2B7CA

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
437
structure length
437
Chain Sequence
KSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords Elongation factor 1-alpha
publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 122
structure length 437
sequence length 437
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7cA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7cA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b7cA01
1ZM4A 4MYHA 1U8ZA 4C0HA 2ZE8A 3E20A 2RGNC 5K8TA 3ND9A 4KJZA 1YZGA 2O8DB 4XD7A 1YIJB 3UG6A 3EARA 1VKJA 2FG5A 1G7TA 2GZHA 3WYGA 4OL0A 4C30A 4EJSA 2BM1A 1G41A 2ZS8A 3KUCA 4JSYA 2RGDA 1W0JD 2ZIAA 3AF2A 3UATA 2G3YA 4S2EA 2GAOA 4L16A 3G0HA 1PJRA 1GWNA 4TLEA 4BLTA 1CEEA 3RDPA 4GMXA 4IOJA 3QFCA 4RVCA 1PUJA 1UM8A 5AJZA 2WWFA 1E0JA 2GDJA 3RWOA 1N6LA 4URUR 1NMZA 5FPYA 1BMFA 5F98A 3CF6R 3GJ8A 5L8VA 4N0EA 2QI9C 3S1AA 3SR0A 1EFRD 2BEKA 5C2JB 2XNCA 1CR2A 1KZGB 1KO1A 5LB2A 3THYA 1ZUHA 2XXAA 1E62A 1KJYA 1GJRA 2XTMA 4RZXA 3THOA 1GL6A 1N6PA 3LV8A 2BMFA 1T0HB 3PEUA 4UAJA 3QI2A 2VBCA 5LDDC 2WJVA 4KXFB 1CR1A 4XWOA 5D3MB 1R0WA 1S3GA 3A1TA 2ZRPA 3ICQB 1XTIA 1R0YA 1Q86D 3KX2A 3LA6A 4EKDA 1ANKA 1M1KD 4QHSA 621PA 4CEJB 1YJWB 3QIAA 4W5HA 3K9NA 1NNEA 3E1YE 1V5WA 3A4NA 3EG5A 4TT3A 2X8AA 4TYWA 2GQFA 3IILA 3GLFA 1OF1A 2BEJA 3B9PA 1TF7A 5KUTA 2XJ9A 4RD4A 1VIYA 1MOZA 1DAIA 4W9MC 1P72A 3KB1A 1QRAA 4JLOA 4XWAA 3RLFA 4EPTA 4TQUS 2R6HA 2YOGA 4BFWA 4KAXA 1S72B 1C4OA 1KI6B 2GJSA 1OIVA 2DFNA 4TQ9A 3GEHA 3AQ4A 5DYIA 1PZNA 5B58C 2XGJA 1CRQA 3E70C 2VO1A 1IJEA 2CL7X 5AWFC 5JS8A 2ZS7A 3OESA 3QG5A 1ESNA 2FA9A 4WXRA 1G16A 4PZYA 3IEUA 1ELOA 1KKMA 4WVFA 1YR7A 1M34E 4A4DA 4R7ZA 1JECA 1QHHA 5IRCD 1B23P 1PLLA 1LNZA 5EP2A 1GSIA 1IN7A 1KY2A 5DHFA 4HB3A 4MA4A 1NBME 2A5JA 4LV5B 3TBKA 1M74A 4DLVA 1KMQA 2YC2C 2AWNA 2BMDA 2REBA 1QVFB 5FI0B 4TSFA 1YJ9B 4QBHA 1AZSC 4FW9A 5DLQC 1R8QA 3M4YA 4US1R 1RYHA 3CR8A 3OF5A 5CK5A 4CT5A 4MUBA 4DEXA 1U90A 1SULA 4PHGA 2ZXUA 5JI2E 1E2QA 2MSEB 3C16C 2ZRCA 2W6IA 1G3QA 2H5EA 3R9WA 3CUEF 5BN5A 2GK6A 4DLWA 4LK2A 4Q9LA 3T35A 4EPYA 3U44B 3NBFA 1M90D 1BQEA 1CJKC 1FFHA 1I4LD 2RAPA 3B1ZA 3DL0A 3ADCA 4I81A 4LX0A 3E2IA 1P75A 3X1XA 3KQLA 4XOIA 4PHTA 4I4LA 2VRWA 1L4UA 5CIWA 5GVRA 2CLCX 2ZI5A 2IXEA 1E64A 3GLGB 2OUKA 3LRPA 5IHPA 2QORA 5EUQB 3AVPA 4FMBB 3GLHA 4A6PA 4CDGA 3HYTA 1N6RA 1DE0A 3KXKA 4Z1MA 3SBEA 3THXB 3DMDA 5THXA 2OXRA 2CCKA 4L8GA 4ZV4A 1AZTA 4QOSA 2WZQA 2IYTA 4A0HA 1P62B 1HV8A 2O52A 3H4MA 1KYIA 1KK3A 1KRHA 4NKRA 3T12A 3TH5A 1EWYA 1CXZA 1YZQA 1W4AA 4W5WA 3NBZC 4NE2A 2GJ9A 4K8OA 4EJSC 2CE7A 2W2XA 2ZRDA 2GJ8A 4HAXA 4KYIB 2QUZA 4UJ5A 1GKUB 3CH5A 2H7VA 2GF9A 1NJFA 3LAWA 2JJ8A 1OYYA 4GT1A 4B2LA 4NU0A 1XEXA 1W47A 4A2PA 4JVSB 3WMEA 4UNQA 1KK0A 2ZRIA 5AUOB 1IN6A 1G64A 4JBWA 4QGGA 3DDCA 4YMTA 4ESHA 5BN3A 2IWHA 1M8PA 2QE7D 1SXJA 3LDAA 3RANA 1IN5A 1DEKA 4LHWA 3PXGA 1LV7A 4XWKA 4BQSA 2AD5A 3B6EA 5KYKA 3FYHA 3F3YA 4A8JC 2ANBA 2CHQA 2PLRA 2QTFA 2IK8A 2YZ2A 4HZUA 1E2HA 2P6RA 1R2QA 1XCPA 2KBEA 4Q02A 1NKSA 1G7RA 2IC5A 1WF3A 5B30A 2OCAA 1L2TA 5FTLA 1X86B 2CNDA 1CIPA 2CNWA 2HEIA 721PA 4R71A 5DGXA 4D2IA 5EE0A 2VQSA 3R8CA 4P6VF 2CK3A 2IYXA 1M1YE 4ABYA 3HR7A 2RGEA 4QGAA 4URXR 3K9LA 2WOOA 3V4FA 4TLDA 2VA8A 4D6PA 1Z07A 2H17A 2J9RA 2GRJA 3FHTA 3CNOA 1T91A 1M7GA 1KI4A 1II9A 2XOKD 1FP7A 2BMEA 3KTAA 1T3HA 4M53A 1D6JA 4D4KA 2X2FA 3FTQA 1GNQA 3N2IA 3DHWC 1J90A 1SKYB 6Q21A 2RKOA 4F4JA 3I8SA 2QTLA 1MO5A 4Q7JB 5GV7A 1AMOA 1U8YA 3I8XA 3SHFA 5JS7A 1OFTA 5JCZA 4AKIA 5AJWA 3PG5A 2IHYA 5H59A 1E9FA 1G8GA 1A5TA 2WSMA 5JHGB 1SM4A 4O25A 1Y63A 1TQ4A 1NDHA 3G6EB 1AIPA 2A5YB 2ZVPX 1TVCA 1M7BA 4B47A 3CWZA 2JDID 2C95A 2IYLD 2V7QD 2R44A 4B2IA 4B48A 1E9DA 3ZYCA 3IPXA 2WPDD 3CRW1 3CX7A 3LW8A 3LBIA 2DWPA 3ADDA 3GLIA 4NYJQ 5IF9A 3UMRA 2WMNB 1Z3IX 3QKSA 3QOFA 1II0A 4GSYA 4JMPA 4EFMA 3UIEA 3GJ5A 1YHQB 3CCJB 4K1XA 2Q3HA 4LBVA 3QXSA 2IF2A 4DCNA 5HKKD 4GBMA 2OZEA 3NHAA 1ZNXA 1VQKB 3CC7B 3CO5A 4Q4JB 2GVZC 2BSAA 1XEXB 5J4LA 3PITA 4D0LB 2YJTD 3PR1A 2CRVA 2GZDA 2BKUA 3Q72A 5E7IA 4A6XA 5JSZB 5CB6A 3SYLA 2XSZA 2JAQA 1XXHA 1ZUNB 1X8KA 1AM4D 3SDZA 4OK6A 1WE2A 3R7WA 3QBTA 3DEFA 4AD8A 3QE2A 1E9EA 2FFQA 2O8EA 2X19A 1W0KA 3E1SA 2CXXA 3QY0A 3TK1A 1TTTA 5TARA 3DZ8A 3MAAC 4LUCA 4ZPXA 1IN8A 2O8BB 4QGFA 1EFUA 1RIFA 2HXYA 1QDEA 4NCHA 3U6KA 5FUYA 1NIPA 4B3FX 4I1SA 5KU1A 3SJCA 3ZVNA 1OH7A 1IBRA 1YI2B 1GTVA 3VFDA 3NHBA 2PZGA 3VR3A 1Q1EA 4BUJA 1OIXA 5L3SA 2VTKA 3EC1A 3QSYA 1CF4A 2VYFA 3FE2A 4G01B 1EFRA 2B21A 1N6KA 2G9NA 2BCGY 1A8PA 5FOXA 1LY1A 1EESA 1HY3A 4C4PA 4OHYA 1JB1A 1ODFA 4KO8A 5L3QB 1J9ZA 1SXJC 1Z83A 1G7SA 3H2YA 4NP6A 3L8YA 4Q7MB 2V1UA 5F9HA 1UF9A 3ZZTA 1LB1B 4FK8A 3CCRB 2FGKA 3WMFA 2DY1A 2WVJA 1JPJA 3OIWA 3SQWA 2KE5A 4MITA 1LTQA 3AH8A 1QG0A 5CYOA 3GPLA 2JIZD 1AGRA 1S3SA 2ZRKA 4OHWA 3FFBA 1Q82D 821PA 2ZETA 4M22A 3LQQA 1A2KC 4D4MA 3U3JA 2PZFA 4YC7A 2FSIA 3NEJA 2FJUA 4GZMA 3O8RA 2FZLA 2Z4RA 2AFIE 2J0SA 5FPSA 1E98A 3TLXA 2KBFA 2HCBA 1OLOA 2A5FA 1Z28A 5JWHA 5JRJA 2IUSA 2MMCA 3K53A 3PUXA 4JLKA 4PFSA 1N2CE 3A37A 4PHFA 1OXUA 4DZZA 3VNVA 2ZRLA 2XNDA 3PUZA 4IEEA 4QGHA 2P65A 4TQAA 