1NRKA

Ygfz protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
325
structure length
325
Chain Sequence
MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLHIEPLPYSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YgfZ protein from Escherichia coli suggests a folate-dependent regulatory role in one-carbon metabolism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords YGFZ Protein
total genus 68
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.160 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1nrkA03
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1nrkA02
3.30.70.1630 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nrkA01
1VLOA 1WOSA 1PJ6A 1NRKA 3A8IA 3A8JA 1V5VA 1PJ5A 3A8KA 1VLYA 1WSVA 3GSIA 1PJ7A 4PABA 1WOOA 1WORA 3GIRA 1WSRA 1YX2A 5L46A 1WOPA 4P9SA 4PAAA
chains in the Genus database with same CATH superfamily
4GQNA 5CAAA 2OMOA 4F0MA 3P4UB 3ETOA 3D9BA 3OXLA 1YQHA 1HBNB 2RRNA 3WC2A 3E3XA 2X1FA 3H4DA 3R6KA 5CZVA 4PABA 2ZH1A 3RRGA 1FJ7A 2DGXA 2IDLA 1H8EA 3IRXA 2IY5B 5EWEA 4UW2A 2E7WA 3CJKB 4PKDB 5F0UA 4C11B 3R6GB 4LF5J 2HNDB 2J0SD 1HWLA 2H4YB 1HBNA 1YTYA 2DO4A 4K4UA 1X4DA 3AVYA 4FF1A 4OI6A 2OEMA 4TLQA 1SH0A 4KGVB 2Z57B 4O3PA 2W4PA 2W4CA 2HMIB 3QT7A 3GIIA 4USIA 5F8GA 5CYMB 3VALA 1BWVA 4OX8A 4ZMMA 3DLGA 3QZ8A 4FVCA 4N8OA 2ZOMA 2I8EA 1Q16B 2OPSA 2BJ1A 1C0TB 4HLBA 1I3OB 5H9FJ 2BE9B 4AD6A 1SXLA 2BE7D 1RCOB 3UQSA 1X4GA 2MB0B 3FCVA 5KFZA 4NYZA 4DS5A 3OJXA 1CULA 4OPVA 2NYIA 5KFTA 1F1BB 4K4ZA 5D77A 1B7FA 4ANEA 2XWYA 4YB1P 2GIFA 2VPYB 3BDPA 2KT5A 3THTA 2B4PA 1VJSA 1GQEA 3G96A 1UZDA 2BE2B 4HH0A 3DRXA 3UD3P 2BACA 3TW0A 2OK8A 1T5EA 3T5KA 3PEHA 1DLOA 3NBPB 4J9SA 2X8KA 3DRRB 4FNIA 3SSQA 4LUBA 3QRPA 4FYXB 5EMNA 1FNOA 3OEEA 2EFNA 1RHMB 1NK7A 1KKHA 2KL8A 2RQMA 4OX9J 2V68A 5K14A 2ZVSA 4NRUA 4DN9A 4OI4A 3UE2A 4WJBA 1TK5A 4OOXA 2YQ1A 2DHAA 3SIPB 2D69A 2J76E 3QYYA 3B78A 3PRVA 2XSJB 4RW9B 2KJVA 3F0NA 2JN9A 4M95A 2E5GA 3D6HB 2Y8WA 1KTVA 3GR1A 3TAMA 1YJWB 4MFBA 1SQFA 2A0FB 2GHPA 5F8MA 3KDNA 1VQNB 3KLIB 4OZ1A 1N32F 5HLFB 3PYEA 4FF2A 2FC8A 2R8JA 5M2UA 3ELHA 4TY9A 4EWTA 1G4CA 3EXYA 3F44A 4TNOA 3OFEA 3AD8C 4C9DA 1RT6A 2V2KA 2FPHX 4P3YA 1FRHA 2HWHA 3KNGA 3BKUA 4QYZJ 3BGUA 4TU7A 4DV1J 1IQTA 3DGPB 1FK9B 2CJ9A 1S6UA 1M5VC 3OR2A 2AJ0A 3KHRA 4OYAA 4C6AA 2QTZA 4UZFA 2MQMA 1VS3A 1RTJB 4E2FB 2O5DA 2HHWA 5KFLA 5THXA 3VAGA 1TUIA 2W9BA 2W9CB 2RRBA 4DPUA 3HJFA 4AT1B 5L1LA 4F8RA 4OIXA 2R7TA 5LSRA 1XJWB 1QDUB 3WX4A 1SKQA 1GNKA 3DN9A 3R1HA 1MU2B 4ZVSB 1E62A 3W9HA 1TL3A 1JNZB 3MR7A 1RUSA 2RE1A 1P4MA 1E79A 1YZ6A 3UNYA 4QHYA 1EFRA 1EETB 4ASUA 3QGPA 3HKZD 1WG1A 3I4PA 1UL3A 1XMOF 4UY85 1FKPB 3KDOA 5D0EA 4IH6A 4Y2IA 2ASJA 3TZZA 2QA2A 1NHKL 2E1CA 1U48A 4YR2A 1Q7LB 4GVBB 5GAEI 1P8GA 2ATCB 3FRYA 2Q6CA 4ID5B 2HZCA 5ETPA 3EGWB 4ZITA 2JWNA 3GPAA 2HQGA 4KGZB 3SFUA 4KFBA 4NOHA 3G6YA 4PWDA 1G7SA 3R1LA 3BBBA 2CPXA 3O6QA 3E01A 1RWXB 2HQIA 2C78A 1LWCB 3HHLB 4XDCA 4LSNA 2DNNA 1XTZA 5HQLA 2IA6A 2WBRA 2K7JA 4K0KF 2UXBF 3KK2B 1U24A 4JI4F 1C1CA 5L9NA 3MZIA 3TQ1A 1HHSA 2M52A 3H25A 1N8RT 1Y0RA 1SBRA 3EZUA 3W2VA 2EFPA 5A2QY 2GCFA 5J1EA 1CEZA 1S12A 2R8HA 3BSCA 3N6MA 1DAXA 3QZ7A 5EUHA 1YJ9B 5KFMA 3JQKA 3BREA 3CD7A 1SV5A 3H9NA 1S57A 3KG4A 2P9CA 2YPYA 2D3OR 1WPCA 4X2BA 1HBOA 1K47A 3H98A 3EPIA 1U6ZA 4Q8FA 4I7FB 5A0YB 3G87A 2OO4A 2D9OA 4NZ0A 3G05A 4GVLA 4FPRA 1RWPB 2WYRA 4II2A 1K44A 4J90A 5FO1A 3OXFA 1NDKA 4HH1A 2IBKA 1XB2A 1QH0A 2VNKA 4H4KA 1M5PC 1ITPA 3BR8A 5LXRA 4EBCA 1LFPA 1KFDA 4OV1A 2VBSA 5IZHA 2DNRA 3RRKA 1EETA 4DCPB 1FVSA 4P6QA 4ZPTR 3ZZOA 2AGQA 2R7UA 3Q89A 2IC3A 2QT7A 3BH7B 2AV5A 5D78A 2MKJA 3PDNA 1HA3A 4NXNF 3P27A 5KFQA 4U67Q 2FLLA 2M4MA 3NNAA 2PI4A 3M8SA 4USMA 3A3GA 2B5OA 1U26A 3PA1A 2EVZA 2MMYA 4PUOB 4TYBA 3OZUA 4OYMA 5DG9A 4Y9UA 4IO1A 1F9HA 1JJCB 1HD1A 4G3IA 1EZZB 2HZVA 4CWBA 2YKQA 3EWGA 3BO2A 2UVWA 1VQ5B 4MJKA 2LFVA 1RHQB 4U7UK 5LSOA 5DDOC 1UZHA 3WZ0A 5J2PB 2V4QA 1YJ7A 3MPDA 2OPPB 3GQBA 3MEDB 2MPUA 1R6VA 2GMHA 3L9ZA 3IBWA 3ISZA 3S7RA 2VD3A 2V7WA 4RW4A 4DU8A 4B9VA 3K5OA 3CRZA 2CQ4A 1EARA 2IC3B 3J80Y 2UXCF 1IBMF 4U8YA 4I6YA 3AH6A 3CCVS 4DL0C 1S1UA 4QW9A 1XERA 1W2BR 3N79A 2QYCA 4N76A 3H5XA 1U7LA 4RU9A 4RUCA 3P3DA 3IA0A 3CCJS 3GONA 2YNGA 3SDEA 2BX6A 5K14B 2VFRA 4LF8F 3FJ2A 4O44A 4X4RA 1H74A 1RTHA 2NXEA 3PUMA 1KHWA 2CQIA 2XLKA 3ZTPA 2IVFB 2FQQB 2VFVA 3DXBA 5E41A 4ETXA 4KBIA 3QFRA 1N34F 5C2CA 3CT9A 5LMZA 5EN1A 4DWIA 2XULA 5J1EB 3L4BC 2YXLA 3SLDA 5B0DA 3N28A 2GJ2A 3W7BA 1DURA 3QRRA 4RBVA 3ONQA 1PG5B 2CXEA 3IGNA 1KOOA 2WW8A 2UUBJ 2CNNB 1ZH5A 2ZDOA 1VC6A 1VISA 3PUNA 4KJIA 1H7XA 1W7WA 2Z4PA 3LP0A 2AYGA 4XL9A 1NSPA 1RA7A 4B44A 2IMWP 5KFGA 4Z4ZA 1OS5A 1CC8A 4PC7A 1MN9A 3NGSA 3RAQA 1TL4A 3JTNA 1BXNA 3GYXB 2RHQB 1NKEA 1OB0A 3ULHA 3K5NA 4LRBA 1QGAA 2HLTA 3ZC3A 3NGDA 3QRQA 3QSIA 1VHOA 5IC6B 4LFCF 1CBKA 1RT4A 1UMJA 2P2CB 2J8AA 4PR6A 2W2NP 3CUNA 1HHTP 4DQKA 2CDQA 4OYXA 4FXVA 1IR2A 4YFUA 1U0HA 3HSGA 5KTQA 3K89A 4OI0A 1ZS6A 2ZJPQ 1MMLA 2BV3A 2C2RA 5JBQA 4PQUA 1WF1A 1S1XA 4K4VA 5M2PA 3M8ZA 2OPRA 1U1QA 4L75A 1RCXB 1JJHA 2OBRA 1WSVA 2N3LA 3K58A 2W9BB 1RU1A 1DZ5A 1BQMA 1V6HA 1Q82T 2PE3A 1UVIA 