2B7CA

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
437
structure length
437
Chain Sequence
b'KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Elongation factor 1-alpha
molecule tags Translation
source organism Saccharomyces cerevisiae
publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
total genus 122
structure length 437
sequence length 437
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7cA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7cA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b7cA01
3CCMB 1UBGA 3OAAD 5TARA 1P2TA 1R7RA 1GOTA 1E2DA 4L4UA 3SHWA 5EP1A 3RRNA 4G1UC 2X19A 4HAUA 2ZRAA 3DO6A 1K8RA 4FCWA 4ITRC 3T35A 4TYPA 4Y0VA 3W34A 5GJBA 3D7MA 1NBME 2J7KA 1XEXB 4QRHA 4D6PA 4UJ5A 3AGQA 1QF9A 2Z6VA 2ZJAA 3AF2A 1GL6A 2PCJA 3Q7QA 2VTKA 1OYWA 1NIPA 3FFBA 3SU8A 3LLUA 3HU1A 1GAWA 4LHZA 5JHGB 2GZAA 1IB0A 1NRJB 2VA8A 2W0SA 1TU4A 3JZMA 3SR0A 4ZDJA 3NEJA 1R0YA 2BBTA 2OM2A 2FSGA 2Z5FA 1KIMA 3CCQB 1ZNYA 4XD7D 3B13B 4A8JB 1DOAA 5TDHA 3LO5A 2QRZA 2VH5R 3JVVA 3EPKA 3W9YA 1TADA 5F2EA 3TH5A 4UAJA 4OL0A 1Z83A 2P6NA 1G8GA 1TTTA 3AVTA 1J70A 2ZYVX 3RS3A 1ZUIA 2YVUA 4EPYA 1OFIA 5AJVB 2AXPA 2EVWX 3U4QB 2PJZA 5DI3B 2VQSA 3BWDD 5ELXA 2CMKA 3IIMA 4IEEA 2W6JD 1QX4A 2WWYA 3WNBA 1ZMXA 4E5UA 3G0HA 2J7PA 1MR3F 1E94E 3A1WA 2IC5A 5L3VA 1E2PA 1OT3A 1NBMA 3KFVA 3X1XA 4RD0A 5D3MA 4NPHA 1SM4A 3W2HA 1PLLA 1R8QA 4A1FA 2VSOA 2YOHA 1G291 2C8VA 2ZJZA 4OQMA 4LJ8A 1FP7A 3MHPA 3QF4B 4PTLA 2H17A 3EPHA 3CD6B 4FK8A 2ZM5A 2GA8A 4U02A 2FEOA 4Y7CA 3FDIA 3CPEA 3R8CA 1NMXA 1EWRA 1XU4A 3U7GA 3O8CA 4AURA 3P26A 3T5DA 3UANA 1IN4A 2QPAA 4KFTA 4IVQA 1HTWA 3PFIA 3H84A 3QG1A 2FEMA 4YMTA 2OCBA 2VL7A 1OLOA 2IYVA 2JLZA 2ZREA 2IX3A 1HUQA 4KV9A 3RC8A 5H59A 3AF1A 4WBSA 3CBQA 2N46A 3LLMA 4WZAE 1KO7A 2Q9AA 1N0UA 4KI0A 3CRVA 3W90A 3KQUA 5JCPA 4Q66C 2B7BA 4ESHA 1Z8FA 2VNIA 2VP6A 4OYHA 1KI6B 1JA0A 2D74A 1EP2B 2D62A 2W0MA 4JBXA 4DCNA 1EX7A 2QGZA 3W2FA 2BCGY 2JAQA 2OEPA 3FPAA 3THOA 1Z6AA 4OK5A 3EPJA 3ICQB 1XTQA 2H92A 5AK0A 3ZQJA 1FRQA 1S9DA 2OUKA 3CUEF 4YMUA 1IAQA 1QDEA 1JEEA 3LWNA 2CJWB 3UG7A 2V7QD 2CHVA 1Q3TA 2J0UB 2QE7D 2W2TA 1LF0A 2OTJB 4OJQA 2C96A 3RYTC 5JJKA 1E2NA 3NH9A 4JYCA 1R5OA 1QVRA 5DHAA 4DDWA 1AIPA 1MT0A 1RRGA 2V6IA 3FE2A 2H16A 3QVVA 1U2RA 3ES9A 1FNBA 2JJ2D 2ZRPA 1QGYA 3GLHE 3MSXA 2GAOA 2WTUA 1U0LA 4A9AA 3K1JA 3C41J 2VHTA 4JLBA 4DLWA 3T1QA 4F4IA 4OQFA 2AXNA 3A6PC 4PAQA 4DCSA 4JIMA 5HE8A 1R0WA 1K5DA 1E9DA 4JVMA 3A4LA 4LRWA 2JIZD 4Q4LA 3PR1A 4WW0A 1DAIA 1JR3A 3CX6A 2FN4A 1OIVA 4X8MA 3FPKA 4D0NA 3CKLA 2FSIA 3N70A 2ZI4A 3RAPR 1HQYE 1DG1G 2G6BA 2GZHA 4LV5B 2FPKA 3GLFA 5DN6D 1N5LA 4R2HA 2YC2C 4IEIA 1UJ2A 2O8FA 4A0GA 1GP2A 1N5KA 5CM8B 5L3QA 4HUTA 4IDHA 1KZGB 1VIYA 4O0MA 5KSWB 3GMTA 1M1KD 1NVUQ 1MV5A 4ASUD 1TPZA 3IPYA 2UZ3A 3KUCA 4G0NA 1BMFD 4N1AA 5TV2A 1GRNA 1ZC3A 5JSZB 3QPUA 2Z4SA 1E9EA 2Q3HA 2A3RA 4HSEA 3LBNA 1D9XA 1EESA 3QKRA 3KJEA 5FTKA 3E20A 3LW8A 2NPFA 4GP7A 2RHMA 3DKVA 3VKWA 1ZM3A 2GJKA 2OESA 2JDID 3EC1A 3KKQA 1OKKA 1WMSA 2PMDA 2GILA 5KSPA 3PG5A 2WOOA 4XVRA 2ZI3A 3TAHA 2OILA 4BRWA 1KD1D 1Z28A 4UNSA 2ODBA 2QMHA 2GAAA 1KI6A 3B1VA 3N5CA 3EZ7A 4I4LA 1Q20A 1F2TB 4HAYA 5KSZA 5J4KA 1WE2A 4XSGA 4B34A 1OH8A 2KSQA 3ZD6A 4R7ZA 1KSHA 2D7DA 1R5BA 1V43A 4AKIA 1KRHA 5FR2A 2FFQA 1AKEA 4C0KA 1N6KA 2WSSD 1PUIA 2RHDA 2X8AA 4C0QC 2FJUA 2HT1A 3QF4A 1FTNA 1G19A 1XZPA 2F43B 3EG5A 2C78A 4JVNA 4PPGA 2AWNA 2CK3D 1G16A 2H57A 2WAYA 2ZRGA 4XIGS 4BFZA 821PA 2KWIA 2QU8A 5C4MA 3WRYC 4BZPA 3VQTA 4DEYA 5LDDC 5LD2C 1PV4A 2WIAA 4IDOA 3FMPB 4HE5A 2A9KA 4I81A 1E1RA 1U94A 4MKHA 4Y9RA 5A5GA 1AQUA 5J4VA 2WPDA 1QBKC 3SFVA 1WRBA 5EXPA 3AVYA 1DE0A 2LWIA 2REXB 3ZZUA 2QRNA 2W6IA 5CYOA 4G1BA 2XXAB 3IIJA 4Q4HB 4TTQA 3PXGA 1G9XA 1IN8A 2YOGA 2ZAMA 1OXVA 3SZRA 3F0TA 5AR1A 1LS6A 4GBMA 4TT3A 1A5TA 3W8NA 2NPIA 4G3XA 4BFSA 4EH1A 3EWSA 1J2JA 4PFSA 2C04A 2IS1A 2WMNB 4C30A 1BO6A 1C9KA 3Q5DA 2WICA 2K5UA 2RCNA 1KAOA 4TTRA 3FOZA 5JI3E 2HCJB 3E5HA 5KDOA 1N0WA 1ZRHA 2DWPA 2ZU6A 4MRSA 1E4VA 4TTPA 4JZKA 1Q81D 1UADA 3ASZA 5FPYA 3AVXA 3KJGA 1QG4A 4PO1A 1U90A 1AS2A 5J40A 3WMFA 4WA7A 2GNOA 3RDPA 3AVOA 2RH5A 2J45A 1JA1A 4URXR 2GVZC 4NHOA 3O47A 4GT1A 1DAMA 3MWJA 3HJNA 4DIDA 1Q44A 1KY3A 2WWGA 3ADCA 1XJQA 2DFKB 3NDBB 5A0FA 1W36B 3UG6A 2W00A 2AFIE 1R0XA 2GPJA 5JRJA 2BBWA 3QFRA 4XH9B 4B2PA 3CLVA 3QBVA 2OHFA 3QXCA 4G01B 3TNFA 1UFQA 4PZYA 4B35A 4DB4A 2AKYA 4HLQB 2EQBA 4QBHA 1XPOA 2QL6A 3K0CC 3CX8A 1GUAA 2EYUA 4S35A 4IOLA 2YWHA 2G0NA 1DDGA 5JCZA 1YKSA 3MWLA 4TLBA 4W9MC 3I62A 3ADBA 1W46A 1A1VA 3EIQA 2ZS9A 2B8TA 1ZNXA 1OB5A 1XTRA 2V6JA 1XF9A 2DCUA 3QXJA 3RRYA 4UJ3A 1OXXK 1AQYA 1XE1A 1HY3A 3KTAB 2F43A 5FA6A 3VU9B 2WM9B 3IIKA 3FKSD 4A6PA 5GADl 5DLQC 1DEKA 2XB4A 2Q0HA 2FWRA 1PLJA 4OI4A 2OCYC 3GLIB 3TVDA 2ZYTX 2BKUA 4AI6A 4NONA 3CF0A 2JASA 4LOAA 4MA4A 1GDDA 4BECA 1I4LD 3KXKA 3VMFA 4RY2A 4C0HA 2O8DA 721PA 2EFDB 1VDZA 2P2LA 1XMJA 4MKIA 5LB2A 3VHXA 2XOKA 4LJYA 1CTQA 1OGIA 4KLZA 3B2EA 4DUGD 2GJ8A 5FL3A 5FI0B 4ESVA 2UZIR 1AK2A 2XJ9A 3QVUA 1KOFA 4LYFA 5EP2A 3RABA 4HB0A 1YJ5A 3CO5A 4BPBA 2VHQA 5IT5A 4OBEA 4FCVA 4DDTA 5TMPA 3DOEA 3ETLA 3MMPA 