2B8TA 4EIWA 3CNNA 2Q9CA 2G1KA 4BZQA 1VG9B 1KMHA 5EJEA 2PCJA 3I32A 3P4XA 5FL7D 2QN6A 4AWXA 1TUIA 1R8SA 4BFVA 4MYCA 4S35A 4HDOB 5FFMA 2Q0HA 4TTPA 4ZIRB 1J8YF 4ZGNB 2W6JA 4M2LA 1DDIA 1UEJA 3EAQA 4KLZA 3W6OA 4BWYA 3FPAA 4GZLA 4IDNA 5K8UA 2IS1A 2CLDX 4HAVA 2VNHA 3LO8A 3LVRE 5FUVA 3I5YA 3QKUA 3RC3A 4HAUA 1ETUA 3SYNA 1NKTA 4B43A 1VYTA 2QAGA 2O8CB 3B1YA 5C46F 3ZBUA 2IYRA 4QNRA 3AF1A 2GXSA 4D82A 3K0AB 1J7KA 1OFIA 4QJ5A 4AURA 3LW7A 2V6IA 4MDEA 2XITA 5KDOA 4Q5IA 2OCBA 4N3NA 1VG0B 2PL3A 4M1YA 4HLCA 5HTKA 1XTRA 1QHXA 4IDOA 4TTQA 5DE3A 2R6DA 3O8CA 3FJOA 5G53C 2FOLA 1M2OB 3NWJA 4B3XA 4NONA 4MRRA 2H8KA 1US8B 2QTZA 2R65A 2F1RA 1P2VA 4F7DA 4E09A 1ZM9A 4X8OA 2RCNA 4BLOA 4NTZA 1KNXA 3RRMA 5HCIA 3RVBA 3VX3A 2YHSA 3X1DA 5JJIA 5G41A 5FOTA 2ATXA 2VP5A 4KI0A 2AL7A 4M9QA 2XZPA 3U2QA 1AA9A 4EQ6A 2J46A 2NPIA 2QEQA 4MRSA 5E95A 1G4AE 5HE8A 1U94A 1U0LA 3MMPA 2CL0X 1E2IA 2A5DA 3U7HB 1OPXA 3RRNA 5JEDA 1T5LA 3AEZA 1XMJA 4G5OA 2W58A 3AKEA 2RMKA 4QKQA 5BXQC 3W2EA 2G0NA 4LHVA 1OH5A 2BIFA 4IFBA 1FNCA 2J0UA 4LY6A 2LKCA 4RCYA 1NBMA 2ZUBA 4FMCF 2OLKA 4U02A 5EXSA 2XEXA 2VPPA 2XNSA 2ZRGA 4DCTA 4ERNA 1XNJA 3A4MA 2BBTA 2ZEJA 1II8B 1ZU4A 1R10A 4IXMA 3G4SB 3L43A 4M0LA 1F6BA 4IOKA 4KFTA 5DYGA 4KLNA 4PC1A 2HT1A 5DN6D 4BGDA 2HCJB 3V00A 1OB2A 1TQDA 1VYUA 1UFQA 2B7BA 3NDBB 1O3YA 2IW3A 1LVGA 2C03A 4DLSA 4FN5A 2BOVA 1KKLA 5H68A 1D1NA 5EQTA 4EH1A 1ZM7A 2O5VA 4M1KA 5H1YA 4DLRA 1FW6A 3SHWA 1EGAA 2GF0A 3ZH9B 2QY9A 3QKRB 3RHFA 4E07A 2YWGA 2REXB 4Z1MD 4LYFA 3CZQA 5EE5B 5CLQA 3HDTA 2XOKA 1Z0FA 1S9HA 4ZO4A 5G3YA 4FD2A 2ZUDA 3WBKA 4LC1A 1Q3TA 3KJIA 2FZ4A 1IHUA 2JLXA 3TMKA 4UXJA 1E96A 3OIVA 1TNDA 3EASA 3PENA 4MYUA 3UANA 1SGWA 2A2ZA 2QL6A 1ONBA 2CJWB 4B6FA 2N46A 1E2PA 3QF4A 4OQFA 4Q1FA 1P4SA 4LV6A 5EZ6B 3TUJC 1UPTA 1A4RA 3RS5A 1MR3F 5CM9C 1FTSA 4G1BA 3HPQA 2FH5B 5K8LA 3ND8A 4CEHA 2R9VA 2I3BA 3TGPA 2IF0A 4RY2A 221PA 4C7OB 2OCYC 3JZAA 2WMOB 2JDIA 3ZC3A 2DWOA 3GJ7A 1XTKA 2IT1A 1FNDA 1SXJD 4PQFA 1KI3A 4DLUA 2VZLA 4LOAA 4ZKDA 1XZQA 4EPWA 1JNYA 1W36B 2QAGC 3NEYA 4AYTA 1GP2A 1HH4A 1UDWA 2V8OA 1OJLA 1XWIA 4Q9JA 1NG1A 2LCFA 2GILA 1S1CA 1T8TA 2ZRAA 4C0BA 1VCMA 2BBOA 4ZCLA 4K46A 3CCLB 4NHOA 5HKKA 4J0QA 1MABB 2JGNA 2CNWD 3GQBA 4JLMA 2YINC 5J4HA 4YMWA 2BWJA 3U61B 4D4JA 3H86A 1C1YA 4C0LA 2CK3D 1ZNWA 3PIRA 2QGZA 1N8RD 1KSJA 2B8WA 3B2EA 1E2FA 3QNUA 4NYIQ 3ZZ0A 3ECCA 4M9SA 3CPJB 1SVMA 3SI7A 1N6IA 2ZJ5A 2ODNA 4BFZA 4DCSA 1QVGB 1XEWX 2Z4SA 2ZTSA 1UBFA 4NH0A 5LD2B 1KHTA 4FINA 1XE1A 2QZ4A 5FTKA 2ZJ2A 4II7A 2ZANA 4CW7A 2ZSEA 1H8ED 5KO2A 2KI5A 3DKPA 1D8TA 3GMTA 3KQHA 2OT3B 1N6OA 2GBLA 3DO6A 4LCBA 4DEYA 4U7DA 4IDHA 4M1OA 1WQ1R 3Q9LA 3BS4A 4QRHA 2ZYUX 1OFHA 4WOPA 4XJXA 3SYKA 3W90A 2ZM5A 3JQQA 2F55A 1ZC3A 1G6OA 2EU8A 1W1WA 1KIMA 4XVUA 4G5RA 1ZBDA 4BECA 2KJQA 3IBYA 1W2BB 2DETA 3CX8A 3D3QA 4G5QA 3BRWD 3TNFA 2QRNA 1ESMA 2IX3A 3QXXA 2IS6A 1F48A 1UBGA 1Z5ZA 1EFTA 2AFHE 2V6JA 3QE0A 3RSLA 1L4YA 4WAUA 2Q3FA 3WNDA 3EPLA 1QFJA 3D8BA 2UZIR 1MO6A 1ZD8A 3JVUA 1S0UA 3TIFA 1IJFA 4LPKA 4CZ2A 4Q66C 1E99A 1T3LA 3U3MA 1H8HD 2VH5R 1N25A 2FEMA 3KJEA 4OI4A 1YRBA 2D74A 3NG1A 5DI3A 4TMVA 3ZZUA 4PGOA 4JLPA 5GADl 1GVNB 3BERA 2JIZA 5JHHB 3UMFA 3P20A 2ZE6A 1I4DD 2X77A 4KSCA 2IYVA 4PSAA 5E4FA 3CPEA 4CEHB 3AGPA 4ZGQB 4P4SA 3FHOA 1V43A 1W2GA 2OFOA 4F7WA 2XNJA 3P1JA 1G8HA 3ZVLA 1XJ0A 1K8AD 1GIAA 5KNBA 3R9XA 1JR3E 1W0KD 1OB5A 1BYIA 1XD2A 3I92A 1P2SA 4KVGA 1FOEB 2VLIA 1W5TA 1FX0A 1TPZA 5EXPA 1A2BA 4PC2A 2IL1A 3RRZA 3KQKA 3Q5EA 1G19A 1UAAA 3WNBA 1ZC4A 2GETA 4O2RA 2HF9A 2YNMA 3FMOB 1F2UA 2ZI9A 3D31A 3QQ5A 1EFHA 2UVQA 3ZS8A 3KKMA 4LJ4A 3KKPA 3C41J 4ACBA 3ZDQA 2BMWA 1E9RA 3W9YA 5AR1A 3EPKA 3SBDA 5FL7A 1RFLA 3QUSA 2CL6X 4PC7A 5EP4A 1P73A 5KHOC 1GL9B 2X2EA 2IA5A 1JI0A 1HA3A 4XTCS 1S9DA 3DVLA 4BZPA 4HLQB 4CEIA 1JPNA 3QG1A 1C9KA 5HZKA 2YC4C 2V55B 2QAJA 1CQXA 2JLYA 1Z06A 3GEIA 3ZBTA 1N0WA 4A8JA 4GP6A 1VQNB 5LB4A 5A0FA 4AG5A 3KUDA 3CWQA 3LBHA 5E3HA 4DDWA 3AKCA 4JYCA 1D9XA 2G0TA 3GJ4A 4XIGS 5CK4A 1E9SA 4DXAA 3NVAA 1RC8A 2YOHA 4HAYA 1ZU5A 1M6NA 2IYUA 3BIFA 4IVRA 5J4YA 3KFXA 3U60B 1P9RA 1TEVA 2VF8A 2XAUA 1GDDA 1NSFA 1KO8A 2C2HA 5J4KA 3W6NA 2FPMA 1G18A 4Z51A 2QSZA 2JATA 4IW3B 1FDRA 2AR7A 1OFUX 2FN4A 3CBQA 2QBYA 2AHOA 4QJ4A 5JBQA 5L3VA 4AG6A 3CC2B 4KFSA 4LJAA 2DHRA 2ZJZA 2FPKA 1KNQA 1G5TA 4RZ2A 3GJ3A 2P6NA 3CRRA 3PUWA 3O8DA 4OI2A 2XNDD 3EZFA 3NH9A 2CE2X 2ONJA 2AK2A 1NF3A 1E2KA 3VR1A 2WWIA 4AKEA 1GAQA 4A2WA 3PFIA 2GBLC 1KJZA 5IDVA 3W34A 4TYYA 1GOTA 2FMXA 1GZSA 3VQTA 5JMTA 1AN0A 2AWOA 1IXZA 1KTVA 3T1VA 2QNRA 2W6JD 1CP2A 1U0JA 4LHXA 1NN5A 3UWOA 4UNRA 3CKLA 3I61A 1YR6A 4DDTA 1X3SA 2UKDA 3K70C 4LJYA 2QA5A 1AQUA 1VQ4B 1G6HA 4FCVA 4FMDB 4OJKA 2A3RA 421PA 4ZDJA 3QFTA 1ZUIA 4JBYA 1X1RA 1GVHA 4OK3A 1AKYA 2QRZA 3K0FA 1YVDA 3PUVA 2OBNA 3C8UA 4G1UC 1DAMA 4YALA 2OE2A 4AI6A 5E7JA 2ZSBA 5BW8A 4EJSB 5DN6A 2VP6A 4B3CA 2F7SA 4Q47A 4Q4AA 2XZOA 4LPSA 5CM8B 1ZJ6A 4LJ5A 2FSHA 3BORA 4F92B 2R6AA 5JFGA 2EWWA 4YXWA 4DSTA 2BPOA 4F4IA 4ZCMA 4Q4HA 2PLFA 1KY3A 4IDQA 2QQ0A 5FBWB 3DM5A 4R9UC 1GAJA 3S1AB 5KSOA 2W0MA 3THYB 2C77A 3PQCA 1E2MA 2CCGA 2XXAB 5FUXA 3RNLA 1Z29A 4U9UA 3AVYA 1IY0A 