3R5CA 1GXTA 1RU2A 3CO0P 1MN7A 4MH8A 5F4JA 2XGQA 1E6YA 4EI2A 1RISA 4OJ1A 1VLYA 2OTJB 3M2RB 4NCBA 3CC4B 4WIIA 9RUBA 2MXYA 3GU0A 3N4WA 3N5FA 4WXOA 2WAQD 3Q8PB 4NYOA 1JXLA 3KYLA 4B9MA 4ENOA 4Q2LA 2QLBB 1B23P 2H65B 3K5MA 4LFAJ 4ALZA 3PO4A 2F1LA 4ECQA 1TL1A 4I6AA 1SQGA 2L9NA 1WHWA 3DHXA 1EP4A 3MECB 4YHHF 2DNKA 2Z2MA 2H5EA 2MZSA 2CPJA 1YJNS 3R6JA 4MFBB 4MT1A 4AL5A 3TOQA 5HQMA 4DV5F 1AIPA 1JQGA 2B4VA 3PCOB 5C7PA 4HKQA 2XG8A 4M5DA 1F60A 1S0MA 1C2PA 3EZ5A 4AE5A 2DGUA 4X7EA 1Y4ZB 2V9KA 1TAQA 2B43A 4O3OA 1U2RA 2R42A 2VC0A 3ENVA 1EWYA 3HT3A 2FX3A 1X9SA 4XR6A 3ENAA 3UI3A 2ZOFA 1X0FA 1N36F 1RT2A 3SQGB 3GTYX 4HVZA 1UD3A 4CLTA 2XI3A 3EMTA 4ZGNB 2E44A 3CTRA 3I6PA 4K4TA 5HVGA 3QJLA 1BD6A 3DRRA 4FP9A 2XMKA 2GZOA 4FYVB 3N6LA 4X64F 1KOHA 3EM1A 4Y34A 2DR9A 5IM0B 2D9RA 4NL5A 1WC5A 2BJ3A 2Q3PA 1HNVA 4LSLA 3W2HA 2BKOA 3UO0A 4MYTA 4KC5A 4Q8EA 3CCSS 1QVGR 2E1RA 4NLVA 2DPJA 1HIYA 4CO1A 5IOLA 1WDDA 4ITSA 5LMNJ 3CSKA 3GWCA 2IBOA 2QYGA 4NEYA 2LU2A 4P73A 4QYRA 2MSSA 3O5TB 1JJ4A 4W92B 4N41A 4ZN1A 3OPKA 1OQ6A 1VFJA 4MYUA 4J9NA 2PMZD 2ZXHA 4Y28C 1QTMA 3T9ZA 2LEPA 3R5GA 1I94J 1C0TA 2GAGC 3CF5Q 3KK2A 2FJXA 1LOUA 1UVKA 4PG7A 2AZ1A 4J5OA 1LWCA 4XOPA 3UR3C 5CYMA 5BYSA 2DNLA 4CM0A 4HE5A 1NDHA 3DDKA 1VRQC 4UAJA 2XMVA 5B0FA 1PJ7A 2V2ZA 3I55S 4YN3B 3AJ2A 4YR0A 2YH0A 3DGVA 3QT8A 1VIXA 5HROA 2HNDA 2DGSA 1HMVB 1S0UA 1O6XA 4C3MA 4NZ7A 1NHUA 3C6TA 4ZCLA 1FKPA 1GMVA 2B9WA 1OB5A 4X06A 1NEEA 1FTCA 4B3OA 3C19A 5FJ4A 4O3QA 3CWJA 4U95A 3VAJA 2QLFB 5A89A 2DR6A 2HS3A 4FXUA 4XD7A 5HK4A 4KO0B 3HHNB 3MM9A 3BDEA 3LAMA 3M8YA 1U45A 2C2DA 2D1CA 2JVRA 1VHFA 2NXJA 1K0VA 2D3UA 1N36J 2V7XA 3DOLA 4GKKF 3FRZA 2HRYA 1QVFR 2C77A 1FRLA 2XBPA 3TX0A 2ZITA 2J6SA 4OMFG 3GYNA 4TQSA 4WZMA 3R5AA 3CP2A 2DHHA 5L1JA 3GQCA 3VNVA 1HNZJ 2G13A 4IQMA 3A3OB 3R8YA 2GJKA 1TFYA 3OUYB 1OHHA 1QUVA 4OYWA 1IKWB 1RTDA 3V4MA 2IJRA 7AT1B 2CPEA 2Y1LB 2FVQA 3FMWA 3KLFB 2VOOA 1N05A 4Q7JB 5EGYA 1UMKA 4WK1A 4OI3A 3NS6A 5DQIA 1BQEA 1UD8A 2GA7A 1HQ2A 1M5SA 4CO0A 3LP2B 1JLGB 3WY9A 5BXIA 4AF7A 2HQ3A 3CCRS 2V67A 2MZQA 4YUDA 3BY2A 3AY0A 3RGIA 4ES1A 2JLEA 4NA3A 3HD2A 6FD1A 4F3OA 4D3GA 5K8MA 4G5GA 4P3IA 3CMMA 1RAOA 2QL5B 2Y1JA 3C66A 3L3CA 1E3XA 1RA6A 2UZAA 4YB6A 3C16A 4X4NA 1FKAF 2J9DA 3V76A 1WKJA 4K4YA 4RCZA 3RAXA 1OSDA 4KKOA 3GV8B 5HBMB 4NCNA 2RQCA 4DUYF 1UWAA 4LBYA 2CPFA 3HFKA 3MPYA 4ED1A 2JOQA 2AEJA 3SYZA 3FEYB 2I0XA 1ICEB 1TTHB 3AOCA 2E29A 1FNCA 3WIVA 4CQ1A 4HHHA 4WF9Q 1ZTWA 3BGRB 1YG0A 3TUZC 1AZSA 3FDSA 4WFNQ 4WQMA 4QWCA 1IBKJ 4K5SA 1K9MT 3PKMA 3CCTA 5A88A 3MM6B 3D0IE 3PFEA 4DPWA 1RT5A 3BGLA 3AA8A 1BC6A 1TUGB 3QATA 3BGOP 4ECWA 4ED4A 1UEUA 4CIOA 2I38A 1B0PA 4J91A 3LNNA 4RW8A 1HNZF 3ZUGA 5KFOA 1HYSA 1XQIA 9ATCB 3T9NA 3GVLA 4P9SA 2HNYB 4K2JA 2D3LA 1W2BB 1MNEA 3SZ2A 2POKA 1AUSL 3AVTA 4JBCA 4NA1A 2HMIA 1KR4A 1W0KA 1T3OA 4KAIA 4X66J 1GMWA 1JJ2B 5AN9A 3IG1A 3EUNA 3FK4A 5A6WA 2BANB 4GKJJ 4P74A 2ROPA 3OL9A 1ZM2A 1N0UA 2I2YA 4LF7F 2NSBA 1R0AA 5BJRA 4LIRA 2CF4A 3H2UB 2GQ2A 3LF0A 2DERA 2HPUA 2H5JB 1Y0HA 1EP1B 2F4NA 2GIQA 2E5LF 1UETA 2MY7A 3GZ7A 4KV8A 3CW2A 4UZUA 2AT1B 1KC8T 1YRUA 1NK4A 2C3OA 5JUMA 3N01A 3VGTA 2LLZA 4CO4A 5D15A 3R5JB 1G1XA 3HSZA 2CQ2A 3F41A 1U1NA 3MMAB 5ITHA 4NRTA 2DNZA 4ZV4A 3CJTA 1CJVB 3R7NB 3BJYA 1NMEB 2XMAA 4P6YA 2CJQA 3PIOQ 2DISA 1RSCA 1KLNA 2I1LA 1L3TA 2AKWB 1VBKA 2MEWA 2FLOA 1RGVA 4USHA 3MEEB 1U47A 5J35A 3CCLS 3VF0B 3C6UB 4ZPVR 4OX9F 2KXFA 3ICLA 4X65F 4A8SA 1FX2A 1UVJA 1WD6A 2AJ1A 3OT9A 3CULA 4DZ6A 2GQQA 3Q86A 1T02A 1HZEA 1V0FA 1SH3A 1FA0A 1PGZA 5C25B 2MZRA 2IYGA 1KVIA 1P9QC 3FKSA 4CM2A 5U47A 3MUMP 4ECRA 4I2QA 4EBDA 4B3TF 4PQAA 1IBLJ 4EGLA 4YHBA 1HR0J 4RNMA 2BVZA 2QFIA 1LWFA 1Q79A 1G2EA 2L08A 3NS5A 3CC4S 2WR8A 1FT8A 2OTLB 4XTTA 4LF7J 1YZ7A 2VZLA 5ADZA 2NPIA 5CCMA 2RILA 1SJ3P 2DNMA 3EYZA 1NK0A 3FSYA 1NSKL 3GFXA 2W9AA 5A8KA 3ZTOA 3K8WA 5RUBA 4X8IA 3PHEA 1LW0A 3BCDA 5KAKA 4JYAF 1N5TA 2BGJA 2XYHB 1SM4A 4UZBA 2VBWA 1N6QB 1VQOS 4X4PA 3TWZA 4WFZA 4IDKA 1U02A 3OTEA 3NWGA 1GX6A 5AJ3F 2HHHJ 3DLEA 3V81B 3FBBA 5KG3A 5GADU 3ZO7A 3HI9A 1S1VA 3NMAA 2B9XA 3M9MB 4DCJB 1KVKA 2FLNA 2DTJA 1YVFA 4XONA 3TR5A 3AOAA 1TQLA 3IR6B 1JNYA 3CJ2A 2W6IA 1S6QA 3LGHA 2HSEB 1UEKA 4L3KA 2ZM6J 2IYIA 2EG1A 4H4MA 3G4SS 3V6DA 4OLPA 1WSRA 2LEAA 1HNIA 2FY1A 3W3SA 3V6JA 3GILA 3V6HA 3W2EA 4YY3J 3MXHP 1NKCA 1JLEB 4TY8A 5C24A 4XLAA 4MMOA 1HA1A 1Y5IB 2CNLB 4KIAA 4DR7J 4LBZA 2AWZA 3GR0A 2EXUA 4DR4F 1AB8A 1NXIA 4I1TA 2FJBB 4IG3A 1JA0A 4YEAA 5KT7A 3BH4A 3KJVB 1PKUA 3I9ZA 1RACB 4LR8A 3QWPA 2R7XA 5DZ7A 4ZJLA 4PXDA 1GVHA 3AODA 1NPPA 8ATCB 3RR7A 3IMQJ 3R7BB 4HEA9 3C46A 1U2FA 1ZA1B 5I3UB 2R8IA 4A47A 2OTLS 2HZAA 2DYIA 2C5BA 4Z4UA 4NYPA 4B17A 2KVIA 1YI2S 4J37A 3U27A 2A2DA 1UVMA 4P2XA 4PYAA 2J9EA 3H59A 1YHQS 4OHVA 2IDEA 2EFGA 4X0CA 3HHDA 1QSYA 3DLLQ 4FKXA 2DEIA 1W35A 3M1VB 4B02A 1N56A 3FBCA 4RX6A 1S9FA 4DV7J 5DDPC 4YS2A 2R7WA 4LRDA 3TANA 4RW7B 2WVEA 4Q5VA 1L5UA 4ZLNA 4DCOB 4NLYA 2AX1A 2ZZQA 1RWWB 2RH3A 4DK0A 1Q8KA 3MCOA 5GV8A 1R8AA 2FJDB 2JFDA 3SXLA 1QFZA 1B7YB 2CJBA 2BQRA 4RZRA 3PYFA 1Y00A 3ASPA 1NM2A 4J9OA 4AQYJ 3QWUA 1HNXJ 3FVYA 1FXDA 2X53S 4ETZA 4BWJA 3OFNA 2WONA 2ZZTA 3OHBA 2CQ1A 1A0OB 3I32A 