1SUQB 1S9GB 2EPIA 4F2RA 3Q2SC 1WHWA 2W9BA 1CJUA 5J2MA 2HCJB 2FIUA 2XS7A 2MJUA 1N34F 3E8OA 4CYUB 3SV4A 3FC9A 2W8LA 1W2BR 4YAFA 1RA7A 2HQDA 3ZZRA 3H8YA 4TMTA 3F41A 4AD6A 2IRUA 1XNRF 2GAHC 1W7WA 2KI2A 1G6BA 3JB9k 1QTNB 1Y00A 3T1AA 3DDYA 4IG0B 3R1LA 4LF7J 5KFTA 1EP2B 2NXNA 4URGA 3BO3A 4RD6A 1I8DA 2K8GA 3M2UB 5E6TA 1XNRJ 2AT1B 4MKYA 3P5BP 4DV7J 1HBOA 2VBXA 4ZDNA 3UR0A 1PAEX 3CD6S 3IBWA 2JDIA 2UZAA 3SSRA 4H54A 4TN2A 2FLPA 2EFQA 3AJ2A 1BX1A 4Y2KA 1Z4UA 3G86A 4YEAA 1E6YB 2RQMA 4XOPA 1SXLA 4RNOA 5DZ6A 3ET6A 2N3LA 1BQMB 1KN6A 4XOTA 2VHGA 2CIMA 4EFAC 2AGQA 3IRWP 4LF9J 2Z6BD 3UDLA 2RE1A 4MH8A 2APOA 5A8RA 2YH0A 3EPGA 3KUGA 5LSRA 4LBPA 3P49B 2R9VA 2RQCA 1NDLA 1U6FA 1H38A 3FMWA 3VGUA 1Y3KA 4G6VB 3K89A 2HWIA 3DM2A 1YJTA 3OD2A 3KDOA 5IOLA 3CD7A 2GHWA 3V4MA 4B9SA 3LP1B 4WCEQ 3GJSB 4F4AA 2QV6A 4MIWA 3IWNC 2QYGA 2E5IA 3MM6A 2XWYA 1RB0A 3DOLB 3W9IA 1OGIA 3RZAA 1H42A 4CLLA 3KG4A 1NK6A 3HLUA 4XLCA 3BC9A 1X4BA 1QG0A 4JI3J 4WXWA 3BPSP 3DI6B 1FWPA 1GAQA 4TKOB 4N3GA 4YOEA 3T5LA 2VA3A 4OZ5A 2WW8A 3QNWB 4ROXA 2OPRA 3NXZA 2D41A 5AE1A 4KGKA 4ECVA 2QL5B 5DETA 1DG1G 4K5RA 1Q78A 4PG7A 3W2VA 1NDKA 1QVGB 5DDRC 4YEJA 2OI2A 4JI7J 1CQMA 1MWYA 3W1YC 3TI0A 2Q43A 1IXKA 1RTJB 4V1Ak 1RDRA 3DM2B 2RC5A 3JSRA 3PYFA 1HMVB 1DAXA 1OY8A 5LOQA 2F65A 3CJKA 4X4SA 3EE3A 4ED5A 4B3MF 4QIVA 4QWCA 2MPUA 4YDXA 4E8UA 4LF7F 3T5JA 4ELTA 4NL5A 2R7VA 1HWKA 3OXFA 1QUFA 2BM0A 3G82B 1S0VA 2WVBA 1N88A 4C48A 4K4YA 2Z2MA 4JI7F 3VAHA 3MAAB 3US5A 1WSVA 2K7JA 3GVLA 3CDAA 3ZO7A 1H85A 5KFRA 3NWGA 2PMZD 4EI2A 4XN0A 2MY7A 4YHHJ 1SH2A 1EZZB 1XB2A 2J9DA 4OOXA 2KG1A 4JI2J 5E3CA 1E79A 5CZVA 3OP1A 2QTLA 4AYBD 1TU0B 3BBCA 3AD7C 1U6ZA 3RGIA 3M8YA 1VF7A 4M94A 2IDEA 5EHHA 2B9EA 3QT6A 3BM7A 1G4CA 3C8YA 3U02A 1T05A 4WJBA 3BGUA 3WX4A 1UVNA 3K5LA 2AJ4A 3T1HJ 2PE8A 1P6TA 1NJXA 2ZL6A 3CDWA 3H2UB 2HQCA 1ZAWA 3PW7A 2OJ3A 4WU2A 3DHWC 3DDNA 2RH3A 3T41A 2EC0A 4N41A 1YGYA 1XR7A 3ELHA 4DQIA 2C42A 1WPCA 2XGJA 2QGFB 3W2HA 1FI4A 3M1VA 1MABA 1NLKL 3M6XA 1F20A 3V7AA 3IP0A 1KC8D 3BDPA 2VJJA 1VR6A 2FYXA 1RWPB 2DNYA 2ZWPA 2JJ2A 3JSMB 4Z4UA 3NMRA 4FYYB 2V4RA 2UXCJ 1NHKL 4ZPWR 1E43A 2V4JB 3EPIA 2W6JA 2FZKB 3AGQA 4W90B 3TWZA 3D1OA 3HSGA 1W35A 3AQPA 3D9BA 3QE2A 2QA4B 3MR3A 4DFKA 4ZVRB 1CG2A 3OR2B 4XD7A 8ATCB 2DKOB 1K8AD 3H25A 4O3OA 3K8WA 3B4MA 2MTLA 5THXA 5HXBA 2ZZTA 1L3VA 2FQQB 3CE8A 4HEA9 5KFHA 1TKXA 4U6PA 3TJAA 4ZGQB 1HI1A 1YZ6A 5DSZA 4ED4A 1N36J 1OGJA 3EJMA 2BM1A 1VQNS 1JB0C 1RE1B 1R0AB 4L72B 1M1KT 3AFGA 3C16B 1HI0P 3OJUA 4M95A 4RW7A 1SC1B 4RW9A 3QO9A 1AW0A 1DFDA 3QMQA 4KTQA 3Q86A 3R5DA 4DR5J 2CPXA 4WYLA 3CC4S 4ZPBA 2NPIA 4P72A 1S9EA 2JOQA 2XNQA 5I4MA 1XMBA 4B9NA 1YJ9B 4DFPA 3KHLA 1B0TA 2DVIA 1HQUA 1WC1A 1LV5A 1QJHA 4MT1A 3BV8A 3N01A 1WNEA 2G0CA 2ZZNA 2IM0A 3VAGA 3PJXA 4A8WA 4OX8A 3V5RA 4USMA 3ILJA 2Q6IA 4G3IA 3QFHA 1U6BA 3PUNA 4Z4VA 1BQEA 2LZJA 3WIUA 4B9UA 2FVGA 2R6HA 1FX4A 1WC0A 1Q7LB 2VKZG 2Z8QA 2ZXIA 4CI0B 3MOZA 2D9RA 1FE4A 3HD1A 2N7CA 3CCVB 1GR1A 1TL3A 1RTZA 1NB0A 4K4ZA 2F4NA 1E6YA 1K9MT 3OFEA 5F8HA 3BYPA 3QIDA 4X4PA 1NZAA 2W9CB 3CO9A 1PJ6A 2QMUA 3HVAA 1M1GA 5KT7A 1MMNA 4O23A 3W2FA 2DGTA 3H2VE 2V9KA 4NYZA 1OB2A 5E3RA 1KLNA 4FF2A 3PVDA 1GFWB 