1GVHA 1O3YA 4JLMA 2R6GA 1QHHB 4TQUS 1M74A 1N6RA 3L2OB 2F3TA 2JJ8A 3BH0A 3VHLB 1UEIA 2WJYA 2A5DA 2XEXA 1YZQA 1TNDA 2F1RA 2QI9C 1E2QA 2DPXA 4LJ6A 1M6NA 3Q72A 2ZE6A 3AGPA 5DE3A 3T5GA 4JSYA 1S2MA 5FUXA 1KKLA 3PEWA 3PENA 4URWR 2GETA 1R10A 4RD4A 3MRSA 4JL6A 5CB8A 5HCNA 1EX6A 1MH1A 4MKGA 4C43A 4JLPA 3CNLA 3VNVA 3BRWD 1S3SA 3CB4A 2V7QA 4DLXA 1YI2B 5G40A 3KKMA 4HE6A 4AF6A 2MSEB 4W5JA 3A1UA 2OK8A 3QFTA 2YV5A 4CYMA 2WKRA 4E09A 3I73A 3LD9A 4F4JA 1UDXA 4KFSA 1XMSA 3W3ZB 4TZ6A 3SFZA 1VIAA 5KU1A 3LA6A 2WAXA 3CPHA 1QHXA 2R6HA 5EXSA 4WIAA 1H85A 3BFKA 4QGHA 4QJ4A 4EPRA 3EZ9A 1VHTA 2AD5A 2EFCB 5KOYA 1II9A 2N1BA 3IHWA 3WMGA 3DMDA 1N6NA 1OE0A 2A5JA 5KO2A 4AIIA 1FX0B 1S1CA 5FUWA 4Q02A 1JJ2B 2YOFA 3FVQA 5DYIA 5ANRB 4RCYA 1ZUHA 2CLSA 3GJ7A 4RFSB 5BYJA 1TLLA 4LV8B 5KSYA 1N0VC 1SVSA 4UXJA 1XJCA 1AKYA 2IYYA 3JZAA 3TRFA 4D2IA 1JXOA 5TY0A 2NTYC 1WP9A 1F5NA 2G3YA 2WJHA 3IEUA 3NDPA 4GOJA 2ECKA 4DEXA 3WNDA 1E2HA 3AQ4A 3U4QA 2J3EA 3B1WA 3NBFA 3X1YA 1TUIA 4BZQA 4UNNA 3WMEA 1GWNA 2ZS8A 4V0LA 4DBLC 1KI9A 4Q21A 3R8FA 4TMZA 1KDRA 2A78A 3AKCA 3OE7A 2ZRDA 4II7A 1G41A 2IYUA 3VTKA 1U9IC 1W49A 1EWYA 2ASEA 2ZR7A 5EZ6B 3RS5A 5JECA 4G5RA 2ZXUA 2IYRA 1SKQA 2OE2A 1RFLA 2O0HA 3AVWA 3DKPA 4LPSA 1NF3A 4N0DA 5TVKA 4EPTA 2JATA 4YONB 4QC2A 3SI7A 3WHLA 4QOSA 3L8YA 3W6PA 3DDCA 1Z2AA 1DS6A 4A4DA 4HZUB 4IVRA 2ONKA 2PLFA 1CLUA 3GLGB 2RGGA 1E62A 1KO5A 2WWXA 1GRQA 3SJCA 1FFHA 4R9UC 3K9NA 2QA5A 3L82B 1EFUA 3PIRA 4DJTA 2ONJA 2E1RA 4Q7KA 1AZSC 4M9QA 3CF6R 1FMLA 1XJ0A 4EJSC 1OH7A 1BQEA 1NVVQ 1SVKA 1YR8A 3CWZA 2XXAA 1KO8A 1VG1A 4RFVA 1P73A 4MYCA 2OZEA 4LSGA 1QHYA 2HXSA 4Q4JB 3CZPA 1QFZA 2QNRA 3VR1A 3KXIA 4GDFA 2OAP1 1IHUA 1D1NA 1A7JA 1XP8A 4XVQA 4Z8XA 4DCUA 3PEYA 1GZSA 2GJAA 4XD7A 4BFWA 1PZNA 3KQHA 3QJYA 2BMEA 3QKSA 4CZ2A 1VCNA 3AH8A 3GEHA 3SBEA 2DY1A 1Q21A 1RIFA 1FQJA 2DFNA 3CRQA 1W0KD 2IF0A 3DZ8A 4ZPXA 5SZIA 6Q21A 2VSFA 5G3ZA 3FMOB 4EKDA 1P2SA 1RRFA 3KTAA 5J4LA 1G8FA 3CCLB 4NYMR 2QAGB 2WWHA 2IYZA 4LI0A 1JBKA 1GSIA 4C0LA 3KQNA 1VG8A 2GZDA 4MGYR 4OKSA 4KBFA 1FTSA 4FWTA 2PZEA 4BFVA 3A37A 4XTRA 3IPXA 1XXHB 3QXHA 1ZC4A 4FMDB 3VKHA 4IW3B 621PA 5JLJA 2Q6TA 4JLAA 3ZLJA 3OJXA 2WBLC 5E7IA 1W5SA 4RD2A 3X1DA 4CVNA 4D4MA 2ZSDA 1NMZA 3GJ8A 521PA 4MDFA 3MCAA 2IT1A 2ZRBA 3ND9A 4DLRA 4RD6A 4M1MA 5EMNA 5GJCA 4A2WA 2B5OA 2BGJA 1K9MD 2C9YA 2FZ4A 4UKDA 5BN5A 2QENA 4EJSB 3AVUA 3H4MA 4B2LA 1DAEA 2GXSA 4FMCB 5G53C 3UWOA 4ZIRA 2OBMA 3NVAA 3GJ6A 1DAKA 3KJHA 3TGPA 1DAHA 1W87A 4A92A 1W35A 1IQPA 1SVIA 3W3AA 1TX4B 1SKYE 2IEYA 5HXBA 4CW7A 4TMWA 3FHTA 3GJ4A 4A0HA 2JGNA 1EWQA 4F93B 5KNBA 5HTKA 4MUAA 1F20A 3CCSB 2BMDA 1E0JA 1D2NA 1Q3HA 1JB9A 4M4SA 1LNZA 1EFHA 2CXXA 3U7HB 3CR7A 4NCHA 1VQNB 1ANKA 4TT3D 1ZW6A 1W2BB 4B47A 1EFRD 1SVOA 1VCIA 4BWYA 5BXQC 1GR1A 4R2IA 5DSZA 3K8YA 3CWQA 1KTVA 1M1YE 3I1FA 4Q19A 4V0NA 3AUYA 2OFOA 4JMPA 2VSXA 3PEUA 1FNDA 3QEJA 2GK6A 1EP1B 3SHFA 2GEVA 3V4RA 2Q21A 4B33A 4MH0R 4TN1A 1IXSB 3I72A 3RSLA 2EIXA 4EDHA 4IKEA 3TUJC 2IW3A 1BH2A 3TSZA 3W2GA 3J81k 5IRCD 4CDGA 3O8DA 1G18A 3THYA 3W5JA 2O8CA 1R2QA 5EXTA 1G3MA 1N6IA 1Q22A 3PJRA 4Q7LA 2FOLA 2J0UA 3CC2B 1NVWQ 4US1R 2CJWA 4IVPA 1Q82D 2C9OA 3NC0C 4X8HA 4B71A 1DG3A 1E2MA 5AJXA 1SXJD 1XDBA 2VLIA 2ANCA 1NJFA 1TU3A 1GRRA 4FI3C 1XNJA 4WVFA 2PMKA 3U7FB 4E22A 2IYQA 4DHEA 3ZVMA 5CIQA 2JCSA 3QFSA 1KDPA 3DVLA 3QPVA 4BQSA 2YC4C 5FOTA 4D4LA 1Z3IX 2DB3A 2XZLA 1G7SA 1E6CA 3H1TA 2GXUA 2YWFA 1VQKB 1ZM7A 1MO4A 4B3CA 3B6EA 1KJZA 2IYWA 1CQXA 2RGBA 4QHSA 4B2IA 4D26A 3W5VA 3ONWA 3FKSA 2JDIA 3DL0A 2ERYA 1KK0A 4P4TA 1F2TA 4US0R 5HZKA 4OHYA 5BW8A 4IDQA 5DYGA 1OV4A 4JVLA 1E98A 3ZGXA 4Q4AB 4PC3A 4AC9A 2GCNA 1XTIA 1D6JA 1QVGB 4RFSA 4M1WA 1G7TA 2FF7A 4DLUA 4KFUA 1GO2A 1P75A 1FX0A 1D9ZA 1FNMA 2BOVA 4ASUA 4OI0A 3KQKA 1G20E 1G7RA 2FSHA 4BLPA 2ZITA 3PUZA 5K8UA 3UK6A 3ZJYA 3RVBA 4LC0A 4KJZA 2BBSA 5J47A 3MUFA 3AP2A 3U3MA 2AKAB 5FH9A 4Y0AA 2TMKA 3C8UA 5CYPA 1SXJC 2RGNA 4V02A 3A1VA 3B1XA 5AUQA 4K1XA 3U3JA 5HPYB 4QM7A 1HYQA 1OF1A 5CLQA 1U99A 5HKKD 5L3QB 1O87A 2WMOB 1BIFA 1N6OA 1W48A 1G5TA 2REOA 4B32A 3EIHA 1AS3A 4KSCA 5JWOA 1U98A 1SULA 4LGMA 4BLTA 1E9FA 2OCPA 4HAZA 5SZHB 4KFRA 2YYZA 121PA 1IY2A 1TF5A 3LH5A 2GEDA 5DI3A 3SYKA 4A2PA 3TKLA 5B58C 1VQLB 3AF0A 1XFAA 2WV9A 3SOPA 3QFCA 4JBWA 4ZCMA 2CL7X 2IS4A 3RS4A 5FL7A 1IXRC 2CLCX 1G5RA 4PX9A 3BB1A 2L0XA 3IO5A 4H1VA 4BE7B 1ZM9A 3P4YA 4Q1AA 3I56B 2XNJA 1Z0FA 3VR6A 2ZJYA 4BEJA 3K9HA 4XWOA 1Z29A 1GITA 5H70A 4MUBA 3R9IA 5EZ5A 3QXSA 1Z06A 4EPXA 1KAGA 5JZVA 4L9SA 4CT4B 1R4AA 1W4RA 5EE1A 4P0TA 1Z0JA 2FPMA 1Z0DA 1D2EA 2V54A 2ZR9A 1XTKA 3MGCA 3ZDQA 4A2QA 1FZQA 4HDCA 5FBQB 2B21A 2YZ2A 3C16C 4S2EA 4TWZA 4LV6A 4IDNA 1Z07A 4U5XA 2IHBA 1YZGA 3CCVB 2Y8EA 4C2UA 1E2IA 2ATXA 3QXXA 1E0SA 2BSAA 2CEAA 3A58B 2C03A 1XXHA 2ERXA 4QL3A 4D82A 3CX7A 3KDSE 2E9SA 1I7PA 3B60A 4LBYA 2ZJ5A 3GLIA 2NO7A 1ZCBA 1W4BA 2FSFA 1NY5A 4Q9KA 3QY0A 3BXZA 3IDQA 1DADA 3TLXA 4Z1MD 3GCGA 3U7EB 3ZD7A 1RRPA 4NCJA 1JR3E 1COWA 2J0VA 2W2VA 3PV0A 4A8JC 4BRUA 2IXEA 1DARA 1W44A 3OZVA 3GQBA 3UKDA 1TEXA 3QSYA 1WDTA 3TMKA 3BE4A 2D2EA 2DEUA 1W36D 1BX1A 1IY0A 3I32A 3NKVA 5CB6A 4Q4JA 2J9RA 4HI0E 4KVAA 3VO1A 4P3YA 