3T53B

Crystal structures of the extrusion state of the cusba adaptor-transporter complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 55
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t53B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t53B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t53B01
2BA0A 1B9NA 1CTMA 5K36H 2PPBC 3D31A 1YNNC 3ND8A 4LK1C 2EJGC 1LABA 4TQUS 3VR6A 3VR5A 3QG1A 2AUJD 2A6HC 3NE5B 1DXMA 3A8KE 4I7ZC 1K8MA 1ZKOA 4G7HC 3D4RA 4H0LC 2E75C 3T53B 2A6EC 4KN7C 2K33A 1Y8OB 1E2VA 2ZT9C 3SDZA 4DK1A 1G291 4KMUC 5JEAH 1IW7C 2D62A 1B9MA 3OPOA 3T51B 1FYCA 1H9MA 3A7AB 3VA7A 1Y69U 3QIAA 1O78A 3PUYA 2LMCB 1V8QA 3GQBA 1H9SA 1Z6HA 1ZYRC 4PV1C 3OW7A 1DCZA 1BDOA 2B8FA 5BN5A 2BA1A 2D5DA 1V43A 4KKSA 2JEBI 3M7NA 1A6XA 3U9SA 4DNTB 2NN6I 1VCIA 2KA7A 5BN3A 1ONLA 3MFYA 3VR3A 1IW7D 1GUTA 4HR7B 3EQLC 1LACA 2EJFC 1E2WA 2JXMB 2E76C 1K8OA 4H13C 3H94A 1Q12A 1GUGA 2O5JC 4JBWA 4DK0A 1GHJA 5BN4A 2Q8IB 4G7ZC 3A8IE 3BG3A 3WDNA 3P20A 4OO1H 2BE5D 1CFMA 3M4YA 2V4DA 4KN4C 3N6RA 4RCNA 1GUNA 1HTPA 3I73A 3DXJC 1Q1EA 3LWUA 2IT1A 1TKWB 3TZUA 2D2CC 2R6GA 4OO1G 1HPCA 2CW0C 3LNNA 4IQZA 2EJMA 3PUVA 2A6ED 4LJZC 1GHKA 1HQMC 1O7LA 1H9JA 4JK1C 1Z7TA 2O5IC 3OOCA 2DNCA 5KNBA 4BA2I 3PUZA 3AB9A 1OXSC 4XIGS 1OXUA 1OXTA 2EDGA 1GUOA 2BDOA 2NN6H 3PV0A 1OXVA 3I72A 2A6HD 1H9RA 3QJYA 1TU2B 2YYZA 3I4LA 2F1MA 1CI3M 2A69D 1GUSA 1QJOA 1DD2A 3SE0A 2AUKA 5C0XH 1Q1BA 3CRLC 2NN6G 1VF5C 3FMCA 3MXUA 5JEAG 4GZYC 3T56B 2QF7A 2PCFB 3IFTA 2PNRC 1H9KA 4OGQC 5C0XG 1IYUA 2DN8A 3ND9A 2E74C 1Y8NB 1YNJC 2KCCA 1GJXA 5KNDA 2JEAI 1Q90A 1IYVA 4KKTA 1T5EA 3HGBA 1HCZA 1EWHA 2A69C 2A68C 2JE6I 3RLFA 4TKOB 3A8JE 3A7LA 3FPPA 4XTCS 3GD7A 1VF7A 2L5TA 3CRKC 2AWOA 2B8GA 2A68D 3IKJA 5KNCA 4IFDG 2DNEA 2K7VA 3M85A 4DNRB 1E2ZA 3PUXA 3W3AA 3L7ZC 2K32A 4L8JA 4BA1I 4KI0A 1Y8PB 4H44C 4IFDH 4G7OC 1SMYC 2BE5C 3KLRA 1PMRA 1H9SB 4KKUA 3PUWA 1I6VC 5K36G 2EVBA 3VR2A 5A35A 3BDOA 1VDZA 3VR4A 4KHZA 1FR3A 1OXXK
chains in the Genus database with same CATH superfamily
1LTAD 3QR8A 1MSGA 3UI2A 1K8AD 4OXPA 2SNMA 5GQOA 2K05A 3AVUA 2LZJA 5M5YH 4EH1A 3AVTA 1B7YB 2YWFA 5FJ8H 1MSHA 4HJ7A 4RD1A 1TWCB 5JOBA 4DK1A 1G291 2K6AA 2AKWB 2IWHA 3W5VA 2HMAA 2ZZFA 1QGAA 4XNFA 3G71B 1EYDA 3PQIA 3SVMA 5JVG3 1VQ5B 2I5HA 4A3DG 2G5DA 2EPBA 3PUYA 1NMFA 1N8RC 2ATWA 2HDLA 1SAPA 3PA2A 5LL6X 3J7ZC 3SLDA 3E9IA 1AIPA 3OP1A 3M3YH 4A3GG 5JBQA 1L1OB 1D5ZC 1JWUD 2D5DA 3K5OA 3B82A 1I5FA 4IN3A 4LFAQ 4DR5L 1I94Q 5HY6A 3OTOL 4HSVA 4NCNA 3HKZE 2ZM6Q 5TY0A 5FO8B 4R8NA 1QZGA 2QDLA 4DR5Q 1WTPA 3F2DA 3BG3A 2LS01 2OXPA 3SJZA 1I4QA 1YHBA 4A3FH 3N6RA 1YNJD 1PRTD 3CAMA 3L9AX 2D2CC 4JI5Q 2F0KA 4XQNA 3GTQH 2XWJB 4OONA 3ONYA 3CMEA 1VQ4B 1I4RA 4X8IA 3QO2A 4A76A 1VQ7B 1YHAA 1K9MD 1I6HH 1RL2A 1TXYA 1KIXA 3VYRA 3QOLA 1OXSC 1R5OA 2JSOA 4V0BA 4XIGS 1OB5A 1N08A 5IGFA 3H3VI 1Q8IA 2DGYA 2NWGA 4JOIC 4DUYQ 3CCMA 2V7WA 2ZITA 2F1MA 2X85A 2N78A 1GUSA 5KIXA 4MN3A 1HZEA 2VXWA 3IFTA 1I6HB 5E4XA 4UP7A 4ALPA 1SMXA 1TWGB 4S3SA 3KL9A 2HDNB 1YNJC 4JI8Q 5CYUA 4NP5A 1SR3A 1XQBA 3K7UC 4C3IH 2UXDL 2X6XA 5AJ3Q 3CRKC 2EE1A 1X55A 1WCMG 2IL8A 4II2A 2OTJA 1KRHA 3ZYYX 1UD5A 1BBUA 4AYBB 4X6AH 4UY8C 3SK6A 1V5VA 1MJCA 1WTHD 5DS0A 1XE1A 2PZWA 1I50B 3I56B 2Z9HA 5C4JH 1AFPA 3HOXG 5JJKA 1XMQQ 4Q7JB 3PUWA 4L5RC 2Y0SB 3CMAB 4DPGA 4DN4M 2JA9A 3CCSA 4IQZA 4ZCMA 1DYQA 1Q82D 3BZCA 1E24A 2EZVA 3FRPB 2PPBC 4ZLTF 3CCJB 3BNWA 4TQUS 1BPLA 3KJPA 1WTOA 1D7QA 1CHPD 3NE5B 4P22A 3MVVA 3OIPA 2NVTH 4KN7C 4Z4TA 2CFMA 4CGYB 4L5SA 4LNQA 1BO0A 3CF5A 2V7TA 3MWYW 3WNBA 1DM0B 1GD7A 1BJKA 2XZPA 1O7IA 1UUPA 2VZAA 3D4WA 4B9WA 5CMDA 4A3LG 1O78A 2B5OA 2BN4A 2EY2A 2EYJA 1MJEA 4K1XA 4LF7L 1ELOA 1WOPA 3H91A 3PUMA 2JA6G 2E1BA 3E5SA 1K0SA 1U5KA 2F4VL 1I8DA 3MXNB 4B47A 3A8JA 3W2EA 4F88A 4RG1A 4ACBA 1AN8A 1GUTA 2VNIA 1PDQA 3SLNA 3G6EB 4HIKA 4YELA 4OPOA 2OEOA 3GTOH 4RM0A 3AVWA 2CKZB 1WD1A 4FDBA 4JBWA 1C8CA 3DEOA 1LV9A 2Y0SE 2YTYA 1PYBA 3F1ZA 1OTCA 1BMFA 2R9VA 1G7TA 1K8GA 1KHIA 1KNEA 1HR0Q 1VQLA 3CC4B 3SK5A 5J3OA 1S5FD 2WFWA 1GUNA 1AE3A 3B78A 4GKJL 4DAPA 2O2LD 4Y9RA 3K58A 4DV7Q 1J8IA 4UZFA 1Q86D 1N07A 4CDCC 1EIGA 1JJGA 3JQRA 1Y1WB 1HFGA 1HVXA 2X0KA 2GREA 5D65A 4YEJA 2OCEA 1VQBA 3HOZH 3GIRA 1CKNB 4WRDA 3LWEA 1IYJB 1U0LA 3DWPA 1D2EA 2ES2A 2C5CA 4PG3A 4BPRA 2BH8A 4M1KA 3BCDA 1KDCA 1X3FA 5G3LD 3ONUA 4QV2A 4LUVA 3S15H 4B3ML 1W6KA 2BOSA 1G51A 5LMUQ 3ICEA 3FMCA 4IPCA 2XEXA 4JI0Q 2RSNA 2UUAQ 3ND9A 1CK1A 2X6YA 1PRTB 3PO2H 3OYYA 4X62Q 2CNDA 1WSRA 3H09A 1JOQA 1Q90A 4XL9A 2B2YC 1VQFA 1EWHA 4QVAA 1IHZA 1XNRQ 1DZ1A 1QUQA 2EIFA 4XT3B 2ICIA 4P2CB 1W35A 1G8ZD 1XXGA 1FNBA 2RDHA 2AHOA 2LSSA 4O2DA 4X66Q 1CZWA 4M1UB 4BBRB 5I6YA 4YWLA 1GOZA 1LTGD 2K4KA 5H1SE 5I2XA 5C3EB 4A3MG 2ASBA 1XNRL 1BOSA 3HG9A 1S3OA 5C44B 4IJHA 2JA7G 2DEUA 1I4XA 3OMGA 1HNWQ 1PFMA 4YCVA 1EQQA 4AQYL 4FF3A 2WAQB 1R4QB 2HHHQ 4P6VF 2X69A 4UZUA 1YHQB 3Q6RA 1DOLA 5TSSA 3T53B 3BZDB 5J3BA 1Y8OB 1E2VA 3D6WA 3HOUB 4KMUC 2XSCA 2YU9B 4K2KA 4RD0A 3NP8A 1V0FA 4YHHQ 4A3JH 2M9VA 1QG0A 2YWGA 4JVZA 2F0FA 1E62A 1QZHA 5TR9A 1QVGA 2F0PA 5FL7A 4PNYA 2BA1A 2VY3A 1UE1A 4KKSA 4XXEA 3M7NA 3A3GA 1JCKB 1WTWA 1BLIA 5BN3A 3OAAA 2F0SA 4JI4L 4A3EG 1L1OC 3CMAA 1FL0A 3GTMB 3BH4A 3L2PA 1HTLD 3WYAA 4Q0FA 2BSAA 1PH4A 2W6JA 1PH1A 3HOYG 4G7ZC 5I9OA 4RA8A 3J80E 5F2DA 3KLSX 5C0XI 1DARA 3K0YA 4KN4C 3HOYH 1S40A 1EWYA 3WBKA 1K3RA 2VZLA 5M5WH 2HT1A 4M53A 4IUTA 1EY6A 1VQNB 3NTIA 2A6ED 1EFUA 4R4OA 4RD2A 1WTQA 4YALA 1GO3E 1V1PB 2DNCA 3HZXA 3S1QH 5KNBA 4BA2I 2HCJB 4B3RL 1ZM3A 4QF4A 5E4WC 1VQMA 3S14B 1BXTA 3STBD 4DNIA 1TWFB 1H9RA 1S72B 4HIDA 1YITA 2UU9L 4FF2A 4DV3Q 2Q6IA 4DK3C 3K80C 4P72A 4Y7NH 5KSWB 3I55B 2X6GA 4B44A 2A5HA 1HNXQ 4DU9A 4JI3Q 3S2DB 2FFKB 3CCQB 3FDTA 4BXXH 1IYVA 1SM4A 4ZK9B 1VQ7A 4GKKL 3HGBA 4F87A 1G6PA 3R6JA 2OQ0A 3A0JA 4QL5A 4RPBA 3CW2C 2XZOA 3MAQA 4BXXG 4TSFA 3G6EA 4BBSG 2A68D 3MEHA 1F2MA 4B3TQ 1VLYA 3LX0A 1K83B 4A3KB 3WOEA 1QE6A 2D74A 2SOBA 2KECA 2WV6D 4POGA 1UMKA 4P2NA 1SJED 1XWEA 4GKKQ 2DIEA 3S2DH 5C4HA 2R7ZB 4G7OC 1SNOA 2OBSA 5LHY1 2MHVA 2D0PA 3D3RA 1N34Q 5HXBA 2HUGA 3T1YQ 1G6ZA 1IXRA 1TIID 3VDYA 1JR0D 2A6HC 3NBHA 3A5ZB 4YHHL 3HS0C 1P16A 1HHVA 1CTMA 2J4XA 5T1GA 1Y14B 1F9SA 4LFBQ 2VBUA 2HQEA 2R7ZG 4ZYSA 2Z6BD 3W5HA 5H59A 1WOSA 3ASQA 1EQVA 2Z1CA 4R1JA 1QILA 1YX2A 3N52A 4B4DA 1SSOA 3AFQA 3MXGA 2WACA 1PKVA 3W5OA 5CBEE 3UDXA 3V2TA 1YIJB 2VB3X 2N49A 2JA8B 1TT2A 2YTXA 3E0JA 1RJTA 1O7YA 4RGMA 1C0AA 4XLFA 2OTJB 4E0FA 1YJ9A 3EQLC 4AF6A 3A5UA 2HIXA 2RDGA 1W34A 5DM73 5GROA 4PAAA 2CRVA 4POFA 1EZ6A 5D3DA 3OZWA 3ZC3A 3R2TA 4UDUC 2Q8IB 4BY7B 4FK8A 3JU4A 4TSSA 5EBDA 1JQYD 2A19A 2QW7A 1H8EA 4IUQA 4V190 2E8GA 2QA4B 2R3ZA 1Q8KA 4LF4L 2AHOB 5DLQE 2KCNA 4YAOA 1YLOA 1TKWB 5F4MA 4OO1G 1DJRD 1ZUNB 5CR3A 3ZIAA 1EP2B 3PUVA 2KJXA 1KK0A 4ID6A 4A3CG 1VQ6B 4NDXA 4QUCA 5C4JB 2IPKD 3OOCA 1E43A 1IB0A 3CESA 1KRTA 4DA2A 4A3CH 4B3GA 1A63A 4KLKA 1OXTA 1GUOA 3CP0A 3QJYA 3TP5A 4Z1MA 1RDPD 3A1PA 3TEHB 1SFOB 1PTOF 4G5GA 1E1OA 3AQQA 1OB2A 4KK7A 1K9MC 4C3HH 4ME3A 3S16H 4DAMA 1IBKL 4ZUIA 1PJ5A 1ENCA 3KDFB 1N33Q 1HA5A 2F3WA 4A3JG 1JB7A 3CPXA 3TN2A 4RLZA 4DV6L 4PMWA 3S2HH 4CQJA 1GR1A 1IL8A 2WB1E 5GV8A 5T1IA 4JBMA 1EL0A 3U6KA 1STHA 3I4NH 4RCZA 5M5WB 4C3IG 1KZLA 2ZXRA 2V7QA 4C2MB 4GQNA 2VJJA 1M90D 3PIP3 4K0KL 5M3MH 1STYA 2CH4W 2N3SA 5F4OA 1I4GA 3TSSA 5BR8Q 2WPDA 1TWAB 4DR1Q 2QTZA 3DUZA 1UE7A 4A3MH 4JI5L 5K36G 2JYOA 3BDCA 4NXNL 1XYIA 2BDNA 1CM9A 3G6JB 3IFDA 2CQAA 4NB3A 1I3QH 4QMGA 3OJXA 2KCTA 1KLUD 4KY6A 1IL2A 3NQTA 1TS4A 3SR1A 5DN6A 2ZM6L 5FO7B 4YWKA 2E2DC 3DM1A 2NVQH 2H1EA 4X65L 4M4SA 5IWAQ 5C3WA 3BC9A 2CH4A 3X3MA 2WP8J 1IW7C 2GQFA 2Q2TA 4XDXA 4LWCA 2C2WA 3CPFA 1WI5A 2OT2A 1BCPB 1R9TH 1K8AC 2GPJA 1IBMQ 3ZZTA 1H85A 1SNMA 2QKIC 2DY1A 3W5UA 1LT6D 2B8FA 3ONAB 1XJVA 2BH2A 4HE5A 1QFYA 3RLNA 1J5EL 3P1HA 3TZDA 3DM3A 2N8NA 2EYHA 2BPOA 3KF8B 1L1OA 3MFYA 2GA4B 2B2WC 2D9UA 1N32L 1B70B 1TS2A 1UD8A 4DGZA 2HLDA 1UD6A 4XQFA 1VQKB 1EYGA 4DK0A 3PO2B 1E64A 5CV5A 5A8AA 3PO3B 1PVOA 2PI2E 2KOLA 4A3EB 4MNOA 4DR3Q 1W87A 1WCMH 4OWTB 2OK8A 4O0AA 1KK1A 3M4YA 3RN2A 4IZ8A 1HTPA 4TMXA 3GSIA 4WJ4A 3TZUA 2CW5A 3OW2B 2V31A 1C48A 3Q8DA 2RQXA 4IFDI 4JV5Q 2ZBUA 1BUVT 5IYDG 2EFGA 2UUCL 4X3UA 1COWA 4LJZC 5THXA 1IBKQ 1IKMA 1WCMB 1YNXA 3UE1A 2QDXA 2F0GA 3AB9A 5C44H 5IGCA 2ZZQA 2BCOA 5CV4A 1CI3M 2A69D 4DV5Q 2WINB 3SE0A 1WFQA 2B7BA 4GNXA 2SNSA 4EQPA 5HGTA 5CDFA 1HH2P 3T56B 4RMFA 4LC0A 4A3KG 1MGSA 4LF7Q 2PNRC 1KC8D 4DQLA 3UDIA 5CV7A 3JAML 3K57A 1I94L 1AMOA 5FLMG 4LFAL 2R93G 3G71A 2ZTGA 2UXBL 4IPGA 1HRJA 3E20A 4DQKA 4X3KA 3CMMA 3I4NG 3CRZA 1HCZA 5BR8L 3B8HA 3MTSA 3URYA 3BVGA 5FLMH 5FIUA 1Y1VH 1KMHA 1XMOL 3IKJA 1PZJD 1KD1C 2XIWA 3T1HL 4K5XA 1M1KD 5CGKA 1G91A 2I5MX 1A2TA 2Z8LA 3TP8A 1YIJA 1PH5A 4KV6A 1FJGQ 1UAPA 2EVBA 2XNDA 2RF4A 2L0CA 2D0OA 2NV4A 1T6ZA 3I70A 1ZM9A 2GJKA 1N0VC 2F52A 1FRQA 2XNAC 2V7XA 2NZHA 1N36L 1KRSA 1YZ6A 4G7HC 4C0SA 3RZOB 2K33A 1LLRD 2TSSA 3D8GA 2CQOA 3HOVH 1NR4A 1HR0L 5IYCH 4BY1B 4A3BH 5C3XA 1Y69U 5LMUL 3W1GA 5EQ0A 4H02A 4OX9Q 1XMQL 3V96A 3PA1A 2Q2HA 2V7UA 3S14H 1EWIA 3I4NB 4JC0A 4LAAA 5F4JA 2B29A 4MYTA 2EY5A 1TUIA 2QMUA 2DYIA 2B2YA 3CC2B 1EQRA 2OBRA 3H3VC 2E2HB 1LACA 2GN5A 3D0FA 5GAEC 1CSPA 4H13C 5AJ3L 1Q12A 3CQZH 3L3OC 4G4KA 3S1RH 5FO9B 4X0CA 4R71A 4YAUA 1U4RA 3H6MA 2IW3A 1SYDA 1P4MA 4DKAC 1B3AA 1EIHA 5LMNL 2JA5H 5IYWA 1CFMA 1FVIA 1AZPA 3S1MH 3FKSA 1KTKA 1G7CA 4P1VA 3CXCA 1JMCA 1NAPA 4HMIA 5L46A 3RD4A 1BX1A 2EJMA 4RGOS 1DDGA 1E3XA 3CCMB 1YJWB 2PI2A 3C1FA 1O7LA 2R7ZH 4IUVA 1YI2A 3C3LA 2XNJA 3NHHA 1DGSA 5KYLA 2VUMG 1PJ7A 1DG1G 5IT9c 2VQFL 4RFBA 4YIJA 4ZAIA 2YYZA 2WAQE 4ACAA 2E5LQ 3FP9A 5C0XH 3HAGA 1VF5C 4JI1L 1HZ9A 1S5DD 2X6LA 3U9OA 2EYFA 3HFZB 3KLSA 2UXCQ 5C0XJ 1KDAA 2WKDA 4DR4Q 4XN3A 2RA4A 4FO2A 5C4XH 2KCCA 2C4UA 4KKTA 3PO3G 3FKIH 3WOFA 4YHBA 4N3NA 1OO9B 5EGTA 3I4MH 1SN8A 4JPBW 1B2TA 2ENBA 5KNCA 2ZZEA 3M4QA 2PQEA 4OWXB 4X64L 1HZBA 3A56A 3KF8A 3W3AA 3GTQB 2JJQA 4KY7A 2KQ3A 4LBZA 5ELBA 1F9PA 2FX3A 4HCEA 1SNPA 1N36Q 2KHSA 4BY7H 4J15A 4XLEA 1WYDA 4LFCL 1VQNA 1JORA 2Z6KC 5K36H 1SLJA 2NVYH 1SRUA 4DR7L 3KUPA 4LW1A 1JOKA 4ODGA 1NJID 4NXML 5IGBA 3KF6A 2F4NA 2F0NA 3SDZA 4PC1A 1L0XB 3X3NA 2ZXHA 5G3LF 2K5NA 3GTMH 2IHEA 3KOJA 1A0IA 5A89A 3PIPA 3ISXA 2F3VA 4PV1C 3Q39A 4JCVE 4EQOA 4KY5A 2F0IA 4X62L 1IJEA 1TR5A 3RLOA 5M9OA 3OMCA 3JQPA 2AQ2B 2PNHA 5KRUA 3Q24A 1K73C 1IW7D 1MHWC 3GTLB 4AVZA 1G7RA 5D3IB 5C4XG 4B3RQ 2LXJA 5DSZA 3I3CA 1J9ZA 3K7AB 5EKLA 1QG7A 1CHQD 1N05A 2OF1A 3S1QB 2ALYB 1VQHA 