4ZVSB 1WELA 5GAGI 2FVQA 4M63A 3R3TA 3NS6A 3WNBA 1B99A 3MCNA 1YWXA 3Q23A 3CJ8A 3PFOA 5TV2A 4L8JA 4X7CA 1UL3A 1R89A 1X4HA 3WXMA 1N5YB 4RJLA 2H5EA 3WZ0A 4FKXA 4RCYA 4NCAA 4F7VA 1QUEA 4N56A 1KQSB 1CPZA 3CCTA 3CESA 1CULA 4ZKAA 2MMYA 1SIWB 1SI9A 3MMCA 3PJ9A 1I3OB 3RJMB 1Q5VA 5FDLB 4H4OA 3K17A 5KFQA 1FRJA 3M8RA 4ZP7A 4ED0A 1NK0A 3TZXA 3TVZA 1JKHA 4KKTA 3TX0A 2SXLA 1X4DA 2FDNA 4C97A 1YJNS 2PMWA 3DOMA 4USUA 3HPOA 2MQ8A 4PC7A 3W2WB 1HNWF 1KEKA 3CXCR 2XLIA 5EWGA 1BD6A 4CO3A 4F3OA 3Q2TC 2FC9A 4ZJLA 3LWMA 4P26A 2QN6A 2IIHA 2R8IA 2HZVA 3MAAA 4N8NA 4C98A 2VZLA 3ZBUA 2HMIB 3PVXA 1RHKB 4MKVA 4DR7J 1VQKB 2EEYA 3H98A 4DSEA 3MR5A 1VHOA 4FPRA 1NU4A 2XOKA 2X1BA 3KK3B 2FJBB 3CP8A 2QLJB 2YKMB 3HF5A 4HT7A 3N79A 2ILZA 1X4FA 3DRPA 1W25A 2DNLA 5HMZA 5KNLA 2VBTA 1VIOA 3IA0A 3EGVA 4YQWA 2HEKA 1BX0A 1K9MD 5J2NB 1QM9A 1LW2B 4F67A 3BN7A 1CJTB 3CJ0A 5B09A 5L1KA 2LA6A 4N77A 2CWKA 3SKBA 3M6UA 5C5JA 1VQ5B 2FHMA 4A48A 1C0UB 4PPZA 4Y28C 2DRDA 4C8KA 3IR6B 4P2FA 2OEJA 3R7BB 1Q0NA 1S12A 1SL1A 5A2QU 1SKRA 4CM0A 3T6JA 3BQ2A 1S97A 1TQLA 2RD5C 3P5TL 1A0OB 3W9HA 2ZVIA 1T0TV 5M2PA 1JX4A 1RABB 3TZWA 3CJRA 2BZ2A 3UO0A 1K1QA 4CCHA 3BGFA 4N5SA 4G1QB 3BR9A 2UXBJ 2Y3YA 1KDNA 5KFMA 1SQEA 1YBAA 4DV7F 3IAS9 1VQKS 2PMDA 3I82A 4F4KA 1TL5A 1HQEA 3EM1A 4I4BA 4G1QA 4QCLA 2HAIA 2D69A 4F4XA 4I1TA 4OV1A 2BANA 3OL7A 2DBBA 1NKCA 5CCLA 3AVXA 2G2YA 4RUAA 4II2A 4KYZA 4B9VA 4ES2A 2YPYA 3SEJA 5IQ6A 4DL5A 5L46A 4CDIA 3EVOA 3CW2C 1QAJA 5HKKA 4Z4WA 2YKNA 1NKEA 3AD8C 3HHDA 3R9LA 4DL6A 3CF5Q 4JYAF 2XMVA 3OR2A 8AT1B 3DLLQ 1QDUB 1FX2A 5KG7A 1X7VA 2RHQB 4NLXA 3HHLB 1HVXA 3AXKA 2V50A 3LANA 4B43A 5GMDA 4PWUA 1D3WA 2AJ1A 4MMOA 5DG8A 1KTVA 3RAMA 1ZM4A 1WHYA 2CQ4A 2GVZB 2KM8B 3IWXA 3OTDA 1NNDA 4LVNP 2GJ2A 1REGX 2Q6BA 4U8YA 3D6MB 3H0PA 2QA4S 5FLXU 2X8KA 2KJVA 1FK9B 5ETMA 1QAYA 4KKSA 1RWOB 1QSLA 4J9KA 4DQQA 2R2RA 4H4MB 1Q16B 4ZP6A 3CMAB 3SQGA 4NLOA 2ZH6A 1W26A 2W6IA 3JQJA 5DDQC 5HK4A 5ETKA 2VUGA 2IA6A 4OHWA 3PYEA 4K59A 1ZM2A 2HAFA 1VQNB 2HHUA 4Z2XA 4ZHRA 4FPIA 1KC8T 3F56A 3ZZOA 8RUCA 3R1HA 4NI2A 4JP8A 4PYAA 1FNCA 2XMTA 1VYAA 3GSDA 3AVYA 4I7FB 4E98A 1S1WB 1EP4A 2RU9A 2HS0A 3GIRA 4Y2AA 3OTOJ 5J2NA 4OYZA 3GU0A 3TX8A 5D3GA 1BLIA 4HACB 5HZAA 3BKTA 4HDHA 1JNZB 4K4WA 4I67A 1FRXA 4AE5A 5KFYA 4WFXA 2HLTA 3J7YU 2FVPA 4OQJA 3DRSA 4KQZA 3M8ZA 2P8IA 1DTQB 2NCKL 2CFXA 1WOPA 5KFXA 3N6NA 1WACA 5A89A 1X4GA 3OJWA 2FJWA 1YI2S 3L7OA 1DQ8A 1U1PA 3W60A 4R8UB 2CDQA 3I0SB 5CYQB 1NRKA 2CJ9A 2F4VJ 3OLBA 3G82A 5L9XA 1GAOA 3AA9A 2VB6A 2BKOA 4N7TA 1U48A 4J9NA 2BGJA 3D1QA 2R9LA 4AT1B 1GMWA 2DEUA 3DCAA 4QBUA 3M9OB 4J9OA 3DU6A 1BLUA 3D68A 2NS1B 3KG1A 3HJVA 5A8WB 2EFVA 1VFJA 1B7YB 3UWTA 3TJ8A 4JI4J 2PSZA 4YFUA 4P74A 3TQEA 4DSJA 2HVHA 4TU9A 4DI6A 1VK8A 4N3NA 2XZOA 1UVJA 3NBPA 4WU3A 2HVZA 3F73A 2OO4A 4KSEB 3ZTOA 1VQ9B 2EFPA 3CCUS 1QVGR 2VFTA 2CQGA 2DHGA 3C15B 3OW2R 2GK6A 2CNOB 5HZBA 4RPDA 3TA1A 2HQIA 2Q6KA 1VISA 5K20B 1VHIA 2Z4PA 3KK2A 2WJVA 1RT1A 1WHVA 2QA2A 1PKVA 3M9MB 5A76A 4QIEA 4A8MP 3CD0A 3J7Z5 2HZAA 3PRVA 1UD4A 4WFNQ 2DJWA 2AJ0A 3MEEB 2N7YA 4TMVA 4AXJA 3CWJA 2IM2A 3I0RB 3GG0A 1Q95G 4QYZJ 1YJ9S 3W62A 1NK4A 3ISNC 1GTHA 3KLEB 3HFVA 1HNXF 1CC7A 3R5AA 5D3GB 