2B7CA

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
437
structure length
437
Chain Sequence
KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Elongation factor 1-alpha
publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 122
structure length 437
sequence length 437
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7cA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7cA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b7cA01
5HZKA 2GJKA 1NG9A 1JB9A 2ZTSA 1JR6A 1AZSC 4DQLA 1XD2B 3VHXA 1FW6A 1Z06A 2W6JD 1KO5A 1KIMA 3VO2A 1YRAA 5BQ5A 1N3BA 4IOJA 1JJ7A 4RSGA 3P20A 2W2VA 4MGIR 4PC1A 1YRBA 2CE2X 5BW8A 2CLDX 2R9VA 2DWQA 4KXFB 4F4JA 4NCJA 2R44A 4LHVA 1RJ9B 3U7HB 5H68A 2G0TA 4JLAA 1XU4A 1EFCA 1XEXB 4MUAA 1ZYUA 4DQKA 4M1WA 3RS0A 4D0LB 4DBLC 4TTRA 1BH2A 3KKPA 1P72A 3ES9A 4ZGNB 3GLFE 3TW8B 4BFWA 4ESVA 4NCNA 1LF0A 3ZGXA 1JBKA 3NH6A 1NLZA 4FN5A 2ZYUX 1R10A 2QORA 4I1OA 4Q02A 1SXJB 1U99A 4QG7A 2H17A 2WPDD 1XMVA 4TSFD 3U7FB 2IS2A 1CJKC 3GLGE 5JLJA 5KDOA 1QFZA 1R5OA 5BN4A 5EE0A 3CF0A 4FI3C 2WTUA 2QG6A 4HLDA 4JL6A 3G5UA 3OAAA 5FUYA 3ZBTA 1D2EA 1L7VC 3VNVA 2OCAA 3LRPA 2AXNA 2BEKA 4XVRA 5E7IA 4BFSA 4HUTA 1QX4A 1VQNB 2C9YA 4XJXA 4Q03A 3EZFA 4OI4A 5J4VA 3I61A 4RZXA 2BBOA 3AP2A 2FNAA 1RYFA 4OHXA 3W8NA 3M1IA 1EWYA 1KMHB 3FGNA 1GL6A 5EZ6B 4TL7A 3QF7A 2QROA 2H18A 4LBWA 5E95A 4CEHA 1SKQA 4LV8B 4A0HA 3HJNA 3OF5A 4KFTA 5EE3A 4RFSB 2DHRA 1ELOA 1GSIA 1YZTA 4A15A 5DI3B 5DNYB 1A2KC 1ZD9A 3N5CA 4HLUA 3AGQA 2QU8A 3FHTA 3UK6A 1JALA 3HYRA 4BUJA 3ADCA 3ZH9B 2DFNA 3D31A 2C9OA 3NIBA 3OHMA 1BX0A 1ZU5A 1H42A 2A5FA 2Q0HA 4TL8A 4R98A 1FQKA 5SZIA 4MKHA 2BMWA 4EFLA 2KWIA 2X8AA 1W0JD 4HUQA 4N1AA 1H85A 1CTQA 5LD2C 2WJIA 2LCFA 1OHHD 1VCOA 4GFDA 4HZIA 4DIEA 3K0CC 4I99A 4MGZR 4DCTA 4EAQA 2GEDA 2BEJA 1AS3A 2W6IA 2WJJA 4GI7A 3VR1A 1ZUHA 1A5TA 3WP1B 4QHSA 5FUVA 2OZEA 4TMWA 2NIPA 3L0IB 1Z5ZA 5HKKD 4PHFA 2RGDA 4IDNA 4BQSA 4UNNA 1OFUX 2F9LA 3VR6A 4US2R 1HT1E 2FZLA 2ZU0C 2CHGA 1SVSA 5FI1B 3GLHA 5FOVA 3DMNA 4US0R 5HXBA 3RWMB 2IYLD 1N0WA 1E1QD 4N3NA 2F43A 4IVPA 2ZUCA 3RSOA 2KBEA 4NYIR 3E1YE 2ZSDA 4JL5A 4FK8A 1NBME 2KJQA 1KRHA 2ZRPA 3IPYA 3EX7C 4QBGB 3GJ5A 4RVCA 4NU0A 4GL2A 2BBSA 1HUQA 1S4QA 4I1SA 1GFIA 2WKPA 4TYWA 1G4UR 4OHVA 1XWIA 4XD7D 4U7DA 1JR3E 4JSYA 1CULC 4B33A 1HYQA 1OPXA 2I1QA 1YJWB 1COWA 3BFVA 4FXPA 5CDFE 1EX7A 3CC4B 2EVWX 4O3MA 4O2LA 2VP5A 4IVQA 4YXWA 1XJQA 3B9QA 4RKFA 1SKYB 1W35A 3QE0A 3SFZA 4BEBA 3H84A 3K09A 2VPPA 4JLNA 4XWKA 2CK3D 1E0JA 2PEYA 2FSIA 5BXQC 2R8RA 4Q1BA 3W6OA 1QVFB 2HV8A 3ZD7A 1FFHA 1Q1ZA 2ZJAA 3UXMA 4BLQA 1KO4A 3O8BA 1GM5A 4IDQA 4L9SA 4C0HA 4A6PA 3AM1A 3GEIA 2C95A 4Z54A 3THWB 1KSGA 5TMPA 1J70A 2RGCA 5F9HA 5AJVB 4F4CA 2IUTA 2AD5A 4A8JB 2D74A 2AWOA 4E5UA 5B58C 3CIOA 5JZVA 1A7JA 5FL3A 4B74A 1UKEA 4BFTA 5DI9A 3BORA 4PPGA 1T8UA 5FR2A 2MSDB 3BERA 2O8CB 5GJCA 4M1SA 3CNNA 4TYNA 1DAGA 4Q4JB 2AKAB 4YAOA 5JWHA 4TMTA 3BD9A 4M9SA 1D9ZA 3AVUA 5JJIA 2NZJA 3GLFA 1BMFA 4CRWB 4LYAA 4ZGQB 1N6IA 2YC4C 4HZUB 5G53C 1Q1BA 5GVRA 4B76A 1NVVQ 3WNBA 4TTQA 2HT6A 4D26A 1ZP6A 2VNIA 5CLQA 2FG5A 4URWR 2JA1A 2GAOA 4UAJA 3K53A 2ZVPX 4FMBB 5A5GA 1E98A 2QMHA 5IHPA 1R0WA 2AL7A 3DOEA 3QNUA 1KO1A 2HUPA 4JLJA 4D2IA 1IN4A 2IA5A 1Q22A 1U0JA 4DUGD 3GPLA 2O8EB 1E9CA 2GA8A 1SXJE 3TMKA 5LPNA 3EZ7A 2V6JA 4LHYA 4DRZA 4EPVA 1R7RA 3SYNA 3SJZA 2QE7A 1JEDA 3W90A 1GIAA 2ODBA 2HXYA 2H92A 3CRMA 1TQ4A 4GP6A 2JCSA 4PSAA 4PPQA 1VHTA 2IT1A 5IT5A 3V76A 1XZQA 2QRNA 3W6PA 2PEZA 4Z8XA 1GJRA 1XTKA 3KXIA 2XSZD 2YWGA 4CYMA 3Q7PA 1DO0A 4ARZA 1H8HA 2JLSA 5FTKA 2ORIA 3B6EA 3W8RA 4PPNA 2QN6A 3SU8A 1NY5A 3PUXA 2W00A 4GP7A 4LYHA 2PMDA 2WWFA 2REXB 1NRJB 3EZ2A 4LY6A 5GVSA 2E9SA 2VRWA 2PH1A 3CKLA 2QAGB 4DLUA 2XITA 3E2IA 3AF3A 5EMNA 2QDXA 1G3MA 4DB2A 3X1XA 2GEVA 3FMFA 1G3RA 2QGNA 4EPRA 1KC8D 4Z1MD 3JZAA 5FOSA 4X8MA 1KY3A 2YZ2A 2WIAA 2ZJBA 4CEIB 2BJWA 4TZ6A 5CITA 1T5LA 3VAAA 3VR4A 4M2LA 1WP9A 1U2RA 2A5JA 3DO6A 3PXGA 4MA4A 1YZLA 1GTVA 3IO5A 1NN3A 1MO4A 5FBWB 1FL9A 2ZQ5A 3UG7A 1T3SA 2GCOB 4ZIRA 2Z83A 2ZM5A 2IS4A 3RAPR 3ADBA 1OH5A 5AN9A 5FPSA 3ZZUA 2R6HA 1US8A 1SULA 2XJ4A 2CCJA 5B64A 3ZLJA 2EWWA 3W3ZB 3PEWA 3MLEA 1XPUA 2HCJB 1J2JA 4X8OA 3E5HA 2XNDD 1N5JA 2FSHA 3ECCA 5E7MA 1ZD1A 3QBTA 5FA6A 1O3YA 2QPAA 1GRRA 4HUQB 4DDWA 2JIZD 4C7OB 3MUFA 2FE4A 4Q48A 2WZQA 2GKSA 4GOXA 1ZM4A 4M21A 3I5YA 2R2AA 2ZI9A 3W2IA 1XCPA 1J90A 5B30A 1NBMA 1T8TA 3FYHA 1P4SA 1X1SA 2BM1A 1ZIOA 3TRFA 4EPTA 3RS7A 2J41A 3RS4A 1SM4A 3PITA 4M1YA 5C4GB 2CCGA 3U7EB 1XPOA 4FCTA 4CEJB 5IF9A 2RC6A 1B23P 3U7GA 3HR7A 4ITRC 3P32A 4DSOA 421PA 2WHXA 2Q9AA 4BECA 1M7HA 2FPKA 1TU3A 3GLHB 3GLIB 5DHFA 5CDFA 1NIJA 2UVQA 2QL6A 1CRQA 1N5LA 2WJGA 3AUYA 4W5HA 1CKEA 1NY6A 1Z0JA 2GNOA 3KKQA 4I1VA 2RMKA 1E1RA 3A1WA 4V0LA 2FPLA 2HF9A 4RCYA 2J5XA 4IDPA 4H9GA 1YKSA 5FPHA 3ZYCA 1AJEA 3IDQA 2KBFA 1QHHB 2B5OA 1NMXA 3QG1A 2WM9B 1G9XA 1QF9A 5DN6D 4MRSA 3X1DA 1QHXA 1SKYE 1W34A 4DSNA 2D62A 4US1R 5FBVB 3V00A 3OIUA 1XPRA 4PSKA 3B1XA 1EP3B 2JATA 4NE2A 3QG5A 1BKDR 3AF0A 3KJEA 4C0LA 4NHOA 4TL9A 1T5IA 4LHXA 1XEFA 2FWRA 3B2EA 4JLBA 4NCIA 5DO9A 3ZS9A 1S9DA 1L2TA 4PXAA 3VR3A 3ZVNA 3TAUA 