1RB0A 1KQFB 2ZJRQ 4LF4F 4ERDA 2VOPA 2P5VA 5KG1A 5KFSA 3OPOA 4PXEA 4ECSA 1NCLA 1TK0A 4K2XA 5LMNF 4IG0B 4B9UA 1X4FA 1FKOB 3B6BA 4JV0A 1OY9A 4B3SF 2K3KA 4BS2A 4KPYA 4DV0J 4IR9A 5D0GA 2JNJA 1TLLA 2O1PA 1I94F 1DY3A 2ACMA 4UQTA 1JLQB 2X0KA 2DRBA 1FHTA 3WNBA 4TMZA 4R8UB 4BWMA 3T5LA 1DQ9A 2VIHA 4ICLB 3J7YI 4P71A 3S01A 4J9UE 3MEDA 4QBUA 2CJXB 2WVDA 1G7RA 2DGQA 2MKYA 1OYDA 1MROA 3OTOF 2WTFA 4FWTA 4LT6A 1JLBB 4RD3A 4HIZA 5IYQA 3ITHA 2ZBVA 1GXUA 3I0SB 1I51B 3R2CJ 3V6DB 5F3TA 2EPIA 3BQ1A 2CQGA 4QUZA 3GFZA 2OTJS 2VG7A 4JUZA 2XC9A 4P7TA 3OTCA 1RHUB 3OKXA 2CPDA 4DR3F 1MABA 5HZAA 3VR6A 3A12A 4QW8A 3T1AA 2HVZA 4DV4J 1VQKS 4UOHA 4O4GA 3GVJA 1LWEA 2GVDB 5B09A 2HGLA 2BGIA 3R6LB 1JJ2R 5E2QA 1S4EA 3JYTA 4KGKA 4QIFA 2VC1A 3BYPA 2RIJA 5LMUF 1S1WB 1L3KA 2WOMB 5K5MA 1W34A 1RBAA 4AXIA 1SPBP 4C8KA 3UVJA 2UUCJ 5A6PA 1YKWA 4ZP9A 2EW9A 2V8GA 4N3GA 4RPFA 1KNZA 2PN6A 5FIUA 3IXQA 1BX0A 1TKXA 2CVEA 2VBVA 3DFEA 2ADBA 1IR1A 4TQRA 3B82A 2YQ0A 4Y7CA 4DNRB 3LQVA 2OYNA 2YKMA 4RPDA 2B5JB 1RTIB 3KG0A 2X6XA 3ZZYA 1JLCB 2VBTA 4DX6A 1KVJA 2E5JA 2KB2A 2LXFA 1T6XA 2YNHB 1O51A 1CS4B 1JIHA 3VVTA 2F4VF 3QGHA 2NQPA 3D6TB 2C4UA 4RBUA 2ZEJA 2ZL5A 4ZPWR 2UP1A 1S0VA 4S0MA 3GV7B 5H9EJ 3EVWA 4C98A 2YKNB 2OH2A 2CUYA 3ETMA 4DSEA 1TL5A 2BXJA 2XM3A 4QFMA 3PW2A 1FRNA 1HWIA 3SMZA 1Q95G 1TZ0A 2PEHA 1GMWD 3MM8B 4HE6A 4I2PA 3KHLA 3UCGA 1GK8A 4LSZB 4F4AA 4DV6F 2BN4A 2J0WA 1U0SA 2QSFA 4PPDA 2U2FA 1LNQA 3QGGA 2DEJA 4K4XA 1M90T 4ACAA 4TMVA 2NSCA 4DR3J 3IAS9 4RWWA 1N5YB 3O44A 3VGVA 2KXHA 2XY7A 2PO4A 2V9WA 1N48A 1B3TA 1BUXA 2B7CB 3MD1A 2CW5A 3UDEA 3DM2B 1U1LA 4DUZF 5DQHA 2M70A 3HZGA 1NK5A 2K1RB 1FDBA 3TVKA 4JI3F 2HIYA 3TRGA 5GAEU 3MR5A 4K4WA 2JEJA 2ADCA 1J27A 4UY8T 4DQIA 1WHYA 1I6JA 4LIWA 1VQNS 1V0EA 4YHHJ 1Q5YA 2H1YA 2N7YA 2HAFA 4Y6IA 1IKVA 2WZPP 2DNHA 2J0XA 2YNFB 2VJIA 4I6WA 2PIIA 5DS7A 4CI0B 3OJWA 1CNFA 1HD0A 3VZHA 4V19J 4RD1A 4B47A 1H85A 3CCLB 2MGZB 3PENA 2DH7A 3PJXA 4LF1A 2QE7A 4NBSA 3K5LA 3CCWA 1WACA 4M0LA 4J9RA 1FJGF 2C1EB 1TMMA 1F0XA 2YX7A 2RS2A 3OBIA 4F67A 3ET6B 1SCJB 2VPXB 2UVVA 4ED0A 1XBWA 3R3TA 5J2MA 2F9DA 1NRKA 5L39A 4Y2MA 3QSYB 1BGXT 2XOKA 3L95X 3EX7B 3EGNA 1K8AD 1T9UA 4LR7A 1D2EA 3GJTB 1FE0A 4R5PB 3CMES 4XIUA 2CWXA 2EWHA 1BX1A 4N56A 4X64J 2FJWA 3M2VA 1VK8A 2KKHA 3DMJA 1X4HA 4DFMA 3PFOA 3ZZUA 3ASTA 3W5UA 2Z8QA 4TU9A 3FQLA 2HQDA 3FZBA 4MIWA 2GJIA 1HVXA 2QJ3A 1WTFA 5FLXU 3F56A 3ZBUA 1J5EJ 1FWKA 7FD1A 2KN4A 3W2WB 2Q6BA 1XNQF 2QLXA 2VG5B 3EXCX 4NA2A 2QMUB 2FVPA 1URNA 4KTQA 2X3GA 2O01C 2GREA 3PA2A 4G65A 4MTPA 3T1YJ 1E63A 3HSDA 2N3OA 4EBEA 1BLUA 3C14A 1N54B 4FZVA 3AVXA 2D9PA 5KT4A 3TVYA 5GMKa 2CQHA 2QFJA 2VONA 3D5MA 3DLHA 2CZ9A 3AB2B 1U1PA 2GIRA 3PW0A 3W2WA 1E64A 2L3MA 1KJZA 3K0JA 4M5HA 4RJVA 3DNCA 1NKBA 2LXUA 2HHVA 3ZTRA 4C0SA 4CTAA 2CIMA 3AD7C 2QRRA 3JSMB 2ILZA 1SL1A 3PR5B 1J5OA 2Z56B 5CZXA 3W2FA 4WFAQ 3QLHB 4DLGA 1IR0A 1RAHB 3WQPA 1XEZA 3DI6B 2HCJB 5IWAJ 3P8BB 2F1MA 1H6KX 4WIQA 3M2VB 3O8WA 2ZD1B 5CDFA 4DU7A 3ILJA 3RR8A 4ED2A 4H4OA 1ZM3A 3PX0A 2C4TA 3VGSA 2DR8A 3PYGA 1QM9A 2OEKA 4M94A 4OZ5A 1N8RD 2A10A 2G9OA 5DM6Q 1YJNB 3UD5A 4EH1A 4B3GA 3KLFA 4QIGA 2XY5A 3OEHA 3NOCA 2HURA 4XLHA 4YP3A 5BSYA 2R7QA 2YH1A 3CXCB 4DR1J 3FSIA 3CJKA 2H5IB 4ZPBA 2DT9A 1MW7A 3TVZA 3IRXB 2FHMA 1VQ9S 1JA1A 2VQEJ 1X8DA 3R7SB 2W7OA 4DR2F 2CADA 4ED3A 2LDYA 1UTAA 4NXMF 3TJ9A 1TFWA 3A8EA 2Z30B 4ZN3A 4IFYB 5F8IA 2HHPA 2I6WA 3DLKA 4X62J 4PEOA 1URRA 4IFVA 3WXMA 1TV6A 1X60A 2CFXA 3CMAB 3KUGA 2CJAA 4QR2A 2HHSA 2XNDA 4ECVA 5E3AA 4KO0A 2VG6A 5HP1B 1WOPA 4NXNJ 3CD6S 4B4DA 2R7VA 2I9SA 4P10A 3GVKA 4DPYA 5J1PA 4CLSA 2F7VA 3HHKA 4OHYA 1TAUA 5KFEA 1R43A 1H7WA 3O1LA 2ZBPA 1C4AA 3R9LA 3MCAA 5K8OA 3NG8A 1YJTA 5DGBA 2R4FA 3BY1A 1SC6A 2PGCA 1RDRA 2XNCA 4CO3A 2Y0BB 2CZVC 3KLHA 2HBQB 4WWSA 3M2UA 4C8OA 3N5BA 1GX5A 5DZ6A 4LMZA 2DCLA 2HWTA 2RJZA 2V7TA 2H51B 4DR7F 3HCXA 2C2MB 4O3RA 3GG1A 2XMWA 1X0PA 5KFJA 1ZUNB 3G2XA 2ZVIA 1R5BA 2EBEA 2HYIB 2GPJA 4JV1A 3ZXWA 1YBAA 3CJ0A 3JS9A 3T6BA 1R8HA 3DOKB 4J9KA 1YDLA 5A76A 3ISND 3HVTB 1ULRA 1WF0A 5E0OA 4WZEA 1FFWB 4JI8F 1XE1A 1JLAB 1CS4A 2GVZA 1VQ7S 1X4CA 4EO6A 2PMDA 3HX9A 5MAOA 2GJPA 1G7TA 2UU9J 4GO7X 3BZQA 1U6FA 2DNOA 3SCIE 1FDDA 2APOA 2OHDA 4KGXB 2D3O1 3PTWA 2PLFA 4B08A 1H2TZ 3MMJA 5LJ5Y 4DQPA 4DL3A 3C14B 5I4MA 4LBPA 3ZPNA 4NXMJ 3D54A 5LSLA 2DGTA 3KL9A 4IUFA 2ZBIA 3OLAA 1NJZA 1PBUA 1RT1B 2R6HA 3I9V9 4Q43A 5CA5A 2EKYA 4NLRA 1DBDA 3KHHA 1S7IA 1WORA 2MYFA 2YPZA 2XS7A 1FRXA 1VRTB 3MCMA 1IVZA 2M7SA 3IS9A 3J7YU 1W2IA 1HPZA 3OFFA 4DSFA 3QFSA 4ZHRB 3J81Y 1M5OC 4G1QB 5AE1A 1QE1B 4O4GB 1RLDA 1ZM9A 2VU5A 2JVOA 3NNHA 2JC1A 3M2UB 3LAKA 2WPDA 4DDFA 4PC1A 4AF6A 4F36A 1MMDA 5EWGA 5FD1A 1SC3B 3G9CA 4MKYA 1YJUA 4E0DA 1YWXA 1J9ZA 2B0GA 2DHGA 2DHXA 3K2YA 3G82B 1SI9A 2ZZNA 4ROXA 3W8GA 2U1AA 4NLDA 1QGYA 2QA4G 2JHEA 3PRBA 3THPA 4B3FX 3CD5A 3PACA 2V63A 3HLUA 3M2RA 3JQRA 1X5OA 2IRUA 5C42A 1TKDA 1HKAA 4ID8A 1YJWS 1VQKB 2DYAA 1H42A 2QDXA 1U1OA 4IFYA 2BEFA 5CHCB 1CC7A 1RTZA 1REVB 3VAFA 1S97A 3H4BA 1PAEX 4OV6A 2Q79A 1FXRA 2CNDA 3GIRA 1HQUA 1VIOA 2QC3A 3DOMA 4USWA 1K1SA 2P9GA 4WYLA 5H9EK 2FD2A 3OP1A 2OIHA 1H8HA 2V50A 1DRZA 5IT9U 4G1IA 1IKYA 2X1AA 1VQYA 