3T15A 3UMRA 4ACAA 1VCMA 4DQLA 1ZVQA 4LCBA 2ORIA 4KXFB 2HT6A 3DPUA 5IF9A 1YR9A 4TYNA 1TQDA 3A4MA 2YINC 1Q1ZA 5IK2A 2RGDA 4V0MA 4ON9A 4L15A 2ANBA 1X1RA 3U6BA 2NMVA 5LPNA 2AWOA 3EASA 1UMKA 4ZV4A 3HR7A 4QG7A 2KE5A 2NO9A 2IYSA 1KO1A 4URYR 4ZGNB 4PAOA 2NO0A 3A1TA 2I4IA 3ECCA 3THWA 2REBA 1PLKA 2EFEB 3OIWA 1GNRA 4B44A 1SVMA 1US8A 3FGNA 2EFHB 2XB2A 5FPKA 1GIAA 1L7VC 2UKDA 1X8LA 3EC2A 3CPWB 2VF7A 4RKFA 3SEAA 2R9VA 4P33A 1JR3D 5FBLB 1OGJA 2BV3A 4B6FA 2RGEA 1SHZA 2D3WA 4PO8A 1KGDA 2RMKA 5THXA 1KHTA 4I1SA 5FR1A 1KI1A 4Q00A 3TQFA 4CEHB 3RS2A 3SS8A 1Z2CA 2DBYA 2DWOA 1CR1A 1RJ9B 1W36C 1Z0AA 4O2RA 1JB1A 2QTHA 2DERA 3LRPA 5JI2E 4LUCA 4FN5A 3O8RA 5FTMA 1E3MA 2VNHA 3CC4B 1AGPA 1U0JA 4TL7A 1XMVA 2AFHE 4ILEA 1XD2B 5F98A 2FE4A 1II8B 3NBXX 2O8EB 1SXJB 1X6VA 3NEYA 2MSDB 3SJBA 4HDQB 3TBKA 5JSZA 2GHIA 4IFBA 4F91B 1OW3B 4YALA 3VR4A 4U00A 5P21A 5DISB 2CLDX 2IYXA 4KO8A 2QM8A 3N2IA 1HE8B 5LBIA 3RHFA 3T61A 2FDCA 1F2UA 3U6KA 1U8ZA 2OV2A 3QKTA 4JL5A 3ICEA 1W2HA 1VPLA 1NY6A 3UMSA 2H8KA 3K9GA 2QP9X 2R8RA 2J0QA 5EP3A 4V0ME 2HYDA 5A4JA 1FDRA 4TLDA 2F55A 1UEJA 3FMFA 2CNDA 2ZUCA 1A8PA 3UWKA 1E4YA 2PT7A 3Q7PA 4O25A 2XZOA 2PEZA 4CEHA 5FL7D 2CNWA 2R65A 5DGXA 2CL6X 2OTLB 4NE2A 5KHOC 1XTSA 4FD2A 5BWMA 1N2CE 2PBRA 2EU8A 4Q7JB 1W1WA 2G88A 4EQ6B 2XNCA 1AM4D 2MMCA 5JS8A 1CJTC 4HB2A 1M7BA 3B5JA 5EXXA 3GJ3A 1QH0A 1S0UA 5HE9A 3NTUA 2ZUDA 2IK8A 3FB4A 1R5NA 4KCGA 1NLFA 2IEZA 3VO2A 4HYYA 4JT4A 3EPLA 3B85A 3LXXA 4Q1CA 2FMXA 1DPFA 1G64A 1CU1A 3I8SA 5JRZA 1NIJA 4YHBA 1RYFA 4DUGA 4NYJQ 3K70D 1R8SA 3OHMA 1UPTA 2ZROA 3BD9A 3FFAA 1ZUNB 3P27A 2O8BB 1Z6YA 2GF9A 1NP6A 1G8PA 4EPVA 3ZC3A 2BIFA 1WA5A 1ZIOA 4EJSA 1VQ5B 2EW1A 3KXLA 4LX0A 2O8CB 2Z4RA 5CDFA 4DCVA 2RGAA 3BAFA 1ZM4A 3B9QA 3SNHA 5CITA 1IN5A 2LKCA 1JQJC 4E07A 4AKGA 1W0JA 2XNSA 3REFA 3HYTA 1LTQA 2N42A 3AB3A 1L8QA 3CRMA 1EXMA 3QIAA 1CXZA 1X8JA 5G41A 1A4RA 1Q1BA 5K8TA 1L4YA 3L0IB 1JPJA 2C9CA 2A7QA 1HH4A 1OSNA 3E2IA 4P6VF 2JLVA 4NBSA 1CR0A 4BGDA 2EWVA 4PR0A 5L3RA 4MGKR 3TR5A 5E7MA 1B23P 2ZSEA 4DC9A 2QM7A 3B1ZA 4BFXA 1DO2A 2R6AA 3MLEA 3NG1A 4TQAA 4L9WA 4CRWB 3BS4A 2IL1A 4HDOB 2X2FA 1CF4A 5EUMA 3EX7C 2H1LA 1OXTA 2HF8A 5FOVA 3QUSA 1M7HA 2QMUA 2VPPA 3S1AB 2A5YB 1AJEA 2QY9A 3L0SA 3U61B 3KFXA 4H9GA 1SXJA 4PQFA 4AYWA 3CH4B 4M8NE 1Z63A 4YQFA 1BYIA 1S9HA 1A82A 1MO5A 3OZXA 2DETA 1JALA 2LKDA 4OK6A 5FFMA 4Z1MA 1P9NA 2Q3MA 2PJRA 3V76A 1T9HA 4O3MA 2VO1A 2WWWA 3HDTA 3BJIC 3K09A 3AVPA 421PA 1U0HC 4C0AC 5FOWA 3ZVLA 3HWSA 3G6EB 1JAHA 1VQ7B 3V00A 4BFTA 2QQEA 3GLIE 2R44A 1EP3B 3R9XA 1Y63A 3GLGA 1KMQA 2CBZA 1XPRA 1XXHE 1XCMA 3AKEA 2VRWA 4N0EA 2PT5A 4OQNA 4TL6A 1KC8D 3AVQA 3VR3A 4BUJA 4DSNA 4YLGA 3OIUA 1GILA 2GQFA 4Q18A 2P6RA 5JS7A 1TQ4A 3W2EA 2ZIAA 4B43A 3F8TA 2JLRA 2YJTD 4FIDA 1QGAA 4PANA 3QQ5A 1EG7A 2MMGA 3EZFA 4I1OA 3ZZTA 2ZRMA 4GNKA 3T1VA 4DQKA 2F3RA 2FV8A 1FPMA 2QTFA 1WQ1R 1Z47A 1AZTA 2OK7A 3FYHA 2XGJA 4A82A 3VAAA 1OB2A 4TYYA 3DEFA 2YNMA 3QNUA 2W83A 1XEXA 4PC6A 2W58A 3KJIA 4LJ5A 4LYAA 2BN4A 3MWKA 1G6HA 1X3SA 5B2ZA 5FUVA 2F9LA 3OESA 3U2QA 4BLRA 4JYBA 3UXMA 3CIOA 4IRUB 1JQLB 3RRMA 2R6DA 1LF5A 1E2FA 1KQSB 1CR2A 1T3HA 4HUQB 5AUPB 2QUZA 5JHHB 4QJ5A 1Z5ZA 3S1AA 3G4SB 3DMNA 2AD1A 2O52A 4MQBA 3QF7A 2GF0A 1R0ZA 4M21A 3SN6A 1LY1A 1XD9A 5G3YA 3WNCA 1F6BA 3FTQA 1E79D 1JNYA 1ZYUA 2XZPA 4OJKA 4IXMA 4M53A 4LHXA 2GRJA 4GMXA 3IILA 1HT2E 4PAMA 2NG1A 1JI0A 2IWHA 4X8LA 4GOXA 2KBFA 1ZU5A 5DI9A 4NTZA 3CW2A 4PHHA 2HYIC 2VP9A 1GL9B 1G3IA 8OHMA 1XB2A 4MYHA 1LVGA 2BVNA 4YAWA 3GEEA 4RVCA 2RGNC 3CMEB 4A36A 1KNXA 2SHKA 4D25A 4M0LA 5IHPA 1XEFA 2OLJA 1DELA 1W0KA 2BEJA 2CVFA 2OBLA 4A15A 3OEHD 1E96A 1Q57A 3K0AA 3AP3A 4KYUA 2CRVA 5JEEA 1G8HA 2P3SA 1XMIA 1QVFB 4POAA 4URUR 1GKYA 2O8BA 3WRXC 1ESMA 4IHQA 4WQMA 2PX3A 1OKKD 1YZUA 4N3NA 2G77B 3A8TA 4URVR 1H42A 2QPTA 3H2YA 4W5HA 4ZCIA 1P60A 2IYLD 2R6FA 3AKDA 2Z43A 4NCKA 1FUUA 1P2VA 5SZKB 4ZDIA 2FPLA 3AEZA 4DLSA 4Q9LA 3BB4A 2BKEA 1Z0IA 3OZUA 2ZSAA 1C1YA 1ZM2A 1BMFA 4V0KA 2QDXA 1Q0UA 3NHBA 4QGGA 1QHGA 1Y3AA 2MSCB 2ZR0A 2BM1A 1QHSA 2V55B 5FBWB 3ZYCA 5FBVB 4U7DA 4AK9A 3ADDA 1YRAA 4NCNA 1PJRA 2FGJA 1KSFX 4O2LA 3GD7A 5BN3A 4PPNA 3ND8A 3SE0A 1OHHA 4NL4H 1YVDA 2JLSA 2AL7A 1Q1EA 1DDIA 1Q86D 3TUIC 2G0TA 5SZJA 3QOFA 3AF3A 1D8TA 1EK0A 2GCOB 2ODEA 3PUWA 4FMDF 2ZJ8A 1S3GA 2JIZA 4TL8A 3BFXA 4DZZA 2AN9A 1JAIA 1OXSC 1LW7A 1KSGA 4QFMA 3GLFB 1VYUA 4IJMA 1VQOB 4XTCS 3QE0A 5JJIA 1TMKA 5EE9A 1NI3A 2GBLA 4LJ7A 1X1SA 4IFEA 3OFND 2R62A 2ZQ5A 4B3XA 5B57C 2VNKA 1KK3A 2JJ2A 3I5XA 4IOMA 3JQPA 4DCTA 3ZZ0A 1WB9A 2BPOA 2IUSA 2O8EA 4F38A 4AY2A 4KHZA 1M8PA 1OJLA 1VECA 2XX3A 3JQRA 3LVQE 2AX4A 3NHAA 1UAAA 2WJVA 2J0SA 3W5HA 1T5IA 4LK2A 1OYYA 4Q48A 2HJVA 2IUTA 4MRRA 5E95A 3LX5A 4D4JA 3QKUA 3KUDA 4ZIRB 3ASYA 1RJ9A 1UKEA 2A5FA 2QZ4A 4EQ6A 1E2JA 5DIFA 4ZGQB 4TLAA 3QI2A 4DDVA 1MRNA 2DR3A 4EIWA 3MAAC 4YAFA 1CBUA 3OIYA 2HLDA 1T0JB 3K0FA 1AMOA 2P6UA 2ODWA 2F6RA 2NIPA 4KU4A 2GDJA 3K0CA 3I4LA 1CIPA 2B6HA 2PH1A 2JLWA 2RGCA 3Q3JB 4M9ZA 3RNLA 1UBFA 4M1KA 1MOZA 4I1UA 3TW8B 1EGAA 3HP1A 4F7WA 4ZDKA 3TVTA 2BMWA 3EA0A 4AF7A 4BLQA 3SYLA 2ZETA 1CJVC 4R71A 3UPUA 2ZSFA 1NLYA 1F3OA 4F92B 4V03A 2GXAA 1ZU4A 