3T53B

Crystal structures of the extrusion state of the cusba adaptor-transporter complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusB
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 55
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t53B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t53B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t53B01
1H9SA 4KKSA 2BE5C 2JE6I 3CRLC 4KN4C 2CW0C 2D5DA 2K32A 2D62A 4KKTA 2PPBC 3T53B 4L8JA 4H44C 1GUNA 1IW7C 5BN5A 2KA7A 3MXUA 2L5TA 2BE5D 1IYUA 4JBWA 1H9RA 4KI0A 4IFDG 3A8KE 4IFDH 1O78A 1K8OA 5KNCA 3D4RA 1VF5C 1DCZA 3IKJA 1IW7D 2QF7A 2EJMA 4H13C 3HGBA 2EJFC 2YYZA 3GQBA 4TQUS 1FR3A 3IFTA 1H9MA 3VR3A 5BN3A 1Q12A 1GUOA 1GUSA 2LMCB 2PNRC 2KCCA 3L7ZC 3VR5A 4OO1G 5C0XH 5C0XG 2NN6H 1G291 1OXUA 2EVBA 2DNCA 4GZYC 1VDZA 3NE5B 3T56B 1VF7A 2AWOA 3FMCA 3LNNA 4DK1A 2BA1A 3I73A 4H0LC 3A8JE 1ZKOA 4XTCS 4BA2I 4TKOB 3VA7A 2BDOA 1E2VA 1HPCA 3I72A 1GUTA 4I7ZC 4DK0A 2A68C 2AUKA 4KKUA 3VR6A 3FPPA 4LJZC 3M4YA 2IT1A 1E2WA 1BDOA 1DXMA 2NN6I 3A8IE 3W3AA 1EWHA 5KNDA 2ZT9C 1VCIA 2A6EC 2DNEA 3PUXA 1CFMA 3TZUA 1HTPA 2K33A 3GD7A 1QJOA 2B8GA 3PUYA 2A68D 3A7AB 1HQMC 4LK1C 1B9MA 3MFYA 3PUVA 3QIAA 1TU2B 4OGQC 4OO1H 1H9SB 3DXJC 1GUGA 3N6RA 3BDOA 3OPOA 3OOCA 1GHJA 4DNRB 3D31A 3PUWA 2Q8IB 1LACA 2R6GA 1V8QA 3SDZA 1H9KA 3LWUA 1OXVA 3H94A 2A69C 3A7LA 3RLFA 3SE0A 2JEBI 2AUJD 4KHZA 1YNJC 2JEAI 1V43A 1OXTA 1IYVA 2B8FA 5BN4A 4PV1C 1LABA 1Y69U 1GHKA 1PMRA 2BA0A 3EQLC 2A6HD 4G7ZC 2F1MA 2K7VA 3BG3A 2EDGA 3CRKC 4KMUC 1B9NA 3VR2A 1Y8NB 5JEAG 1OXSC 3ND9A 1GJXA 1Z7TA 4G7HC 3AB9A 5KNBA 2EJGC 3OW7A 2A6ED 2V4DA 3QG1A 3T51B 3PUZA 2DN8A 1Z6HA 1H9JA 3PV0A 5A35A 1K8MA 1T5EA 1ZYRC 3QJYA 2O5IC 1I6VC 1Q90A 3M85A 4KN7C 1A6XA 1FYCA 1OXXK 3ND8A 3P20A 1CTMA 3KLRA 3WDNA 2O5JC 4G7OC 1Q1BA 3U9SA 2PCFB 3M7NA 1E2ZA 1SMYC 1Y8PB 4RCNA 2A6HC 2E74C 1TKWB 1HCZA 1Y8OB 4XIGS 1ONLA 3VR4A 1O7LA 2A69D 2JXMB 4BA1I 5K36G 5K36H 1CI3M 2E76C 4DNTB 4IQZA 1YNNC 5JEAH 4HR7B 2E75C 2NN6G 3I4LA 2D2CC 4JK1C 1DD2A 1Q1EA
chains in the Genus database with same CATH superfamily
2DCUA 1VQ8B 1I5FA 2PQEA 1EYDA 2CW0C 1EFWA 2D62A 4GOPB 4L8JA 3M4QA 3KF6A 4WRDA 4G7WA 2KA7A 1HNWL 2E2HH 2GK7A 2VJJA 3A74A 4A76A 5M5YH 2E2IH 3LVBA 1LT5D 5BR8Q 1P4MA 4HE6A 5J35A 1PZID 3HOWB 5IGEA 1IW7D 4ZCMA 4WJWA 2X6WA 3QFRA 1FD7D 1B53A 4G1VA 5JBQA 2PNRC 1STAA 1A0IA 4DU9A 5IP9G 1I4HA 1AN8A 3T56B 3VNUA 1MSGA 2AWOA 4DK1A 4H0LC 1W6JA 1N0UA 3QWNA 1PKVA 2EE1A 2LKVA 2XNAC 3HG9A 4MYTA 1Y1WH 3CPXA 3EBEA 2HCIA 2FINB 1E79A 2VZAA 1GUTA 1FNMA 3H3VI 1EQQA 2B2UC 1BCPD 3BU2A 4X62L 3UI2A 2CW5A 1DXMA 2L4NA 3KLSX 1IBLQ 5FIUA 1B7YB 1VCIA 2K03A 2ZT9C 1E1TA 4C3IB 1F9SA 3SJPA 5EBCA 2ICEC 2N8NA 4NB3A 1PRTF 3GD7A 2N88A 1GVHA 4UAJA 1HTLD 4KHPQ 1FNBA 3AVUA 5JJKA 1HQMC 1EWIA 2CRVA 2AHOA 1DYQA 2RCNA 4P1VA 1PH7A 1RQRA 4GOPC 4UY8C 3ISXA 4IUVA 3HOZG 4DV2L 2VYQA 3STBD 3G05A 3A56A 1N07A 4LC0A 4N3NA 3CCJB 3QFSA 4II3A 1YJWB 2K5DA 4TMVA 2L55A 1S40A 1KK2A 4X65L 2L1BA 2HCCA 1LTLA 2HDLA 3A0JA 1ESRA 4FNFA 4HMJA 3U4ZA 2JA7B 4OO1I 5F4MA 1IYVA 4QFMA 2OTLA 1G6PA 4A3EG 2QEXB 3FPUB 2WJVA 2N49A 3DWQA 4S3SA 3EQLC 4Z4RA 4JYAQ 3CC7B 5JEAH 5J3BA 3MTSA 1B9NA 1GJXA 1Y8NB 4LMQD 1LTSD 3HP3A 5L46A 4RGMA 2OK7A 5C5LA 4EVOA 1EY6A 1KQSB 4HJ5A 3QE2A 2R93H 2UXCQ 1V0FA 3U6KA 4RCZA 2J7ZA 1SNQA 1OB5A 4LFCQ 4UAIA 1NRKA 2RHQB 1GAWA 4C3JH 4AF7A 1CTMA 4XONA 3VO1A 1B8AA 3ZYYX 1KLUD 4DK6C 3CW2A 5ELOA 4BY1G 2F0UA 5LHY1 1O80A 1TKWB 1Y8OB 3T1YL 1ASZA 4YY3Q 4XKVA 5M3FB 4GKKL 2CF4A 2IW3A 4DUZQ 4GLXA 4WZTA 2HUGA 1H9SA 2BE5C 4YEJA 4QUFA 4XYQA 2V7UA 1R5NA 5D14A 1G8ZD 1N36L 2XWBB 1EEFD 1SYCA 1PZJD 3A5UA 2VJIA 2UUCL 1TUIA 5E4XA 4HTHA 2B7CA 3ZZTA 4DF7A 2JN4A 1Y1VH 5JEAJ 3ZZ0A 4IUTA 3CMEA 4IFDH 3A8KE 4JCVE 4JBJA 1RTNA 1PH3A 1KD1C 1DCZA 3IKJA 4OOVA 1C7YA 1PDQA 2ZXIA 3A3BA 4BY7B 2PLFA 3JAMi 1LYLA 1W0KA 1BKBA 3VR5A 4B08A 5JVG3 4TRDA 2IWHA 1KIXA 2MHVA 1K9MC 2R7ZH 3TZDA 1Q3LA 4TT3A 2C2WA 5DNFA 3TDQA 1QZHA 3NE5B 4X8IA 4QIWB 1VF7A 2G9HD 5HZBA 2EYFA 4ZGNB 1FNCA 5GAEC 1WTWA 4X66L 1MIUA 5IY0A 2EXZA 5IWAQ 1VQ6B 4DK0A 3CD6B 3ZJYC 1NJIC 1QUFA 4LJZC 3M4YA 4DAYB 2KCNA 2A6EC 3Q39A 2Y0SE 2HHHL 1STYA 2B8GA 2OBTA 1MKHA 1I6HB 1YJ9A 3NWTA 1YHQA 2BDNA 4OX9Q 1I94Q 5LMZA 3OPOA 1EWCA 4BBSH 1SNOA 4IFDJ 2QTZA 4IPGA 1DOKA 1LTGD 3OWFA 5C44B 1HA6A 3RY8A 3OW2B 5FJ8G 1Y14B 4CJ2C 1UD8A 2WP8J 3NBHB 2OTJA 1Z9FA 1K0SA 4QJFA 1MJEA 3RD4A 1LTRD 1NDHA 2F52A 4AF6A 1KC8C 4WZLA 5IK2A 3K8AA 2K7VA 3UDGA 3ES9A 3CRKC 4PZ8A 4WJ4A 2KHSA 4XLEA 2F43A 3PENA 1P16A 1WI5A 3G48A 3OW7A 1I3QH 3NWSA 1PH6A 3CP2A 1UAPA 2HMAA 1S72A 2J7KA 2PYKA 4C2MH 3ZIAA 5F4OA 1PRTB 3TP5A 2BM0A 5CBAE 3CCLB 3AVWA 3Q38A 1WFQA 1W6KA 3GTKH 1E0BA 3HOYB 1K3RA 2EXDA 2PCFB 2FMMA 4Q0FA 2R6HA 1WTRA 4JV5Q 5LMUL 1TWFH 1YITB 4DR4Q 1U4PA 2E74C 3I2ZA 4IOCA 4JI8L 4HN7A 1S4MA 4IN3A 1VQOA 1JB3A 3ITPA 5GQOA 3KLWA 4P75A 3I4LA 1BX0A 3LWEA 2YTYA 3S24A 4N8X1 2VUMH 1WSVA 1V0EA 3RZOH 1XPUA 2PMDA 3R3OA 3B8HA 4N3GA 2ZTEA 4K0KL 4DV5L 4MYUA 4X7DA 1YZ6A 2SEBD 2X8KA 3DLLA 3GVKA 1TWCB 4K2LA 5KNCA 2QMUA 4JI0L 1XNQL 1PJ5A 1N8RD 4JG2A 5BSYA 1D2BA 1IL8A 3GDEA 4M2LA 3S17H 1VQNB 2F0OA 5KSWB 4LW1A 5A2QE 1KMHA 4CKBA 3Q3AA 1AE2A 3D6CA 4M1UB 1V1QA 3CCUB 1VQLA 5LMNL 5C0XH 4LFBQ 2EVBA 2PMZE 3DMUA 4BBSG 2K01A 3H0GB 1STHA 1FNWA 1LT3D 1EQRA 1QVFB 1JWMD 1Z47A 1PH1A 2K05A 1QVCA 1BDOA 3W3AA 4KV6A 2IHEA 4MN3A 4XYOA 1VQ9B 2DNEA 2A19A 4KLKA 2R92H 1QOHA 4Z4ZA 2EYMA 1IBKQ 2WR8A 1G2TA 1BUVT 2F0IA 1ENAA 1R4PB 2PZTA 4XQJA 4NXMQ 5LL6X 1U0LA 1B9MA 1BQQT 3JC66 4A3GH 2JJ1A 4FYDA 1VQ4A 4GN3B 1BCPB 1YLOA 3LGJA 1H9KA 1JORA 3E20A 4XQFA 4P72A 4DK3C 1CA5A 3S2HH 1YBYA 1PFSA 2JEBI 3EJIA 4KHZA 3CMAA 4ALPA 1JOKA 1OO9B 4B3RL 2Y0SG 3I3CA 1L2FA 2ZXOA 1YNXA 5LL6S 5C0XJ 4Z4UA 2BM1A 4A3DB 2VBTA 1IKMA 2BVNA 1WDTA 4RPBA 3ERQA 1SEBD 2VQEQ 3S1RH 1T5XD 3OZWA 1JJCB 1I4XA 2BV3A 1I50H 2I0QA 2KEDA 3U4VA 2KENA 4P2CB 3K0YA 5AFWA 5AN9A 3FVQA 1ET9A 3DHQA 1Q86C 4R1JA 5IYPA 1UE6A 1NBWA 4EX5A 1VQ7B 2WAQB 5THXA 5KYIA 1J6QA 3PO3G 4IJLA 3R8BA 2GVBA 4XN0A 4DR6Q 1QFZA 1B2TA 1KNAA 2M00A 2ZL5A 3WNBA 2BH8A 4E0FA 1R5OA 1EEID 5FO7B 2JA6H 1VQPB 4P73A 1BCPC 1ZM2A 1AE3A 4RFBA 5CDFA 1WTPA 4IOAA 2JJQA 2NWGA 2F0SA 1VQ5A 2OF1A 4GNXB 4I7AA 3BC9A 1A63A 3A8IA 1K73D 3OP1A 1JNYA 1BX1A 1BLIA 2I1LA 1GD7A 2WFWA 4O2DA 4ZV4A 3K58A 5DM73 1KRHA 4OIKA 5C3EB 4A3MB 4DUYL 4H13C 4P6VF 3OE7A 3STBC 1C48A 4X3SA 1M90D 4B9XA 1UD3A 5IYNA 4A3GG 4LF9L 5GROA 4X3KA 4DV1L 2NVYH 3SLDA 1K8AC 3CPWB 5CR3A 2OXPA 4XT1B 2PE3A 3I72A 4RMFA 2EOTA 1I7PA 4RPDA 4B3MQ 1IXRA 1PFMA 4F8MA 2NN6I 5FO1A 4BPRA 4C3HB 5I4DA 3PF5A 3ULPA 4A3FH 1TWAB 4DQLA 2XGJA 1R9TH 5GAHC 2LY7A 2Q8TA 2PZUA 3CCRA 3I56A 2RDGA 3E9HA 3M4OB 1QNUA 3AGQA 5IOCA 1J5EQ 2I5HA 1TWGB 3AVVA 3KEWA 3LQEA 4RKLA 4GNXC 2B5OA 5FK9C 1Q8KA 1WCMB 1SNCA 1OXVA 3SGIA 2ZTGA 4XXEA 2XZOA 1QH0A 1G91A 5M5XH 2RC6A 2X85A 4MZ9A 4TSSA 4LF8L 2JEAI 4JBKA 4A3BB 3J7A5 2WACA 5IGGA 4A3IB 1SM4A 2NVTH 3MCAA 4CDEC 3T1HL 4XKWA 3UDXA 1JT8A 4DV7Q 1W2BB 1PA6A 5H5JA 5E7NA 5BSXA 4JW0A 2VBUA 4XL9A 5I9OA 2VNIA 2CQAA 1UE1A 3BDLA 2O5IC 3ASTA 1KDCA 1N33Q 3W2FA 4WFN3 1PHJA 1SDFA 1QX4A 2B63H 4QUCA 1EYAA 3Q23A 5GAGC 5I6WA 1JJ2A 1AP0A 1E64A 4LUVA 4Z4WA 4P3IA 1PH2A 4JBMA 2UU9L 4XLCA 3K7AH 4B3XA 3I90A 2CH4A 1Q1EA 1KZLA 1XTCD 1UMKA 2C4UA 2D9UA 3EFXD 4Y7NB 4X3UA 2LXJA 4Q5VA 2B3GA 2OWOA 2ICIA 3HOVH 3S14H 3AU7A 3V05A 4OPVA 1PYBA 3FDTA 3S1NH 5IT9c 2QKIC 4FDBA 2WB1E 3SVMA 1F9PA 1D1NA 3CCSB 3CU7A 1O78A 1Q82D 2UXDL 4A3FG 3S16H 2ZL6A 1IHZA 1SR3A 1VLYA 3S2DH 2QF7A 1N34Q 3HGBA 1IJFA 3TS2A 5BN3A 1H9MA 3FKIH 1K8OA 5I2XA 1TWHB 3HZXA 4RH6A 4JI7L 1V1PB 4ROXA 4RD1A 2JA8H 4DR7L 4GQNA 3W2DA 4Y7CA 2AKWB 4PZ6A 3CHBD 3K57A 5IT9L 1AW7A 3S1MB 4P12A 4C1NK 2X0KA 3M3YH 1QZGA 1O7ZA 4V190 2P5ZX 4WZKA 4KKUA 5AJ3L 1CT1D 2K5HA 5KRUA 1G7TA 5GV7A 2B2TC 3QB3A 2PW5A 3DM3A 1ELOA 4KHPL 1VMCA 2HQEA 2FXQA 1B3QA 4BBRG 3HOXG 2DYIA 2G5DA 5C5MA 2XNDA 1WP6A 3CC2A 1NSNS 3B78A 1DOMA 1ZM9A 1Q81D 4RD2A 5M3MG 2V7QA 1JE5A 3N6RA 2PQAA 5C4XH 1KRTA 4QMGA 5IYQA 2WZPP 3IRBA 2F3VA 5FLMG 4QL5A 3KF6B 4IZ8A 3U2QA 4F88A 4BXXG 1UEAB 4QVAA 4FXGC 3DUZA 1IL2A 2B63G 1V43A 1BJKA 1JR0D 1MSHA 1GO3E 4M53A 2I5MX 3NP8A 1G6ZA 3P75A 3QOJA 1CA6A 3CB4A 4NP5A 5KGUA 1PMRA 5EQ0A 4AQYL 3HRZC 