5HKKA 1O7ZA 5ELFA 3DXJC 5FA6A 1Q9SA 4IO9A 2IT1A 4PC7A 1TS5A 2R6GA 2GJPA 4Y52H 2QGQA 1HPCA 4ZUJA 1VS0A 3BDLA 4C3JB 4A3FG 1QGYA 4A3DB 2X53S 1KL9A 1H9JA 4AQYQ 4X3TA 1KD1D 1LUZA 1CKNA 4A3IG 2I07B 2L11A 4A3LH 5I2YA 3ZBTA 3I72A 1I7PA 2X6WA 3I4LA 1H8HA 1F60A 2M00A 3HOWB 3P26A 1GAWA 2E2IH 1SROA 3LVBA 5EBCA 1ENFA 1BX0A 3OSOA 2MNAA 3PF5A 4OWWB 4IUPA 3J81c 2WZPP 3LQ6A 4LUOA 4J0QA 1OHHA 4Z4RA 4CHTB 4A3BG 1EY7A 2JQOA 2DCUA 1ESFA 4C56C 2RC6A 3ASPA 1CNEA 3Q6SA 2A69C 1LTID 1EY9A 2IX1A 4DAVA 1EEID 3J81k 4K6LA 4YCWA 1R9TB 1PTOH 3CCEA 1VF7A 4N3GA 4XLHA 3OW2A 2F0WA 2DNEA 4OP7A 3PUXA 4YY3L 1Y1VG 2B2UA 4BA1I 4H44C 1Y1WH 2JN9A 2DERA 1FNMA 1S4MA 2Z4IA 4ILWA 1CNFA 2B2VC 2QN6A 2NTSA 4QIWE 2XGJA 4Z9CB 5K5PA 1MI2A 2PW5A 1X54A 1SYGA 2CK3A 2AQ3B 1OXXK 2KCMA 3CTAA 5CV8A 1W9XA 1SYBA 2EYMA 3NELA 3CCRA 4JMQA 2FMCA 3VR6A 1LABA 4AH6A 3J81j 4JBKA 5FK9C 3A55A 3BQJA 1ZKOA 4APVA 1R5BA 4R4IA 3G4SB 2Q6OA 3ULPA 4RGTA 3DDYA 4ZGQB 1S5BD 1FYCA 3A7AB 5JPNC 4OPVA 3F2UA 3QIAA 2AWNA 4CBVA 1SNCA 3R6KA 1Z6HA 4B3SQ 2M5SA 1S5ED 1G2SA 1YJ9B 2LKVA 1BDOA 4U68A 4DV2Q 5IP7H 1FGBD 1RF2D 4O1NA 1FNCA 1V43A 4JI3L 3K5NA 1UWVA 1EFCA 1QVFA 1EWCA 1FX0A 3S1NB 4KJOA 4JI6Q 4P71A 3VNVA 1FNVA 4K5VA 1TWGH 5FKAC 3U58A 1GHJA 2RDFA 2BF4A 3GTGH 3VO1A 2B2UC 1F2LA 1VQ6A 3NQIA 3W2FA 3SEBA 3WDNA 3OTOQ 3GTKH 1KLGD 2K01A 3MZ5A 3NXWA 3WNDA 4F7DA 3PSIA 3GTJB 4OO1I 3TREA 2QE7A 1D1IA 2AQ1B 3GV6A 4FN5A 1B50A 2MO1A 2NZ1D 2D9RA 1YITB 1S72A 1D1KA 3HOWG 1RQRA 1NUCA 3B6YA 4G57A 2FINB 4UZEA 3PF4A 2BDOA 1QVCA 2ZBVA 3BYTB 2XOKA 5BSYA 2PMDA 4B3XA 3HKZG 1SE8A 1GKHA 2C77A 2XN9C 1HR0W 3U6BA 3M4OH 3TS2A 4H7BA 3GVKA 3R3OA 1K28A 4AIMA 1NMGA 2Q2UA 4DR6Q 4GZYC 1E22A 2ICEC 4OGQC 2VNJA 5GV7A 2DN8A 1D8TA 4NPSA 3EA6A 4FXUA 3P75A 4OELB 2Q8RE 5M3MB 4KJNA 1I4PA 3CCQA 4YCUA 2K75A 4HJ5A 2BMWA 1RCVD 4RH6A 3QOJA 1YJWA 4JI2L 4HIZA 1PFBA 4DR6L 1BKBA 1G2TA 4RPDA 5FO1A 4IOAA 1STNA 2E1RA 2AWOA 1TY2A 3M85A 3TMEA 4RKBA 1I18A 4X7FA 3NBHB 2XNCA 2XRSD 2MGSA 1HUNA 3ER0A 2UXDQ 1TY0A 3NEMA 2WIIB 5ELNA 2CF4A 3LGJA 1ET6A 4BWGB 2WAQG 3AGQA 1TWCH 2R7DA 4LBWA 1WDTA 3AFPA 4MZ9A 1X65A 4RGNA 5B6IA 4WZEA 1A3TA 3IAYA 3W2HA 3OZUA 3S17B 1C7YA 1HA6A 4BY7G 2JA8G 4LK1C 2ZXIA 1Q81C 3AVVA 3M3YB 1LTBD 1Q3LA 4AF7A 1X3EA 3M7GA 3S9WA 5A2QL 5EMNA 2NUCA 5JEAH 3WNCA 3JAMi 1BF4A 1EIYB 3A74A 2D62A 4DR3L 3SJPA 4JG2A 1PV4A 1HXYD 5JAVA 3G4SA 4JI6L 1VQAA 4DR1L 1U4LA 2F0OA 1B1ZA 3CD6B 3U4ZA 3PO3H 3UE0A 3PIOA 4C3HG 3AYHB 3A8IA 3CB4A 3V05A 2JEBI 1A6XA 4NXNQ 1PXUA 1VCIA 5IP9G 3BVMA 4L5QA 3KEWA 3VO2A 3GTPB 5M3FH 3H94A 2F0QA 2P5ZX 2YTVA 4IPDA 4C1NI 1VQJA 4PC2A 1RTOA 1X56A 1A8VA 5BN4A 5IWAL 1VQOB 2B3GA 4K0KQ 4HE6A 2BE5D 1GVPA 1EOTA 1UE5A 2V4DA 1E7ZA 1BCPC 5IYDH 5HURA 5M5XB 1JJ2B 5M3MG 1NB9A 3CPWB 2UXBQ 2BM0A 3V76A 5C3EH 1HQMC 3I90A 4XQQA 1SDFA 1Q86C 1D5XC 3CCUA 1KQSA 2O5IC 4WWVA 5C6AA 5IYRA 1N06A 5EKIA 1B3QA 1BCPF 1E1RA 2NN6H 1SJHD 4A93B 4DV7L 1F2ZA 3T1HQ 5I6WA 2JA8H 2B2TC 5IYBH 1QJOA 2Z4HA 3RUZA 2NN6G 3KFUA 2ZJQA 3CXCB 2JJ2A 3MXUA 1IKLA 1Q7YD 4LF6Q 1K73D 4J6HA 2IY5B 3H0GB 1HFNA 3C46A 2PO4A 2ZL6A 1V1PA 3NUCA 2UUCQ 5KGUA 2F4IA 1W0KA 2JEAI 3TBIB 3ASSA 2JA6B 1SYFA 2F0TA 3CMEB 4TKOB 1Z9FA 3RLFA 5IP7G 4Z4UA 5FLXc 4XTCS 1PH3A 1AP0A 5EPKA 1B23P 1NDHA 2VBVA 3JAME 4ZKBB 1A8PA 1TQOA 2PZUA 3FVQA 1JWSD 1X32A 4L8JA 2K32A 3GVLA 4XORA 3VYTA 2QCPX 3I2ZA 1VQKA 2QEXA 5IIFA 1E3PA 4OOVA 1CT1D 4GOPC 4JV5L 3K7AH 2C78A 4RD3A 1A2UA 4A3GB 4IUNA 2BGIA 4LBVA 4B43A 4G1VA 3ZZ0A 4ZCKA 1R4PB 5IK2A 2QTLA 1ICWA 4PZ8A 3D31A 1GM5A 3HOYB 2EJGC 4OEMB 4ASUA 3NWSA 4RHSA 4HIMA 2WZNA 2A6EC 2YV5A 2ZT9C 1VQ8B 1A3VA 2FHTA 4DV5L 2E5LL 4MYUA 3BYYB 3OKXA 1SXTA 2A74C 3OPOA 4PMCA 3I4OA 4GNXC 4XOTA 4XKVA 4MHEA 3VA5A 1LYLA 1X9NA 1VQEA 1IBLQ 2J7KA 2Q6LA 2D3NA 4J8QA 5KEEA 4GN5A 2HDMA 2CCZA 4OHJA 1D5MC 1N8RD 1WOCA 5FOBB 4DUZQ 2E2IB 4DNTB 3QFRA 2NVTB 1EOVA 4G7XA 1PFSA 2KUMA 5KYIA 1AEXA 3A8KA 1KC8C 1OGIA 2VQFQ 1H95A 1QWYA 4PABA 1UD4A 3HOXH 3A8IE 1W2BB 1HQRD 2GVBA 2ID0A 1DDIA 4XLAA 3ERSX 4BS9A 4DR2Q 1PZID 1QNUA 3CKIB 2BV3A 2CW0C 1K83H 3CQZB 1L0WA 5IE8A 1VQLB 3IRBA 1HZCA 2L9HA 1Z7TA 4R8IA 3ZZUA 1PZKD 4B3MQ 5GAHC 4LF5Q 1FRNA 2V7VA 1RD9D 4GKJQ 1JC7A 3ITPA 1F2YA 4A3IB 1Q1BA 3AU7A 2EIXA 1UNSA 4RDKA 2F0MA 4OX9L 5GADC 2R7FA 1A3UA 3R8BA 2ZL7A 1FNDA 1U2RA 3RZDH 2J7ZA 1V9PA 4E6IA 1EP3B 1PFNA 2MP1A 3CC7A 2ZTEA 4RCYA 5KNDA 4DAYA 2VYQA 1TWHH 2FMMA 2JP1A 2NZOA 4WJ3M 1PH7A 2A68C 2JE6I 5HZBA 1MD2D 4RCOA 1WP6A 4WZLA 2DY7A 1EY5A 1KAWA 3GD7A 3J80c 3S15B 1EP1B 5J1ZA 1NSNS 2B8GA 2BVNA 3QE2A 3W2DA 4NXMQ 2DJGC 3P7JA 4LBYA 2DETA 1OGJA 2GK7A 1KXLA 1EFRA 4TN1A 4OIKA 3RZDB 4XMYA 5LL6S 3S1NH 3EVQA 4DXFA 3DHQA 1CQFA 1PH9A 2HHHL 4Z4YA 3K8AA 5C4ZA 3VR2A 4DXGA 1N9WA 3VR4A 1B2RA 4KD4A 2R93B 4G1BA 2K5QA 4M2LA 3KF6B 5JJZA 2F03A 3BU2A 4DV1L 1T9HA 2K50A 3SKBA 1SNQA 1YJNB 1XFOA 3PENA 2E75C 1QUEA 1HA3A 4G7WA 2MQHA 4K5WA 3W1BA 2CW0D 1ASZA 3CHBD 4N8FA 4JI4Q 1VQ8A 3BY2A 4ME5A 3FJOA 3QFCA 2CWPA 2FXQA 2R93H 1V8QA 4R4CA 1HJPA 1K0RA 2IX3A 1LM0A 3F8TA 4FF4A 1Y1VB 4A75A 2KBNA 1JA0A 2R92G 2NTTA 4PZ6A 4LFCQ 3SXHA 2NN6I 1BQQT 2B2WA 1ONLA 3VR3A 1VMPA 2ZTDA 4U9UA 4K6DA 2JXMB 4IW3B 3T4AC 2GVAA 4BBRG 1PYSB 1STBA 1GUGA 2XZLA 1ML0D 1NCVA 4DV4L 2K5HA 2F0EA 2PQAB 3MHBA 2IX0A 4X64Q 2G9HD 1V1QA 2MFIA 1D8LA 4YY3Q 3RY8A 3P20A 4OO1H 3S2HB 2K1BA 4UPAA 3OEHA 3QB3A 2IHFA 3KBGA 1ZM4A 1WTRA 1STEA 3GTLH 3J81i 3EJIA 4QVJA 2JK8A 5DAUA 1XX8A 3RN5A 2RCFA 3VYUA 2B2VA 3Q38A 4LF9L 2HCCA 4BY1H 3BZKA 4GLXA 1U4MA 4B9XA 2OK7A 3M4PA 4UAIA 5IYCG 2DY8A 4UAJA 4XQJA 4NBSA 2CWAA 3DMUA 2VUMH 1BBXC 2F3IA 4WFN3 3S17H 4LF9Q 1KNAA 2PMZE 1B8AA 3LQEA 3NPPA 4DF7A 4ZV4A 2F43A 1VQMB 2J0TD 5M5YB 4XR6A 3DWAA 3J81L 2NVQB 1T6YA 4LMQD 1VQDA 1M1KC 4B48A 3MC0B 1VQ5A 1YNND 1YEZA 1QX4A 4WQMA 4XYOA 3SEJA 3HEJA 4YAWA 4DV3L 2VQEQ 1JT8A 2UUBL 1FNUA 4P74A 4IFDG 3FKIG 4DNRB 2VW9A 2I5LX 3I4MG 3MXNA 3F2CA 1E3ZA 1EFTA 3EROA 3VNUA 2VQEL 4H9GA 3KLRA 4DV1Q 1PMRA 1SYEA 2VJIA 5E1FA 3GVJA 3RR5A 3HOZB 3E9HA 4N9TA 2B39A 4DV0Q 3L0OA 1IHMA 4P12A 4XOPA 2XTIA 2LXKA 1WTXA 2LY7A 3MMPA 2WJVA 1E1TA 4HSPA 4TMZA 1YNNC 1S4ZA 2P3MA 2ZTCA 2C9OA 4QIWB 5M5XH 2E2JB 2C5HA 3QG1A 4OPSA 3Q23A 2OQKA 2KHJA 4CKCA 3CC4A 5CV9A 4H0LC 2R61A 1WSVA 3G05A 1VQPA 1NR2A 2HCIA 1EZ8A 3IL8A 2R92B 1STAA 4TMWA 1QFJA 3FKIB 4LFBL 2QEXB 5GAGC 1TTTA 5EPLA 3J80L 4A93H 2K5WA 1LT5D 3U2QA 2E2JH 3S24A 1DCZA 4WZTA 4X65Q 4BBRH 3U9SA 1FDRA 2KA7A 3ES9A 2WB1G 4KHVA 3GTJH 3AVXA 4P9SA 5IGDA 3ZUGA 4GLVB 3NTKA 3DLLA 1KDBA 4RD4A 3NSWA 5COYA 4RKLA 2YWEA 1EU3A 2NYZD 3V7AA 4ZCIA 4FP5D 1YI2B 4TMVA 3AEVA 4DK6C 3U4VA 2Z6KA 4QY7A 1N32Q 3OEEA 1LT3D 2NVYB 4QCLA 1IJFA 5ISRA 5I4DA 3M4OB 4ZGNB 1SFOH 1V1OA 2L4NA 1SMYD 4PZ7A 4DV2L 4HJ9A 3WXMA 1NNXA 4XT1B 2O4XA 4JK1C 1MABA 3GTGB 2NBFA 3CC7B 1ZXTA 3G48A 3CCVA 3A35A 1M4VA 4X7CA 5L37A 2Q2IA 5IGGA 4P75A 4TT3A 5TRDA 1DOKA 2JN4A 4HN7A 5IYNA 3LO8A 2VNKA 2A73B 3PUNA 1VQIA 2L1BA 2XWBB 1WJJA 4KD3A 1EFID 1TVXA 1S0UA 1FNWA 1JNYA 2OTLA 4B3SL 3CCEB 2ZTNA 5C0XG 3MCAA 2VNUD 4IJLA 4HEDA 1LTSD 3HOVB 2Z0SA 1GJXA 1J6QA 2DOGA 4RAUC 1MRZA 4EQNA 4K8IA 2RSOA 3FEWX 4PQXA 3A7LA 1ZYRD 1GAQA 2PW7A 4C3HB 1CQVA 2L5TA 4QGUA 3S16B 5CV6A 2K52A 4RJLA 1W3SA 1E2ZA 3CCRB 3EN2A 1KK3A 4HJ8A 1AZQA 1Y8PB 1EY8A 1NB0A 1OB0A 3QFTA 2I0QA 1SMYC 2B63H 4XYQA 1H9SB 1NJIC 1G7SA 3FPUB 2VBSA 1I6VC 3DWQA 2RCNA 4G6IA 1QCBD 2EYPA 4MTNA 3ULLA 1VQ9B 4X7DA 4P3IA 1W6JA 3KJOA 2RHQB 2JA5B 4GN4B 4ABNA 4JI2Q 4C2MH 2PLFA 1JE4A 1N0UA 3WY9A 3SHLA 3TQYA 2DUDA 1FJGL 5AN9A 1SBBB 2PIAA 1Q7YC 1KK2A 3J81E 2B2TA 1MBYA 3J80i 4QFMA 3F2BA 2PQAA 3QSYA 3Q3AA 3GQBA 1Q46A 1STGA 2EYOA 4FNFA 1BNZA 4UHVA 1RTNA 1XNQL 3I55A 2RVLA 5E7NA 1KTVA 3O13A 4A3EH 2VBTA 4A3KH 4C3JG 4A3FB 1Y0YA 4DFAA 3FPKA 4FF1A 5JVH3 2KVOA 2KEEA 3JAMc 1ZM2A 1BR9A 1UEBA 2F0HA 4CJ2C 4JI7L 1M90C 4WZKA 2K03A 4JW0A 2KHIA 1Y1WG 4IPHA 5C4XB 1TVCA 1J5EQ 1TWHB 4I7AA 3VMFA 2H4OA 4EGVA 2A8VA 3TDQA 1Q82C 2F0UA 3I4MB 2CBXA 4RCNA 3KDFA 1JJCB 3I73A 3H9NA 3KLWA 3CP2A 4LF6L 2CC2A 5M3FB 4TVAB 4XKWA 3H0GG 5EKKA 1WD0A 1LTRD 2I46A 4MTKA 1GHKA 3OIQA 2L55A 4CKEA 1MIUA 4HTHA 4OL7A 1PJ6A 3EBEA 3W2GA 3H0GH 4Q5VA 2F1LA 1PH8A 2KVMA 1ESRA 3ZBUA 1NY4A 2XGTA 4C3IB 2RC5A 4A93G 2HIVA 1QGZA 3CRLC 3T13A 1QOHA 1CA5A 3K81C 4X07A 3J7AF 4EQ5A 5JEAG 2QGGA 2WYRA 2QF7A 3HRZC 3VYSA 1M8AA 4YAFA 1IBLL 2BM1A 2KEDA 1H9KA 4KHPL 1GJRA 3I91A 2MUYA 3Q0AA 2NB0A 5ELDA 5TV2A 1Y8NB 5FNZA 2YU9H 3ZPNA 4A3JB 4RWSC 1QNKA 2C5BA 3FPPA 4II3A 1PH6A 3GTKB 4B08A 4P6YA 4KHPQ 1EQTA 3AMUA 4CJ1B 3Q6QA 2X3UA 4YWMA 3C2QA 4DUYL 2C35B 4N8X1 4RHRA 3MHPA 1VQCA 4KI0A 3CCLA 4Z4ZA 4UP9A 4IFDH 2A1AA 4HIOA 2WSSA 5CBAE 3R2IA 3Q22A 1K3BC 4XD7A 1MKHA 5A35A 3BDOA 2GK6A 1T6XA 3QWNA 4DUZL 2BA0A 1B9NA 4RDJA 1X3PA 3E6ZX 1IBML 2VL6A 4LF5L 3BCFA 1KAAA 1LTLA 5C5LA 3A8KE 3OJWA 1QB5D 2OWOA 1WORA 1QUQB 4A3DH 3GDEA 4X3SA 4WJWA 1E0BA 1B4OA 3DEPA 3KBXA 4DAYB 3ZJYC 2WKCA 4LUZA 5ELCA 1Q81D 2K5DA 4A3GH 3QFSA 4FYDA 4JI7Q 4DR2L 4JBJA 2RHSB 2WR8A 1CZGA 2RKSA 3NENA 4UP8A 2OTLB 4GOPB 3HOXB 1P8LA 1WVLA 4TRDA 3PGZA 1XPOA 2PMZB 4Y7NB 2EJFC 1K8OA 4XONA 3J7A5 1FGUA 1TWAH 3J7YW 4A3BB 3BVZA 2O5JC 2HD3A 1D2BA 2L12A 5J39A 3CCVB 4C1NK 1JE5A 1WTVA 4C43A 1IZ6A 2QILA 5M3FG 5H5JA 1X3QA 1U9RA 4NMZA 4FXGC 1PTOB 2TMPA 1I3QB 1QUFA 2MPMA 2E2HH 2UUAL 1C4QA 1JOOA 2F0LA 2X8KA 3K0XA 3LNNA 3TS0A 1VHEA 4J1MA 1EY4A 3CCSB 5ELEA 5FO0A 3WWVA 2F4VQ 4FXDA 1I4HA 2K04A 2QDBA 2ZXPA 5CORA 5DNFA 1B53A 1SYCA 1HNZL 2EY6A 3SK8A 3EIVA 1AE2A 2G9DA 5EAYA 2EDGA 4DR4L 3PV0A 1XPRA 4BY1G 1OXVA 4OIJA 4MIUA 4NNJA 4IUUA 2Q6KA 3ULJA 2VB2X 4U673 1HNZQ 1U4PA 1H42A 1E1QA 1BBWA 2PCFB 5IYBG 1XMOQ 3D26A 4K8JA 5BSXA 3WBJA 3C1EA 4HCSA 5IYQA 5IP9H 1JWMD 2DJFC 4IOCA 1NTGA 2V1CC 2KENA 4ZKCB 1AW7A 1T5EA 1F9RA 2IJ0A 1E63A 4HJAA 3A8JE 3J7AV 1F9QA 4PC3A 4EX5A 2JA5G 2ZJRA 3L7ZC 2ZL5A 1RIPA 3PCOB 1L0YB 4FXKC 1QVGB 2NVXH 2H5XA 4M8AA 5JEAJ 3H3VH 2R6HA 2LFNA 4B3FX 2EOTA 1KQSB 2BGJA 4ROXA 3TP7A 1BCPD 2F0DA 4RDLA 4R4TA 2PE3A 1VDZA 3E0EA 4R9WA 4KHZA 5AFWA 5IGEA 3HOZG 1C9OA 3GO5A 2Q8TA 3I1FA 1YJNA 1DOMA 3HP3A 1YHQA 2JA7H 5KNLA 4N9PA 5E3FA 3D6CA 4DV4Q 4GOPA 3HOUG 5A88A 1GUWA 4I7ZC 5C5MA 1K8MA 2NVXB 1L2FA 3D4RA 3AGPA 1XPUA 4XM3A 1EYAA 1LO5D 2ZXOA 1VQOA 1ILQA 1B9MA 4IURA 3T51B 1H9MA 3VA7A 4XN0A 4JYAL 2JA6H 2FVGA 4DR7Q 5HZAA 2C4TA 5KW9A 4X7EA 4Y9UA 2LMCB 1CA6A 5JJLA 4QJFA 1BQEA 1H9SA 4JI0L 1RQPA 2K5VA 1UE6A 3P27A 4Y7CA 4LF8Q 3A3BA 2JA7B 3OW7A 4O42A 3JQQA 4FWTA 5BN5A 1EFWA 1GVHA 1O80A 2EY1A 3CU7A 1K28D 1A62A 5ELOA 5LMNQ 4Z4SA 1HNWL 4P3YA 3G7LA 2F0JA 4JYAQ 4P26A 1ILPA 