1XD2A 1VQ5B 4MYCA 5K8LA 3ICEA 2WKRA 4IOLA 1KO7A 1H8ED 1KKLA 5FUXA 1W36C 5DIFA 3U3JA 1EX6A 1FQJA 3CLVA 3IIMA 3QKUA 4AWXA 4MRVA 3PV0A 3ETLA 5FL7A 5C2JB 1X8JA 2GESA 1JB1A 1WMSA 2WIBA 3ZVMA 4LWZA 3SZRA 1ZAKA 1RJ9A 1FMLA 4FWIB 3DVLA 3NDBB 2RKOA 2YYZA 2XOKA 2OCBA 1Z6TA 1XEXA 2ODWA 2YINC 2YOGA 4URXR 1II0A 5M04A 1QFJA 3GCGA 2QQ0A 4PAQA 2BKUA 1XCMA 4QHYA 1MKYA 1FNBA 4WZAE 2ATXA 3AP3A 2IS6A 5HE9A 3IBYA 1T3LA 2F9MA 2IYVA 4D25A 4EUNA 1SXJA 1ESMA 2JASA 2UZIR 1G1MA 3EPHA 1G5PA 3B85A 3H2YA 3PEVA 1FUUA 1BS1A 1RYHA 3LLMA 1WB9A 4AG6A 3EXAA 5EUQB 1Z3IX 1ZM9A 1D2MA 2BMDA 4JJKA 4MUBA 4CIDA 2N46A 3KTAA 4DDUA 1N0UA 4A9AA 1KDRA 5KSOA 1E2KA 3GP8A 2FGJA 2OLJA 3CCMB 1F3OA 2R6CA 3HPQA 4A0GA 3T06B 2UKDA 5C18A 2CHVA 2FFAA 4EKDA 1W4AA 3T1VA 1S2MA 3O8CA 5BN3A 2PCLA 4DLVA 2WV9A 2F7SA 1WDTA 1RZ3A 3T61A 2Z0MA 1S1MA 1HT2E 3U6BA 4QBIA 6Q21A 1Y3AA 1VQLB 3QENA 2REBA 1F2UB 4IFBA 1W5SA 5JBQA 3NBZC 2FA9A 2D2EA 3JQPA 3PQCA 4RFSA 1I2DA 4GSYA 3GFTA 5AUQA 1XTSA 5DI3A 3LQRA 4URVR 2AR7A 3TUIC 2JLVA 4NBSA 3OIWA 1EXMA 2F55A 1R0YA 4B2PA 1JA0A 3TUZC 1X8KA 3I4LA 5HR5A 3BIFA 1AM4D 4QJ4A 4PC3A 1IN6A 4GPTA 4ERNA 2CNDA 2AKYA 4ARZB 2DEUA 3LWNA 3TVDA 3B1VA 3CCJB 3BRWD 3TSZA 4ACAA 4C4PA 2CL6X 1DELA 3O47A 5SZKB 1W46A 1F6BA 1Z63A 4BGDA 5CK5A 3CB4A 1MV5A 2VZLA 1EFRD 2IC5A 2X1VA 4D4LA 2BMFA 3BWDD 3NWJA 3KB2A 2QTHA 2ZSEA 1D1NA 3U44A 1KI8A 2HF8A 5HPYB 1DOAA 3TQFA 1RRPA 1W4CA 1GAWA 2BF4A 1QGYA 3BC1A 4U00A 2ZI6A 2ZROA 1NKSA 1NSTA 3DM5A 4UJ3A 3IEVA 4JLOA 4KVGA 4C0AC 4HI0E 1NNEA 1TNDA 2BJVA 1M7GA 3M4YA 1GKYA 4XWAA 3S1AB 1HURA 1CJUC 1ZD8A 2ZAOA 3AF2A 1LTQA 2J7PA 1T0HB 1C9KA 3MRSA 1XEWX 3X1WA 3THXA 3ZIAD 1BYUA 3THYA 3OZUA 2YKGA 3ADKA 4H1UA 4X8HA 1L4YA 1EESA 3FOZA 4ASUA 5GJBA 2IUUA 5EQTA 1NLYA 3PUWA 1G17A 5P21A 2P3SA 1OB2A 2QENA 2XZLA 1WF3A 3LLUA 2GXAA 1OXVA 4XTCS 1US8B 2V55B 4DCUA 1U8YA 5KNDA 5D3MB 1G8YA 5JI3E 2H5EA 2E87A 1TEVA 5JWRA 2ZXUA 2W0MA 3P27A 4LC0A 5AUOB 3SOPA 2L0XA 1AN0A 3SYKA 3NH9A 3G4SB 5B2ZA 5H5JA 1KZ7B 2JDIA 1KNQA 2EWVA 5FPTA 2VHJA 3UMRA 3VX4A 4P4UA 1TUEA 4DLRA 4JBYA 2O5VA 3PEUA 4A92A 3K70B 3GLIE 1I7PA 3GLHE 3Q5DA 1Z6YA 1OE0A 1WA5A 2P6NA 3U4QA 1RW4A 4QGHA 1W0KA 4LGMA 2ZR9A 1IN8A 4RFVA 1GUAA 4TLDA 3REGA 5EE1A 2ORWA 3CF6R 2FPMA 1ETUA 2PZGA 2OCYC 4LJ4A 5TY0A 3VX3A 1XNJA 4AKEA 1VQPB 3AV0B 3OFNA 3DPUA 1PZNA 2NTYC 2I1VB 1Q82D 5J4HA 4BASA 4W9MC 2J0QA 1Q57A 2PX0A 2ZUDA 3LH5A 3NEYA 1LS1A 3IEUA 2WSSD 4LHWA 4OL0A 1G16A 2A5GA 4NYMR 4HE6A 5EP3A 4W5JA 2IXGA 1KI6B 5BYJA 1OYYA 1ZC3A 2VEDA 3CZQA 3CRRA 5L8VA 3UMSA 3LBNA 1K8AD 1DAEA 2EU8A 3P4YA 3C5CA 4B6EA 4MRNA 3THWA 1YI2B 5CB6A 3AF1A 1ZM2A 2ECKA 3X2SA 4TT3A 4DWJA 8OHMA 4Z8YA 2CCKA 4IFEA 2ZR0A 2ONKA 4DLSA 4DLYA 4A8JA 1NI3A 1J8MF 3EPLA 1CNEA 1GWNA 2QTFA 2XZPA 1FP6A 4BWYA 1Z8FA 2R6GA 4B3XA 2ZJ8A 3OAAD 4IEIA 4M1OA 4B4DA 1E2PA 4NYJQ 1Z22A 4XH9B 2ZI3A 3TR0A 1HV8A 3VKWA 1Z6AA 5F9FA 4JMPA 1YQTA 2ZE8A 1JNYA 4V0NA 1KSHA 3FPKA 5FTNA 4DXAA 1E0SA 1G7RA 3LX5A 4HZUA 4Q4HA 4BFVA 2YOHA 5H59A 1CJVC 2O52A 4HE5A 1P73A 2DWOA 1S96A 4V0KA 3QQ5A 1KI3A 1VQ7B 3JQQA 5JSZA 5TXGA 4Q19A 1G3UA 1W36D 4V0OA 1GKUB 2BSAA 4V0ME 3OEHA 1P2TA 1JQJC 2FZ4A 1WBDA 1Z0FA 1U9IA 3FKSD 4LJ9A 3SE0A 2QMUA 2CLCX 2IYZA 3WHKA 2O8EA 3VKHA 2C99A 2NPIA 3RC3A 4XIGS 4QJ3A 4ZKDA 4JT4A 1YE8A 2HDNB 1YZGA 5BYKA 2DY1A 3WY9A 5LD2B 3NBFA 1I4TD 2YVUA 2GJ9A 4ACBA 4BLTA 4NMMA 3RNLA 1JA1A 3HDTA 1Q12A 3OW2B 3CMEB 1QVGB 4URUR 4C30A 1FNNA 2A78A 4WVFA 3QY0A 5L3SA 1BJKA 4PHGA 1E4VA 4OK5A 1XD8A 3BB3A 3BOSA 4MH0R 5EJEA 1KK2A 3LY5A 4OQXA 1Q1QA 2ANCA 3W2HA 3CWQA 4G5SA 4M1TA 3V4RA 5EXXA 2ORVA 4DHEA 2WMOB 1W2BB 1S1CA 3RLFA 4P3YA 2I3BA 3ZZ0A 4AG5A 4LJ8A 2D4HA 1IY1A 2OBMA 1XTRA 3KTAB 3QF4B 1ZM3A 4UNQA 3PENA 2Q3FA 3PUZA 1TUIA 2G9NA 2QAGA 2ZRAA 2VYQA 4M0LA 1TL7C 1W49A 1OFIA 4P0TA 2WAYA 4MRPA 3A4LA 1TAGA 3OIVA 1DTSA 1TQ6A 3EAQA 4D0GA 2GTPA 2IEYA 1MH1A 2RGNA 3RC8A 4M8NE 4M9XA 1GG2A 2B7CA 3TIFA 2J1LA 1WBBA 2V7QD 1EWRA 4CEIA 5HCNA 4DIDA 2R62A 2XNCA 4O0MA 3GJ0A 4P33A 1X8LA 1EFTA 1OXSC 2BKEA 1G5RA 3NTUA 1TF7A 3SQXA 2G6BA 2O8DB 4LDJA 1LF5A 2ZRMA 4WXPA 1SQ5A 1QVRA 3D6TB 3A1VA 1ESNA 2GCOA 2WOOA 4Q01A 4G5QA 3MD0A 4ZO4A 1YITB 1CJMA 4YMUA 5DE3A 1TLLA 3DKVA 2OHFA 1VQ9B 3AQ4A 1TF2A 1E0KA 1M34E 1ZCAA 2NO0A 2QP4A 4W7SA 5GJVC 2W6JA 3K9GA 3U3RA 3AGPA 4TLBA 4M9QA 4TMVA 1OXUA 3KKNA 2WOJA 5FI0B 4LOAA 1COWD 2WVJA 4Q1FA 3CCSB 1HE8B 1ZNZA 4GZLA 4AYXA 4OJQA 1SVLA 4CGZA 1E9FA 3U44B 4LK2A 1BOFA 4C7OA 1AS0A 4OK6A 1K9MD 1N6HA 3I5XA 2J59A 1FDRA 3CRVA 1E2EA 2WWYA 5FBQB 3DZ8A 3LA6A 4TN1A 3HU3A 3UWKA 1ZBDA 2VHQA 5CYPA 2CL7X 3KZ1E 2H57A 2YNMA 4Z51A 4LZZA 5KPJA 3L43A 1YZNA 4PR0A 1ZUNB 2Z5FA 1C1YA 4CEJA 3KX2A 1G8FA 1M6NA 2HLDA 3MWJA 4U02A 3W6NA 1AQYA 3THXB 3THYB 3I8XA 3SQWA 1R4AA 3GLIA 1E99A 4TSFA 1CXZA 2QI9C 1KTVA 2FMXA 1FTSA 1X1RA 4HAXA 4IOKA 2Q9CA 1R5NA 2REOA 3AKYA 2JJ8A 3EA5A 4JVSB 4CT5A 4KBGA 4C0SA 3U61B 2NZ8A 1BQEA 2ZU6A 4B3CA 4FMCF 4RZ2A 3T34A 5IK2D 2PLFA 2OO7A 2VF8A 2QRZA 3T1QA 2IW3A 1Z28A 3P1JA 4DB4A 1UKVY 1QHHA 4AURA 3EPJA 5AUNB 1IB0A 2J46A 3BH7A 1DDIA 3K0FB 1JXMA 4WAUA 1L4UA 4E09A 3C4JA 4DEXA 1S9HA 4PC7A 2RAPA 4JLPA 4NTZA 5D3QA 5JECA 1P3JA 3CCLB 