4MIUA 5L37A 2QTLA 2ZM6Q 5C4ZA 1U4MA 2FFKB 4PNYA 4LFCL 1EL0A 1H42A 1MABA 3TSSA 3ER0A 1N8RC 5CC4A 3PO2G 3HEJA 2NVXB 3M9BA 3K6OA 1EZ8A 3CTAA 1V1OA 3HOZB 2ZXHA 3SK4A 3HAGA 3TP7A 1WOOA 1T6ZA 2WZNA 3WDNA 5IYBH 3DM1A 1Q1BA 3U9SA 4G7OC 3SK8A 1WPCA 3FPKA 5NUCA 4JC0A 4DR5Q 4RGTA 1QGYA 4K6LA 4X3TA 3E5SA 2NBFA 5JJLA 2GREA 1HQRD 3KJPA 1T6XA 2QEJC 5IYCH 4A3EB 4RDLA 1EXMA 4F87A 4J6HA 4B3TL 2XGTA 2D9RA 2YWGA 4LBVA 4MTNA 1MRZA 4B3FX 4KN4C 2D5DA 2PNHA 3OMCA 2IX3A 4PC2A 3WOFA 3BJUA 4DV3Q 4O42A 2DUDA 2L9HA 3MXNA 1B2RA 1HHVA 4A3KG 1PTOH 4B3SQ 1HNXL 4Z4SA 1LM0A 1WYDA 3MEHA 2MO1A 1A3VA 4HIDA 3ASQA 3K5MA 4GKJL 2BCOA 4L5SA 4I65A 2E2IB 4PQXA 2EJMA 3GVLA 1GM5A 4BY1B 4M8AA 3VR3A 3A55A 3T13A 5KIXA 4LF7Q 4J8QA 2Q2IA 1W0JA 3JAMc 1FJGL 2HIVA 3BY1A 2WB1G 2SNSA 2GA4B 1IHMA 1M1KD 2F3WA 1YEZA 1N0VC 2F0KA 1Y1WB 1AZQA 2X6LA 1H8HA 5HURA 2VNUD 4PC6A 5C4JH 1XMQQ 3FPPA 1X55A 5T1GA 3AEVA 2C35B 4M1KA 3I70A 4JPBW 2A74C 4CKCA 1K28D 3H91A 4LK1C 3W2GA 3JAML 1C4QA 3H09A 4LUZA 1F60A 3W1GA 5CMDA 3Q8DA 1LT4D 1CQXA 1CZGA 4K5XA 5IP7G 1EUJA 1H9SB 1CKNA 1ZXTA 3DXJC 1VMPA 4FXKC 2JA5H 3BDOA 2CC2A 1L0YB 2RCFA 3TN2A 3MHBA 2LXKA 3CPFA 2F4VQ 5KNLA 2KCMA 3KOJA 1X65A 1OXTA 3PUMA 4LBZA 2OK8A 1SBBB 1A15A 1EY7A 2XNJA 1KRSA 2KECA 2MQHA 1KABA 1U4RA 2EIFA 1WTOA 1PH4A 1GHKA 5IYCG 5J22A 4XQNA 1E1QA 1N05A 1Q7YD 2YWFA 1FL0A 2VW9A 4OWWB 1K73C 1HZCA 3B6YA 1NMGA 3J7AF 1HA5A 2RDHA 1EY4A 1SLJA 3BZDB 4X64Q 2E5LQ 4TVAB 1S4ZA 2LFNA 4ZLTF 1K8MA 4OONA 4POFA 2ASBA 4A3LH 2ENBA 4YHHQ 4YHBA 3CRZA 1FYCA 2J4XA 3CW2C 3G4SA 1M90C 3KLRA 3HOWH 2Q2HA 4C3JB 1YIJA 4K5VA 4ME3A 5TSSA 2IPKD 5FO8B 1S5DD 2SDFA 4RCNA 4RD4A 2JP1A 5FA6A 4QF4A 4NXNQ 4FP5D 3GTGB 3FEWX 3MVVA 4FWTA 1NR4A 1IBMQ 3VYUA 4AYBE 4UPAA 1ZUNB 2AMCB 4XN3A 3AVXA 1IYJB 2A6HD 1QVGB 3BYTB 1NCVA 2NPFA 3J80i 1EFTA 4JI2Q 1SYGA 1PZKD 5DAUA 5HGQA 1N32Q 5EPJA 3D0FA 3CCQA 2OTJB 4CDFC 2RVLA 1NB9A 4ABNA 4DV0L 1X6OA 4Y9UA 1VF5C 4WQMA 5DLQE 2RA4A 5G3LD 5J1ZA 5IIFA 2EJFC 2YYZA 5HZAA 3BZCA 2B2VA 2CWAA 1CKOA 2MP1A 3IL8A 3TP6A 1UD5A 4JI4Q 1VQ8A 1V5VA 1S5BD 1VDZA 3NTHA 1QGZA 1Y1WG 2F0DA 2BDOA 4QUZA 4N9TA 4DR1L 4XLFA 1HPCA 3BQJA 2JA7H 2UUBQ 4I7ZC 5T1IA 2A68C 2BOSA 1D8TA 3GIRA 4JI5L 5E6TA 2NVQB 1COWA 1EWHA 1UE7A 2NZ1D 4UZUA 5ELDA 3WY9A 1BCPF 3T4AC 3NPPA 4RJLA 4AIMA 2HT1A 3A7AB 4JI6Q 3GTQH 1VQOB 5CV4A 1KK3A 2M5SA 1QGAA 1PJ6A 1GUGA 1QE6A 5GV8A 4OPOA 2N78A 1GAQA 2YU9B 3P27A 2IX1A 1R5BA 1BOSA 4IUQA 1W9XA 3CMMA 3NEMA 4BBSB 5DEHA 1DOLA 3W2EA 4H02A 1JB7A 3K5NA 2H1EA 3BVGA 3G6JB 3TP8A 1STGA 4ZUJA 3ZUGA 2I46A 3H9NA 1X3FA 2XZPA 1I8DA 5TRDA 1XPOA 4IURA 5IT9E 5JEAG 2EDGA 2TMPA 4H7BA 2M2LA 3RZDH 4DKAC 2X6XA 2R3ZA 2MGSA 1Q82C 1Q8IA 2R93G 1GOZA 4OIJA 2OBRA 1JA0A 1T5EA 1F9RA 3CXCA 4UDUC 3HOUH 1YJWA 4CGYB 3M85A 4C2MB 4C3JG 5EJWA 5IGCA 4RM0A 5ISRA 2Z6KA 1CHPD 4DQKA 1HNWQ 4RD3A 2CNDA 4DR6L 3U50C 2UUAL 1KJZA 2QEXA 4DXGA 4A75A 2BH2A 1I4GA 4BWGB 2Y0SB 1HCZA 1TWFB 4CJ0B 2JXMB 1OGIA 3V96A 4DNTB 3OZUA 3UDIA 2VS1A 4GLVB 5F4JA 3EVQA 5E1FA 2AQ2B 1CSQA 3AYHB 1KQSA 1JCKB 2FHTA 3V76A 3GV6A 4HIKA 2F0TA 1VQ4B 1U2RA 4ZGQB 4EH1A 4HSPA 1G2SA 2AQ1B 5BN5A 1SJHD 3P7JA 3ASSA 4B3GA 4XT3B 5M5WH 1YJNA 1Y1VG 2F0HA 3OTOL 1HR0L 1WOPA 1Q81C 2IX0A 4IFDG 3WQZA 4X62Q 1F2LA 1BXTA 1DJRD 4XR6A 4GN4B 4AYBG 3PO3B 4ZRZA 3RR5A 1I6HH 4LF6Q 1SN8A 4TMZA 4B4DA 2F0PA 5D3IB 4LF5L 4X7EA 3PF4A 2C5HA 2R61A 1SYEA 2R7ZG 3L9AX 3KL9A 4YCUA 4B48A 2KOLA 2GVAA 3KFUA 3ZBUA 5HY6A 2K52A 2F0GA 1MBYA 2YWHA 4OWXB 4BA2I 3J7YW 4TKOB 4DV2Q 1QG7A 1JICA 4DV6L 4YCVA 3I55B 3D4DA 1X3EA 4UHVA 4EGVA 3A8IE 2B7BA 5IODA 4X65Q 1GXDC 2Z6BD 3U6BA 3RNUA 5HKKA 2PIAA 4PC1A 2VQFL 3N52A 3QOLA 4RLZA 1UE5A 3A35A 3PUVA 2ZTNA 4A3JH 3ASPA 4A3GB 2UXBL 4R4CA 3I4MH 4A93H 1SMXA 3BNWA 1U5KA 3HOUG 1XE1A 3SEJA 3E3XA 3LWUA 4JI3L 3HOYH 1VQ5B 4DAVA 5FKAC 1EFUA 3TEHB 4R4QA 1YNJC 2EZVA 4GS3A 1VQBA 3CC4A 4MNOA 1KTVA 3AFPA 2DJGC 4DV7L 4PV1C 5D3DA 4RKBA 4DV4L 4HAEA 3MHPA 1WOSA 3T1YQ 4KJOA 2NYZD 2B2YA 1HJPA 4GKKQ 3S1RB 1FVIA 3I7FA 1E22A 1HH2P 2PMZB 1XMOL 3R6JA 2W6IA 4P25A 1N36Q 3TREA 3A1PA 4C56C 2BPOA 2ZZQA 5I9PA 1I4PA 1TWCH 3JAME 2VB2X 3MFGA 2UUCQ 2Q8RE 1B44D 3OWEB 1RHPA 1JC7A 3J81i 1L0WA 2ES2A 4OELB 1EP1B 1F20A 3A54A 3CCRB 1O7LA 3F1ZA 1PTOD 4TSFA 2BGIA 3W1BA 4YAWA 3GTOB 5IYWA 1M1KC 4R8NA 2VBSA 4HIZA 1SRUA 2D2CC 1VQGA 5EKIA 1E43A 1LUZA 1SSOA 2VUMG 1EIHA 3PA2A 4G57A 4RHRA 4Y52H 2EYJA 1IW7C 3CCLA 5CV5A 4X66Q 4JBWA 2NZOA 4Z4TA 3CF5A 4RGNA 1KAWA 3VDYA 3GTPH 2K50A 2P3MA 3S15B 3ASRA 3OIPA 2Z0SA 4ZQ3A 2KHJA 2XWJB 1FNUA 1VQJA 2EYOA 1FR3A 1HNZL 4WJ3M 1GUOA 2HHHQ 3H3VH 4DR2Q 1UWVA 3MC0B 4A3JG 3QSYA 4HJAA 5C0XG 1VQEA 2QILA 1SYDA 3I4MG 1B70B 4A93G 2ID0A 3W5HA 3VO2A 2ZTCA 1VQAA 1E3XA 3CCMB 4P74A 1AZPA 2C9OA 1ESFA 1YHAA 3BCFA 3BH4A 1WTQA 3MXGA 3HKZE 1KAAA 2V7XA 4E6IA 3SEBA 3WBJA 5IE8A 1K28A 4A3DH 1K3BC 1X3QA 5KNDA 1JJ2B 3X3MA 1JOOA 2AQ3B 1VQFA 2R92G 1HTPA 1A8VA 4WWVA 2K33A 3D8GA 2C77A 1VQNA 4A3FB 3CCUA 3CP8A 4XORA 3QIAA 1BR9A 4YELA 1RDPD 1H8EA 3L3OC 4OO1H 4XNFA 1SNDA 4IUPA 2VZLA 4TMXA 3DEPA 3SDZA 1EP3B 1E1RA 4RDKA 1XQBA 1QWYA 1XXGA 2QA4A 3RLFA 4K5WA 4M4SA 4UP8A 4OEMB 1QG0A 1F2ZA 2DEUA 3KDFA 1P8LA 2B8FA 4LFAL 1WTHA 1M8AA 4DFAA 2Q6IA 3BS1A 2EY2A 4P71A 1PH9A 3GTMH 4HJ9A 2DY7A 2K4KA 5LMUQ 2NVTB 2BA0A 2HQLA 1RCVD 3SR1A 5COYA 1EFCA 3C46A 1D5MC 3HOXB 4BBRB 2E2JB 1HUNA 1VLOA 3GTLB 1HFGA 3B82A 3NQIA 1SXTA 3VYTA 3T51B 3PUZA 1VQKA 5M3MB 1BPLA 4RCYA 4MHEA 1VHEA 1SNMA 1EYGA 2VNHA 4TN1A 4ID6A 3KF8A 5A89A 1OXXK 2CH4W 2F0LA 3A5ZB 5C3EH 4A3MH 4K0KQ 2BSAA 2HLDA 1KL9A 4DV5Q 2B63B 2DERA 5CV8A 1E63A 3CCEB 2ZBUA 4II2A 1D8LA 4JI0Q 1BQEA 4XIGS 1S0UA 1XNQQ 2DOGA 5K36H 3AGPA 2GN5A 1EFRA 2JA6G 1EWYA 1XNRL 2VY3A 3GSIA 5LMNQ 4Y9RA 2JE6I 3PMFA 4RWSC 2Z4HA 5E4WC 4FVMA 1KLGD 2EFGA 3NELA 3GV3A 4KK7A 2JQOA 3X3NA 4XLHA 4PMCA 1GUNA 3BVMA 3HOVB 2LSSA 1ILPA 2A5HA 4R4IA 3J7ZC 4C3HH 3PO2B 4Z4YA 3MXUA 1VS0A 2BE5D 3SK6A 1IYUA 3S1NB 1FDRA 2OEOA 1VQCA 2JSOA 3F8TA 1HA3A 1D7QA 2OYNA 5DN6A 1XPRA 1SE3A 1CK1A 2GJKA 1A3TA 1B50A 2ZXRA 3S2DB 2B29A 1B3AA 2B2WA 1VQPA 1RL2A 4R8IA 3W2IA 4OO1G 2FVGA 4M0LA 4CQJA 2Q6OA 3G6EB 4IFDI 1KD1D 1WCMH 3SLNA 3W2HA 2QDXA 1NNXA 1TS4A 5CGKA 3HS0C 3VA7A 4GNXA 2HDMA 4NCNA 4XDXA 4DR3Q 4A3IH 1GUWA 3VR6A 3ZPNA 3T16A 5BR8L 3M3YB 1OTCA 3SKBA 4A3KB 2F0JA 1Q9SA 1EOVA 4B3RQ 2YV5A 3V2TA 1WU8A 2YTVA 1L0XB 4XOPA 1DDGA 1F2YA 1FNVA 4IW3B 1VJSA 5JAVA 2ZJPA 2EY1A 5IGFA 1WSRA 3EIVA 2KHIA 1UEBA 3D31A 2Q8IB 3HKZG 1XB2A 5C4XB 1UD4A 3MXNB 2WB1B 2PI2A 3E1YE 3PSIA 1J9ZA 3Q6SA 3SHLA 2QDBA 1IBLL 3K59A 2JN9A 4XM3A 4RD0A 5EGTA 1X32A 1D6EC 4LWCA 4RHSA 1OGJA 4K8JA 3C2PA 2F0WA 1LLRD 2ZBVA 1EFID 3BG3A 3VR2A 1O7YA 1KXLA 3ND9A 1U4LA 1DGSA 1TR5A 4HSVA 1NUCA 3RUZA 1W3SA 1XTDA 4YAUA 1TTTA 3HKSA 2O4XA 3I4NH 1PV4A 1KC8D 3EA6A 1K8GA 2NTTA 3PVDA 3CQZB 3G7LA 3NTIA 2K5NA 4IO9A 3ERSX 1PH5A 1Q90A 1HRJA 4R71A 1CNEA 4KN7C 4X7FA 3P20A 5ELFA 3RLNA 4OHJA 3AFQA 2EY6A 3M7NA 2DGYA 3U9OA 2CWPA 1JQYD 1JB9A 5IYRA 4JYAL 5H1SE 1TWHH 4APVA 3E9IA 1CI3M 1Q46A 1VQMB 1DM0B 1OB0A 1N06A 3WBKA 4PZ7A 4LF9Q 3S1MH 4WORA 2UXCL 3MA2B 4DV1Q 5CBEE 2K32A 1SKYB 4O1NA 3CCVA 3ONUA 3T53B 3HOVG 1L1OA 1NTGA 2DY8A 2BF4A 1SKQA 4A4IA 1Y0YA 1FRNA 4DAMA 1AMOA 4X06A 4U68A 1PTOB 2XNCA 3J80c 1R4QB 2M9VA 5GADC 2EIXA 3RN2A 1IB0A 3D4RA 2N55A 4YY3L 4YWKA 4DUZL 3FKIG 4P22A 4G7XA 2AHOB 5IP9H 4HMIA 3KYHC 2V7VA 2JA8G 2K6AA 4IUUA 4GZYC 1IZ6A 1UNSA 3I73A 3LNNA 3KJOA 2BA1A 3L0OA 4HEDA 4XTCS 3ULJA 4RD6A 1VHOA 3J80L 2WKDA 1A3UA 1PYSB 1AFPA 3G4SB 3OYYA 2V7TA 1LO5D 2Z6BA 3P1HA 1PRTD 3PIPA 1YIJB 1W34A 1E2WA 1X56A 3MWYW 5C0XI 5C4JB 3F2CA 4LF8Q 2E2HB 3PUXA 1EU4A 1DDIA 2OTLB 1SNPA 2AWNA 5M5YB 2F0EA 3K81C 4PABA 3NBIA 3T1HQ 4JOIA 5EKKA 5LMNW 3C1FA 1V1PA 3KLSA 1JOQA 2TSSA 3WXMA 2O2LD 2WPDA 3PIOA 1BBXC 2NVXH 2GPJA 3I4NG 3DEOA 3HOZH 5C4XG 1DG1G 1KTKA 2X6YA 2BMWA 4PC7A 1MD2D 1KDAA 2K5VA 4EQPA 5IWAL 1PTOC 4QHYA 3OJXA 1GKHA 5FLXc 4TMTA 4K2KA 2D3NA 3CCQB 4QCLA 4RGOS 4OP7A 4RAUC 1SFOH 4A3EH 5I6YA 4FN5A 2OT2A 5C3XA 4N9PA 4KTAA 4ZCLA 1MGSA 1YI2A 2W6JA 5JPNC 3GTJH 3D3RA 4KMUC 2F0NA 1Z7TA 2ZJQA 4ZYSA 3K7UC 4OX9L 2IHFA 1I94L 3PA1A 4O0AA 2UU9Q 3S1QH 3Q6RA 1EIFA 2CK3A 2H5XA 1K83H 1V9PA 3QG1A 4HJ8A 2KEEA 3PV0A 5FLXL 4DAPA 1D1KA 1PVOA 1D5XC 1LT6D 3MMPA 1QUEA 2LZJA 1J8IA 5IYBG 4OL7A 1NMFA 