1D5CA 2D62A 3FB4A 3Q85A 5EXTA 1A1VA 2MMGA 4Q7LA 4YDSA 1XFAA 4IEIA 4A8JB 4L15A 4HB0A 3L82B 1R0ZA 1DTSA 2QDXA 1YRAA 3LQRA 4HEJA 1Z6TA 2GESA 2PX3A 3K0EA 1VQ7B 5E7MA 3HP1A 4LJ7A 4P0TA 1M7HA 1UJ2A 1IOZA 3KZ1E 3KQUA 2CBZA 1Z0DA 1EWQA 1RE0A 2E9SA 2P67A 3GLFB 1YZTA 1Y3AA 1E4VA 3M0EA 4JLDA 4GPTA 4DCVA 1CR4A 2CVFA 3THWA 5DSZA 2EFDB 4EPVA 4XSHA 5CDFA 4AC9A 3A1UA 1NP6A 4JKYA 4LHYA 3N2EA 2GXQA 3VNUA 1NBMD 2ZU6A 5TY0A 1MT0A 2WKPA 3KJHA 2WIAA 4GMDA 3LXXA 1W4RA 4KVAA 4ZCIA 1FP6A 4TLAA 4A0RA 1JJVA 1FNMA 2CLSA 4DCUA 4CT4B 1HUQA 3CC4B 2QQEA 2R6GA 1YR8A 3I1FA 5FBRB 3SFVA 4QNMA 4YAWA 1QHHB 2VF7A 5EE3A 2G1JA 4BEJA 5JECA 2RGAA 3CH4B 3X1ZA 2ZE7A 3B13B 1EFCA 1NJGA 2F1JA 2WM9B 5TV2A 1VCIA 4OQLA 3T06B 4D0NA 4HI0E 2L0XA 3FKSA 3KJGA 2GCOA 3A1SA 4M1WA 5LBIA 2FFAA 1W34A 2RGBA 1Q0UA 1NVUQ 1FPMA 2FU5C 3ZQJA 1YZLA 4P32A 2YYZA 3K0FB 3RRYA 3IIJA 2YWHA 4XVQA 2CVHA 1NVXQ 5FBQB 4MDFA 1QHSA 1H8EA 2N42A 4LYJA 4MYTA 2J87A 4FWTA 1W4CA 5GJVC 4ARZA 1E0KA 5H5JA 1NLZA 1S2MA 3QXJA 1U81A 4Q4AB 1Z0AA 4MKGA 5GJWC 4R2HA 4YMVA 2GA8A 4PO9A 2QGNA 1KDRA 3AKYA 4YQFA 3IUYA 3PEWA 4IHQA 4G0NA 2GNOA 4L5BA 3U4QA 2R6CA 3T34A 3CPHA 1Z47A 1QUEA 2GAAA 1LW7A 2PX0A 3F8TA 3OZXA 3ADKA 1K5GA 4AF7A 4NCIA 4NCNA 1NJID 3GLHB 1ZD1A 4U5XA 4XTRA 3EIHA 2YWFA 1DADA 3P32A 4JZKA 4Q4LA 3MWJA 5SZIA 3SS8A 4QM7A 3DOEA 1SZPA 3FWYA 3ZGXA 1ZNZA 3BWDD 1H42A 2NPFA 1G17A 1JQJC 1VQ8B 3KL4A 3OIYA 4DQKA 3SC3A 1E9BA 1H8HA 4C3ZA 2F6RA 1E6CA 1VYVA 2EW1A 2JEOA 2NGRA 1Z6XA 4CRWB 4Y9UA 4PHHA 1JB9A 5H70A 1QH0A 2PT5A 4A92A 4BZXA 3BXZA 3OAAD 4WZBE 4HE5A 4EFNA 4N3GA 1E2DA 2HLDD 2IEYA 1AS0A 2A5GA 3CF0A 3CCUB 4NL4H 3VU9A 4M9ZA 4IOMA 3ICEA 1MH1A 4ASUD 2W00A 2GJAA 1D2MA 4GRAA 3W5JA 4NBSA 1SXJB 2J3EA 1IY2A 4OQXA 3BAFA 3H0KA 4HUTA 2OILA 1NN0A 2GEVA 2GEDA 2OLJA 4UJ3A 4ZKEA 4NCJA 1TF5A 2OTJB 4LC0A 4A1FA 2QA4B 3CRVA 1QFYA 3AVUA 1QVAA 4HZUB 4DSOA 3A1WA 1NY6A 1KI2A 1HEIA 1MV5A 4IKEA 3I4LA 2ZUCA 4V0ME 1DBSA 3V9PA 2OM2A 3EWAA 3I73A 2VHJA 3RC8A 2RGGA 3LY5A 1LFDB 3L0IB 3K70D 4PANA 4DT1A 4RFSA 1HE1C 1SVSA 2FFHA 2H16A 4Y7CA 2ZI3A 2PMDA 2JA1A 2F43A 4JL6A 4MKIA 1KGDA 3NH6A 2ANCA 2GCOB 4UXIA 2GHIA 1KJWA 3ZLJA 1JJ2B 3CCEB 2NMVA 2GJKA 4B3DA 2WSSD 2DERA 3KTAB 4PSKA 5TXGA 3PV0A 2VHQA 3CRMA 3F5FA 1E79D 2NO9A 1BX1A 1Q1QA 1NSTA 4TMXA 2ZR9A 3OHMA 3LX5A 3RWMB 3GLGE 2EYQA 3HPRA 3MWKA 1Q1BA 2D7CA 2F1HA 4Q1DA 4QBIA 1WRBA 4A0GA 1OIWA 4Q9KA 2RC5A 3RAPR 3K9HA 2HUPA 1OXSC 3TR5A 1OV4A 1E2JA 2F9LA 5K8IA 1J8MF 3DM9B 3B78A 1RKBA 3OFNA 3VO1A 1JEEA 1AK2A 1CULC 2E1RA 2JLSA 2BJVA 1VHLA 2WIBA 4JT4A 2KSQA 1VQMB 3OZWA 4PXAA 3DMNA 3IQWA 1QGZA 3SJZA 4E22A 3I3SR 4HLUA 2EFGA 4DLZA 3WBJA 3LNCA 3WXMA 2EQBA 2ZROA 2B92A 3CCVB 4KHZA 4MRVA 4B3BA 2QTVB 3GLIB 3QPUA 1VPLA 4EAQA 2A78A 5KSYA 2IUUA 4BFTA 3QKSB 4IRUB 1N0UA 1IONA 2HJGA 2ONKA 2ECKA 1JR3A 2DBYA 3FDIA 2GKSA 1Z6YA 4HE6A 5CJPA 4TMZA 3A6PC 2OV2A 3PJRA 4IOLA 5TMPA 4PSVA 1L7VC 4DKXA 1XBTA 4KV9A 2WWYA 3BFXA 2J41A 1TU4A 4MRNA 3MRSA 4B34A 3VU9B 4PTLA 1E1QD 1HQCA 2C9CA 4TYPA 4JVNA 3K1JA 3U7EB 1XXHB 3SZRA 1G4UR 1FTNA 3R7WB 2ZRBA 2J59A 1CR0A 4Y0AA 5CITA 4MGYR 1KK1A 2O8EB 5AUPB 4OKSA 3W2FA 1LS6A 1KDPA 1W46A 1ZD9A 4XSGA 4RD2A 4DB4A 3ZVRA 3L0PA 3B82A 2IYZA 4URWR 1G7CA 4YAOA 1VG8A 5P21A 3CMEB 3I62A 1GM5A 1E32A 1CJUC 4HAWA 2ZSFA 3HU3A 1SHZA 3GP8A 3LBNA 2FX3A 1FMJA 2GCNA 5CJ2A 1G8PA 2OXCA 4LGMA 2OBMA 1NI3A 1BYUA 1DG1G 4RFSB 4IDPA 3TE6A 4OYHA 5L3SB 3VHXA 1SKYE 1FQJA 3SN6A 3WMGA 4TZ6A 4AKHA 5FPTA 3TAHA 2BBWA 1N6HA 1VMAA 3BBPA 1XTSA 3DKVA 1GRQA 1WP9A 3IO5A 4MGIR 2J0QA 2QG6A 1UEIA 2YKGA 2CDNA 2PH1A 1XD8A 4HZIA 4A82A 4JLBA 2IWRA 3ZIAD 4ZI3A 3OE7D 1UKVY 2C9YA 4DIDA 1K73D 2G83A 3AF0A 1CNFA 2I4IA 4GNKA 1GL7A 2R6FA 5JJKA 4Q7KA 4DQLA 2AN9A 4RZ3A 5CB8A 1QHYA 1KI1A 1WA5A 2QT1A 4ZDWA 3AP1A 4PPQA 3SOPA 2JASA 4AF6A 3SEAA 5J47A 4X8MA 2HYIC 1BS1A 2RHMA 1OH8A 1WCV1 4FIDA 2DYKA 3AF3A 3OEHD 3P4YA 2QTHA 3QVUA 5CYPA 3BH6A 2BN4A 2F3RA 5B2ZA 1KO4A 3FMIA 3RYTC 4B6EA 1FUUA 2ERYA 1U9IA 1N5IA 2H57A 4FCTA 2VHCA 1K5DA 2WWWA 1J70A 1G291 3HYRA 4B71A 2GVDC 3BJIC 1NRJB 4DJTA 2AX4A 1R0XA 2PCLA 1N5LA 1AS2A 2WAXA 1CTQA 1NIJA 3ETLA 4NMMA 1EK0A 2B7CA 2B5OA 1KD1D 4BLRA 1CBUA 4TLBA 1KMHB 3CCQB 3FVQA 5FR1A 4GL2A 4YXWD 1Z6AA 1ZMXA 2Q9AA 1RJ9A 1H65A 3FPKA 1TL7C 4M4SA 4RSGA 4YLGA 3REGA 2WWXA 1Q44A 4OQNA 2BKEA 1KSGA 1RRPA 1JA1A 3LLUA 2JJ1D 4NYIR 1WBBA 3JQPA 3C15C 1NL3A 3H1TA 2FEOA 4B74A 2QAGB 1KDTA 2JCSA 4M9XA 4HLUC 4MGKR 3IGFA 3ZS9A 1FNNA 2P5SA 3CONA 3B8HA 2V1XA 1ZVQA 5B64A 1U99A 1UADA 1RRFA 1AKEA 3NTUA 2AKAB 2RGXA 4BEBA 4YMUA 5F9FA 4C43A 3CMAB 1OW3B 3QJYA 1XEFA 4YAFA 4HUQA 1ZCAA 4OHXA 1SQ5A 1JXMA 1XX6A 1Q57A 3GJ0A 3W3AA 2VEDA 5FTNA 2D4HA 1NN3A 3QF7A 2ZRNA 3NC0C 1QF9A 4CYMA 3TSWA 4LV8B 3KKOA 1OE0A 3LWNA 4V0OA 1B2RA 4YONB 1NVVQ 3CR7A 1VQ9B 4JLAA 1JJ7A 4A15A 1CNEA 1JBKA 2EFEB 1G3IA 5BYJA 2RHDA 2ZRHA 1FRQA 3TSZA 4CIDA 4LBYA 5DO9A 3EWSA 4EFLA 2ZR0A 2WHXA 3EIQA 4EQ6B 1MRNA 1Z0JA 2WOJA 3A36A 2YV5A 2BVNA 1W87A 2ASEA 1E63A 3TW8B 3HJNA 1XJCA 4RCZA 3OAAA 3AP2A 4HDCA 2HLDA 1RPZA 3V76A 1R7RA 1HTWA 3MCAA 4GDFA 4KCGA 4US0R 3B60A 2RB4A 3FKSD 3Q5DA 2JJ2D 5EZ5A 3BB4A 2J0UB 4IVQA 4ASUA 5JWOA 2O8DA 2A30A 