2IXFA 2IUUA 1KY2A 1ZNWA 4C0JA 2VNJA 4OQXA 4CT5A 3I5YA 3IEVA 2AHOA 3A1SA 1P9WA 3H86A 1TEVA 3KQLA 5H5JA 1NBMD 3LDAA 1FNNA 3JQQA 1IOZA 4HUQA 1NJGA 4DB2A 1KI8A 1ZP6A 5E3HA 4EFNA 1TUEA 4I99A 4DDUA 4B3FX 1W4AA 3BERA 3THYB 2PCLA 2BWJA 1TAGA 1GAQA 2DFTA 1NJID 1J8YF 1NSFA 4BASA 2VP0A 1GG2A 2W6JA 3K09C 1OXUA 4A0RA 1G3UA 2HCBA 4RZXA 1J9ZA 3QE2A 4WOPA 1J7KA 1S8FA 4Z54A 2D06A 3VX3A 2P67A 1YZNA 5TB5A 1GKUB 1ZD9A 2NO1A 3CNOA 4JKYA 1OFTA 3LXRA 1JXMA 2F1IA 2DWQA 4ERNA 3NH6A 4B3DA 2ATVA 3WBJA 3OW2B 2ZS7A 1YITB 2JEOA 5FBRB 2F7SA 2WWFA 1YIJB 2NO6A 2ORVA 2C77A 3WYAA 1Z6GA 1Q12A 3V9PA 2ZRNA 4PC2A 3BBPA 3MFYA 2ZI9A 4L5BA 4LJ9A 2EFGA 1VMAA 1UKYA 4FW9A 4TMKA 3THWB 4PO9A 1EFTA 4A8JA 1ETUA 1ESNA 4UXIA 4TMXA 2QT1A 2GWHA 2YWEA 1ZINA 4D0GA 3CMAB 4YMSA 3OE7D 4FMBB 2UVQA 3BH6A 4Z8YA 5FOSA 3RRZA 4DWJA 4TMVA 2I3BA 3TJZA 2BEKA 2CL0X 1M34E 2J59A 4OK3A 3THXB 4NH0A 4XWKA 3CR8A 4MDEA 1NKTA 2X1VA 2Z83A 3LX8A 3M6AA 3QBTA 2RGXA 2F9MA 2WJJA 2AR7A 4BPRA 3MD0A 4I1VA 4UNRA 1GTVA 4Q4HA 1N8RD 3RS0A 5JWRA 1CR4A 2PLRA 1N6LA 2OXCA 2ZRLA 4C7OB 2CE7A 4CGZA 2KB0A 4ZI3A 4B6EA 2ZPTX 3WXMA 5HR5A 2FX3A 1BYUA 2OCAA 1E63A 1CNEA 1BOFA 1QHNA 3T34A 1T6NA 2H18A 2QAGA 3P32A 2J41A 4P4SA 1VYTA 2JJ1D 2QP4A 3I8XA 1GM5A 3U44B 2KI5A 4JKIA 4K81B 3CCRB 4TYQA 2V8OA 2VBCA 4CF7A 2OAQ1 2CHGA 3QKSB 4CEJB 3I3SR 2QORA 5AN9A 1PUJA 2CCKA 1E9AA 4ARZA 1ONBA 3ZH9B 3LVRE 3AM1A 2XTNA 1W4CA 3D3QA 2XSZA 1ZBDA 5TXGA 4XWAA 3L8ZA 2ZE5A 5BN4A 3VX4A 4JL8A 2PZGA 4YAUA 1WBBA 2CHQA 2VZLA 3CCUB 4PQYA 3KL4A 1SGWA 4YC7A 3CNNA 1IM2A 1NN0A 1SKYB 2NQ2C 1N6HA 2QSZA 4PPFA 5J5CA 5LB4A 3BB3A 3BOSA 2IWRA 2GVDC 4B76A 4DRZA 2BCJQ 2H7VA 2P5SA 1XPUA 2JA1A 2W6ID 4HZIA 3G71B 1E9BA 1QHHA 1P61B 3EA5A 4HATA 2BM0A 1U8AA 2VP2A 1RC8A 2HMAA 1OH5A 3VFDA 1RW4A 2EYQA 3E1YE 3TW4A 3V4FA 5HKKA 2G1KA 1E1RD 3QG5A 2BGIA 5BQ5A 1S4QA 4DIEA 3PVSA 1FQKA 2Q3FA 3HPRA 5DH9A 2QPOA 3HPQA 1KZ7B 3LAWA 3KKPA 4CEIB 1KK1A 1KDTA 3G82C 1D2MA 3K70B 3DHWC 4D0LB 1NSTA 4OHVA 4PZZA 3B7GA 4GOKA 5FOUA 5KSOA 1TL7C 1VKJA 4Q1DA 3T1TA 4JLOA 1VQ6B 2VF8A 2CCJA 3NBYC 4TLEA 4RSGA 4YXWA 3IO3A 1E1QD 1GL7A 1OFUX 1NVVR 3RLFA 1G1MA 1LFDB 1QUEA 4FINA 4TMTA 2XOKD 3MG9A 2GEUA 4JLDA 3OEEA 4M1YA 4WZBE 4K46A 1E0KA 1IONA 1CEEA 4MYTA 3I61A 1RVDA 5GV7A 1XEWY 4GRAA 1JJ7A 2D4HA 1RKBA 2I1QA 4LYHA 3P1JA 1I4TD 4ZKEA 1KJWA 4P4UA 2YWGA 3E1SA 4Q1EA 1YJ9B 4TSFD 5KYKA 1QUFA 3SJAA 1NG1A 4P32A 2XJ4A 5M04A 4AG5A 5AUNB 1MABB 4LBVA 3PUVA 4GI7A 1G3QA 3C14C 1K73D 2R6CA 2OFXA 2RAPA 3M0EA 1UKVY 1GVNB 2B92A 3HU2A 4PXAA 5UKDA 1XX6A 3Q85A 1T8UA 5JBQA 2WJGA 4WXPA 2ZRFA 2ZVQX 2QMOA 1Z08A 5L3SB 4MITA 4MGIR 4BFYA 2HDNB 2WOJA 2ZRCA 3W6NA 4XSHA 4HLUC 4C9BA 4US2R 2ZJOA 4Q9HA 2WHXA 5F9FA 3PUYA 5K8LA 5FPTA 2G1JA 3M1IA 4OI1A 2D7CA 3PQCA 1CJKC 5AUOB 1FOEB 2DYKA 4TQ9A 2WKQA 1NN1A 4XVUA 1B0UA 1YJNB 5DN6A 1SXJE 5C2JB 4PQRA 1OH6A 4G5QA 2BC9A 2JLYA 2PIAA 2CVHA 2FFAA 2P65A 1QGZA 3CPJB 1NKSA 3TK1A 2PEYA 1VQ8B 2J87A 4FMCF 4JLVA 1FRNA 4PPQA 2ZYUX 5EUQB 3U3RA 1W34A 3KB2A 1X86B 2XNDA 1DAFA 3ZVRA 2IHYA 2QTLA 4HAWA 1I2MA 3GFTA 1EFRA 4WXRA 4B3BA 3GP8A 3Q9LA 4B75A 2QMEA 3ZS9A 3C15C 1G8YA 3ZBUA 1KDOA 3C4JA 1IXZA 1WCV1 2GTPA 1ZD8A 1FNCA 1G4UR 2ZJ2A 3K53A 4W5WA 2RKOA 1XBTA 1WBDA 3CONA 4NU0A 1IJEA 2DHRA 4M22A 4L8GA 3ZQ6A 1HV8A 1ZD1A 4GSYA 4G1VA 5D3MB 4CIDA 4HLCA 2QQ0A 3RSOA 2VHUA 1CKEA 1E2GA 3U3OA 2V3CC 2GXQA 4P31A 5EJEA 5GJWC 3TIFA 4G5SA 3CCJB 1LB1B 1SVWA 5KDLA 1KNQA 1S72B 4RZ2A 1JR6A 4Q1BA 3W8RA 5FTJA 4YAOA 2Q9BA 3DOFA 4ABYA 3DM9B 2QA4B 3T06B 1DO0A 1P72A 1LS1A 2QN6A 1WF3A 4BFUA 1QFJA 1P4SA 2ZI5A 2ZI6A 3LFUA 5GVRA 3R7WA 5JJLA 1YZKA 4OHWA 2WPDD 1P2UA 5AJYA 3OIVA 1FL9A 3ADKA 3VR5A 2F1JA 1VCOA 5CIWA 1BKDR 1CS4C 2P0EA 3D31A 1VG0B 2GJ9A 3IUYA 1KI7A 4EPWA 4HB3A 5AJZA 4URZR 3PEVA 3REGA 3CRRA 3IQXA 2EWWA 1Z6TA 1CRQA 2J46A 4DSOA 3IGFA 1II0A 2WSSA 2PX0A 5B30A 2WSMA 2IF2A 4YMVA 2OLKA 2GESA 1ODFA 5CK4A 2ORWA 1T91A 1YRBA 2PL3A 4H1UA 1XWIA 3Q5EA 4Z51A 2OG2A 3NIBA 3THXA 1JEDA 3GEIA 1KI2A 3T1OA 2C95A 4TL9A 1I2DA 3R20A 3F3YA 2ZRIA 4GMDA 5GV8A 2ZVPX 4C2TA 2KJQA 5LD2B 1YHNA 1FUKA 2KBEA 3QKRB 1M90D 1OFHA 1F60A 1VG9B 2WZQA 4BLSA 4NYMQ 4AYXA 4TSFA 1HQCA 4A0FA 4TLCA 4C7OA 2QEXB 1E9SA 1H8ED 1N5IA 1B2RA 1VQPB 3BIFA 3EW9A 4JT2A 2V9PA 3OEED 4B73A 4KBGA 3U60B 4F7DA 1K6MA 3SYNA 2O8FB 1GNQA 3I55B 4PZLA 5EP4A 1W7AA 3EARA 1Z22A 1RE0A 2QBYA 1KI3A 3RS7A 1NG9A 2X77A 4ZO4A 4AYTA 1YHQB 1NLZA 5DHFA 4DLTA 1U81A 4ZCLA 3VKGA 1IN7A 2GCOA 3BC1A 1OIWA 1UBCA 2ZRJA 3WYGA 3K70C 1XRJA 4NDZA 2XITA 4J0QA 2O0KA 3GJ5A 5IDVA 1J8MF 1N3BA 1TF2A 1K8AD 2VEDA 5CM9C 2BMJA 1FW6A 2F1HA 3D6TB 4ZI2A 1XD8A 1MO6A 3U3KA 5KNDA 3N2EA 1RYHA 3B1YA 1FP6A 1U9IA 4JLKA 4D81A 2Q9CA 4IDPA 5E7JA 1IJFA 1VQ4B 1P3JA 3FHOA 1FMJA 4JSTA 2XTZA 2DFLA 2J1LA 4B48A 4KSBA 5JEDA 2C2HA 4IOKA 2HXYA 4ZKDA 3AKYA 3LNCA 1P9RA 4JJKA 1XD2A 3KX2A 1H65A 2JLQA 2CNWD 4QM6A 1M2OB 4ACBA 4LY6A 1VTKA 4DKXA 2XSZD 1EFCA 1D5CA 1DTSA 4LHVA 2NGRA 3RANA 4LWZA 1DVRA 2B7CA 4MKFA 3NC1C 4HLUA 4MRPA 4YDHB 2QGNA 1GKIA 4PHTA 3WBKA 4BLOA 2FFBA 4Q47A 1YZLA 1CULC 1QG2A 3F5FA 5FTLA 3EIEA 3EXAA 1KMHA 2JJ1A 4KODA 5KDDA 1VYVA 4JLNA 1E32A 2NZ8A 4M1TA 1U8YA 2A30A 3LQQA 4M9SA 