3QYYA 3IR5B 4DV5J 3GYGA 2OPSB 4WFBQ 3GIJA 4DUTA 2OELA 3NGTA 3NY0A 1RACB 1T03A 4CQJA 1HNZF 1BMQB 1I7PA 4RLEA 3BR8A 3I5CA 3VO1A 3OFFA 5AXKA 5DQIA 2DHHA 2JN9A 3MHYA 3W2EA 5H9EJ 3MAHA 2OTJB 4HKQA 4UY8T 3B6BA 2ZH8A 2CG8A 3W8GA 4WP9A 2EKNA 5BJRA 3VF0B 2GX8A 3IXQA 3GR0A 2H54B 5KG6A 4OOVA 2IMOA 3N4WA 4RNHA 4CLTA 5A8KB 4X66F 4JUZA 3CDUA 4E2FB 4FZVA 3UDEA 3G2XA 1WP6A 4DV6F 2EXUA 1WEYA 1VMBA 2R7TA 2QA4G 4ECTA 2G1DA 4RW4B 4KFBB 3A1PA 4ZPCA 4IFVA 4QVJA 3FBBA 2HNZB 1TKXB 4Z7CA 1XIQA 2BE2A 5CHCB 3QFWA 3PRBA 3PACA 1CJVA 5L8RC 4K5SA 1V0EA 2IVFB 1LWXA 5HVGA 5DLGA 1FKOA 2ZBPA 4ZCLA 2C3YA 4MKBA 3CMMA 1EXMA 1L3KA 2H5IB 4OJ1A 4UQTA 1FJ7A 1D2EA 2QLBB 3DRYA 1VRTB 2BJ9A 4JB8B 3KHHA 1G2EA 2GJRA 1BXNA 4ILLA 3LPYA 3KK1A 1FKPB 2CAJA 3L95X 2JDJA 1K47A 2CNKB 2J9EA 2JEJA 4A8YA 2LXFA 3H5XA 4A8SA 4N47A 4QOTA 2OTJS 2VQEJ 4MFBB 2CJXB 1J5OB 1KR4A 1X60A 1ZZFA 3LP0B 2IDLA 2ZBCA 3VTIA 2XBPA 5DS0A 4FN5A 2GQQA 2XNDA 1VQ7S 5I42A 4PABA 3R7SB 3VAMA 4RPFA 2AMCB 3OV7A 1IBLJ 4LSNA 1EX8A 5C2GA 4WFZA 5DQHA 1OPIA 2E44A 2HW3A 4C0BA 3KNGA 2HHSA 2LA4A 3BKUA 4L73A 3N0VA 1Q1KA 1ICEB 4DFJA 4OMFG 5KT5A 1IR0A 1XK8A 2VICA 1D1UA 1U4BA 2DIVA 3T56B 2KT2A 4ZA1A 1WG1A 2V6AA 4DLGA 4J9QA 2IYIA 4GKJJ 1W9XA 3B4DA 5EDWA 4U67Q 4ZITA 3B54A 4OHZA 2B56A 2KVIA 2LQ9A 4WFAQ 2XZDB 3PCOB 2G9OA 3VAIA 4GMKA 2QLFB 4KR0B 2GV1A 1EP1B 2YX4A 2PA3A 4BCAA 3A12A 2ZUGA 1QY7A 4H4KC 4FXDA 4EMDA 1RT4A 2I9SA 4NE9C 2MGZB 2RMLA 1R8AA 3GYNA 1H7XA 1N5TA 3W5UA 4OLPA 2LVWA 2R42A 3K5MA 3QGGA 1OMSA 1PBAA 3D6HB 2C2ZB 3OTEA 4OYAA 3UD4P 4ZP8A 2GFFA 2XSFA 2DXDA 4ECUA 3D3BJ 3ULHA 2E1MC 2RAQA 1NCLA 4Z4TA 2L9DA 4HI2A 2ZOMA 1GNKA 2VFSA 1Q9SA 4I6AA 4DPWA 1U02A 2MSTA 2VG6A 2K06A 1B2RA 1UW9A 4K4TA 1FT8A 1JKHB 4F26A 4H4KA 2C4TA 4ILRA 4Y3CA 2U2FA 2B9WA 5GADU 4HH0A 1E1RA 4TN1A 3M7VA 3DGVA 3I4PA 3CUNA 1R43A 1TVRA 1ACMB 3D6TB 3EXYA 3UD5A 2ZBIA 1KD1T 3LALA 1QUVA 3QFRA 4F3QA 3DI6A 3NP5A 3KK2B 3NGRA 1UD2A 3EGZA 1S79A 4ECRA 4OL8A 2K7KA 2IM3A 1HHQA 5HLFB 2Y1RI 2CQPA 3DLBA 1FESA 4PYDA 5FLXY 1VQLB 3ZC3A 2WZNA 3KG0A 5KT2A 3FPPA 3FEXB 2B4UA 2NYIA 2UVWA 1UVIA 3D0HE 4LFBJ 3FEYB 4ZPTR 4DPYA 3HHLC 1VQ4B 3MEDB 1N5QA 2YVSA 1HARA 5IYRA 3VCDA 1N8RD 4O3NA 2N4DA 1JLGB 1QE1A 3EX7B 5E2QA 3FUYA 4DWIA 2XQCA 2LDIA 2NUUG 2ZE2B 4XLHA 1IB0A 4LF4J 3LQEA 2KO1A 2OPQB 1D09B 2QN6B 3A3PB 1VC5A 4EYIB 1R31A 2OPRB 3UI3A 2IY5B 2DEIA 2C2RA 4USWA 4WK1A 2G0IA 3EVWA 2OPQA 2NV4A 2KU7A 4X8IA 1FA0A 3Q0AA 1BJKA 1MMDA 5K5MA 1QGAA 1WOOA 4C0SA 1NKBA 4IO1A 4QHYA 1AFJA 1IKYB 3CSKA 5KG4A 4PXCA 2LEPA 4KE5A 4DX7A 3PRDA 1XE1A 4PXBA 2LEAA 3Q8QB 1DQ9A 4NCNA 3DRSB 2DB1A 4TQSA 1SQFA 1HD1A 1RT3B 2IBKA 2LP4A 3PEHA 3FKBA 2B5JB 1UEKA 2KB2A 2J8SA 3ZC4A 5IM0B 2HHVA 1ZUNB 2I6WA 3GQCA 2QDXA 3KMQA 1JWWA 5L39A 1N5YA 2CRVA 2DD8S 1Y3JA 4DV3J 1HNIA 2GMLA 2M8DB 2JJ4D 1RT2B 2D3UA 1GMUA 1IBMJ 3LNNA 4QR2A 2UUCF 3CC7B 1YSJA 1P8GA 4OZ3A 4P6QA 4PXEA 5FO0A 3A3BA 1UJ5A 1SQGA 4PQUB 4KV8B 2XI2A 1T6ZA 2CADA 3PYDA 3TNVA 1KQSR 4XLFA 2V94A 2PLFA 3QO9B 4NMXA 2NQPA 1R5BA 3IFEA 4QR1A 4HDGA 1EP3B 4O3QA 1Q8IA 1YHQS 4FDFA 2DT9A 4TYBA 4ES3A 3K0JA 2CZ9A 1U1OA 2CQ1A 1X5SA 3HJFA 2GREA 1S4FA 4L3NA 1T94A 1S0NA 1IVZA 3DN9A 3QLHA 1RTDB 3NL0A 1UWAA 2QMWA 2EBGA 