5JRZA 2DFKB 3EC2A 3WYAA 3H84A 4X8HA 1P7CA 4TL8A 2WICA 1XD9A 4D80A 3I56B 1E2EA 3UMSA 1UKYA 4V02A 3CF2A 4LI0A 3TJZA 4JVMA 4PAMA 4Z8YA 5EXXA 2Q9BA 4I99A 4HAZA 5HZHA 1Q1ZA 4Q1AA 1E3MA 1KI9A 3HU1A 3NKVA 2EIXA 4MKHA 3GJ6A 3C4JA 4NPHA 3AVTA 4PZZA 5UKDA 1KC8D 4Q1BA 4Z8XA 1LF5A 5FA6A 1N0VC 1N5JA 2O0KA 3BGWA 2H18A 4UQOA 2VYQA 3TR0A 4PQRA 4AYWA 2C9OA 3HR8A 1N3BA 3EW9A 3EIEA 2Q21A 4TZ0A 1IXSB 1F20A 1Q3HA 2FPLA 4KSBA 4QG7A 4K81B 3DPUA 3K0SA 1T8UA 2ZSAA 3CX6A 2C98A 1PLJA 3L2OB 1VQPB 4DDVA 5D3MA 3WP0A 2WKRA 4JL5A 4PAQA 2HV8A 1XJQA 2WSSA 4CVNA 1E1RA 5J4VA 4P4UA 2J7KA 1U9IC 2Z83A 3ADBA 2J45A 3D7MA 2ORWA 3LX8A 1YU9A 3RS3A 4ESVA 3R9IA 3KDSE 4CEJA 1E79A 2ZI7A 2VP9A 4BFXA 2J7PA 2PJZA 4KYUA 4I1OA 3OZVA 2K5UA 4B4DA 4RD1A 1JA0A 3UKDA 1P61B 1T0JB 2R2AA 5AUQA 2P6UA 3QF4B 4LJ6A 4URZR 3QXHA 2NO0A 1MO4A 2QPTA 4OHZA 3MJRA 1KI6A 4LDJA 2IHBA 4C0SA 4B75A 4CF7A 3EXAA 1E2NA 1N5KA 2W2VA 3BB1A 3BE4A 4Y0VA 4PPFA 4BRWA 1W48A 4ITRC 1T6NA 1L8QA 3AM1A 3W2IA 1VCOA 3EZ7A 2Y8EA 1G3RA 5KSWB 3EPHA 1SKQA 3RABA 1SVWA 5BN4A 2OFWA 3LH5A 4PAOA 4D81A 2WJYA 1K8RA 3WRYC 1S96A 1Z0KA 3JZMA 2GWHA 5DHAA 4V0LA 2ZJBA 3QPVA 4MUAA 1KO5A 1XMSA 1GG2A 4WW0A 2JLWA 4NYMQ 5AJYA 2ZITA 3T15A 3BK7A 1EX7A 2W83A 4V0MA 4B35A 4X8LA 4C0QC 4RD6A 3MJHA 2NZ8A 4O0MA 4JJKA 5H8WA 1YZNA 1Z2AA 3RS2A 1UDXA 1E1QA 4OHVA 3U3OA 2XJ4A 1P60A 4A9AA 3GFTA 1MKYA 4URYR 1XPRA 3AKDA 1YJ5A 3W5VA 1VIAA 2HXSA 1OKKD 3WNCA 5FTMA 4DRZA 5KNCA 3AB3A 2H1LA 5J40A 4JBXA 3WRXC 1W49A 3U44A 5A4JA 1RVDA 1RW4A 3QFRA 5EP1A 3BB3A 4LZZA 1I7PA 5F2EA 1COWD 3G5UA 4M21A 1DAHA 2I1VB 4F91B 1BJKA 3CXCB 4A2QA 5HR5A 3ZJYA 2QROA 1YE8A 1P9WA 2YOFA 5C1BA 3GLGA 4M8NE 2CEAA 2TMKA 3K70B 3DZDA 4QJ3A 5FPKA 3OFND 5J5CA 3F0TA 1OT3A 3MFYA 3THXA 5M04A 4Q1EA 2WWGA 4IJMA 3ZD7A 4RD0A 4JS0A 4DBLC 2D2FA 3PEVA 3B1WA 4AY2A 4DVGA 2DCUA 5KDLA 3UG7A 2RH5A 1IQPA 3FOZA 2IS2A 3KKQA 3QEJA 4HDQB 2IXFA 5AUNB 2C5LA 5FTJA 1CJTC 1Q12A 2ZU0C 1E9AA 3MSXA 1K9MD 1N6NA 3C14C 3OE7A 4TWZA 1JR3D 3UXMA 4WZ6A 3ZIAA 4Q9IA 1B0UA 3M1IA 3WP1B 4EDHA 2FF7A 1CJVC 2VSXA 1EP2B 1XF9A 5DI3B 3U3KA 2V4ZA 1Q22A 2C99A 4PPNA 1MRSA 3VR4A 4H1VA 5DI9A 2BGJA 2IYSA 2J5XA 4AK9A 1P6XA 4B2PA 3SJAA 1EX6A 3W6PA 2O0HA 2VP0A 5GV8A 3AV0B 4Q00A 5B57C 1DAGA 3OEHA 4P4SB 2VP4A 2ZPTX 5KTYA 2GXAA 4UNSA 2Z0MA 4R98A 2EWVA 2OHFA 2WV9A 4F4CA 1TUEA 1FUKA 3IHWA 2QPAA 2ZYTX 4HATA 4O2LA 1MO3A 1PV4A 4E03A 2C04A 2NO1A 1GRRA 4A36A 1F2TA 3OEED 4FCWA 1XD2B 2OAQ1 4JIMA 4RKEA 1FX0B 1I2DA 2OG2A 1ZM3A 4NCKA 1OXTA 2LKDA 2ODEA 2P5TB 2ZRMA 3IEVA 1F2UB 2OESA 5KOYA 2GZAA 1DAEA 2DEUA 2ODBA 1DARA 4DUGA 2XZLA 1RYFA 4WZAE 5AK0A 1VECA 4EPXA 2QM8A 3NC1C 3A4LA 5FL3A 4PQYA 3P27A 1JALA 3GD7A 1KZ7B 1Q21A 3OZUA 4B44A 2XB4A 2DPXA 1YJNB 2GXUA 5DH9A 3TVTA 4TL7A 2P2LA 1JEDA 2W2TA 4EUNA 1QVRA 4RJLA 2CHGA 2JJ1A 3LXRA 4CEIB 4QBGB 1EXMA 1VCNA 3BOSA 1ZYUA 4HYYA 1WDTA 3W2HA 4ON9A 1SVKA 4BLSA 1G9XA 1ZIPA 5KNDA 3B1VA 2MSDB 4A0FA 1PVOA 1J2JA 1FRNA 4KFRA 1IY1A 1T9HA 2QT0A 2A9KA 3IDQA 4MQBA 3MG9A 1WB9A 2P0EA 5JJLA 1DO0A 3B7GA 4LHZA 1DAFA 3VKHA 2V9PA 4Y9RA 2QP9X 1Z0IA 1JQLB 1ZP6A 4LJ9A 1O87A 5CIQA 1NLFA 2WAYA 1D9ZA 1IAQA 4P4TA 5JCPA 4LWZA 3KKNA 4I1VA 1Q7YD 2FFBA 2FE4A 1W36D 2BDTA 4DLYA 2Z5FA 3R20A 1P5ZB 3MLEA 4Z54A 1S4QA 2QBYB 2R62A 1PUIA 3A8TA 1TEXA 2J1LA 3AVWA 3LVQE 1DELA 4B32A 2HF8A 4BLQA 4G1VA 4Q21A 1P9NA 5BQ5A 2WJHA 1KAOA 2F9MA 4P3YA 4Q1CA 4NYJR 3SE0A 3RSOA 4C2TA 4AKGA 4Q4JA 3WHLA 1TQ6A 1IXRC 3NBYC 3LO5A 1HE8B 4DDUA 2QMOA 4W7SA 5JSZA 3R8FA 2REOA 3IHLA 4QHTA 4OQMA 4Q18A 1OGJA 4GFDA 1WMSA 4IFEA 2EFCB 2OBLA 3L0SA 1GRNA 4DIEA 2Z6VA 4DWJA 1I4TD 2JJ2A 4B3GA 2OK8A 1OGIA 4F38A 2JLVA 3VKGA 2WBLC 3CLVA 5TR9A 1F2TB 3NXSA 4POAA 1HT2E 2HJVA 2O8BA 1DG3A 1XTJA 2QMEA 4KFUA 1XPUA 1EG7A 4Q03A 5F3WB 1AQYA 4MH0R 4DC9A 1YITB 1TF2A 5IT5A 3A1VA 2ZRFA 1VQ5B 2JLZA 4JJZA 3MUFA 5G3ZA 5D3QA 3KQNA 1VQLB 4D26A 1YZUA 2ATVA 2D06A 4P33A 4UNPA 3IPYA 1R4AA 3O8BA 1XDBA 4Q9HA 1X8JA 2CCJA 4PZLA 2PT7A 1QFZA 2IYYA 3FGNA 4Q4HB 1BKDR 4GOXA 2QM7A 4DB2A 4RFVA 5L3QA 2WJGA 1NN1A 2ZSDA 4JL8A 4PX9A 5TDHA 3AUYA 1W7AA 2G88A 5DISB 4FI3C 1TX4B 1ZM2A 3N5CA 4BFUA 2VSOA 2IUTA 4JKIA 3LFUA 2X3UA 5A5GA 4QFMA 3AVQA 5FBLB 3K8YA 1XEWY 2O8FA 2IYQA 2C8VA 1QG4A 5FOUA 3Q7PA 4KBFA 4D4LA 4WBSA 1CKEA 4MKFA 3TQCA 3THWB 3VKWA 4URVR 5EP3A 2ZS9A 1QGAA 2OTLB 3EPJA 2NO7A 1QHNA 1TLLA 2MSCB 3L0OA 1ZNYA 2AK3A 2IS4A 2HDNB 1OSNA 1VG1A 2FDCA 3NDPA 5DIFA 4JT2A 2BBSA 1AGPA 1P3JA 4WIAA 2FSFA 2OCPA 3U7GA 1ZAKA 3CM0A 3CCMB 1I2MA 3UPUA 4P31A 4C0KA 1ZRHA 1DPFA 3IIMA 4NDZA 2GK7A 4JLJA 4R2IA 5GVSA 1E69A 2AD1A 3OJXA 1G8FA 2IYWA 3JVVA 4PC6A 3L8ZA 4BLPA 1KI7A 1RRGA 2AKYA 3T5GA 2DR3A 3LD9A 4ZIRA 5EMNA 1F3OA 1G21E 1TMKA 3PEYA 4QBFA 5JWRA 3EZ9A 3CRZA 3BD9A 3U6BA 3EX7C 3MHPA 1FQKA 1D2NA 5FOVA 2OSBA 1E4YA 5IK2D 3CZPA 2ODWA 1AS3A 1GR1A 3QPWA 1CS4C 2PMKA 2O8CA 3BH0A 3E5HA 1NMYA 2ZQ5A 3X1YA 3OJWA 3J81k 3VR5A 2N1BA 2BC9A 2GPJA 3UWKA 1ZIOA 3K0AA 1W5SA 3AGQA 1U0HC 2FNAA 1E2GA 2G6BA 3Q8XB 4NZYA 2DB3A 3KFVA 3MWLA 1E1RD 1OKKA 1W35A 3TUIC 1KQSB 2NG1A 2VNIA 2FGJA 2J0VA 2XB2A 1A7JA 1W0JA 2BMJA 3ZD6A 3K9GA 4LBWA 4MGZR 2J7PD 1IN4A 3N70A 1EWRA 4ARZB 3WHKA 5CLLA 2NTYC 1COWA 