2QLJB 3SCKE 1U1MA 2VBUA 1RT3A 4WTYA 1B4SA 2F43A 3SEOA 1EFCA 5AE2A 2BJ8A 2XNQA 4ILLA 4RW6B 3SFGA 4B3MJ 1IBLF 3DLJA 2OD6A 5KFBA 5ETLA 4Y9RA 5EX3A 5A8WB 4DF8A 1QGZA 3OL7A 3CJ5A 1FX4A 2HVHA 2LQ5A 5GAGU 3ILLA 2BKPA 4C0HA 3QFCA 1HBMB 2C22A 4EFAC 4PPZA 4RDKA 3IO1A 1MSWD 1XIQA 4TSFA 2RHSB 2P8IA 2HMAA 2AGOA 4H9GA 3MAHA 5EWFA 2OPQB 2LU1A 4PG5A 2BW7A 3CCMB 3ZZ0A 1QD1A 4X7CA 1XMBA 4MAKA 2F4VJ 3OXGA 1VCTA 4K50A 3RBZA 2YNHA 3WNDA 4CH0S 2E9RX 5HJXA 4Q45A 2C3YA 3QNWB 1NJWA 3IM8A 4WTOB 2CKWA 2ZXIA 1AYEA 1YBTA 2E1BA 1AA1B 1TVRA 2VQFF 3M32B 2YKMB 4PG4A 4F4KA 1UWBB 3THVA 1IB0A 3MTJA 1Q0NA 1VQLS 1KLMA 4F3MA 5BYQA 4I56A 4DV1F 2XZDB 1LKZA 1JKHB 2QTLA 5HJYA 4JV2A 2EK6A 4KHPF 2VNHA 2HBYB 3IBCB 5IQ6A 1RWVB 1S1UB 2JDIA 2ABYA 3KJFB 2KVOA 1VRUA 1Y11A 2Z6BD 2MLZA 2W25A 4NPOA 3W9JA 1FCAA 2RU9A 4B3RF 4M1KA 2MJUA 4NZ6A 1S1VB 3A3PB 1L3UA 1S59A 4Z4WA 3CCJB 3B4MA 3AJDA 2BR0A 3IS9B 4WE1A 1RWNB 1VRTA 4QCLA 1Q7YD 4FK8A 5KFXA 4JI2J 1JMTA 5IYNA 1XNRJ 1GXLA 4WXWA 4ZCIA 1VF7A 2LA6A 3HVWA 5FNZA 2F8HA 3OSNA 3VR1A 4KHMA 3NGTA 4TU8A 2F63A 1RT1A 2QN6B 3TA2A 2CZ4A 2QA1A 3PX6A 4USUA 3K59A 3CEDA 3J80U 5KFWA 3V5RA 4IOAQ 2NXCA 3TYTA 4WZKA 3I56B 4YMEA 3DDIA 4Q0BA 1MWQA 4DHVA 2RDIA 4CQJA 2GMLA 4F7VA 4K7QA 1FTRA 2DEUA 3CIMA 1D8ZA 2XQCA 2EKNA 2JJ2A 2VASA 1Q8LA 3VMFA 5IYWA 4TXSA 2H9ZA 1Z2ZA 3P96A 4L72B 2BPOA 2LP4A 3W2GA 2DH8A 2PIAA 4HHJA 4N5SA 2V31A 1Q7YT 1M90D 2B51A 4G1VA 3WBJA 3GLJA 4ZP6A 1BQNA 2D41A 4HTIA 2MKHA 2BKNA 1D09B 2DRAA 5GVQA 2GK6A 1IUJA 3PJ9A 3RB3A 2R2TA 3KLHB 1CG2A 1O5JA 4DV0F 2QGGA 2VKRA 1UPMB 3CGIA 3V4IB 3J81j 2BDPA 5FA6A 2YX4A 4KSEB 3JQMA 4RD2A 5CQGA 1KQSR 4P2NA 1VDHA 3LPYA 4RW7A 4ER8A 5ETRA 4QIWD 1XMQJ 2YKNA 3AFGA 5E7OB 1CJUA 2HWIA 2DR5A 2DH9A 2PMWA 2HHUA 1S9EA 1GO2A 2VG6B 1RAEB 3AAWB 3CD0A 3KLGA 4JOUA 5H9FK 4PWDB 2CK3A 2JEGA 2HLUA 3OTOJ 4DR5J 4WU2A 4ZCMA 4UF4A 1AMOA 5F8LA 1MWYA 5ETVA 4ELVA 1NNDA 2X51A 4LBVA 1UJ4A 2OK7A 4XNFA 2DCUA 2HFVA 2R2UA 2EC2A 1I18A 2COLA 4HACA 4TMWA 2DGOA 4HL9A 2AHOA 5HVFA 2FDNA 3CMQA 1NB2A 2V8HA 1E6VB 4QU6A 5D0RA 3PW4A 2RD5C 1RAGB 3BV8A 4DUYJ 2LVWA 5K8NA 1RWOB 2FHKA 4LFBF 3CJ8A 3TJAA 3JQJA 1R8BA 1Y0YA 4DLEA 2RF2B 1R5NA 4PCQA 2GHWA 4YOEA 2RKIB 3DRPB 4A8YA 1Z2LA 4ZA1A 3WQZA 4RBTA 5AXMA 3JYTB 4QPXA 1HHQA 1WHXA 1COWA 4XN0A 3G71B 3RZAA 1IBMJ 2FHOB 4ZVGA 4OZ0A 4LQ9A 3M05A 3TAPA 2XZWA 4KE5A 3MFIA 3U1MA 3PHTA 1DQAA 1X5SA 4XPCA 3NLCA 3JB9k 2DJWA 3JSMA 2QGFB 1NPRA 4Y2CA 1HL6A 2DD8S 4X4QA 3U6BA 4RUAA 1JLBA 3FCHA 5D4OA 2O66A 4DQSA 4X62F 4RLZA 4XM3A 1XQBA 1Q81D 4XLEA 1N6QA 3ZBTA 4J9LA 4Q7AA 1UWBA 3FGVA 2L48A 1QVFB 1N34J 1F5CA 4GKJF 4LRAA 5CH7B 3PO5A 1DARA 4ILMA 5A8RB 3HPOA 1FXLA 5A8KB 1D9DA 4F2SA 5CYJA 4QVAA 2AJ4A 4A46A 1PC5A 4OYPA 4CLLA 2BBEA 2DIEA 3MCNA 4CLZA 2GJFA 4LVNP 2WB4A 3B4DA 3OTBA 4NI2B 4W4MA 2FTRA 2V7VA 3T56B 2ZH3A 3CJ3A 3SV3A 1PSDA 5G0RB 4FS2A 4ZPCA 8AT1B 1Q8BA 1IKXA 2OSQA 1H2UX 4PRFA 3V2UC 1RYRA 3NY0A 4KPCA 3DMJB 4R0JA 4DUZJ 2FB0A 3CCZA 3CW2C 2WCXA 2BE2A 4LFCJ 1PJ6A 5E3QA 3HMJG 3CC7S 3LP2A 2V4JB 1QG0A 4B3XA 3RBDA 1KD1D 4P2MA 2M0GB 1S77D 1UEVA 4YAUA 2CQCA 4JI8J 3QSYA 4F4YA 2ASDA 1TP7A 4RD4A 2HVEA 1BQNB 4X65J 4KB7A 4YAFA 3OZWA 3DYAB 4IO9Q 4LREA 2IVYA 3PYDA 3OUYA 1T8EA 2W6JA 3N6NA 1SIWB 4QWAA 3I82A 2ZH6A 2FY8A 2IHR1 1FJGJ 1FI4A 5HP1A 1HQUB 3MMAA 4IOCQ 5CABA 1VJQA 3IP0A 4CO5A 1IKVB 3CDBA 4ZIVA 2BJ9A 1HWKA 2DXEA 5L46A 4LF5F 2KZZA 4FYWB 1LW2A 3AQPA 1UP1A 3LPEA 3P45B 1S9GA 3Q8VA 3KLGB 3PEJA 5D0HA 3VAHA 1W25A 2C3MA 4KY3A 4C11A 4B9LA 2IM3A 2E1MC 5C24B 5HQ8A 3OHAA 3MMPA 4RL1A 3TEGA 3BKTA 4USJC 1B64A 3H5YA 3G82A 5LL6d 1H0HB 3UFCX 1N5YA 3HHLC 4H4MB 3Q0AA 2CQPA 2OELA 1RHKB 2PI5A 3KLEB 4DV5J 4NLGA 2DIUA 4GMKA 4F02A 1D8TA 2R7OA 2X1GA 2XO7A 3W5YA 3MAQA 3T51B 4DF4A 4P1VA 4FKYA 2R9LA 1F3VA 4UZCA 3DCAA 1DTQA 2CBXA 2V34A 4RM0A 2RDJA 2KDOA 3CC7B 4KR0B 4YR3A 1CQNA 2WVFA 3FNNA 1YIJB 1S72B 4PXBA 1IHMA 4B48A 3TZXA 2VZ9A 5I3QA 4IDKB 3CCQB 3MMCB 1B70B 3ZZZA 2YWKA 5F3ZA 4DG1A 3KMQA 4IKAA 3JSYA 1ZBTA 2C2OB 3OW2R 3RBXA 2VBZA 2EEYA 2UV8G 1VQLB 3MM6A 2HNZB 2M8HA 3FFIA 2IM2A 2CVIA 5J2NB 4ZDNA 5BR8F 3W2IA 1RAJA 5KFIA 1RWUA 5JXSA 1KWMA 1A7GE 1TVRB 4O3SA 2XI2A 1U6BA 1HW8A 1VQMS 4P2FA 1FWLA 4KHRA 3MDFA 1S7HA 5ETNA 1WC3A 4L76A 1U09A 5F4OA 2R8GA 3OVAA 2MZTA 1RWMB 2P9EA 2NUHA 4IH5A 2DY9A 1D9FA 2OBSA 3AA9A 3AVWA 2J9CA 3UVJB 1SJQA 1NB0A 3GJQB 4G7XA 2F65A 4QWEA 4RU2A 1KMHA 2C2WA 2YNIA 3OTDA 3GV5B 4EU0A 5HSPA 5L1IA 4Y65A 5LT5A 2WJYA 1CJKA 4N7TA 2IAJB 2HFSA 1RAFB 1WUUA 1OQ3A 5F8NA 4OYIA 1VRUB 1NDLA 1YGYA 1WKLA 4DPTA 3TARA 2VG7B 2HHTA 2QLWA 1QAJA 3Q38A 4P2SA 5CCLA 4QIVA 1VR6A 5HKKA 1IJFB 2M88A 4G1BA 2HEKA 1HW9A 1WEXA 1UFWA 1NDPA 4DV7F 4M5IA 3GCXP 2X6WA 3OW2B 5DGAA 5B08A 4BPRA 2OUGA 2WSEC 3RBEA 4TYAA 2LDIA 3BN7A 3POTA 2GX8A 2RF2A 2DNPA 1SC1B 4NE9C 3HHLD 1UA1A 3PY8A 4ZIWA 1PYTA 3MF5A 2B4OA 1S0OA 5ETSA 3Q8RB 5HXBA 2K8GA 4C3KA 1NH8A 4AVZA 4IFVB 2R7SA 1RADB 1SVDA 2ZNZA 3DLBA 2E1PA 2PFDA 1APSA 4TN2A 3KUHA 4OPOA 2MQ8A 4M5JA 2C2EA 2IJNA 2F5GA 4IR1A 4OOVA 1NB9A 3BO4A 3BSAA 3W64A 2R3VA 3DOLB 1RKJA 2GFFA 4M63A 2GGPA 2BZ2A 2VV5A 1D1UA 1KSPA 1FRMA 3BR9A 5KW9A 4QJVA 3VAKA 5KFHA 4JI5F 2ZTNA 4XORA 3H2LA 5KFDA 3ES9A 5IT9Y 