1G291 1IN5A 4UXJA 3KQUA 3MSXA 4PGOA 1I4LD 2PL3A 3OESA 3W2FA 1FPMA 4HDOB 3U4QB 4ZI3A 5JEEA 2NO6A 3EC2A 3FTQA 1W4BA 4NCHA 1VG9B 4IEEA 2DFKB 5AJWA 2EYQA 2V8OA 1P2SA 4IDOA 4A36A 3F0TA 1S72B 4RKEA 3WHLA 4LI0A 3GMTA 2QSZA 2P6UA 4B6FA 1RC8A 1SVKA 2WICA 4FMDF 4JLKA 4MKIA 1X6VA 1ZNWA 4YMSA 2HMAA 1Q86D 1RPZA 1KSJA 1G20E 2C5LA 2QM7A 1XXHB 2QE7D 1TF5A 1UBGA 1V5WA 2GDJA 5EXSA 1FOEB 1AIPA 2GZAA 4B48A 2XB4A 4GMXA 3T1OA 2ZRGA 2IYWA 3NG1A 2IK8A 3K9LA 5JRZA 1FNDA 1DG3A 2O8FB 2A7QA 2OBNA 3AP1A 4R71A 3OE7D 3CXCB 4S35A 4KI0A 2IYUA 4C3ZA 4V02A 4V0MA 4WZ6A 2E1RA 1H8HD 3SJAA 4C2UA 1SVWA 2V54A 1KK3A 3Q5EA 2CDNA 3EIHA 1ANKA 1JQLB 3ZC3A 1NVXQ 3PVSA 4BLRA 1HA3A 1UF9A 1WRBA 1D2NA 2H8KA 1QGAA 3QFRA 1ZW6A 3BK7A 4LYJA 5E3HA 4BPBA 2O8BB 2ODNA 5DHAA 1S0UA 4F91B 1E1QA 2VHUA 4M22A 1DEKA 1N6RA 4Q4HB 1MRSA 3C8UA 4D0NA 3HR8A 4XWOA 2YV5A 3C41J 3CH5A 1AK2A 1N5KA 2W2XA 3SDZA 3I55B 1LB1B 2OV2A 3B78A 1ZRHA 2OEPA 2H1LA 3OZXA 4PAOA 4WZBE 2ZJZA 5FOTA 3W5IA 4MYTA 5KSWB 2VA8A 4Q7MB 4AKIA 1GVNB 1FRQA 5SZHB 3B82A 4KODA 2GPJA 2BMJA 4R9UC 3E20A 4LJ7A 5B57C 3KUDA 1RIFA 3RRYA 1U0HC 3EWSA 4IJMA 1JXOA 3KQLA 1F2UA 2GBLA 3W34A 2QAJA 3JZMA 3VU9B 1RE0A 5G3ZA 4Y7CA 1GL7A 3GJ4A 3DDCA 3VR5A 1XJCA 3GD7A 3KL4A 3T5GA 3WNCA 3IKJA 3VKGA 2GVZC 2V3CC 1MRNA 4WIAA 4ABYA 1Q7YD 2ZR7A 4XVUA 4ZDJA 5L3SB 2CRVA 5CM8B 1S3GA 3BGWA 5FOUA 2W58A 2FEOA 2PLRA 2O0HA 3C15C 3RANA 1DAFA 5TB5A 3KQKA 4Q18A 1DBSA 1E2FA 1ZVQA 3B9PA 1UEJA 1Q21A 1XTJA 2BPOA 3LW8A 2KB0A 1NBMD 4C43A 4KCGA 1E63A 4HAWA 1E64A 2IWRA 4OBEA 1VKJA 1B0UA 3CRW1 4GZMA 2J9RA 2QP9X 3WRYC 1GITA 2ZS8A 3KKMA 4UJ5A 2X3UA 4POAA 1KJYA 3HPRA 1M1KD 1KOFA 1NN5A 5GJWC 2OXRA 4F4IA 1KSFX 3AF4A 5KSZA 1QRAA 1JR3D 5KYKA 4D6PA 3GFPA 4A82A 2QY9A 3AVWA 1E2JA 1E9DA 2VP2A 3LFUA 4B73A 2GJ8A 3PG5A 2CVFA 3AH8A 3F3YA 2XXAA 1I2MA 1RFLA 3S1AA 2WWIA 1GZSA 3RABA 4UQOA 3F8TA 4CF7A 3G82C 2PZEA 4URYR 3LBIA 2ONJA 3I62A 1P5ZB 2QSYA 3EZ9A 4KVAA 2C78A 1ZIPA 4E03A 3ZVLA 3OJWA 4OQMA 2FF7A 1UJ2A 1FX0B 2Y8EA 5KNCA 1U8AA 3SR0A 2MMGA 2WWXA 5SZJA 3QEJA 1E2MA 1KZGB 4PZYA 4ESHA 1GNPA 4Q4AB 2BN4A 1F20A 1NVUQ 3TAHA 2D7CA 5D3MA 2ZVQX 3AVQA 4JSTA 121PA 5EXPA 5KSPA 4G1BA 3KJHA 4EDHA 1W87A 3CPWB 1VCMA 4GBMA 4KSBA 4Q9IA 4XTRA 5F3WB 1DAIA 1NJGA 2XZOA 5CK4A 3ZQ6A 1R5BA 5GV8A 1VCIA 1E4YA 3D7MA 2CVHA 2NOAA 3B7GA 2D06A 4DUGA 4Q1DA 4LPKA 3K1JA 5JMTA 1N8RD 1II9A 3N2IA 4NP6A 5H70A 3M6AA 2ZYWX 3PCRB 2KSQA 4RY2A 4YC7A 4TYYA 3QOFA 2H16A 4OKSA 4PC2A 4LJ5A 4G0NA 1QBKC 1W44A 2J0UA 2WWWA 1GL9B 3C7KA 3RRZA 3QVUA 2ZRNA 1SHZA 3I92A 1XBTA 1SZPA 3FMIA 5FL7D 4JBXA 2VNJA 5LB4A 4C0QC 721PA 5JS8A 1XDBA 4ON9A 1DE0A 1P62B 3AVPA 3KFVA 3W3AA 1IXZA 2DERA 2PBRA 4KV9A 4NZYA 3TQCA 2XOKD 2XSZA 4QM6A 3W5HA 4NCKA 3TH5A 2GK6A 4JVLA 3BE4A 4IOMA 5CYOA 3QPUA 1QHGA 1KI6A 2DBYA 3N2EA 1TMKA 4X8LA 1DPFA 1R8QA 4C0KA 3UIEA 2HT1A 4M4SA 1GNQA 5FOXA 5TR9A 5FTMA 3CH4B 4P32A 4XVQA 4TMKA 4D81A 2KE5A 2FSGA 2RC5A 1SXJD 2P2LA 2G1JA 2OK7A 2ERYA 4OYHA 1FMJA 2RB4A 2XB2A 3SHWA 4DLWA 3QIAA 1CLUA 1W4RA 1M7BA 1ZNXA 1VYTA 3DOFA 3QJYA 4RD0A 3VO1A 3LO8A 1MOZA 1U81A 4ILEA 4JL8A 1IOZA 3NHBA 4IRUB 4TL6A 1UFQA 4G1UC 5DYGA 5DYIA 4Z1MA 3B5JA 5JS7A 2QPTA 2F3TA 4JLDA 3IILA 4GOJA 4DCNA 1IY2A 5JHGB 2ZANA 1ZNYA 2ZE7A 3LXXA 4R7ZA 1OFHA 4RCZA 4P4TA 5HZHA 1VQMB 3FHCB 3BJIC 1E9RA 3SI7A 3FWYA 3LXRA 3TLXA 2NQ2C 4PAMA 4QM7A 2AHOA 3SJBA 5HCIA 1X3SA 4WOPA 1YZQA 1OB5A 4HLCA 3IIJA 4OHYA 5DSZA 1JI0A 2QTVB 4G1VA 3BB4A 5KTYA 5JJKA 3PIRA 3ASYA 3K0SA 1D5CA 2J3EA 1GR1A 1NP6A 1G6OA 3W2GA 3ND9A 4WA7A 1QHSA 5KPDA 3ADDA 4LBZA 3CRQA 4HDCA 1TQ2A 4TTPA 1EWQA 4HLUC 2XNDA 3T1TA 4JYCA 1JJVA 2JIZA 4BPRA 2RGBA 2PIAA 2CJWB 2F1JA 2JAQA 4RJLA 2RH5A 1W1WA 3K0CA 3WYAA 1WQ1R 2AK3A 1Z0AA 3ONWA 4Q1AA 2EFEB 1YVDA 4HAVA 3LW7A 1HEIA 4B35A 1JECA 4YLGA 2FFBA 1VQ6B 1GRQA 1PLJA 1J7KA 2F1IA 2GILA 1DDGA 4W5WA 4E07A 1DARA 2AFIE 1DAHA 2H7VA 1KHTA 1E9EA 2VSOA 1UBEA 1UDXA 1OSNA 5L3VA 3IO3A 1KGDA 4NYMQ 1R8SA 2BGIA 1T9HA 3P4XA 1G7TA 4U9UA 3QF4A 4K46A 2QQEA 4TMXA 4GDFA 2QEXB 4AY2A 5KSYA 3L0SA 2C04A 3SBEA 4BLPA 1E79A 5FBRB 5A4JA 3QKRA 3KB1A 2J7PD 4Q1EA 3WRXC 4TQAA 1HE1C 1LS6A 1Z6GA 2AN9A 1JJ2B 2P5SA 4QBHA 1OF1A 4TQ9A 4XSHA 3CX7A 2AX4A 1P2VA 2XTZA 3EASA 4YQFA 4DKXA 4LBYA 4C0JA 3SHFA 4JYBA 2YHSA 2QUZA 2BC9A 1SGWA 4BLOA 5AJXA 2JJ2D 4EPWA 5BWMA 1E2QA 3V9PA 2VP9A 4LBVA 1J9ZA 4TQUS 4TMZA 1YIJB 1MABB 3REFA 4A0RA 2EFHB 2YWFA 5HE8A 2LWIA 5FR1A 4Y9UA 3SS8A 3KQNA 3LAWA 4G5OA 2O8DA 3DEFA 3ICQB 1WE2A 2DWPA 3QKSA 1EK0A 3SYLA 3KXLA 2BBWA 2WAXA 4JVMA 2P6RA 4A2QA 3TK1A 2FFQA 2ZRFA 1UKZA 3DMDA 3KFXA 3O8RA 4LCBA 2Z6VA 3GQBA 2OT3B 2ZUBA 4P4SB 4CW7A 4R2IA 5JJLA 2IHYA 4PHTA 1E2IA 5K8UA 1SHKA 4HB2A 3X1YA 2KI5A 4AK9A 3W2EA 1RRGA 2GZHA 2QP3A 2FV8A 3QSYA 3OEED 4YMVA 1G18A 3A1TA 4C9BA 3JQRA 3K09C 4DDVA 5CB8A 1KI7A 4GMDA 2A30A 3K9HA 1XE1A 3AVTA 2A2ZA 1T0JB 3QVVA 4AF7A 2O0KA 4Y0VA 3MMPA 2X2FA 5AWFC 4KJZA 1Z29A 1G8PA 3H0KA 1G4AE 4MYUA 5GV7A 2B92A 3H1TA 3CC2B 2XXAB 2AD1A 1A1VA 4YONB 4L5BA 4CDGA 2P5TB 1OKKA 5THXA 4WXRA 1CS4C 1FNCA 4PPFA 4PZLA 4Y0AA 1OJLA 3OJXA 4UKDA 1YU9A 3NVAA 4LV5B 4CT4B 4EJSB 1R2QA 5DISB 4A1FA 1KNXA 3AKCA 3KKOA 1EP2B 2OILA 1GO2A 4EIWA 