2W9AA 4R8UA 1AYEA 4AF6A 4KHPJ 3NRBA 2CPFA 4K4XA 4UY85 4J37A 1OSDA 5AE2A 4QZVB 2MSSA 4FS1A 3PHTA 1W0JA 2XZWA 4JV5J 3BSOA 1TLLA 2XLKA 1UVKA 1N33J 1X5PA 3KKFA 3OTCA 2BJDA 3FZBA 2KYZA 1NDPA 2GCFA 4OX7A 2ACYA 4OI4A 2JEFA 5TY0A 2J9CA 3MR6A 1CQNA 3NCPA 3RAXA 4FVCA 1JQGA 2PGCA 4RM0A 1N33F 3WIVA 2BABA 1M1KD 1T6XA 4NNJA 4JI8J 5K9FA 2BJ7A 1YITS 5C42A 4F3MA 2ZZMA 4IRCA 3LUYA 5C25A 2FLNA 3CCLS 4OYPA 5CABA 3CCJB 2Q1LA 4KO0A 2PT0A 4ETXA 1RQ0A 4KH0B 4XNFA 2N3OA 5H9EK 2X1GA 5FL7A 3KLHB 3DC2A 5B0CA 5MLCV 2YBVA 1S5ZA 2QL9B 1VQ9S 2VJUA 2CRLA 4ZVHA 4LQ9A 1NK9A 1S76D 5GV7A 1I1GA 5LT5A 3SI8A 3MAQA 5EUHA 3ZZYA 4PXDA 4PC2A 3KHRA 2E5HA 1N52B 3QAEA 3NEKA 4H4MA 4RD4A 3FZ2A 4DR3J 1OYEA 4X84A 1BHNA 1VQOS 2FZGB 3IRXB 3FKSA 4F0MA 3VALA 3T5HA 3IM8A 1IUJA 3PW5A 1FRIA 2Y1IA 4IQMA 4ZJQA 1WEXA 2VQFF 5FO1A 2D3LA 2XC9A 3C6UA 2H4YB 2GZOA 1PC4A 1VQ6B 4YMEA 3LO3A 3ZUGA 5F0WA 1VS3A 3PKYA 2DNRA 2MQLA 1CBKA 4DL7A 4G7WA 2C5HA 4X05A 5F8NA 4QIWD 5HBMB 5GAGU 4LSZB 1AUSL 1EAYC 5B0DA 4XM3A 4IDKB 1N8RT 2D9PA 3E01A 2GGPB 2W2OP 3N6LA 4ECSA 2CVEA 4B47A 5E3PA 4LF5F 2QYCA 2ROEA 2VPYB 2DY1A 5G0RB 2BSAA 1EFCA 3IAM9 4FF3A 1WHXA 4DUZJ 1NM2A 4FYWB 4P6YA 3TEHB 1PGZA 4F4WA 5KOWA 1RT5A 1FRNA 3MFIA 1LXJA 2LU1A 4OZLA 1F0XA 3UN2A 3AAWB 4TMZA 2IPOB 1F2GA 3EYZA 4ZK7M 2DYIA 1V3SA 1IN0A 1HWJA 2ASJA 3PW2A 3KYLA 3ICLA 5K14B 1SJ1A 2CQ2A 2EK1A 3DLGB 5FD1A 1WI8A 1RBLA 4OZJA 1FVQA 2D74A 3K57A 5E7OB 2BE2B 4XO0A 3AVWA 3QWUA 4HE6A 3G6EB 3MD1A 2PI4A 1YLXA 1ELOA 1FDBA 2PIAA 3KLIA 1HW9A 2DNMA 3ENAA 1K0VA 1X5TA 2HBYB 1C4AA 4UZUA 3ZIAA 2BVZA 4LF6J 2Z0GA 2Z57B 4NLGA 4O3SA 4N76A 3JYTB 3PR5B 2IFXA 1KKHA 4ZJOA 1N6QB 1WI6A 2E9TA 3W3SA 3EDRB 2R7XA 2DRAA 4MIAA 4XPCA 2ZH5A 4QPTA 2CQ0A 2XGQA 3VZIA 3JQPA 4BDPA 1OB5A 3R2CJ 2L08A 3DOKA 5JJBA 2FX3A 4DL4A 3CCJS 4B3OB 2A10A 2F40A 3MM8A 3D1HA 1RLDA 2W2NP 2MQPA 3SCKE 4I2QB 4WWVA 5ETRA 1QE1B 2NSBA 3VGVA 4M8LA 3ENVA 5FNZA 2P6SA 4YR3A 3VR6A 2ZKUA 4OJHA 3CMES 2UVUA 4Z4RA 2CPJA 4CT9A 2FJVA 4DK1A 5K8NA 2M0GB 1KMHA 2VJVA 3MEEA 1V5VA 2GO9A 4I6WA 1CULB 2HIQA 4DQRA 2DOGA 2GJIA 2HPUA 1GQEA 3KJVB 2FGCA 1IBKF 1XMQF 1MN7A 2ASLA 3VO2A 4OIXA 2GMJA 3TQ1A 1KVIA 3Q3AA 5HROB 5HROA 3Q22A 4DR4F 3WBZA 1PO6A 4HHHA 1UEUA 2DERA 2XS5A 1U2RA 4ELUA 3WQPA 1Q53A 1YBTA 3CPWB 2UUAJ 2NXJA 3FVYA 1HYSA 1URRA 4RX6A 2YKQA 1K8AT 5EGYA 2F7VA 3GCWP 4UOGA 1JLEB 4ZVOB 3P96A 2GS8A 3CC2B 1TZ0A 1IKWA 2VOOA 5SZTA 4CTAA 2WSFC 2GMHA 3CGIA 4DG1B 5E5NA 4IKAA 4JI0J 3TW0A 4TXSA 2ZC4A 3GE9A 4NA1A 2XO7A 5A6PA 5KFOA 3HCXA 3UCUP 4LT6A 3I55S 4DPOA 1D0EA 3X3UA 2BKPA 4WIIA 3R7NB 4P2XA 1NAQA 4ZHRB 3KUEA 4Q44A 1B0VA 4JV2A 1YKWA 4BLGA 5LM7E 1HA1A 3P26A 1ZBTA 1REVB 4DLEA 2R2TA 2ZZGA 2Q6LA 5B0FA 3PNIA 3OHAA 2QA1A 2C2WA 3BSCA 2VV5A 1XMOF 1RT6A 2QMXA 4OX9F 4IG0A 2ZXHA 4AUKA 4JI0F 2XLJA 2V4JA 1QUPA 5A88A 2XCAA 5KOXA 4PC6A 3OL6A 1HKAA 4LBIA 4UZEA 4Q2MA 5KG5A 4QWEA 4CLFA 1RCOB 1S99A 5D78A 1EP4B 1N06A 4PQAA 2GVZA 4B3SJ 1L5UA 2ADCA 2QT7A 5K14A 4XK8C 4W98A 1TUWA 1VRUB 2HNYB 2W9BB 4QW8A 3KLVA 5FA6A 4ZPDA 3GPAA 5KG1A 3ONQA 1T9YA 3CC2S 2XYPB 1FJEB 3R5BA 2V8HA 2MKHA 2UU9F 4KT0C 4XAKA 4CNZA 1GH8A 5IT9U 2Y8WA 1JLFB 3VMFA 2MQQA 2BJEA 3MZIA 4RW7B 1VBYA 2MHNA 1W2BB 5FJ4A 