2DY1A 5H59A 1CKMA 3CMEB 4BY1H 2QGQA 3PUNA 5A8AA 1G51A 1G7CA 4X0CA 4AVZA 1Q86D 2UXDQ 3MAQA 2RHSB 1NR2A 2A69D 2Q2UA 2Q6LA 1WTHD 2OQ0A 4JVZA 3OFNA 3KK7A 4KKSA 4JI7Q 2E1BA 4HCEA 4DR7Q 2PPBC 4KKTA 4U673 4C1NI 2D0PA 1VQHA 4H44C 1C0AA 5E3FA 2EYPA 2R93B 1HZAA 4JV5L 4DR4L 5AJ3Q 3G71A 2E2DC 3NSWA 4LF6L 4HIOA 4OOXA 2B2VC 1QUQA 2X6GA 1X3GA 4TQUS 4FXDA 4PC3A 5EKLA 1W35A 2NN6H 3TRZA 3ZC3A 1YJ9B 1YHQB 1EP2B 1BVSA 1A62A 1TIID 2Z1CA 2JDIA 5IYDH 3VMFA 3DDYA 2ZZGA 3CXCB 3K80C 3OHXC 2R7FA 5C4HA 2F0FA 3NK9A 4K14A 1K8AD 4C3IH 1ZM3A 4CDDC 1BBUA 1WTVA 3OEEA 3WNCA 3AVYA 1ET6A 2N3SA 1Y1VB 3W5VA 2B2UA 2F4IA 3NQTA 4LBWA 4IUNA 1NBMA 1PJ7A 4KD3A 2PW7A 3MEFA 4AYBB 1NY4A 1BBWA 4LFBL 5B6IA 4AQYQ 3GTQB 1ML0D 2CHBD 1VQMA 1TU2B 1EU3A 4KHVA 5JPMC 3OSOA 1E3PA 3PGZA 2JA5G 2R7ZB 1LV9A 3PUWA 4JI1Q 4GOPA 1HUMA 2R6GA 1S72B 4LF4Q 2CBXA 2OBSA 5DSZA 5FJ8H 2G9DA 2ZJRA 4J15A 2XOKA 1YJNB 3J7AV 2DETA 1TY0A 3A3GA 4PG3A 4P3YA 3GTGH 4TMWA 3TBIB 1IBKL 4FF3A 2ZL7A 5ELCA 2NTSA 4NXML 1SJED 1J9OA 1JJGA 2F03A 1I4RA 2RQXA 1DARA 4G7HC 2KBNA 5KNBA 2VNJA 4R9WA 4B3TQ 2RBMA 3RZDB 4PAAA 2MPMA 2MNAA 5A88A 2DN8A 3F2UA 4QIWE 1JA1A 2Z6KC 4HIMA 3JU4A 1CNFA 4A3LG 1GO2A 2SNMA 2HCJB 3M4PA 4LAAA 1F2MA 4UP9A 3HOUB 3ND8A 1A6XA 3HOWG 1HNXQ 2QDLA 2VNKA 1S3OA 1EIYB 3ICEA 1JWSD 4Q7JB 4GKJQ 5M3FH 1ONLA 1KDBA 2VQEL 3BVZA 1FRQA 2C78A 4YALA 1EOTA 1JWUD 1SE2A 4L5TA 1TLLA 3J81c 1SYFA 4HR7B 4XD7A 2NN6G 1M4VA 1H95A 1VQLB 2HIXA 5ELEA 2CFMA 4F7XA 1RKNA 1YVCA 4EQOA 4B47A 4K1XA 3OJWA 4NNJA 4YCWA 4NBSA 5IYDG 1FJGQ 1PYWD 1I3QB 2WJYA 2R9VA 3CCJA 4JMQA 1A2TA 3VA5A 1K0RA 2Z9HA 2NVQH 2KJXA 4C3IG 5FNZA 2L5TA 4WZEA 4A3CH 3CC4B 4EQNA 1H9RA 5M5WB 3IAYA 4N8FA 2L15A 1I18A 3C1EA 3GTKB 3TMEA 4BY7H 3ULLA 3J81L 3F2DA 1RF2D 5EAYA 4DR2L 3CC7A 2XZLA 1S5FD 1BMFA 4G1BA 3O13A 2WYRA 5G3LF 4IPHA 3NXWA 1QVGA 3ONYA 2YU9H 2XIWA 4R4TA 1YHBA 1QILA 1GVPA 3C2QA 1WD0A 1EY9A 4NW2A 5KW9A 2A8VA 2VUMB 1TS2A 1YNND 2RF4A 3GP7A 3RZOB 2JA7G 3I91A 2QE7A 3RMHA 3CMAB 1QCBD 1ASYA 3TS0A 4Z9CB 5DM63 4AH6A 3KBGA 1I4QA 5ELNA 5D65A 3QO2A 4G6IA 2NUCA 4BS9A 5CV7A 3K5LA 1ILQA 4V0BA 3PUYA 1KK1A 5EBDA 3GVJA 3CAMA 3S17B 1QNKA 4DNIA 1X9NA 4IALA 1E62A 2KVOA 4A3JB 1BNZA 3EROA 4U9UA 1GHJA 1VQIA 5C44H 5JJIA 4QQBX 3I4MB 4A93B 2XEXA 3QR8A 4NPSA 3JQQA 3SE0A 4B3ML 1U9RA 1SE8A 1UUPA 5BN4A 2HD3A 4UZEA 5M3FG 3WNDA 4FF1A 2B2YC 2RKSA 4ACBA 2R92B 2XSCA 1J5EL 3J80E 3OMGA 2VL6A 2EPBA 1TY2A 3Q0AA 5M9OA 2E1RA 5DS0A 4B43A 3AQQA 3R6KA 1Z6HA 2IL8A 2KQ3A 1AIPA 2PZWA 1T6YA 4YAOA 2V31A 4ASUA 1VQ6A 2L11A 2V1CC 3CD6A 3A8KA 4A3CG 1H85A 1TS3A 3FP9A 3S2HB 1XX8A 1E2ZA 1ENFA 4DAYA 3PO3H 3ZBTA 1WJJA 4BY7G 3MZ5A 2IJ0A 2XRQD 2HDNB 3CP0A 4DV0Q 4BA1I 1S5ED 1HVXA 2X3UA 1FGBD 5C6AA 3BYYB 4DXFA 2WV6D 1UD2A 3FRPB 1RIPA 2L0CA 4JK1C 4ZCKA 3JQPA 1PRTC 2Z8LA 1I50B 1RJTA 1N33L 4HCSA 3OW2A 2QA4B 3R2IA 1BO0A 1EZ6A 4DR1Q 2X69A 3KDFB 3FKSA 3NBHA 1O7IA 4KI0A 4JI5Q 1EQTA 3RLOA 1WORA 2OCEA 2VXWA 1ENCA 3W5UA 4K8IA 3GTPB 1ZYRD 4XLAA 5FLXE 4ZKCB 3GQBA 3I56B 1Q12A 1PFBA 4UZFA 2F4NA 2L12A 2F3IA 5JVH3 1SMYD 1G291 1A8PA 1OXUA 3R93A 5C44G 1RQPA 3CKIB 4FXUA 2JA6B 1VQKB 3FMCA 3H0GH 4DR3L 4DPGA 1ZM4A 2SOBA 5J39A 4H9GA 1AEXA 1E2VA 1STNA 1PFNA 1W87A 3KF8B 2K75A 3QFCA 4LUOA 2WAQE 1WVLA 2MUYA 2BGJA 3LO8A 1II3A 2CW0D 4QVJA 1YITA 1N34L 3UE0A 1F77A 3TZUA 4LNQA 1EIGA 2D74A 1JMCA 1STBA 1QJOA 5IGDA 1B1ZA 2CVRA 5C3WA 2JYOA 4X05A 4G5GA 2QCPX 3UDFA 3OZVA 2YWEA 2GJRA 4KJNA 5FL7A 4RA8A 1QFYA 2ZXPA 4L5QA 5K5PA 3I8ZA 1CQFA 5JJZA 3HFZB 4AC9A 2NVYB 4L6TB 3K5OA 3H94A 2A69C 3A7LA 2F0QA 3HOYG 2Z4IA 2GQFA 3R2TA 5I2YA 3I55A 2AUJD 1DONA 2Q6KA 2R7DA 1AH9A 1Q7YC 1LTAD 4DN4M 2C4TA 2UUAQ 3GTOH 4YAFA 2RDFA 3D26A 1EYCA 3GTMB 4HE5A 3DWPA 1WD1A 1R9TB 2MJ8A 1XFOA 3H3VC 2WKCA 2V7WA 1NE3A 4B9WA 2F1LA 3AB9A 5ELBA 2ZTDA 1F9QA 1STEA 4ZK9B 4NMZA 3P26A 4P2NA 4OOSA 4ULLA 3OAAA 2RSNA 3S9WA 5HXBA 5HGTA 1VQDA 1SAPA 5EPLA 1QVFA 3HKZB 2RC5A 4QV2A 2O5JC 3S15H 2PI2E 1HR0Q 3OTOQ 5M5XB 2IY5B 1VQ9A 3SK5A 1WTXA 2A6HC 3PIP3 3BY2A 2WSSA 3VR4A 1FGUA 5KEEA 2J0TD 4QY7A 4F7DA 4X6AH 4IQZA 2ZM6L 4JI8Q 4LF5Q 1CM9A 1N08A 2WINB 1PTOF 3CRLC 5F2DA 3H0GG 4OPSA 2XRSD 3PIO3 3H15A 2F0MA 3D4WA 3VNVA 1TS5A 3OKXA 2X53S 2NB0A 3BDCA 3AMUA 4DV6Q 2QN6A 3MXPA 4CHTB 4DR5L 2JJ2A 4XOTA 3Q24A 2CCZA 4QB4A 1HXYD 3E0JA 5IGBA 2B2WC 4RDJA 3JQRA 1B23P 3M7GA 4PMBA 1GUSA 1YX2A 2KCCA 1FNDA 2FJ2A 3CC2B 2VQFQ 1TXYA 1PLFA 2H4OA 3K7AB 3Q22A 1C9OA 2DNCA 3PCOB 1DZ1A 2PQAB 4DV3L 4ZCIA 3A8JE 1LTTD 2UXBQ 4CKEA 3SXHA 4B3SL 2I5LX 1SYBA 1VQ7A 3S14B 4L63B 4JI3Q 4P26A 2AUKA 3WWVA 3VYSA 1D5ZC 4C0SA 1HZ9A 2A73B 2IT1A 4A3DG 5TY0A 1TWAH 4HJ7A 1CFMA 3KBXA 4KY6A 1TT2A 3H6MA 3M4OH 3HOXH 4BBRH 1FX0A 1Y0RA 1CUKA 3NENA 1XJVA 4DV4Q 2E2JH 4FF2A 3PQIA 3S16B 2A68D 3GTLH 1TWGH 5FO9B 4LF7L 4J1MA 4NKLA 3ONAB 3TQYA 5M3MH 3FKIB 3WYAA 1GJRA 4CJ1B 4ZAIA 2NV4A 3OOCA 4FO2A 3CCVB 3CCMA 2JA8B 3D6WA 4RG1A 1XMOQ 5FLMH 2WAQG 1IJEA 1ZEQX 2CQOA 5TV2A 1L1OB 4KY5A 3J81E 3BCDA 1XMQL 1A2UA 4YWMA 4GN5A 4A3BH 2K5WA 1LTBD 1K9MD 4BXXH 1HFNA 5JOBA 4X7CA 3VYRA 4P6YA 3W5OA 4K6DA 1EQVA 2XVSA 2D0OA 4XMYA 1LABA 2DJFC 2KCTA 1E1OA 2F1MA 4CDCC 1ICWA 1NJID 4CBVA 4YWLA 2KVMA 4UP7A 3CESA 1NB0A 4OWTB 1D2EA 1G7RA 2A6ED 3J81j 1WOCA 3OEHA 4KD4A 3Q6QA 2K14A 3J81k 3CPWA 1H9JA 3PO2H 3I4NB 1N9WA 2QGGA 2F4VL 4YXWA 1S5CD 1I6VC 4FK8A 2JA9A 2XTIA 5C3EG 4A3MG 1SE4A 4QGUA 1TVCA 2JIZA 4ILWA 3QFTA 1ICFB 1KHIA 1E24A 3AVTA 1RTOA 2ZZEA 1EY5A 2MO0A 1C8CA 5K36G 3DWAA 2E76C 4NDXA 5CV9A 2B39A 3ZZUA 3E0EA 1YNNC 1HNZQ 4IJHA 4Y7NH 4X64L 1LTID 2E5LL 1MHWC 3LQ6A 1XYIA 1L1OC 4B44A 3FJOA 2WIIB 4Z4VA 1CQVA 4IPDA 5CORA 4YHHL 4PMWA 2K28A 4A3KH 1MJCA 1SROA 2EY5A 1GR1A 4C3HG 2C5BA 2ZITA 4ZKBB 3EN2A 1KNEA 3NUCA 1E7ZA 3CCEA 4NXNL 5CYUA 4G4KA 4MTKA 2YTXA 4YIJA 3KUPA 1TQOA 5EMNA 1IBML 1X3PA 1YI2B 2E8GA 1NAPA 1XWEA 1W2BA 1QB5D 1X54A 4DUYQ 3IFTA 3F2BA 2FX3A 2LMCB 3L7ZC 3I4OA 2ALYB 2C5CA 4GLAC 1WCMG 2ATWA 3A8JA 1CKNB 1KK0A 1OB2A 4JI2L 1QFJA 4RCOA 1ZKOA 3FHWA 3NHHA 4OXPA 3UE1A 4Z1MA 4A3BG 1HR0W 1N32L 4A3IG 3RN5A 4IPCA 1HZBA 3IFDA 5CV6A 2JK8A 2KUMA 3URYA 4ZUIA 2VBVA 2NZHA 1CZWA 1RODA 2QW7A 1RD9D 4JOIC 4LFAQ 2FMCA 1E3ZA 3WOEA 2GK6A 4DA2A 2B2TA 5J3OA 2EYHA 5FO0A 2A1AA 2VB3X 4JI4L 4POGA 3MFYA 1UD6A 5IP7H 4OGQC 3G6EA 4JI1L 1D1IA 4X07A 3CQZH 4LF4L 4XQQA 1CSPA 4DNRB 1HZEA 4P9SA 2D3LA 1LACA 4DGZA 1V8QA 3I1FA 4C43A 2UUBL 1MI2A 2CKZB 1BF4A 4KY7A 4L5RC 4ME5A 2EQSA 1OHHA 5TR9A 4ACAA 2DIEA 3CCSA 4ODGA 3G71B 4LBYA 3L2PA 1Y69U 2ZZFA 1SFOB 5FOBB 1T9HA 4JI6L 1QUQB 2BN4A 1TVXA 4G7ZC 5EPKA 2EYLA 1YNJD 1G7SA 2I07B 2K5QA 2XN9C 4EQ5A 1OXSC 2OQKA 3GTJB 5KYLA 2RSOA 1IKLA 2F0VA 2EJGC 2V4DA 3S1QB 3LX0A 1PXUA 1XNRQ 1K83B 5A2QL 5A35A 3K0XA 3NTKA 2JA5B 1ZYRC 3QJYA 1CHQD 2MFIA 3OIQA 1PH8A 2K1BA 3E6ZX 4PGOA 2PO4A 4FF4A 1B4OA 1SMYC 3SJZA 3V7AA 1EY8A 1Y8PB 3BZKA 2K04A 4R4OA 4J0QA 3U58A 3C3LA 1JE4A 2Q2TA 2GJPA 2LS01 2E75C 3GO5A 1DD2A 1EY0A
chains in the Genus database with same CATH topology
2PQEA 1EYDA 2CW0C 2D62A 4L8JA 4WRDA 4G7WA 2KA7A 2GK7A 2VJJA 1LT5D 3HOWB 1PZID 5IGEA 1IW7D 4WJWA 2X6WA 1FD7D 1B53A 2PNRC 1STAA 4DU9A 1I4HA 1AN8A 3T56B 1MSGA 2AWOA 4DK1A 4H0LC 1W6JA 3QWNA 4KY6A 1PKVA 2EE1A 2LKVA 2XNAC 3HG9A 2HCIA 2FINB 1E79A 1GUTA 2B2UC 1BCPD 3UI2A 1DXMA 2L4NA 3KLSX 2ZT9C 1VCIA 2K03A 4C3IB 1F9SA 5EBCA 2ICEC 1PRTF 3GD7A 2N88A 1HTLD 1HQMC 1DYQA 4IUVA 3G05A 3A56A 4II3A 2K5DA 2L55A 2L1BA 2HCCA 4FNFA 2HDLA 4HMJA 1ESRA 1IYVA 2JA7B 4OO1I 3FPUB 2WJVA 3DWQA 4S3SA 3EQLC 5JEAH 3MTSA 1B9NA 1GJXA 1Y8NB 4LMQD 1LTSD 3HP3A 4RGMA 5C5LA 4EVOA 1EY6A 1V0FA 2J7ZA 1SNQA 4UAIA 1NRKA 1CTMA 4XONA 3ZYYX 1KLUD 2F0UA 5LHY1 1O80A 1TKWB 1Y8OB 4XKVA 5M3FB 2IW3A 2HUGA 1H9SA 2BE5C 4YEJA 4QUFA 4XYQA 5D14A 1G8ZD 2XWBB 1EEFD 1SYCA 1PZJD 2VJIA 5E4XA 4HTHA 4DF7A 5JEAJ 4IUTA 4IFDH 3A8KE 1RTNA 1DCZA 3IKJA 1PDQA 2ZXIA 3A3BA 4BY7B 1W0KA 3VR5A 4B08A 5JVG3 4TRDA 2IWHA 2MHVA 3TZDA 1Q3LA 4TT3A 5DNFA 3TDQA 3NE5B 4QIWB 1VF7A 2G9HD 2EYFA 1WTWA 2EXZA 4DK0A 4LJZC 3M4YA 2KCNA 2A6EC 1STYA 2B8GA 1I6HB 3NWTA 2BDNA 3OPOA 1EWCA 1SNOA 4IFDJ 1DOKA 1LTGD 3OWFA 5C44B 1HA6A 4CJ2C 1UD8A 2WP8J 3RD4A 1LTRD 5IK2A 2K7VA 3CRKC 2KHSA 4XLEA 2F43A 3OW7A 3NWSA 3CP2A 1UAPA 2PYKA 3ZIAA 1PRTB 3TP5A 5CBAE 1W6KA 3HOYB 1E0BA 2PCFB 2FMMA 4Q0FA 1WTRA 1U4PA 2E74C 4HN7A 