4QGAA 1EFHA 5CJ2A 4PC6A 1KY2A 2QMEA 4HYYA 4EH1A 1HQCA 1T91A 1XTIA 1KQSB 2QMOA 3CX6A 2GCNA 4OHWA 2BBTA 3A4NA 1ZUIA 1ONBA 4Q9JA 3SC3A 4OHZA 1CU1A 821PA 4L9WA 1N6KA 4KYUA 1PUJA 2F6RA 3PJRA 3K0FA 4ZDIA 3BS4A 1Z2CA 5TDHA 3TVTA 1G6HA 3JVUA 2GVDC 1CR4A 4KLNA 1E9SA 4A2PA 3MJRA 4EQ6A 4ZV4A 2WKQA 2BVNA 4I4LA 3G71B 1VECA 3B1YA 4HATA 1UM8A 1E2LA 5AJYA 1E9AA 4OI1A 1NL3A 5G40A 2J0UB 2VNHA 2QGZA 3NHAA 4C2TA 2IYTA 2OCPA 2P0EA 3LNCA 3IUYA 3OEHD 5L3RA 2IX3A 2IS1A 4DSUA 3BBPA 3I72A 2BM0A 2ERXA 3RYTC 3L2OB 3L0OA 3UMFA 1Z83A 2O0JA 4B2LA 3R8CA 1P6XA 5K8TA 1Z0IA 1XXHA 3J81k 4TLCA 1QG0A 4JLMA 3T5DA 2ZJ5A 4Y9RA 1M8PA 3UG6A 4O2RA 2JJ1A 2O8FA 2ZSBA 1QH0A 3U2QA 1OLOA 2OSBA 4LSGA 1XCGB 2QM8A 3CRZA 2AXPA 5KNBA 4FD2A 2GXUA 4L16A 2RGAA 4PANA 1KI1A 1U0LA 4DSTA 5JHHB 3I3SR 3Q72A 3U6KA 4N3GA 3K0AB 4A6XA 4GT1A 2QZ4A 1OYWA 3E1SA 3IBGA 1VG8A 3KDSE 1OXTA 1FZQA 3ZS8A 3GJ7A 3FHOA 3THOA 3UANA 1G5TA 1MR3F 3ZIAA 5KUTA 2O8BA 2VHTA 4F38A 2OESA 3VTKA 2Z4SA 2Q6TA 1NIPA 4NYIQ 3QFCA 3QEOA 2G83A 5ELXA 1E62A 3D3QA 2IF2A 1JAHA 1J99A 4B43A 3PUYA 3I1FA 2BCJQ 1VQOB 4MKGA 4ZPXA 5J4YA 1VDZA 2AWNA 3DZDA 2OM2A 4F93B 4II7A 2QT1A 3HYTA 2V9PA 3PR1A 1R6BX 2UZ3A 4ZDWA 1Z0KA 3T35A 4PSVA 1CR0A 1ZMXA 4M1MA 1G19A 1A2BA 1VCNA 5EUMA 1VPLA 2JLZA 4UNPA 1OV4A 2ODEA 3VU9A 1X86B 3NDPA 2GXQA 3VFDA 1N6OA 4UNSA 1LNZA 4B3FX 3GJ6A 2BMEA 3A4MA 4FIDA 4DT1B 2VBCA 2WJHA 1G64A 1XFAA 2GEUA 4PO1A 1CQXA 1TVCA 4M1KA 1AGRA 3CPEA 3MCAA 1QHNA 4F7WA 1JEEA 4P6VF 3K70C 4IXMA 4MITA 4BZQA 1II8B 1YZUA 3LD9A 3IGFA 4KHZA 2CE7A 3IQXA 3QI2A 1VYUA 5JRJA 2B8WA 5DLQC 2C9CA 2WSSA 4B3GA 4B47A 1XB2A 2W6ID 1NLFA 2GZDA 1PJRA 4MQBA 1G8HA 2VP0A 1XF9A 3QKRB 2BHRA 1UBFA 2HLDD 3K8YA 2YJTD 5KOYA 4F7DA 1PLLA 3T15A 1YZKA 3W5VA 4PO8A 1N5IA 1P9NA 2CNWA 2YWHA 3UKDA 4GNKA 521PA 1G3IA 3X1ZA 2YWEA 1GVHA 4WW0A 2ZRCA 2OUKA 5E4FA 2ANBA 4URZR 5FH9A 3CNLA 4RD4A 2X19A 1QVAA 2ZRHA 4AD8A 3T12A 1QG4A 2HJGA 1A82A 3Q9LA 2ZSFA 3I32A 3QKSB 3CCVB 3UWOA 5E7JA 2JLXA 1FX0A 1GKIA 2EFDB 4MRRA 4BFYA 4PFSA 2ZE6A 1KI9A 4Q4AA 1OT3A 3LVRE 2NGRA 4BRWA 4ZCMA 1K5DA 2A5YB 3VNUA 3NBYC 1ZJ6A 1CNFA 1TPZA 3CONA 1YR8A 2ZYTX 2QTLA 1A4RA 1CF4A 1RRCA 1CP2A 1PLKA 4ZCIA 4B71A 4PX9A 5CM9C 5EXTA 3ZJYA 1UDWA 4WBSA 1LY1A 1MO5A 4Q66C 1D8TA 1TEXA 4YDHB 3FKSA 3VQTA 4YXWD 4ZDKA 2GCPA 4AKGA 1BYIA 3BH6A 3CR7A 3Q8XB 3CPHA 2P65A 4JVNA 4M9ZA 4LX0A 2VL7A 5FUWA 1OIWA 2ZRLA 2ZPTX 3GJ8A 3IHLA 5DH9A 3CF2A 2XTNA 4UNRA 2BV3A 3L82B 1DG1G 5L3QA 2HYIC 1M74A 2VQSA 3DM9B 3MFYA 4OQFA 4QOSA 1AGPA 2W0SA 5C46F 3TGPA 2ATVA 5TARA 1B2RA 4MGKR 1XJ0A 5C4MA 5JFGA 1TU4A 1QFYA 4HB0A 2HEIA 2WPDA 3QUSA 2CMKA 5AK0A 3WMFA 1SVIA 4G5GA 4OQLA 2FDCA 2GK7A 5KU1A 2EQBA 1EGAA 2QEQA 4UXIA 1P9WA 1DADA 2EW1A 3GFOA 4XSGA 3B8HA 1QUFA 1TQDA 2ZI4A 2FOLA 3L8YA 1C4OA 4IXNA 1NN0A 1QDEA 4PTLA 4PQFA 2JEOA 1SXJC 1FNMA 4NYJR 1G3QA 1W48A 5FTLA 1DO2A 5IDVA 5FOWA 4RD2A 1F2TB 3MAAC 2V4ZA 2VO1A 3LX8A 4JIMA 4E22A 2G3YA 4EFMA 2K5UA 2IYYA 2ZRIA 1P7CA 4EQ6B 1BMFD 1T3HA 1M1YE 2ASEA 1IAQA 2NO9A 2V7QA 1NJFA 4QXAA 4AKHA 1GRNA 2NG1A 2OLKA 2J7KA 3BAFA 4QRHA 1Q3HA 3NEJA 1P60A 3PEYA 1E96A 1F48A 3EIEA 3BFKA 3RS2A 1P9RA 2GAAA 2XNSA 3IIKA 1W7AA 3RWOA 5EZ5A 5FBLB 1XRJA 3TSOA 3CCEB 5KDLA 4Q7KA 1UPTA 2OE2A 1AMOA 4GOKA 4LJ6A 3QPVA 1QGZA 1R0ZA 5TV2A 4Q47A 1TTTA 4Q7LA 1YJNB 3QKTA 3SNHA 2LKCA 4K81B 1OIXA 1J8YF 2A3RA 4JS0A 4KFRA 1W0JA 1JAIA 1OHHA 4JKIA 3VR2A 3VHLB 1GAQA 2CJWA 2OG2A 1FRNA 3WNDA 1E0AA 1IXRC 4QL3A 5GADl 2ZJOA 1NDHA 4ZKEA 3EG5A 3RRNA 2D3WA 3MHPA 5C1BA 1KI2A 1PV4A 4WQMA 3C14C 1KDPA 1DVRA 2V6IA 5HKKA 2OAP1 2OFWA 4DVGA 1SVMA 4B44A 5ANRB 1GP2A 4MYHA 4EFNA 4JBWA 3D8BA 1IXSB 221PA 4PQRA 1M90D 2CEAA 4TWZA 2IL1A 1W2GA 2MMCA 1G7CA 3H86A 3HP1A 4ZI2A 4RD3A 2HJVA 5JWOA 2RCNA 5EE9A 4YMWA 1G7SA 4IVRA 1IM2A 1T6NA 1UBCA 3RSLA 2VYFA 5KDDA 1ZM7A 5IK2A 2OFOA 2PZFA 4L4UA 2FU5C 4HEJA 4LYFA 3FFBA 4MDFA 4QHTA 2QBYB 2R6DA 3B13B 2Z4RA 2GRJA 4P31A 2IF0A 4GRAA 1OGIA 2V1UA 1IN7A 4KFUA 2GHIA 1XMSA 2GETA 2JLUA 4DDTA 2OTLB 2IYQA 3KUCA 1Q3TA 3CWZA 2RGEA 2PCJA 4XD7A 3IQWA 4QNRA 2HXSA 2VP4A 4QFMA 1MABA 2R6FA 4OJKA 1HH4A 4ZCLA 1OFTA 4BFUA 4QC2A 1OGJA 4Q21A 2GWHA 4A0FA 3GLGA 3FDIA 4D4MA 3W9YA 4AF6A 4A2WA 1E3MA 5H8WA 2GF0A 2ZEJA 1MO6A 4HAUA 2JGNA 5JCPA 2BIFA 4NH0A 1ZC4A 2CK3A 4P4SA 2ZYVX 1SVOA 2OXCA 3TR5A 2FGKA 3R7WA 1Q20A 2CL0X 3K70D 3TE6A 2WWHA 2FH5B 1FUKA 1IHUA 2IHBA 4KO8A 3LDAA 5LB2A 4YDSA 1O87A 1EG7A 1GNRA 4YAWA 3F5FA 2CHQA 2B6HA 1LVGA 3MWKA 3RS3A 2TMKA 1QG2A 3CPJB 3A1SA 3CZPA 3KJGA 3NBXX 3NXSA 4LUCA 1ODFA 2VSFA 3GEHA 3O8DA 3U60B 3NC1C 3OIYA 3OE7A 2VF7A 2IXFA 1S3SA 2OK8A 1G21E 2G1KA 4LV6A 4B3DA 2F1RA 2B8TA 3FMOB 3VMFA 1I4DD 2DPXA 3WYFA 1E2NA 3OZVA 3G0HA 3B60A 5EE5B 3QXJA 3AVYA 1E1RD 1VQ8B 1XX6A 2A5DA 4HDQB 1E9BA 5LBIA 1KI4A 4B2IA 3CBQA 1E2GA 2IYSA 4EJSA 3EA0A 1CR2A 4BFXA 1DAKA 3MG9A 2HCBA 1U94A 2C98A 2ZRDA 2C77A 2XNJA 4MKFA 4TYPA 4A8JC 3LVQE 4YMTA 2J0SA 2NPFA 1IQPA 1HTWA 1OXXK 5TVKA 4D4JA 1L8QA 5G3YA 3R20A 4OQNA 1XZPA 3QXXA 1NKTA 2F3RA 4RZ3A 2D2FA 5BN5A 1BIFA 1KJZA 1UEIA 3MWLA 4PO9A 5KO2A 1CR1A 1K5GA 2IWHA 4CEHB 1EFUA 4D82A 2DETA 1U8ZA 2IEZA 2PT5A 1OW3B 1W36B 1P75A 2BDTA 4C0BA 1AKYA 