5L1IA 3DRRB 1FEHA 3MUTP 2I38A 2ROGA 1FKAF 5KFZA 3GONA 3JAMY 3UW1A 2ASDA 1R5OA 3HMJG 5DO2A 4ED2A 4C8LA 2D3NA 4Q2LA 2OBTA 3MCOA 1FK9A 3CCMB 2PN6A 3IG1A 4IH6A 3TAPA 1IR1A 3HZEA 4OYIA 2VZ9A 1S6OA 2CYYA 3HKZD 4A8OA 1IWAA 2Z56B 2HWTA 2VNKA 4ICLB 2MZQA 1OJ4A 2H5JB 4L6V3 2HVEA 1LWFA 5D6GA 1TUVA 1IKVB 2NPFA 2V2VA 4UOFA 3DOKB 2V8GA 2AYEA 3MPYA 3SCIE 5CZXA 5H5JA 1F60B 1Y0YA 5D0EA 5E0OA 5JMNA 2DGXA 2WOMA 4NBSA 4LBWA 3JSMA 1EETA 1UD6A 2XNCA 3QZ7A 2HKEA 2XM3A 1NSQA 3V6HA 1OYDA 1JXEA 2NZ4A 2V2KA 4Y00A 4LBVA 3CIMA 4EBEA 3LO8A 2UUWA 5IV4A 3BGOP 5J2QA 1WF1A 1AZSA 1Y5NB 4DV1J 4Z4YA 1P1TA 1DBDA 3QBCA 3HULA 4XKWA 3M8QA 3O8WA 9ATCB 5BR8J 3PM9A 3R2DJ 1FJCA 1QH0A 1RGVA 1E1QA 4X65F 3B8HA 3BKFA 3DLKA 2CDRB 3GTYX 3G6ES 2DGSA 3A35A 1UMKA 2OBRA 2IC3B 2J0XA 2V8DA 1M90T 2C78A 3G4SB 2CG4A 3BY2A 3H4BA 4DXLA 2OEKA 1R3NA 2OMOA 3ZTRA 3G8SA 2KTQA 2QFJA 5IT4A 3GIMA 5JBQA 3MM7A 3ES9A 2L48A 1IKXB 1TL1B 3LW5C 3QSIA 3D3CJ 2M4MA 1RWWB 1VDHA 2WR8A 3OQ2A 4W92B 3GJQB 5HVHA 2ZBRA 1G1XA 3C2PA 1KS2A 1KK3A 3IC1A 4LQ3A 2MLXA 1RAAB 4XLEA 3OW7A 3G71B 1JJ4A 2DPJA 1Q4RA 1RAGB 3H4DA 5KFDA 2DO4A 3R5JB 1CJVB 1C0TA 4G1IA 1TAQA 4NCGB 4PAAA 4KC5A 1I94J 4AQYJ 4DHVA 2VDHA 4USKA 2KXNB 3H90A 3PYGA 5HQMA 2CPEA 1GX5A 1Y5LB 3ADAC 4LIRA 3TZZA 4DQKA 3I32A 4II3A 4ZP9A 3CEDA 5KT3A 3BYRA 2EFOA 2FJAB 3SFUA 3Q24A 4HTIA 5HQ8A 2IM1A 1N32J 1BPLA 1T5EA 1A7GE 3MM7B 4ED3A 2D3O1 3RBXA 1WKLA 3S1TA 4JYAJ 2YTCA 2O1PA 2GC8A 2RVJA 1JNYA 2CPZA 2G2ZA 5D4NA 2E5GA 1OPZA 4DBQA 2R7WA 4CYUA 2GQCA 4D3HA 3DDKA 3I31A 3WHIA 5FIIA 2GIFA 1SH3A 3MM6B 4YXWA 3RBEA 3U1NA 4M5IA 2FHKA 4ER8A 3DOLA 4ZMMA 4A8FA 4XN3A 1W34A 4OPOA 3D5MA 1TK5A 5GVQA 2DGVA 1DDIA 1LOUA 2WVDA 5J1NA 3DRXA 2LECA 2GJPA 5EMNA 1JXLA 1UVLA 1RWVB 3HHKA 1J5OA 5IT9Y 4ANEA 4WXOA 1O51A 4OOSA 1G7CB 2VJIA 1NHUA 1MW7A 4DX5A 3CJ4A 4DS4A 2WB1D 1D8TA 1YJVA 5CH7B 4DQPA 2VBVA 3QJPA 4FF1A 3QPIA 1RBAA 2DCUB 5AXNA 2HS4A 3JQMA 4WTOB 4U96A 1WC4A 2A18A 2ZM6J 1XNQJ 3HT0A 4NLPA 1NO8A 1Z2LA 2MHEA 4LRCA 1D8YA 2UUBF 3BN4A 2IRXA 2HIYA 3LP2B 1KHWA 2WHOA 2E1CA 3CCRS 5DLFA 1RTDA 3A3GA 1U24A 4DQSA 5KG3A 3QLHB 3VVTA 3U1MA 1CNFA 1RISA 2RRBA 5AJ3F 3VNVA 1U7LA 4FXWA 2HHHJ 4YB5A 4WQMA 2YX7A 3CMEB 4LBZA 2C28A 2GW8A 1PYOB 1UD5A 2OK8A 1FF2A 2FLOA 4H9GA 5H9FJ 5HO4A 1VRQC 5CDFA 2GHPA 2AW0A 1J5EF 4DQLA 1XJWB 4M5GA 2JLEA 3WYAA 5BYQA 1HPZA 1SB6A 3QGHA 2FVSA 3D6FB 3O2IA 3IN5A 5KFJA 4EU0A 1CQXA 4G1BA 2E1RA 4O44A 1HNIB 1U1NA 3BO2A 3J7YI 4C3MA 5LSOA 4AF7A 2KJWA 4NXNF 4LBYA 2VG6B 4TLQA 1HBMB 2RKIA 2V63A 3UN3A 4K2JA 1R6YA 1R6VA 1YRTA 1M5PC 3QJJA 1BC6A 1DLOA 4YY3F 4CQ1A 4OX9J 2JC0A 4UW2A 5HN0A 3P8BB 3DXSX 4FYXB 2RRAA 1MN9A 4DSLA 2RS2A 4OHVA 1SC6A 5F8MA 5D77A 2VA2A 1PYSB 1KD1D 3CW2A 5D4LA 4YY3J 3GJTB 1CNEA 3PO4A 1MRZA 1K28D 4EK2A 1T95A 1WUUA 1VQOB 2B4VA 2BQUA 4F4ZA 4B3RJ 4KKOA 3C14B 3GJRB 2W4CA 3CCEB 3CCVS 3TOQA 4YUDA 2C77A 2AQ4A 1NZ8A 4A46A 1U8SA 4DG1A 1NBMA 1X4AA 3BCFA 3P4UB 2O01C 1Q7YD 3W61A 2C4UA 2V2ZA 1EFRA 2L3MA 3MMBA 2M9KA 5A8AA 2DR5A 4DX6A 4EZ6A 5IQQA 2CUYA 4I2QA 2ZDOA 2PI5A 1GO2A 4PWDA 3POTA 1UWBB 4AXIA 3CJ5A 2YNFA 1YHQB 1CSJA 3CMAS 4DZ6A 1PAUB 1IHMA 3LOUA 4F50A 1RWNB 4DL2A 2X3DA 1F6TA 1HHSA 1UPMB 4NCGA 3A1YG 4WIQA 