4RD1A 3GLGE 4IXNA 1G7CA 4PGOA 5L3SA 3TR0A 1QRAA 3KB1A 5EE0A 4YMWA 2HUPA 5AWFC 2OFWA 3LO8A 4AKEA 3UATA 1VHLA 4MYUA 1JJVA 1L4UA 3OFNA 1IN6A 4RCZA 4B4DA 4V0OA 2XAUA 1MABA 3LQRA 1TQ6A 5FPSA 1A2BA 3PITA 3SBDA 3CZQA 1Q1QA 3LBIA 4PSVA 4EFLA 1HURA 1JECA 1M7GA 2HV8A 5B64A 3W2IA 1UF9A 2RB4A 4GPTA 4C0BA 2FNAA 4M1OA 1II8A 4NKRA 3OZWA 4LHWA 4LZZA 5CJ2A 4M9XA 1NMYA 2QG6A 1E0AA 1CRPA 4CEJA 3BGWA 3GPLA 1KSJA 4Y9UA 3WHKA 1NVXQ 1BS1A 5C46F 2QBYB 1P7CA 1E2LA 3ZBTA 4UXHA 2P5TB 5GJVC 3QEOA 2FA9A 2HF9A 2J7PD 4M1SA 3SQWA 3CRZA 3ZS8A 3FMIA 4YDSA 4XJXA 3MJRA 1S1MA 2GK7A 3EZ6A 4DXAA 1CJMA 1H8EA 2OO7A 4DLVA 2WVJA 1G5PA 3L0PA 4QNRA 4NYIR 1X8KA 5FUYA 1L2TA 2VIIA 3B9PA 2JLXA 2IA5A 3AF4A 5C1BA 3HYRA 4AG6A 4DT1A 1HA3A 1NN3A 1HEIA 1TF7A 2GKSA 2PZFA 3K0EA 3FWYA 2QROA 4QBFA 4QBGB 4EUNA 5CDFE 1US8B 1AN0A 2WWIA 5IK2D 1Z0KA 1W5TA 4RKEA 2A5GA 1P5ZB 4UQOA 1HE1C 4HEJA 4ZDWA 1OIXA 4KAXA 1T4GA 1RPZA 1G3RA 3B78A 1TQ2A 2VHJA 3K0SA 4HLDA 4LPKA 5EE3A 4KITB 1UKZA 2QTZA 1S96A 1YQTA 1G21E 2J5XA 1DBSA 1XTJA 4NP6A 4QNMA 3NXSA 3TUZC 3EAQA 1NNEA 3E70C 2C5LA 2V4ZA 4GP6A 4WAUA 1RRCA 1UM8A 1YJWB 2FU5C 3IBGA 3QPWA 4NCIA 1T5LA 3G5UA 1HT1E 3O8BA 1N5JA 3LV8A 3Q8XB 4K8OA 5FPHA 1H8HA 1T3LA 3DZDA 4G5OA 3HU3A 3K0AB 3FKQA 4GZMA 3SC3A 1UDWA 4DVGA 5DNYB 1CNFA 4M2LA 1COWD 5H68A 3W5UA 3D8BA 1KJYA 5JMTA 2AK3A 5FI1B 5JFGA 1Q7YD 3KKNA 4DSUA 3LVBA 4Q01A 4QJ3A 1E79A 4NYJR 1ZNZA 3B8HA 5GVSA 2QAGC 4JS0A 3OAAA 4TYWA 4BEBA 3A36A 2QEQA 4Q1FA 2FH5B 1KK2A 5E4FA 5F9HA 2FFHA 4A6XA 1KKMA 4U9UA 1MKYA 2ZAOA 1P62B 3PUXA 2HLDD 2LCFA 2ZANA 3ZIAA 1JPNA 2AK2A 2G83A 2BMFA 1ZAKA 3I92A 2ZEJA 4Q03A 2IS6A 4C0SA 1XCGB 2OSBA 3VNUA 1CP2A 2CDNA 3GLHA 4X8OA 4LC1A 2QSYA 1XZQA 4FWIB 3GJ0A 3L43A 4AKHA 4NZYA 5CJPA 4XOIA 4QGFA 1SHKA 5KNCA 4LDJA 4DLYA 2ZUBA 4GZLA 3TAUA 2BHRA 1P6XA 2GJSA 2QAJA 4RD3A 4LBWA 3U5ZB 1BX0A 2H5EA 3TE6A 3GFOA 1MRSA 4PC7A 4PHGA 1V5WA 4TZ0A 4JLJA 5TR9A 2C99A 4PHFA 4QBIA 3IQWA 2VP4A 1E9CA 4DLZA 3R9WA 3SQXA 3MWYW 2NOAA 4Q5IA 5HZHA 2ZE8A 3RWMB 5F3WB 4LHYA 2XNDD 3CC7B 4D80A 2BDTA 2V1XA 2IYTA 3IBYA 3AUXA 2QP3A 3W6OA 4HZUA 4Q7MB 1ZCAA 3DM5A 3BFVA 3FJOA 1GAJA 1E99A 5FOXA 2G9NA 2VYQA 4LYJA 3WY9A 5KPDA 1KI4A 1ELOA 2R2AA 5C4GB 2OT3B 2VHCA 1E2KA 4DT1B 3VR2A 1YE8A 5KUTA 1F48A 1SQ5A 1J90A 1DAGA 5C18A 3NBZC 2CK3A 1KMHB 2VP5A 1E9RA 5L8VA 2A2ZA 221PA 1OPXA 2BBOA 3BH7A 2WKPA 4E03A 4HB4A 1QG0A 2OBNA 5BYKA 1ZIPA 1VQMB 1XEWX 4HAVA 3P4XA 3AVVA 1YZTA 1W2GA 2CCGA 4RZ3A 1RZ3A 3KKOA 4MRVA 1XCPA 1OHHD 4L16A 4PSAA 2W2XA 3BORA 2ZSBA 2ZE7A 5H8WA 2QTVB 1MO3A 1G6OA 4OI2A 3B82A 5D3QA 2JLUA 1VQ9B 3OJWA 1H8HD 2WIBA 3CF2A 2ZRHA 4OHXA 1Z6XA 3WP1B 1IY1A 3CRW1 4HAXA 5CLLA 2ZJBA 2V1UA 1A2KC 3IHLA 3PCRB 1F2UB 3QENA 4PSKA 3ZVNA 2IS2A 4FCTA 4Q9IA 2YKGA 2O5VA 3A4NA 3C5CA 1LV7A 3HR8A 1TVCA 2QT0A 1SZPA 1G4AE 4LBZA 5HCIA 2ZYWX 4LJ4A 4JJZA 1GJRA 3LW7A 4KVGA 4JVSB 4UNQA 4LJAA 1QZXA 4KLNA 2B8WA 4AWXA 4RZUA 3CM0A 1AA9A 3SJZA 3CXCB 1YR7A 2I1VB 4MGZR 1AS0A 3OEHA 1W0JD 1SVLA 2HJGA 4UNPA 3W5IA 1AGRA 1E69A 4QHTA 3TSOA 4BZXA 3WP0A 1NL3A 1IBRA 2D2FA 2BJWA 2ODNA 1ZJ6A 3EZ2A 4RJLA 1KYIA 3RC3A 2XTMA 3KZ1E 3LBHA 4MRNA 4EAQA 4YXWD 4Q4AA 4WZ6A 5H1YA 5K8IA 3MJHA 4NMMA 3LY5A 3C5HA 2CE2X 4N3GA 3K0FB 4OHZA 3GLFE 2ZI7A 2NZJA 5J4HA 3T12A 2C98A 1QFYA 4JBYA 4QKQA 5KTYA 4F4CA 3GJXC 2X3UA 1GFIA 1E1QA 4QXAA 3IKJA 2IBMA 5EE5B 2ZTSA 3TQCA 3BK7A 2GBLC 2ZRKA 1E64A 2FZLA 2HEIA 4GL2A 1E2EA 2WJIA 3EWAA 2X2EA 4KYIB 1KO4A 4EFMA 4B3GA 2VYFA 1CJUC 3NWJA 4GFDA 1K5GA 1N25A 1WXQA 4IOJA 4PC1A 4CEIA 1QVAA 3K9LA 3OF5A 3H0KA 3X1ZA 2FGKA 2IXGA 5J4YA 2OXRA 2O0JA 1N6PA 1NN5A 3AV0B 3FHCB 4AD8A 3WYFA 2ZU0C 3X2SA 3JVUA 3SDZA 4C3ZA 1QHIA 4OQLA 1J99A 5JWHA 1G17A 2FG5A 3RWOA 4DSTA 3P20A 2QE7A 4W7SA 5DO9A 1C4OA 2E87A 5CK5A 4D4KA 2O8DB 4Q9JA 2RC5A 3GFPA 5FTNA 4ARZB 4FXPA 4QHYA 1W47A 3CH5A 3CCEB 1NDHA 5AJWA 3GLHB 4QGAA 5KPJA 2YHSA 1T3SA 2Z0MA 3U44A 3C7KA 1R6BX 1YU9A 1GNPA 4G5GA 3M4YA 1T0HB 3L0OA 4R98A 4B74A 3AP1A 2GCPA 3X1WA 1BJKA 3UMFA 3VU9A 4NYIQ 3ZIAD 3R7WB 5EQTA 3UIEA 1UBEA 3TSWA 2BF4A 1PVOA 4P4SB 2BJVA 1I4DD 1YR6A 4C4PA 1T8TA 2RC6A
chains in the Genus database with same CATH superfamily
5IUNC 3OAAD 1CB7A 1IZZA 1DWQA 4OMUA 1J4AA 4FEEA 3BRSA 4A8TA 1E60A 3UXYA 4BZZA 4L4UA 2RIRA 5M3BA 3RRNA 4Z2YA 2OC9A 2HF7A 2X19A 1N7GA 3A04A 3EXG1 4HAUA 3COPA 4NEHB 3KLMX 4Z3KA 3H4IA 2L19A 3IODA 1GSOA 3NORA 4R5HA 1JDBB 5JXIA 1NBME 3IT0A 3Q6RA 3DT9A 1XRNA 1Y5RA 2ZTGA 2PAAA 4KIWA 4ZXFA 4D6PA 2Z6VA 1SVUA 2NT3A 1OC4A 1U7PA 3D3KA 3HCFA 3Q7QA 4GO1A 3QKWA 2VTKA 1OYWA 3I2FA 4AJHA 5LZ2A 3HKDB 5ILQA 4WKGA 3SU8A 2NN3C 3LLUA 3N8HA 3VM6A 1IB0A 3OUUA 4IH1A 4B6GA 4E2XA 1DAOA 2CLHB 2VA8A 1XR3A 3SR0A 1TU4A 4EJ6A 4ZDJA 3NJ8A 4FBLA 4HDNA 4PYJA 1H9AA 1R0YA 2A57A 4EHAA 1KTIA 2I76A 2P4SA 3PJEA 2Z5FA 4YUWA 5CDUA 3BXEA 4F1JA 1T5HX 1DOAA 4X95A 5TDHA 5IMSA 1WY5A 3GU3A 1B74A 3BTUA 3T5TA 5FUMA 5CTAA 2VUTA 3CLHA 4UAJA 2RHGB 1ZJ4A 3I01A 4OL0A 1Z83A 2P6NA 1G8GA 3ED1A 3G2QA 1TTTA 3C24A 3NLLA 1J70A 4L9AA 1N2IA 2X8KA 1ZUIA 4YJHB 4EPYA 4KRXA 1ISJA 1LJ8A 5AJVB 5B1HA 1ZK1A 5TQ2A 2YJ5A 3EGEA 5IYPA 4C1BA 1JWLA 3DF9A 3IAM6 3PRHA 3IIMA 1VA4A 3KLOA 5IBQA 2PH3A 1YSCA 2WWYA 