1SE2A 4RD6A 2D3LA 1E2WA 2E76C 3CD6A 4QUZA 2ZJPA 2XRQD 4HMJA 1RHPA 3HKSA 1YBYA 1CQXA 1TLLA 4C3JH 2UUBQ 1AH9A 3R93A 1QH0A 3W2IA 1VMCA 3GP7A 4PGOA 4X66L 4CDFC 4B3TL 2B63G 3AVYA 1EUJA 4CJ0B 2VNHA 2CVRA 2UU9Q 3BY1A 3PMFA 5I9PA 3TP6A 3BJUA 1DONA 2N88A 1UD2A 1ET9A 1FD7D 4K14A 4EVOA 3UDFA 3HOWH 2XVSA 2QEJC 1PA6A 2VUMB 4DV0L 2SDFA 3RZOH 2Z6BA 2B7CA 3MA2B 5FJ8G 4GN3B 1PTOD 4JI1Q 2ZZGA 2EYLA 2SEBD 2UXCL 2VS1A 3BS1A 5J22A 5C3EG 4A3MB 1OXUA 4KTAA 2EXDA 1RKNA 3TRZA 2MJ8A 1D1NA 2OYNA 1NBWA 1ZEQX 2GJRA 4CDDC 2AUKA 1PYWD 3NWTA 5D14A 1ASYA 5DEHA 5JPMC 1GXDC 1SE4A 3RNUA 4A4IA 3FHWA 1VHOA 1NE3A 2WB1B 5E6TA 4QUFA 3NBIA 3CCUB 2WJYA 4F7XA 1JA1A 1J9OA 1ICFB 1TWFH 4CDEC 1SKYB 3OWFA 4P25A 5IYPA 2PYKA 4AYBE 3CPWA 3S1MB 1EIFA 1JICA 3JC66 2K7VA 1WTHA 1A15A 1Z47A 3OWEB 5DM63 2K14A 5IY0A 2F0VA 3K59A 3E3XA 3GTPH 1CSQA 3NTHA 4KKUA 5EJWA 4I65A 1V0EA 1RODA 2EXZA 1HNXL 2W6IA 4ZCLA 1VQPB 1D6EC 5JJIA 1FR3A 2BE5C 2OBTA 4A3IH 4L6TB 4R4QA 1YVCA 2Y0SG 3GV3A 1S5CD 1B44D 3ND8A 2FJ2A 4NW2A 4X05A 3VR5A 4LF8L 2AUJD 1DXMA 1WOOA 3MEFA 1PHJA 2HQLA 1VJSA 1X3GA 1QFZA 1LTTD 5EPJA 5C44G 3PIO3 1W0JA 1EY0A 2N55A 1R5NA 3WQZA 1EEFD 1PLFA 3MXPA 3K6OA 3KYHC 4YXWA 4K2LA 2CHBD 3MFGA 2I1LA 3E1YE 1UD3A 1ZYRC 3STBC 4CKBA 4QHYA 3T1YL 1N34L 5LMZA 3A54A 4OOXA 1EXMA 3K5LA 5FLXL 3KK7A 3CCLB 1QVFB 3H15A 3ASTA 1E79A 2PZTA 4HR7B 4M0LA 1VQ9A 1T5XD 4Z4VA 2R92H 2JIZA 4AYBG 2M2LA 3OHXC 5FLXE 1XTCD 4L63B 5LMNW 2RBMA 2MO0A 5IT9E 4QQBX 1EU4A 5NUCA 3ERQA 1UEAB 5IOCA 4XLCA 3LWUA 1Q1EA 5IT9L 3OZVA 1KABA 1HUMA 3CCJA 1WU8A 3OE7A 3UDGA 1PTOC 2QA4A 4GS3A 3HOUH 4TMTA 1JB3A 1I50H 4DV6Q 2JDIA 3PVDA 5J35A 4IALA 4X06A 4P73A 3I7FA 3SK4A 3PUZA 1F20A 4GLAC 2AMCB 1CKOA 4F8MA 1JB9A 5HGQA 1WPCA 1VQGA 1KJZA 1XTDA 4JOIA 1VLOA 1ENAA 2A6HD 4PMBA 3I56A 1TU2B 1NBMA 1PH2A 3K5MA 3ASRA 1DD2A 1II3A 1VQ4A 1XB2A 5CC4A 1Y0RA 4OOSA 1LT4D 4PC6A 4HAEA 3PO2G 1EYCA 1JJ2A 3HOVG 4LF4Q 2EQSA 1TS3A 1XNQQ 3U50C 1IYUA 4L5TA 3D4DA 5A2QE 2E74C 1CUKA 3C2PA 2K28A 2NPFA 3SGIA 4BBSH 2B63B 1F77A 2L15A 1PRTC 3EFXD 3OFNA 2JJ1A 3CW2A 4ZRZA 4GNXB 4QB4A 3NK9A 1GO2A 4JI8L 1SNDA 4ULLA 1SEBD 1SKQA 3T16A 1W2BA 1CKMA 3M9BA 4NKLA 3CP8A 5IODA 4BBSB 4AC9A 3GTOB 4IFDJ 3HKZB 2YWHA 1PRTF 4Z4WA 4WORA 1X6OA 1HZAA 1NRKA 4FVMA 3S1RB 1N33L 3RMHA 4ZQ3A 1BVSA 1SE3A 3I8ZA 3CC2A
chains in the Genus database with same CATH topology
1LTAD 1MSGA 3UI2A 2SNMA 2K05A 2LZJA 1MSHA 1TWCB 5JOBA 4DK1A 1G291 2K6AA 2IWHA 2ZZFA 1EYDA 4XNFA 5JVG3 3SVMA 2EPBA 3PUYA 2HDLA 1SAPA 5LL6X 1JWUD 3K5OA 1D5ZC 2D5DA 5IGFA 4IN3A 4HSVA 5FO8B 4R8NA 1WTPA 3BG3A 2LS01 2OXPA 1I4QA 3N6RA 1YNJD 1PRTD 3L9AX 2D2CC 2F0KA 4XQNA 2XWJB 1I4RA 3QO2A 3VYRA 3QOLA 1OXSC 4V0BA 2JSOA 4XIGS 1Q8IA 2NWGA 2F1MA 2X85A 5KIXA 1GUSA 4MN3A 1HZEA 2VXWA 3IFTA 1I6HB 5E4XA 1TWGB 4S3SA 1YNJC 5CYUA 4NP5A 2X6XA 3CRKC 2EE1A 2IL8A 4II2A 3ZYYX 1UD5A 4AYBB 3SK6A 1WTHD 2PZWA 1I50B 1AFPA 3PUWA 2Y0SB 4DN4M 4IQZA 1DYQA 2EZVA 3FRPB 2PPBC 4ZLTF 4TQUS 1BPLA 1WTOA 1CHPD 3NE5B 4P22A 3MVVA 3OIPA 4KN7C 4CGYB 1BO0A 3MWYW 1DM0B 3D4WA 2XZPA 1UUPA 5CMDA 4B9WA 1O78A 2EY2A 2EYJA 3H91A 2E1BA 3E5SA 1I8DA 4F88A 1GUTA 1AN8A 1PDQA 4YELA 2OEOA 1WD1A 4JBWA 1C8CA 3DEOA 1LV9A 1BMFA 2R9VA 1KNEA 3SK5A 1S5FD 1GUNA 4DAPA 2O2LD 3K58A 1J8IA 1EIGA 1Y1WB 1HFGA 1HVXA 5D65A 4YEJA 4WRDA 3LWEA 3DWPA 2C5CA 3BCDA 1KDCA 5G3LD 1W6KA 2BOSA 3FMCA 2RSNA 3ND9A 1CK1A 2X6YA 1PRTB 3H09A 1JOQA 1Q90A 4XL9A 2B2YC 1EWHA 1IHZA 1DZ1A 4XT3B 2ICIA 4P2CB 1G8ZD 1XXGA 2RDHA 1CZWA 4M1UB 4BBRB 5I6YA 1GOZA 1LTGD 5I2XA 5C3EB 1BOSA 3HG9A 5C44B 1I4XA 3OMGA 1PFMA 4FF3A 2WAQB 1R4QB 2X69A 4UZUA 1DOLA 5TSSA 3BZDB 3T53B 1Y8OB 1E2VA 3D6WA 3HOUB 4KMUC 2XSCA 2YU9B 4K2KA 3NP8A 1V0FA 2M9VA 2F0FA 2F0PA 5FL7A 4PNYA 2BA1A 4KKSA 4XXEA 3M7NA 3A3GA 1JCKB 1WTWA 1BLIA 5BN3A 3OAAA 2F0SA 3GTMB 3BH4A 1HTLD 4Q0FA 2W6JA 4G7ZC 5I9OA 4RA8A 3J80E 5F2DA 3KLSX 5C0XI 3K0YA 4KN4C 4IUTA 1EY6A 3NTIA 2A6ED 1WTQA 1V1PB 2DNCA 3HZXA 5KNBA 4BA2I 4QF4A 5E4WC 3S14B 1BXTA 1TWFB 1H9RA 4FF2A 2X6GA 2A5HA 4DU9A 3S2DB 2FFKB 3FDTA 1IYVA 4ZK9B 3HGBA 4F87A 2XZOA 3MAQA 4TSFA 2A68D 3MEHA 1F2MA 1VLYA 3LX0A 1K83B 4A3KB 3WOEA 1QE6A 2SOBA 2KECA 2WV6D 1XWEA 1SJED 4G7OC 2DIEA 5C4HA 2R7ZB 1SNOA 5LHY1 2MHVA 3D3RA 2HUGA 1G6ZA 1TIID 1JR0D 2A6HC 3NBHA 3HS0C 1HHVA 1CTMA 2J4XA 5T1GA 1F9SA 2HQEA 4ZYSA 2Z6BD 1EQVA 2Z1CA 1QILA 3N52A 3MXGA 1SSOA 2WACA 1PKVA 5CBEE 3V2TA 2VB3X 2JA8B 1TT2A 3E0JA 1RJTA 1O7YA 4RGMA 4XLFA 4E0FA 3EQLC 2RDGA 5DM73 1EZ6A 5D3DA 2Q8IB 4UDUC 3R2TA 4BY7B 3JU4A 4TSSA 5EBDA 1JQYD 4V190 1H8EA 4IUQA 2R3ZA 2KCNA 1TKWB 4OO1G 1DJRD 5CR3A 3ZIAA 3PUVA 2KJXA 4ID6A 4NDXA 4QUCA 5C4JB 2IPKD 3OOCA 1E43A 3CESA 4DA2A 4B3GA 1OXTA 1GUOA 3QJYA 3TP5A 4Z1MA 1RDPD 1SFOB 1PTOF 4KK7A 4ZUIA 1ENCA 1HA5A 2F3WA 3TN2A 4PMWA 5T1IA 1IL8A 1EL0A 1STHA 5M5WB 4C3IG 1KZLA 2ZXRA 2V7QA 4C2MB 4GQNA 2VJJA 3PIP3 1STYA 3TSSA 1I4GA 2WPDA 1TWAB 3DUZA 5K36G 2JYOA 3BDCA 1XYIA 2BDNA 1CM9A 3G6JB 3IFDA 2CQAA 4QMGA 1KLUD 4KY6A 3NQTA 1TS4A 3SR1A 5DN6A 5FO7B 2E2DC 3DM1A 2H1EA 5C3WA 3BC9A 3X3MA 2WP8J 1IW7C 4XDXA 2OT2A 1BCPB 1SNMA 2QKIC 1LT6D 2B8FA 3ONAB 3P1HA 3TZDA 2EYHA 3MFYA 2GA4B 2B2WC 2D9UA 1TS2A 1UD8A 4DGZA 2HLDA 1UD6A 4XQFA 4DK0A 3PO2B 5CV5A 3PO3B 2KOLA 4A3EB 3M4YA 4IZ8A 1HTPA 3TZUA 4IFDI 2V31A 1C48A 2RQXA 1BUVT 4X3UA 1COWA 4LJZC 1IKMA 1WCMB 2F0GA 3AB9A 5IGCA 2ZZQA 2BCOA 5CV4A 1CI3M 2A69D 2WINB 3SE0A 2SNSA 4EQPA 5HGTA 5CDFA 3T56B 1MGSA 2PNRC 5CV7A 3JAML 3K57A 2ZTGA 1HRJA 4X3KA 3CMMA 1HCZA 3MTSA 3URYA 3BVGA 1KMHA 3IKJA 1PZJD 2XIWA 4K5XA 5CGKA 1G91A 1A2TA 2Z8LA 3TP8A 4KV6A 1UAPA 2EVBA 2XNDA 2L0CA 3I70A 2GJKA 2XNAC 4G7HC 3RZOB 2K33A 1LLRD 2TSSA 3D8GA 1NR4A 4BY1B 5C3XA 1Y69U 5EQ0A 3V96A 3I4NB 4LAAA 2EY5A 2B2YA 3H3VC 2E2HB 1LACA 4H13C 1Q12A 3L3OC 4G4KA 5FO9B 1U4RA 3H6MA 2IW3A 1SYDA 1B3AA 1EIHA 1CFMA 1AZPA 3FKSA 1KTKA 1NAPA 4HMIA 3RD4A 2EJMA 4RGOS 1E3XA 3C1FA 1O7LA 4IUVA 3C3LA 3NHHA 5KYLA 4RFBA 4YIJA 4ZAIA 2YYZA 5C0XH 3HAGA 1VF5C 1S5DD 2X6LA 3U9OA 2EYFA 3KLSA 5C0XJ 1KDAA 2WKDA 4XN3A 2RA4A 4FO2A 2KCCA 4KKTA 3WOFA 1OO9B 5EGTA 1B2TA 2ENBA 5KNCA 2ZZEA 2PQEA 3A56A 3KF8A 3W3AA 3GTQB 4KY7A 2KQ3A 5ELBA 1F9PA 4HCEA 1SNPA 2KHSA 1JORA 4XLEA 5K36H 3KUPA 1JOKA 4ODGA 5IGBA 2F0NA 3SDZA 1L0XB 3X3NA 2ZXHA 5G3LF 2F3VA 4PV1C 4EQOA 4KY5A 2F0IA 1TR5A 5M9OA 3OMCA 3Q24A 2AQ2B 5KRUA 1IW7D 3GTLB 4AVZA 5D3IB 3I3CA 3K7AB 5EKLA 1QG7A 1CHQD 2OF1A 3S1QB 5HKKA 1O7ZA 5ELFA 3DXJC 2IT1A 1TS5A 2R6GA 2GJPA 4ZUJA 1HPCA 3BDLA 4C3JB 4A3DB 2X53S 1H9JA 4X3TA 2I07B 2L11A 5I2YA 3I72A 2X6WA 3I4LA 1H8HA 2M00A 3HOWB 5EBCA 1ENFA 3OSOA 4IUPA 2WZPP 1OHHA 4CHTB 1EY7A 1ESFA 4C56C 3Q6SA 2A69C 1LTID 1EY9A 2IX1A 4DAVA 1EEID 4K6LA 1R9TB 1PTOH 1VF7A 4XLHA 2F0WA 2DNEA 3PUXA 4BA1I 2B2UA 4H44C 4ILWA 2Z4IA 2B2VC 2NTSA 2XGJA 4Z9CB 5K5PA 1MI2A 2PW5A 1SYGA 2CK3A 2AQ3B 1OXXK 5CV8A 1W9XA 1SYBA 2EYMA 4JMQA 2FMCA 3VR6A 1LABA 5FK9C 3A55A 1ZKOA 4RGTA 3DDYA 1S5BD 1FYCA 3A7AB 5JPNC 3F2UA 3QIAA 2AWNA 4CBVA 1SNCA 1Z6HA 2M5SA 1S5ED 1G2SA 2LKVA 4U68A 1BDOA 1FGBD 1RF2D 4O1NA 3K5NA 1V43A 1EWCA 1FX0A 3S1NB 4KJOA 1FNVA 4K5VA 5FKAC 1GHJA 2RDFA 2B2UC 1F2LA 3NQIA 3SEBA 3WDNA 1KLGD 2K01A 3MZ5A 3NXWA 3GTJB 4OO1I 2QE7A 1D1IA 2AQ1B 3GV6A 1B50A 2NZ1D 1D1KA 1NUCA 4G57A 2FINB 2BDOA 3BYTB 2XOKA 2XN9C 4H7BA 3GVKA 3R3OA 4GZYC 2ICEC 4OGQC 2DN8A 3EA6A 4FXUA 3P75A 5M3MB 2Q8RE 4KJNA 1I4PA 4RH6A 1RCVD 3QOJA 4HIZA 1PFBA 1G2TA 1STNA 2AWOA 1TY2A 3M85A 3TMEA 4RKBA 1I18A 2XRSD 2MGSA 1HUNA 1TY0A 4BWGB 2WIIB 1ET6A 4RGNA 1A3TA 3IAYA 3S17B 1HA6A 4LK1C 2ZXIA 3M3YB 1LTBD 1Q3LA 3M7GA 5A2QL 3S9WA 2NUCA 5JEAH 1BF4A 2D62A 1HXYD 5JAVA 1U4LA 2F0OA 1B1ZA 4C3HG 3V05A 2JEBI 1A6XA 1PXUA 1VCIA 3BVMA 3KEWA 3GTPB 3H94A 2F0QA 4C1NI 1RTOA 5BN4A 2BE5D 1EOTA 2V4DA 1BCPC 5HURA 5M5XB 1HQMC 3I90A 4XQQA 1SDFA 1D5XC 2O5IC 5C6AA 5EKIA 4A93B 1BCPF 1E1RA 2NN6H 1SJHD 1F2ZA 5I6WA 2B2TC 1QJOA 2Z4HA 3RUZA 2NN6G 2JJ2A 3MXUA 1IKLA 4J6HA 1HFNA 3H0GB 3C46A 2PO4A 1V1PA 3NUCA 2JEAI 5KGUA 2F4IA 1W0KA 3TBIB 2JA6B 1SYFA 2F0TA 3RLFA 4TKOB 4XTCS 5EPKA 3JAME 4ZKBB 1TQOA 2PZUA 3FVQA 1JWSD 1X32A 4L8JA 2K32A 3GVLA 4XORA 3VYTA 2QCPX 5IIFA 1CT1D 1A2UA 4A3GB 4IUNA 1R4PB 5IK2A 1ICWA 3D31A 3HOYB 2EJGC 4ASUA 3NWSA 4RHSA 2A6EC 2ZT9C 1A3VA 2FHTA 3BYYB 2A74C 1SXTA 4PMCA 3OPOA 4XOTA 4XKVA 4MHEA 3VA5A 4J8QA 2D3NA 5KEEA 2HDMA 4OHJA 1D5MC 5FOBB 2E2IB 4DNTB 2NVTB 4G7XA 2KUMA 5KYIA 1AEXA 1QWYA 1UD4A 3A8IE 1HQRD 2ID0A 4XLAA 4BS9A 1PZID 1QNUA 3CKIB 2CW0C 3CQZB 2L9HA 1Z7TA 4R8IA 1PZKD 1RD9D 1JC7A 3ITPA 1F2YA 4A3IB 1Q1BA 3AU7A 1UNSA 2F0MA 1A3UA 3R8BA 2J7ZA 4E6IA 1PFNA 2MP1A 5KNDA 4DAYA 2JP1A 2FMMA 2A68C 2JE6I 1MD2D 4RCOA 1WP6A 2DY7A 1EY5A 3GD7A 3S15B 5J1ZA 1NSNS 2B8GA 3W2DA 3P7JA 2GK7A 1EFRA 4OIKA 3RZDB 4XMYA 5LL6S 3EVQA 4DXFA 3DHQA 1CQFA 5C4ZA 3VR2A 4DXGA 3VR4A 4KD4A 2R93B 2K5QA 5JJZA 2F03A 1SNQA 2E75C 4K5WA 4G7WA 2CW0D 3CHBD 4ME5A 1V8QA 2IX3A 4FF4A 1Y1VB 2NTTA 3SXHA 2NN6I 1BQQT 2B2WA 1ONLA 3VR3A 1VMPA 4K6DA 2JXMB 3T4AC 1STBA 1GUGA 2XZLA 1ML0D 1NCVA 2F0EA 3MHBA 2IX0A 2G9HD 3P20A 4OO1H 3S2HB 2K1BA 3OEHA 3QB3A 3KBGA 1WTRA 1STEA 3EJIA 5DAUA 1XX8A 3VYUA 2B2VA 2HCCA 1U4MA 4B9XA 4UAIA 2DY8A 4XQJA 3DMUA 1BBXC 4WFN3 1KNAA 3NPPA 4DF7A 2F43A 2J0TD 5M5YB 4XR6A 3DWAA 3J81L 2NVQB 4LMQD 3MC0B 1YNND 4XYOA 3HEJA 1FNUA 4IFDG 4DNRB 3MXNA 1E3ZA 3EROA 3KLRA 1PMRA 1SYEA 5E1FA 2VJIA 3GVJA 3HOZB 4N9TA 2B39A 4XOPA 1WTXA 2LY7A 2WJVA 4HSPA 1YNNC 4QIWB 1S4ZA 2C9OA 2E2JB 3QG1A 3Q23A 4CKCA 5CV9A 4H0LC 2R61A 3G05A 3IL8A 2HCIA 1NR2A 1EZ8A 2R92B 1STAA 3FKIB 5EPLA 3J80L 2K5WA 1LT5D 1DCZA 3U9SA 2KA7A 4KHVA 5IGDA 3NTKA 1KDBA 3NSWA 5COYA 4RKLA 1EU3A 2NYZD 4FP5D 3OEEA 1LT3D 2NVYB 4QCLA 5ISRA 5I4DA 3M4OB 1V1OA 2L4NA 1SMYD 4XT1B 2O4XA 4JK1C 1MABA 3GTGB 2NBFA 1ZXTA 3A35A 1M4VA 5IGGA 4TT3A 1DOKA 4HN7A 2A73B 2XWBB 2L1BA 4KD3A 1EFID 1TVXA 1FNWA 2ZTNA 5C0XG 2VNUD 4HEDA 1LTSD 3HOVB 1GJXA 4RAUC 4EQNA 4K8IA 2RSOA 3FEWX 4PQXA 3A7LA 1ZYRD 2PW7A 4C3HB 1CQVA 2L5TA 3S16B 5CV6A 1E2ZA 1AZQA 1Y8PB 1EY8A 1OB0A 1SMYC 4XYQA 1H9SB 3FPUB 1I6VC 3DWQA 4G6IA 1QCBD 2EYPA 1W6JA 2JA5B 4ABNA 1JE4A 3SHLA 1SBBB 3J81E 2B2TA 1MBYA 1STGA 3GQBA 2EYOA 4FNFA 1BNZA 1RTNA 2RVLA 3O13A 4C3JG 4A3FB 4DFAA 4FF1A 5JVH3 2KVOA 2KEEA 1BR9A 2F0HA 4CJ2C 2K03A 5C4XB 1TWHB 2H4OA 4EGVA 3TDQA 2F0UA 3I4MB 4RCNA 3I73A 3CP2A 5M3FB 4XKWA 5EKKA 1WD0A 1LTRD 2I46A 1GHKA 3OIQA 2L55A 4CKEA 4HTHA 4OL7A 4Q5VA 2KVMA 1ESRA 4C3IB 3CRLC 3T13A 1QOHA 1CA5A 3J7AF 5JEAG 2QF7A 3HRZC 3VYSA 1M8AA 2KEDA 1H9KA 3I91A 2MUYA 3Q0AA 2NB0A 5ELDA 1Y8NB 3ZPNA 4A3JB 4RWSC 1QNKA 3FPPA 