1UD3A 1JLAB 3MECB 3I0SA 2HMIA 1RK8A 3KLFB 2CC2A 2MKSA 3LGMA 1T11A 3SLDA 1LWEA 2HK3A 3DMJA 3I6PA 4USIA 2BMWA 4A8XA 2XZPA 4F7DA 3HFKA 2HRYA 4ECZA 1RAEB 4RUHA 4EBCA 3PUMA 3AVTA 2OLWA 4CH7A 4Q8FA 5A0YA 2LKZA 5HMYA 1PC5A 3HAGA 4YB6A 3GQBA 1XNQF 1Y11A 3WNDA 1ULRA 2ABYA 3G71S 2KYXA 2QL7B 3QT8A 2Z30B 9RUBA 3MMCB 4JI8F 1TK8A 5C24A 1U0SA 1SBRA 3OFNA 4G6IA 2RU3A 5ETNA 3ZZTA 2GO8A 3BQ1A 3DLHA 1G7RA 1N4LA 2UP1A 2LU2A 3I5AA 4UUWA 3LPEA 4ZOSA 3R6JA 4ZLPA 2WBRA 1AB8A 3GVJA 1WG4A 5DG9A 4F4YA 3IR7B 2AHOB 1HR0F 3SQGB 2B6AA 1FX0A 2LQJA 4MYUA 2EG1A 4WZLA 3G96A 5B08A 2WAQD 1M5SA 2D7SA 4WTYA 4FBUA 3RBZA 1O6XA 4RDLA 2YX1A 4WK3A 1IJEA 3M8PA 2BUNA 1WORA 1KOHA 1PYTA 2O66A 5KFAA 2WOMB 1V5IB 3I9V9 2X0KA 4DR7F 4PKDB 1ZTTA 4A4JA 2ZTNA 3ET6B 3BH4A 2QIFA 3LAMA 4RO0A 3M8SA 2UXCF 2OUGA 1EB0A 1RCXB 4HI1A 2CNDA 2G1HA 4C8YA 4OHYA 2HQ3A 2HGLA 4YDDB 5H9FK 3OLAA 4LF9F 1NMEB 1H7WA 4ACAA 4PC1A 3PV8A 3IBCB 5D0GA 1NJIT 2XULA 3KJQB 4QYZK 1S1XA 1NPPA 2AGOA 2HQFA 2CK3A 3NGDA 3AT1B 2DNKA 4C43A 5KW9A 4USJC 4LFAJ 5L38A 2R8JA 1KRHA 2RB7A 5LMUJ 1BQNB 2OFGX 2HS3A 2HFOA 3HVWA 5HI7A 5A0YB 2CQIA 1RYSA 1KTQA 4ANCA 3W9JA 5IT0A 3ISXA 3E01B 3OEEA 2GJKA 4RD2A 1E3XA 3MM9A 4F0KA 3DLKB 4RL1A 4JI5F 5B0GA 2HWHA 5KFPA 4F8RA 3M6WA 1VJWA 4C8ZA 1AROP 3GSIA 2GPJA 3FBEA 3KLGA 1ROFA 2RQ4A 5EWFA 3MTKA 4ID5B 4IRKA 1EFUA 4PC3A 1S6QB 1VRUA 2HNYA 3C6UB 4DV4F 4M5DB 1U25A 1Z2ZA 4URSA 2RS8A 5GV8A 1MNEA 2V67A 1AA1B 2FD2A 3N6MA 1P27B 1LKZA 1VC0A 4B4DA 1RTIA 1B4SA 3KWMA 4GO5X 4N8OA 2IA0A 5KFBA 2KT3A 1GXTA 1K73T 1CVJA 5T41A 4WE1A 1RU1A 2NYHA 3G6XA 1RAHB 4LRFA 4U9RA 1SJ4P 2QSWA 3GZ7A 3HSJA 2WSEC 1GMVA 1UJ6A 1TL3B 2M52A 2VC0A 1PILA 3MDFA 3CXCB 3JXOA 2VODA 3UCZP 5CYQA 3CCES 4DN9A 4ICLA 2I8EA 2EFGA 2IBOA 3CD5A 3VR1A 4ZV4A 1O8BA 4DV4J 2KHCA 2V68A 1S0MA 4WWSA 2FVCA 2BBEA 1SUQA 2RUGA 4YR0A 3WY9A 1T3OA 5D4PA 2AZ1A 1FNOA 1H74A 3H5UA 1XBWA 4YHHF 4WE1B 4M5JA 3ZXWA 2A1BA 4M5NA 2HMAA 4NLTA 3W7BA 1N48A 5F9LA 4USHA 1SL0A 3S8SA 4UUXA 2JIZA 3ISZA 1HYSB 1DTTA 1UAWA 3FBFA 3ITHA 3THVA 2XYHB 3UDVA 1S49A 3CJTA 1LNQA 2CQ3A 3TUZC 2I5JA 4IH5A 2J7KA 3FRYA 3I87A 3QT7A 3C6TB 4QJVA 1KRPA 4FBTA 4LMZA 3M32A 2OSQA 1PJ5A 1GK8A 4B3FX 5SUHA 5DS7A 4JOUA 2ZJQQ 3UNGC 3CCSS 2QEXB 4E0FA 1UZHA 2YKAA 4RBVA 5TRDA 4BBYA 1LXNA 2B5JA 4R71A 2BW7A 1T05B 1FEEA 2W4PA 4B44A 2DGQA 1AMOA 4J9UE 3HVRA 3D66A 4NRUA 4X4UA 3PTWA 4XMYA 3OXLA 2MLYA 1EWYA 1GTEA 2UXDJ 2LXUA 4R25A 1E3ZA 1JA1A 1JJ2B 4CLKA 2W2MP 3BO4A 1ZH5A 4ASUA 2R8HA 1HW8A 3QT5A 1DJ0A 1FNMA 2Z2ZA 4RR5A 2FZCB 4YP3A 2BDPA 4P25A 3S6EA 2IHR1 2BJ8A 3P45B 1U1RA 4Y2IA 1WWHA 1HLWA 3OJSA 5F4OA 4QUZA 1JLBB 2ZNZA 3H5SA 2XB2D 2O67A 3E2EA 1FDRA 4CO2A 4CRJA 1ZPVA 2O3DA 4Q0BB 2JJ1A 4DR2F 2B5OA 2ZZQA 1S4EA 4ZVTB 1RT3A 1BWVA 1O0PA 2HZCA 4NZ7A 1QFJA 4R0EA 1U1LA 4DU8A 2D9OA 2QEXS 3TP2A 1VQPB 2W7OA 5CYMB 3SSQA 5IWAJ 3PENA 5KFSA 5DJBA 4Y9RA 2P3MA 4MKAA 3ZNUA 4J0QA 3NMAA 2GQ2A 5E41A 4AQYF 4P52A 4L74A 1RP5A 2V7WA 3VZHA 2BVNA 4C2MA 3O44A 3BQJA 4LUBA 3T3FA 3TEGA 2YWWA 1G3OA 4O0NA 2F9JA 2OGUA 2NXCA 3MWBA 3KXDA 2D3ZA 1YTYA 5J35A 1NH7A 2BQRA 1TVRB 5IS2A 3CCLB 2ZE2A 4LRAA 4F25A 3OPKA 5LJ3Y 4BC7A 1Z1ZA 2NXUA 3QFTA 4RW6A 4JI1F 2RC6A 2ZHBA 1NH8A 4YALA 