5C4GB 3UK6A 3TKLA 3NBXX 3RS0A 2BV3A 4YAUA 4WQMA 5EUMA 4JYBA 2GEUA 1W44A 2DFTA 4L4UA 1P2UA 3TVDA 5BWMA 3VO2A 1LF0A 4G5GA 3U4QB 3QBVA 3W8RA 1US8A 1TADA 1XRJA 3Q7QA 3REFA 3U7FB 2QU8A 1XPOA 3WYFA 2JLUA 4D25A 2BM0A 1K6MA 4FXPA 1GITA 2A7QA 5JZVA 2X1VA 2WTUA 3ZQ6A 3W5IA 3T1TA 2VL7A 1XB2A 1XCMA 4WA7A 1U98A 4W5JA 4M1SA 3GLFE 1XU4A 2XTNA 4OI1A 2FSGA 3PUYA 2BF4A 5SZJA 1T5IA 3G71B 1OHHD 2KWIA 1Q81D 2UZ3A 4JLVA 4BPRA 4ILEA 2GTPA 2ZAOA 1WXQA 4Q01A 4TYQA 1G3MA 4DSUA 2O8FB 1F60A 4FWIB 3FFAA 5TB5A 5FBVB 3TSOA 3VR6A 4DLXA 4OK5A 2JLQA 1OH6A 1BX0A 2WKQA 4YMSA 3T1QA 1E94E 4UNNA 2FV8A 1GKYA 3P26A 3B1XA 2ZJOA 3AVXA 5KDDA 2XTZA 3TQFA 2QMUA 4XD7D 3W8NA 5ELXA 3T5DA 1DDGA 1II8A 1VHTA 1XMVA 3T1OA 5AJVB 3OW2B 1JXOA 4QC2A 4TMKA 2ZR7A 1X1SA 3OEEA 1NMXA 2CHVA 4DLTA 1YHNA 2OEPA 3TW4A 3EA5A 4LYHA 4QXAA 3I55B 2OO7A 3ES9A 4V0KA 4QL3A 4HB4A 5JLJA 2HMAA 1AJEA 2IXGA 5SZKB 3FMPB 1Z8FA 5LPNA 1BMFD 1D2EA 1G1MA 1Z2CA 2RGCA 4PC3A 3QKRA 2WJIA 4V03A 1KI8A 1HYQA 2OFXA 1FL9A 4HB2A 4LJ8A 3RS7A 4DT1B 4OJQA 2JLRA 2Q6TA 5FI1B 2FWRA 4G5SA 1E9CA 2BCJQ 1IB0A 2ZJ8A 2AXPA 1QHGA 1Z08A 2F43B 2OK7A 2GCPA 4TMTA 2AXNA 1R6BX 3QXCA 5HPYB 1KDOA 2VHTA 4N1AA 3AVVA 5AJXA 1UBCA 3X1WA 4OI0A 2IEZA 5HE9A 1E0AA 4LBZA 1GUAA 4WXPA 2RC6A 1QUFA 5DNYB 4F93B 1G5PA 2H92A 4I1UA 1IM2A 2ZJYA 4TT3D 2CJWA 1G8YA 4Q19A 4KU4A 3LVBA 3BC1A 2BJWA 3GJXC 1YQTA 3CIOA 1SHKA 4U00A 4KITB 1FZQA 4O3MA 2WJJA 3GLHE 4TL9A 5FR2A 4AIIA 4DHEA 4OBEA 1Z6GA 3W5UA 4BRUA 1UBEA 4TL6A 4C7OA 1YZKA 1DAKA 4XVRA 3CD6B 3M6AA 3IQXA 3I72A 1OXXK 1UKZA 3IIKA 5AN9A 5KPDA 4TLCA 3VAAA 1QG2A 3C5CA 3BH7A 3QEOA 4LYAA 2PEZA 2SHKA 4B73A 4B76A 1BH2A 1XTQA 3CPWB 1GFIA 4HLDA 1NVVR 1F5NA 4L9WA 1VTKA 5CDFE 1MABA 2OAP1 2EYUA 2BHRA 2KB0A 1YKSA 2IBMA 4IXNA 1DVRA 3SJBA 4DUGD 4ACAA 1X8LA 4RKFA 1SXJE 1KO7A 2QENA 4TSFD 1ZCBA 1VDZA 1QBKC 4YDHB 2HT6A 2XX3A 1G3UA 3IO3A 4BFYA 1SVOA 1RRCA 1G20E 2E87A 2QE7A 5KSZA 3K0CA 3U3RA 5BYKA 1W4BA 2C78A 2ZYWX 4M1TA 4GOJA 1S8FA 1GKIA 2DFLA 4DSNA 5GJCA 2W6ID 2QP3A 2NQ2C 1JAHA 2NZJA 1A82A 2VNJA 3VTKA 4PO1A 4G3XA 3X2SA 1XP8A 2LWIA 1SVLA 1T3SA 3GCGA 4LRWA 1U2RA 2PBRA 1HT1E 2QSYA 2ZE5A 2ZI4A 4YHBA 4CGZA 4JLNA 1X6VA 4AYXA 4KODA 3GFPA 3V4RA 1HQYE 8OHMA 4PR0A 1NVWQ 4BPBA 1FNBA 5C18A 5FPHA 1Q20A 3K09A 3B85A 2PIAA 5HXBA 1SVIA 1YR9A 2V54A 1KSFX 1Z22A 4L9SA 3U5ZB 4PO8A 1XMIA 2VHUA 1KK2A 5C4MA 3WY9A 2G77B 2ZYVX 2DWQA 2RGNA 5EE1A 2W0SA 3TAUA 4ZI2A 1BO6A 1JAIA 4UXHA 3KXIA 1GILA 3KB2A 1R5NA 3QVVA 1CJMA 1DOAA 3C7KA 4US2R 1CLUA 3TRFA 2O0JA 1T4GA 5TVKA 5JI3E 2QPOA 5FUWA 2F1IA 2QEXB 1GNPA 4JSTA 4EPRA 3ONWA 2PJRA 1JR6A 3AVOA 3MGCA 4TTRA 1VQ6B 2QP4A 3CW2A 4GP7A 1U8AA 3CB4A 3RS4A 4XH9B 5HCNA 3T61A 3GLIE 2ZAMA 1P2TA 1XCGB 2VSFA 2V7QA 2EFHB 4IVPA 2WPDA 3ASZA 3HU2A 3SFZA 4FMDF 4M1MA 3EZ2A 3FHCB 1ZINA 4RZUA 5ANRB 4TMWA 4B33A 2Q3MA 3DOFA 4UKDA 1R5BA 2NIPA 3QKTA 3GFOA 2ZRJA 4QHYA 2YWEA 2R8RA 1QX4A 3G82C 5G40A 3BFVA 1E0SA 2ORVA 3B9QA 2NOAA 1KAGA 2ZI6A 4TN1A 1XZPA 2CMKA 2D2EA 4HSEA 3PVSA 3D6TB 5SZHB 2ORIA 2C96A 3PCRB 1WBDA 1QGYA 3VMFA 2ZJAA 1NY5A 3A58B 3W3ZB 3VR2A 1XXHE 1DS6A 1GO2A 1GNRA 1OXVA 4GOKA 3GEEA 1EP1B 3VHLB 1NG9A 3CCSB 4BE7B 1RJ9B 1QZXA 4V0NA 5L3RA 3IBGA 4NYMR 5IK2A 5KSPA 1TU3A 3IKJA 5KPJA 2BGIA 1R5OA 4BASA 3EZ6A 5EE9A 3LLMA 3TUZC 1OYWA 2YVUA 5FH9A 1UKEA 5FOWA 3JQRA 1W36C 2Z43A 1KSHA 4RD3A 1HURA 4E5UA 1CRPA 3QENA 3AF4A 1J99A 3AUXA 4N0DA 1BOFA 2B6HA 521PA 2D7DA 1QHIA 3C5HA 3B5JA 3FKQA 3CNLA 3EA0A 3OIUA 2I1QA 1UMKA 4MRPA 2VNKA 3W2GA 4C0JA 1TQ2A 4LSGA 2VIIA 1FMLA 2ERXA 1E2LA 1TAGA 2VP2A 4HUQB 1KOFA 3VX4A 3KXLA 3AP3A 3MD0A 3HWSA 1Z63A 2ZVQX 1NLYA 4QM6A 1CU1A 2QMHA 4PPGA 4ZDIA 2EVWX 5LD2C 3K0CC 3QFSA 3W5HA 1RZ3A 2V3CC 3I5XA 1H85A 2PZEA 2ZREA 1G5RA 1S1MA 4D0GA 2D3WA 2HYDA 3Q3JB 3SU8A 4C2UA 2WWHA 2PEYA 2NO6A 4GI7A 3NIBA 121PA 1OHHA 1VQOB 4C0AC 1W2HA 1BIFA 2P3SA 4ZDKA 1ZW6A 4TYNA 1EP3B 4C9BA 1GAWA 4Q48A 5FOSA 4BFSA 1LS1A 3ZVMA 5GJBA 3MWYW 4H9GA 4KBGA 3O47A 3ASYA 4JVLA 3SNHA 2XSZD 4H1UA 1PLKA 3K09C 3BFKA 1DO2A 3SQXA 5JEEA 3CRQA 4FMCB 3FMFA 2F3TA
chains in the Genus database with same CATH superfamily
1RAGA 3UMGA 3EZGA 4WZEA 3H75A 1U8ZA 1R3UA 3O1IC 1IDN1 2RGNC 4C0HA 1YZGA 3Q3GE 4XD7A 4NECA 5IJXA 5CA0F 3HN2A 1Z3CA 3BSYA 4IMRA 3EARA 1HZZA 4PLFA 1G7TA 1EFLA 3GVIA 4D1YA 2ECFA 5AW1A 1T10A 3LHFA 1G41A 3OZTA 1KZ9A 3AF2A 1ZONA 3G0HA 1H6CA 1UK8A 1CEEA 4B7AA 1YHYA 3AFIA 4KXXA 3KU1A 4F6RB 3WKEA 3TLAA 4GMXA 4XLCA 3DV2A 1V8ZA 5LIRA 3QFCA 1NPTO 1Z5OA 4ENSA 1H0RA 2MYPA 1QSGA 1IUNA 5BORA 2C1ZA 4UEKA 5DRTA 1Q19A 5FPYA 1BMFA 4E94A 2P9YA 1W25A 1V5EA 2ILVA 1IHDA 3CF6R 4GRIA 3K6SA 1VKNA 2OD2A 1WXXA 4ZRNA 1BPLA 4WDQA 1E62A 3AHEA 3VR5H 2BFMA 2C4UA 1GL6A 1M2FA 2RH8A 2BMFA 2G9RA 2PG3A 4UAJA 1UZMA 1V35A 3I12A 3QI2A 1GYQA 4ZO7A 2INGX 1S3GA 4F6LA 3P2EA 3QVGA 4FYKA 2X8JA 1R4NB 2ZRPA 3A1TA 2C9BA 3NAMA 5D5QA 3K9CA 2M5SA 5EJ8A 5TSDA 4KC0A 3G05A 1ANKA 3A6JA 3WO0A 1LBSA 3TKYA 1QR2A 621PA 4CEJB 3I6IA 2AG1A 3E1YE 4TYWA 3WK9A 4TKMA 2YJZA 1QTIA 3FYUC 2A9PA 3B9PA 5CX4A 1U9JA 2XJ9A 1IZ7A 1Q6YA 4ZOQI 1P80A 4LF4B 3JZIA 5FO1A 4W1SA 5JC1A 2FCAA 2WNHA 3HXTA 2BGNA 4EPTA 4XWAA 3KB8A 5C52B 4PYLA 1DKMA 