4HT5A 4NNJA 6AT1B 3GB0A 3US5A 5GAGI 3D1QA 4DQQA 1S48A 4NLWA 3QJPA 2WJVA 3N9UC 4KRWA 2HG4A 3CCSB 3U02A 2JH3A 2W7PA 4RUBA 4L8JA 1B0TA 4RNNA 2RRAA 4LF2A 3GJSB 2IM0A 5AXNA 1WEZA 3R5BA 2HVIA 4W98A 3W5ZA 1R31A 2Y0SD 1Y9OA 1OIAA 1T94A 3Q8QB 4M53A 4LBWA 3KOAA 1YRTA 1D1NA 4P26A 2DPIA 2ZHOA 1D9AA 3AXKA 3BPDA 1VQMB 3QIDA 4II3A 3QFHA 3QBCA 1EXMA 3C3LA 1UD6A 2GO9A 4ZPDA 2Q6OA 4F2RA 2UVUA 1W9XA 2GJRA 1EFUA 4BHQA 1AZSB 4BDPA 1PKVA 3I0RA 5IK2A 3SI8A 3WHIA 2VUGA 4ELTA 1OWXA 5J3OA 1SJFA 2CNOB 1V5IB 1FESA 2JLFA 3BCFA 3FFIB 4LSLB 2ZBUA 5IT4A 3SKBA 2HNZA 3K7RA 5T14A 1FO1A 1ZYQA 4E8UA 1GTHA 1C4CA 1UVNA 3JSBA 2J6TA 1SKWA 2KHDA 3UW1A 2QMXA 1HNIB 4Z4YA 5CD4H 5D4LA 4LRFA 2QG9B 2JC0A 3SQGA 1V3SA 4CH7A 1KEKA 3NEKA 4P52A 2HHQA 2XZPA 3CDUA 2A6OA 4U7CA 3Q8YA 1N32J 1UD4A 2ROEA 4CYUA 4ECUA 5FLXY 2V4RA 5IV4A 1VLOA 3VQTA 3OOCA 3W66A 4EEYA 2ZBCA 3KK1B 3ZZTA 2ALZA 5DO2A 1DTQB 2BRLA 4ZHRA 5IYRA 3FEZA 1OO0B 2IMOA 1HI1A 1TKZB 2KO1A 4XKVA 4C3LA 1HPZB 4KH0B 3MR6A 5DSZA 1MWZA 3SCJE 5ETQA 2KI2A 4NLPA 3H5UA 2C3UA 4ZVUB 3QAEA 4V19X 3VZIA 1KN6A 2GMJA 2FVRA 3MECA 2ZZFA 5FDLA 4PGOA 3BO3A 3UCUP 1P1LA 4GC7A 1KK2A 4YQWA 1V5VA 1FNDA 2AHOB 1Y5NB 3IWNC 2NZCA 2E5LJ 4JI6J 3RTVA 1HLWA 5B7WA 2W2PP 3LQEA 4LF8J 1S9GB 1SB6A 1UFLA 4PAAA 5J1NA 3BF4A 1DQ8A 4E98A 3QFWA 1OGIA 3IM9A 1LQ9A 1XR5A 5EDWA 1PIEA 3BGFA 1VQ7B 1RAIB 3P26A 1JLAA 3MM9B 4PZVA 4YALA 1S49A 3WIUA 2ACYA 2AYMA 5F8HA 2V69A 1FKOA 2GO8A 1ZPWX 4IG0A 4CLFA 2OPQA 4LQ3A 2OI2A 2MDAA 1HMVA 2E7VA 3U7JA 2F4FA 4I7FA 5A0YA 3D67A 2ZTGA 4A48A 4KKUA 3DKDA 4OZ3A 1JB0C 2FJEB 2MHNA 3RW6A 3M8PB 2ZKUA 3CPXA 4ILRA 3T1HF 4WWVA 2AIRB 3Q6QA 3CCEB 4BC9A 2UXBJ 2VA2A 1D8YA 3WBKA 4F7DA 5LM7E 4LBIA 3AJ1A 4B9NA 2AU0A 3JAMU 2R8KA 4B3TJ 4J9VA 2OKQA 2DHSA 2A1BA 4LRCA 4ED8A 2AJFE 1VQPS 2I5JB 2BJ7A 1KK1A 1IKXB 2KJWA 3H42A 3UCZP 1NU4A 1AUDA 2V5HG 1V3RA 2AMCB 2X1BA 5KFVA 1VHEA 2CAJA 3IWXA 1Y3JA 4FS1A 2CDRB 4HI2A 1H73A 2BJDA 2CNKB 3CJSA 4Q2MA 2JL9A 1UCNA 3UDCA 4C0OC 3DOMB 4P7VA 2HFOA 2R2RA 1XNQJ 2DK2A 1REVA 3T5HA 2K7KA 2Y8YA 1QFJA 2R9VA 3IR5B 4OZNA 3T1YF 4JI6F 3QAUA 5LXYA 1J5EF 4HR2A 1H98A 3G71S 3I1FA 4DNTB 2QN6A 4XMYA 3MPWA 1YHQB 1FNBA 3BYRA 2MQLA 2MZJA 3LVBA 3NGKA 5KFKA 3G8SA 3CE8A 1EB0A 1UA0A 3IG1B 3CCES 5KOWA 4RLEA 3M6VA 1A9NB 1TK8A 1SQEA 2EI5A 4RCYA 3DRSB 4NLQA 4F0KA 2LA4A 1OB2A 2DITA 2GVDA 1LWEB 4Z37A 3V6KA 1R0CB 4DL7A 1SKRA 3CJRA 5SUHA 1HYSB 4RW4B 4ECYA 1ZTTA 3R5DA 1NZ8A 1Q86T 1EP4B 4ECZA 1OYEA 3DRSA 1HWJA 3VCDA 2RS8A 1JKHA 2W7AA 3DLEB 2VJJA 4Y00A 3TUIC 2PC6A 2ZC4A 4GO5X 5AXKA 1T9TA 4H4KC 4CLPA 1T95A 2C42A 3FZ2A 1EAYC 1RQPA 3D68A 4ZLLA 1OPZA 4CRJA 3A3NB 3OE7A 3WX8A 2HDNB 4CLYA 3RU0A 3OVBA 2UXCJ 2DNQA 3LGNA 3FSXA 3ZZPA 3S8SA 3J7A1 3FKBA 1TMJA 3AXMA 3GSIA 3CMAS 3D28A 2FIUA 2HBZB 5ETTA 3HVRA 2E5IA 1M1KT 1T6YA 1VHIA 4RW9A 1BQMB 3OFGA 3BBFA 5A8AA 2XNRA 3BNWA 1T6ZA 3BEGB 3NKYA 2OSRA 2ASYA 2DY1A 3W62A 3MOJB 1KRHA 4M2LA 5DJBA 3X1LB 2NXNA 4DR2J 5DRKA 1N4LA 4A8WA 1JK9B 4ES3A 4ZP8A 3KWMA 1DG1G 7FDRA 5GV7A 2I5JA 3NAIA 1XWLA 5ETMA 3SJPA 1HBMA 2WK4A 1DDIA 5HVHA 3TZYA 2E66A 2BF4A 3PRDA 1AROP 5JVGQ 1KP6A 2DGVA 2VPZB 4WFBQ 4O4RA 3U6KA 4LR9A 5B0AA 4FN5A 1WELA 2XMUA 1MMNA 2ZC3A 2BQ3A 1IWGA 2R2SA 2DVIA 1HNWF 2XZOA 4Z1MA 4QOTA 1XMOJ 4XO0A 1WOOA 3JQPA 4OYOA 3FCWA 1NBEB 3MTKA 4LBHA 4LF4J 2EFQA 1O0PA 2VBXA 3OW7A 4JV5J 5L38A 4KYZA 4OX7A 1WTBA 1KONA 4JI0F 3LUYA 3HXMA 1K73D 1N5SA 1K28D 2DNGA 1XR7A 2OLWA 2RSQA 1N33J 2BYCA 1FFGB 3EICA 5HO4A 3LWLA 2ZWPA 2CYYA 3TX8A 2VFTA 5GMEA 2L9DA 4F3QA 3SV4A 4DUTA 2HS0A 5KT6A 5T41A 4KV8B 3MMBA 3CESA 2DRDA 2XYGB 4F26A 4PC2A 2K1RA 1R8PA 2XY6A 2QA4S 4GVBA 2C28A 4OHZA 1KBRA 4MKBA 2VODA 3DHWC 4I69A 2NPFA 3QIPB 4DV3J 5AT1B 4TKOB 4TVAB 2WSCC 2FVSA 4K59A 2UU9F 3ILIA 4NMXA 1IJFA 4USVA 4WFXA 3DYAA 4ZVHA 1SL2A 3AT1B 1VQSA 1BMFA 1FDRA 1RK8A 2WOMA 1VQ5S 2HAIA 3P5BP 2RMLA 2XMTA 1HFEL 4CT9A 4J0QA 2KTQA 2N82B 2OD4A 3GMGA 2Q6IA 1Y3KA 4BCAA 4G1QA 4LFAF 1RP5A 1BJKA 4DN0A 2CC2A 5G4DA 1WTHD 2HGNA 2ZD1A 3MM8A 2R7RA 3PZPA 1KFSA 3VAIA 3HHEA 4A8MP 2CRLA 5KOXA 3L7UA 4LC0A 2KM8B 3QT5A 2W2MP 3MR2A 3MUVP 4Y0FA 3HO1A 1HNWJ 4CTAB 5CYQA 3FPKA 1UD2A 1UFKA 2G0CA 1MROB 4JV5F 3LO8A 4ZVTB 1GAQA 4HYKA 2Q6LA 2V6AA 2AW0A 3ENWA 4WKRA 1N88A 2B5JA 3PJWA 4C8YA 2FZKB 1RKIA 4KGMA 4O3NA 1Q78A 2AP6A 1Q86D 4UOGA 2PSZA 5F9LA 2Y1RI 1YJVA 2MTLA 4C8ZA 1YRXA 1BMQB 5AJ3J 4BC7A 3KG1A 1S1TB 3HVTA 1BHNA 4Z4VA 3J81k 5HMXA 5IFMA 5JVHQ 4PG8A 1RT2B 2WVBA 4DG1B 1MLAA 3OR1B 3MMCA 2F1FA 1IBKF 1U25A 4LF6J 4D3HA 3ASRA 2XTJP 1WEYA 2XGPA 1ROFA 2XLIA 1VMBA 2OMLA 2BMWA 3Q39A 2V0NA 5KG5A 5HZBA 1F60B 1FRJA 4EZ9A 3MPUB 3OV7A 2OGUA 2HKEA 2P3MA 4JI7F 4OP7A 2G1HA 1Q81T 1T9XA 2DXFA 3D6MB 5KG4A 1TKTB 1JLGA 1KQGB 1VQ9B 4ED7A 4RW6A 4QV2A 4N47A 2RKIA 1TL1B 1HI0P 1FVQA 1VQ4S 4OZLA 2LCWA 3CPWR 1B0VA 3M1VA 1M1GA 3T3FA 1CJVA 2DXDA 4IOBA 4A8KA 1IKYB 3SSRA 3ET6A 1ZAVA 2J5AA 2OBTA 3PM9A 3HJVA 4FPIA 3ASQA 3ILOA 2F9JA 5F4MA 3HFZB 3TAQA 4R8UA 3ONUA 1E6VA 4MIBA 1LFWA 1XFOA 2MGZA 1LW2B 3G6EB 1JLQA 5CXTA 4F50A 1Z4UA 2UUAJ 4BLGA 1IWAA 1YK9A 4KQZA 1S72S 3AVUA 1FD8A 1U1RA 3I96A 1UJ6A 4G1PA 1VBZA 1CJTA 2ZH2A 5IT0A 2MKCA 1HBUB 4DX5A 1NH7A 3AGPA 2B3TB 2XEXA 1Q53A 2FC9A 