4IN3A 3ITPA 3I4LA 3LWEA 1V0EA 3R3OA 2SEBD 2X8KA 3GVKA 1TWCB 4K2LA 5KNCA 1D2BA 1IL8A 2F0OA 5A2QE 1KMHA 4CKBA 3D6CA 4M1UB 5C0XH 2EVBA 3DMUA 2K01A 3H0GB 1STHA 1FNWA 1LT3D 1JWMD 1Z47A 2K05A 1BDOA 3W3AA 4KV6A 4MN3A 4XYOA 2DNEA 1QOHA 2EYMA 1G2TA 1BUVT 2F0IA 1ENAA 1R4PB 2PZTA 4XQJA 5LL6X 1B9MA 1BQQT 2JJ1A 4FYDA 1BCPB 1H9KA 1JORA 4XQFA 1CA5A 2JEBI 3EJIA 4KHZA 1JOKA 1OO9B 3I3CA 2ZXOA 5LL6S 5C0XJ 4A3DB 1IKMA 3ERQA 1SEBD 1T5XD 1I4XA 2KEDA 4P2CB 3K0YA 5AFWA 3FVQA 1ET9A 3DHQA 2WAQB 5KYIA 3R8BA 4XN0A 1B2TA 1KNAA 2M00A 4E0FA 1EEID 5FO7B 1BCPC 4RFBA 5CDFA 1WTPA 2NWGA 2F0SA 2OF1A 3BC9A 1BLIA 3K58A 5DM73 5C3EB 4OIKA 4A3MB 4H13C 3OE7A 1C48A 4X3SA 4B9XA 1UD3A 4X3KA 5CR3A 2OXPA 4XT1B 3I72A 2EOTA 1PFMA 4F8MA 2NN6I 4C3HB 5I4DA 1TWAB 2XGJA 2LY7A 2Q8TA 2PZUA 2RDGA 3M4OB 1QNUA 5IOCA 1TWGB 3KEWA 4RKLA 5FK9C 1WCMB 1SNCA 1OXVA 2ZTGA 4XXEA 2XZOA 1G91A 4TSSA 2X85A 2JEAI 4A3BB 2WACA 5IGGA 4A3IB 4XKWA 4XL9A 5I9OA 2CQAA 3BDLA 2O5IC 1KDCA 4WFN3 1SDFA 4QUCA 1EYAA 3Q23A 5I6WA 1AP0A 4XLCA 3I90A 1Q1EA 1KZLA 1XTCD 2D9UA 3EFXD 4Y7NB 4X3UA 4Q5VA 2ICIA 3AU7A 3V05A 3FDTA 2QKIC 3SVMA 1F9PA 3CU7A 1O78A 1IHZA 1VLYA 2QF7A 3HGBA 5BN3A 1H9MA 1K8OA 5I2XA 1TWHB 3HZXA 4RH6A 1V1PB 4GQNA 3W2DA 3CHBD 3K57A 5IT9L 1AW7A 3S1MB 4C1NK 1O7ZA 4V190 4KKUA 1CT1D 5KRUA 2B2TC 3QB3A 2PW5A 1VMCA 2HQEA 5C5MA 2XNDA 1WP6A 1NSNS 1DOMA 2V7QA 3N6RA 4QMGA 2WZPP 2F3VA 4IZ8A 4F88A 1UEAB 4FXGC 3DUZA 1V43A 1JR0D 1MSHA 3NP8A 1G6ZA 3P75A 3QOJA 1CA6A 4NP5A 5KGUA 1PMRA 5EQ0A 3HRZC 4MIUA 5C4ZA 1U4MA 2FFKB 4PNYA 1EL0A 1MABA 3TSSA 5CC4A 3HEJA 2NVXB 3K6OA 1EZ8A 1V1OA 3HOZB 2ZXHA 3SK4A 3HAGA 3TP7A 3WDNA 3DM1A 1Q1BA 3U9SA 4G7OC 3SK8A 1WPCA 5NUCA 4RGTA 4X3TA 4K6LA 3E5SA 2NBFA 1HQRD 2QEJC 4A3EB 4F87A 4J6HA 4B3FX 4KN4C 2D5DA 3OMCA 2IX3A 3WOFA 4O42A 2L9HA 3MXNA 1HHVA 1PTOH 3MEHA 1A3VA 3K5MA 2BCOA 4I65A 2E2IB 4PQXA 2EJMA 3GVLA 4BY1B 4M8AA 3VR3A 3A55A 3T13A 5KIXA 4J8QA 1W0JA 2SNSA 2GA4B 2F3WA 1Y1WB 2F0KA 1AZQA 2X6LA 1H8HA 5HURA 2VNUD 3FPPA 5T1GA 3I70A 2A74C 4CKCA 1K28D 3H91A 4LK1C 3JAML 1C4QA 3H09A 5CMDA 1LT4D 1CZGA 4K5XA 1H9SB 3DXJC 1ZXTA 4FXKC 1VMPA 3BDOA 1L0YB 3TN2A 3MHBA 5KNLA 1OXTA 1SBBB 1A15A 1EY7A 2KECA 1KABA 1U4RA 1WTOA 1GHKA 5J22A 4XQNA 1E1QA 3J7AF 1HA5A 2RDHA 1EY4A 3BZDB 1S4ZA 2LFNA 4ZLTF 1K8MA 2ENBA 1FYCA 2J4XA 3KLRA 4C3JB 4K5VA 5TSSA 2IPKD 5FO8B 1S5DD 2SDFA 4RCNA 2JP1A 4QF4A 4FP5D 3GTGB 3FEWX 3MVVA 1NR4A 3VYUA 4XN3A 2A6HD 3BYTB 1NCVA 1SYGA 1PZKD 5DAUA 5EPJA 2RVLA 4ABNA 1VF5C 5J1ZA 5G3LD 2RA4A 5IIFA 2EJFC 2YYZA 2B2VA 3IL8A 2MP1A 3TP6A 1UD5A 1S5BD 1VDZA 3NTHA 2F0DA 2BDOA 4N9TA 4XLFA 1HPCA 4I7ZC 5T1IA 2A68C 2BOSA 2NVQB 1COWA 1EWHA 2NZ1D 4UZUA 5ELDA 1BCPF 3T4AC 3NPPA 3A7AB 5CV4A 2M5SA 1GUGA 1QE6A 2YU9B 2IX1A 1BOSA 4IUQA 4BBSB 1W9XA 3CMMA 5DEHA 1DOLA 3K5NA 2H1EA 3BVGA 3G6JB 3TP8A 1STGA 4ZUJA 2I46A 2XZPA 1I8DA 4IURA 5IT9E 5JEAG 2EDGA 2TMPA 4H7BA 2M2LA 2X6XA 2R3ZA 2MGSA 1Q8IA 1GOZA 4OIJA 1T5EA 1F9RA 4UDUC 4CGYB 3M85A 4C2MB 4C3JG 5EJWA 5IGCA 5ISRA 1CHPD 4DXGA 1I4GA 4BWGB 2Y0SB 1HCZA 1TWFB 4CJ0B 2JXMB 3V96A 4DNTB 3EVQA 5E1FA 2AQ2B 1JCKB 2FHTA 3GV6A 2F0TA 4HSPA 1G2SA 2AQ1B 5BN5A 1SJHD 3P7JA 4XT3B 4B3GA 2F0HA 2IX0A 4IFDG 3WQZA 1F2LA 1BXTA 1DJRD 4XR6A 3PO3B 4ZRZA 2F0PA 5D3IB 2R61A 1SYEA 3L9AX 2KOLA 2F0GA 1MBYA 4BA2I 3J7YW 4TKOB 1QG7A 1JICA 3D4DA 4EGVA 3A8IE 5IODA 1GXDC 2Z6BD 5HKKA 3N52A 3QOLA 3A35A 3PUVA 2ZTNA 4A3GB 3LWUA 4DAVA 5FKAC 1YNJC 2EZVA 4PV1C 5D3DA 4RKBA 4HAEA 4KJOA 2NYZD 2B2YA 3S1RB 2PMZB 2W6IA 4C56C 2ZZQA 5I9PA 1I4PA 3JAME 2VB2X 3MFGA 2Q8RE 1B44D 3OWEB 1RHPA 1JC7A 3A54A 1O7LA 1PTOD 4TSFA 3GTOB 4R8NA 4HIZA 2D2CC 5EKIA 1E43A 1SSOA 1EIHA 4G57A 4RHRA 2EYJA 1IW7C 5CV5A 4JBWA 4RGNA 3S15B 3OIPA 4ZQ3A 2XWJB 1FNUA 2EYOA 1FR3A 1GUOA 3MC0B 5C0XG 2QILA 1SYDA 2ID0A 1E3XA 1AZPA 2C9OA 1ESFA 3BCFA 3BH4A 1WTQA 3MXGA 1KAAA 4E6IA 3SEBA 1X3QA 5KNDA 3X3MA 1JOOA 2AQ3B 1HTPA 2K33A 3D8GA 4A3FB 3CP8A 4XORA 3QIAA 1BR9A 4YELA 1RDPD 1H8EA 3L3OC 4OO1H 4XNFA 1SNDA 4IUPA 3DEPA 3SDZA 1E1RA 1XXGA 1QWYA 3RLFA 4K5WA 1F2ZA 2B8FA 1M8AA 4DFAA 3BS1A 2EY2A 2DY7A 2NVTB 2BA0A 1RCVD 3SR1A 5COYA 3C46A 1D5MC 3HOXB 4BBRB 2E2JB 1HUNA 3GTLB 1HFGA 3NQIA 1SXTA 3VYTA 3T51B 3PUZA 5M3MB 1BPLA 4MHEA 1SNMA 4ID6A 3KF8A 1OXXK 2F0LA 2HLDA 2B63B 5CV8A 4II2A 4XIGS 5K36H 1EFRA 2JE6I 3PMFA 4RWSC 2Z4HA 5E4WC 4FVMA 1KLGD 4KK7A 3GV3A 3X3NA 4XLHA 4PMCA 1GUNA 3BVMA 3HOVB 1ILPA 2A5HA 3PO2B 3MXUA 2BE5D 3SK6A 1IYUA 3S1NB 2OEOA 2JSOA 5DN6A 1SE3A 1CK1A 2GJKA 1A3TA 1B50A 2ZXRA 3S2DB 1B3AA 2B2WA 4R8IA 4OO1G 4IFDI 1TS4A 5CGKA 3HS0C 3VA7A 2HDMA 4XDXA 1GUWA 3VR6A 3ZPNA 3T16A 3M3YB 4A3KB 2F0JA 3V2TA 1L0XB 4XOPA 1F2YA 1FNVA 1VJSA 5JAVA 2EY1A 5IGFA 3D31A 2Q8IB 5C4XB 1UD4A 2WB1B 3Q6SA 3SHLA 2QDBA 3K59A 4XM3A 5EGTA 1X32A 1D6EC 4RHSA 4K8JA 3C2PA 2F0WA 1LLRD 1EFID 3BG3A 3VR2A 1O7YA 3ND9A 1U4LA 1TR5A 4HSVA 1NUCA 3RUZA 2O4XA 3EA6A 2NTTA 3CQZB 3NTIA 3G7LA 1HRJA 1Q90A 4KN7C 3P20A 5ELFA 4OHJA 2EY6A 3M7NA 3U9OA 1JQYD 1CI3M 1DM0B 1OB0A 4WORA 3MA2B 5CBEE 2K32A 1SKYB 4O1NA 3T53B 2DY8A 4U68A 1PTOB 1R4QB 2M9VA 3D4RA 2N55A 4P22A 4G7XA 4HMIA 2K6AA 4IUUA 4GZYC 1UNSA 3I73A 3LNNA 2BA1A 4HEDA 4XTCS 3J80L 2WKDA 1A3UA 1AFPA 1LO5D 3P1HA 1PRTD 1E2WA 3MWYW 5C0XI 5C4JB 2E2HB 3PUXA 1EU4A 1SNPA 2AWNA 5M5YB 2F0EA 3NBIA 5EKKA 3C1FA 1V1PA 3KLSA 1JOQA 2TSSA 2O2LD 2WPDA 1BBXC 3DEOA 1KTKA 2X6YA 1MD2D 1KDAA 4EQPA 1PTOC 4K2KA 2D3NA 4QCLA 4RGOS 4RAUC 5I6YA 2OT2A 5C3XA 4N9PA 4KTAA 1MGSA 2W6JA 5JPNC 3D3RA 4KMUC 2F0NA 1Z7TA 4ZYSA 2CK3A 3QG1A 2KEEA 3PV0A 5FLXL 4DAPA 1D1KA 1D5XC 1LT6D 2LZJA 1J8IA 4OL7A 4AVZA 3MAQA 1NR2A 2A69D 1WTHD 3OFNA 3KK7A 4KKSA 2E1BA 4HCEA 2PPBC 4KKTA 4U673 4C1NI 4H44C 5E3FA 2EYPA 2R93B 2E2DC 3NSWA 2B2VC 2X6GA 4TQUS 4FXDA 5EKLA 2NN6H 1TIID 2Z1CA 2JDIA 3DDYA 2ZZGA 3OHXC 5C4HA 2F0FA 3NK9A 4K14A 1WTVA 3OEEA 1ET6A 1Y1VB 2B2UA 2F4IA 3NQTA 4IUNA 1NBMA 4KD3A 2PW7A 4AYBB 3GTQB 1ML0D 2CHBD 1TU2B 1EU3A 4KHVA 5JPMC 3OSOA 2R7ZB 1LV9A 3PUWA 1HUMA 2R6GA 2G9DA 2XOKA 3J7AV 1TY0A 3A3GA 3TBIB 4FF3A 5ELCA 2NTSA 1SJED 1J9OA 2F03A 1I4RA 2RQXA 4G7HC 5KNBA 4R9WA 2RBMA 3RZDB 2MPMA 2DN8A 3F2UA 3JU4A 2SNMA 4LAAA 1A6XA 1F2MA 3HOUB 3ND8A 1JWSD 1ONLA 1KDBA 3BVZA 1EOTA 1JWUD 1SE2A 1SYFA 4HR7B 4XD7A 2NN6G 1M4VA 5ELEA 4F7XA 1RKNA 4EQOA 4NNJA 1PYWD 1I3QB 2WJYA 2R9VA 4JMQA 1A2TA 3VA5A 2KJXA 4C3IG 2L5TA 4EQNA 1H9RA 5M5WB 3IAYA 1I18A 3C1EA 3GTKB 3TMEA 3J81L 1RF2D 2XZLA 1S5FD 1BMFA 3O13A 5G3LF 3NXWA 2XIWA 1QILA 1WD0A 1EY9A 4NW2A 2VUMB 1TS2A 1YNND 3GP7A 3RZOB 3I91A 2QE7A 3RMHA 1QCBD 4Z9CB 5DM63 3KBGA 1I4QA 5D65A 3QO2A 4G6IA 2NUCA 4BS9A 5CV7A 3K5LA 1ILQA 4V0BA 3PUYA 1EY0A 5EBDA 3GVJA 3S17B 1QNKA 4IALA 2KVOA 4A3JB 1BNZA 3EROA 1GHJA 3I4MB 4A93B 3SE0A 1U9RA 1UUPA 5BN4A 4FF1A 2B2YC 2RKSA 2R92B 2XSCA 3J80E 3OMGA 2EPBA 1TY2A 3Q0AA 5M9OA 1Z6HA 2IL8A 2KQ3A 2PZWA 2V31A 4ASUA 2L11A 1TS3A 3S2HB 1XX8A 1E2ZA 1ENFA 4DAYA 3MZ5A 2IJ0A 2XRQD 4BA1I 1S5ED 1HVXA 1FGBD 5C6AA 3BYYB 4DXFA 2WV6D 1UD2A 3FRPB 2L0CA 4JK1C 1PRTC 2Z8LA 1I50B 1RJTA 4HCSA 3R2IA 1BO0A 1EZ6A 2X69A 3NBHA 3FKSA 4KI0A 1EQTA 2VXWA 1ENCA 4K8IA 3GTPB 1ZYRD 4XLAA 5FLXE 4ZKCB 3GQBA 1Q12A 1PFBA 2L12A 5JVH3 1SMYD 1G291 3R93A 1OXUA 3CKIB 4FXUA 2JA6B 3FMCA 2SOBA 5J39A 1AEXA 1E2VA 1STNA 1PFNA 1WVLA 2MUYA 1II3A 2CW0D 1F77A 3TZUA 1EIGA 1STBA 1QJOA 5IGDA 1B1ZA 2CVRA 5C3WA 2JYOA 2QCPX 2GJRA 4KJNA 5FL7A 4RA8A 2ZXPA 5K5PA 3I8ZA 1CQFA 5JJZA 2NVYB 4L6TB 3K5OA 3H94A 2A69C 3A7LA 2F0QA 2Z4IA 3R2TA 5I2YA 1DONA 2AUJD 1LTAD 4DN4M 2RDFA 1EYCA 3GTMB 3DWPA 1WD1A 1R9TB 2MJ8A 3H3VC 2WKCA 4B9WA 3AB9A 5ELBA 1F9QA 1STEA 4ZK9B 4NMZA 4ULLA 3OAAA 2RSNA 3S9WA 5HGTA 1SAPA 5EPLA 3HKZB 2O5JC 5M5XB 3SK5A 1WTXA 2A6HC 3PIP3 2WSSA 3VR4A 5KEEA 2J0TD 4IQZA 1CM9A 2WINB 1PTOF 3CRLC 5F2DA 2XRSD 3PIO3 2F0MA 3D4WA 1TS5A 2X53S 2NB0A 3BDCA 3AMUA 3MXPA 4CHTB 2JJ2A 4XOTA 3Q24A 4QB4A 1HXYD 3E0JA 5IGBA 2B2WC 3M7GA 4PMBA 1GUSA 2KCCA 2FJ2A 1PLFA 2H4OA 3K7AB 3Q22A 2DNCA 1DZ1A 3A8JE 1LTTD 4CKEA 3SXHA 1SYBA 3S14B 4L63B 2AUKA 3VYSA 1D5ZC 2A73B 2IT1A 1CFMA 3KBXA 1TT2A 3H6MA 1FX0A 3S16B 4FF2A 2A68D 5FO9B 4J1MA 4NKLA 3ONAB 3FKIB 4CJ1B 4ZAIA 4FO2A 3OOCA 2JA8B 3D6WA 1ZEQX 4KY5A 3J81E 3BCDA 1A2UA 2K5WA 1LTBD 1HFNA 5JOBA 3VYRA 4K6DA 1EQVA 2XVSA 4XMYA 1LABA 2F1MA 1ICWA 4CBVA 2KVMA 3CESA 2A6ED 