2GN8A 2R6HA 4NK4A 5EHNA 4BUZA 4KAXA 3EGCA 4Z2AA 1K75A 1CY7A 2VUUA 2YHAA 5JPIA 3M3DA 4GHWA 1L8AA 1H5UA 2XGJA 2YRWA 3AQ4A 4AO6A 1SQFA 4WZBB 1EH5A 1NW7A 1OXKB 1RYNA 2VO1A 3E70C 4DXHA 5JS8A 1VHWA 3HFJA 4IUDS 1L5ZA 5CM2Z 1T8YA 1ESNA 1W5FA 4CMJA 3UXEA 1JR4A 1Q74A 1ZKMA 2H2WA 2AS0A 2G09A 4WVFA 5DBIA 1MPTA 2C31A 2Q1WA 3ABSB 1QHHA 3JD2A 4H7JA 1O9GA 2I4OA 3OICA 3JQGA 1LNZA 1ATZA 3AUAA 3IKLA 4HXGA 1P0MA 1WMEA 5DHFA 4KXVA 3VVLA 1NBME 3TBKA 1U0RA 3TI9A 4CM4B 4HN2A 4BNVA 1M1NB 2TMYA 4M88A 4TSFA 2OHIA 1QCCA 2F3QA 2O2IA 5ARDA 3RW9A 4I7EA 1NVBA 2VFAA 4E4YA 4TX1A 2QVLA 5KINB 4XSVA 4PYKA 1PBNA 1WHSA 3HP7A 1U90A 3W4KA 1RYBA 1SIBE 4YP7A 1OGYA 2D1QA 2M1ZA 3VRHA 5DB4A 4Z3OA 1KS2A 4MQEB 5EWJA 4Q3OA 4B4OA 2R68A 3SD7A 4M87A 5K3FB 3GDHA 1HDEA 2EX0A 1Y8QB 4DLWA 2LTAA 3T35A 1DMRA 3AERA 1B0ZA 2I7XA 1BQEA 2RAPA 3Q1KA 3CUYA 5AM1A 3JAMA 1TA9A 5HGXA 1CNMA 1XLTC 2HZBA 4KKSA 4U2BA 4ZICA 3X1XA 1UEXC 4ZQFA 5CDUA 1PR9A 5HIAA 4V2UA 3GVCA 4MMZB 5J2TA 4XIYA 4UU0A 2XWQA 2ZI5A 4H6XA 1ZHOA 4OOEA 3K8QA 3GLGB 2ENUA 1HYGA 2NSLA 2QORA 5EUQB 1FU8A 4ZJZA 1EHYA 2IVFA 4JB3A 4ZC8A 2VSYA 1DE0A 3THXB 3CS3A 5THXA 3MIZA 3E9RA 4NIMA 3HNPA 2V0CA 4LRYA 1F8UA 2IYTA 1SUPA 4WL0A 3AUFA 3IKMB 2IIPA 1BFUA 2OBBA 1P62B 4NKRA 3FWZA 4X63A 3PLRA 4TROA 5AXCA 4X8IA 1CXZA 1B0PA 1VPDA 4JYZA 2NAPA 5EQFA 1TZ2A 1ADBA 3DH0A 2HGZA 2A3NA 2CE7A 5FUQA 5LXTA 1OA0A 1Z4NA 4ZZIA 1GKUB 4MVXA 2EDCA 4B2LA 5IC4A 1Y7IA 2VYND 1P5RA 5E6RA 3AY3A 4RPDA 1RPTA 1YCDA 3QK7A 4UW9A 3UVEA 3WMEA 1EIWA 2GPTA 4KKVA 1XZHA 2FW8A 1G64A 1M2KA 2A86A 4AY6A 1K2VN 2C8LA 1HDYA 2IWHA 4EY7A 1NSYA 5BVGB 3P0RA 3AESB 5EZYA 2IEBA 3OQIA 3NTXA 3WL4A 4YRJA 4HDRB 1G20A 4BX2A 2NQTA 4Y2UA 2J08A 4A8JC 2PLRA 2QTFA 2N0SA 2XA9A 4MR8B 3BAZA 3IAM1 3A2NA 2B8JA 2IE8A 3UMVA 4DJFC 1XCPA 5MGBA 1NVDA 1WO8A 1G5HA 1G7RA 5F4MA 2EQAA 2XIQA 5K4AA 2VJAA 2A7XA 1RWXA 1XRLA 3HDHA 4JK3A 3JQGB 4L75A 4PF1A 1IYZA 1X86B 1CIPA 2H4YA 4Q4DA 4MXDA 4Z7OB 2VXOA 4ZZ0A 1EWTA 5CXXA 4R71A 1X1BA 1YL5A 5DGXA 4F9EA 3BIJA 1T29A 1CUGA 4X41A 5FBHA 1M1YE 3TPFA 5HOQA 1RYYA 4NY1A 1VJGA 4URXR 5IEJA 5IULC 1YH3A 1EBUA 1T6ZA 1Z07A 2H17A 2GRJA 5DOZA 5EHQA 4BNWA 5C5EA 3FHTA 2RAUA 1P4JA 2TECE 1II9A 1MH9A 1N8KA 1ST3A 2XOKD 5AK5A 1XPRA 1E3JA 2X2FA 4G0QA 4B40A 1SKYB 2A67A 2RKOA 1SIOA 4KMMA 5K0CA 4Y6OA 4IIJF 2A1IA 4LQLA 4Q7JB 5GV7A 1A9YA 1U8YA 4PN7A 2HPHA 1CYEA 2QVCA 4JB2A 5C5IA 3PG5A 2YZGA 1ZVMA 1GTZA 5H59A 3P71T 3ZNOA 4RL4A 5JHGB 1J9EA 1RMQA 2WAAA 1K8YB 2GCGA 4RHYA 3ZQKA 3TDKA 1Y63A 5JZMA 5SYNA 5A1TA 1AIPA 5A88A 1OBVA 4EEKA 4LJKA 2ZVPX 5KVVA 3SLDA 4TXLA 3W9SA 4BS9A 5J2TB 4WHMA 4B47A 1R6XA 4E51A 2F62A 1VC2A 1OWMA 3BRQA 3SXUB 2J4FA 4M3NA 5MHTA 2X13A 5SY4A 3IAM6 1FCJA 1O6GA 3HZOA 5GOZA 4WT7A 2JIDA 1PEDA 4B2IA 4B48A 2O2ZA 3ZYCA 2WPDD 3LBIA 5LZ2A 3ADDA 2NT4A 5LP6C 3EGOA 3FX2A 4IDEA 4RVNA 4S24A 4L5AA 3UMRA 2EFJA 5CG2A 1KORA 3QOFA 1II0A 1TIPA 2C7VA 3ENZA 5DLPA 1PEAA 5DM60 2CLMB 3I2FA 9ABPA 4GQAA 4K9KA 4DCNA 4YIHA 2HXGA 3CUWA 2HMVA 1DIHA 4GW3A 4CM7A 3I09A 3IP9A 4H08A 4I4IA 4UAGA 2ZIFA 2LIPA 2ST1A 4EKIA 4NFSA 2RHTA 2XMZA 3JYPA 4BO8A 2BSAA 3AIMA 4L0CA 5J4LA 3PITA 4Z4SA 1M8GA 2PD3A 1I2AA 1EGQA 1RBQA 2H7YA 5K20A 3NHWA 1MPXA 1EJ0A 3DMRA 4L28A 3S1SA 4II2A 5CB6A 1W88B 2ZTUA 3GJQA 3SYLA 5ICCA 2XSZA 1Y1QA 3MCTA 4S05A 3SDZA 3WDSA 3SXPA 2CNBA 4RWZA 3QE2A 1OXBB 4YPOA 1RI1A 2X19A 1W0KA 1L7PA 4EHBA 1FSPA 3IAS1 3BQ9A 5CJJA 4YRNA 1RI3A 3VAZA 3TK1A 4FQ5A 2GD2A 4HQLA 3DZ8A 4ZPXA 3EFOB 3OU7A 1BG6A 2BFEA 3O3NB 2DG2A 2DKOA 4F4DA 4N5LA 4TUYA 1HDRA 1AXEA 1EFUA 2X6XA 4LGCA 4FUTA 2QRLA 4NCHA 5LMCA 2D1FA 1OH7A 2NVOA 2TYSB 4EKYA 2Y93A 1YDMA 1ISMA 1A4UA 1ODTC 1I6WA 3EVTA 4QTUB 1POWA 4IICA 3VR3A 1NNI1 2Q50A 1PSZA 3JSXA 4RQUA 2CYBA 2WYRA 1NLUA 4JU8A 3ZD8A 3L92A 4OQZA 3FVWA 4QU9A 3N9IA 3E7PA 5BVHB 4OKNA 2Q6OA 4BXOA 3ISXA 1N6KA 2B69A 4Y8VA 3AJEA 1D0VA 3AEQA 3HJHA 5FOXA 4B2YA 1HY3A 1MJNA 3VI4B 3CP8A 4KO8A 5TRTA 4M86A 3F49S 4DFDA 1SXJC 1Z83A 2VWHA 5J3OA 1N2HA 3DVAA 4Q7MB 2V1UA 4IYRA 1EJ2A 3B38A 3WMFA 4PCUA 3H04A 1TZMA 4B3IA 3FNEA 1TCCA 3SQWA 4AXXA 4CF6A 1LTQA 1DCKA 1N7IA 2DU8A 1OXMA 1LSSA 2GK4A 4BGEA 3INYA 4DA6A 3MGKA 4AL4A 5CCXA 1ISHA 1JDVA 5H7XA 1XZEA 1NT2A 5PGMA 4ZD6A 2WHYA 3PQ3A 2IY8A 3IAS6 1HOTA 4RGYA 3EPRA 3LQQA 4J1SA 1T5SA 1A2KC 4M99A 3GVJA 3NEJA 2X4IA 4GZMA 2YFHA 4H35A 2P78A 2AFIE 2R00A 1EFVB 1H5QA 5FPSA 5KNBD 4Z4CA 4K6GA 5JE8A 1PNRA 2HCBA 3D5TA 2A5FA 4WOJA 1RAEA 3BDVA 1UP7A 3CEJA 2IUSA 3K53A 1J07A 1KY5A 1EB9A 2ZB7A 4JBGA 2ARKA 4JLKA 1FDUA 4AB1A 2Q3EA 3T95A 2GYUA 5AMXA 4DZZA 3NU1A 3RK0A 3HJBA 5IDQA 5CDYA 3E22B 3GN2A 1X9GA 4IEEA 1PGJA 5I7OA 4TQAA 4QOHA 4AY4A 4XKWA 4EHIA 1RQGA 3ESZA 4OHFA 1WXHA 4NQZA 4R9RA 4JBLA 1SC1A 2Q9CA 2IPAB 1LLUA 1YD7A 5TMDA 3UB2A 3GRYA 5EJEA 4JFRA 1N3YA 2ZZGA 1EVLA 4AWXA 2ZLBA 2JGDB 5FFMA 3A28A 4KKTA 1UK9A 5JDCC 1QM5A 2CNOA 4FHEA 4QEDA 1CCWA 1LRLA 3UV6A 4MGEA 2OB1A 3W6OA 3SS9X 4MQUA 1A77A 2CLDX 2EV9A 5IBPA 4CWAA 4FFOA 3LVRE 5FUVA 3HSKA 2AE1A 4HAUA 1NKTA 4B43A 4KQGA 3UJAA 1RWPA 3HYNA 1VE9A 3LJKA 1N2GA 3T9CA 5IZCA 2X4DA 4C4RA 1M5UA 5IWCA 3ROQA 2GXSA 3W5AA 1WUYA 4E15A 1F9EA 2QIOA 3WL6A 3T1YB 5H3CA 2HN9A 3ABIA 1YASA 