3WNBA 4NC9A 3D8UA 4E5UA 3G0HA 1XFDA 2WFLA 3OQ1A 3VO9A 1E94E 4CM8A 2XMQA 5AI4A 3WGTA 5AW4A 1TMYA 4LRQA 3ISXA 1E2PA 3HJTA 1XVIA 1NBMA 2WW8A 3X1XA 3INNA 3BVPA 3V55A 1SM4A 3ZU3A 4AB1A 3W2HA 1PLLA 2VSOA 2XODA 1N9GA 3RVNA 4YROA 2VATA 3ZOZA 1FFXB 1Q1NA 2ZJZA 2RGWA 1WHTB 2W2NA 4PZDA 3MHPA 4FHEA 2H17A 3NX4A 4PTLA 4OXRA 1O4VA 5JCJD 5JW6A 1Z34A 2D5LA 4GR4A 4UREA 4UMFA 2BKXA 1FYXA 4HN4B 4ZQCB 3WLLA 2AOVA 3CPEA 3OOYA 3R8CA 3V8QA 1PWXA 1EWRA 1NMQA 2UUBB 3O8CA 1KPHA 1YC2A 3NIDB 1IN4A 2I80A 4ALNA 1ECLA 4XONA 5IJXA 2QVLA 4S2UA 2INGX 1U4NA 1PDOA 2YV4A 4XN0A 2Z95A 3PIDA 3TRHA 4N7RA 2NUAA 3HZRA 2OCBA 3RROA 1QO7A 5A62A 4HNVA 1Z5GA 4GZ6A 3KXPA 3QLUC 3RC8A 4WBSA 2R00A 1T2VA 5K4HA 2Q9AA 5MN4A 4FCCA 1N0UA 1JR2A 3PTZA 1Z7BA 1YOBA 1VJ1A 1TYAE 2BEWA 1PG2A 4NPAA 3EAGA 5D51S 4EUSA 1VPDA 3KQUA 3T41A 4L8YA 1U6KA 1RHKA 3IOBA 4F2WA 1Z8FA 4XW2A 2VNIA 1PT8A 4O2BA 1KI6B 3K2BA 2KMLA 3W5CA 2W0MA 1EX7A 3FPFA 2QGZA 4RS4A 1P5RA 3THOA 3FPAA 3EPJA 3KD2A 1EJ2A 1Z6AA 4IMRA 1XTQA 5AK0A 4ZARA 3UT6A 2YRFA 1CUEA 1S2GA 3MPOA 2XQJA 1E1CA 1C1XB 1V1MB 4XVCA 2YWJA 2V7QD 1Q3TA 3CUWA 3L84A 5GMOA 2RB5A 2ADFA 2GH1A 3DWGA 4WLNA 1FFWA 1E2NA 3FOWA 4MR9A 3PYLA 1FCJA 5DHAA 4F2DA 1SC4A 3TRIA 3ES9A 2ZRPA 3GLHE 4KYTA 2WTUA 5JAUA 3QPDA 4ND2A 1U0LA 4A9AA 1IQRA 1NHWA 1IBSA 3IXLA 3A6PC 3ZWNA 2WLTA 4JIMA 4EFDA 1C80A 1R0WA 3RTGA 5JNLA 1NAHA 4MRAA 4WW0A 4EO9A 5IT0A 3PR1A 1Y5LA 1LBTA 2GRUA 3L7MA 4UOZA 1KP2A 1ODJA 5ARCA 1ST2A 3OLYA 1T36B 2FSIA 2P2SA 2YXPX 1UMDA 2EJBA 1HQYE 1LV8A 1DG1G 2ZI4A 4JB2A 3AHJA 4LV5B 4OFZA 3SHVA 4NWIA 2QW1A 4XDHA 5ENDA 3RVDA 3N2YA 2QV0A 2YC2C 4OSEA 3P2JA 4ALMA 4YGXB 3WLTA 3VVCA 3AR3A 1TA4A 4A0GA 2GYUA 3S1SA 3DTNA 2NP6A 5AXBA 2CLMB 1M1KD 1NVUQ 3RRFA 3JZFA 4NJOA 5BUSA 3GO4A 3EEYA 1KE2A 5L4NA 3DQZA 2C1ZA 2H5IA 2ZT8A 4NDAA 1AXEA 1GRNA 3UJ9A 3BK1A 2NO5A 2QRMA 4MHTA 3QPUA 1Z3CA 2Z4SA 1E9EA 3F6YA 4IPTA 5FX2A 4HSEA 1D9XA 3X0DA 3BCUA 4CMJA 2JK1A 3E20A 1NOIA 2X5OA 3G5AA 2NSYA 2ZYIA 3LW8A 4NR0A 1XMPA 2ZBDA 2XBLA 3NALA 1M6HA 3DKVA 3DTTA 5EYPA 2PGLA 3ZW9A 4R51A 2C9MA 3N8DA 4MKZA 4ZZ2A 1OKKA 1WMSA 4NABA 3H5LA 3PG5A 2ZI3A 3TAHA 4BNUA 2QRKA 4UNSA 5TVGA 2ODBA 1XCLA 1EDOA 2IE8A 5C8YB 1TJYA 1RQ7A 1SXIA 4LMBA 3DQQA 4I4LA 4TTJA 1F2TB 3RU3A 2XMPA 5CA1A 3FSGA 1WE2A 4E88A 3IPAA 1U28A 1Z74A 4F5DA 3AIKA 1Q16A 1Y6QA 5A4DA 5JAHA 5K3SA 3GFVA 3SIWA 4FYPA 3TX6A 4EY3A 5LKRA 4YJFA 1C9MA 4R9VA 1QS0A 1U11A 1D2AA 1V43A 2ZWIA 3OZCA 4PZCA 4K6HA 4R16A 5H3LA 4FB4A 1YZ3A 3BUSA 2P8JA 2DPMA 2ZPAA 4I6EA 3OOWA 3AW9A 1N6KA 1GZVA 1Q1GA 2VYVA 2WSSD 1KZ6A 2X8AA 1GXSB 2V6FA 3B5IA 2D2IA 1FTNA 4WNAA 5EVJA 1WVGA 5EERA 5J2UB 3EG5A 3PLRA 4JVNA 3GPIA 1W59A 4PPGA 4QPZA 2H57A 1R6AA 2WAYA 2YMPA 2YN4A 3JAWA 4L0MA 5GONF 2KWIA 4OP7A 1RCFA 4Y7DA 4BZPA 4X41A 2VHEA 1EDDA 2WP8J 3KYDB 3U9LA 1WUHS 2IU3A 1SIUA 3FMPB 4TWBA 1FY2A 4D3YA 1U94A 3WL8A 5A5GA 5L51A 1CVRA 1X7GA 1KS9A 2CYBA 2YJ6A 2X4IA 3COYA 4R41A 1FXUA 1I18A 2ETVA 3CLRD 3H9UA 2Q5OA 1RAGA 1WRBA 1BEUB 2H1HA 4J1SA 4K6FA 4MVJA 5EXPA 4BVAA 1DE0A 4DARA 4FR0A 1V7ZA 5B5SA 2XXAB 3PXGA 4KHPB 2HEGA 4DA8A 1WQ4A 2BR4A 3N2GB 3OX3A 5DTRA 4ZO6A 2QRVA 5ITZB 2VTBB 1ZFNA 2PANA 3QEKA 3V4ZA 2AV6A 2FDRA 5AR1A 2Q2WA 2OHXA 2WYVA 5C52B 2CBXA 4QWWA 4DTCA 3AWIA 3HB5X 3E4CA 1U8FO 1ZSYA 2H07A 1DXYA 1X87A 1SC9A 2B4RO 1TKAA 2XWSA 3PVCA 2COUA 1O95A 3BPSA 5LJLA 2WMNB 1CY2A 4LZAA 4C30A 3DE1X 1XZAA 2J9FA 2K5UA 1YA6A 3EGXA 2C2ZA 2RCNA 4XAQA 2QL7A 2RHLA 3HCNA 1Z13A 5J2UA 1PKVA 2PSEA 5KDOA 3E5HA 5BMVF 3HJGA 4KEAA 2ZU6A 2V59A 4MRSA 4EG0A 2Q9UA 4Z4QA 4RIEA 4JZKA 3KSRA 2P2GA 2O14A 3WMRA 4DIBA 4LE2A 5C7LO 5IKOA 2C84A 3V1LA 5LOVB 4WA7A 2P4UA 2G25A 3T7CA 3GY0A 1QS0B 2RH5A 3HSSA 4AUMA 3AHIA 1JA1A 1G38A 2JAUA 3QEMB 3AEUA 3DDOA 4NHOA 5CIYA 1U7HA 1WOYA 3MWJA 3L3BA 4KV7A 3NTOA 1D6SA 1XJQA 5A0FA 2ZTVA 3DV0A 2VPTA 2VF2A 1YNSA 2W00A 2AFIE 1YTLA 3DHEA 3UG6A 5JRJA 1PR1A 4MQLA 5H3CA 1WY7A 3SMVA 4B2PA 3QXCA 4I19A 2WUGA 1UFQA 3TNFA 2RDMA 4CKCA 3OI7A 4N49A 4QODA 2WIJA 1ADGA 2AKYA 2NYUA 3EEQA 3PFWO 5BSHA 2EQBA 1XPOA 1KU6A 4CETA 2P3OA 1BXGB 1GUAA 3DMHA 4HGPA 2I4LA 4S35A 4X6LA 2E55A 1Y34E 2PUHA 2XHEA 5LDGA 2HMUA 1MVOA 2QD4A 3MWLA 3O9MA 5HK9A 1I3LA 2IP2A 2YRXA 4LXXA 1K98A 2O59A 3GDGA 3PIIA 1T2NA 3PQ8A 1WETA 3V4PB 5KTOA 4IMIB 1SHLA 3M4ZA 4GVLA 1A1VA 3KUXA 2H1IA 1MD9A 2XE6A 1ZNXA 1A8HA 1XTRA 3PDIB 1FC0A 2XMDA 4EEKA 1PSDA 2V6JA 2X9VA 1EYZA 4RYDA 4CLDA 2V4UA 2AMVA 5C8ZA 1XE1A 4X71A 2WNHA 3SE7A 3KSUA 2B4KA 2VYND 3G9QA 5FA6A 3KNZA 3NDJA 2UZ1A 4UTPA 5BQFA 3HFRA 3HCCA 4A6PA 5M2QA 2GAIA 5CYFA 1DEKA 5DLQC 4TTSA 2Q0HA 5FNZA 1PLJA 1OVGA 4BQIA 3OECA 2OCYC 3OEYA 3U7QA 3VZCA 3C39A 2PZJA 3B48A 1IEQA 3GLIB 4J16C 4ROXA 2BKUA 4MP3A 3WFJA 3B7WA 4NONA 5TPZD 3VH2A 4IDBA 3OQNA 3LWDA 4MA4A 3TOVA 1GDDA 4MW4A 2FVYA 2ZR8A 3WP0A 2Z2XA 1X7DA 2FUCA 3DAPA 2O8DA 1VDZA 3A1PA 3EOZA 1F12A 4GE3A 2HRBA 4CHTA 5C8XA 1BVHA 5LB2A 3KQMA 4G1MB 4BWVA 3DE0X 5EIXA 2YVAA 1GL3A 4OXKA 5FI0B 4JHLA 1I1OA 1T9ZA 5ARBA 1DKNA 5EP2A 5KJCA 1U2EA 4OLAA 3OMWA 3CO5A 3GL9A 4X54A 3PEFA 5G4KB 3OU2A 3G1WA 3EF0A 2EATA 4PYKA 4BPBA 3FY4A 4OBEA 3V7UA 3V2HA 3I23A 1L4HA 1DX9A 3B7PA 3TZEA 1M34A 1POXA 2XUFA 3QVLA 4P58A 