3OEHA 4KD4A 1H9JA 3I4NB 4YXWA 1S5CD 1I6VC 1SE4A 2JIZA 4ILWA 1RTOA 2ZZEA 1EY5A 1C8CA 5K36G 3DWAA 2E76C 4NDXA 5CV9A 2B39A 1YNNC 1LTID 1XYIA 2WIIB 1CQVA 5CORA 4PMWA 2K28A 4C3HG 2EY5A 4ZKBB 1KNEA 3NUCA 5CYUA 4G4KA 4YIJA 3KUPA 1TQOA 1X3PA 1NAPA 1XWEA 1QB5D 3IFTA 2LMCB 3L7ZC 2C5CA 4RCOA 1ZKOA 3NHHA 4Z1MA 3IFDA 5CV6A 2KUMA 3URYA 4ZUIA 1CZWA 1RODA 1RD9D 3WOEA 2FMCA 1E3ZA 2GK6A 4DA2A 2B2TA 2EYHA 2VB3X 3MFYA 1UD6A 4OGQC 1D1IA 4XQQA 4DNRB 1HZEA 4DGZA 2D3LA 1LACA 1V8QA 1MI2A 1BF4A 4KY7A 4ME5A 1OHHA 2DIEA 4ODGA 1Y69U 2ZZFA 1SFOB 5FOBB 1TVXA 4G7ZC 5EPKA 2EYLA 1YNJD 2I07B 2XN9C 2K5QA 1OXSC 3GTJB 5KYLA 2RSOA 1IKLA 2F0VA 2EJGC 2V4DA 3S1QB 3LX0A 1PXUA 1K83B 5A2QL 5A35A 3NTKA 2JA5B 1ZYRC 3QJYA 1CHQD 3OIQA 2K1BA 3E6ZX 2PO4A 4FF4A 1B4OA 1SMYC 1EY8A 1Y8PB 2K04A 3C3LA 1JE4A 2GJPA 2LS01 2E75C 3GO5A 1DD2A 1JB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9S A;  4KKS A;  2BE5 C;  2JE6 I;  3CRL C;  4KN4 C;  2CW0 C;  2D5D A;  2K32 A;  2D62 A;  4KKT A;  2PPB C;  3T53 B;  4L8J A;  4H44 C;  1GUN A;  1IW7 C;  5BN5 A;  2KA7 A;  3MXU A;  2L5T A;  2BE5 D;  1IYU A;  4JBW A;  1H9R A;  4KI0 A;  4IFD G;  3A8K E;  4IFD H;  1O78 A;  1K8O A;  5KNC A;  3D4R A;  1VF5 C;  1DCZ A;  3IKJ A;  1IW7 D;  2QF7 A;  2EJM A;  4H13 C;  3HGB A;  2EJF C;  2YYZ A;  3GQB A;  4TQU S;  1FR3 A;  3IFT A;  1H9M A;  3VR3 A;  5BN3 A;  1Q12 A;  1GUO A;  1GUS A;  2LMC B;  2PNR C;  2KCC A;  3L7Z C;  3VR5 A;  4OO1 G;  5C0X H;  5C0X G;  2NN6 H;  1G29 1;  1OXU A;  2EVB A;  2DNC A;  4GZY C;  1VDZ A;  3NE5 B;  3T56 B;  1VF7 A;  2AWO A;  3FMC A;  3LNN A;  4DK1 A;  2BA1 A;  3I73 A;  4H0L C;  3A8J E;  1ZKO A;  4XTC S;  4BA2 I;  4TKO B;  3VA7 A;  2BDO A;  1E2V A;  1HPC A;  3I72 A;  1GUT A;  4I7Z C;  4DK0 A;  2A68 C;  2AUK A;  4KKU A;  3VR6 A;  3FPP A;  4LJZ C;  3M4Y A;  2IT1 A;  1E2W A;  1BDO A;  1DXM A;  2NN6 I;  3A8I E;  3W3A A;  1EWH A;  5KND A;  2ZT9 C;  1VCI A;  2A6E C;  2DNE A;  3PUX A;  1CFM A;  3TZU A;  1HTP A;  2K33 A;  3GD7 A;  1QJO A;  2B8G A;  3PUY A;  2A68 D;  3A7A B;  1HQM C;  4LK1 C;  1B9M A;  3MFY A;  3PUV A;  3QIA A;  1TU2 B;  4OGQ C;  4OO1 H;  1H9S B;  3DXJ C;  1GUG A;  3N6R A;  3BDO A;  3OPO A;  3OOC A;  1GHJ A;  4DNR B;  3D31 A;  3PUW A;  2Q8I B;  1LAC A;  2R6G A;  1V8Q A;  3SDZ A;  1H9K A;  3LWU A;  1OXV A;  3H94 A;  2A69 C;  3A7L A;  3RLF A;  3SE0 A;  2JEB I;  2AUJ D;  4KHZ A;  1YNJ C;  2JEA I;  1V43 A;  1OXT A;  1IYV A;  2B8F A;  5BN4 A;  4PV1 C;  1LAB A;  1Y69 U;  1GHK A;  1PMR A;  2BA0 A;  3EQL C;  2A6H D;  4G7Z C;  2F1M A;  2K7V A;  3BG3 A;  2EDG A;  3CRK C;  4KMU C;  1B9N A;  3VR2 A;  1Y8N B;  5JEA G;  1OXS C;  3ND9 A;  1GJX A;  1Z7T A;  4G7H C;  3AB9 A;  5KNB A;  2EJG C;  3OW7 A;  2A6E D;  2V4D A;  3QG1 A;  3T51 B;  3PUZ A;  2DN8 A;  1Z6H A;  1H9J A;  3PV0 A;  5A35 A;  1K8M A;  1T5E A;  1ZYR C;  3QJY A;  2O5I C;  1I6V C;  1Q90 A;  3M85 A;  4KN7 C;  1A6X A;  1FYC A;  1OXX K;  3ND8 A;  3P20 A;  1CTM A;  3KLR A;  3WDN A;  2O5J C;  4G7O C;  1Q1B A;  3U9S A;  2PCF B;  3M7N A;  1E2Z A;  1SMY C;  1Y8P B;  4RCN A;  2A6H C;  2E74 C;  1TKW B;  1HCZ A;  1Y8O B;  4XIG S;  1ONL A;  3VR4 A;  1O7L A;  2A69 D;  2JXM B;  4BA1 I;  5K36 G;  5K36 H;  1CI3 M;  2E76 C;  4DNT B;  4IQZ A;  1YNN C;  5JEA H;  4HR7 B;  2E75 C;  2NN6 G;  3I4L A;  2D2C C;  4JK1 C;  1DD2 A;  1Q1E A; 
#chains in the Genus database with same CATH topology
 2DCU A;  1VQ8 B;  1I5F A;  2PQE A;  1EYD A;  2CW0 C;  1EFW A;  2D62 A;  4GOP B;  4L8J A;  3M4Q A;  3KF6 A;  4WRD A;  4G7W A;  2KA7 A;  1HNW L;  2E2H H;  2GK7 A;  2VJJ A;  3A74 A;  4A76 A;  5M5Y H;  2E2I H;  3LVB A;  1LT5 D;  5BR8 Q;  1P4M A;  4HE6 A;  5J35 A;  1PZI D;  3HOW B;  5IGE A;  1IW7 D;  4ZCM A;  4WJW A;  2X6W A;  3QFR A;  1FD7 D;  1B53 A;  4G1V A;  5JBQ A;  2PNR C;  1STA A;  1A0I A;  4DU9 A;  5IP9 G;  1I4H A;  1AN8 A;  3T56 B;  3VNU A;  1MSG A;  2AWO A;  4DK1 A;  4H0L C;  1W6J A;  1N0U A;  3QWN A;  1PKV A;  2EE1 A;  2LKV A;  2XNA C;  3HG9 A;  4MYT A;  1Y1W H;  3CPX A;  3EBE A;  2HCI A;  2FIN B;  1E79 A;  2VZA A;  1GUT A;  1FNM A;  3H3V I;  1EQQ A;  2B2U C;  1BCP D;  3BU2 A;  4X62 L;  3UI2 A;  2CW5 A;  1DXM A;  2L4N A;  3KLS X;  1IBL Q;  5FIU A;  1B7Y B;  1VCI A;  2K03 A;  2ZT9 C;  1E1T A;  4C3I B;  1F9S A;  3SJP A;  5EBC A;  2ICE C;  2N8N A;  4NB3 A;  1PRT F;  3GD7 A;  2N88 A;  1GVH A;  4UAJ A;  1HTL D;  4KHP Q;  1FNB A;  3AVU A;  5JJK A;  1HQM C;  1EWI A;  2CRV A;  2AHO A;  1DYQ A;  2RCN A;  4P1V A;  1PH7 A;  1RQR A;  4GOP C;  4UY8 C;  3ISX A;  4IUV A;  3HOZ G;  4DV2 L;  2VYQ A;  3STB D;  3G05 A;  3A56 A;  1N07 A;  4LC0 A;  4N3N A;  3CCJ B;  3QFS A;  4II3 A;  1YJW B;  2K5D A;  4TMV A;  2L55 A;  1S40 A;  1KK2 A;  4X65 L;  2L1B A;  2HCC A;  1LTL A;  2HDL A;  3A0J A;  1ESR A;  4FNF A;  4HMJ A;  3U4Z A;  2JA7 B;  4OO1 I;  5F4M A;  1IYV A;  4QFM A;  2OTL A;  1G6P A;  4A3E G;  2QEX B;  3FPU B;  2WJV A;  2N49 A;  3DWQ A;  4S3S A;  3EQL C;  4Z4R A;  4JYA Q;  3CC7 B;  5JEA H;  5J3B A;  3MTS A;  1B9N A;  1GJX A;  1Y8N B;  4LMQ D;  1LTS D;  3HP3 A;  5L46 A;  4RGM A;  2OK7 A;  5C5L A;  4EVO A;  1EY6 A;  1KQS B;  4HJ5 A;  3QE2 A;  2R93 H;  2UXC Q;  1V0F A;  3U6K A;  4RCZ A;  2J7Z A;  1SNQ A;  1OB5 A;  4LFC Q;  4UAI A;  1NRK A;  2RHQ B;  1GAW A;  4C3J H;  4AF7 A;  1CTM A;  4XON A;  3VO1 A;  1B8A A;  3ZYY X;  1KLU D;  4DK6 C;  3CW2 A;  5ELO A;  4BY1 G;  2F0U A;  5LHY 1;  1O80 A;  1TKW B;  1Y8O B;  3T1Y L;  1ASZ A;  4YY3 Q;  4XKV A;  5M3F B;  4GKK L;  2CF4 A;  2IW3 A;  4DUZ Q;  4GLX A;  4WZT A;  2HUG A;  1H9S A;  2BE5 C;  4YEJ A;  4QUF A;  4XYQ A;  2V7U A;  1R5N A;  5D14 A;  1G8Z D;  1N36 L;  2XWB B;  1EEF D;  1SYC A;  1PZJ D;  3A5U A;  2VJI A;  2UUC L;  1TUI A;  5E4X A;  4HTH A;  2B7C A;  3ZZT A;  4DF7 A;  2JN4 A;  1Y1V H;  5JEA J;  3ZZ0 A;  4IUT A;  3CME A;  4IFD H;  3A8K E;  4JCV E;  4JBJ A;  1RTN A;  1PH3 A;  1KD1 C;  1DCZ A;  3IKJ A;  4OOV A;  1C7Y A;  1PDQ A;  2ZXI A;  3A3B A;  4BY7 B;  2PLF A;  3JAM i;  1LYL A;  1W0K A;  1BKB A;  3VR5 A;  4B08 A;  5JVG 3;  4TRD A;  2IWH A;  1KIX A;  2MHV A;  1K9M C;  2R7Z H;  3TZD A;  1Q3L A;  4TT3 A;  2C2W A;  5DNF A;  3TDQ A;  1QZH A;  3NE5 B;  4X8I A;  4QIW B;  1VF7 A;  2G9H D;  5HZB A;  2EYF A;  4ZGN B;  1FNC A;  5GAE C;  1WTW A;  4X66 L;  1MIU A;  5IY0 A;  2EXZ A;  5IWA Q;  1VQ6 B;  4DK0 A;  3CD6 B;  3ZJY C;  1NJI C;  1QUF A;  4LJZ C;  3M4Y A;  4DAY B;  2KCN A;  2A6E C;  3Q39 A;  2Y0S E;  2HHH L;  1STY A;  2B8G A;  2OBT A;  1MKH A;  1I6H B;  1YJ9 A;  3NWT A;  1YHQ A;  2BDN A;  4OX9 Q;  1I94 Q;  5LMZ A;  3OPO A;  1EWC A;  4BBS H;  1SNO A;  4IFD J;  2QTZ A;  4IPG A;  1DOK A;  1LTG D;  3OWF A;  5C44 B;  1HA6 A;  3RY8 A;  3OW2 B;  5FJ8 G;  1Y14 B;  4CJ2 C;  1UD8 A;  2WP8 J;  3NBH B;  2OTJ A;  1Z9F A;  1K0S A;  4QJF A;  1MJE A;  3RD4 A;  1LTR D;  1NDH A;  2F52 A;  4AF6 A;  1KC8 C;  4WZL A;  5IK2 A;  3K8A A;  2K7V A;  3UDG A;  3ES9 A;  3CRK C;  4PZ8 A;  4WJ4 A;  2KHS A;  4XLE A;  2F43 A;  3PEN A;  1P16 A;  1WI5 A;  3G48 A;  3OW7 A;  1I3Q H;  3NWS A;  1PH6 A;  3CP2 A;  1UAP A;  2HMA A;  1S72 A;  2J7K A;  2PYK A;  4C2M H;  3ZIA A;  5F4O A;  1PRT B;  3TP5 A;  2BM0 A;  5CBA E;  3CCL B;  3AVW A;  3Q38 A;  1WFQ A;  1W6K A;  3GTK H;  1E0B A;  3HOY B;  1K3R A;  2EXD A;  2PCF B;  2FMM A;  4Q0F A;  2R6H A;  1WTR A;  4JV5 Q;  5LMU L;  1TWF H;  1YIT B;  4DR4 Q;  1U4P A;  2E74 C;  3I2Z A;  4IOC A;  4JI8 L;  4HN7 A;  1S4M A;  4IN3 A;  1VQO A;  1JB3 A;  3ITP A;  5GQO A;  3KLW A;  4P75 A;  3I4L A;  1BX0 A;  3LWE A;  2YTY A;  3S24 A;  4N8X 1;  2VUM H;  1WSV A;  1V0E A;  3RZO H;  1XPU A;  2PMD A;  3R3O A;  3B8H A;  4N3G A;  2ZTE A;  4K0K L;  4DV5 L;  4MYU A;  4X7D A;  1YZ6 A;  2SEB D;  2X8K A;  3DLL A;  3GVK A;  1TWC B;  4K2L A;  5KNC A;  2QMU A;  4JI0 L;  1XNQ L;  1PJ5 A;  1N8R D;  4JG2 A;  5BSY A;  1D2B A;  1IL8 A;  3GDE A;  4M2L A;  3S17 H;  1VQN B;  2F0O A;  5KSW B;  4LW1 A;  5A2Q E;  1KMH A;  4CKB A;  3Q3A A;  1AE2 A;  3D6C A;  4M1U B;  1V1Q A;  3CCU B;  1VQL A;  5LMN L;  5C0X H;  4LFB Q;  2EVB A;  2PMZ E;  3DMU A;  4BBS G;  2K01 A;  3H0G B;  1STH A;  1FNW A;  1LT3 D;  1EQR A;  