1YR9A 3K9NA 4AC9A 1S8FA 2Q21A 2VH5R 3C5HA 4LRWA 1E94E 3Q3JB 1PUIA 3WBKA 4QJ5A 3AVVA 1Z2AA 1YJ9B 1BX1A 4NONA 5A0FA 2XGJA 1NVWQ 2DYKA 1AKEA 1YR7A 3FPAA 4H1VA 3WMEA 2W2TA 4FCVA 4N0DA 4G3XA 1N25A 3B1WA 5L3QB 1JPNA 2DFLA 1U9IC 1GOTA 1KAGA 1W5TA 4YHBA 1GAJA 1HQYE 1VTKA 1CRPA 2C96A 2ZIAA 2DCUA 3QFSA 2IYXA 2NO7A 3QXCA 3KXKA 3LO5A 3AVXA 2ZITA 1AZTA 3RRMA 4A4DA 3ZVRA 2G0NA 4DCSA 5J4LA 1VG0B 4FCWA 2JLWA 4Q9LA 3U3KA 2EIXA 1CEEA 1XD9A 4HLQB 2WMNB 5KHOC 1P2UA 3JVVA 2RGGA 1W47A 3KQHA 621PA 3PUVA 2VLIA 2ZRBA 4B3BA 5K8IA 4TZ0A 1IBRA 4QKQA 1VIYA 4O25A 4XOIA 1JR3A 4YAFA 1XTQA 2G88A 1VHLA 2ZE5A 4D80A 3MGCA 3CUEF 4AYTA 1AA9A 4CZ2A 3CMAB 3K0AA 3FJOA 1D6JA 1Z0DA 2EYUA 2F43B 3DHWC 4N0EA 4R2HA 4IKEA 4BEJA 2IXEA 3GJ3A 3OZWA 3SFVA 1KDTA 5AR1A 2QAGC 3QXHA 4Q00A 3TKLA 1NG1A 3BB1A 1NVVR 2P67A 1E79D 2YOFA 1XXHE 4PZZA 3QBVA 4JJZA 5J40A 2DB3A 3SEAA 1KKMA 2RGNC 1Q1EA 3ASZA 4JZKA 5AJZA 2C03A 4QGGA 4DJTA 1E2DA 1IONA 2PJRA 2WWGA 4I81A 3R9XA 2AK2A 1LW7A 1VYVA 4OI2A 4AYWA 3NKVA 1UAAA 3G6EB 1N2CE 3FB4A 1GILA 2YC2C 1Q44A 1UADA 3TJZA 2PJZA 2BOVA 1EP1B 4DEYA 1XEWY 2B7BA 3CM0A 2ZJ2A 5HTKA 4J0QA 3R9IA 1JPJA 3UATA 2V1XA 3TNFA 3SJCA 2PT7A 2QNRA 1F60A 4L8GA 3RVBA 3ZD6A 3ZZTA 4IDHA 1HY3A 2NO1A 5AUPB 3EW9A 4DT1A 1KAOA 4D4KA 2XTMA 5EP2A 4Q9HA 1RRFA 4LC1A 3I8SA 1YHQB 3LBHA 4IHQA 2RHDA 4B34A 3AVOA 1U98A 4DLXA 1A8PA 1PVOA 3R8FA 4KSCA 1II8A 2F1HA 3A8TA 2PMKA 5LDDC 1NSFA 3A58B 1OH6A 1N6LA 5JI2E 1XMJA 2G77B 4LHZA 3EPKA 2ZRJA 2IUSA 3N70A 2OBLA 3AB3A 4RZUA 3CW2A 4F92B 1VQ4B 1OKKD 2FFHA 3MWYW 1FTNA 5EP4A 1E6CA 3QE2A 1KYIA 1E2HA 4FMCB 3U3OA 3HU1A 2N1BA 4LJAA 2D7DA 2C2HA 3EZ6A 3HU2A 2I4IA 3DKPA 3KJIA 2QA5A 1OH7A 3FVQA 2GJSA 5DN6A 4ASUD 1W2HA 2FN4A 5JSZB 2OAQ1 3A37A 5F98A 3ND8A 1BO6A 3U3MA 2GQFA 1Q0UA 1G8GA 1TX4B 3FKQA 3LQQA 1IJEA 2A9KA 3IHWA 3GLFB 1UKYA 2VTKA 4BE7B 2WBLC 3CNOA 4PQYA 2WJVA 4KAXA 1XMIA 2W83A 2J0VA 2QPOA 3GLGB 1NMZA 4DLTA 1DS6A 2JDID 4G01B 3SN6A 2EFCB 3EC1A 2XAUA 5J47A 1KD1D 3CCQB 4HB4A 3PFIA 4TLEA 4LPSA 1KMHA 1IY0A 2LKDA 3R9WA 3AKDA 2QT0A 2Z43A 1NMYA 1LV7A 1CJTC 2X2EA 1QHIA 5J5CA 1H8EA 2Q3MA 3R7WB 3L0PA 2ZS7A 4FMDB 5CLLA 2BWJA 1E32A 1W0KD 2ZREA 4KITB 4FW9A 3CX8A 5G41A 3EARA 3QPWA 2VIIA 1AQUA 3IPXA 4LJYA 2XEXA 4OI0A 2HYDA 1Q81D 3A1UA 2JLQA 3NC0C 3OFND 4KU4A 3CC7B 3RDPA 4RD6A 1TADA 4Q1CA 2BGJA 1GDDA 1WCV1 4NDZA 5JCZA 4TLAA 5CJPA 2ZRKA 1F5NA 5CIWA 5EP1A 3V4FA 4BLSA 2ZETA 3WYGA 3ZDQA 3C16C 2J45A 3I56B 4PHHA 4QBFA 1N6PA 1ZCBA 4BFZA 3FMPB 5IRCD 2RHMA 4B75A 1K73D 1Z07A 3RS5A 1Z6XA 3WBJA 3BFXA 2JJ1D 2FX3A 3Q7QA 4AIIA 2NMVA 4TT3D 2SHKA 3P26A 4G5RA 1E69A 3E70C 4KFSA 4NKRA 4QNMA 2FJUA 1MO3A 1CIPA 4NL4H 2Q9BA 2GXSA 5FFMA 1KK0A 2C8VA 1Z47A 1VMAA 4V03A 1OIVA 4S2EA 2JLYA 2JLRA 4FWTA 3CD6B 2Q3HA 5J4KA 1Y63A 3TBKA 1XP8A 1P61B 2OTJB 3CO5A 1KO8A 2ZI7A 1F2TA 3AUXA 3B1ZA 3QXSA 1K6MA 3WMGA 4BRUA 2J87A 1T4GA 2ZSAA 4UXHA 4ZIRB 2WSMA 1ZINA 2DFTA 2JJ2A 3H4MA 2GJAA 4K8OA 1VIAA 3L8ZA 2CLSA 4HAYA 4DC9A 1UMKA 1U90A 5H1YA 4YALA 2IBMA 4JLVA 4M53A 2EFGA 4KLZA 5CIQA 4JKYA 2BCGY 2GF9A 3TSWA 1NN1A 3TW4A 1IJFA 1VQKB 3W5JA 5JEDA 4EPXA 1QUEA 2R65A 4HAZA 1CBUA 4I1UA 1AS2A 2B21A 2CBZA 4YAUA 3A36A 3FFAA 4OK3A 2RGXA 2GBLC 3TUJC 2VHCA 2ZI5A 3ZBUA 4MDEA 3FE2A 3EIQA 1M2OB 4MGYR 1OH8A 3AKEA 3LVBA 3OEEA 1N0VC 1D9XA 1EFRA 3GEEA 1V43A 2WJYA 5F2EA 4EPYA 3SBDA 2ZAMA 1KK1A 4BZPA 3U5ZB 3CR8A 4CVNA 3GJXC 1KMQA 1VG1A 1QZXA 1MT0A 4TYQA 4FINA 3Q85A 3WP0A 3HWSA 4KBFA 1YR6A 1N6NA 1H65A 2N42A 2OFXA 3CCUB 2QA4B 1NJID 4L15A 4K1XA 5UKDA 4DCVA 3CCRB 1FP7A 2FSFA 3AEZA 4Q5IA 5FPKA 3WXMA 1G41A 2FEMA 4IW3B 3EWAA 2XJ9A 2VP6A 3QFTA 4B32A 3M0EA 1Z08A 4QGFA 1WXQA 4DZZA 1YHNA 2QTZA 4Q7JB 3ZQJA 1K8RA 4Q4LA 3W5UA 3MJHA 4U5XA 5DGXA 2MSCB 2IYRA 4KYIB 3UPUA 1QHYA 4Q9KA 4NPHA 1ZU4A 2CNWD 3A6PC 2DR3A 2MSEB 4BZXA 3BXZA 4AI6A 4HSEA 5FPYA 2VSXA 1DAMA 3I73A 4RD1A 1RVDA 2QBYA 2X77A 3DL0A 3LV8A 4HB3A 3K0EA 2AFHE 4EJSC 2O8CA 1NF3A 2R6AA 1YJ5A 2CXXA 2XX3A 3BH0A 4DLZA 5FTJA 1KJWA 4JT2A 3RHFA 1LFDB 1R0XA 4Q4JA 2PX3A 1KDOA 2ZJYA 1RKBA 2ZS9A 2VNKA
chains in the Genus database with same CATH superfamily
3V4SA 1FEZA 3ZCPA 4EG5A 1SCKA 1ODJA 4TWAA 6AT1A 5HZKA 1DFHA 1M2FA 3OCCA 4P4SB 2SKCA 5CGQB 1SKUA 1XD2B 2C3PA 2KYRA 3MIIA 2Q46A 1FW6A 3WDSA 4R9RA 3V5NA 5FQOA 2W6JD 2B4QA 1KC1A 4PXYA 2DX7A 2V7WA 1SOMA 1Y9DA 5C5CA 5BQ5A 1BH6A 4BHTA 2X4DA 3NHZA 4XSVA 1KYVA 5A4MS 4RSGA 4FR5A 3TB4A 4DJDC 3DEIA 4MGIR 2IFTA 3BRCA 1H3FA 4F5WA 5BW8A 4PLHA 1YI0A 1K86A 2CLDX 2VSNA 4KXFB 3EXFA 3PQDA 3FPSA 3B5EA 4MEBA 2R44A 2XMDA 4FGUA 1CVIA 5GM2A 1XAGA 2YV1A 4NFHA 5C9ZA 2G0TA 4IJKA 1CY6A 1XU4A 4CKCB 1GADO 3RS0A 3GAAA 3ISTA 4WZBB 1OV6A 4EATA 1VLQA 2FMTA 3A35A 2APJA 1JT9A 3TW8B 1PR3A 1Y8QB 4A6DA 4CKBB 1LF0A 3ZGXA 3BULA 3NH6A 4J4TA 4OQEA 1FYEA 1MD9A 5FBHA 5BSTA 2ZYUX 3O2JA 4TWBA 1K88A 4H77A 5CDTA 3U7FB 3DW1X 3LGAA 4TSFD 2QMZA 3N7TA 2AOVA 4H3HB 2E85A 1YSCA 2QL7A 5K3EA 3AUKA 4MV1A 5DMXA 5DNUA 1GT91 2WSBA 4P7BA 1G2OA 2OMEA 3A6GA 4TXJA 3OCWA 4QQRA 3UB2A 1VSTA 1KVQA 3D8UA 1H4SA 5FUYA 3N0TA 1H3NA 3BHIA 4GKBA 3UMBA 3VPHA 3ZBTA 5LOVB 1D2EA 5CBPA 5L53A 2C57A 2PQ6A 5DM60 1FFYA 1QX4A 4ZQEA 2E4UA 5K0LA 