2PGDA 1JIVA 1NULA 2AE2A 3KS9A 4CM7A 1M74A 3L2OB 1H6CA 4M0CA 3PVZA 3KETA 2E82A 2E4UA 3CX3A 4PLCA 4BWFB 1UEIA 2C0QA 2PRZA 3UB4A 2QI9C 3HBLA 2JCXA 2HBZA 1CZNA 1PFWA 5JCOC 4JSYA 1S2MA 1SPXA 2A0KA 2OVFA 3QVGB 5DNCA 1LCIA 4DMKA 4CMHA 3PENA 2H2WA 2KX7A 4URWR 3NBAA 4RD4A 1SBZA 2IFTA 3H9EO 4ETIA 5CB8A 1QC5A 3CLTD 1JI3A 2PS1A 2QG9A 4U4AA 2DH6A 4C43A 1ZEMA 3CNLA 3K6SA 4MRMB 1A5AB 2HJSA 4K2AA 2HGZA 4DLXA 3VPBA 4WT7A 3WK9A 3KKMA 1SCNE 5A03A 2NADA 2CJFA 1ZQ9A 3B3QA 4EMTA 4WXEA 4CYMA 4ER5A 4E12A 1EFLA 4E09A 4P6YA 5GQSA 1QOQB 1XMSA 3VR4D 3FRIA 4TZ6A 1EVYA 4XWYA 1QHXA 5DN9A 2R6HA 5EXSA 2A86A 2A9RA 1N2BA 2C61A 1MNAA 1Z16A 4QGHA 2GB4A 4QJ4A 2J9GA 1WD7A 5E8RA 5EY5B 2TYSB 4HN9A 4QE3A 3QITA 3IHWA 5CA0B 5TC4A 3RLIA 3DMDA 2EBFX 4OUDA 5KO2A 1OE0A 3ZV4A 3MC1A 3TI9A 5FUWA 1AVTA 4MI1A 4NMLA 1J9GA 1XZ8A 4OXYA 1ZUHA 1NVDA 1PJLA 1TLLA 1N8SA 2CNLA 1JW9B 2ZAIA 3BZUA 3MUNA 1JWBB 1P80A 4LRYA 4UXJA 2IYYA 2R86A 4DJFC 4XM1A 2FZEA 4P7FA 5TY0A 1KVQA 4K9PA 4MI6A 4ZCSA 4EUFA 3W8FA 1RKXA 2BHTA 2EFYA 1UBHS 3IDSA 4LKRA 3BHIA 1LBIA 1HLFA 1U80A 4PGMA 2FUKA 2CVZA 3NDPA 1ZOIA 2ECKA 1EINA 3BAZA 3JYOA 2CLEB 4MQUA 1VE3A 3L7KA 3ZDRA 4DBLE 4S05A 3M7IA 2JIBA 3UBTA 3X1YA 1S2NA 4BZQA 1KZHA 3GIRA 1MB3A 3WMEA 3AUTA 1KI9A 2C4TA 4U2DA 4UHEA 3L05A 4WK2B 3FHJA 4DFDA 5IWCA 3ROXA 2HF2A 4Q3LA 4CM6A 4II7A 1UP6A 5I7RA 4NZNA 2ZRDA 3IEXA 3PJDA 2I4MA 2IYUA 2VUIB 5F2OA 5GOZA 2AJDA 2ZBUA 3GIWA 3NCTA 5CDYA 1SCBA 3I04M 3P2YA 1XLUA 2ZXUA 1SKQA 2ABWA 1RFLA 4EPTA 5JMOA 1VKNA 1PJTA 1UC8A 4MJLA 1X7YA 4QC2A 2Z98A 4KAJA 4QOSA 2JH8A 3C5EA 1Z2AA 4R2XA 3G1UA 5C3MA 3ZHYA 1PQ4A 4BBAA 4P3IA 4I0WB 5ALLA 1KL7A 4TPKA 2RGGA 1GRQA 1P4MA 4R9UC 3K9NA 1IIRA 1PGOA 2HO4A 4QPJC 1PFKA 2X6RA 3AUSA 1X77A 4TLLB 4BMZA 4Q7KA 4RK6A 1AZSC 3F8SA 3JW8A 3UV7A 3TOXA 2GRAA 1YR8A 2R8EA 2OQ2A 2OGWA 3O93A 4MYCA 4H17A 2OZEA 1T1EA 1QHYA 3ONUA 4GPEA 1W1IA 5IM5A 3SG0A 4BUCA 2A9FA 4Q15A 2GN1A 3F46A 1IHUA 4Z8XA 2BHLA 4DCUA 1OB0A 2R1ZA 2JGRA 2R25B 1PZNA 2I65A 1ZH6A 3ZU6A 1M6VA 3ZWAA 1N8KA 2R7LA 3HXQA 4ZO8A 1VCNA 1NUPA 1VMDA 3AH8A 3GEHA 3SBEA 4EAAA 5HSGA 5K20A 3GNQA 2DFNA 2WU4A 3DZ8A 5CEFA 2XKKA 2IF0A 4DKJA 3SBXA 4TMYA 4YT2A 1CE8A 2F4VB 1OBVA 1XZHA 1PJ6A 1EX9A 3KJQA 3PRYA 3UK1A 3VZSA 3KTAA 1T6YA 5J4LA 2I4RA 4PCUA 4YUYA 4F56A 2I6XA 4N3CA 4C0LA 4DY4A 2JFGA 1VG8A 2GZDA 3CKKA 4TV8F 4BFVA 2GZSA 1FYDA 4XTRA 4EHBA 621PA 3OJEA 2VDWB 4GEGA 4OH1A 3LHIA 3OJXA 3L0ZA 3ZLJA 3M3DA 5E7IA 3F6BX 3JAKA 4KPUA 2AJCA 3C3JA 3M4XA 2ZT6A 4WL0A 1Y8ZA 4DLRA 5F23A 5A2QA 4FKBA 4M1MA 4JCOA 5E9QA 4C05A 5L7TA 2CMDA 5AJHA 4YEJA 1SC6A 1KYYA 4FE4A 4J0IA 4KTTE 2HPAA 4MV7A 5E2AA 1DAEA 5BWCA 2VJNA 4FMCB 3UWOA 5KOIA 3KBBA 4ZIRA 3I4CA 1F0NA 3KLNA 1GSAA 4X64B 3NVAA 1W87A 3SZOA 3TLGB 4B6PA 2HFJA 1SVIA 3W3AA 4YDRA 5DIZA 5GY7A 1GQSA 4D46A 1KJJA 2VTDA 3FMVA 3OZTA 2EX4A 3VDRA 1Y4DE 3D4OA 1YLOA 3EIUA 3EJWA 4P3NA 4PX5A 4CW7A 4HADA 3G13A 1Y6ZA 4AS3A 3CGWA 4MS1A 1PJAA 1TM2A 1SA0B 2BONA 3TRDA 2XA1A 4A0HA 1EWQA 1J5EB 5IZCA 2Y0PA 2PSFA 4YJ3A 1X2BA 2EC5A 5KNBA 3U39A 4M4SA 2BGKA 4RORA 3D6UA 2ZB2A 4M9UA 1VXOA 4YWJA 1VQNB 1TZJA 5EL0A 3FTFA 5GZ1A 1W2BB 5EPUA 4B47A 3WWZA 3EFEA 4EBBA 4KVFA 1VCIA 4BWYA 5KMGA 1TTPB 4UU0A 1GR1A 1V96A 3JR7A 3K8YA 2X2OA 1SCAA 3CWQA 3I1FA 1BS2A 2P9EA 4W9RA 1XTVA 2VSXA 2Y05A 3D64A 2Z09A 4MWGA 5HMMA 3A6EA 2R1TA 1EP1B 1SN7A 3BXFA 2H59A 3T3NA 3SHFA 3OQJA 2GEVA 1IM8A 4RGVA 1D0VA 2Q21A 4B33A 1IXSB 3LT4A 4MUFA 3V4RA 2G28A 2A92A 4WASA 3JXEA 4IKEA 4LYEA 1K27A 2W4QA 2VAPA 3MLBA 1KZ1A 1TZKA 3F97A 3NHMA 5FWXB 1FP2A 5IRCD 2OYNA 1K63A 1G18A 4HNRA 3B6ZA 3EEBA 5DGDA 5EXTA 1Q22A 4ZVOA 3PJRA 3JQ8A 3AKZA 1NM5A 1GFSA 2FOLA 2JFNA 4IXWA 1EFAA 4MV8A 4QLBA 3PCXA 3K5IA 2OCGA 3DGFC 3NC0C 4H4EA 4X8HA 5DXAA 3VU0A 4GYJA 3OKCA 3I1IA 2VLIA 2ANCA 3UMVA 1WTCA 4WVFA 4YFYA 3GZNB 5KVSA 2PMKA 4UE3S 1QOPB 4O4HA 2IYQA 1EE9A 2JCSA 4IIHA 3VDQA 5K0EA 2WC1A 3Q3VA 1BFDA 3DVLA 1WF6A 5D8DA 2VRBA 2CXTA 4RTSA 1G7SA 5BQPA 4CMCA 1YMQA 5IYZB 3TOZA 2XAAA 2YRWA 1EIZA 4DK1A 1BKYA 3EVDA 3N0RA 3P97A 4B3CA 4AMUA 4ZTZB 5LQNA 4WJKB 4KQGA 3DOIA 1G9SA 3FKSA 1JDTA 3SKBA 5IX8A 2I34A 4B35A 3MUEA 5KQMA 1P0MA 1IY8A 4M38A 2I1WA 4JVLA 1E98A 3IR6A 3ZGXA 3WTBA 4LF9B 3GVJA 2WHEA 1UOEA 4QTUB 5KJEA 4MW5A 2EBUA 1KRWA 2JI4A 1UDRA 1ITZA 1DC8A 1H2XA 2R1VB 2FF7A 3QJ5A 1EKXA 1IG3A 2FPWA 3JWIA 1VJRA 4KFUA 1FX0A 1D9ZA 2XGMA 2PNJA 4ASUA 1NM5C 1R15A 1G20E 1G7RA 3ICCA 4XLTA 5IKPA 3FOEC 3L8DA 4IFIA 2HHCA 2PU7A 5DK4A 3N5KA 3HJCA 4TKUB 1JFRA 3RW9A 3LY8A 5LIPA 1WWKA 1CY6A 2W8BB 4KJZA 2BBSA 1SXGA 3BWCA 3PKZA 4MZDA 4ETWA 3D59A 3M3PA 4P2BA 2AKAB 1V16B 5E0KB 4Y0AA 2D7JA 2NO4A 1ESDA 3QZUA 3R0VA 4V02A 1VI5A 3LPAA 4K1XA 3U3JA 2FCRA 1ADCA 1T4CB 1U99A 4LFAB 1O87A 5C81A 1RPAA 2C3MA 1N6OA 2GLUA 1G5TA 5A5VA 1RXVA 1I1NA 2YCLA 5T8KA 3OICA 1ZG3A 4DMLA 1VSVA 2DBRA 4LGMA 4BLTA 1RPNA 3A3KA 1E9FA 1NV8A 3KOOA 3NFRA 4Q6BA 4KFRA 2JC3A 4NHEA 1QTRA 5SZHB 1M8JA 3WV5A 3VTAA 4FHFA 2GEDA 1T2FA 4A2PA 3IERA 3PHJA 1SB8A 1XVTA 2BE7A 1NX6A 2BSXA 2Q41A 3DMFA 2WV9A 2GI4A 1J0DA 5DMXA 2P3MA 4C7MA 1Q7EA 2PX8A 2ZJ7A 3WWCA 1B15A 1XK7A 3RVRA 4N6GA 5AK6A 4WZLA 1I2CA 4CR8A 4M87A 3WKAA 3RBXA 1E1LA 3WGLA 1DJLA 4RLHA 