4II3A 3GTKB 4B08A 1EQTA 3AMUA 4CJ1B 4RHRA 4KI0A 4IFDH 2WSSA 5CBAE 3R2IA 3Q22A 4XD7A 5A35A 3BDOA 2GK6A 3QWNA 2BA0A 1B9NA 1X3PA 3E6ZX 3BCFA 1KAAA 5C5LA 3A8KE 1QB5D 4X3SA 4WJWA 1E0BA 1B4OA 3KBXA 3DEPA 2WKCA 5ELCA 2K5DA 4FYDA 1CZGA 2RKSA 3HOXB 1WVLA 4TRDA 2PMZB 4Y7NB 2EJFC 1K8OA 4XONA 3J7YW 4A3BB 3BVZA 2O5JC 1D2BA 2L12A 5J39A 4C1NK 1WTVA 2QILA 1X3QA 1U9RA 4NMZA 4FXGC 1PTOB 2TMPA 1I3QB 2MPMA 1C4QA 1JOOA 2F0LA 2X8KA 3LNNA 4J1MA 1EY4A 5ELEA 4FXDA 1I4HA 2K04A 2QDBA 2ZXPA 5CORA 5DNFA 1B53A 1SYCA 2EY6A 3SK8A 2G9DA 2EDGA 3PV0A 1OXVA 4OIJA 4MIUA 4NNJA 4IUUA 2VB2X 4U673 1U4PA 1E1QA 2PCFB 4K8JA 3C1EA 4HCSA 1JWMD 4ZKCB 1AW7A 1T5EA 1F9RA 2IJ0A 3A8JE 3J7AV 1F9QA 3L7ZC 1L0YB 4FXKC 4M8AA 5JEAJ 2LFNA 4B3FX 2EOTA 3TP7A 1AP0A 1BCPD 2F0DA 4R9WA 5AFWA 1VDZA 5IGEA 4KHZA 3GO5A 2Q8TA 1DOMA 3HP3A 5KNLA 4N9PA 5E3FA 3D6CA 1GUWA 4I7ZC 5C5MA 1K8MA 2NVXB 3D4RA 4XM3A 1EYAA 1LO5D 2ZXOA 1ILQA 1B9MA 4IURA 3T51B 1H9MA 3VA7A 4XN0A 2LMCB 1CA6A 1H9SA 2JA7B 3A3BA 3OW7A 4O42A 5BN5A 1O80A 2EY1A 3CU7A 1K28D 1ILPA 3G7LA 2F0JA 1SE2A 2D3LA 1E2WA 2E76C 2XRQD 4HMJA 1RHPA 3R93A 1VMCA 3GP7A 4CJ0B 2CVRA 3PMFA 5I9PA 3TP6A 1DONA 2N88A 1UD2A 1ET9A 1FD7D 4K14A 4EVOA 2XVSA 2QEJC 2VUMB 2SDFA 3MA2B 1PTOD 2ZZGA 2EYLA 2SEBD 3BS1A 5J22A 4A3MB 1OXUA 4KTAA 1RKNA 2MJ8A 1ZEQX 2GJRA 2AUKA 1PYWD 3NWTA 5D14A 5DEHA 5JPMC 1GXDC 1SE4A 2WB1B 4QUFA 3NBIA 2WJYA 4F7XA 1J9OA 1SKYB 3OWFA 2PYKA 3S1MB 1JICA 2K7VA 1A15A 1Z47A 3OWEB 5DM63 2F0VA 3K59A 3NTHA 4KKUA 5EJWA 4I65A 1V0EA 1RODA 2EXZA 2W6IA 1D6EC 1FR3A 2BE5C 4L6TB 3GV3A 1S5CD 1B44D 3ND8A 2FJ2A 4NW2A 3VR5A 2AUJD 1DXMA 1VJSA 1LTTD 5EPJA 3PIO3 1W0JA 1EY0A 2N55A 3MXPA 1PLFA 3WQZA 1EEFD 3K6OA 4YXWA 4K2LA 2CHBD 3MFGA 1UD3A 1ZYRC 4CKBA 3A54A 3K5LA 5FLXL 3KK7A 1E79A 2PZTA 4HR7B 1T5XD 2JIZA 2M2LA 3OHXC 5FLXE 1XTCD 4L63B 2RBMA 5IT9E 1EU4A 5NUCA 3ERQA 1UEAB 5IOCA 4XLCA 3LWUA 1Q1EA 5IT9L 1KABA 1HUMA 3OE7A 1PTOC 1JB3A 2JDIA 4IALA 3SK4A 3PUZA 4F8MA 1WPCA 1ENAA 2A6HD 4PMBA 1TU2B 1NBMA 3K5MA 1DD2A 1II3A 5CC4A 1LT4D 4HAEA 1EYCA 1TS3A 1IYUA 3D4DA 5A2QE 2E74C 3C2PA 2K28A 2B63B 1F77A 1PRTC 3EFXD 3OFNA 2JJ1A 4ZRZA 4QB4A 3NK9A 1SNDA 4ULLA 1SEBD 3T16A 4NKLA 3CP8A 5IODA 4BBSB 3GTOB 4IFDJ 3HKZB 1PRTF 3S1RB 4WORA 4FVMA 1NRKA 3RMHA 4ZQ3A 1SE3A 3I8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  1B9N A;  1CTM A;  5K36 H;  2PPB C;  3D31 A;  1YNN C;  3ND8 A;  4LK1 C;  2EJG C;  1LAB A;  4TQU S;  3VR6 A;  3VR5 A;  3QG1 A;  2AUJ D;  2A6H C;  3NE5 B;  1DXM A;  3A8K E;  4I7Z C;  1K8M A;  1ZKO A;  4G7H C;  3D4R A;  4H0L C;  2E75 C;  3T53 B;  2A6E C;  4KN7 C;  2K33 A;  1Y8O B;  1E2V A;  2ZT9 C;  3SDZ A;  4DK1 A;  1G29 1;  4KMU C;  5JEA H;  1IW7 C;  2D62 A;  1B9M A;  3OPO A;  3T51 B;  1FYC A;  1H9M A;  3A7A B;  3VA7 A;  1Y69 U;  3QIA A;  1O78 A;  3PUY A;  2LMC B;  1V8Q A;  3GQB A;  1H9S A;  1Z6H A;  1ZYR C;  4PV1 C;  3OW7 A;  1DCZ A;  1BDO A;  2B8F A;  5BN5 A;  2BA1 A;  2D5D A;  1V43 A;  4KKS A;  2JEB I;  3M7N A;  1A6X A;  3U9S A;  4DNT B;  2NN6 I;  1VCI A;  2KA7 A;  5BN3 A;  1ONL A;  3MFY A;  3VR3 A;  1IW7 D;  1GUT A;  4HR7 B;  3EQL C;  1LAC A;  2EJF C;  1E2W A;  2JXM B;  2E76 C;  1K8O A;  4H13 C;  3H94 A;  1Q12 A;  1GUG A;  2O5J C;  4JBW A;  4DK0 A;  1GHJ A;  5BN4 A;  2Q8I B;  4G7Z C;  3A8I E;  3BG3 A;  3WDN A;  3P20 A;  4OO1 H;  2BE5 D;  1CFM A;  3M4Y A;  2V4D A;  4KN4 C;  3N6R A;  4RCN A;  1GUN A;  1HTP A;  3I73 A;  3DXJ C;  1Q1E A;  3LWU A;  2IT1 A;  1TKW B;  3TZU A;  2D2C C;  2R6G A;  4OO1 G;  1HPC A;  2CW0 C;  3LNN A;  4IQZ A;  2EJM A;  3PUV A;  2A6E D;  4LJZ C;  1GHK A;  1HQM C;  1O7L A;  1H9J A;  4JK1 C;  1Z7T A;  2O5I C;  3OOC A;  2DNC A;  5KNB A;  4BA2 I;  3PUZ A;  3AB9 A;  1OXS C;  4XIG S;  1OXU A;  1OXT A;  2EDG A;  1GUO A;  2BDO A;  2NN6 H;  3PV0 A;  1OXV A;  3I72 A;  2A6H D;  1H9R A;  3QJY A;  1TU2 B;  2YYZ A;  3I4L A;  2F1M A;  1CI3 M;  2A69 D;  1GUS A;  1QJO A;  1DD2 A;  3SE0 A;  2AUK A;  5C0X H;  1Q1B A;  3CRL C;  2NN6 G;  1VF5 C;  3FMC A;  3MXU A;  5JEA G;  4GZY C;  3T56 B;  2QF7 A;  2PCF B;  3IFT A;  2PNR C;  1H9K A;  4OGQ C;  5C0X G;  1IYU A;  2DN8 A;  3ND9 A;  2E74 C;  1Y8N B;  1YNJ C;  2KCC A;  1GJX A;  5KND A;  2JEA I;  1Q90 A;  1IYV A;  4KKT A;  1T5E A;  3HGB A;  1HCZ A;  1EWH A;  2A69 C;  2A68 C;  2JE6 I;  3RLF A;  4TKO B;  3A8J E;  3A7L A;  3FPP A;  4XTC S;  3GD7 A;  1VF7 A;  2L5T A;  3CRK C;  2AWO A;  2B8G A;  2A68 D;  3IKJ A;  5KNC A;  4IFD G;  2DNE A;  2K7V A;  3M85 A;  4DNR B;  1E2Z A;  3PUX A;  3W3A A;  3L7Z C;  2K32 A;  4L8J A;  4BA1 I;  4KI0 A;  1Y8P B;  4H44 C;  4IFD H;  4G7O C;  1SMY C;  2BE5 C;  3KLR A;  1PMR A;  1H9S B;  4KKU A;  3PUW A;  1I6V C;  5K36 G;  2EVB A;  3VR2 A;  5A35 A;  3BDO A;  1VDZ A;  3VR4 A;  4KHZ A;  1FR3 A;  1OXX K; 
#chains in the Genus database with same CATH topology
 1LTA D;  3QR8 A;  1MSG A;  3UI2 A;  1K8A D;  4OXP A;  2SNM A;  5GQO A;  2K05 A;  3AVU A;  2LZJ A;  5M5Y H;  4EH1 A;  3AVT A;  1B7Y B;  2YWF A;  5FJ8 H;  1MSH A;  4HJ7 A;  4RD1 A;  1TWC B;  5JOB A;  4DK1 A;  1G29 1;  2K6A A;  2AKW B;  2IWH A;  3W5V A;  2HMA A;  2ZZF A;  1QGA A;  4XNF A;  3G71 B;  1EYD A;  3PQI A;  3SVM A;  5JVG 3;  1VQ5 B;  2I5H A;  4A3D G;  2G5D A;  2EPB A;  3PUY A;  1NMF A;  1N8R C;  2ATW A;  2HDL A;  1SAP A;  3PA2 A;  5LL6 X;  3J7Z C;  3SLD A;  3E9I A;  1AIP A;  3OP1 A;  3M3Y H;  4A3G G;  5JBQ A;  1L1O B;  1D5Z C;  1JWU D;  2D5D A;  3K5O A;  3B82 A;  1I5F A;  4IN3 A;  4LFA Q;  4DR5 L;  1I94 Q;  5HY6 A;  3OTO L;  4HSV A;  4NCN A;  3HKZ E;  2ZM6 Q;  5TY0 A;  5FO8 B;  4R8N A;  1QZG A;  2QDL A;  4DR5 Q;  1WTP A;  3F2D A;  3BG3 A;  2LS0 1;  2OXP A;  3SJZ A;  1I4Q A;  1YHB A;  4A3F H;  3N6R A;  1YNJ D;  1PRT D;  3CAM A;  3L9A X;  2D2C C;  4JI5 Q;  2F0K A;  4XQN A;  3GTQ H;  2XWJ B;  4OON A;  3ONY A;  3CME A;  1VQ4 B;  1I4R A;  4X8I A;  3QO2 A;  4A76 A;  1VQ7 B;  1YHA A;  1K9M D;  1I6H H;  1RL2 A;  1TXY A;  1KIX A;  3VYR A;  3QOL A;  1OXS C;  1R5O A;  2JSO A;  4V0B A;  4XIG S;  1OB5 A;  1N08 A;  5IGF A;  3H3V I;  1Q8I A;  2DGY A;  2NWG A;  4JOI C;  4DUY Q;  3CCM A;  2V7W A;  2ZIT A;  2F1M A;  2X85 A;  2N78 A;  1GUS A;  5KIX A;  4MN3 A;  1HZE A;  2VXW A;  3IFT A;  1I6H B;  5E4X A;  4UP7 A;  4ALP A;  1SMX A;  1TWG B;  4S3S A;  3KL9 A;  2HDN B;  1YNJ C;  4JI8 Q;  5CYU A;  4NP5 A;  1SR3 A;  1XQB A;  3K7U C;  4C3I H;  2UXD L;  2X6X A;  5AJ3 Q;  3CRK C;  2EE1 A;  1X55 A;  1WCM G;  2IL8 A;  4II2 A;  2OTJ A;  1KRH A;  3ZYY X;  1UD5 A;  1BBU A;  4AYB B;  4X6A H;  4UY8 C;  3SK6 A;  1V5V A;  1MJC A;  1WTH D;  5DS0 A;  1XE1 A;  2PZW A;  1I50 B;  3I56 B;  2Z9H A;  5C4J H;  1AFP A;  3HOX G;  5JJK A;  1XMQ Q;  4Q7J B;  3PUW A;  4L5R C;  2Y0S B;  3CMA B;  4DPG A;  4DN4 M;  2JA9 A;  3CCS A;  4IQZ A;  4ZCM A;  1DYQ A;  1Q82 D;  3BZC A;  1E24 A;  2EZV A;  3FRP B;  2PPB C;  4ZLT F;  3CCJ B;  3BNW A;  4TQU S;  1BPL A;  3KJP A;  1WTO A;  1D7Q A;  1CHP D;  3NE5 B;  4P22 A;  3MVV A;  3OIP A;  2NVT H;  4KN7 C;  4Z4T A;  2CFM A;  4CGY B;  4L5S A;  4LNQ A;  1BO0 A;  3CF5 A;  2V7T A;  3MWY W;  3WNB A;  1DM0 B;  1GD7 A;  1BJK A;  2XZP A;  1O7I A;  1UUP A;  2VZA A;  3D4W A;  4B9W A;  5CMD A;  4A3L G;  1O78 A;  2B5O A;  2BN4 A;  2EY2 A;  2EYJ A;  1MJE A;  4K1X A;  4LF7 L;  1ELO A;  1WOP A;  3H91 A;  3PUM A;  2JA6 G;  2E1B A;  3E5S A;  1K0S A;  1U5K A;  2F4V L;  1I8D A;  3MXN B;  4B47 A;  3A8J A;  3W2E A;  4F88 A;  4RG1 A;  4ACB A;  1AN8 A;  1GUT A;  2VNI A;  1PDQ A;  3SLN A;  3G6E B;  4HIK A;  4YEL A;  4OPO A;  2OEO A;  3GTO H;  4RM0 A;  3AVW A;  2CKZ B;  1WD1 A;  4FDB A;  4JBW A;  1C8C A;  3DEO A;  1LV9 A;  2Y0S E;  2YTY A;  1PYB A;  3F1Z A;  1OTC A;  1BMF A;  2R9V A;  1G7T A;  1K8G A;  1KHI A;  1KNE A;  1HR0 Q;  1VQL A;  3CC4 B;  3SK5 A;  5J3O A;  1S5F D;  2WFW A;  1GUN A;  1AE3 A;  3B78 A;  4GKJ L;  4DAP A;  2O2L D;  4Y9R A;  3K58 A;  4DV7 Q;  1J8I A;  4UZF A;  1Q86 D;  1N07 A;  4CDC C;  1EIG A;  1JJG A;  3JQR A;  1Y1W B;  1HFG A;  1HVX A;  2X0K A;  2GRE A;  5D65 A;  4YEJ A;  2OCE A;  1VQB A;  3HOZ H;  3GIR A;  1CKN B;  4WRD A;  3LWE A;  1IYJ B;  1U0L A;  3DWP A;  1D2E A;  2ES2 A;  2C5C A;  4PG3 A;  4BPR A;  2BH8 A;  4M1K A;  3BCD A;  1KDC A;  1X3F A;  5G3L D;  3ONU A;  4QV2 A;  4LUV A;  3S15 H;  4B3M L;  1W6K A;  2BOS A;  1G51 A;  5LMU Q;  3ICE A;  3FMC A;  4IPC A;  2XEX A;  4JI0 Q;  2RSN A;  2UUA Q;  3ND9 A;  1CK1 A;  2X6Y A;  1PRT B;  3PO2 H;  3OYY A;  4X62 Q;  2CND A;  1WSR A;  3H09 A;  1JOQ A;  1Q90 A;  4XL9 A;  2B2Y C;  1VQF A;  1EWH A;  4QVA A;  1IHZ A;  1XNR Q;  1DZ1 A;  1QUQ A;  2EIF A;  4XT3 B;  2ICI A;  4P2C B;  1W35 A;  1G8Z D;  1XXG A;  1FNB A;  2RDH A;  2AHO A;  2LSS A;  4O2D A;  4X66 Q;  1CZW A;  4M1U B;  4BBR B;  5I6Y A;  4YWL A;  1GOZ A;  1LTG D;  2K4K A;  5H1S E;  5I2X A;  5C3E B;  4A3M G;  2ASB A;  1XNR L;  1BOS A;  3HG9 A;  1S3O A;  5C44 B;  4IJH A;  2JA7 G;  2DEU A;  1I4X A;  3OMG A;  1HNW Q;  1PFM A;  4YCV A;  1EQQ A;  4AQY L;  4FF3 A;  2WAQ B;  1R4Q B;  2HHH Q;  4P6V F;  2X69 A;  4UZU A;  1YHQ B;  3Q6R A;  1DOL A;  5TSS A;  3T53 B;  3BZD B;  5J3B A;  1Y8O B;  1E2V A;  3D6W A;  3HOU B;  4KMU C;  2XSC A;  2YU9 B;  4K2K A;  4RD0 A;  3NP8 A;  1V0F A;  4YHH Q;  4A3J H;  2M9V A;  1QG0 A;  2YWG A;  4JVZ A;  2F0F A;  1E62 A;  1QZH A;  5TR9 A;  1QVG A;  2F0P A;  5FL7 A;  4PNY A;  2BA1 A;  2VY3 A;  1UE1 A;  4KKS A;  4XXE A;  3M7N A;  3A3G A;  1JCK B;  1WTW A;  1BLI A;  5BN3 A;  3OAA A;  2F0S A;  4JI4 L;  4A3E G;  1L1O C;  3CMA A;  1FL0 A;  3GTM B;  3BH4 A;  3L2P A;  1HTL D;  3WYA A;  4Q0F A;  2BSA A;  1PH4 A;  2W6J A;  1PH1 A;  3HOY G;  4G7Z C;  5I9O A;  4RA8 A;  3J80 E;  5F2D A;  3KLS X;  5C0X I;  1DAR A;  3K0Y A;  4KN4 C;  3HOY H;  1S40 A;  1EWY A;  3WBK A;  1K3R A;  2VZL A;  5M5W H;  2HT1 A;  4M53 A;  4IUT A;  1EY6 A;  1VQN B;  3NTI A;  2A6E D;  1EFU A;  4R4O A;  4RD2 A;  1WTQ A;  4YAL A;  1GO3 E;  1V1P B;  2DNC A;  3HZX A;  3S1Q H;  5KNB A;  4BA2 I;  2HCJ B;  4B3R L;  1ZM3 A;  4QF4 A;  5E4W C;  1VQM A;  3S14 B;  1BXT A;  3STB D;  4DNI A;  1TWF B;  1H9R A;  1S72 B;  4HID A;  1YIT A;  2UU9 L;  4FF2 A;  4DV3 Q;  2Q6I A;  4DK3 C;  3K80 C;  4P72 A;  4Y7N H;  5KSW B;  3I55 B;  2X6G A;  4B44 A;  2A5H A;  1HNX Q;  4DU9 A;  4JI3 Q;  3S2D B;  2FFK B;  3CCQ B;  3FDT A;  4BXX H;  1IYV A;  1SM4 A;  4ZK9 B;  1VQ7 A;  4GKK L;  3HGB A;  4F87 A;  1G6P A;  3R6J A;  