1QVF B;  1JWM D;  1Z47 A;  1PH1 A;  2K05 A;  1QVC A;  1BDO A;  3W3A A;  4KV6 A;  2IHE A;  4MN3 A;  4XYO A;  1VQ9 B;  2DNE A;  2A19 A;  4KLK A;  2R92 H;  1QOH A;  4Z4Z A;  2EYM A;  1IBK Q;  2WR8 A;  1G2T A;  1BUV T;  2F0I A;  1ENA A;  1R4P B;  2PZT A;  4XQJ A;  4NXM Q;  5LL6 X;  1U0L A;  1B9M A;  1BQQ T;  3JC6 6;  4A3G H;  2JJ1 A;  4FYD A;  1VQ4 A;  4GN3 B;  1BCP B;  1YLO A;  3LGJ A;  1H9K A;  1JOR A;  3E20 A;  4XQF A;  4P72 A;  4DK3 C;  1CA5 A;  3S2H H;  1YBY A;  1PFS A;  2JEB I;  3EJI A;  4KHZ A;  3CMA A;  4ALP A;  1JOK A;  1OO9 B;  4B3R L;  2Y0S G;  3I3C A;  1L2F A;  2ZXO A;  1YNX A;  5LL6 S;  5C0X J;  4Z4U A;  2BM1 A;  4A3D B;  2VBT A;  1IKM A;  2BVN A;  1WDT A;  4RPB A;  3ERQ A;  1SEB D;  2VQE Q;  3S1R H;  1T5X D;  3OZW A;  1JJC B;  1I4X A;  2BV3 A;  1I50 H;  2I0Q A;  2KED A;  3U4V A;  2KEN A;  4P2C B;  3K0Y A;  5AFW A;  5AN9 A;  3FVQ A;  1ET9 A;  3DHQ A;  1Q86 C;  4R1J A;  5IYP A;  1UE6 A;  1NBW A;  4EX5 A;  1VQ7 B;  2WAQ B;  5THX A;  5KYI A;  1J6Q A;  3PO3 G;  4IJL A;  3R8B A;  2GVB A;  4XN0 A;  4DR6 Q;  1QFZ A;  1B2T A;  1KNA A;  2M00 A;  2ZL5 A;  3WNB A;  2BH8 A;  4E0F A;  1R5O A;  1EEI D;  5FO7 B;  2JA6 H;  1VQP B;  4P73 A;  1BCP C;  1ZM2 A;  1AE3 A;  4RFB A;  5CDF A;  1WTP A;  4IOA A;  2JJQ A;  2NWG A;  2F0S A;  1VQ5 A;  2OF1 A;  4GNX B;  4I7A A;  3BC9 A;  1A63 A;  3A8I A;  1K73 D;  3OP1 A;  1JNY A;  1BX1 A;  1BLI A;  2I1L A;  1GD7 A;  2WFW A;  4O2D A;  4ZV4 A;  3K58 A;  5DM7 3;  1KRH A;  4OIK A;  5C3E B;  4A3M B;  4DUY L;  4H13 C;  4P6V F;  3OE7 A;  3STB C;  1C48 A;  4X3S A;  1M90 D;  4B9X A;  1UD3 A;  5IYN A;  4A3G G;  4LF9 L;  5GRO A;  4X3K A;  4DV1 L;  2NVY H;  3SLD A;  1K8A C;  3CPW B;  5CR3 A;  2OXP A;  4XT1 B;  2PE3 A;  3I72 A;  4RMF A;  2EOT A;  1I7P A;  4RPD A;  4B3M Q;  1IXR A;  1PFM A;  4F8M A;  2NN6 I;  5FO1 A;  4BPR A;  4C3H B;  5I4D A;  3PF5 A;  3ULP A;  4A3F H;  1TWA B;  4DQL A;  2XGJ A;  1R9T H;  5GAH C;  2LY7 A;  2Q8T A;  2PZU A;  3CCR A;  3I56 A;  2RDG A;  3E9H A;  3M4O B;  1QNU A;  3AGQ A;  5IOC A;  1J5E Q;  2I5H A;  1TWG B;  3AVV A;  3KEW A;  3LQE A;  4RKL A;  4GNX C;  2B5O A;  5FK9 C;  1Q8K A;  1WCM B;  1SNC A;  1OXV A;  3SGI A;  2ZTG A;  4XXE A;  2XZO A;  1QH0 A;  1G91 A;  5M5X H;  2RC6 A;  2X85 A;  4MZ9 A;  4TSS A;  4LF8 L;  2JEA I;  4JBK A;  4A3B B;  3J7A 5;  2WAC A;  5IGG A;  4A3I B;  1SM4 A;  2NVT H;  3MCA A;  4CDE C;  3T1H L;  4XKW A;  3UDX A;  1JT8 A;  4DV7 Q;  1W2B B;  1PA6 A;  5H5J A;  5E7N A;  5BSX A;  4JW0 A;  2VBU A;  4XL9 A;  5I9O A;  2VNI A;  2CQA A;  1UE1 A;  3BDL A;  2O5I C;  3AST A;  1KDC A;  1N33 Q;  3W2F A;  4WFN 3;  1PHJ A;  1SDF A;  1QX4 A;  2B63 H;  4QUC A;  1EYA A;  3Q23 A;  5GAG C;  5I6W A;  1JJ2 A;  1AP0 A;  1E64 A;  4LUV A;  4Z4W A;  4P3I A;  1PH2 A;  4JBM A;  2UU9 L;  4XLC A;  3K7A H;  4B3X A;  3I90 A;  2CH4 A;  1Q1E A;  1KZL A;  1XTC D;  1UMK A;  2C4U A;  2D9U A;  3EFX D;  4Y7N B;  4X3U A;  2LXJ A;  4Q5V A;  2B3G A;  2OWO A;  2ICI A;  3HOV H;  3S14 H;  3AU7 A;  3V05 A;  4OPV A;  1PYB A;  3FDT A;  3S1N H;  5IT9 c;  2QKI C;  4FDB A;  2WB1 E;  3SVM A;  1F9P A;  1D1N A;  3CCS B;  3CU7 A;  1O78 A;  1Q82 D;  2UXD L;  4A3F G;  3S16 H;  2ZL6 A;  1IHZ A;  1SR3 A;  1VLY A;  3S2D H;  2QF7 A;  1N34 Q;  3HGB A;  1IJF A;  3TS2 A;  5BN3 A;  1H9M A;  3FKI H;  1K8O A;  5I2X A;  1TWH B;  3HZX A;  4RH6 A;  4JI7 L;  1V1P B;  4ROX A;  4RD1 A;  2JA8 H;  4DR7 L;  4GQN A;  3W2D A;  4Y7C A;  2AKW B;  4PZ6 A;  3CHB D;  3K57 A;  5IT9 L;  1AW7 A;  3S1M B;  4P12 A;  4C1N K;  2X0K A;  3M3Y H;  1QZG A;  1O7Z A;  4V19 0;  2P5Z X;  4WZK A;  4KKU A;  5AJ3 L;  1CT1 D;  2K5H A;  5KRU A;  1G7T A;  5GV7 A;  2B2T C;  3QB3 A;  2PW5 A;  3DM3 A;  1ELO A;  4KHP L;  1VMC A;  2HQE A;  2FXQ A;  1B3Q A;  4BBR G;  3HOX G;  2DYI A;  2G5D A;  5C5M A;  2XND A;  1WP6 A;  3CC2 A;  1NSN S;  3B78 A;  1DOM A;  1ZM9 A;  1Q81 D;  4RD2 A;  5M3M G;  2V7Q A;  1JE5 A;  3N6R A;  2PQA A;  5C4X H;  1KRT A;  4QMG A;  5IYQ A;  2WZP P;  3IRB A;  2F3V A;  5FLM G;  4QL5 A;  3KF6 B;  4IZ8 A;  3U2Q A;  4F88 A;  4BXX G;  1UEA B;  4QVA A;  4FXG C;  3DUZ A;  1IL2 A;  2B63 G;  1V43 A;  1BJK A;  1JR0 D;  1MSH A;  1GO3 E;  4M53 A;  2I5M X;  3NP8 A;  1G6Z A;  3P75 A;  3QOJ A;  1CA6 A;  3CB4 A;  4NP5 A;  5KGU A;  1PMR A;  5EQ0 A;  4AQY L;  3HRZ C;  4MIU A;  5L37 A;  2QTL A;  2ZM6 Q;  5C4Z A;  1U4M A;  2FFK B;  4PNY A;  4LFC L;  1EL0 A;  1H42 A;  1MAB A;  3TSS A;  3ER0 A;  1N8R C;  5CC4 A;  3PO2 G;  3HEJ A;  2NVX B;  3M9B A;  3K6O A;  1EZ8 A;  3CTA A;  1V1O A;  3HOZ B;  2ZXH A;  3SK4 A;  3HAG A;  3TP7 A;  1WOO A;  1T6Z A;  2WZN A;  3WDN A;  5IYB H;  3DM1 A;  1Q1B A;  3U9S A;  4G7O C;  3SK8 A;  1WPC A;  3FPK A;  5NUC A;  4JC0 A;  4DR5 Q;  4RGT A;  1QGY A;  4K6L A;  4X3T A;  3E5S A;  2NBF A;  5JJL A;  2GRE A;  1HQR D;  3KJP A;  1T6X A;  2QEJ C;  5IYC H;  4A3E B;  4RDL A;  1EXM A;  4F87 A;  4J6H A;  4B3T L;  2XGT A;  2D9R A;  2YWG A;  4LBV A;  4MTN A;  1MRZ A;  4B3F X;  4KN4 C;  2D5D A;  2PNH A;  3OMC A;  2IX3 A;  4PC2 A;  3WOF A;  3BJU A;  4DV3 Q;  4O42 A;  2DUD A;  2L9H A;  3MXN A;  1B2R A;  1HHV A;  4A3K G;  1PTO H;  4B3S Q;  1HNX L;  4Z4S A;  1LM0 A;  1WYD A;  3MEH A;  2MO1 A;  1A3V A;  4HID A;  3ASQ A;  3K5M A;  4GKJ L;  2BCO A;  4L5S A;  4I65 A;  2E2I B;  4PQX A;  2EJM A;  3GVL A;  1GM5 A;  4BY1 B;  4M8A A;  3VR3 A;  3A55 A;  3T13 A;  5KIX A;  4LF7 Q;  4J8Q A;  2Q2I A;  1W0J A;  3JAM c;  1FJG L;  2HIV A;  3BY1 A;  2WB1 G;  2SNS A;  2GA4 B;  1IHM A;  1M1K D;  2F3W A;  1YEZ A;  1N0V C;  2F0K A;  1Y1W B;  1AZQ A;  2X6L A;  1H8H A;  5HUR A;  2VNU D;  4PC6 A;  5C4J H;  1XMQ Q;  3FPP A;  1X55 A;  5T1G A;  3AEV A;  2C35 B;  4M1K A;  3I70 A;  4JPB W;  2A74 C;  4CKC A;  1K28 D;  3H91 A;  4LK1 C;  3W2G A;  3JAM L;  1C4Q A;  3H09 A;  4LUZ A;  1F60 A;  3W1G A;  5CMD A;  3Q8D A;  1LT4 D;  1CQX A;  1CZG A;  4K5X A;  5IP7 G;  1EUJ A;  1H9S B;  1CKN A;  1ZXT A;  3DXJ C;  1VMP A;  4FXK C;  2JA5 H;  3BDO A;  2CC2 A;  1L0Y B;  2RCF A;  3TN2 A;  3MHB A;  2LXK A;  3CPF A;  2F4V Q;  5KNL A;  2KCM A;  3KOJ A;  1X65 A;  1OXT A;  3PUM A;  4LBZ A;  2OK8 A;  1SBB B;  1A15 A;  1EY7 A;  2XNJ A;  1KRS A;  2KEC A;  2MQH A;  1KAB A;  1U4R A;  2EIF A;  1WTO A;  1PH4 A;  1GHK A;  5IYC G;  5J22 A;  4XQN A;  1E1Q A;  1N05 A;  1Q7Y D;  2YWF A;  1FL0 A;  2VW9 A;  4OWW B;  1K73 C;  1HZC A;  3B6Y A;  1NMG A;  3J7A F;  1HA5 A;  2RDH A;  1EY4 A;  1SLJ A;  3BZD B;  4X64 Q;  2E5L Q;  4TVA B;  1S4Z A;  2LFN A;  4ZLT F;  1K8M A;  4OON A;  4POF A;  2ASB A;  4A3L H;  2ENB A;  4YHH Q;  4YHB A;  3CRZ A;  1FYC A;  2J4X A;  3CW2 C;  3G4S A;  1M90 C;  3KLR A;  3HOW H;  2Q2H A;  4C3J B;  1YIJ A;  4K5V A;  4ME3 A;  5TSS A;  2IPK D;  5FO8 B;  1S5D D;  2SDF A;  4RCN A;  4RD4 A;  2JP1 A;  5FA6 A;  4QF4 A;  4NXN Q;  4FP5 D;  3GTG B;  3FEW X;  3MVV A;  4FWT A;  1NR4 A;  1IBM Q;  3VYU A;  4AYB E;  4UPA A;  1ZUN B;  2AMC B;  4XN3 A;  3AVX A;  1IYJ B;  2A6H D;  1QVG B;  3BYT B;  1NCV A;  2NPF A;  3J80 i;  1EFT A;  4JI2 Q;  1SYG A;  1PZK D;  5DAU A;  5HGQ A;  1N32 Q;  5EPJ A;  3D0F A;  3CCQ A;  2OTJ B;  4CDF C;  2RVL A;  1NB9 A;  4ABN A;  4DV0 L;  1X6O A;  4Y9U A;  1VF5 C;  4WQM A;  5DLQ E;  2RA4 A;  5G3L D;  5J1Z A;  5IIF A;  2EJF C;  2YYZ A;  5HZA A;  3BZC A;  2B2V A;  2CWA A;  1CKO A;  2MP1 A;  3IL8 A;  3TP6 A;  1UD5 A;  4JI4 Q;  1VQ8 A;  1V5V A;  1S5B D;  1VDZ A;  3NTH A;  1QGZ A;  1Y1W G;  2F0D A;  2BDO A;  4QUZ A;  4N9T A;  4DR1 L;  4XLF A;  1HPC A;  3BQJ A;  2JA7 H;  2UUB Q;  4I7Z C;  5T1I A;  2A68 C;  2BOS A;  1D8T A;  3GIR A;  4JI5 L;  5E6T A;  2NVQ B;  1COW A;  1EWH A;  1UE7 A;  2NZ1 D;  4UZU A;  5ELD A;  3WY9 A;  1BCP F;  3T4A C;  3NPP A;  4RJL A;  4AIM A;  2HT1 A;  3A7A B;  4JI6 Q;  3GTQ H;  1VQO B;  5CV4 A;  1KK3 A;  2M5S A;  1QGA A;  1PJ6 A;  1GUG A;  1QE6 A;  5GV8 A;  4OPO A;  2N78 A;  1GAQ A;  2YU9 B;  3P27 A;  2IX1 A;  1R5B A;  1BOS A;  4IUQ A;  1W9X A;  3CMM A;  3NEM A;  4BBS B;  5DEH A;  1DOL A;  3W2E A;  4H02 A;  1JB7 A;  3K5N A;  2H1E A;  3BVG A;  3G6J B;  3TP8 A;  1STG A;  4ZUJ A;  3ZUG A;  2I46 A;  3H9N A;  1X3F