3AOAA 3R5CA 5IXUA 1RA6A 4LFBF 1EKSA 2Q6OA 2BQ3A 3A3NB 4I2PB 4DSFA 3U1LA 1NB7A 2H3EB 2HVDA 3EGWB 4ZCKA 2R7QA 2AV5A 2XWXA 2GVDB 2ZH1A 1F9EB 1VJQA 4NA3A 3HX9A 1RHMB 2H4WB 1WC6A 2PFFB 3BSNA 4TY8A 2DEJA 2J76E 2VQEF 2UXDF 2HRTA 3KLFA 2HHWA 2E9ZA 3ZZPA 3MECA 2JL9A 3PXGa 5JUMA 5DM7Q 2BW2A 4XPEA 1AFIA 3SLNA 5HBMA 2OH2A 3TVYA 4KPCA 1QFYA 1RSCA 3ZTSA 4LREA 4NLQA 3VHQA 2HURA 4RU9A 3OZUA 3Q83A 5KFVA 4RD3A 5CXTA 4DPUA 2GK7A 3CCRB 4OX6A 4B9LA 2ZZEA 1KQKA 4RW6B 4X4VA 3HO1A 2AEFA 3MPWA 2VASA 1S72S 3EICA 2JSXA 2OP5A 5HP1B 1J9ZA 1C1CA 3UVJB 2BGIA 1TP7A 4ZCIA 2ZM6F 1XFOA 4CLZA 1OY9A 1RTHA 1NSKL 3TUIC 3OEHA 2E1BA 4LF6F 4PRFA 2WW4A 2B7BB 3BGRA 2GNKA 1SJ3P 4JI6J 1YITB 5GADI 4ACBA 1VI7A 3M32B 1FRMA 1Q81D 2KH9A 4OI0A 1JLAA 3R8YA 2ZVSA 2AJFE 3W63A 4C7QA 4ID8A 4RZRA 4B9MA 5B0EA 2XY7A 2H9ZA 4OI1A 1RT4B 2YXLA 3CCZA 4X07A 2AKWB 4UQGA 2XSJA 5C42B 4QV2A 4KGXB 3SCJE 1JK9B 2FGOA 5E3AA 1DLOB 4RCZA 3PG9A 3WQZA 1VQ4S 3J80Y 2QLWA 3CCWA 2WPDA 4YAOA 3GIKA 1Q81T 4P7VA 1NDHA 4GKJF 2M7SA 3R27A 1H3DA 2IJFA 2HBQB 2B8PA 1T9UA 1F9FA 3G87A 1LWCA 5ADZA 3E20A 2B7CB 3DLEB 2IRYA 1VQ5S 4RW8A 4UZBA 1MG7A 4YR2A 2B9YA 5IYWA 1LW0A 4DL0C 2HFNA 2A6OA 5DGAA 1HNWJ 3QRQA 3A4TA 4TMWA 1XQIA 1YK9A 1TTTA 4CLSA 2C2KB 4KAIA 1WU8A 4ERDA 4DR6J 1FHTA 3IGNA 3W5ZA 5CCMA 3G6YA 4JV0A 2FVRA 1I6JA 3FJ2A 2P9GA 2QGGA 3FCWA 1JB9A 4UOHA 1DHMA 3K58A 2RIJA 2YNGA 2QTZA 2KVQE 1S7IA 1DURA 3DOMB 3HP6A 2Y1LB 1U0HB 5B7WA 2YKPA 4RUCA 2Z2YB 5K8OA 1BMFA 4DS5A 5BSYA 2AF6A 2BXJA 3H40A 1ZAVA 7FD1A 2VF3A 2ZJRQ 2EG2A 1TKTA 1S6QA 4P3IA 2YQ3A 3KLGB 2HG4A 1S9GA 3V2UC 3GR1A 3GG1A 5KAKA 3MD3A 4Y9UA 3U6BA 4JI1J 1FRQA 4HR2A 3IS9B 3PFEA 1UCNA 2F9DA 3PA2A 4Q7JB 1NXIA 1AXQA 3FMBA 4DEZA 1YZ7A 2RDDA 3Q8SB 4NWBA 4KB7A 4FK8A 3PO5A 3KLEA 1FXDA 4DV3F 3KNAA 4YS2A 1FDAA 2B8QA 1WEZA 4ZVUB 1Q86T 1OB0A 1TV6B 1NPKA 2WYRA 3TZYA 4IRDA 4OHXA 2QSFA 2DNOA 4EEYA 5ETPA 4NCBA 4TY9A 2HLUA 2IAJB 2YWKA 2XY6A 4B3RF 2QZ8A 2BR0A 5IWAF 3OSNA 4LF2A 1SIZA 1CS4A 4YN3B 3ZTPA 2B7CA 3DLEA 3D0GE 2MQOA 3MTJA 2HFUA 2YNHB 1FRHA 2K1RB 2QTWA 3PX0A 3T1YF 1UKUA 2ILYA 3GILA 2E7WA 2Q79A 2WSCC 1T03B 1QVFB 4JI6F 2F63A 4IFYA 4DX8H 4ECWA 2RF2A 4QW9A 1G7CA 4QU6A 4RD0A 4LSLA 4KIAA 1UJ4A 3PIOQ 3ASPA 4U7UD 3M8WA 1FWKA 3QFSA 3PKMA 3I0RA 2DR9A 1RHUB 1KQFB 4ZVGA 3TVKA 1TL7A 4L3KA 1YIJS 1NJWA 1B3TA 1OY6A 2VPWB 3KFWX 4L76A 4K0KF 5LL6d 2BRKA 4WKRA 4UZFA 2NLWA 2ZFHA 1GX6A 3ZZ0A 2V8PA 3RYLA 3QRRA 2O5DA 2E5LJ 1S0OA 1YJRA 1RWXB 3RAQA 4IOAQ 3BQ0A 2HHTA 2BACA 3QIPB 1S6PA 4DR5F 3OZVA 3GV5B 3D2WA 4YAWA 2E5LF 1X5OA 4PG6A 2GIQA 3SJZA 3T53B 3VQSA 2V4QA 2BV3A 1JLCA 2DNNA 1Q82D 5KFLA 2JC1A 3J81j 5J1EB 2ZUAA 3GV7B
chains in the Genus database with same CATH topology
1YRUA 5EX0A 3LP0A 3OBIA 3TVZA 1FK9A 1R8PA 1JKHA 4KKTA 1X0PA 3BREA 2PN6A 4B02A 3IG1A 5G4DA 2SXLA 1X4DA 2FDNA 4IH6A 5F8LA 2P6TA 3NNCA 1B7FA 4IFYB 4C97A 5G0RA 3TAPA 3KEWA 5JVHQ 1YJNS 1FVSA 1X8DA 3DOMA 3HZEA 3SZ2A 2HLDA 2VZ9A 3HPOA 5KG2A 3VAKA 1M5KC 2Y0SD 3A8IA 1S6OA 1PJ7A 3W2WB 1HBNA 1HNWF 1KEKA 3CXCR 2CYYA 3HKZD 2XLIA 2LXIA 1BD6A 5EWGA 1PSDA 4A8OA 4CO3A 2HWTA 2QRRA 4F3OA 1FXRA 3Q2TC 4ICLB 2DHAA 2FC9A 3LWMA 2MZQA 1X9MA 2NSCA 2JH3A 4L6V3 1E6VB 2R8IA 1W0KA 4N8NA 