2VDIA 3UN3A 1K73T 1SJ1A 2XZTB 3HD1A 3H94A 2E1AA 4HI1A 3W8PA 4ATNA 4C4WA 1S9EB 3HT0A 1WDTA 2VA3A 3G4SB 2A3JA 3BKFA 1F2HA 2F40A 2XZLA 4DI6A 3A8IA 1S4MA 3T53B 4ACBA 2Q6KA 3OL8A 4O23A 3LTOA 4UQGA 1ZZNA 1BWEA 4XAKA 2X3UA 3LALA 1LK7A 3RRHA 2MLXA 3V4IA 1V3ZA 4LF6F 5JJBA 5DM7Q 4P12A 4QPTA 4NLUA 4KH1B 2IAJA 3OR2B 4H54A 2VICA 2LQBA 1CJKB 1FK9A 4RKUC 8RUCA 3TO8A 3DU6A 1ELOA 4J9QA 4RPBA 3L7PA 3VHQA 4JI7J 5G0RA 1RWKB 1Q82D 2QSWA 3MGJA 3GJRB 2JJ1A 3D26A 3J7AN 1RT6B 3OR1A 3V7AA 3ZIAA 4I64A 1VQ8B 5D8HB 3E51A 4CNYA 2HFNA 4DMZA 1S1TA 2GAHC 2QMWA 3KLIA 2HFUA 3A8KA 5DN6A 4GRSA 3EJMA 4JI4J 3BGRA 2RC5A 5TRDA 2XS2A 2WW4A 2Z0GA 4JI2F 3MM5A 4Q0BB 2BVNA 3D2WA 4U96A 4ZLJA 1GFWB 2VNIA 1FRKA 2VG5A 1KK3A 1S6PB 5F9NA 2OFGX 2GQFA 2IA0A 2ZBRA 5DG7A 3IAM9 5GADI 1KZLA 2GVZB 4C97A 2FGOA 1RT7A 3FQKA 3G8TA 1VQ6S 1T9WA 3W5XA 3A13A 2Z2ZA 3DOKA 2NYHA 3LW5C 3M9OB 2UXDJ 1NHVA 1YITS 3SJZA 3HSJA 1W87A 4DL4A 1N0VC 3G6VA 1LEOA 1PC4A 4DXLA 2DETA 4UZEA 1ACMB 2XCPA 3MURP 4WE1B 2ZH7A 3AGQA 2UUWA 5KSWB 4U9RA 4OQJA 4B9SA 1EHWA 5KG2A 3NXZA 1FNMA 1PBAA 4HTJA 2RB7A 2ZUAA 1CQXA 4X84A 3BN4A 5D3GB 1H3DA 2E9TA 2KXNB 1FRIA 2M3DA 2FVGA 2KRBA 5J2PA 3CTAA 3C6UA 1PJ5A 2E5HA 1RQ0A 1UPPA 1K0TA 4DJBA 1CSJA 4YB7A 1R3NA 2YKOA 4NWBA 2D3ZA 4PUOA 1GR1A 2FYXA 2ZOGA 1UKUA 1EJ7L 4WBFA 3QMQA 2E9ZA 2KHCA 4YAOA 5ETOA 3RJMB 1KLMB 1Q8IA 4YY3F 1XMQF 3KNAA 2RT3A 4KKSA 3NGRA 2ZWOA 3F73A 1M5HA 5GAHI 3NE5B 3BQ0A 3CCUB 3MMBB 4ED6A 1TV6B 5KG6A 3W5HA 3A1YG 2KG0A 1UAWA 4OHWA 1RE1B 2HLDA 3ZTSA 4B9TA 1WU8A 1EIYB 1EKRA 3OZVA 3MEKA 2BJEA 3EE3A 3DRYA 3CO9A 1ZETA 3W65A 2RQKA 2B7CA 2DNYA 4J9PA 1CJUB 3A35A 4UUXA 2HW3A 4DFKA 3DDYA 1K9MD 3FEXB 5DG8A 1ZAWA 3NP5A 2ALYB 2GK7A 4G7WA 3RB0A 3FBFA 2AEMA 1VQ4B 2QL9B 2CQ3A 3BS9A 1U0HB 1EFTA 3PW5A 3I5BA 2BQUA 5F0WA 4RD6A 2MJNA 2M2BA 4J7CA 1Z1ZA 2KU7A 5HANA 5DDQC 1WG5A 3I55B 2CQDA 1FEHA 3D66A 3CXCR 4I0WA 1FD2A 3UDLA 4H4OB 2AF6A 2V4JA 3NCPA 1X5PA 2AX0A 4CLUA 3NRBA 5GAHU 1Y5LB 3RAMA 1WJ9A 4TKTA 3DI6A 1VQ8S 1UVLA 2LZJA 4C7QA 2D74A 2MLYA 2G0IA 2H4WB 2PMHA 4C8NA 1NSQA 3LOUA 1YSJA 1CPZA 4NLTA 1R27B 2GW8A 3UNGC 3EVMA 2OEJA 2UUBF 3P6YC 4DX7A 2HVDA 3HULA 4R0EA 2B8PA 5KG0A 4K5RA 4NI2A 4CT8A 4NLOA 5B6IA 2DR7A 3VVUA 1E3ZA 1NZAA 2VFSA 4A8XA 5HMZA 1P1TA 4YEJA 4O0NA 1JX4A 4DSIA 4OZJA 1M1KD 1WC1A 3D3CJ 1LV5A 4F04B 2V8VA 1KRPA 4CLKA 5KT5A 3WBZA 5A8RA 1NSAA 2EK1A 2XGJA 5DETA 3BPSP 3KJVA 1R0AB 4IG3B 2IIHA 1S1WA 5KFFA 5DDRC 2CPZA 2YNGB 3SDEB 2XHWA 5MLCV 2O3DA 4DL5A 2RQ4A 2IVMA 4XDDA 3TQEA 2OAUA 4RD0A 1V9OA 1X4AA 1X31C 1RI7A 4RNFA 4JI0J 1RHJB 1MG7A 3ENQA 4FBTA 2FUG9 1NUEA 1S6QB 5H59A 4ED5A 4Y2KA 4NCGA 5C5JA 1QE1A 1EQ0A 4ZVOB 1A8PA 5DS0A 3ITHB 2WZNA 2HHHF 4QQBA 3DRPA 4QVJA 5FL7A 1RT5B 2JSXA 1VK3A 5J2MB 3RYLA 1X4BA 1G7CA 4WK3A 2LMIA 3E8OA 2J7KA 2MQOA 3LANA 1NJID 1YLOA 1FDAA 3G6XA 1RTDB 1BE4A 5EHHA 1I1GA 3Q23A 2CPHA 3L09A 2H3EB 2XHCA 1E6YB 1W0JA 4ZPAA 5KFAA 1ZOTA 1PAUB 2ZDPA 5D4NA 3H20A 2CWKA 4HACB 3U1NA 3HK2A 5M2RA 2DCUB 1BPLA 2YNFA 2C3PA 3GE9A 3BB5A 4L3NA 5HBMA 2Y9HA 1REGX 4X4UA 4P75A 1KS2A 4PQUB 1NPKA 2ZE2B 2VB6A 5IWAF 3PG9A 3T1HJ 4MK7A 1CVJA 1TL7B 2M8DB 3CIZA 1TUWA 4W90B 3C2PA 2P6TA 1P27B 1U1KA 4JI1J 4B3MF 4RWXA 3PX4A 4CP5A 4RNHA 2HK3A 1QUFA 2L9WA 1T7PA 2PD1A 3LGMA 2WVCA 2XO6A 1T05B 4TMTA 2UV8A 2G1DA 1FJEB 2IPOB 4OI1A 5HROB 1SL0A 3A1PA 2JRSA 3C8YA 4U8VA 4DFJA 4DR1F 3ZNUA 3M8PA 1GAOA 3UWTA 1KDNA 4U7UD 2BM0A 1WP6A 3AQOA 2VQEF 3PKYA 4DV6J 1LXJA 5TV2A 1WNEA 3K17A 1T9YA 3MEGA 3MR3A 1RAAB 2N4CA 4Y2AA 4LVOP 3KHGA 4OFZA 2VH7A 3NNCA 4XPEA 4ES2A 3OSPA 4ZCKA 1YX2A 1PYOB 3HP6A 2G2OA 2JDJA 2YWHA 3TA1A 3UD4P 2KYXA 1IBCB 3SQOP 1MRZA 3E01B 5TR9A 1AFJA 5E6TA 1Q1KA 3BQ2A 4OL8A 2GNKA 3IGVA 4DSKA 3EGVA 1PO6A 5C42B 3FUYA 5ETKA 1NBMA 2HIQA 3A4TA 3DLKB 4URGA 4ID5A 1PCAA 2ZZGA 2ZH4A 2M9KA 1HNVB 3E1YE 2HQFA 2OFHX 4O44B 4OJHA 4B3SJ 3W5VA 3S6EA 3JQQA 5EX0A 4ZVFA 2MHEA 1JLEA 4UUWA 3H8YA 2F8MA 1WOSA 3MI7X 4DFPA 5HMYA 2VL1A 5FDLB 1HQEA 2QE5A 4OYBA 2EG2A 2MQQA 1XR6A 2CRVA 3J7ZT 3SBMA 4EYHB 2ZL6A 1SJRA 2AGPA 4DBQA 3MM7B 2NXUA 4DS4A 1MU2A 3WC0A 1TKZA 4K8RA 1JXVA 5LOQA 1QTNB 2Z58B 3UN5A 1NAQA 1CQMA 5J2QA 2YKAA 1QJHA 2ERRA 2ZH9A 2XCAA 3KK1A 1HR0F 4GKKJ 1RXOB 2OPPA 4K0KJ 4CO2A 2YVSA 3Q24A 4HDHA 3V81A 5IXUA 1G3OA 2CA9A 2ASLA 1RBLA 2NS1B 4FF4A 3NGUA 1ZZFA 2F3JA 3D6FB 2QEXB 1NK8A 4M5GA 3QLHA 2V8PA 4UTGA 1KHVA 3CB4A 1VC5A 1WC6A 2C5HA 2FLPA 3M7VA 3A8JA 1Q4RA 2JJ4D 4WPAA 3KKFA 3QO9A 4FDFA 2B9EA 5K8PA 1G6BA 5D3GA 2EFOA 4CZCA 5THWA 4XOTA 1TU0B 2QZ8A 4QU7A 3M32A 3SLNA 2RAQA 4X7DA 2JLGA 2ZJQQ 5L1KA 3JSRA 4F4ZA 2VYQA 3I0RB 2UUCF 3TAMB 2IFXA 2AZ3A 4RJLA 1IN0A 3W9IA 3QE2A 2M5SA 3TP2A 3Q2SC 4U6PA 3X3UA 1M5KC 2A18A 3OL6A 4I2QB 1FJCA 4G6VB 1ZAXA 1RT7B 1S5ZA 1VQOB 3CVKA 3AD9C 5DQGA 2FVCA 4QIEA 2ZHBA 3Q22A 5C25A 1XC9A 2B56A 2ZUGA 2NLWA 4Z7CA 1H72C 3D1HA 1NJXA 1S6PA 2Y3YA 1LWXA 1R6YA 1YBUA 1RLCL 1JWWA 2QEXS 1EX8A 1EP2B 2B6AB 2XMJA 1QAXA 3HFVA 2WSFC 2MSTA 3MEEA 1R89A 4UT4A 4JI5J 4XK8C 2VJVA 3ONYA 2RU3A 3TJ8A 5D4PA 2J7WA 4DQRA 1VGYA 4ZVEA 2YQ3A 1NLKL 3LP0B 3R97A 4DR5F 3BM7A 4AXJA 1VI7A 1FDNA 2HQCA 3GIKA 1VC0A 2GGPB 3IN5A 4DV3F 2OPSB 1R8CA 1F9FA 5H1SV 4KFBB 3D7SB 1P9YA 2VBYA 4DZDA 