A;  2XZP A;  1I8D A;  5TRD A;  1XPO A;  4IUR A;  5IT9 E;  5JEA G;  2EDG A;  2TMP A;  4H7B A;  2M2L A;  3RZD H;  4DKA C;  2X6X A;  2R3Z A;  2MGS A;  1Q82 C;  1Q8I A;  2R93 G;  1GOZ A;  4OIJ A;  2OBR A;  1JA0 A;  1T5E A;  1F9R A;  3CXC A;  4UDU C;  3HOU H;  1YJW A;  4CGY B;  3M85 A;  4C2M B;  4C3J G;  5EJW A;  5IGC A;  4RM0 A;  5ISR A;  2Z6K A;  1CHP D;  4DQK A;  1HNW Q;  4RD3 A;  2CND A;  4DR6 L;  3U50 C;  2UUA L;  1KJZ A;  2QEX A;  4DXG A;  4A75 A;  2BH2 A;  1I4G A;  4BWG B;  2Y0S B;  1HCZ A;  1TWF B;  4CJ0 B;  2JXM B;  1OGI A;  3V96 A;  4DNT B;  3OZU A;  3UDI A;  2VS1 A;  4GLV B;  5F4J A;  3EVQ A;  5E1F A;  2AQ2 B;  1CSQ A;  3AYH B;  1KQS A;  1JCK B;  2FHT A;  3V76 A;  3GV6 A;  4HIK A;  2F0T A;  1VQ4 B;  1U2R A;  4ZGQ B;  4EH1 A;  4HSP A;  1G2S A;  2AQ1 B;  5BN5 A;  1SJH D;  3P7J A;  3ASS A;  4B3G A;  4XT3 B;  5M5W H;  1YJN A;  1Y1V G;  2F0H A;  3OTO L;  1HR0 L;  1WOP A;  1Q81 C;  2IX0 A;  4IFD G;  3WQZ A;  4X62 Q;  1F2L A;  1BXT A;  1DJR D;  4XR6 A;  4GN4 B;  4AYB G;  3PO3 B;  4ZRZ A;  3RR5 A;  1I6H H;  4LF6 Q;  1SN8 A;  4TMZ A;  4B4D A;  2F0P A;  5D3I B;  4LF5 L;  4X7E A;  3PF4 A;  2C5H A;  2R61 A;  1SYE A;  2R7Z G;  3L9A X;  3KL9 A;  4YCU A;  4B48 A;  2KOL A;  2GVA A;  3KFU A;  3ZBU A;  5HY6 A;  2K52 A;  2F0G A;  1MBY A;  2YWH A;  4OWX B;  4BA2 I;  3J7Y W;  4TKO B;  4DV2 Q;  1QG7 A;  1JIC A;  4DV6 L;  4YCV A;  3I55 B;  3D4D A;  1X3E A;  4UHV A;  4EGV A;  3A8I E;  2B7B A;  5IOD A;  4X65 Q;  1GXD C;  2Z6B D;  3U6B A;  3RNU A;  5HKK A;  2PIA A;  4PC1 A;  2VQF L;  3N52 A;  3QOL A;  4RLZ A;  1UE5 A;  3A35 A;  3PUV A;  2ZTN A;  4A3J H;  3ASP A;  4A3G B;  2UXB L;  4R4C A;  3I4M H;  4A93 H;  1SMX A;  3BNW A;  1U5K A;  3HOU G;  1XE1 A;  3SEJ A;  3E3X A;  3LWU A;  4JI3 L;  3HOY H;  1VQ5 B;  4DAV A;  5FKA C;  1EFU A;  3TEH B;  4R4Q A;  1YNJ C;  2EZV A;  4GS3 A;  1VQB A;  3CC4 A;  4MNO A;  1KTV A;  3AFP A;  2DJG C;  4DV7 L;  4PV1 C;  5D3D A;  4RKB A;  4DV4 L;  4HAE A;  3MHP A;  1WOS A;  3T1Y Q;  4KJO A;  2NYZ D;  2B2Y A;  1HJP A;  4GKK Q;  3S1R B;  1FVI A;  3I7F A;  1E22 A;  1HH2 P;  2PMZ B;  1XMO L;  3R6J A;  2W6I A;  4P25 A;  1N36 Q;  3TRE A;  3A1P A;  4C56 C;  2BPO A;  2ZZQ A;  5I9P A;  1I4P A;  1TWC H;  3JAM E;  2VB2 X;  3MFG A;  2UUC Q;  2Q8R E;  1B44 D;  3OWE B;  1RHP A;  1JC7 A;  3J81 i;  1L0W A;  2ES2 A;  4OEL B;  1EP1 B;  1F20 A;  3A54 A;  3CCR B;  1O7L A;  3F1Z A;  1PTO D;  4TSF A;  2BGI A;  3W1B A;  4YAW A;  3GTO B;  5IYW A;  1M1K C;  4R8N A;  2VBS A;  4HIZ A;  1SRU A;  2D2C C;  1VQG A;  5EKI A;  1E43 A;  1LUZ A;  1SSO A;  2VUM G;  1EIH A;  3PA2 A;  4G57 A;  4RHR A;  4Y52 H;  2EYJ A;  1IW7 C;  3CCL A;  5CV5 A;  4X66 Q;  4JBW A;  2NZO A;  4Z4T A;  3CF5 A;  4RGN A;  1KAW A;  3VDY A;  3GTP H;  2K50 A;  2P3M A;  3S15 B;  3ASR A;  3OIP A;  2Z0S A;  4ZQ3 A;  2KHJ A;  2XWJ B;  1FNU A;  1VQJ A;  2EYO A;  1FR3 A;  1HNZ L;  4WJ3 M;  1GUO A;  2HHH Q;  3H3V H;  4DR2 Q;  1UWV A;  3MC0 B;  4A3J G;  3QSY A;  4HJA A;  5C0X G;  1VQE A;  2QIL A;  1SYD A;  3I4M G;  1B70 B;  4A93 G;  2ID0 A;  3W5H A;  3VO2 A;  2ZTC A;  1VQA A;  1E3X A;  3CCM B;  4P74 A;  1AZP A;  2C9O A;  1ESF A;  1YHA A;  3BCF A;  3BH4 A;  1WTQ A;  3MXG A;  3HKZ E;  1KAA A;  2V7X A;  4E6I A;  3SEB A;  3WBJ A;  5IE8 A;  1K28 A;  4A3D H;  1K3B C;  1X3Q A;  5KND A;  1JJ2 B;  3X3M A;  1JOO A;  2AQ3 B;  1VQF A;  2R92 G;  1HTP A;  1A8V A;  4WWV A;  2K33 A;  3D8G A;  2C77 A;  1VQN A;  4A3F B;  3CCU A;  3CP8 A;  4XOR A;  3QIA A;  1BR9 A;  4YEL A;  1RDP D;  1H8E A;  3L3O C;  4OO1 H;  4XNF A;  1SND A;  4IUP A;  2VZL A;  4TMX A;  3DEP A;  3SDZ A;  1EP3 B;  1E1R A;  4RDK A;  1XQB A;  1QWY A;  1XXG A;  2QA4 A;  3RLF A;  4K5W A;  4M4S A;  4UP8 A;  4OEM B;  1QG0 A;  1F2Z A;  2DEU A;  3KDF A;  1P8L A;  2B8F A;  4LFA L;  1WTH A;  1M8A A;  4DFA A;  2Q6I A;  3BS1 A;  2EY2 A;  4P71 A;  1PH9 A;  3GTM H;  4HJ9 A;  2DY7 A;  2K4K A;  5LMU Q;  2NVT B;  2BA0 A;  2HQL A;  1RCV D;  3SR1 A;  5COY A;  1EFC A;  3C46 A;  1D5M C;  3HOX B;  4BBR B;  2E2J B;  1HUN A;  1VLO A;  3GTL B;  1HFG A;  3B82 A;  3NQI A;  1SXT A;  3VYT A;  3T51 B;  3PUZ A;  1VQK A;  5M3M B;  1BPL A;  4RCY A;  4MHE A;  1VHE A;  1SNM A;  1EYG A;  2VNH A;  4TN1 A;  4ID6 A;  3KF8 A;  5A89 A;  1OXX K;  2CH4 W;  2F0L A;  3A5Z B;  5C3E H;  4A3M H;  4K0K Q;  2BSA A;  2HLD A;  1KL9 A;  4DV5 Q;  2B63 B;  2DER A;  5CV8 A;  1E63 A;  3CCE B;  2ZBU A;  4II2 A;  1D8L A;  4JI0 Q;  1BQE A;  4XIG S;  1S0U A;  1XNQ Q;  2DOG A;  5K36 H;  3AGP A;  2GN5 A;  1EFR A;  2JA6 G;  1EWY A;  1XNR L;  2VY3 A;  3GSI A;  5LMN Q;  4Y9R A;  2JE6 I;  3PMF A;  4RWS C;  2Z4H A;  5E4W C;  4FVM A;  1KLG D;  2EFG A;  3NEL A;  3GV3 A;  4KK7 A;  2JQO A;  3X3N A;  4XLH A;  4PMC A;  1GUN A;  3BVM A;  3HOV B;  2LSS A;  1ILP A;  2A5H A;  4R4I A;  3J7Z C;  4C3H H;  3PO2 B;  4Z4Y A;  3MXU A;  1VS0 A;  2BE5 D;  3SK6 A;  1IYU A;  3S1N B;  1FDR A;  2OEO A;  1VQC A;  2JSO A;  3F8T A;  1HA3 A;  1D7Q A;  2OYN A;  5DN6 A;  1XPR A;  1SE3 A;  1CK1 A;  2GJK A;  1A3T A;  1B50 A;  2ZXR A;  3S2D B;  2B29 A;  1B3A A;  2B2W A;  1VQP A;  1RL2 A;  4R8I A;  3W2I A;  4OO1 G;  2FVG A;  4M0L A;  4CQJ A;  2Q6O A;  3G6E B;  4IFD I;  1KD1 D;  1WCM H;  3SLN A;  3W2H A;  2QDX A;  1NNX A;  1TS4 A;  5CGK A;  3HS0 C;  3VA7 A;  4GNX A;  2HDM A;  4NCN A;  4XDX A;  4DR3 Q;  4A3I H;  1GUW A;  3VR6 A;  3ZPN A;  3T16 A;  5BR8 L;  3M3Y B;  1OTC A;  3SKB A;  4A3K B;  2F0J A;  1Q9S A;  1EOV A;  4B3R Q;  2YV5 A;  3V2T A;  1WU8 A;  2YTV A;  1L0X B;  4XOP A;  1DDG A;  1F2Y A;  1FNV A;  4IW3 B;  1VJS A;  5JAV A;  2ZJP A;  2EY1 A;  5IGF A;  1WSR A;  3EIV A;  2KHI A;  1UEB A;  3D31 A;  2Q8I B;  3HKZ G;  1XB2 A;  5C4X B;  1UD4 A;  3MXN B;  2WB1 B;  2PI2 A;  3E1Y E;  3PSI A;  1J9Z A;  3Q6S A;  3SHL A;  2QDB A;  1IBL L;  3K59 A;  2JN9 A;  4XM3 A;  4RD0 A;  5EGT A;  1X32 A;  1D6E C;  4LWC A;  4RHS A;  1OGJ A;  4K8J A;  3C2P A;  2F0W A;  1LLR D;  2ZBV A;  1EFI D;  3BG3 A;  3VR2 A;  1O7Y A;  1KXL A;  3ND9 A;  1U4L A;  1DGS A;  1TR5 A;  4HSV A;  1NUC A;  3RUZ A;  1W3S A;  1XTD A;  4YAU A;  1TTT A;  3HKS A;  2O4X A;  3I4N H;  1PV4 A;  1KC8 D;  3EA6 A;  1K8G A;  2NTT A;  3PVD A;  3CQZ B;  3G7L A;  3NTI A;  2K5N A;  4IO9 A;  3ERS X;  1PH5 A;  1Q90 A;  1HRJ A;  4R71 A;  1CNE A;  4KN7 C;  4X7F A;  3P20 A;  5ELF A;  3RLN A;  4OHJ A;  3AFQ A;  2EY6 A;  3M7N A;  2DGY A;  3U9O A;  2CWP A;  1JQY D;  1JB9 A;  5IYR A;  4JYA L;  5H1S E;  1TWH H;  4APV A;  3E9I A;  1CI3 M;  1Q46 A;  1VQM B;  1DM0 B;  1OB0 A;  1N06 A;  3WBK A;  4PZ7 A;  4LF9 Q;  3S1M H;  4WOR A;  2UXC L;  3MA2 B;  4DV1 Q;  5CBE E;  2K32 A;  1SKY B;  4O1N A;  3CCV A;  3ONU A;  3T53 B;  3HOV G;  1L1O A;  1NTG A;  2DY8 A;  2BF4 A;  1SKQ A;  4A4I A;  1Y0Y A;  1FRN A;  4DAM A;  1AMO A;  4X06 A;  4U68 A;  1PTO B;  2XNC A;  3J80 c;  1R4Q B;  2M9V A;  5GAD C;  2EIX A;  3RN2 A;  1IB0 A;  3D4R A;  2N55 A;  4YY3 L;  4YWK A;  4DUZ L;  3FKI G;  4P22 A;  4G7X A;  2AHO B;  5IP9 H;  4HMI A;  3KYH C;  2V7V A;  2JA8 G;  2K6A A;  4IUU A;  4GZY C;  1IZ6 A;  1UNS A;  3I73 A;  3LNN A;  3KJO A;  2BA1 A;  3L0O A;  4HED A;  4XTC S;  3ULJ A;  4RD6 A;  1VHO A;  3J80 L;  2WKD A;  1A3U A;  1PYS B;  1AFP A;  3G4S B;  3OYY A;  2V7T A;  1LO5 D;  2Z6B A;  3P1H A;  1PRT D;  3PIP A;  1YIJ B;  1W34 A;  1E2W A;  1X56 A;  3MWY W;  5C0X I;  5C4J B;  3F2C A;  4LF8 Q;  2E2H B;  3PUX A;  1EU4 A;  1DDI A;  2OTL B;  1SNP A;  2AWN A;  5M5Y B;  2F0E A;  3K81 C;  4PAB A;  3NBI A;  3T1H Q;  4JOI A;  5EKK A;  5LMN W;  3C1F A;  1V1P A;  3KLS A;  1JOQ A;  2TSS A;  3WXM A;  2O2L D;  2WPD A;  3PIO A;  1BBX C;  2NVX H;  2GPJ A;  3I4N G;  3DEO A;  3HOZ H;  5C4X G;  1DG1 G;  1KTK A;  2X6Y A;  2BMW A;  4PC7 A;  1MD2 D;  1KDA A;  2K5V A;  4EQP A;  5IWA L;  1PTO C;  4QHY A;  3OJX A;  1GKH A;  5FLX c;  4TMT A;  4K2K A;  2D3N A;  3CCQ B;  4QCL A;  4RGO S;  4OP7 A;  4RAU C;  1SFO H;  4A3E H;  5I6Y A;  4FN5 A;  2OT2 A;  5C3X A;  4N9P A;  4KTA A;  4ZCL A;  1MGS A;  1YI2 A;  2W6J A;  5JPN C;  3GTJ H;  3D3R A;  4KMU C;  2F0N A;  1Z7T A;  2ZJQ A;  4ZYS A;  3K7U C;  4OX9 L;  2IHF