2OQ0 A;  3A0J A;  4QL5 A;  4RPB A;  3CW2 C;  2XZO A;  3MAQ A;  4BXX G;  4TSF A;  3G6E A;  4BBS G;  2A68 D;  3MEH A;  1F2M A;  4B3T Q;  1VLY A;  3LX0 A;  1K83 B;  4A3K B;  3WOE A;  1QE6 A;  2D74 A;  2SOB A;  2KEC A;  2WV6 D;  4POG A;  1UMK A;  4P2N A;  1SJE D;  1XWE A;  4GKK Q;  2DIE A;  3S2D H;  5C4H A;  2R7Z B;  4G7O C;  1SNO A;  2OBS A;  5LHY 1;  2MHV A;  2D0P A;  3D3R A;  1N34 Q;  5HXB A;  2HUG A;  3T1Y Q;  1G6Z A;  1IXR A;  1TII D;  3VDY A;  1JR0 D;  2A6H C;  3NBH A;  3A5Z B;  4YHH L;  3HS0 C;  1P16 A;  1HHV A;  1CTM A;  2J4X A;  5T1G A;  1Y14 B;  1F9S A;  4LFB Q;  2VBU A;  2HQE A;  2R7Z G;  4ZYS A;  2Z6B D;  3W5H A;  5H59 A;  1WOS A;  3ASQ A;  1EQV A;  2Z1C A;  4R1J A;  1QIL A;  1YX2 A;  3N52 A;  4B4D A;  1SSO A;  3AFQ A;  3MXG A;  2WAC A;  1PKV A;  3W5O A;  5CBE E;  3UDX A;  3V2T A;  1YIJ B;  2VB3 X;  2N49 A;  2JA8 B;  1TT2 A;  2YTX A;  3E0J A;  1RJT A;  1O7Y A;  4RGM A;  1C0A A;  4XLF A;  2OTJ B;  4E0F A;  1YJ9 A;  3EQL C;  4AF6 A;  3A5U A;  2HIX A;  2RDG A;  1W34 A;  5DM7 3;  5GRO A;  4PAA A;  2CRV A;  4POF A;  1EZ6 A;  5D3D A;  3OZW A;  3ZC3 A;  3R2T A;  4UDU C;  2Q8I B;  4BY7 B;  4FK8 A;  3JU4 A;  4TSS A;  5EBD A;  1JQY D;  2A19 A;  2QW7 A;  1H8E A;  4IUQ A;  4V19 0;  2E8G A;  2QA4 B;  2R3Z A;  1Q8K A;  4LF4 L;  2AHO B;  5DLQ E;  2KCN A;  4YAO A;  1YLO A;  1TKW B;  5F4M A;  4OO1 G;  1DJR D;  1ZUN B;  5CR3 A;  3ZIA A;  1EP2 B;  3PUV A;  2KJX A;  1KK0 A;  4ID6 A;  4A3C G;  1VQ6 B;  4NDX A;  4QUC A;  5C4J B;  2IPK D;  3OOC A;  1E43 A;  1IB0 A;  3CES A;  1KRT A;  4DA2 A;  4A3C H;  4B3G A;  1A63 A;  4KLK A;  1OXT A;  1GUO A;  3CP0 A;  3QJY A;  3TP5 A;  4Z1M A;  1RDP D;  3A1P A;  3TEH B;  1SFO B;  1PTO F;  4G5G A;  1E1O A;  3AQQ A;  1OB2 A;  4KK7 A;  1K9M C;  4C3H H;  4ME3 A;  3S16 H;  4DAM A;  1IBK L;  4ZUI A;  1PJ5 A;  1ENC A;  3KDF B;  1N33 Q;  1HA5 A;  2F3W A;  4A3J G;  1JB7 A;  3CPX A;  3TN2 A;  4RLZ A;  4DV6 L;  4PMW A;  3S2H H;  4CQJ A;  1GR1 A;  1IL8 A;  2WB1 E;  5GV8 A;  5T1I A;  4JBM A;  1EL0 A;  3U6K A;  1STH A;  3I4N H;  4RCZ A;  5M5W B;  4C3I G;  1KZL A;  2ZXR A;  2V7Q A;  4C2M B;  4GQN A;  2VJJ A;  1M90 D;  3PIP 3;  4K0K L;  5M3M H;  1STY A;  2CH4 W;  2N3S A;  5F4O A;  1I4G A;  3TSS A;  5BR8 Q;  2WPD A;  1TWA B;  4DR1 Q;  2QTZ A;  3DUZ A;  1UE7 A;  4A3M H;  4JI5 L;  5K36 G;  2JYO A;  3BDC A;  4NXN L;  1XYI A;  2BDN A;  1CM9 A;  3G6J B;  3IFD A;  2CQA A;  4NB3 A;  1I3Q H;  4QMG A;  3OJX A;  2KCT A;  1KLU D;  4KY6 A;  1IL2 A;  3NQT A;  1TS4 A;  3SR1 A;  5DN6 A;  2ZM6 L;  5FO7 B;  4YWK A;  2E2D C;  3DM1 A;  2NVQ H;  2H1E A;  4X65 L;  4M4S A;  5IWA Q;  5C3W A;  3BC9 A;  2CH4 A;  3X3M A;  2WP8 J;  1IW7 C;  2GQF A;  2Q2T A;  4XDX A;  4LWC A;  2C2W A;  3CPF A;  1WI5 A;  2OT2 A;  1BCP B;  1R9T H;  1K8A C;  2GPJ A;  1IBM Q;  3ZZT A;  1H85 A;  1SNM A;  2QKI C;  2DY1 A;  3W5U A;  1LT6 D;  2B8F A;  3ONA B;  1XJV A;  2BH2 A;  4HE5 A;  1QFY A;  3RLN A;  1J5E L;  3P1H A;  3TZD A;  3DM3 A;  2N8N A;  2EYH A;  2BPO A;  3KF8 B;  1L1O A;  3MFY A;  2GA4 B;  2B2W C;  2D9U A;  1N32 L;  1B70 B;  1TS2 A;  1UD8 A;  4DGZ A;  2HLD A;  1UD6 A;  4XQF A;  1VQK B;  1EYG A;  4DK0 A;  3PO2 B;  1E64 A;  5CV5 A;  5A8A A;  3PO3 B;  1PVO A;  2PI2 E;  2KOL A;  4A3E B;  4MNO A;  4DR3 Q;  1W87 A;  1WCM H;  4OWT B;  2OK8 A;  4O0A A;  1KK1 A;  3M4Y A;  3RN2 A;  4IZ8 A;  1HTP A;  4TMX A;  3GSI A;  4WJ4 A;  3TZU A;  2CW5 A;  3OW2 B;  2V31 A;  1C48 A;  3Q8D A;  2RQX A;  4IFD I;  4JV5 Q;  2ZBU A;  1BUV T;  5IYD G;  2EFG A;  2UUC L;  4X3U A;  1COW A;  4LJZ C;  5THX A;  1IBK Q;  1IKM A;  1WCM B;  1YNX A;  3UE1 A;  2QDX A;  2F0G A;  3AB9 A;  5C44 H;  5IGC A;  2ZZQ A;  2BCO A;  5CV4 A;  1CI3 M;  2A69 D;  4DV5 Q;  2WIN B;  3SE0 A;  1WFQ A;  2B7B A;  4GNX A;  2SNS A;  4EQP A;  5HGT A;  5CDF A;  1HH2 P;  3T56 B;  4RMF A;  4LC0 A;  4A3K G;  1MGS A;  4LF7 Q;  2PNR C;  1KC8 D;  4DQL A;  3UDI A;  5CV7 A;  3JAM L;  3K57 A;  1I94 L;  1AMO A;  5FLM G;  4LFA L;  2R93 G;  3G71 A;  2ZTG A;  2UXB L;  4IPG A;  1HRJ A;  3E20 A;  4DQK A;  4X3K A;  3CMM A;  3I4N G;  3CRZ A;  1HCZ A;  5BR8 L;  3B8H A;  3MTS A;  3URY A;  3BVG A;  5FLM H;  5FIU A;  1Y1V H;  1KMH A;  1XMO L;  3IKJ A;  1PZJ D;  1KD1 C;  2XIW A;  3T1H L;  4K5X A;  1M1K D;  5CGK A;  1G91 A;  2I5M X;  1A2T A;  2Z8L A;  3TP8 A;  1YIJ A;  1PH5 A;  4KV6 A;  1FJG Q;  1UAP A;  2EVB A;  2XND A;  2RF4 A;  2L0C A;  2D0O A;  2NV4 A;  1T6Z A;  3I70 A;  1ZM9 A;  2GJK A;  1N0V C;  2F52 A;  1FRQ A;  2XNA C;  2V7X A;  2NZH A;  1N36 L;  1KRS A;  1YZ6 A;  4G7H C;  4C0S A;  3RZO B;  2K33 A;  1LLR D;  2TSS A;  3D8G A;  2CQO A;  3HOV H;  1NR4 A;  1HR0 L;  5IYC H;  4BY1 B;  4A3B H;  5C3X A;  1Y69 U;  5LMU L;  3W1G A;  5EQ0 A;  4H02 A;  4OX9 Q;  1XMQ L;  3V96 A;  3PA1 A;  2Q2H A;  2V7U A;  3S14 H;  1EWI A;  3I4N B;  4JC0 A;  4LAA A;  5F4J A;  2B29 A;  4MYT A;  2EY5 A;  1TUI A;  2QMU A;  2DYI A;  2B2Y A;  3CC2 B;  1EQR A;  2OBR A;  3H3V C;  2E2H B;  1LAC A;  2GN5 A;  3D0F A;  5GAE C;  1CSP A;  4H13 C;  5AJ3 L;  1Q12 A;  3CQZ H;  3L3O C;  4G4K A;  3S1R H;  5FO9 B;  4X0C A;  4R71 A;  4YAU A;  1U4R A;  3H6M A;  2IW3 A;  1SYD A;  1P4M A;  4DKA C;  1B3A A;  1EIH A;  5LMN L;  2JA5 H;  5IYW A;  1CFM A;  1FVI A;  1AZP A;  3S1M H;  3FKS A;  1KTK A;  1G7C A;  4P1V A;  3CXC A;  1JMC A;  1NAP A;  4HMI A;  5L46 A;  3RD4 A;  1BX1 A;  2EJM A;  4RGO S;  1DDG A;  1E3X A;  3CCM B;  1YJW B;  2PI2 A;  3C1F A;  1O7L A;  2R7Z H;  4IUV A;  1YI2 A;  3C3L A;  2XNJ A;  3NHH A;  1DGS A;  5KYL A;  2VUM G;  1PJ7 A;  1DG1 G;  5IT9 c;  2VQF L;  4RFB A;  4YIJ A;  4ZAI A;  2YYZ A;  2WAQ E;  4ACA A;  2E5L Q;  3FP9 A;  5C0X H;  3HAG A;  1VF5 C;  4JI1 L;  1HZ9 A;  1S5D D;  2X6L A;  3U9O A;  2EYF A;  3HFZ B;  3KLS A;  2UXC Q;  5C0X J;  1KDA A;  2WKD A;  4DR4 Q;  4XN3 A;  2RA4 A;  4FO2 A;  5C4X H;  2KCC A;  2C4U A;  4KKT A;  3PO3 G;  3FKI H;  3WOF A;  4YHB A;  4N3N A;  1OO9 B;  5EGT A;  3I4M H;  1SN8 A;  4JPB W;  1B2T A;  2ENB A;  5KNC A;  2ZZE A;  3M4Q A;  2PQE A;  4OWX B;  4X64 L;  1HZB A;  3A56 A;  3KF8 A;  3W3A A;  3GTQ B;  2JJQ A;  4KY7 A;  2KQ3 A;  4LBZ A;  5ELB A;  1F9P A;  2FX3 A;  4HCE A;  1SNP A;  1N36 Q;  2KHS A;  4BY7 H;  4J15 A;  4XLE A;  1WYD A;  4LFC L;  1VQN A;  1JOR A;  2Z6K C;  5K36 H;  1SLJ A;  2NVY H;  1SRU A;  4DR7 L;  3KUP A;  4LW1 A;  1JOK A;  4ODG A;  1NJI D;  4NXM L;  5IGB A;  3KF6 A;  2F4N A;  2F0N A;  3SDZ A;  4PC1 A;  1L0X B;  3X3N A;  2ZXH A;  5G3L F;  2K5N A;  3GTM H;  2IHE A;  3KOJ A;  1A0I A;  5A89 A;  3PIP A;  3ISX A;  2F3V A;  4PV1 C;  3Q39 A;  4JCV E;  4EQO A;  4KY5 A;  2F0I A;  4X62 L;  1IJE A;  1TR5 A;  3RLO A;  5M9O A;  3OMC A;  3JQP A;  2AQ2 B;  2PNH A;  5KRU A;  3Q24 A;  1K73 C;  1IW7 D;  1MHW C;  3GTL B;  4AVZ A;  1G7R A;  5D3I B;  5C4X G;  4B3R Q;  2LXJ A;  5DSZ A;  3I3C A;  1J9Z A;  3K7A B;  5EKL A;  1QG7 A;  1CHQ D;  1N05 A;  2OF1 A;  3S1Q B;  2ALY B;  1VQH A;  5HKK A;  1O7Z A;  5ELF A;  3DXJ C;  5FA6 A;  1Q9S A;  4IO9 A;  2IT1 A;  4PC7 A;  1TS5 A;  2R6G A;  2GJP A;  4Y52 H;  2QGQ A;  1HPC A;  4ZUJ A;  1VS0 A;  3BDL A;  4C3J B;  4A3F G;  1QGY A;  4A3D B;  2X53 S;  1KL9 A;  1H9J A;  4AQY Q;  4X3T A;  1KD1 D;  1LUZ A;  1CKN A;  4A3I G;  2I07 B;  2L11 A;  4A3L H;  5I2Y A;  3ZBT A;  3I72 A;  1I7P A;  2X6W A;  3I4L A;  1H8H A;  1F60 A;  2M00 A;  3HOW B;  3P26 A;  1GAW A;  2E2I H;  1SRO A;  3LVB A;  5EBC A;  1ENF A;  1BX0 A;  3OSO A;  2MNA A;  3PF5 A;  4OWW B;  4IUP A;  3J81 c;  2WZP P;  3LQ6 A;  4LUO A;  4J0Q A;  1OHH A;  4Z4R A;  4CHT B;  4A3B G;  1EY7 A;  2JQO A;  2DCU A;  1ESF A;  4C56 C;  2RC6 A;  3ASP A;  1CNE A;  3Q6S A;  2A69 C;  1LTI D;  1EY9 A;  2IX1 A;  4DAV A;  1EEI D;  3J81 k;  4K6L A;  4YCW A;  1R9T B;  1PTO H;  3CCE A;  1VF7 A;  4N3G A;  4XLH A;  3OW2 A;  2F0W A;  2DNE A;  4OP7 A;  3PUX A;  4YY3 L;  1Y1V G;  2B2U A;  4BA1 I;  4H44 C;  1Y1W H;  2JN9 A;  2DER A;  1FNM A;  1S4M A;  2Z4I A;  4ILW A;  1CNF A;  2B2V C;  2QN6 A;  2NTS A;  4QIW E;  2XGJ A;  4Z9C B;  5K5P A;  1MI2 A;  2PW5 A;  1X54 A;  1SYG A;  2CK3 A;  2AQ3 B;  1OXX K;  2KCM A;  3CTA A;  5CV8 A;  1W9X A;  1SYB A;  2EYM A;  3NEL A;  3CCR A;  4JMQ A;  2FMC A;  3VR6 A;  1LAB A;  4AH6 A;  3J81 j;  4JBK A;  5FK9 C;  3A55 A;  3BQJ A;  1ZKO A;  4APV A;  1R5B A;  4R4I A;  3G4S B;  2Q6O A;  3ULP A;  4RGT A;  3DDY A;  4ZGQ B;  1S5B D;  1FYC A;  3A7A B;  5JPN C;  4OPV A;  3F2U A;  3QIA A;  2AWN A;  4CBV A;  1SNC A;  3R6K A;  1Z6H A;  4B3S Q;  2M5S A;  1S5E D;  1G2S A;  1YJ9 B;  2LKV A;  1BDO A;  4U68 A;  4DV2 Q;  5IP7 H;  1FGB D;  1RF2 D;  4O1N A;  1FNC A;  1V43 A;  4JI3 L;  3K5N A;  1UWV A;  1EFC A;  1QVF A;  1EWC A;  1FX0 A;  3S1N B;  4KJO A;  4JI6 Q;  4P71 A;  3VNV A;  1FNV A;  4K5V A;  1TWG H;  5FKA C;  3U58 A;  1GHJ A;  2RDF A;  2BF4 A;  3GTG H;  3VO1 A;  2B2U C;  1F2L A;  1VQ6 A;  3NQI A;  3W2F A;  3SEB A;  3WDN A;  3OTO Q;  3GTK H;  1KLG D;  2K01 A;  3MZ5 A;  3NXW A;  3WND A;  4F7D A;  3PSI A;  3GTJ B;  4OO1 I;  3TRE A;  2QE7 A;  1D1I A;  2AQ1 B;  3GV6 A;  4FN5 A;  1B50 A;  2MO1 A;  2NZ1 D;  2D9R A;  1YIT B;  1S72 A;  1D1K A;  3HOW G;  1RQR A;  1NUC A;  3B6Y A;  4G57 A;  2FIN B;  4UZE A;  3PF4 A;  2BDO A;  1QVC A;  2ZBV A;  3BYT B;  2XOK A;  5BSY A;  2PMD A;  4B3X A;  3HKZ G;  1SE8 A;  1GKH A;  2C77 A;  2XN9 C;  1HR0 W;  3U6B A;  3M4O H;  3TS2 A;  4H7B A;  3GVK A;  3R3O A;  1K28 A;  4AIM A;  1NMG A;  2Q2U A;  4DR6 Q;  4GZY C;  1E22 A;  2ICE C;  4OGQ C;  2VNJ A;  5GV7 A;  2DN8 A;  1D8T A;  4NPS A;  3EA6 A;  4FXU A;  3P75 A;  4OEL B;  2Q8R E;  5M3M B;  4KJN A;  1I4P A;  3CCQ A;  4YCU A;  2K75 A;  4HJ5 A;  2BMW A;  1RCV D;  4RH6 A;  3QOJ A;  1YJW A;  4JI2 L;  4HIZ A;  1PFB A;  4DR6 L;  1BKB A;  1G2T A;  4RPD A;  5FO1 A;  4IOA A;  1STN A;  2E1R A;  2AWO A;  1TY2 A;  3M85 A;  3TME A;  4RKB A;  1I18 A;  4X7F A;  3NBH B;  2XNC A;  2XRS D;  2MGS A;  1HUN A;  3ER0 A;  2UXD Q;  1TY0 A;  3NEM A;  2WII B;  5ELN A;  2CF4 A;  3LGJ A;  1ET6 A;  4BWG B;  2WAQ G;  3AGQ A;  1TWC H;  2R7D A;  4LBW A;  1WDT A;  3AFP A;  4MZ9 A;  1X65 A;  4RGN A;  5B6I A;  4WZE A;  1A3T A;  3IAY A;  3W2H A;  3OZU A;  3S17 B;  1C7Y A;  1HA6 A;  4BY7 G;  2JA8 G;  4LK1 C;  2ZXI A;  1Q81 C;  3AVV A;  3M3Y B;  1LTB D;  1Q3L A;  4AF7 A;  1X3E A;  3M7G A;  3S9W A;  5A2Q L;  5EMN A;  2NUC A;  5JEA H;  3WNC