4KDEA 5J63A 1ULHA 4W1QA 3S81A 4Y18A 2OQRA 2EHDA 3WBFA 2LTAA 5AVZA 4HYEA 4CT4B 1F4LA 4PQEA 1MJNA 3D6JA 4LMAA 4LFBB 1R4AA 1B41A 3BFJA 2WKWA 4DV5B 4C04A 3EIOA 4DQUA 3HKEB 3KU1A 3N7AA 1UD4A 1XTKA 3MGCA 3DEHA 3ZDQA 5F33A 4LF7B 2CUZA 2N75A 4A2QA 5BN5B 3I39X 4TS9A 2E2WA 4EITA 1EXDA 1X14A 4TWZA 4ZQIA 4LWOA 3I0MA 1ZBQA 3LBYA 4CM1A 2A58A 1CUYA 3KELA 2Y8EA 4C2UA 1V9SA 2AB0A 4CF3A 1MHPA 1T10A 3CKYA 1E0SA 2CEAA 3LWZA 4C7KA 2C03A 3PKJA 4OF4A 3BN3A 2WMDA 3HGMA 3EOBI 2E9SA 2PZ8A 3U7QB 5EFOA 1TVMA 4A7PA 1ZCBA 3OT1A 3IJ5A 5KWEA 3E7PA 1IUNA 1PEDA 2M6SA 4WXYB 4C08A 3HUTA 4GAEA 4ZALA 2J6BA 4Z4YA 3AJRA 4Z1MD 3PQEA 4P08A 1J9EA 3U7EB 1N2CB 1L5NA 3MRTA 1RYZA 3KQTA 3PGA1 5A9SA 1A9YA 2VWHA 1FYFA 2W2VA 3AJ9A 3PV0A 4J2TA 4DMRA 3CCBA 3CVYA 2G5GX 4Z4GA 4BRUA 2V45A 1JWAB 4EYKA 1PDWA 2PMBA 2PWPA 3OZVA 3M1AA 3AHDA 3ZDCA 3LCUA 3COVA 3QSYA 3INTA 3TMKA 2PE3A 2TRSB 3H5AA 4E5MA 2DEUA 1W36D 2CV0A 4Z3OA 3LXMA 3TLZA 1IY0A 5K8JB 4Q4JA 2D2XA 3ZCTA 4H15A 3N7TA 4TXJA 4MS3A 3REQA 3T15A 3UMRA 4CKBA 3R4CA 3TS1A 3NQ41 1DC7A 3D0KA 2VDKB 1PZFA 1ZVQA 4LCBA 2ORIA 4KXFB 4E4RA 4C1NA 2FQWA 2C2WA 2J9YB 3A6FA 3GJYA 3EY9A 2JLBA 1JDPA 1PL0A 1YR9A 3E9CA 1DB3A 1Z4JA 3MJDA 2YINC 3ZD9A 4AY3A 3DOUA 3FCUB 1K6JA 2PRYA 2HA6A 4QPPA 1A72A 1JGTA 2KVOA 4FSXA 4W9NA 2FW0A 4ON9A 2C3PA 3U7IA 3ADPA 5LPNA 4NRDA 4ZU1X 4QG7A 5DYTA 3V2UA 2ZATA 3IAXA 2XYRA 2BI8A 2RK3A 2H2AA 2CMGA 3D7NA 3VYSB 2NO0A 3UICA 4Y2JA 2I4IA 3R5HA 5JDCC 1GGVA 1LD3A 5JLAA 4MWZA 5B3JC 2OHHA 1VBNA 3OIWA 4B44A 4C4OA 2EFHB 1Z2PX 2AXQA 2IUEA 2WG2A 1GIAA 4YJ2A 3TXAA 2UKDA 1X8LA 1ZN9A 3AESB 3EC2A 2VF7A 2FOIA 1CDZA 5FCDA 5BO5A 3UQZA 3ZE1B 3VU8A 4D6YA 2OCLA 1OGJA 2BV3A 5B36A 3IAM1 1QIJA 4QNNA 4P3PA 4RE5A 2D3WA 3EXFA 1L5GB 3RKRA 1XJ5A 5THXA 3JALA 3TQFA 3SS8A 2YV2A 4GWLA 1Z2CA 2WDZA 2J33A 2WWRA 1CR1A 2HNKA 2QNBA 3C45A 3DEYX 4TLMB 5AVKA 1H0RA 2QX8A 2Q1SA 3K20A 5C51B 3S2SA 1V0JA 2XTJA 4MQEB 1P2FA 1T9GR 3P9SA 2VR1A 3LRPA 4PZEA 4UTOA 4YV1A 3FDJA 3BSSA 3UFXA 3UVEA 4Z4TA 4LCJA 3L9XA 3ZBQA 1U0JA 5DCYA 1XMVA 1XD2B 5HP4A 1M5UA 1SXJB 3ONNA 4FS8A 5GWXA 5E2IA 2V3WA 2X15A 4PGAA 4F91B 4R3UC 2JGDB 1P0IA 1NE7A 5P21A 1JEQB 4YCSA 2Q7XA 4TROA 3BY2A 3RHFA 3T61A 2FDCA 1FJGB 3U6KA 5AW1A 1PR6A 1U8ZA 2OV2A 4O8CA 3VTZA 5T3UA 3ICEA 4JL5A 5LA6A 1X70A 3C3PA 1VPLA 1NY6A 2Q1TA 3KALA 2IDJA 3Q0TA 3SR3A 2HK6A 4V0ME 2HYDA 4TM8A 5A4JA 5COAA 4Y6PA 1Z75A 5A06A 5DBIA 2FOXA 1AQLA 2AIRA 1UEJA 3FMFA 2CNDA 4NE7A 5DXJA 3UWKA 2BZGA 2CUKA 2M2IA 4R1NA 1JKFA 1IU9A 2PT7A 1SUFA 1VL8A 2ZFUA 2DYIA 4I36A 3C6MA 4J0DA 4BNJA 3G85A 3QTBA 4R1PA 1I4EB 5DV9A 4E5PA 2BGWA 1UK8A 3DAHA 2FSUA 3FIJA 2OTLB 1NBAA 4NE2A 1RAHA 3EVAA 5D84A 3ZTTA 2AUNA 5A02A 3M34A 4I1RA 5B4VA 4FD2A 4E0BA 2J3HA 1L8LA 2PBRA 3LOUA 3U62A 4EQ6B 3HKBB 3PUNA 2XNCA 5JS8A 5C34B 1CJTC 2D8MA 1B00A 1UP4A 2XRMA 1CIVA 4TS3A 2A1IA 5EXXA 5GPBA 5D3ZA 4NMWA 4ZI7B 1S0UA 1E3WA 4X00A 3CP2A 4JLSA 1U2GA 3UMBA 3O92A 4L9RA 2OBYA 1RJEA 4BV9A 3OQOA 1I5OA 4GXNA 2VI5A 2IPNA 1JSLA 2IEZA 3VO2A 1VHJA 4NS1A 4PAGA 1SC3A 4N8SA 1K2VN 1UAYA 2PDAA 3VZBA 1ZOSA 2W2KB 1EK2A 5JRZA 3I8SA 4MLCA 5I4BA 4QUBA 2C4VA 4P54A 4BCBA 5FULA 5LCXA 2YYYA 4GBJA 4IGAA 1R8SA 4YV2A 1Q92A 1FK8A 1LXCA 2LCIA 3BD9A 4QOJA 1R18A 3M6XA 2O8BB 1NP6A 1CR6A 1G8PA 1U04A 4JEMA 4XIFA 4B82A 1DCKA 1R0RE 4EJSA 3UMMA 3KXLA 3O74A 5CDFA 2Z4RA 1I80A 3CNQS 1SCJA 4E13A 5JZSA 2Q5FA 1YB7A 3UAYA 5G1PA 3HACA 1W0JA 3W9BA 4AKGA 1Y1PA 4KQ1A 4O0LA 2V58A 3KE9A 5F2NA 3HYTA 4L08A 1LTQA 4PZUA 4KXWA 5DP1A 2XCRB 3QIAA 4HXGA 2HJRA 3IE1A 5G41A 1EVKA 2ZYSA 3OFSA 1UODA 1GY8A 5PGMA 4K3VA 3UAVA 3ZDAA 1NWHA 1JPJA 2NPOA 2P40A 3F4BA 3E2IA 1LK7A 3FZYA 3JWEA 3CUTA 3OWHA 4NFSA 4BGDA 2JLVA 4JYMA 3PLNA 3TR5A 2HA0A 3DGEC 3SZ3A 5AOBA 1F6WA 3O26A 3B1ZA 4FJ0A 1S8OA 5BN3B 3NG1A 3ROMA 4L9WA 4CRWB 1E5LA 2XKBA 2X8BA 3B89A 5EUMA 3EX7C 2HF8A 5FOVA 2PMEA 3QUSA 3PUMA 5C37A 2R5NA 2QMUA 3D5EA 3OLQA 3W1WA 1X1QA 3R3HA 3SLRA 5IXYA 3FNRA 1QP8A 2VH1A 4GECA 5K4GA 5A7GA 3L0SA 3QA3E 4H9GA 1SXJA 4AYWA 4M8NE 4YACA 4Z0NA 1CQIB 3I9KA 3OZXA 1JALA 2UV8A 4HLNA 2Z2JA 3V8BA 2Q3MA 4ZVLA 4E1BA 3IALA 7AT1A 4B46A 1ECBA 1YUNA 3WOHA 2XW6A 1M2VA 4WA8A 4X60A 3LCVB 1U0HC 3Q12A 2J8ZA 3WK5A 3F7MA 5FOWA 5E4YA 3ZVLA 3HWX1 3G6EB 4U7WA 4DIUA 1YS6A 3A8IA 1VQ7B 2P0AA 4BFTA 1Y8CA 4ZGGA 1U0EA 4OY3A 4R54A 2B4YA 1XXHE 1XCMA 3AKEA 2GS9A 3HHPA 4KB5A 5DM1A 4TL6A 4R3WA 2JI8A 5T3YA 3T99A 4W99A 4DSNA 4YLGA 2XCUA 1KYXA 3IIIA 4FYJA 1KQNA 5FI3A 4NAUA 3TCXB 3BHJA 3GMDA 2UVDA 4B43A 2ZIAA 1DRWA 3F8TA 3UAOA 5GINE 1U4OA 2GN2A 2YJTD 4FIDA 3RC2A 1S7CA 4PANA 4I55B 4DOMA 2C5HA 1FLDA 4G6IA 1CVLA 1PL7A 1OV6A 4JUFA 1IRXA 1C9JA 2OWDA 2MSLA 3EZFA 4YJ2B 5G0UA 1B1AA 2VCHA 3RFTA 4GNKA 2JHFA 4DQKA 1WXEA 2F3RA 1FSPA 4DYDA 1O95D 3H3JA 3UWSA 3NTLA 3ABSB 1PTKA 4C4YA 2ZVJA 1P74A 3F47A 2WHPB 1PD1A 1FXSA 1I24A 1QIHA 1UKAA 2V6MA 4UVIA 5DXFA 4F8JA 1FVXA 1Y3IA 1EUCB 1ZHHA 3ERCA 3NT2A 3QNUA 5EA2A 2W58A 4RE6A 1M72A 5B2ZA 5EIBD 3CF4G 4R0MA 2VT3A 3UT0A 1J24A 1A9TA 2QYTA 3GUUA 3LWBA 2JBAB 4ZREA 3UXMA 4BLRA 2D5AA 4LSMA 2JK0A 3SNKA 3JARB 5AVWA 2AG0A 3C7AA 1LF5A 1P2GA 3M49A 3PGJA 4JJ4A 4WFKA 3C8DA 5AUPB 5JHHB 2D3LA 1TJ5A 2CEKA 3PDWA 4QJ5A