1LWFA 4C98A 3HHLA 5D6GA 3V4IA 3OFGA 3PZPA 4NLSA 2HMIB 3PVXA 1HZEA 4IDKA 1TUVA 2HVIA 1U2FA 1IKVB 3SSSA 3WDOA 3F44A 2FB0A 2NPFA 3RBDA 4CO0A 2DGUA 4RNMA 5JVGQ 2XI3A 4RBUA 2K3IA 3DOKB 3PR4A 3H98A 2V8GA 2AYEA 3MPYA 1V9OA 3DYAA 4HLBA 5CZXA 1FCAA 3SCIE 3MR5A 1FRLA 1F60B 4FPRA 1NU4A 3K5NA 6FDRA 1CC8A 5E0OA 2R7RA 3K5PA 4P2SA 2XOKA 2X1BA 3KK3B 3SEOA 5LJ5Y 4Y34A 2DGXA 2FJBB 2WOMA 3CP8A 3TAMA 1S1UA 2YKMB 2KN4A 3JSMA 3HF5A 1FTCA 4Y0FA 5F3TA 1EETA 3D28A 1O5JA 1UD6A 4HT7A 2L9WA 3N79A 2ILZA 1X4FA 2RSQA 3DRPA 1W25A 3KTQA 2DNLA 3QZ7A 2M8HA 5HMZA 4Q5VA 5KNLA 1RTJA 3KOAA 1DRZA 1VIOA 3IA0A 3V6HA 2EKYA 4YQWA 1KNZA 1JXEA 1B0PA 2COLA 5J2NB 2NZ4A 4MJKA 1QM9A 1WTBA 3JU4A 1LW2B 2V2KA 3PX0A 4F67A 4Y00A 3BN7A 4QIFA 3IRXA 3CIMA 4EBEA 3CJ0A 5B09A 5L1KA 3PX4A 2K2PA 2UUWA 3OUYA 4LF8F 2LA6A 4N77A 2J0WA 1M5OC 2XSJB 1RWUA 5J2QA 4DR3F 1S1WA 4ED0A 2E66A 1WF1A 3M6UA 2RT3A 1Y5NB 1P1TA 4CO4A 5C5JA 1DBDA 2FHMA 3CCMS 4A48A 1TK0A 1C0UB 4AL6A 4PPZA 2MZ1A 4XKWA 4Y28C 3M8QA 3O8WA 4K4UA 4JI2F 5I3PA 4C8KA 3IR6B 3THTA 5B0BA 4HVZA 3PM9A 1TFWA 2FUG9 1FJCA 2VBWA 1RGVA 1E1QA 4X65F 3CTRA 2MKJA 1IKVA 1XERA 2AX1A 3B8HA 3AA8A 3RW7A 4J9SA 3W2VB 3DLKA 4DV2F 1SL1A 1YJUA 3G6ES 1SKRA 3T6JA 2WCXA 3BQ2A 3RTVA 2J7UA 2XY5A 2DGSA 1S97A 3OHBA 4NXMF 3A35A 1LWFB 1TQLA 3N9UC 2RD5C 2CZVC 3P5TL 3N5FA 3MCSA 4X64F 2J0XA 2IC3B 4ATNA 2V8DA 5M2RA 5C25B 3KJVA 1VBXA 1JIHA 1M90T 5M2PA 4GC6A 3OL8A 1N0UA 1JX4A 2GA7A 2ZH4A 2CG4A 3H4BA 3C46A 3EGNA 1R3NA 2OMOA 3G8SA 2BZ2A 3AQOA 1ZZNA 1K1QA 5DDOC 5A6WA 4CCHA 2KTQA 4O4GA 2YY3A 2QFJA 5IT4A 3GIMA 1C1CB 3MM7A 1RTHB 1KZLA 1IQZA 3BGFA 4N5SA 2YWGA 4G1QB 2L48A 1IKXB 3HZGA 3HDSA 5AE3A 4BHQA 3BR9A 4IG3A 4NOHA 2MXYA 2FJEB 5T7LB 1TL1B 5KFMA 1SQEA 1YBAA 4DV7F 2EVZA 3LW5C 3MM5B 3MM5A 3SDEB 3IAS9 1VQKS 3I82A 4F4KA 3MXHP 2DNZA 1RT7B 3CDEA 1TL5A 2JX2A 2M4MA 3MMAA 1HQEA 4I56A 4NLUA 1SJQA 4I4BA 1P1LA 2JLFA 2R8GA 3OQ2A 4G1QA 4W92B 4QCLA 4I0WA 5GMKa 2HAIA 3CP2A 5DGBA 4F4XA 4I1TA 4OV1A 1G1XA 2BANA 2CJAA 3OL7A 1FD2A 3C2PA 2GHVC 2DBBA 2BYCA 3DMJB 1H0HB 1KS2A 2DCLA 1NKCA 3DRRA 2YKMA 3IC1A 5CCLA 1QSSA 4RUAA 4II2A 2JLGA 4B9VA 1KQGB 4ES2A 4ED1A 5IQ6A 4DL5A 3FRZA 4HL9A 5L46A 4LQ3A 1JMTA 1QAJA 4QWDA 5HKKA 5GAHI 2ZKTA 2CZ4A 2YKNA 3FFIA 3HHDA 1NKEA 4DN0A 3LH2S 4CO1A 2ZTGA 4DL6A 3CF5Q 2X3GA 4XLEA 1S7HA 1RT1B 3OW7A 1U09A 2XMVA 4JYAF 1FKPA 2F1MA 1M5VC 3OR2A 1KLMB 3HHLD 4C9DA 1JJ4A 3DLLQ 3TANA 4DNRB 1HPZB 4C8OA 4RNNA 2DPJA 3EZ5A 4K2XA 1Q4RA 3H4DA 5KG7A 5KFDA 4TY8B 1X7VA 4YB1P 1FKOB 3U7JA 4NLXA 1HL6A 2DO4A 1HVXA 3HHLB 5J1PA 2YKOA 3LANA 1C0TA 4G1IA 4PWUA 1H8HA 1D3WA 1TAQA 4NCGB 2AJ1A 4PAAA 4MMOA 4KC5A 4DUZF 2FLLA 5DG8A 4HIZA 1KTVA 3RAMA 1ZM4A 1BQXA 1HBOB 1WHYA 2CQ4A 4P22A 2LLZA 3D0IE 4DHVA 1RYRA 4EUVA 3G8TA 2KM8B 3CIZA 3IWXA 1NNDA 3OTDA 2ADBA 4LVNP 2GJ2A 3MMBB 4X4RA 3ZFVA 1N56A 5F0UA 2KXNB 2CPEA 1X4CA 1GX5A 1Y5LB 2Q6BA 4MYTA 4LIRA 3I32A 4II3A 1UWBA 3CPWR 4WZMA 2QA4S 4ZP9A 3VWSA 3CEDA 4F02A 4XLAA 2VPXB 5KT3A 1IJEB 2R8KA 2X8KA 1S1TA 2KJVA 2MZTA 2R7SA 4OZ1A 1FK9B 1LQ9A 2EFOA 2V4DA 1QAYA 4NYPA 2FJAB 3AY0A 4KKSA 3SFUA 5L1LA 1SV5B 3BGLA 4XKVA 4HTIA 3Q24A 4J9KA 5HQ8A 1QSLA 3BB5A 4KFBA 3V81B 3OSPA 4IG3B 2IM1A 4DQQA 1BPLA