1UBKS 2C9YA 2PS9A 2VZEA 3DTTA 4JNCA 2VUTA 4O6VA 3EZFA 4WKPA 3E9QA 2ZJ7A 1HFEL 4KL8S 4BN5A 2V7TA 2HN9A 1RYFA 4YDQA 4UM8B 3M1IA 4ZO9A 2X0JA 1PL8A 3O4VA 2VPTA 4QXRA 1U0RA 1XPJA 5FPQA 2F59A 3QF7A 4OQZA 4H1WA 4LJRA 4UZSA 3JR7A 4LDPA 1EIWA 3M70A 1JJFA 2VJMA 3LIPA 1LKZA 2OOKA 4HX2A 1MA3A 3HJNA 4CM6A 2Q0XA 3DP9A 4FNAA 4RE5A 4TMYA 5EE3A 3OT5A 1MU0A 2PZMA 1YOBA 1GUBA 3H9NA 2WT9A 2G09A 2NM0A 2O2GA 1YZTA 4A15A 4YMIA 1A2KC 1C0LA 1LA2A 4XIJA 4RVOA 3N5CA 2PD4A 4LE2A 4U3JB 5I7VA 3U16A 2W6OA 3AGQA 3O3NB 2QU8A 3FHTA 2YN0A 4RS3A 2FN9A 1JALA 4BUJA 3ADCA 4ZVLA 4PGMA 2PZ8A 2DFNA 4F46A 1RLJA 1XZFA 1I01A 3OKFA 3NIBA 1PL7A 3BAZA 4NZMA 3OHMA 1P91A 1BDIA 2BONA 1ODSA 1BX0A 3WLNA 2J5BA 1H94A 1PWYE 1X7XB 4G36A 4MPPA 4QDXA 3E1KA 3GJYA 4CODB 4DNFA 4NCAA 1LUAA 5BO5A 5GONB 3QX7A 2BMWA 1F7UA 3OTQA 2VTDA 4HNAB 4NNPA 3NIWA 4EFLA 2L17A 1B3BA 4F8YA 1CTQA 5LD2C 1NYQA 2LCFA 3A6ZA 3ZY5A 3VR2D 5LMCA 2E4ZA 2J9YB 2RAUA 3GRRA 4NFSA 4DCTA 1NAIA 3H1GA 5CDGA 4NZOA 1E18A 1AS3A 2W6IA 5DU2A 3WP1B 4ZCQA 5FUVA 1U2PA 1M6WA 1XCLA 3EIOA 1XQWA 2R85A 3RFUA 1Z5ZA 2PA0A 4M1EA 3GC6A 2MT9A 4BQSA 3VR6A 5DULA 4I3HA 3CT6A 4ZO7A 2ZU0C 1C3EA 4BJ1A 4WL0A 4JODA 2FJPA 3A27A 3GVJA 3HMQA 1WDWB 2X23A 4G24A 1QORA 3EXHB 3LK6A 1NUHA 4LEIA 5CTJA 2G1PA 4GXTA 3GL9A 2K87A 3RWMB 4HVCA 5J2TA 1EVLA 5HP4A 4URHA 1WP4A 3R1IA 2XTAA 3EFEA 1BD3A 2D7JA 3RSOA 2ZBUA 1P5FA 2FN8A 3W05A 2JEZA 4NYIR 5M2QA 1P7PA 3WQSB 3EOAI 3JAWA 2R00C 3Q6RA 5DX8A 3TOSA 4L0DA 3U1TA 5AVJA 1CDZA 9MHTA 3GJ5A 2WJ6A 1B8OA 5T6MA 1W4ZA 4X1KA 3GVPA 1I4EB 2CN1A 4XMYA 4LYEA 3ZWWA 3PQFA 3D2AA 1IWOA 3NETA 4B4KA 5C8XA 5BW4A 4TYWA 1AD2A 5DVZA 4BV8A 3LBFA 2BW0A 2FG7C 1JR3E 4U7DA 5CVTA 3M5DA 1OR8A 2FW9A 2R1TA 4C78A 2BFEA 2HA2A 1DV2A 1GG8A 1YZHA 1ZZGA 3BFVA 4L4RA 4MZDA 4AULA 5CDFE 4BXOA 1KYYA 1P1FA 1N9KA 1EX7A 2J33A 2LTAA 2X7XA 3BZWA 4LMBA 2C00A 4BTLA 4O3MA 4O2LA 5B37A 4XLAA 4IVQA 4CTKA 2OCXA 3WOHA 1AQ6A 3SFZA 5TJ9A 4B81A 2VPPA 2P41A 3PUJA 1SA0B 4JLNA 3G1TA 4XWKA 5ALMA 3ZJ5A 2PEYA 2W2LA 1PV2A 1W0CA 1TYCA 3C3EA 3R5TA 4Q1BA 3W6OA 1WMBA 1RWXA 3NGMA 3W1WA 2O4UX 1KE2A 2RH8A 4GWGA 5K0BA 2EX1A 1EVEA 4ZV9A 2ZJAA 3UXMA 1WTCA 3KEQA 2G9RA 5C37A 5HXAA 3DOIA 1W4LA 3BIJA 3CCCA 4JP8A 1JKFA 4C0HA 5AW6A 2I4OA 1L5HB 2WMDA 3DMFA 3JQEA 4DA6A 5F4JA 3GEIA 5EHNA 2QTNA 2C95A 4MTLA 1TPYA 1KSGA 1J70A 1P9LA 5LN1A 3ZY6A 5GOTA 1KIAA 5KYUB 5EQFA 5D01A 1KWKA 5IX8A 5F9HA 3RFVA 1RYDA 1L4HA 1FDVA 1WMEA 1GCGA 2D74A 3M7IA 1A7JA 4I55A 5FL3A 4B4OA 1EUCA 2RBKA 3UMGA 4QQNA 5GJCA 3CNNA 1J25A 4PG4A 1Y3IA 2P78A 4B46A 3C6ZA 2JHGA 1QRUA 4WJLA 3WWZA 1TO6A 1Z36A 1DJLA 4Y2YA 2ZSHA 3ZHTA 2V3WA 3B6MA 1AGXA 4NZNA 4F1KA 1GZVA 2WSIA 4HGNA 4LYAA 1N6IA 4HZUB 5ILOA 1JYFA 1NVVQ 3WNBA 3GUVA 2HT6A 4TTQA 3O1JC 1FJGB 2WWTA 3QEAZ 4H27A 3HUUA 3JAKA 1O94A 2X9VA 2HQRA 1KYZA 3A6LA 3MTDA 1JDPA 1WOYA 1CUAA 3H65A 1HX7A 3Q0TA 1I5OA 2Y1DA 3LP6A 4W1SA 4UTNA 1YMQA 3WO0A 4EVRA 4D2IA 1IN4A 2AI3A 1U0JA 3KQPA 1JHPA 1KJJA 1WUIS 2ONCA 4TS9A 3SHVA 1E9CA 3H11B 2F00A 4J1TC 4X1YB 1NR1A 4EPVA 1XZMA 2DOGA 1EVIA 3N76A 5D85A 3FUUA 1VI6A 4ER7A 2C4MA 5HOQA 4R2XA 1GTMA 2QE7A 3D6NB 3W90A 1NHWA 1SCNE 5JIBA 1NVGA 4XGIA 3WYNA 2HHJA 3EQ9A 4ZOLF 1PVVA 3J80A 1WUYA 3CRMA 1LC0A 4P4LA 4E88A 1T5TA 2VBGA 3BBLA 2JCSA 5DWVA 4BVBA 4E21A 3ESXA 2W90A 4LNUB 5JH7F 3OTIA 5JDCA 1LTKA 3AM3A 5CNKA 4Z8XA 4FX5A 1S2OA 1GJRA 1GZHB 1XTKA 1BMDA 4GLBA 3KSUA 5A7FA 3MTIA 4M0EA 3EXG2 2DFPA 1SPBS 4V24A 2HM7A 3DO8A 5CR9A 3L1KA 3IQZA 1U2DA 4FI3F 5HJ2A 5TPWA 5T5QA 4QRDA 5LM3A 4CIVA 2Z4TA 2QN6A 3M4ZA 3VPDA 5EWLA 5EPOA 4I9GA 1V3QE 2WWFA 3KC2A 4IHKA 4A16A 2IHTA 4LF6B 3UENA 5GVSA 2E9SA 1XFOA 2VRWA 2PH1A 3CKLA 2DHDA 2QAGB 4DLUA 4HFJA 4P7JA 2OG1A 2XITA 4BVHA 4Y2PA 4ED9A 2ZAYA 3TLAA 1MDFA 4RSRA 4DBZA 3H2ZA 4AP5A 1F8FA 3Q12A 3A9WA 1UIMA 4KIWA 1NW5A 2J4CA 5FOSA 1KY5A 1E7YA 4KN9S 2YZ2A 5BV1A 1C3VA 1UM9A 1JEQB 3ROTA 4YRMA 4CEIB 4HDKA 3HXTA 2A94A 3KP1A 3QX3A 3MVEA 5CITA 1T5LA 3V4LA 3AV3A 3CN7A 3HEBA 4R3WA 7REQB 4I2NA 3PXGA 2Z8YM 4L0CA 1JP7A 3BE8A 1FRFS 4XRRA 1T9GS 2RGUA 4QX6A 1QOQB 3AEUB 5ALGA 4A5OA 4LHSA 1YONA 5A4IS 2NVUA 4BJ6A 1MO4A 1PK7A 2ECOA 3H4TA 4QELA 2VK2A 2PL9A 4UEWA 4PNZA 2A4MA 3RAPR 4OLBA 4ZRDA 1WSBA 5FPSA 1Z5PA 4FEGA 4RMNA 1ZUD1 2A9QA 3EOBI 3BILA 3OOYA 1BE8A 4JV5B 3ABZA 3ZLJA 2HNKA 4AJHA 3MLEA 1OI4A 1EGHA 4FYWA 1K92A 3COPA 4WCFB 3UB3A 4ZZ0A 5IEJA 1YGPA 2ECPA 1SWWA 4U4AA 1N5JA 1WMAA 4XX1A 3RT1A 2QPAA 4BGUA 3ZNNA 4M88A 5NULA 2JIZD 2IPAB 4NEHB 4C7OB 3MUFA 2FE4A 4GOXA 1HNNA 2A0FA 2GKSA 2BGUA 2Q4DA 1NYLA 1V9LA 2R2AA 4M21A 3L49A 1KY4A 1G42A 4WBXC 4XEHA 1VZ2A 3FDXA 3EY9A 3I4FA 1MGOA 1P4SA 3ZXXA 1RPNA 1AKVA 1O89A 2WNHA 4JJEA 3TRFA 3AG5A 4GGOA 5J5VA 1SM4A 1F12A 2Q99A 4YV0A 3PXUA 4FCTA 4RHTA 2NACA 2YZ7A 2Q7DA 5IYWA 1RTTA 2H1CA 4BVAA 1B23P 4CEJB 3U7GA 1UMDB 4INJA 2PX4A 1M0SA 2AG8A 4W82A 3P32A 3D6VA 4ZVTA 1O5IA 2FPKA 1E4EA 1MVNA 4RIFA 4AZ3A 4D3DA 4FE3A 3W06A 1FLDA 4PCVA 4AMUA 2DTEA 1IEQA 3T0FA 3T7SA 4EK9A 1CKEA 3H7IA 1I14A 1A9PA 1NY6A 1IYZA 2ARKA 2H4JA 2Y1CA 4TV8B 4QFDA 4BCDA 2VYCA 4QODA 2GNOA 2ZPAA 3KKQA 2QNIA 3EXG1 4IS2A 3A1WA 1E1RA 4ZT7A 2Q6OA 4YV1A 1Q6ZA 2P6OA 4IKOA 4RCYA 5FPHA 3ZYCA 