3Q7TA 3CX4A 3CTPA 3OOJA 5KDOA 4XDGA 4B6PA 2OCBA 1VG0B 2PL3A 4UCFA 3ZWXA 1V8BA 1J21A 2Y1XA 3ODGA 1K2WA 1GQOA 5T4EA 5TGDA 3HRHA 1H23A 1XDUA 1VI5A 2CV1A 2PUVA 3D6FA 2HHAA 2H3HA 3FJOA 3WKDA 4WTOA 1IL0A 2PTGA 2QF7A 1M2OB 3NWJA 4B3XA 3RUHA 5C3MA 1KWKA 3CO0S 2H11A 2YH2A 4MP6A 4DARA 3DZCA 1T9CA 5LLSA 2R65A 3T0FA 2W2LD 2WYIA 2F48A 3AEQB 2W8ZA 4CJXA 1GADO 3I3OA 3HVHA 2RCNA 2I78A 3HBNA 3DCNA 3R5TA 1V4NA 2FSVA 5ERYA 3RRMA 4BOYA 5LZ9A 1YIOA 4G41A 3E9YA 5JASA 1WSWA 4C01A 4Z4YA 2DUJA 1C9DB 5G41A 4Y2GA 3NZEA 3GR6A 1X1CA 4KI0A 3BK1A 3PE6A 2AL7A 4QUJA 3BULA 2XZPA 1AA9A 4DG9A 1M72A 1ZK0A 2VOEA 2EOAA 5L3ZA 2YJ3A 1U0GA 3CLUD 4KW7A 5FWAA 1U0LA 2P4HX 2NU6A 3VXKA 5ADHA 5BPFA 3BMQB 4BB0A 4O08A 2A5DA 3O1LA 1KIAA 3VPGA 3KL9A 2W58A 2X2OA 3AKEA 3P0IA 2V6MA 4G5OA 4N47A 2O4CA 1ORRA 1KXZA 4J0CA 3W2EA 4LHVA 4BRSA 2PLWA 3F2VA 3ICOA 4IFBA 1RKQA 1RWQA 1FNCA 5TX7A 4ZXFA 4E5DA 4RCYA 4FMCF 2ZUBA 5L7TA 3NONA 3LCVB 3B7WA 5EXSA 3OD1A 2VPPA 1U4SA 3HG7A 1VL8A 2XKJE 4DCTA 5AK3A 4EVRA 2BBTA 2ZEJA 1JVBA 1ZU4A 3IUSA 2QB5A 4IOKA 1UD8A 3N58A 2IU4A 4KFTA 4PRYA 2H54A 3FSEA 3U13A 4PC1A 2ZZFA 3BY1A 2Y1CA 3FVVA 3KLMX 4PIPA 2J9FB 2K7FA 2CF6A 2G17A 2VP3A 1BGWA 3WJ7A 2ECOA 2Q2VA 3OPYB 3L6UA 4R84A 3TPZA 3VGPA 1UFQA 1XZMA 2B7BA 2MU1A 3TTWA 2NUAB 1Z4QA 1LVGA 2C03A 2GPBA 4EG4A 4KR6A 5ARBA 1KKLA 2WU3A 4MV7A 1YUNA 2SBTA 3TX2A 4L27A 1D1NA 2OZKA 3E9QA 1OX5A 5IAAA 4K0KB 2O5VA 2P90A 1VE1A 4KI7A 2UXCB 4UUAA 4B6OA 1FW6A 2GF0A 3ZH9B 1AGXA 1TCAA 2C97A 1RSZA 2HJRA 3GGSA 1OPRA 4E07A 3ZKWA 1RLJA 4X6YA 5CLQA 1N0HA 5EE5B 4N48A 3P2IA 3QU5A 5CBPB 5G3YA 2FPXA 3BZWA 3ILYA 1IVNA 2R6ZA 3TZ6A 2JLXA 1BLIA 1IHUA 3GMIA 4C89A 4UXJA 1TO6A 1AT1A 4BNMA 1H2FA 1F1JA 2JJQA 3BF8A 1CD5A 1T4CA 5NLLA 3UANA 3ZI0A 1FRZA 3GLKA 1JAZA 1TB4A 2UZ1A 1A8UA 3CZ4A 2VWPA 2BGLA 4R01A 1C80A 1K3UB 2C8JA 3R6GA 4Q1FA 3GEGA 3O9MA 1A4RA 1LSUA 3DV9A 4JEUA 3WWZA 3NMUF 3HPQA 2X0JA 3DEZA 1UBTS 3NGXA 4J3JA 4BQFA 2PD4A 3V4PB 3TGPA 4W99A 1PL6A 3SHOA 1LGYA 2YHUA 4F9FA 3GJ7A 3QVMA 3A9RA 1LLQA 1O96A 3UT6A 4GMFA 5F1YA 4ER7A 3HDGA 4HF7A 3QPAA 2QAGC 4NNOA 3U3DA 1QVWA 4IIFA 1QGUA 1GP2A 2V8OA 3A0RB 2XUDA 1V25A 4E2YA 2WU0A 1CZHA 2YX1A 3EDCA 1S1CA 1T8TA 4X94A 1Y3IA 4ZAXA 2Y9PB 1K9VF 4C0BA 1GUDA 2BBOA 3ML1A 3RWBA 3KSZO 4YT8A 2CSUA 5E4YA 2ASVA 5LUAA 1MABB 4E1BA 2JGNA 2CNWD 3GQBA 5AJTA 2CXRA 2C0QA 2YINC 2BWJA 3ETCA 4FIZA 4PZCA 5HVNA 3RIEA 1RYDA 3H86A 3TQHA 2QD5A 4IIDA 4YI3A 1ZD2P 1LQUA 3BDIA 2Y76A 2I55A 1QH8B 1KSJA 2QGZA 4L8FA 1E2FA 2I2BA 4ENVA 1TGYA 4RVOA 4L22A 2PZJA 3SI7A 1N6IA 3GRRA 4JVOA 3KT0A 4EK9A 4EABA 2B5WA 1XEWX 1EM6A 3NI2A 2DLDA 4N5HX 2X5OA 1XE1A 4RHCA 4D43A 4KN5A 3KETA 2YYYA 4II7A 1ND6A 3CQ9A 3LL4A 4IQ4A 1MLDA 4QFBA 4YV0A 3KQHA 2DAPA 4G0UA 4KQMA 4PGGA 2GBLA 5T6MA 4FYIA 2IOYA 4U7DA 4DEYA 4M1OA 4C4AA 1WQ1R 4PIVA 4BZWA 2D7DA 1MGPA 1RCFA 1X2BA 4QRHA 2X0FA 1C2TA 2VSNA 3WK6A 1NOIA 2PAFA 1AXGA 3T56B 3HHPA 4WOPA 4FX2A 3SYKA 3W90A 3X43A 4RHTA 2F55A 1ZC3A 4AZWA 4XFKA 4EZIA 1UANA 1G6OA 1GZ3A 1JT2A 1WCIA 1JIIA 2G9UA 3DTVB 3T5MA 3V2UA 1ZBDA 2H7CA 3PTLA 2WV7A 3MWFA 3D3QA 3CX8A 1ONOA 6CHYA 2PYDA 2QRNA 2IX3A 2P4SA 5TT0A 1K97A 3PNLA 4YR7A 1F48A 1Z6PA 3G8CA 3LA8A 1Z5ZA 1SOMA 2HA2A 3FBTA 5IAGA 3WISA 3AXSA 1U9ZA 3M5PA 4MQLA 4FJ1A 1L7NA 3WNDA 4WAUA 2I29A 5A1JA 5ERGB 4D42A 5JVDF 3IEMA 1DCTA 1XOIA 4NE9A 1JKIA 3JVUA 1YZHA 4YECA 2Z1DA 3TIFA 2FEAA 2WF6A 2HI0A 4C87A 1KOLA 3O38A 5IT4A 1G60A 4KL8S 1DKNA 2G5GX 1T4CB 4TMVA 3H5NA 3KVYA 5DI3A 4EUEA 5C5DA 3DEYX 3JRWA 1PBTA 5JHHB 4I9NA 2Y92A 3P20A 1V1RA 2XTAA 3KFLA 4J8PA 3EIOA 5HDBB 3S68A 1MV8A 2GLUA 2IYVA 3IAAA 2XECA 4JP1A 4JI3B 2DH6A 3HV2A 2HPAA 3CPEA 2PSJA 1EUCA 3N0VA 4IJKA 1A5AB 4R3WA 4WFQA 5AVWA 1YBHA 1V43A 3CB2A 1ZPDA 4QO7A 1GL3A 3U09A 3R77A 4YB8A 4HS4A 1XJ0A 2P3LA 4TV8F 1NXTA 1QANA 4CIAA 1GIAA 3WQZA 1FEZA 4P34A 3D5EA 5I7HA 1A9PA 1SH7A 3ZWNA 1FFXA 3DHEA 3O2JA 2VLIA 3QUQA 5AKHA 1Q0ZA 1GDHA 1TM2A 3S2IA 3KRTA 4GC9A 3KQKA 3Q5EA 2Y4OA 1UAAA 1ZC4A 1T8WA 3GP3A 1C7QA 1ZN9A 4DXDA 1F2UA 2ZI9A 3R3YA 2AJLI 2OWEA 3DEKA 4XRRA 3FYUB 1E5TA 4KFCA 2VWQA 4LJ4A 5BYBA 3VPBA 3W6UA 4L5CA 4E5KA 3CEHA 1WWKA 3C1TA 3HB1A 3I34X 3LC7O 1OILA 1EK5A 5TPZA 5A2GA 5HIKA 1JJFA 3V1LA 5EP4A 4PC7A 3F2IA 3GFBA 4MVJA 4EB3A 1YFLA 3BA6A 3VU3A 2ZAYA 4XTCS 1HA3A 4B9AA 4HLQB 3ROMA 3G2IA 4EA6A 4CEIA 1QIEA 3B5EA 4FGZA 1C9KA 1MNQA 1C9NA 4HH3C 3ITDA 1JIXA 4XDZA 5LJLA 1HK7A 1Z06A 2ERCA 3TIIA 3B3QA 4Z4EA 3DT9A 3MGBA 4A8JA 5JAOA 2Y1EA 1ENPA 1JHZA 1VQNB 2NX2A 5A0FA 4AG5A 4DV0B 1L8LA 2WE8A 2I6XA 3P9NA 1I4WA 1DLJA 3V1NA 3QV1A 4AKSA 3HXOA 1NPDA 1F0NA 3RQSA 3AKCA 4X54A 4DKJA 1TFRA 2G0TA 1ICEA 1A9XB 3JQDA 4NS4A 4XIGS 5CK4A 3V8PA 3ZDFA 4BLVA 3F8SA 4DXAA 5LIPA 2YOHA 3LQFA 2SKDA 1R64A 2BRUA 2WAOA 4IVRA 1DL5A 1SO8A 3U60B 1Q0HA 3CXRA 5EGSA 3NVMB 1LBHA 4O4IA 2B36A 4FILA 4Q0MA 2K2QB 4ENTA 2M32A 1TT7A 1ZOOA 3GRKA 3PXDA 3V8MA 3WL5A 2FPMA 1RXUA 4XQ0A 4KMSA 2AR7A 2VDLB 4YRTA 4A1OA 2FN4A 3NDRA 3CBQA 4WFJA 1ULTA 1QYIA 1J25A 1X1QA 4ARUA 4HVCA 1W4LA 2ZUSA 4QJ4A 2VXBA 1YQWA 3CRNA 3CC2B 3DV0B 4LJAA 1BE6A 2BFAA 3STTA 4TTTS 2ZYDA 1D8AA 5G0VA 4R6XA 4AY5A 3PUWA 2LV8A 3EZFA 3NH9A 5IPFA 1GTMA 2N47A 