5CD4A 2VF3A 3VO2A 2D7SA 1X4EA 3DLGB 3BSOA 4WFYA 3FPPA 4LF9F 2H48B 4QWBA 4WU3A 3FJOA 4CDIA 1OY6A 2B8QA 4DPOA 2X3DA 2Q1LA 1QAIA 3OFHA 1QSSA 4MKAA 1N07A 4ZLPA 3U2QA 1AW0A 4HT7A 3KK3B 2DO0A 5FO0A 5A2QU 4JB8B 1I7PA 1RTHB 3MFHA 3H5SA 2MQPA 2LECA 4URQU 1TL3B 4B3OB 1HNXF 3VO1A 1OPIA 2A6MA 3VTIA 1RABB 2KYZA 5KT3A 2Y1IA 4WZLA 4Q44A 3TZWA 1ZM4A 3MCSA 2BRKA 3MD3A 4WP9A 2RC6A 2RUSA 1RTJA 3D0GE 1F9EB 2AEFA 3BBCA 2HNYA 2G0JA 1H38A 1SUQB 4P22A 5LJ3Y 4YAWA 1C0UA 3BC9A 4OZ2A 4C8LA 1N06A 3Q3AA 3OAAA 2H54B 3H0PA 2V8DA 2XSFA 4GC6A 3ZFVA 2YNIB 3BSNA 3OD2A 1S79A 1DDGA 2W24A 5F41A 5KFUA 1D0EA 4ZVRB 5BYRA 4UOFA 3FBEA 1NK9A 3QJJA 2VQFJ 4WZTA 3I5CA 5E3RA 4FYDA 1LK5A 2YWEA 1CLFA 1TKTA 4NASA 1HI8A 2XYPB 3AVVA 4HHUA 3TUJC 3IWLA 1R0BG 5HN0A 2SXLA 2YWGA 3GP9A 1NB7A 1RTIA 1GJRA 1PILA 1FWPA 3GSDA 2QMUA 3ZZRA 5B0CA 2YX1A 4WKYA 2EBGA 3Q2TC 3S1TA 4JMQA 1E43A 1TKXB 1WC4A 2CJYB 5I42B 3PR4A 3CPWB 1C1BB 4F4WA 2KFZA 1J2VA 4LF9J 2DB1A 3HAGA 2O67A 4A4JA 3JTPA 3VWSA 5KFRA 1QVGB 1X9MA 3K57A 4M8LA 2M5YA 2IRYA 2WZ1A 4OJ3A 4IW3B 4ECXA 2W2QP 2L41A 1DLOB 3DDNA 2DKOB 2Z2LA 4M5KA 2ZBQA 2RUGA 1IJEB 4XLCA 3DU5A 4K4SA 2ZL7A 1AT1B 2VNJA 2OJ3A 1UW9A 1U2CA 2JEIA 4DQLA 3JXOA 4OHXA 3QGIA 3B54A 2UUAF 3Q6RA 4FF3A 4ELUA 3KLEA 1UJ5A 1R7IA 2FJAB 3KXDA 2HK2A 4KKTA 3J81U 3AHPA 3NMRA 2JZ5A 3OJUA 1RJJA 2FHJD 1FE4A 5IS2A 5T7LA 1WWHA 1VYAA 2VFUA 4DK1A 3UR0A 4DR6J 3KJQB 2NV4A 3VGUA 1HARA 1U49A 1FF2A 1OJ4A 3KTQA 1AXQA 2BOPA 2PA8D 2G2YA 1QUEA 2BABA 4L73A 3KJNB 2V2VA 1U8SA 4EUVA 1SUQA 3T6JA 2HRTA 4Z2XA 2AYBA 4M5MA 4WYWA 5IV3A 4URSA 1NK6A 4X05A 4TN1A 2MY8A 2C2ZB 2WBMA 3DM2A 2Q43A 2V2QA 2HRUA 3AOBA 2ZM6F 4FBUA 1S0NA 2FJVA 2B7BA 1S1XB 1KC8D 3C6TB 1FFSB 3CCRB 3NS7B 3QIPA 4DL6A 2FHJA 1DTTA 5E3PA 3SSSA 1QUPA 2D3NA 3MHYA 4I4BA 4IRCA 1RYSA 3GFYA 2NZ4A 3MOZA 1X9WA 5HMWA 2RDDA 1E1QA 1WKKA 3QQCD 2A2CA 4DR4J 1RT4B 3ASSA 1YJ9S 1TVCA 1VOMA 1JLFB 3SEJA 4I67A 3CD6B 3GYGA 3GIJA 5HAOA 4I2PB 2J8SA 3MAAB 4JI3J 2XS5A 1IXKA 5AXLA 3HDSA 2X7IA 3HF5A 3M8QA 4OLOA 4AUKA 2BOAA 4EO8A 5DLFA 1J5OB 1F3FA 3ZC4A 4QWDA 4PWWA 3KUEA 4OJGA 1WF2A 4J9MA 3HHLA 4ZJQA 3MHPA 2CQBA 5BR8J 1VBYA 1S76D 3WNCA 3JTOA 4PXCA 4LJMA 1NO8A 1JLCA 3CCVB 4C0BA 4WP8A 2EIXA 1F20A 3M6WA 4R25A 4ZKAA 4TMXA 2RNEA 4PC6A 2GQCA 2UVRA 4X7FA 2QX0A 4CH1A 1QAYA 2K2PA 3CDEA 2IRXA 2ZH8A 2VPWB 2QV6A 3VV2B 4YELA 4EMDA 3M6UA 1XK8A 3GCWP 2N7CA 2B6AA 3T5JA 3KEWA 3DC2A 2NCKL 2WRMA 1N08A 4MIAA 3P49B 3RB6A 3HZEA 4E0FA 3ZTQA 1JB9A 1KTQA 1NDCA 4V1Ak 1TL7A 2KVQE 4AYBD 2BUNA 2ZE2A 4TY8B 2ILYA 1QLNA 3KLVA 1KD1T 1UW4A 4P25A 2JEFA 1F2GA 3LQ6A 3UPFA 3OVSA 4PG6A 3CCUS 1Y7PA 1SH2A 5K20B 5IQQA 1SJ4P 1GEHA 4IQXA 2BW2A 5HI7A 4IRKA 1RQRA 1DJ0A 2BM1A 2DOGA 4ZOSA 1LXNA 2K06A 4AL6A 1NJYA 4C2MA 3EDRB 3H40A 1B2RA 4R5PA 2ZKTA 1PYSB 4YDXA 3PVDA 3I0SA 2KFNA 3PXGa 3RY8A 1CNEA 4CLWA 4NX9A 1W26A 4O0IA 1L3SA 2AJQA 3QO9B 1F5BA 4FXWA 5C2GA 1G7CB 1CULB 1U4BA 5E5NA 4N3NA 1VQPB 2Z2YB 5H5JA 1EP3B 2CPYA 1OSCA 1WC0A 1T03B 3VAMA 1IKWA 4OI2A 4USKA 1P6TA 4NCGB 4WP3A 5HL7Q 1AFIA 5D6GA 4BBYA 2QL7B 3E20A 2MKKA 4YDDB 3CNQP 3NWRA 4G6IA 3M8WA 5L9XA 3M30B 1TR0A 3NAHA 1N33F 1LWFB 3EZOA 1SKYB 4PWUA 4CNZA 4JP8A 1JNRB 5LMUJ 1HQEB 3KK3A 4PC3A 3W60A 4IRDA 2ROGA 1RZMA 4X4OA 3C15B 1N5VA 3EGZA 1DHMA 4RO0A 4P6VF 1I8DA 2HS4A 1EKSA 2DGWA 3CMEB 4ZK7M 3VNUA 3ADAC 5JMNA 5KT2A 1HBOB 1KQKA 2LQJA 4M5LA 2G2ZA 4EK2A 5TY0A 2E7XA 5KFCA 2PE8A 2XWXA 1F5AA 4ZVQB 3W63A 3KFWX 1BQXA 4X4VA 4M5NA 2NUUG 1B99A 3W2VB 2VJUA 4DPXA 1H2VZ 2BMBA 1T9VA 2V7UA 5K9FA 2KG1A 1UD5A 2QO3A 4X66F 3NL0A 2W1BA 2B4UA 4F4XA 1WI8A 3Q8UA 1VBXA 3MAAA 4X07A 5SZTA 4OOSA 2HGMA 1SIZA 4OYZA 3PW7A 2XB2D 2VHGA 4U9UA 1DFDA 1YLXA 3CDAA 1FEEA 3W61A 4RUHA 3IBFB 2LQ9A 3BH6B 3I31A 4C48A 4ANDA 1YJRA 4ANCA 3K8VA 2QA4B 1SKUB 1QX4A 1T05A 3TI0A 1WHVA 5IM0A 1K8AT 3PVXA 3LO3A 1OMSA 2B7BB 1RBOB 1T3NA 3CC2S 3KMSA 1IM4A 4ZVPB 3U1LA 4N77A 3B8HA 1N52B 4IYQA 2LQ8A 5KNLA 2ZH5A 1T11A 2WSSA 4A8FA 3H7HB 2MKIA 2OP5A 4FYYB 3FC9A 5IYPA 4FVMA 3R2DJ 3LP1B 3VQSA 1I5OB 3IR7B 4P72A 3T19A 5T7LB 1OGJA 3HVAA 2YKPA 3EDQB 5HATA 4DSLA 1XN9A 2BA9A 2I1RA 3OLBA 4NLSA 4RW8B 3SCLE 4NCAA 1T03A 3I87A 2AYEA 4UOCA 2CQ0A 3G8QA 3ISNC 5BSXA 3EPGA 2W01A 2J7UA 2W4DA 1FRQA 4NMLA 1S10A 3LWMA 4B3RJ 2FZGB 1A6LA 4PYDA 4EZ6A 1OY8A 4L74A 2ZZMA 2XNJA 4K1XA 5DLGA 1R5OA 2CPIA 2PFFB 2MZ1A 4ICLA 4JI1F 3ISXA 5B0BA 4C43A 5GMDA 3IRWP 5HLFA 3M4XA 5L8RC 1Q5VA 1XNRF 4DX8H 4B43A 1U8WA 2IJFA 3JAMY 1IM6A 1WI6A 3MM7A 4CYUB 2GV1A 4XKWA 2PDAA 2LYVA 4AFFA 4X4SA 2CJKA 4A8QA 2ZHAA 4F0HA 2OPRB 4Z4TA 1ZPVA 4KKOB 2FZCB 1QSLA 5B0GA 5I42A 5E3CA 4QR0A 3M6XA 3IC1A 2ZNYA 3O3LA 3Q8SB 3PV8A 4AC9A 4JYAJ 2CG8A 2WONB 2KFYA 2PA3A 1VQ6B 4QZVB 3CDWA 4FNHA 2AJ2A 1TELA 3MM5B 3NBPA 4DOZA 2JX2A 2PEBA 3FMBA 4A8OA 3HM9A 2GC8A 2XMMA 1BY9A 1FNXH 3D0HE 5A8WA 2AQ4A 2YY3A 2HHXA 1Y10A 4KT0C 2P6SA 1C1CB 3Q83A 4L6V3 1M0SA 3E2EA 5IC4B 4IH7A 1RT3B 4AL7A 4R71A 3I5AA 2N4DA 4DV2F 3MEGB 2LEBA 5E33A 3H2VE 3JU4A 3MWBA 2VDHA 1KQSB 3G6ES 1C0UB 3TNVA 1M1HA 3LH2S 3M9NB 2C2NA 4WCEQ 5I3UA 4X4TA 4I68A 3GIMA 1RHRB 3TEHB 4EYIB 4MKVA 3TUPA 1JLFA 1IQZA 3CCMS 3L7OA 3TA0A 2YWWA 3C15A 5F8JA 1ZA2B 2B9YA 3D4JA 1QFYA 1TTTA 3I56S 2X85A 