A;  3JAM i;  1BF4 A;  1EIY B;  3A74 A;  2D62 A;  4DR3 L;  3SJP A;  4JG2 A;  1PV4 A;  1HXY D;  5JAV A;  3G4S A;  4JI6 L;  1VQA A;  4DR1 L;  1U4L A;  2F0O A;  1B1Z A;  3CD6 B;  3U4Z A;  3PO3 H;  3UE0 A;  3PIO A;  4C3H G;  3AYH B;  3A8I A;  3CB4 A;  3V05 A;  2JEB I;  1A6X A;  4NXN Q;  1PXU A;  1VCI A;  5IP9 G;  3BVM A;  4L5Q A;  3KEW A;  3VO2 A;  3GTP B;  5M3F H;  3H94 A;  2F0Q A;  2P5Z X;  2YTV A;  4IPD A;  4C1N I;  1VQJ A;  4PC2 A;  1RTO A;  1X56 A;  1A8V A;  5BN4 A;  5IWA L;  1VQO B;  2B3G A;  4K0K Q;  4HE6 A;  2BE5 D;  1GVP A;  1EOT A;  1UE5 A;  2V4D A;  1E7Z A;  1BCP C;  5IYD H;  5HUR A;  5M5X B;  1JJ2 B;  5M3M G;  1NB9 A;  3CPW B;  2UXB Q;  2BM0 A;  3V76 A;  5C3E H;  1HQM C;  3I90 A;  4XQQ A;  1SDF A;  1Q86 C;  1D5X C;  3CCU A;  1KQS A;  2O5I C;  4WWV A;  5C6A A;  5IYR A;  1N06 A;  5EKI A;  1B3Q A;  1BCP F;  1E1R A;  2NN6 H;  1SJH D;  4A93 B;  4DV7 L;  1F2Z A;  3T1H Q;  5I6W A;  2JA8 H;  2B2T C;  5IYB H;  1QJO A;  2Z4H A;  3RUZ A;  2NN6 G;  3KFU A;  2ZJQ A;  3CXC B;  2JJ2 A;  3MXU A;  1IKL A;  1Q7Y D;  4LF6 Q;  1K73 D;  4J6H A;  2IY5 B;  3H0G B;  1HFN A;  3C46 A;  2PO4 A;  2ZL6 A;  1V1P A;  3NUC A;  2UUC Q;  5KGU A;  2F4I A;  1W0K A;  2JEA I;  3TBI B;  3ASS A;  2JA6 B;  1SYF A;  2F0T A;  3CME B;  4TKO B;  1Z9F A;  3RLF A;  5IP7 G;  4Z4U A;  5FLX c;  4XTC S;  1PH3 A;  1AP0 A;  5EPK A;  1B23 P;  1NDH A;  2VBV A;  3JAM E;  4ZKB B;  1A8P A;  1TQO A;  2PZU A;  3FVQ A;  1JWS D;  1X32 A;  4L8J A;  2K32 A;  3GVL A;  4XOR A;  3VYT A;  2QCP X;  3I2Z A;  1VQK A;  2QEX A;  5IIF A;  1E3P A;  4OOV A;  1CT1 D;  4GOP C;  4JV5 L;  3K7A H;  2C78 A;  4RD3 A;  1A2U A;  4A3G B;  4IUN A;  2BGI A;  4LBV A;  4B43 A;  4G1V A;  3ZZ0 A;  4ZCK A;  1R4P B;  5IK2 A;  2QTL A;  1ICW A;  4PZ8 A;  3D31 A;  1GM5 A;  3HOY B;  2EJG C;  4OEM B;  4ASU A;  3NWS A;  4RHS A;  4HIM A;  2WZN A;  2A6E C;  2YV5 A;  2ZT9 C;  1VQ8 B;  1A3V A;  2FHT A;  4DV5 L;  2E5L L;  4MYU A;  3BYY B;  3OKX A;  1SXT A;  2A74 C;  3OPO A;  4PMC A;  3I4O A;  4GNX C;  4XOT A;  4XKV A;  4MHE A;  3VA5 A;  1LYL A;  1X9N A;  1VQE A;  1IBL Q;  2J7K A;  2Q6L A;  2D3N A;  4J8Q A;  5KEE A;  4GN5 A;  2HDM A;  2CCZ A;  4OHJ A;  1D5M C;  1N8R D;  1WOC A;  5FOB B;  4DUZ Q;  2E2I B;  4DNT B;  3QFR A;  2NVT B;  1EOV A;  4G7X A;  1PFS A;  2KUM A;  5KYI A;  1AEX A;  3A8K A;  1KC8 C;  1OGI A;  2VQF Q;  1H95 A;  1QWY A;  4PAB A;  1UD4 A;  3HOX H;  3A8I E;  1W2B B;  1HQR D;  2GVB A;  2ID0 A;  1DDI A;  4XLA A;  3ERS X;  4BS9 A;  4DR2 Q;  1PZI D;  1QNU A;  3CKI B;  2BV3 A;  2CW0 C;  1K83 H;  3CQZ B;  1L0W A;  5IE8 A;  1VQL B;  3IRB A;  1HZC A;  2L9H A;  1Z7T A;  4R8I A;  3ZZU A;  1PZK D;  4B3M Q;  5GAH C;  4LF5 Q;  1FRN A;  2V7V A;  1RD9 D;  4GKJ Q;  1JC7 A;  3ITP A;  1F2Y A;  4A3I B;  1Q1B A;  3AU7 A;  2EIX A;  1UNS A;  4RDK A;  2F0M A;  4OX9 L;  5GAD C;  2R7F A;  1A3U A;  3R8B A;  2ZL7 A;  1FND A;  1U2R A;  3RZD H;  2J7Z A;  1V9P A;  4E6I A;  1EP3 B;  1PFN A;  2MP1 A;  3CC7 A;  2ZTE A;  4RCY A;  5KND A;  4DAY A;  2VYQ A;  1TWH H;  2FMM A;  2JP1 A;  2NZO A;  4WJ3 M;  1PH7 A;  2A68 C;  2JE6 I;  5HZB A;  1MD2 D;  4RCO A;  1WP6 A;  4WZL A;  2DY7 A;  1EY5 A;  1KAW A;  3GD7 A;  3J80 c;  3S15 B;  1EP1 B;  5J1Z A;  1NSN S;  2B8G A;  2BVN A;  3QE2 A;  3W2D A;  4NXM Q;  2DJG C;  3P7J A;  4LBY A;  2DET A;  1OGJ A;  2GK7 A;  1KXL A;  1EFR A;  4TN1 A;  4OIK A;  3RZD B;  4XMY A;  5LL6 S;  3S1N H;  3EVQ A;  4DXF A;  3DHQ A;  1CQF A;  1PH9 A;  2HHH L;  4Z4Y A;  3K8A A;  5C4Z A;  3VR2 A;  4DXG A;  1N9W A;  3VR4 A;  1B2R A;  4KD4 A;  2R93 B;  4G1B A;  2K5Q A;  4M2L A;  3KF6 B;  5JJZ A;  2F03 A;  3BU2 A;  4DV1 L;  1T9H A;  2K50 A;  3SKB A;  1SNQ A;  1YJN B;  1XFO A;  3PEN A;  2E75 C;  1QUE A;  1HA3 A;  4G7W A;  2MQH A;  4K5W A;  3W1B A;  2CW0 D;  1ASZ A;  3CHB D;  4N8F A;  4JI4 Q;  1VQ8 A;  3BY2 A;  4ME5 A;  3FJO A;  3QFC A;  2CWP A;  2FXQ A;  2R93 H;  1V8Q A;  4R4C A;  1HJP A;  1K0R A;  2IX3 A;  1LM0 A;  3F8T A;  4FF4 A;  1Y1V B;  4A75 A;  2KBN A;  1JA0 A;  2R92 G;  2NTT A;  4PZ6 A;  4LFC Q;  3SXH A;  2NN6 I;  1BQQ T;  2B2W A;  1ONL A;  3VR3 A;  1VMP A;  2ZTD A;  4U9U A;  4K6D A;  2JXM B;  4IW3 B;  3T4A C;  2GVA A;  4BBR G;  1PYS B;  1STB A;  1GUG A;  2XZL A;  1ML0 D;  1NCV A;  4DV4 L;  2K5H A;  2F0E A;  2PQA B;  3MHB A;  2IX0 A;  4X64 Q;  2G9H D;  1V1Q A;  2MFI A;  1D8L A;  4YY3 Q;  3RY8 A;  3P20 A;  4OO1 H;  3S2H B;  2K1B A;  4UPA A;  3OEH A;  3QB3 A;  2IHF A;  3KBG A;  1ZM4 A;  1WTR A;  1STE A;  3GTL H;  3J81 i;  3EJI A;  4QVJ A;  2JK8 A;  5DAU A;  1XX8 A;  3RN5 A;  2RCF A;  3VYU A;  2B2V A;  3Q38 A;  4LF9 L;  2HCC A;  4BY1 H;  3BZK A;  4GLX A;  1U4M A;  4B9X A;  2OK7 A;  3M4P A;  4UAI A;  5IYC G;  2DY8 A;  4UAJ A;  4XQJ A;  4NBS A;  2CWA A;  3DMU A;  2VUM H;  1BBX C;  2F3I A;  4WFN 3;  3S17 H;  4LF9 Q;  1KNA A;  2PMZ E;  1B8A A;  3LQE A;  3NPP A;  4DF7 A;  4ZV4 A;  2F43 A;  1VQM B;  2J0T D;  5M5Y B;  4XR6 A;  3DWA A;  3J81 L;  2NVQ B;  1T6Y A;  4LMQ D;  1VQD A;  1M1K C;  4B48 A;  3MC0 B;  1VQ5 A;  1YNN D;  1YEZ A;  1QX4 A;  4WQM A;  4XYO A;  3SEJ A;  3HEJ A;  4YAW A;  4DV3 L;  2VQE Q;  1JT8 A;  2UUB L;  1FNU A;  4P74 A;  4IFD G;  3FKI G;  4DNR B;  2VW9 A;  2I5L X;  3I4M G;  3MXN A;  3F2C A;  1E3Z A;  1EFT A;  3ERO A;  3VNU A;  2VQE L;  4H9G A;  3KLR A;  4DV1 Q;  1PMR A;  1SYE A;  2VJI A;  5E1F A;  3GVJ A;  3RR5 A;  3HOZ B;  3E9H A;  4N9T A;  2B39 A;  4DV0 Q;  3L0O A;  1IHM A;  4P12 A;  4XOP A;  2XTI A;  2LXK A;  1WTX A;  2LY7 A;  3MMP A;  2WJV A;  1E1T A;  4HSP A;  4TMZ A;  1YNN C;  1S4Z A;  2P3M A;  2ZTC A;  2C9O A;  4QIW B;  5M5X H;  2E2J B;  2C5H A;  3QG1 A;  4OPS A;  3Q23 A;  2OQK A;  2KHJ A;  4CKC A;  3CC4 A;  5CV9 A;  4H0L C;  2R61 A;  1WSV A;  3G05 A;  1VQP A;  1NR2 A;  2HCI A;  1EZ8 A;  3IL8 A;  2R92 B;  1STA A;  4TMW A;  1QFJ A;  3FKI B;  4LFB L;  2QEX B;  5GAG C;  1TTT A;  5EPL A;  3J80 L;  4A93 H;  2K5W A;  1LT5 D;  3U2Q A;  2E2J H;  3S24 A;  1DCZ A;  4WZT A;  4X65 Q;  4BBR H;  3U9S A;  1FDR A;  2KA7 A;  3ES9 A;  2WB1 G;  4KHV A;  3GTJ H;  3AVX A;  4P9S A;  5IGD A;  3ZUG A;  4GLV B;  3NTK A;  3DLL A;  1KDB A;  4RD4 A;  3NSW A;  5COY A;  4RKL A;  2YWE A;  1EU3 A;  2NYZ D;  3V7A A;  4ZCI A;  4FP5 D;  1YI2 B;  4TMV A;  3AEV A;  4DK6 C;  3U4V A;  2Z6K A;  4QY7 A;  1N32 Q;  3OEE A;  1LT3 D;  2NVY B;  4QCL A;  1IJF A;  5ISR A;  5I4D A;  3M4O B;  4ZGN B;  1SFO H;  1V1O A;  2L4N A;  1SMY D;  4PZ7 A;  4DV2 L;  4HJ9 A;  3WXM A;  1NNX A;  4XT1 B;  2O4X A;  4JK1 C;  1MAB A;  3GTG B;  2NBF A;  3CC7 B;  1ZXT A;  3G48 A;  3CCV A;  3A35 A;  1M4V A;  4X7C A;  5L37 A;  2Q2I A;  5IGG A;  4P75 A;  4TT3 A;  5TRD A;  1DOK A;  2JN4 A;  4HN7 A;  5IYN A;  3LO8 A;  2VNK A;  2A73 B;  3PUN A;  1VQI A;  2L1B A;  2XWB B;  1WJJ A;  4KD3 A;  1EFI D;  1TVX A;  1S0U A;  1FNW A;  1JNY A;  2OTL A;  4B3S L;  3CCE B;  2ZTN A;  5C0X G;  3MCA A;  2VNU D;  4IJL A;  4HED A;  1LTS D;  3HOV B;  2Z0S A;  1GJX A;  1J6Q A;  2DOG A;  4RAU C;  1MRZ A;  4EQN A;  4K8I A;  2RSO A;  3FEW X;  4PQX A;  3A7L A;  1ZYR D;  1GAQ A;  2PW7 A;  4C3H B;  1CQV A;  2L5T A;  4QGU A;  3S16 B;  5CV6 A;  2K52 A;  4RJL A;  1W3S A;  1E2Z A;  3CCR B;  3EN2 A;  1KK3 A;  4HJ8 A;  1AZQ A;  1Y8P B;  1EY8 A;  1NB0 A;  1OB0 A;  3QFT A;  2I0Q A;  1SMY C;  2B63 H;  4XYQ A;  1H9S B;  1NJI C;  1G7S A;  3FPU B;  2VBS A;  1I6V C;  3DWQ A;  2RCN A;  4G6I A;  1QCB D;  2EYP A;  4MTN A;  3ULL A;  1VQ9 B;  4X7D A;  4P3I A;  1W6J A;  3KJO A;  2RHQ B;  2JA5 B;  4GN4 B;  4ABN A;  4JI2 Q;  4C2M H;  2PLF A;  1JE4 A;  1N0U A;  3WY9 A;  3SHL A;  3TQY A;  2DUD A;  1FJG L;  5AN9 A;  1SBB B;  2PIA A;  1Q7Y C;  1KK2 A;  3J81 E;  2B2T A;  1MBY A;  3J80 i;  4QFM A;  3F2B A;  2PQA A;  3QSY A;  3Q3A A;  3GQB A;  1Q46 A;  1STG A;  2EYO A;  4FNF A;  1BNZ A;  4UHV A;  1RTN A;  1XNQ L;  3I55 A;  2RVL A;  5E7N A;  1KTV A;  3O13 A;  4A3E H;  2VBT A;  4A3K H;  4C3J G;  4A3F B;  1Y0Y A;  4DFA A;  3FPK A;  4FF1 A;  5JVH 3;  2KVO A;  2KEE A;  3JAM c;  1ZM2 A;  1BR9 A;  1UEB A;  2F0H A;  4CJ2 C;  4JI7 L;  1M90 C;  4WZK A;  2K03 A;  4JW0 A;  2KHI A;  1Y1W G;  4IPH A;  5C4X B;  1TVC A;  1J5E Q;  1TWH B;  4I7A A;  3VMF A;  2H4O A;  4EGV A;  2A8V A;  3TDQ A;  1Q82 C;  2F0U A;  3I4M B;  2CBX A;  4RCN A;  3KDF A;  1JJC B;  3I73 A;  3H9N A;  3KLW A;  3CP2 A;  4LF6 L;  2CC2 A;  5M3F B;  4TVA B;  4XKW A;  3H0G G;  5EKK A;  1WD0 A;  1LTR D;  2I46 A;  4MTK A;  1GHK A;  3OIQ A;  2L55 A;  4CKE A;  1MIU A;  4HTH A;  4OL7 A;  1PJ6 A;  3EBE A;  3W2G A;  3H0G H;  4Q5V A;  2F1L A;  1PH8 A;  2KVM A;  1ESR A;  3ZBU A;  1NY4 A;  2XGT A;  4C3I B;  2RC5 A;  4A93 G;  2HIV A;  1QGZ A;  3CRL C;  3T13 A;  1QOH A;  1CA5 A;  3K81 C;  4X07 A;  3J7A F;  4EQ5 A;  5JEA G;  2QGG A;  2WYR A;  2QF7 A;  3HRZ C;  3VYS A;  1M8A A;  4YAF A;  1IBL L;  2BM1 A;  2KED A;  1H9K A;  4KHP L;  1GJR A;  3I91 A;  2MUY A;  3Q0A A;  2NB0 A;  5ELD A;  5TV2 A;  1Y8N B;  5FNZ A;  2YU9 H;  3ZPN A;  4A3J B;  4RWS C;  1QNK A;  2C5B A;  3FPP A;  4II3 A;  1PH6 A;  3GTK B;  4B08 A;  4P6Y A;  4KHP Q;  1EQT A;  3AMU A;  4CJ1 B;  3Q6Q A;  2X3U A;  4YWM A;  3C2Q A;  4DUY L;  2C35 B;  4N8X 1;  4RHR A;  3MHP A;  1VQC A;  4KI0 A;  3CCL A;  4Z4Z A;  4UP9 A;  4IFD H;  2A1A A;  4HIO A;  2WSS A;  5CBA E;  3R2I A;  3Q22 A;  1K3B C;  4XD7 A;  1MKH A;  5A35 A;  3BDO A;  2GK6 A;  1T6X A;  3QWN A;  4DUZ L;  2BA0 A;  1B9N A;  4RDJ A;  1X3P A;  3E6Z X;  1IBM L;  2VL6 A;  4LF5 L;  3BCF A;  1KAA A;  1LTL A;  5C5L A;  3A8K E;  3OJW A;  1QB5 D;  2OWO A;  1WOR A;  1QUQ B;  4A3D H;  3GDE A;  4X3S A;  4WJW A;  1E0B A;  1B4O A;  3DEP A;  3KBX A;  4DAY B;  3ZJY C;  2WKC A;  4LUZ A;  5ELC A;  1Q81 D;  2K5D A;  4A3G H;  3QFS A;  4FYD A;  4JI7 Q;  4DR2 L;  4JBJ A;  2RHS B;  2WR8 A;  1CZG A;  2RKS A;  3NEN A;  4UP8 A;  2OTL B;  4GOP B;  3HOX B;  1P8L A;  1WVL A;  4TRD A;  3PGZ A;  1XPO A;  2PMZ B;  4Y7N B;  2EJF C;  1K8O A;  4XON A;  3J7A 5;  1FGU A;  1TWA H;  3J7Y W;  4A3B B;  3BVZ A;  2O5J C;  2HD3 A;  1D2B A;  2L12 A;  5J39 A;  3CCV B;  4C1N K;  1JE5 A;  1WTV A;  4C43 A;  1IZ6 A;  2QIL A;  5M3F G;  5H5J A;  1X3Q A;  1U9R A;  4NMZ A;  4FXG C;  1PTO B;  2TMP A;  1I3Q B;  1QUF A;  2MPM A;  2E2H H;  2UUA L;  1C4Q A;  1JOO A;  2F0L A;  2X8K A;  3K0X A;  3LNN A;  3TS0 A;  1VHE A;  4J1M A;  1EY4 A;  3CCS B;  