2AF4C 2NYRA 3PXCX 5LZ2A 2KBFA 1QHHB 1M2VA 1NMXA 2GNPA 1V8ZA 3L07A 1JLKA 2O7NA 4MWDA 1ZGBA 4E12A 1QHXA 1IQ0A 4FHEA 3M6UA 3P2OA 4LOIA 1FSFA 1MQ8B 1BWRA 5DCWA 3R0ZA 5FBVB 3OIUA 4X7RA 3TDNA 2WFMA 5BVHB 5K45A 5SYMA 5BXYA 1OI3A 4H6XA 1EP3B 2D8AA 2JATA 3IKTA 3NYIA 1CIJA 4KQEA 5DGIA 2JD2A 3AF0A 4X63A 3LWDA 3NCHA 1IEVA 1XEFA 4LHXA 2RG1A 3FFWA 4JLBA 5IULC 3DMTA 3V7UA 1KVRA 3FPBA 1E43A 2Z2ZA 2X14A 3RIMA 4XW2A 4MQUA 3VOAA 1CIVA 1RXSA 3VR3A 3GFRA 4OPOA 4MYCA 1OAOC 4FHCA 5DASA 3EEQA 5K8LA 4DRYA 2ACVA 3OC6A 2Q5IA 3L46A 3GU3A 1KKLA 4XYEA 5MHTA 4NICA 3CLVA 4B7CA 2A57A 1K68A 2PMFA 3KTOA 3IIMA 3VPBA 1C3LA 2V58A 2XRMA 1DKRA 3MT0A 2XT6A 1QP8A 3QUTA 1GZ7A 3JQAA 3RUAA 5B7NA 3GQVA 1L5WA 2WIBA 4KN5A 4KMOA 3LPNA 5DNEA 3USCS 3TWOA 2HGSA 2IZ1A 5JC1A 1RJ9A 3A06A 4DK1A 4YJKA 2E1PA 5HKAA 4FWIB 4Y1RA 5AM1A 3ZWAA 1KFEB 1XLVA 2QV7A 6PFKA 4JEHA 1ZH8A 2YOGA 4JB3A 2XGOA 3C5VA 1DKOA 2Q41A 3DE7X 4JOBA 4U7FA 4URXR 3L8EA 2DHQA 2QV0A 3GCGA 1GUDA 1ZIXA 5ECGC 1FNBA 3HGMA 4C2AA 1GUYA 1R9JA 2D1YA 4ZP1A 4RV5A 2RBGA 3K8ZA 4QUBA 3USZA 1WM1A 4IZIA 3DSRA 4ND1A 4WEQA 1T3LA 2GHTA 2IYVA 3GVHA 4CQMB 3KYCA 1NE2A 1P8JA 2NQTA 2BMAA 1DKMA 1SXJA 5EIWA 3QV2A 3OI7A 3T3HA 3P9QA 1V37A 4CLXA 3H2YA 1VLLA 3N6RA 4BC1A 1FUUA 1BS1A 5E1MA 1ORHA 1YAHA 4GBED 5IM4A 1N2JA 1CUBA 1PQPA 1ZM9A 3F7OA 1USGA 1Z33A 3ETGA 4IZOA 4JJKA 4BYMA 5J63A 4CIDA 2OBTA 1Z4MA 1V5EA 2N46A 3I04A 3KTAA 4A9AA 1E2KA 2WNIA 2OECA 3C0KA 4N40A 5L40A 2JK0A 3HPQA 4WNIA 2BM9A 2UKDA 3ZHSA 2FRDA 4M6WB 5BSVA 4L2IB 2FFAA 1V3TA 3TG8A 1W4AA 1ZG3A 5K4HA 3VYRB 1KEWA 5BN3A 2P9FA 4DLVA 1OZFA 3PC7A 4UCQA 1USIA 2ZWPA 2IVFA 4H7JA 3V4PB 3C3YA 2XB8A 1Z3CA 3T61A 4RZIA 4XPIB 1S1MA 1OAAA 1PU2A 1CZHA 1KR5A 4RGQA 1Y3AA 5B3AA 2I2FA 1C7FA 4GH5A 3FMGA 5G0VA 1R6DA 3Q40A 1W5SA 1ES9A 2VT6A 2FA9A 2P75A 4UVIA 3HBNA 4DZTA 1NBEA 1CUJA 4UM5A 4AO6A 4QOGA 3FCXA 3GFTA 2DKNA 3RFXA 4EM6A 1F38A 4WZKA 1M1ZA 1UKAA 3PTZA 5GP1A 3TUIC 5IU6A 2WG0A 4NBSA 3OZ7A 4EHAA 1MF7A 3BWVA 4X6YA 3TEJA 1C3OA 4MQFB 4LTDA 3ZKWA 3GRPA 3TUZC 4BDSA 2FMUA 1N4DA 3I4LA 1JEYB 4DDHA 1AM4D 1D7OA 4OA8A 2FPPB 1AXEA 2AKYA 4S12A 3TVDA 4B6PA 1NXWA 1NATA 3B1VA 5DB4A 1OASA 5HQ3A 4PRLA 5TQ0B 1PL0A 1W46A 1Z63A 1ENOA 3FSJX 2BZGA 1ONOA 3BWDD 3PTLA 3NWJA 3BQMB 4BNZA 2WUVA 5FLXA 2AJDA 1KI8A 2WHQA 3WL8A 3CRNA 4WUVA 2YFYA 3HY4A 4DR4B 4PGGA 4EGFA 1WU7A 1BKYA 1P1HA 4IX1A 2OHGA 5I47A 1ZXXA 4ZOAA 2BF4A 1JL3A 1FLNA 1QGYA 1GQ2A 3H9JA 5CXXA 4U00A 1G8AA 4XLTA 4BGVA 3PPVA 3QMPA 1IZZA 4U9HS 5JCOA 5REQA 3WE7A 1NV8A 2XV1A 4JLOA 4HI0E 4KVGA 1TNDA 3GFBA 4LZJA 1M7GA 5E9JA 3WGZA 1GKYA 1ZICA 4H6WA 5D8DA 1IBKB 1DEXA 1VJGA 3W5AA 1CJUC 3EIUA 4UZEA 2ZAOA 4JJIA 4MP8A 1UJ5A 4XGQA 1C9KA 2O8VA 2OD7A 3JTEA 1I5RA 1VE7A 3ENVA 3I0ZA 1XQ6A 3OM0A 4H1UA 5LA6B 3VYTB 1R8XA 3TSCA 2SBTA 3GCZA 3SS9X 3G0IA 2G25A 2HQBA 1ZJYA 3FY4A 5AVKA 5KVQA 2O20A 4AECA 5KVCA 2P3SA 1OB2A 5TLSA 1KZ4A 4WA8A 1X42A 3KAKA 1WF3A 2IS6A 2YHAA 4I4TB 2AR9A 5HW0A 5CCXA 3PYXA 3ELBA 4XTCS 4MS1B 2ZOSA 1YOVB 2XT9A 4QWMA 3UICA 1T5BA 3GZNA 5LQSA 2IY9A 3DEKA 2E87A 4RZQA 5KS2A 2ZXUA 4LC0A 3KUUA 4MQ4A 2J85A 3D6UA 1G8SA 1JS1X 2VAMA 3TL2A 3X1JA 5EHGA 5I4IA 5JZMA 4X7CA 1MB0A 3SYKA 4KR2A 3ZCVA 5B2ZA 3G4SB 1SBHA 1Q74A 2I4NA 3FDFA 3DNPA 3H1AA 3RTEA 1XZDA 3VX4A 4DLRA 1FFAA 1TUEA 2XI4A 2QE6A 4I9NA 4M9RA 4EBFA 2J6IA 1UODA 1Y9JA 3RSQA 3K70B 1CUCA 4TYMA 4L85A 2P6NA 4IUDS 5TX7A 1VBMA 4LGMA 2OL4A 1ENYA 5A5FA 2H4ZA 1GUAA 4TLDA 3S2EA 1ML4A 2NO5A 3CF6R 2G17A 2G1UA 1QQTA 3WRYA 5C5EA 2WJ4A 2PZGA 4ISBA 1Y0RA 2Q1TA 1YI1A 3WA6A 1CEQA 1VQPB 2I2BA 4WOCA 3OFNA 4CCWA 2V0NA 1PZNA 2CJPA 2EJCA 4L9AA 1B8PA 2PKQO 3A3PA 3G88A 3CH6A 4BASA 4EA8A 4W9MC 5C7IO 4C14A 1RHUA 3TRJA 4K9KA 5EYPB 4B6GA 4MVJD 5K2OA 1UT8A 1ZI9A 1GLNA 1YCHA 1QKIA 5FFNA 5TMDA 1NJ6A 1G16A 1QYWA 4KX5A 4HE6A 4LVCA 3UH1A 4W5JA 1FXSA 2IXGA 1CDDA 2WLSA 2Y76A 4ZYUA 2VEDA 2WU8A 2X6YA 4J6FA 5ENDA 3LBNA 1K8AD 1WZCA 1C9JA 4XGRA 4UAUA 4G2TA 3FM9A 4QQFA 4J90A 1DQSA 2HWKA 3N6XA 2IBSA 2JFVA 8OHMA 3N2GB 2RI0A 4E5YA 4LVOA 1HBJA 4YCSA 4MIYA 1NI3A 5E3JA 4A8JA 1YT5A 1MEEA 3A6HA 2XZPA 2PPLA 3RCBA 4AY4A 4W5QA 2WKSA 3QVGA 4BWYA 4IEIA 3KO8A 4B4DA 1MXHA 2V6GA 4XH9B 1T29A 1XRMA 3L6RA 3TR0A 5MN5A 4OP7A 1HV8A 1BXRB 1Z6AA 4B6RA 4JMPA 1PJAA 3DAFA 3HCDA 3UJ8A 4WXEA 4WN9A 1GTJ1 3UHFA 2K6GA 3FR7A 4DXAA 1E0SA 1WR8A 4CDRA 1G7RA 1GDHA 3G7SA 4AJIA 2YOHA 1WAMA 1CJVC 2O52A 3ADPA 3KVRA 4KEAA 1QK3A 3Q3AA 4GR5A 1S96A 4V0KA 1JIKA 1VQ7B 3JQQA 4HTAA 1ZHOA 3M49A 1C7RA 3RK4A 1PNOA 1G3UA 2RHHA 3KR0A 3UJ6A 1WHSB 1GKUB 4V0OA 1QB7A 4V0ME 4M0UA 4ZI7B 2P5UA 4RUKA 4MVJI 1WBDA 1A7AA 2AJTA 5BSKA 3FKSD 2HPVA 4LJ9A 1ZGJA 1Z15A 4A23A 1XELA 1MB2A 1SEPA 1JG7A 3PFGA 4LJSA 3E82A 3KB6A 4JT4A 5FA5A 2HDNB 1YZGA 4ZKDA 3PUNA 1YB1A 3NBFA 1O77A 2XB9A 4MJ7A 3NBMA 2VPYA 5EJ9A 1FVXA 3F6SA 1EGMB 4P1VA 1GPAA 2BJHA 4P9SA 3FCYA 3OW2B 4MDYA 1QVGB 4ZU3A 3VPGA 3B7PA 1FNNA 3DBHB 2A78A 3T51B 1B42A 5AVXA 1C80A 5CA1B 3ORRA 4U39A 1BJKA 4O4IB 3IPCA 4RJ2A 2XQGA 4HJRA 4EF5A 5DM1A 3VV3A 4CUZA 2MWMA 4NH4A 4OQXA 2ANCA 3O1LA 3PHGA 1Q7RA 5B6PA 2WM8A 3QPAA 1W2BB 3NOQA 3PHCA 1S1CA 4LOKA 4NBVA 4P3YA 2I3BA 1YB4A 3ZZ0A 4YRKA 3TLCA 3UAWA 