2W2OP 3QFTA 2KM8C 2AD9A 4QR1A 3RW7A 4XQFA 3G86A 2IM1A 2XLJA 2V94A 3NOGA 2V7QA 1SKSA 2GHVC 1DTTB 2BANA 1L3VA 3K5PA 2JFKA 2YTCA 3M30A 3DXSX 3UDVA 1NJIT 2EC0A 3QT6A 4NEZA 4OPSA 3RG6A 3BQJA 1S99A 1HWUA 4C8MA 1X7VA 1HBUA 2MQNA 2W9CA 2YBVA 1CJTB 2WHOA 2KH9A 2DBBA 1JXEA 3QPIA 2NREA 4FXDA 4N8NA 2UXDF 4ECTA 2GS8A 4Y3CA 2ATLA 4USTA 1YITB 4LFBJ 4MK8A 4DL2A 4MK9A 2X6YA 3MPVA 1D3WA 3DGPA 4RNOA 1T0TV 4DR6F 3NCRA 2Q66A 2HBRB 1K1QA 2FGCA 1FX0A 2PT0A 2KT2A 3POTB 4TT3A 2EFVA 1YI2B 4AQYF 4M4SA 4F25A 2V4DA 1GH8A 3D3BJ 4DSJA 3WDOA 1GMUA 4ZP7A 1LW0B 2W8LA 6FDRA 1BLIA 3EVOA 1KK0A 4XLFA 1VJWA 2CG4A 2QIFA 4DV2J 1WG4A 2YWFA 5KFYA 4KHPJ 2NR0A 2XSJA 3J7Z5 3N0VA 4YXWA 2C2KB 4CCHA 3AB4B 1IJEA 1E1RA 4OX6A 2J0QD 4XN3A 3RUBL 1O8BA 2K3IA 3CC2B 3C16B 4Z7YA 3HKWA 3T41A 2F8EX 2J9DE 5KFPA 3H90A 5FIIA 2QTWA 3I4HX 2KT3A 2J6UA 2LXIA 2MKSA 4RDLA 3LA0A 4Z4SA 1C1BA 1S6OA 1QY7A 4DEZA 4TLRA 3ZNJ1 2RVJA 2KZMA 1Q9SA 4ZJOA 4NLXA 4RR5A 2KRRA 2UUTA 3R27A 4YB5A 2DIVA 4RDJA 5I3PA 4M5DB 4ZS6A 3PNIA 5J2NA 1SV5B 1TUVA 5AE3A 3WYAA 1GTEA 3CP8A 4HDGA 3O2IA 5B0EA 1FERA 1X5TA 2W8KA 1F6TA 3UN2A 3M8RA 4DV4F 5CYQB 2G4BA 3GFHA 1SC4B 1GAWA 1S4FA 3W1YC 4QYZK 2BSAA 2JIZA 3IFEA 3OQ2A 3PIPQ 3M8QB 3RB4A 2D74B 2LKZA 4ZGQB 3NCQA 4WZQA 1GT8A 4LSNB 3CJQA 3CCQS 4Z4RA 2WB1D 1EQMA 2ZZEA 3GG0A 1YIJS 2HFZA 2ZFHA 3A3BA 3P5TL 3LP1A 1N5QA 5J2QB 5KG7A 3D1OA 3CJ4A 2VKZG 3MUTP 5KFNA 3OJSA
chains in the Genus database with same CATH topology
3OW2R 3L09A 3OFNA 2VBZA 4GQNA 1E6YB 1W0JA 4ZPAA 2WONA 2OMOA 5KFAA 3ETOA 3OXLA 3OHBA 2CQ1A 1ZOTA 1YQHA 2ZDPA 3I32A 5D4NA 1KQFB 2ZJRQ 4LF4F 4ERDA 1HBNB 2RRNA 3WC2A 3E3XA 3H20A 2X1FA 2UV8G 3U1NA 3H4DA 3HK2A 2VOPA 2P5VA 3MM6A 5M2RA 2HNZB 4PABA 5CZVA 5KG1A 2ZH1A 3RRGA 5KFSA 2DGXA 1FJ7A 2DCUB 3OPOA 1BPLA 2M8HA 2YNFA 3FFIA 4PXEA 2IM2A 4ECSA 2CVIA 5J2NB 2C3PA 3GE9A 4K2XA 1TK0A 5LMNF 4IG0B 1H8EA 4ZDNA 5BR8F 4B9UA 3BB5A 3IRXA 1RAJA 1X4FA 1FKOB 4L3NA 5EWEA 5KFIA 1RWUA 5HBMA 4UW2A 4JV0A 5JXSA 4B3SF 1A7GE 4X4UA 2K3KA 1TVRB 4O3SA 4BS2A 2E7WA 3CJKB 2XI2A 4KPYA 1KS2A 4PKDB 1U6BA 4PQUB 4IR9A 2ZE2B 5F0UA 1HW8A 2VB6A 4C11B 5IWAF 1VQMS 2J0SD 2HNDB 1HWLA 4MK7A 1CVJA 2O1PA 2M8DB 4KHRA 1HBNA 3MDFA 1S7HA 1I94F 3CIZA 1YTYA 1U09A 4W90B 2DO4A 2R8GA 4UQTA 3OVAA 2MZTA 3C2PA 4K4UA 1X4DA 2P9EA 2P6TA 1JLQB 1P27B 1U1KA 2DRBA 4FF1A 1FHTA 2NUHA 4IH5A 4OI6A 4TLQA 4B3MF 1SH0A 4RWXA 4O3PA 4R8UB 1D9FA 3AA9A 4BWMA 3PX4A 3T5LA 2W4PA 2J9CA 1DQ9A 1SJQA 4RNHA 4ICLB 2W4CA 3J7YI 2HMIB 3S01A 2L9WA 1T7PA 3MEDA 2PD1A 3LGMA 4G7XA 1T05B 4QBUA 3GIIA 4USIA 4QWEA 4RU2A 2DGQA 5F8GA 2UV8A 5CYMB 3VALA 1KMHA 2G1DA 4OX8A 1FJEB 2YNIA 3OTDA 3DLGA 4ZMMA 3QZ8A 4OI1A 1MROA 5HROB 1SL0A 4FVCA 4N8OA 3OTOF 3GV5B 2JRSA 2ZOMA 2WTFA 3C8YA 4LT6A 4EU0A 1JLBB 2I8EA 5L1IA 4Y65A 4DFJA 4HIZA 4DR1F 3M8PA 1Q16B 5LT5A 3ITHA 1GXUA 2WJYA 3I0SB 1GAOA 3V6DB 2OPSA 3UWTA 5F3TA 2IAJB 1C0TB 2EPIA 2BM0A 3BQ1A 4HLBA 1WP6A 5H9FJ 2CQGA 1OQ3A 5F8NA 3AQOA 3GFZA 2VQEF 3PKYA 2VG7A 2OTJS 4JUZA 2XC9A 1SXLA 4P7TA 1VRUB 1LXJA 3OTCA 1YGYA 2CPDA 1WNEA 3UQSA 4DR3F 1X4GA 2MB0B 3MEGA 5KFZA 3MR3A 4NYZA 2VG7B 1MABA 4DS5A 2QLWA 3TARA 2HHTA 1QAJA 3VR6A 4QW8A 3T1AA 2N4CA 2HVZA 4Y2AA 4P2SA 4LVOP 1VQKS 3KHGA 5KFTA 2NYIA 4QIVA 5CCLA 4O4GA 3GVJA 5HKKA 1LWEA 4OFZA 1IJFB 2VH7A 2M88A 3NNCA 4K4ZA 5B09A 5D77A 2HGLA 1B7FA 1HW9A 4ES2A 4XPEA 1WEXA 1UFWA 3OSPA 4DV7F 1JJ2R 2XWYA 5E2QA 4ZCKA 2X6WA 4YB1P 5DGAA 1YX2A 3JYTA 5B08A 3HP6A 2WSEC 4KGKA 2JDJA 3RBEA 2VPYB 3BDPA 4TYAA 2YWHA 2LDIA 2KT5A 3THTA 3BN7A 3TA1A 3POTA 3UD4P 2GX8A 2B4PA 2RF2A 2KYXA 1VJSA 2DNPA 4QIFA 1GQEA 3G96A 2VC1A 2BE2B 2RIJA 4HH0A 3DRXA 5LMUF 3E01B 3HHLD 1S1WB 3UD3P 2BACA 1UA1A 3TW0A 1L3KA 2WOMB 5K5MA 1AFJA 1T5EA 4AXIA 3PY8A 3T5KA 1Q1KA 3PEHA 3BQ2A 3MF5A 4C8KA 1DLOA 2B4OA 3NBPB 4OL8A 2GNKA 4J9SA 3IGVA 1S0OA 4DSKA 2X8KA 5A6PA 3Q8RB 3DRRB 4FNIA 3SSQA 2K8GA 4LUBA 5C42B 1PO6A 4C3KA 1NBMA 1NH8A 4AVZA 4ZP9A 2EW9A 2V8GA 2HIQA 4IFVB 2R7SA 1FNOA 3OEEA 3DLKB 2ZNZA 3DLBA 1KNZA 4URGA 2PN6A 4ID5A 2EFNA 2ZZGA 3IXQA 2ZH4A 1TKXA 1NK7A 1APSA 2M9KA 1HNVB 2CVEA 4TN2A 3DFEA 2ADBA 2RQMA 5K14A 4TQRA 2OFHX 2C2EA 3B82A 2IJNA 4O44B 4OJHA 4IR1A 3S6EA 5EX0A 2ZVSA 4DNRB 2MHEA 1JLEA 4UUWA 4ZVFA 3H8YA 3LQVA 4NRUA 4DN9A 2F8MA 4OI4A 3UE2A 3BSAA 4WJBA 1TK5A 2DHAA 1WOSA 3MI7X 4DFPA 5HMYA 2YKMA 3DOLB 1RKJA 2B5JB 1RTIB 2J76E 2VL1A 5FDLB 2GFFA 3QYYA 3B78A 1HQEA 2QE5A 3KG0A 2X6XA 2XSJB 4RW9B 3ZZYA 2KJVA 1JLCB 2EG2A 4M63A 2GGPA 2MQQA 4M95A 1XR6A 3J7ZT 2E5GA 1KVJA 2E5JA 2BZ2A 2KB2A 2LXFA 2VV5A 1D1UA 1KTVA 3GR1A 4EYHB 1KSPA 2YNHB 1O51A 1FRMA 1JIHA 3BR9A 1SJRA 3TAMA 4MFBA 4QJVA 3VAKA 5KFHA 2AGPA 4JI5F 4DBQA 3QGHA 2F4VF 2NQPA 3MM7B 2ZTNA 4XORA 2NXUA 3H2LA 2GHPA 5F8MA 4DS4A 4RBUA 5KFDA 3KLIB 1MU2A 4OZ1A 3WC0A 1N32F 5IT9Y 4ZPWR 4HT5A 5HLFB 1TKZA 4NNJA 3GB0A 3US5A 5GAGI 2UP1A 1S0VA 3D1QA 4FF2A 4DQQA 2FC8A 2R8JA 1NAQA 1S48A 4NLWA 3GV7B 1CQMA 5M2UA 5J2QA 4C98A 5H9EJ 2WJVA 2YKNB 3QJPA 4TY9A 2OH2A 2YKAA 4EWTA 3N9UC 4DSEA 4KRWA 1TL5A 1QJHA 2BXJA 2HG4A 3EXYA 3F44A 2JH3A 4TNOA 3U02A 2XCAA 2ZH9A 3OFEA 3KK1A 2ERRA 4C9DA 1RT6A 2W7PA 3PW2A 1HR0F 2V2KA 4L8JA 1HWIA 2FPHX 2OPPA 1B0TA 3SMZA 4CO2A 2YVSA 3Q24A