5ELE A;  5FO0 A;  3WWV A;  2F4V Q;  4FXD A;  1I4H A;  2K04 A;  2QDB A;  2ZXP A;  5COR A;  5DNF A;  1B53 A;  1SYC A;  1HNZ L;  2EY6 A;  3SK8 A;  3EIV A;  1AE2 A;  2G9D A;  5EAY A;  2EDG A;  4DR4 L;  3PV0 A;  1XPR A;  4BY1 G;  1OXV A;  4OIJ A;  4MIU A;  4NNJ A;  4IUU A;  2Q6K A;  3ULJ A;  2VB2 X;  4U67 3;  1HNZ Q;  1U4P A;  1H42 A;  1E1Q A;  1BBW A;  2PCF B;  5IYB G;  1XMO Q;  3D26 A;  4K8J A;  5BSX A;  3WBJ A;  3C1E A;  4HCS A;  5IYQ A;  5IP9 H;  1JWM D;  2DJF C;  4IOC A;  1NTG A;  2V1C C;  2KEN A;  4ZKC B;  1AW7 A;  1T5E A;  1F9R A;  2IJ0 A;  1E63 A;  4HJA A;  3A8J E;  3J7A V;  1F9Q A;  4PC3 A;  4EX5 A;  2JA5 G;  2ZJR A;  3L7Z C;  2ZL5 A;  1RIP A;  3PCO B;  1L0Y B;  4FXK C;  1QVG B;  2NVX H;  2H5X A;  4M8A A;  5JEA J;  3H3V H;  2R6H A;  2LFN A;  4B3F X;  2EOT A;  1KQS B;  2BGJ A;  4ROX A;  3TP7 A;  1BCP D;  2F0D A;  4RDL A;  4R4T A;  2PE3 A;  1VDZ A;  3E0E A;  4R9W A;  4KHZ A;  5AFW A;  5IGE A;  3HOZ G;  1C9O A;  3GO5 A;  2Q8T A;  3I1F A;  1YJN A;  1DOM A;  3HP3 A;  1YHQ A;  2JA7 H;  5KNL A;  4N9P A;  5E3F A;  3D6C A;  4DV4 Q;  4GOP A;  3HOU G;  5A88 A;  1GUW A;  4I7Z C;  5C5M A;  1K8M A;  2NVX B;  1L2F A;  3D4R A;  3AGP A;  1XPU A;  4XM3 A;  1EYA A;  1LO5 D;  2ZXO A;  1VQO A;  1ILQ A;  1B9M A;  4IUR A;  3T51 B;  1H9M A;  3VA7 A;  4XN0 A;  4JYA L;  2JA6 H;  2FVG A;  4DR7 Q;  5HZA A;  2C4T A;  5KW9 A;  4X7E A;  4Y9U A;  2LMC B;  1CA6 A;  5JJL A;  4QJF A;  1BQE A;  1H9S A;  4JI0 L;  1RQP A;  2K5V A;  1UE6 A;  3P27 A;  4Y7C A;  4LF8 Q;  3A3B A;  2JA7 B;  3OW7 A;  4O42 A;  3JQQ A;  4FWT A;  5BN5 A;  1EFW A;  1GVH A;  1O80 A;  2EY1 A;  3CU7 A;  1K28 D;  1A62 A;  5ELO A;  5LMN Q;  4Z4S A;  1HNW L;  4P3Y A;  3G7L A;  2F0J A;  4JYA Q;  4P26 A;  1ILP A;  1SE2 A;  4RD6 A;  2D3L A;  1E2W A;  2E76 C;  3CD6 A;  4QUZ A;  2ZJP A;  2XRQ D;  4HMJ A;  1RHP A;  3HKS A;  1YBY A;  1CQX A;  1TLL A;  4C3J H;  2UUB Q;  1AH9 A;  3R93 A;  1QH0 A;  3W2I A;  1VMC A;  3GP7 A;  4PGO A;  4X66 L;  4CDF C;  4B3T L;  2B63 G;  3AVY A;  1EUJ A;  4CJ0 B;  2VNH A;  2CVR A;  2UU9 Q;  3BY1 A;  3PMF A;  5I9P A;  3TP6 A;  3BJU A;  1DON A;  2N88 A;  1UD2 A;  1ET9 A;  1FD7 D;  4K14 A;  4EVO A;  3UDF A;  3HOW H;  2XVS A;  2QEJ C;  1PA6 A;  2VUM B;  4DV0 L;  2SDF A;  3RZO H;  2Z6B A;  2B7C A;  3MA2 B;  5FJ8 G;  4GN3 B;  1PTO D;  4JI1 Q;  2ZZG A;  2EYL A;  2SEB D;  2UXC L;  2VS1 A;  3BS1 A;  5J22 A;  5C3E G;  4A3M B;  1OXU A;  4KTA A;  2EXD A;  1RKN A;  3TRZ A;  2MJ8 A;  1D1N A;  2OYN A;  1NBW A;  1ZEQ X;  2GJR A;  4CDD C;  2AUK A;  1PYW D;  3NWT A;  5D14 A;  1ASY A;  5DEH A;  5JPM C;  1GXD C;  1SE4 A;  3RNU A;  4A4I A;  3FHW A;  1VHO A;  1NE3 A;  2WB1 B;  5E6T A;  4QUF A;  3NBI A;  3CCU B;  2WJY A;  4F7X A;  1JA1 A;  1J9O A;  1ICF B;  1TWF H;  4CDE C;  1SKY B;  3OWF A;  4P25 A;  5IYP A;  2PYK A;  4AYB E;  3CPW A;  3S1M B;  1EIF A;  1JIC A;  3JC6 6;  2K7V A;  1WTH A;  1A15 A;  1Z47 A;  3OWE B;  5DM6 3;  2K14 A;  5IY0 A;  2F0V A;  3K59 A;  3E3X A;  3GTP H;  1CSQ A;  3NTH A;  4KKU A;  5EJW A;  4I65 A;  1V0E A;  1ROD A;  2EXZ A;  1HNX L;  2W6I A;  4ZCL A;  1VQP B;  1D6E C;  5JJI A;  1FR3 A;  2BE5 C;  2OBT A;  4A3I H;  4L6T B;  4R4Q A;  1YVC A;  2Y0S G;  3GV3 A;  1S5C D;  1B44 D;  3ND8 A;  2FJ2 A;  4NW2 A;  4X05 A;  3VR5 A;  4LF8 L;  2AUJ D;  1DXM A;  1WOO A;  3MEF A;  1PHJ A;  2HQL A;  1VJS A;  1X3G A;  1QFZ A;  1LTT D;  5EPJ A;  5C44 G;  3PIO 3;  1W0J A;  1EY0 A;  2N55 A;  1R5N A;  3WQZ A;  1EEF D;  1PLF A;  3MXP A;  3K6O A;  3KYH C;  4YXW A;  4K2L A;  2CHB D;  3MFG A;  2I1L A;  3E1Y E;  1UD3 A;  1ZYR C;  3STB C;  4CKB A;  4QHY A;  3T1Y L;  1N34 L;  5LMZ A;  3A54 A;  4OOX A;  1EXM A;  3K5L A;  5FLX L;  3KK7 A;  3CCL B;  1QVF B;  3H15 A;  3AST A;  1E79 A;  2PZT A;  4HR7 B;  4M0L A;  1VQ9 A;  1T5X D;  4Z4V A;  2R92 H;  2JIZ A;  4AYB G;  2M2L A;  3OHX C;  5FLX E;  1XTC D;  4L63 B;  5LMN W;  2RBM A;  2MO0 A;  5IT9 E;  4QQB X;  1EU4 A;  5NUC A;  3ERQ A;  1UEA B;  5IOC A;  4XLC A;  3LWU A;  1Q1E A;  5IT9 L;  3OZV A;  1KAB A;  1HUM A;  3CCJ A;  1WU8 A;  3OE7 A;  3UDG A;  1PTO C;  2QA4 A;  4GS3 A;  3HOU H;  4TMT A;  1JB3 A;  1I50 H;  4DV6 Q;  2JDI A;  3PVD A;  5J35 A;  4IAL A;  4X06 A;  4P73 A;  3I7F A;  3SK4 A;  3PUZ A;  1F20 A;  4GLA C;  2AMC B;  1CKO A;  4F8M A;  1JB9 A;  5HGQ A;  1WPC A;  1VQG A;  1KJZ A;  1XTD A;  4JOI A;  1VLO A;  1ENA A;  2A6H D;  4PMB A;  3I56 A;  1TU2 B;  1NBM A;  1PH2 A;  3K5M A;  3ASR A;  1DD2 A;  1II3 A;  1VQ4 A;  1XB2 A;  5CC4 A;  1Y0R A;  4OOS A;  1LT4 D;  4PC6 A;  4HAE A;  3PO2 G;  1EYC A;  1JJ2 A;  3HOV G;  4LF4 Q;  2EQS A;  1TS3 A;  1XNQ Q;  3U50 C;  1IYU A;  4L5T A;  3D4D A;  5A2Q E;  2E74 C;  1CUK A;  3C2P A;  2K28 A;  2NPF A;  3SGI A;  4BBS H;  2B63 B;  1F77 A;  2L15 A;  1PRT C;  3EFX D;  3OFN A;  2JJ1 A;  3CW2 A;  4ZRZ A;  4GNX B;  4QB4 A;  3NK9 A;  1GO2 A;  4JI8 L;  1SND A;  4ULL A;  1SEB D;  1SKQ A;  3T16 A;  1W2B A;  1CKM A;  3M9B A;  4NKL A;  3CP8 A;  5IOD A;  4BBS B;  4AC9 A;  3GTO B;  4IFD J;  3HKZ B;  2YWH A;  1PRT F;  4Z4W A;  4WOR A;  1X6O A;  1HZA A;  1NRK A;  4FVM A;  3S1R B;  1N33 L;  3RMH A;  4ZQ3 A;  1BVS A;  1SE3 A;  3I8Z A;  3CC2 A; 
#chains in the Genus database with same CATH homology
 1LTA D;  1MSG A;  3UI2 A;  2SNM A;  2K05 A;  2LZJ A;  1MSH A;  1TWC B;  5JOB A;  4DK1 A;  1G29 1;  2K6A A;  2IWH A;  2ZZF A;  1EYD A;  4XNF A;  5JVG 3;  3SVM A;  2EPB A;  3PUY A;  2HDL A;  1SAP A;  5LL6 X;  1JWU D;  3K5O A;  1D5Z C;  2D5D A;  5IGF A;  4IN3 A;  4HSV A;  5FO8 B;  4R8N A;  1WTP A;  3BG3 A;  2LS0 1;  2OXP A;  1I4Q A;  3N6R A;  1YNJ D;  1PRT D;  3L9A X;  2D2C C;  2F0K A;  4XQN A;  2XWJ B;  1I4R A;  3QO2 A;  3VYR A;  3QOL A;  1OXS C;  4V0B A;  2JSO A;  4XIG S;  1Q8I A;  2NWG A;  2F1M A;  2X85 A;  5KIX A;  1GUS A;  4MN3 A;  1HZE A;  2VXW A;  3IFT A;  1I6H B;  5E4X A;  1TWG B;  4S3S A;  1YNJ C;  5CYU A;  4NP5 A;  2X6X A;  3CRK C;  2EE1 A;  2IL8 A;  4II2 A;  3ZYY X;  1UD5 A;  4AYB B;  3SK6 A;  1WTH D;  2PZW A;  1I50 B;  1AFP A;  3PUW A;  2Y0S B;  4DN4 M;  4IQZ A;  1DYQ A;  2EZV A;  3FRP B;  2PPB C;  4ZLT F;  4TQU S;  1BPL A;  1WTO A;  1CHP D;  3NE5 B;  4P22 A;  3MVV A;  3OIP A;  4KN7 C;  4CGY B;  1BO0 A;  3MWY W;  1DM0 B;  3D4W A;  2XZP A;  1UUP A;  5CMD A;  4B9W A;  1O78 A;  2EY2 A;  2EYJ A;  3H91 A;  2E1B A;  3E5S A;  1I8D A;  4F88 A;  1GUT A;  1AN8 A;  1PDQ A;  4YEL A;  2OEO A;  1WD1 A;  4JBW A;  1C8C A;  3DEO A;  1LV9 A;  1BMF A;  2R9V A;  1KNE A;  3SK5 A;  1S5F D;  1GUN A;  4DAP A;  2O2L D;  3K58 A;  1J8I A;  1EIG A;  1Y1W B;  1HFG A;  1HVX A;  5D65 A;  4YEJ A;  4WRD A;  3LWE A;  3DWP A;  2C5C A;  3BCD A;  1KDC A;  5G3L D;  1W6K A;  2BOS A;  3FMC A;  2RSN A;  3ND9 A;  1CK1 A;  2X6Y A;  1PRT B;  3H09 A;  1JOQ A;  1Q90 A;  4XL9 A;  2B2Y C;  1EWH A;  1IHZ A;  1DZ1 A;  4XT3 B;  2ICI A;  4P2C B;  1G8Z D;  1XXG A;  2RDH A;  1CZW A;  4M1U B;  4BBR B;  5I6Y A;  1GOZ A;  1LTG D;  5I2X A;  5C3E B;  1BOS A;  3HG9 A;  5C44 B;  1I4X A;  3OMG A;  1PFM A;  4FF3 A;  2WAQ B;  1R4Q B;  2X69 A;  4UZU A;  1DOL A;  5TSS A;  3BZD B;  3T53 B;  1Y8O B;  1E2V A;  3D6W A;  3HOU B;  4KMU C;  2XSC A;  2YU9 B;  4K2K A;  3NP8 A;  1V0F A;  2M9V A;  2F0F A;  2F0P A;  5FL7 A;  4PNY A;  2BA1 A;  4KKS A;  4XXE A;  3M7N A;  3A3G A;  1JCK B;  1WTW A;  1BLI A;  5BN3 A;  3OAA A;  2F0S A;  3GTM B;  3BH4 A;  1HTL D;  4Q0F A;  2W6J A;  4G7Z C;  5I9O A;  4RA8 A;  3J80 E;  5F2D A;  3KLS X;  5C0X I;  3K0Y A;  4KN4 C;  4IUT A;  1EY6 A;  3NTI A;  2A6E D;  1WTQ A;  1V1P B;  2DNC A;  3HZX A;  5KNB A;  4BA2 I;  4QF4 A;  5E4W C;  3S14 B;  1BXT A;  1TWF B;  1H9R A;  4FF2 A;  2X6G A;  2A5H A;  4DU9 A;  3S2D B;  2FFK B;  3FDT A;  1IYV A;  4ZK9 B;  3HGB A;  4F87 A;  2XZO A;  3MAQ A;  4TSF A;  2A68 D;  3MEH A;  1F2M A;  1VLY A;  3LX0 A;  1K83 B;  4A3K B;  3WOE A;  1QE6 A;  2SOB A;  2KEC A;  2WV6 D;  1XWE A;  1SJE D;  4G7O C;  2DIE A;  5C4H A;  2R7Z B;  1SNO A;  5LHY 1;  2MHV A;  3D3R A;  2HUG A;  1G6Z A;  1TII D;  1JR0 D;  2A6H C;  3NBH A;  3HS0 C;  1HHV A;  1CTM A;  2J4X A;  5T1G A;  1F9S A;  2HQE A;  4ZYS A;  2Z6B D;  1EQV A;  2Z1C A;  1QIL A;  3N52 A;  3MXG A;  1SSO A;  2WAC A;  1PKV A;  5CBE E;  3V2T A;  2VB3 X;  2JA8 B;  1TT2 A;  3E0J A;  1RJT A;  1O7Y A;  4RGM A;  4XLF A;  4E0F A;  3EQL C;  2RDG A;  5DM7 3;  1EZ6 A;  5D3D A;  2Q8I B;  4UDU C;  3R2T A;  4BY7 B;  3JU4 A;  4TSS A;  5EBD A;  1JQY D;  4V19 0;  1H8E A;  4IUQ A;  2R3Z A;  2KCN A;  1TKW B;  4OO1 G;  1DJR D;  5CR3 A;  3ZIA A;  3PUV A;  2KJX A;  4ID6 A;  4NDX A;  4QUC A;  5C4J B;  2IPK D;  3OOC A;  1E43 A;  3CES A;  4DA2 A;  4B3G A;  1OXT A;  1GUO A;  3QJY A;  3TP5 A;  4Z1M A;  1RDP D;  1SFO B;  1PTO F;  4KK7 A;  4ZUI A;  1ENC A;  1HA5 A;  2F3W A;  3TN2 A;  4PMW A;  5T1I A;  1IL8 A;  1EL0 A;  1STH A;  5M5W B;  4C3I G;  1KZL A;  2ZXR A;  2V7Q A;  4C2M B;  4GQN A;  2VJJ A;  3PIP 3;  1STY A;  3TSS A;  1I4G A;  2WPD A;  1TWA B;  3DUZ A;  5K36 G;  2JYO A;  3BDC A;  1XYI A;  2BDN A;  1CM9 A;  3G6J B;  3IFD A;  2CQA A;  4QMG A;  1KLU D;  4KY6 A;  3NQT A;  1TS4 A;  3SR1 A;  5DN6 A;  5FO7 B;  2E2D C;  3DM1 A;  2H1E A;  5C3W A;  3BC9 A;  3X3M A;  2WP8 J;  1IW7 C;  4XDX A;  2OT2 A;  1BCP B;  1SNM A;  2QKI C;  1LT6 D;  2B8F A;  3ONA B;  3P1H A;  3TZD A;  2EYH A;  3MFY A;  2GA4 B;  2B2W C;  2D9U A;  1TS2 A;  1UD8 A;  4DGZ A;  2HLD A;  1UD6 A;  4XQF A;  4DK0 A;  3PO2 B;  5CV5 A;  3PO3 B;  2KOL A;  4A3E B;  3M4Y A;  4IZ8 A;  1HTP A;  3TZU A;  4IFD I;  2V31 A;  1C48 A;  2RQX A;  1BUV T;  4X3U A;  1COW A;  4LJZ C;  1IKM A;  1WCM B;  2F0G A;  3AB9 A;  5IGC A;  2ZZQ A;  2BCO A;  5CV4 A;  1CI3 M;  2A69 D;  2WIN B;  3SE0 A;  2SNS A;  4EQP A;  5HGT A;  5CDF A;  3T56 B;  1MGS A;  2PNR C;  5CV7 A;  3JAM L;  3K57 A;  2ZTG A;  1HRJ A;  4X3K A;  3CMM A;  1HCZ A;  3MTS A;  3URY A;  3BVG A;  1KMH A;  3IKJ A;  1PZJ D;  2XIW A;  4K5X A;  5CGK A;  1G91 A;  1A2T A;  2Z8L A;  3TP8 A;  4KV6 A;  1UAP A;  2EVB A;  2XND A;  2L0C A;  3I70 A;  2GJK A;  2XNA C;  4G7H C;  3RZO B;  2K33 A;  1LLR D;  2TSS A;  3D8G A;  1NR4 A;  4BY1 B;  5C3X A;  1Y69 U;  5EQ0 A;  3V96 A;  3I4N B;  4LAA A;  2EY5 A;  2B2Y A;  3H3V C;  2E2H B;  1LAC A;  4H13 C;  1Q12 A;  3L3O C;  4G4K A;  5FO9 B;  1U4R A;  3H6M A;  2IW3 A;  1SYD A;  1B3A A;  1EIH A;  1CFM A;  1AZP A;  3FKS A;  