2RHRA 4CL3A 1NLUA 4V1CB 1VQ1A 1YVUA 4CMAA 1ZK0A 1KFJB 2HIGA 2QRVB 1HE2A 4UNQA 2NO4A 4PFQA 1EB8A 2CY0A 1TUBB 3Q9SA 4XCQA 5CPFA 1GN9A 4YLEA 4EHFA 4PIVA 3PUZA 1RAHA 4UBNA 5HJ5A 1URPA 5DF1A 2QN1A 4JI4B 2QUIA 3GAMA 2VYQA 2VCHA 2B1GA 4CIBA 1OFIA 4V3CA 4P0TA 4MRPA 5J2TF 5EFOA 2XRZA 5KCZA 1TQ6A 4UU0A 1HETA 3EAQA 3KYIB 3FYUC 1FFBA 1SUWA 5HKBA 1HTBA 4M8NE 1X7HA 4B8YA 1QKJA 1RQGA 4G97A 1QLWA 5CTAA 3AXTA 2I33A 4IIYA 4RLSA 1TYDE 2JIDA 2Y66A 3TQQA 1EWRA 1E6UA 4UOZA 5HCNA 2WU3A 3QKWA 3I1IA 4YT5A 1XFDA 3WI7A 2ACKA 5CT8A 1GFWA 2XNCA 1MXFA 3FBWA 3GJ0A 1TT7A 2BKEA 1OXSC 3QVMA 4BZXA 2P4EA 2B3TA 1LF5A 5H3HA 1MC5A 1N1MA 1L9KA 2R8ZA 3CSDA 1QVRA 4K40A 1DC5A 3D6TB 2PNJA 2A9RA 2IIBA 2AMVA 3O8OB 4Q01A 4PYRA 2AI1A 3FAZA 1VBKA 3I58A 2UYOA 2QUKA 3UJAA 3MD0A 5JS2A 1YITB 1F6WA 5DE3A 2BGWA 1E1KA 2OHFA 1VQ9B 4FQ7A 4W7SA 1OWOA 2W2MA 4EZIA 4GPEA 4K0KB 1B73A 4ZOCA 3RYIB 2P9QA 4FP9A 4M9QA 1OXUA 3IX7A 1Q1AA 3FJ1A 1ZVKA 1YUBA 5LKAA 4Q1FA 3CCSB 1A27A 5B1SA 4OB6A 3EUAA 1T2NA 1SVLA 3KPYA 3E23A 4JUAA 4REQA 4GMHA 1GFSA 1PWZA 5FWXA 1C9YA 3ZHZA 1D0SA 4DA4A 1UXGA 3JQGA 3CRVA 3RUIA 2GZ2A 5F78A 2WWYA 2VHXA 3BTOA 3IOMA 1TJ5A 4ALLA 3SICE 3UWKA 4D8VA 1I3CA 3VVCA 4RGBA 4L7QA 4YJ3A 5CYPA 2CL7X 1LLDA 1UP6A 2VH1A 4Z51A 3JWEA 1PQWA 5FBKA 1I2AA 2B61A 4CG1A 1YZNA 4NMLA 3RUCA 2ZQYA 2Z5FA 1C1YA 4XYGA 2OZLB 4L5IA 4YX9A 1N3YA 3MWJA 3Q41A 1JHQA 2O4CA 4U02A 5EZQA 5KKAA 3TNYA 3RYFB 1AQYA 4RY0A 4S0XA 4W6QA 4WCDA 4RY8A 2ODAA 5AVSA 4XLHA 3CUUA 5I48A 3EWNA 5D5PA 5EXDA 3R74A 1N9GB 3CEHA 2JJ8A 3V97A 1IU9A 4KBGA 3TECE 4CIXA 4I55F 3VYVA 5HBGA 2NZ8A 1G6Q1 5JY1A 3O38A 4KE8A 2IV3A 3P0FA 4B3CA 3A6KA 4RZ2A 2C1EA 3SSAA 2EWMA 2WABA 1JWLA 3SD7A 1D3AA 3OLWA 2H3EA 1KJ8A 3P1JA 1KWGA 1GNVA 2EJUA 3H4VA 1AUPA 4DB4A 4QYMA 3REOA 1VYHA 4YQYA 1O97C 1QC5A 1YS1X 2OHVA 3K0FB 4F9EA 5DCUA 4E09A 4PC7A 5JECA 4WASA 1AF7A 3D1VA 3K92A 4GZ5A 4RSHA 5IC5A 1D0IA 3IXMA 1NOIA 3Q9UA 3KQUA 4U7HA 3OESA 4I50A 1S01A 4MI9A 2Z3ZA 4O4JA 5EIAA 2RIPA 2XUGA 1W4BA 4MS3A 1P18A 2JZCA 3HVHA 5CDUA 1V95A 2EYQA 3HBLA 2X4GA 4L4SA 1PO7A 2XMZA 4A36A 5GGYA 3ORSA 1RBZA 4LI0A 2ZBVA 1WXEA 3UT0A 3PNKA 4Q3BA 2QSZA 3AETA 4LFBB 2HB6A 4Q3KA 1SVKA 2QR5A 2W6CX 4OSOA 3S2YA 3LKDA 1OA1A 4JLKA 1RC8A 4HZGA 3ZK7A 2FVXA 3AFMA 5KOIA 5MF6A 1P3DA 3VMMA 2COEA 2QM7A 4X94A 4ZC1A 2ZBFA 4MAFA 2IITA 2HZ7A 2J9XB 4B48A 4GMXA 2VDOB 3GROA 4TVOA 1EAMA 3GDWA 2ID8A 2IK8A 2JHFA 3M83A 5JRZA 1FNDA 3H9UA 2CUKA 3CE6A 3ODGA 1OB0A 2DH5A 4P84A 1AQJA 1T36B 3CXCB 2MYUA 4L76A 2CYCA 2O3SA 4XM0A 1J9EA 1I3LA 2IYUA 1IG3A 1RXIA 4W8OA 3L9XA 4WZ6A 4C3ZA 2E1RA 2I54A 2Z8XA 5HMMA 4DWOA 3ISXA 3HXKA 2ISSD 1DIGA 2YJGA 1NM5C 1V4BA 2PSDA 5CT6A 2E4AA 1TZMA 5TT0A 1KK3A 3I4CA 3ZWQA 4ESEA 4MICA 3QU9A 3ZC3A 2QJWA 4DSAA 4BLRA 1UF9A 4JAVC 2YIDA 4JI2B 3OLYA 3WKDA 1Z16A 3W8EA 2H8KA 4IL5A 5E3HA 1KDYA 3SVZA 4OYRA 1DUSA 3KOZA 4F3KA 4BPBA 3ZJUA 2O8BB 4F91B 2JG3A 2XT0A 1N6RA 4TROA 4Q4HB 3V7NA 4D0NA 4XWOA 4E5MA 5CA0A 3GGJA 3UT6A 3CH5A 4WLFA 4G1MB 4P35A 5J35A 1LB1B 3LSYA 3QWHA 4E2ZA 3B78A 5JSZB 4EY8A 2OV3A 5AI9A 5KSWB 1V7QA 4X0CA 1DO8A 1RKXA 4GRDA 1BEEA 1VF7A 1U1FA 4G2NA 3VR4D 4N12A 5F1PA 3ZJVA 2C4UA 2HK6A 5JYBA 5BW5A 2XYHA 1OX4A 1RQRA 1YQEA 4QPZA 3ZXUB 1KOLA 3RRYA 1U0HC 4M46A 4QYIB 3CO0S 2E48A 2M9MA 5JSHA 1F2UA 3D5EA 1BN6A 2XWBF 3JZMA 4MLPA 3Q3EA 3F1KA 4IIXA 4Y7CA 3TZLA 3UHAA 2MR6A 5KMGB 1EGVB 1GG9A 1GU1A 2QRGA 3OP1A 3WNCA 1TCBA 2I87A 3OURA 3TZCA 3LHIA 2R86A 4HXGA 4PZPA 3GYBA 3LUCA 4WIAA 4Y2QA 4EECA 1EXVA 2CRVA 5BN1A 5ILQA 5IYPA 3OZTA 1AA6A 3WYEA 2ZCUA 2PLRA 2QRUA 3C15C 1UIRA 4LNHA 2IUYA 2MIIA 1ZCFA 1GV1A 3RANA 3U1BA 1K8YB 1E2FA 3PHJA 1XTJA 1GTZA 2YWXA 3G0CA 4K6CA 2YHIB 3WK4A 2KB0A 3UK0A 1S2DA 1KVSA 3S0JA 2IWRA 1PSWA 2H0QA 4N6OA 1VKJA 3AEKA 5IBRA 3LHFA 4UE2A 4ESOA 2CB0A 4JJ8A 1H2RS 1FIUA 2I8LA 3JQBA 2FVYA 2HHLA 5ICSA 3HPRA 2WUGA 1KOFA 3TIIA 3WLHA 4IV5A 2IZ7A 3A8KA 2I03A 5IM5A 2Q6KA 4KHPB 2OXRA 2R7MA 3DOJA 3P2JA 5AHOA 4FYIA 4HVTA 4GGPA 2MINB 4K9LA 3QSGA 1JR3D 4C4YA 5E0KB 5KYKA 3G9ZA 5HRAA 1EP9A 2OGZA 3CKMA 3HACA 4K6HA 2X0EA 3VGPA 3ABRB 3I9OA 3TTUA 1E9DA 2VP2A 3CJRA 1TAUA 2XWPA 4D79A 5EMMA 3R41A 4TUYB 4YO7A 3PGXA 2OHIA 4DK0A 2AKEA 4ZVUA 3RABA 2XVZA 3F8TA 4QDTA 1GNSA 3V2GA 4BWGA 5HSGA 1PD0A 4F4FA 5KYYA 4F0JA 1NVKA 3KHTA 4PQEA 5HKOA 2BEWA 3EGOA 3OZSA 4BFCA 3BK2A 5LP6F 5HZBA 2WSYB 1FFWA 3WWPA 4EHDA 1TECE 3VTAA 3FNFA 3ZVLA 5F2NA 2FF7A 2VH2A 1K7FB 4X7PA 1FX0B 2Y8EA 3G23A 4FDVA 1U8AA 3L1HA 2MMGA 4L5JA 1JFFB 3ZR4B 4ESHA 1MC1A 1AG9A 1GNPA 2BN4A 2F67A 1ACLA 1OC4A 1ZH0A 2D7CA 3TAHA 1DIOB 3V6LA 1I36A 1X7YB 2E3JA 1FS6A 5KSPA 3MUEA 5E38A 2A88A 4JR1A 4DNQA 4XTRA 1VJSA 1X7WB 2QN9A 3K31A 1LBQA 2HGZA 3QE3A 2OO3A 4IJ6A 4ITUA 4NFYA 5ALHA 4YR7A 1L5ZA 1SC1A 1X2BA 3HXLA 4HPXB 3ZCSA 3DV0B 2OBSA 2YWCA 1VCIA 1DWOA 4DARA 5LUBA 1N8SA 2ZTVA 2V8BA 1XCBA 5BV8A 2D06A 1WKVA 4AMVA 4N76A 3C1TA 3LA8A 4BB0A 4IXWA 1JH9A 3N2IA 1ZISA 1B43A 3QLTA 5GIPE 4M7RA 2ZYWX 4MI3A 4YC7A 1J8QA 1PGPA 1P5RA 3PGMA 4OKSA 2H2DA 2WUDA 1Q77A 3HCWA 1E1LA 4GL4A 2J0UA 4L8JA 4CMIB 3RRZA 4WFKA 1VP3A 3NHLA 1L1QA 3CNEA 3KOYA 4M38A 5C1DA 4N7RA 4EG0A 2CVOA 5FL7D 4JBXA 2VNJA 3WLAA 2OCIA 3K35A