4FCCA 4D3DA 2O8VA 2W90A 3F4BA 1YB1A 1Z16A 3JASA 3Q5GA 3VR1A 1MQSA 1NI4B 4AKEA 3KD2A 4XR6A 1N2CA 2XCUA 1PEKE 1N8NA 3PQ6A 1KJZA 1IMJA 1PGPA 3A6FA 3W34A 3KR2A 3F6SA 1GZSA 1KP2A 5EJIA 4DCPA 4CCSA 3TDMA 4CUKA 1AN0A 1V1RB 2TRSB 3VZBA 1IXZA 4QE3A 1KTVA 1PDWA 1H2XA 4BGUA 1T8SA 2C5EA 1YTUA 3BGVA 4N0QA 2IYFA 3SIRA 2O54A 1NN5A 1EUCB 3CKLA 3K70C 1UIMA 2UKDA 1MMFB 1GGKA 1PQWA 4W5NA 421PA 2ZZQA 2A3RA 2HBQA 4QTXA 3F4KA 1WB4A 1ZUIA 1UWLA 2ACKA 1Z0SA 3G2PA 1X1RA 4L0QA 2I87A 2VT3A 1FFXB 1AKYA 3OTWA 4JUAA 2EW2A 4OK3A 3R7LA 1V7QA 5B7PA 1KOGA 1EVKA 3C8UA 5H82A 5TPWB 5EA2A 3KQTA 2YRXA 1UZNA 3GEMA 4HDKA 3Q8LA 1OWOA 3AFOA 4JJ6A 1G8SA 1U28C 4Q47A 2G9QA 4Q4AA 3MT7A 4KN6A 4LPSA 4Q34A 5CM8B 1PVDA 2J4CA 2O19A 1U0EA 1X14A 4P3OA 3BORA 4F92B 2Y6UA 4NEQA 5L51A 4YXWA 1NASA 3I53A 4RFLA 4QQ8A 4DTCA 2BPOA 4MS3A 2NLOA 1Y0RA 4KRYA 3VDNB 4UDOA 4F3RA 4ENQA 2J3HA 3K71B 1H2BA 4RK0A 3SC4A 4I1RA 5BPHA 5GOTA 4R9UC 1GAJA 4CFYA 4DQ0A 1PS9A 2C07A 1NXVA 2C77A 2AN4A 3M4ZA 2CCGA 2P2ZA 1J00A 1THZA 1WMFA 4U9UA 1IY0A 2D62A 5BV0A 3IHKA 4J4TA 1V6AA 3OZBA 2MMGA 3T7IA 4YDSA 1XFAA 4RVSA 4V0QA 4A8JB 3FAZA 5IFLA 1MQ8B 5CYFA 3VPFA 1HRKA 3IXQA 4E4RA 5D6NA 4CKXA 5FADA 2QDXA 1YRAA 4HEJA 2L42A 3CYFA 1NR5A 4AN4A 1YF3A 3K0EA 1VQ7B 5E7MA 3BJMA 3HP1A 4IHJB 1L6IA 1JHXA 4MSUA 5KKCA 1RWNA 2YNMC 1Z0DA 2ILTA 2CXHA 4QXMA 2XUOA 5U4QA 4Y1FA 1N2BA 1ESDA 1XDZA 2OGTA 1VJDA 2R4UA 3L05A 3I9MA 3M9LA 4O4IB 2PUHA 3AOEA 3CNEA 3WWCA 2XRFA 4R51A 3F1LA 2FETA 1NP6A 1R4MA 1G6KA 4GMGA 3MINB 4ZYLA 1VMIA 3G8BA 3VNUA 2FG7C 4N3BA 2PD6A 4O4HF 2OHOA 2DHCA 2WZCA 1NQWA 3FPJA 2O0MA 4N65A 4X6UA 2NQ8A 2QN8A 2WIAA 4FHGA 4QLAA 3D3EA 4HS9A 3G02A 1MTZA 4KVAA 3SVZA 3TAXA 3N0WA 5G0WA 2FVGA 2EG5A 2ZT8A 4RDKA 1L5GB 4UEOA 4EATA 1VHDA 4CT4B 3CC4B 1JG6A 1IEQA 2R6GA 4KXNA 2FPGB 4ONEA 4PNZA 5B12A 5BV7A 1YVPA 3SFVA 4QNMA 5ALSA 3T9EA 1M2VB 2VF7A 1XKLA 4J4HA 4P5PA 4DBLE 3G2HA 4BO2A 1VBKA 2FR1A 1K63A 5JCOA 4EYKA 3X1ZA 1RRVA 1PE0A 1ABBA 1EFCA 4Y1EA 3QQPA 2PKWA 2CUNA 4NF2A 4MWSA 1XFDA 5B7NA 2ZT5A 3PDWA 3QYJA 3GD5A 5TGZA 1Z75A 2L82A 3H3JA 4M9CA 4H77A 5JY1A 5LP6B 4PG6A 1NVUQ 2A14A 3ZQJA 4MAAA 2DLNA 4OJNA 2FXVA 2P8SA 1DP4A 3T51B 4JXKA 4EMBA 2DT5A 3FUXA 4GOMD 4TSKA 1H8EA 2N42A 3PGLA 4LYJA 5G1OA 1PAUA 4LN1A 4NFYA 5HK9A 4DN6A 3HO1A 4OFXA 4OGLA 3MQFA 3OTOB 2AOUA 5GJVC 5BN5B 1ABFA 1FFCA 1RHRA 1UMCA 5H5JA 4Q4AB 4R68A 3DE2X 5AXBA 1KBQA 1Z0AA 5LBUA 4Z7JA 2ZYHA 4YMVA 2YR0A 3Q2KA 4YQFA 2BEWB 2HDWA 3L7OA 4FZJA 1T6BY 4L5BA 4J6EA 4RTQA 2ZAIA 1L4BA 2NXEA 3W3AD 2W9XA 2ZIGA 3G49A 5DGHA 4ZANA 4D3ZA 4G8CA 1ZGHA 4B4KA 4CL8A 4QQKA 3BRWA 1O95D 3BHJA 5BOVA 4NCIA 4NCNA 1NJID 1A04A 2GN1A 5CGZA 3Q38A 3GLHB 4CLRA 2X9GA 4PNHA 4LZAA 1FNSA 2E4UA 1GN9A 1V41E 3EIHA 4ROSA 2B4TO 2D4AA 3P32A 3IIIA 3L6OO 4JZKA 3H4VA 1T8PA 1SZPA 3DOEA 2QX6A 3FWYA 5K6AA 2XH8A 3BWDD 1DIBA 3K05A 4ZVRA 3ENVA 3DSRA 2AUNA 5JD4A 3FI9A 1YA6A 1WZ2A 3EYWA 3FPLA 3A35A 1I3KA 2R48A 4HN9A 1JN0A 3TRKA 3BEOA 3E7DA 1E9BA 1QK5A 4LX8A 3INNA 1MX1A 1VMKA 2C4VA 4AXBA 4F4IA 3MUNA 2NGRA 3DCJA 2ZT7A 5EPOA 1DKRA 1WULS 2H07A 2PV0A 4PHHA 4CRWB 2Q2WA 3A6GA 3GDOA 3KWMA 5H70A 5B2FA 1R8YA 4GPIB 5IKXA 4P1VA 3IAFA 4WZBE 4HE5A 4EFNA 4N3GA 1E2DA 4I66A 4FDUA 2BFNA 3FNGA 2RGRA 3AR6A 1AS0A 2A5GA 1E61A 1NC3A 3CCUB 4LJLA 2COEA 2RH9B 4LIPD 4M9ZA 4M0FA 2IGBA 4IOMA 2ATIA 2FMFA 1VLQA 1MH1A 3IVGA 3KJNA 5AM3A 1T9BA 3UJ3X 1HT3A 4YRLA 5I51A 3NNNA 4C4OA 4KPUA 4OHOA 2E55A 4PX3A 4NBSA 1SXJB 4M98A 5FPQA 2GO7A 5KOJA 1U0TA 4HUTA 5C81A 1CRWG 2I0FA 3A10A 3A6KA 1UPCA 4V0SA 2FQXA 3OZGA 2X9NA 1SKBA 4YUAA 4RBNA 2WVHA 2Z5VA 3BCUA 4ZKEA 1PL7A 3GG2A 3LECA 4IZOA 2C2WA 4DG8A 2OTJB 1T9AA 3ONDA 2ZIZA 5KQLA 2QA4B 2RJOA 2EJBA 3A1WA 1NY6A 3IUMA 5HMMA 4IKEA 2ZUCA 2WA1A 1HSZA 3LS2A 1A5SB 2Y4NA 3OOWA 3PF9A 1ENZA 4AJ1A 2PANA 3NHZA 4PLPA 2IXTA 4YFYA 4DT1A 4L4YA 2ZBRA 4LFAB 2ZI3A 2VBGA 5BQ3A 2GX6A 4RY0A 2P11A 1O4WA 4JL6A 4N76A 3LXUX 4TZKA 1SZDA 4TV9B 5K0LA 5B6JA 2DERA 5LQRA 3ABOB 1CUSA 1PN3A 2J3DA 3EJWA 4EYQA 1PR5A 3KLNA 5IJ0A 3FDZA 4B46A 3CRMA 3F5FA 3MLAA 1E79D 4U7JA 1R0CA 3VSEA 2AFHA 2PXAA 2I4RA 4U8GA 1J5EB 1EUDA 3WR5A 2ZR9A 3VYWA 5H02A 2HADA 3LX5A 3RWMB 2V7EA 3LU1A 4L7QA 2EYQA 3HPRA 4KYTA 4OL9A 5B53A 3VOAA 3UY4A 3GLGE 1MJ5A 4LDRA 1P1BA 4QBIA 3OUUA 4TTVA 4WXHA 5A3QA 5FBZA 1NP7A 3GWGA 4Q9KA 4X62B 3SMQA 3RAPR 3K9HA 4PYMA 4D92A 2ZB3A 2FTKE 3FG9A 3I01A 4UBNA 3R5KA 2H65A 4GECA 5CXUA 2JLSA 2UXDB 2JKYA 2WG0A 5JJCA 1VHLA 5JY6A 3K6KA 4JT4A 2VF5X 4AMZA 1N92A 1IHMA 3IQWA 1QGZA 3TRDA 3ED1A 4Z7QB 2EFGA 1FFSA 3H17A 2H48A 3WBJA 3JQ9C 3LNCA 2B92A 1AY0A 5AW0A 4KHZA 3HWRA 1NUPA 4MKZA 2GARA 1EE1A 2QTVB 3QPUA 5DU2A 5F78A 3SJ7A 5EJ6A 5FEUA 5K7SA 2AQKA 4IV0A 1NB9A 1QQ7A 2A78A 5KSYA 4MI6A 3KTOA 2HJGA 5IYZA 4KXMA 4C5CA 3DL2A 4MULA 3P9RA 3I5UA 5CNMA 2IEDA 1DIGA 2ISSD 2CBXA 4LNUA 2GKSA 4G9BA 3QHPA 3EPPA 3EGDA 2VBFA 4EHNA 4HVTA 2CMDA 1LCIA 2B82A 1XV5A 2JIOA 2OV2A 3A6PC 5TMPA 4Z9FA 3DGFC 3SYRA 3WIUA 1L7VC 3OO0A 4ER5A 4OPOA 4KV9A 1JILA 1PI3A 1SHLA 4BCBA 4IIEA 2VJCA 5EVCA 1K7YA 4PTLA 1NF8A 4Z5XA 5ALWA 3FNRA 1DQRA 1CX9B 5D1NA 5KTPA 1VL5A 5ILQA 5ADVA 2ZCJA 2J59A 4XOTA 2DUWA 5FHQA 1MAUA 3UWPA 1KK1A 1A3CA