1KTK A;  1NAP A;  4HMI A;  3RD4 A;  2EJM A;  4RGO S;  1E3X A;  3C1F A;  1O7L A;  4IUV A;  3C3L A;  3NHH A;  5KYL A;  4RFB A;  4YIJ A;  4ZAI A;  2YYZ A;  5C0X H;  3HAG A;  1VF5 C;  1S5D D;  2X6L A;  3U9O A;  2EYF A;  3KLS A;  5C0X J;  1KDA A;  2WKD A;  4XN3 A;  2RA4 A;  4FO2 A;  2KCC A;  4KKT A;  3WOF A;  1OO9 B;  5EGT A;  1B2T A;  2ENB A;  5KNC A;  2ZZE A;  2PQE A;  3A56 A;  3KF8 A;  3W3A A;  3GTQ B;  4KY7 A;  2KQ3 A;  5ELB A;  1F9P A;  4HCE A;  1SNP A;  2KHS A;  1JOR A;  4XLE A;  5K36 H;  3KUP A;  1JOK A;  4ODG A;  5IGB A;  2F0N A;  3SDZ A;  1L0X B;  3X3N A;  2ZXH A;  5G3L F;  2F3V A;  4PV1 C;  4EQO A;  4KY5 A;  2F0I A;  1TR5 A;  5M9O A;  3OMC A;  3Q24 A;  2AQ2 B;  5KRU A;  1IW7 D;  3GTL B;  4AVZ A;  5D3I B;  3I3C A;  3K7A B;  5EKL A;  1QG7 A;  1CHQ D;  2OF1 A;  3S1Q B;  5HKK A;  1O7Z A;  5ELF A;  3DXJ C;  2IT1 A;  1TS5 A;  2R6G A;  2GJP A;  4ZUJ A;  1HPC A;  3BDL A;  4C3J B;  4A3D B;  2X53 S;  1H9J A;  4X3T A;  2I07 B;  2L11 A;  5I2Y A;  3I72 A;  2X6W A;  3I4L A;  1H8H A;  2M00 A;  3HOW B;  5EBC A;  1ENF A;  3OSO A;  4IUP A;  2WZP P;  1OHH A;  4CHT B;  1EY7 A;  1ESF A;  4C56 C;  3Q6S A;  2A69 C;  1LTI D;  1EY9 A;  2IX1 A;  4DAV A;  1EEI D;  4K6L A;  1R9T B;  1PTO H;  1VF7 A;  4XLH A;  2F0W A;  2DNE A;  3PUX A;  4BA1 I;  2B2U A;  4H44 C;  4ILW A;  2Z4I A;  2B2V C;  2NTS A;  2XGJ A;  4Z9C B;  5K5P A;  1MI2 A;  2PW5 A;  1SYG A;  2CK3 A;  2AQ3 B;  1OXX K;  5CV8 A;  1W9X A;  1SYB A;  2EYM A;  4JMQ A;  2FMC A;  3VR6 A;  1LAB A;  5FK9 C;  3A55 A;  1ZKO A;  4RGT A;  3DDY A;  1S5B D;  1FYC A;  3A7A B;  5JPN C;  3F2U A;  3QIA A;  2AWN A;  4CBV A;  1SNC A;  1Z6H A;  2M5S A;  1S5E D;  1G2S A;  2LKV A;  4U68 A;  1BDO A;  1FGB D;  1RF2 D;  4O1N A;  3K5N A;  1V43 A;  1EWC A;  1FX0 A;  3S1N B;  4KJO A;  1FNV A;  4K5V A;  5FKA C;  1GHJ A;  2RDF A;  2B2U C;  1F2L A;  3NQI A;  3SEB A;  3WDN A;  1KLG D;  2K01 A;  3MZ5 A;  3NXW A;  3GTJ B;  4OO1 I;  2QE7 A;  1D1I A;  2AQ1 B;  3GV6 A;  1B50 A;  2NZ1 D;  1D1K A;  1NUC A;  4G57 A;  2FIN B;  2BDO A;  3BYT B;  2XOK A;  2XN9 C;  4H7B A;  3GVK A;  3R3O A;  4GZY C;  2ICE C;  4OGQ C;  2DN8 A;  3EA6 A;  4FXU A;  3P75 A;  5M3M B;  2Q8R E;  4KJN A;  1I4P A;  4RH6 A;  1RCV D;  3QOJ A;  4HIZ A;  1PFB A;  1G2T A;  1STN A;  2AWO A;  1TY2 A;  3M85 A;  3TME A;  4RKB A;  1I18 A;  2XRS D;  2MGS A;  1HUN A;  1TY0 A;  4BWG B;  2WII B;  1ET6 A;  4RGN A;  1A3T A;  3IAY A;  3S17 B;  1HA6 A;  4LK1 C;  2ZXI A;  3M3Y B;  1LTB D;  1Q3L A;  3M7G A;  5A2Q L;  3S9W A;  2NUC A;  5JEA H;  1BF4 A;  2D62 A;  1HXY D;  5JAV A;  1U4L A;  2F0O A;  1B1Z A;  4C3H G;  3V05 A;  2JEB I;  1A6X A;  1PXU A;  1VCI A;  3BVM A;  3KEW A;  3GTP B;  3H94 A;  2F0Q A;  4C1N I;  1RTO A;  5BN4 A;  2BE5 D;  1EOT A;  2V4D A;  1BCP C;  5HUR A;  5M5X B;  1HQM C;  3I90 A;  4XQQ A;  1SDF A;  1D5X C;  2O5I C;  5C6A A;  5EKI A;  4A93 B;  1BCP F;  1E1R A;  2NN6 H;  1SJH D;  1F2Z A;  5I6W A;  2B2T C;  1QJO A;  2Z4H A;  3RUZ A;  2NN6 G;  2JJ2 A;  3MXU A;  1IKL A;  4J6H A;  1HFN A;  3H0G B;  3C46 A;  2PO4 A;  1V1P A;  3NUC A;  2JEA I;  5KGU A;  2F4I A;  1W0K A;  3TBI B;  2JA6 B;  1SYF A;  2F0T A;  3RLF A;  4TKO B;  4XTC S;  5EPK A;  3JAM E;  4ZKB B;  1TQO A;  2PZU A;  3FVQ A;  1JWS D;  1X32 A;  4L8J A;  2K32 A;  3GVL A;  4XOR A;  3VYT A;  2QCP X;  5IIF A;  1CT1 D;  1A2U A;  4A3G B;  4IUN A;  1R4P B;  5IK2 A;  1ICW A;  3D31 A;  3HOY B;  2EJG C;  4ASU A;  3NWS A;  4RHS A;  2A6E C;  2ZT9 C;  1A3V A;  2FHT A;  3BYY B;  2A74 C;  1SXT A;  4PMC A;  3OPO A;  4XOT A;  4XKV A;  4MHE A;  3VA5 A;  4J8Q A;  2D3N A;  5KEE A;  2HDM A;  4OHJ A;  1D5M C;  5FOB B;  2E2I B;  4DNT B;  2NVT B;  4G7X A;  2KUM A;  5KYI A;  1AEX A;  1QWY A;  1UD4 A;  3A8I E;  1HQR D;  2ID0 A;  4XLA A;  4BS9 A;  1PZI D;  1QNU A;  3CKI B;  2CW0 C;  3CQZ B;  2L9H A;  1Z7T A;  4R8I A;  1PZK D;  1RD9 D;  1JC7 A;  3ITP A;  1F2Y A;  4A3I B;  1Q1B A;  3AU7 A;  1UNS A;  2F0M A;  1A3U A;  3R8B A;  2J7Z A;  4E6I A;  1PFN A;  2MP1 A;  5KND A;  4DAY A;  2JP1 A;  2FMM A;  2A68 C;  2JE6 I;  1MD2 D;  4RCO A;  1WP6 A;  2DY7 A;  1EY5 A;  3GD7 A;  3S15 B;  5J1Z A;  1NSN S;  2B8G A;  3W2D A;  3P7J A;  2GK7 A;  1EFR A;  4OIK A;  3RZD B;  4XMY A;  5LL6 S;  3EVQ A;  4DXF A;  3DHQ A;  1CQF A;  5C4Z A;  3VR2 A;  4DXG A;  3VR4 A;  4KD4 A;  2R93 B;  2K5Q A;  5JJZ A;  2F03 A;  1SNQ A;  2E75 C;  4K5W A;  4G7W A;  2CW0 D;  3CHB D;  4ME5 A;  1V8Q A;  2IX3 A;  4FF4 A;  1Y1V B;  2NTT A;  3SXH A;  2NN6 I;  1BQQ T;  2B2W A;  1ONL A;  3VR3 A;  1VMP A;  4K6D A;  2JXM B;  3T4A C;  1STB A;  1GUG A;  2XZL A;  1ML0 D;  1NCV A;  2F0E A;  3MHB A;  2IX0 A;  2G9H D;  3P20 A;  4OO1 H;  3S2H B;  2K1B A;  3OEH A;  3QB3 A;  3KBG A;  1WTR A;  1STE A;  3EJI A;  5DAU A;  1XX8 A;  3VYU A;  2B2V A;  2HCC A;  1U4M A;  4B9X A;  4UAI A;  2DY8 A;  4XQJ A;  3DMU A;  1BBX C;  4WFN 3;  1KNA A;  3NPP A;  4DF7 A;  2F43 A;  2J0T D;  5M5Y B;  4XR6 A;  3DWA A;  3J81 L;  2NVQ B;  4LMQ D;  3MC0 B;  1YNN D;  4XYO A;  3HEJ A;  1FNU A;  4IFD G;  4DNR B;  3MXN A;  1E3Z A;  3ERO A;  3KLR A;  1PMR A;  1SYE A;  5E1F A;  2VJI A;  3GVJ A;  3HOZ B;  4N9T A;  2B39 A;  4XOP A;  1WTX A;  2LY7 A;  2WJV A;  4HSP A;  1YNN C;  4QIW B;  1S4Z A;  2C9O A;  2E2J B;  3QG1 A;  3Q23 A;  4CKC A;  5CV9 A;  4H0L C;  2R61 A;  3G05 A;  3IL8 A;  2HCI A;  1NR2 A;  1EZ8 A;  2R92 B;  1STA A;  3FKI B;  5EPL A;  3J80 L;  2K5W A;  1LT5 D;  1DCZ A;  3U9S A;  2KA7 A;  4KHV A;  5IGD A;  3NTK A;  1KDB A;  3NSW A;  5COY A;  4RKL A;  1EU3 A;  2NYZ D;  4FP5 D;  3OEE A;  1LT3 D;  2NVY B;  4QCL A;  5ISR A;  5I4D A;  3M4O B;  1V1O A;  2L4N A;  1SMY D;  4XT1 B;  2O4X A;  4JK1 C;  1MAB A;  3GTG B;  2NBF A;  1ZXT A;  3A35 A;  1M4V A;  5IGG A;  4TT3 A;  1DOK A;  4HN7 A;  2A73 B;  2XWB B;  2L1B A;  4KD3 A;  1EFI D;  1TVX A;  1FNW A;  2ZTN A;  5C0X G;  2VNU D;  4HED A;  1LTS D;  3HOV B;  1GJX A;  4RAU C;  4EQN A;  4K8I A;  2RSO A;  3FEW X;  4PQX A;  3A7L A;  1ZYR D;  2PW7 A;  4C3H B;  1CQV A;  2L5T A;  3S16 B;  5CV6 A;  1E2Z A;  1AZQ A;  1Y8P B;  1EY8 A;  1OB0 A;  1SMY C;  4XYQ A;  1H9S B;  3FPU B;  1I6V C;  3DWQ A;  4G6I A;  1QCB D;  2EYP A;  1W6J A;  2JA5 B;  4ABN A;  1JE4 A;  3SHL A;  1SBB B;  3J81 E;  2B2T A;  1MBY A;  1STG A;  3GQB A;  2EYO A;  4FNF A;  1BNZ A;  1RTN A;  2RVL A;  3O13 A;  4C3J G;  4A3F B;  4DFA A;  4FF1 A;  5JVH 3;  2KVO A;  2KEE A;  1BR9 A;  2F0H A;  4CJ2 C;  2K03 A;  5C4X B;  1TWH B;  2H4O A;  4EGV A;  3TDQ A;  2F0U A;  3I4M B;  4RCN A;  3I73 A;  3CP2 A;  5M3F B;  4XKW A;  5EKK A;  1WD0 A;  1LTR D;  2I46 A;  1GHK A;  3OIQ A;  2L55 A;  4CKE A;  4HTH A;  4OL7 A;  4Q5V A;  2KVM A;  1ESR A;  4C3I B;  3CRL C;  3T13 A;  1QOH A;  1CA5 A;  3J7A F;  5JEA G;  2QF7 A;  3HRZ C;  3VYS A;  1M8A A;  2KED A;  1H9K A;  3I91 A;  2MUY A;  3Q0A A;  2NB0 A;  5ELD A;  1Y8N B;  3ZPN A;  4A3J B;  4RWS C;  1QNK A;  3FPP A;  4II3 A;  3GTK B;  4B08 A;  1EQT A;  3AMU A;  4CJ1 B;  4RHR A;  4KI0 A;  4IFD H;  2WSS A;  5CBA E;  3R2I A;  3Q22 A;  4XD7 A;  5A35 A;  3BDO A;  2GK6 A;  3QWN A;  2BA0 A;  1B9N A;  1X3P A;  3E6Z X;  3BCF A;  1KAA A;  5C5L A;  3A8K E;  1QB5 D;  4X3S A;  4WJW A;  1E0B A;  1B4O A;  3KBX A;  3DEP A;  2WKC A;  5ELC A;  2K5D A;  4FYD A;  1CZG A;  2RKS A;  3HOX B;  1WVL A;  4TRD A;  2PMZ B;  4Y7N B;  2EJF C;  1K8O A;  4XON A;  3J7Y W;  4A3B B;  3BVZ A;  2O5J C;  1D2B A;  2L12 A;  5J39 A;  4C1N K;  1WTV A;  2QIL A;  1X3Q A;  1U9R A;  4NMZ A;  4FXG C;  1PTO B;  2TMP A;  1I3Q B;  2MPM A;  1C4Q A;  1JOO A;  2F0L A;  2X8K A;  3LNN A;  4J1M A;  1EY4 A;  5ELE A;  4FXD A;  1I4H A;  2K04 A;  2QDB A;  2ZXP A;  5COR A;  5DNF A;  1B53 A;  1SYC A;  2EY6 A;  3SK8 A;  2G9D A;  2EDG A;  3PV0 A;  1OXV A;  4OIJ A;  4MIU A;  4NNJ A;  4IUU A;  2VB2 X;  4U67 3;  1U4P A;  1E1Q A;  2PCF B;  4K8J A;  3C1E A;  4HCS A;  1JWM D;  4ZKC B;  1AW7 A;  1T5E A;  1F9R A;  2IJ0 A;  3A8J E;  3J7A V;  1F9Q A;  3L7Z C;  1L0Y B;  4FXK C;  4M8A A;  5JEA J;  2LFN A;  4B3F X;  2EOT A;  3TP7 A;  1AP0 A;  1BCP D;  2F0D A;  4R9W A;  5AFW A;  1VDZ A;  5IGE A;  4KHZ A;  3GO5 A;  2Q8T A;  1DOM A;  3HP3 A;  5KNL A;  4N9P A;  5E3F A;  3D6C A;  1GUW A;  4I7Z C;  5C5M A;  1K8M A;  2NVX B;  3D4R A;  4XM3 A;  1EYA A;  1LO5 D;  2ZXO A;  1ILQ A;  1B9M A;  4IUR A;  3T51 B;  1H9M A;  3VA7 A;  4XN0 A;  2LMC B;  1CA6 A;  1H9S A;  2JA7 B;  3A3B A;  3OW7 A;  4O42 A;  5BN5 A;  1O80 A;  2EY1 A;  3CU7 A;  1K28 D;  1ILP A;  3G7L A;  2F0J A;  1SE2 A;  2D3L A;  1E2W A;  2E76 C;  2XRQ D;  4HMJ A;  1RHP A;  3R93 A;  1VMC A;  3GP7 A;  4CJ0 B;  2CVR A;  3PMF A;  5I9P A;  3TP6 A;  1DON A;  2N88 A;  1UD2 A;  1ET9 A;  1FD7 D;  4K14 A;  4EVO A;  2XVS A;  2QEJ C;  2VUM B;  2SDF A;  3MA2 B;  1PTO D;  2ZZG A;  2EYL A;  2SEB D;  3BS1 A;  5J22 A;  4A3M B;  1OXU A;  4KTA A;  1RKN A;  2MJ8 A;  1ZEQ X;  2GJR A;  2AUK A;  1PYW D;  3NWT A;  5D14 A;  5DEH A;  5JPM C;  1GXD C;  1SE4 A;  2WB1 B;  4QUF A;  3NBI A;  2WJY A;  4F7X A;  1J9O A;  1SKY B;  3OWF A;  2PYK A;  3S1M B;  1JIC A;  2K7V A;  1A15 A;  1Z47 A;  3OWE B;  5DM6 3;  2F0V A;  3K59 A;  3NTH A;  4KKU A;  5EJW A;  4I65 A;  1V0E A;  1ROD A;  2EXZ A;  2W6I A;  1D6E C;  1FR3 A;  2BE5 C;  4L6T B;  3GV3 A;  1S5C D;  1B44 D;  3ND8 A;  2FJ2 A;  4NW2 A;  3VR5 A;  2AUJ D;  1DXM A;  1VJS A;  1LTT D;  5EPJ A;  3PIO 3;  1W0J A;  1EY0 A;  2N55 A;  3MXP A;  1PLF A;  3WQZ A;  1EEF D;  3K6O A;  4YXW A;  4K2L A;  2CHB D;  3MFG A;  1UD3 A;  1ZYR C;  4CKB A;  3A54 A;  3K5L A;  5FLX L;  3KK7 A;  1E79 A;  2PZT A;  4HR7 B;  1T5X D;  2JIZ A;  2M2L A;  3OHX C;  5FLX E;  1XTC D;  4L63 B;  2RBM A;  5IT9 E;  1EU4 A;  5NUC A;  3ERQ A;  1UEA B;  5IOC A;  4XLC A;  3LWU A;  1Q1E A;  5IT9 L;  1KAB A;  1HUM A;  3OE7 A;  1PTO C;  1JB3 A;  2JDI A;  4IAL A;  3SK4 A;  3PUZ A;  4F8M A;  1WPC A;  1ENA A;  2A6H D;  4PMB A;  1TU2 B;  1NBM A;  3K5M A;  1DD2 A;  1II3 A;  5CC4 A;  1LT4 D;  4HAE A;  1EYC A;  1TS3 A;  1IYU A;  3D4D A;  5A2Q E;  2E74 C;  3C2P A;  2K28 A;  2B63 B;  1F77 A;  1PRT C;  3EFX D;  3OFN A;  2JJ1 A;  4ZRZ A;  4QB4 A;  3NK9 A;  1SND A;  4ULL A;  1SEB D;  3T16 A;  4NKL A;  3CP8 A;  5IOD A;  4BBS B;  3GTO B;  4IFD J;  3HKZ B;  1PRT F;  3S1R B;  4WOR A;  4FVM A;  1NRK A;  3RMH A;  4ZQ3 A;  1SE3 A;  3I8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...