A;  1I94 L;  3PA1 A;  4O0A A;  2UU9 Q;  3S1Q H;  3Q6R A;  1EIF A;  2CK3 A;  2H5X A;  1K83 H;  1V9P A;  3QG1 A;  4HJ8 A;  2KEE A;  3PV0 A;  5FLX L;  4DAP A;  1D1K A;  1PVO A;  1D5X C;  1LT6 D;  3MMP A;  1QUE A;  2LZJ A;  1J8I A;  5IYB G;  4OL7 A;  1NMF A;  2DY1 A;  5H59 A;  1CKM A;  3CME B;  4BY1 H;  2QGQ A;  3PUN A;  5A8A A;  1G51 A;  1G7C A;  4X0C A;  4AVZ A;  1Q86 D;  2UXD Q;  3MAQ A;  2RHS B;  1NR2 A;  2A69 D;  2Q2U A;  2Q6L A;  1WTH D;  2OQ0 A;  4JVZ A;  3OFN A;  3KK7 A;  4KKS A;  4JI7 Q;  2E1B A;  4HCE A;  4DR7 Q;  2PPB C;  4KKT A;  4U67 3;  4C1N I;  2D0P A;  1VQH A;  4H44 C;  1C0A A;  5E3F A;  2EYP A;  2R93 B;  1HZA A;  4JV5 L;  4DR4 L;  5AJ3 Q;  3G71 A;  2E2D C;  3NSW A;  4LF6 L;  4HIO A;  4OOX A;  2B2V C;  1QUQ A;  2X6G A;  1X3G A;  4TQU S;  4FXD A;  4PC3 A;  5EKL A;  1W35 A;  2NN6 H;  3TRZ A;  3ZC3 A;  1YJ9 B;  1YHQ B;  1EP2 B;  1BVS A;  1A62 A;  1TII D;  2Z1C A;  2JDI A;  5IYD H;  3VMF A;  3DDY A;  2ZZG A;  3CXC B;  3K80 C;  3OHX C;  2R7F A;  5C4H A;  2F0F A;  3NK9 A;  4K14 A;  1K8A D;  4C3I H;  1ZM3 A;  4CDD C;  1BBU A;  1WTV A;  3OEE A;  3WNC A;  3AVY A;  1ET6 A;  2N3S A;  1Y1V B;  3W5V A;  2B2U A;  2F4I A;  3NQT A;  4LBW A;  4IUN A;  1NBM A;  1PJ7 A;  4KD3 A;  2PW7 A;  3MEF A;  4AYB B;  1NY4 A;  1BBW A;  4LFB L;  5B6I A;  4AQY Q;  3GTQ B;  1ML0 D;  2CHB D;  1VQM A;  1TU2 B;  1EU3 A;  4KHV A;  5JPM C;  3OSO A;  1E3P A;  3PGZ A;  2JA5 G;  2R7Z B;  1LV9 A;  3PUW A;  4JI1 Q;  4GOP A;  1HUM A;  2R6G A;  1S72 B;  4LF4 Q;  2CBX A;  2OBS A;  5DSZ A;  5FJ8 H;  2G9D A;  2ZJR A;  4J15 A;  2XOK A;  1YJN B;  3J7A V;  2DET A;  1TY0 A;  3A3G A;  4PG3 A;  4P3Y A;  3GTG H;  4TMW A;  3TBI B;  1IBK L;  4FF3 A;  2ZL7 A;  5ELC A;  2NTS A;  4NXM L;  1SJE D;  1J9O A;  1JJG A;  2F03 A;  1I4R A;  2RQX A;  1DAR A;  4G7H C;  2KBN A;  5KNB A;  2VNJ A;  4R9W A;  4B3T Q;  2RBM A;  3RZD B;  4PAA A;  2MPM A;  2MNA A;  5A88 A;  2DN8 A;  3F2U A;  4QIW E;  1JA1 A;  2Z6K C;  4HIM A;  3JU4 A;  1CNF A;  4A3L G;  1GO2 A;  2SNM A;  2HCJ B;  3M4P A;  4LAA A;  1F2M A;  4UP9 A;  3HOU B;  3ND8 A;  1A6X A;  3HOW G;  1HNX Q;  2QDL A;  2VNK A;  1S3O A;  1EIY B;  3ICE A;  1JWS D;  4Q7J B;  4GKJ Q;  5M3F H;  1ONL A;  1KDB A;  2VQE L;  3BVZ A;  1FRQ A;  2C78 A;  4YAL A;  1EOT A;  1JWU D;  1SE2 A;  4L5T A;  1TLL A;  3J81 c;  1SYF A;  4HR7 B;  4XD7 A;  2NN6 G;  1M4V A;  1H95 A;  1VQL B;  2HIX A;  5ELE A;  2CFM A;  4F7X A;  1RKN A;  1YVC A;  4EQO A;  4B47 A;  4K1X A;  3OJW A;  4NNJ A;  4YCW A;  4NBS A;  5IYD G;  1FJG Q;  1PYW D;  1I3Q B;  2WJY A;  2R9V A;  3CCJ A;  4JMQ A;  1A2T A;  3VA5 A;  1K0R A;  2Z9H A;  2NVQ H;  2KJX A;  4C3I G;  5FNZ A;  2L5T A;  4WZE A;  4A3C H;  3CC4 B;  4EQN A;  1H9R A;  5M5W B;  3IAY A;  4N8F A;  2L15 A;  1I18 A;  3C1E A;  3GTK B;  3TME A;  4BY7 H;  3ULL A;  3J81 L;  3F2D A;  1RF2 D;  5EAY A;  4DR2 L;  3CC7 A;  2XZL A;  1S5F D;  1BMF A;  4G1B A;  3O13 A;  2WYR A;  5G3L F;  4IPH A;  3NXW A;  1QVG A;  3ONY A;  2YU9 H;  2XIW A;  4R4T A;  1YHB A;  1QIL A;  1GVP A;  3C2Q A;  1WD0 A;  1EY9 A;  4NW2 A;  5KW9 A;  2A8V A;  2VUM B;  1TS2 A;  1YNN D;  2RF4 A;  3GP7 A;  3RZO B;  2JA7 G;  3I91 A;  2QE7 A;  3RMH A;  3CMA B;  1QCB D;  1ASY A;  3TS0 A;  4Z9C B;  5DM6 3;  4AH6 A;  3KBG A;  1I4Q A;  5ELN A;  5D65 A;  3QO2 A;  4G6I A;  2NUC A;  4BS9 A;  5CV7 A;  3K5L A;  1ILQ A;  4V0B A;  3PUY A;  1KK1 A;  5EBD A;  3GVJ A;  3CAM A;  3S17 B;  1QNK A;  4DNI A;  1X9N A;  4IAL A;  1E62 A;  2KVO A;  4A3J B;  1BNZ A;  3ERO A;  4U9U A;  1GHJ A;  1VQI A;  5C44 H;  5JJI A;  4QQB X;  3I4M B;  4A93 B;  2XEX A;  3QR8 A;  4NPS A;  3JQQ A;  3SE0 A;  4B3M L;  1U9R A;  1SE8 A;  1UUP A;  5BN4 A;  2HD3 A;  4UZE A;  5M3F G;  3WND A;  4FF1 A;  2B2Y C;  2RKS A;  4ACB A;  2R92 B;  2XSC A;  1J5E L;  3J80 E;  3OMG A;  2VL6 A;  2EPB A;  1TY2 A;  3Q0A A;  5M9O A;  2E1R A;  5DS0 A;  4B43 A;  3AQQ A;  3R6K A;  1Z6H A;  2IL8 A;  2KQ3 A;  1AIP A;  2PZW A;  1T6Y A;  4YAO A;  2V31 A;  4ASU A;  1VQ6 A;  2L11 A;  2V1C C;  3CD6 A;  3A8K A;  4A3C G;  1H85 A;  1TS3 A;  3FP9 A;  3S2H B;  1XX8 A;  1E2Z A;  1ENF A;  4DAY A;  3PO3 H;  3ZBT A;  1WJJ A;  4BY7 G;  3MZ5 A;  2IJ0 A;  2XRQ D;  2HDN B;  3CP0 A;  4DV0 Q;  4BA1 I;  1S5E D;  1HVX A;  2X3U A;  1FGB D;  5C6A A;  3BYY B;  4DXF A;  2WV6 D;  1UD2 A;  3FRP B;  1RIP A;  2L0C A;  4JK1 C;  4ZCK A;  3JQP A;  1PRT C;  2Z8L A;  1I50 B;  1RJT A;  1N33 L;  4HCS A;  3OW2 A;  2QA4 B;  3R2I A;  1BO0 A;  1EZ6 A;  4DR1 Q;  2X69 A;  3KDF B;  3FKS A;  3NBH A;  1O7I A;  4KI0 A;  4JI5 Q;  1EQT A;  3RLO A;  1WOR A;  2OCE A;  2VXW A;  1ENC A;  3W5U A;  4K8I A;  3GTP B;  1ZYR D;  4XLA A;  5FLX E;  4ZKC B;  3GQB A;  3I56 B;  1Q12 A;  1PFB A;  4UZF A;  2F4N A;  2L12 A;  2F3I A;  5JVH 3;  1SMY D;  1G29 1;  1A8P A;  1OXU A;  3R93 A;  5C44 G;  1RQP A;  3CKI B;  4FXU A;  2JA6 B;  1VQK B;  3FMC A;  3H0G H;  4DR3 L;  4DPG A;  1ZM4 A;  2SOB A;  5J39 A;  4H9G A;  1AEX A;  1E2V A;  1STN A;  1PFN A;  1W87 A;  3KF8 B;  2K75 A;  3QFC A;  4LUO A;  2WAQ E;  1WVL A;  2MUY A;  2BGJ A;  3LO8 A;  1II3 A;  2CW0 D;  4QVJ A;  1YIT A;  1N34 L;  3UE0 A;  1F77 A;  3TZU A;  4LNQ A;  1EIG A;  2D74 A;  1JMC A;  1STB A;  1QJO A;  5IGD A;  1B1Z A;  2CVR A;  5C3W A;  2JYO A;  4X05 A;  4G5G A;  2QCP X;  3UDF A;  3OZV A;  2YWE A;  2GJR A;  4KJN A;  5FL7 A;  4RA8 A;  1QFY A;  2ZXP A;  4L5Q A;  5K5P A;  3I8Z A;  1CQF A;  5JJZ A;  3HFZ B;  4AC9 A;  2NVY B;  4L6T B;  3K5O A;  3H94 A;  2A69 C;  3A7L A;  2F0Q A;  3HOY G;  2Z4I A;  2GQF A;  3R2T A;  5I2Y A;  3I55 A;  2AUJ D;  1DON A;  2Q6K A;  2R7D A;  1AH9 A;  1Q7Y C;  1LTA D;  4DN4 M;  2C4T A;  2UUA Q;  3GTO H;  4YAF A;  2RDF A;  3D26 A;  1EYC A;  3GTM B;  4HE5 A;  3DWP A;  1WD1 A;  1R9T B;  2MJ8 A;  1XFO A;  3H3V C;  2WKC A;  2V7W A;  1NE3 A;  4B9W A;  2F1L A;  3AB9 A;  5ELB A;  2ZTD A;  1F9Q A;  1STE A;  4ZK9 B;  4NMZ A;  3P26 A;  4P2N A;  4OOS A;  4ULL A;  3OAA A;  2RSN A;  3S9W A;  5HXB A;  5HGT A;  1VQD A;  1SAP A;  5EPL A;  1QVF A;  3HKZ B;  2RC5 A;  4QV2 A;  2O5J C;  3S15 H;  2PI2 E;  1HR0 Q;  3OTO Q;  5M5X B;  2IY5 B;  1VQ9 A;  3SK5 A;  1WTX A;  2A6H C;  3PIP 3;  3BY2 A;  2WSS A;  3VR4 A;  1FGU A;  5KEE A;  2J0T D;  4QY7 A;  4F7D A;  4X6A H;  4IQZ A;  2ZM6 L;  4JI8 Q;  4LF5 Q;  1CM9 A;  1N08 A;  2WIN B;  1PTO F;  3CRL C;  5F2D A;  3H0G G;  4OPS A;  2XRS D;  3PIO 3;  3H15 A;  2F0M A;  3D4W A;  3VNV A;  1TS5 A;  3OKX A;  2X53 S;  2NB0 A;  3BDC A;  3AMU A;  4DV6 Q;  2QN6 A;  3MXP A;  4CHT B;  4DR5 L;  2JJ2 A;  4XOT A;  3Q24 A;  2CCZ A;  4QB4 A;  1HXY D;  3E0J A;  5IGB A;  2B2W C;  4RDJ A;  3JQR A;  1B23 P;  3M7G A;  4PMB A;  1GUS A;  1YX2 A;  2KCC A;  1FND A;  2FJ2 A;  3CC2 B;  2VQF Q;  1TXY A;  1PLF A;  2H4O A;  3K7A B;  3Q22 A;  1C9O A;  2DNC A;  3PCO B;  1DZ1 A;  2PQA B;  4DV3 L;  4ZCI A;  3A8J E;  1LTT D;  2UXB Q;  4CKE A;  3SXH A;  4B3S L;  2I5L X;  1SYB A;  1VQ7 A;  3S14 B;  4L63 B;  4JI3 Q;  4P26 A;  2AUK A;  3WWV A;  3VYS A;  1D5Z C;  4C0S A;  1HZ9 A;  2A73 B;  2IT1 A;  4A3D G;  5TY0 A;  1TWA H;  4HJ7 A;  1CFM A;  3KBX A;  4KY6 A;  1TT2 A;  3H6M A;  3M4O H;  3HOX H;  4BBR H;  1FX0 A;  1Y0R A;  1CUK A;  3NEN A;  1XJV A;  4DV4 Q;  2E2J H;  4FF2 A;  3PQI A;  3S16 B;  2A68 D;  3GTL H;  1TWG H;  5FO9 B;  4LF7 L;  4J1M A;  4NKL A;  3ONA B;  3TQY A;  5M3M H;  3FKI B;  3WYA A;  1GJR A;  4CJ1 B;  4ZAI A;  2NV4 A;  3OOC A;  4FO2 A;  3CCV B;  3CCM A;  2JA8 B;  3D6W A;  4RG1 A;  1XMO Q;  5FLM H;  2WAQ G;  1IJE A;  1ZEQ X;  2CQO A;  5TV2 A;  1L1O B;  4KY5 A;  3J81 E;  3BCD A;  1XMQ L;  1A2U A;  4YWM A;  4GN5 A;  4A3B H;  2K5W A;  1LTB D;  1K9M D;  4BXX H;  1HFN A;  5JOB A;  4X7C A;  3VYR A;  4P6Y A;  3W5O A;  4K6D A;  1EQV A;  2XVS A;  2D0O A;  4XMY A;  1LAB A;  2DJF C;  2KCT A;  1E1O A;  2F1M A;  4CDC C;  1ICW A;  1NJI D;  4CBV A;  4YWL A;  2KVM A;  4UP7 A;  3CES A;  1NB0 A;  4OWT B;  1D2E A;  1G7R A;  2A6E D;  3J81 j;  1WOC A;  3OEH A;  4KD4 A;  3Q6Q A;  2K14 A;  3J81 k;  3CPW A;  1H9J A;  3PO2 H;  3I4N B;  1N9W A;  2QGG A;  2F4V L;  4YXW A;  1S5C D;  1I6V C;  4FK8 A;  2JA9 A;  2XTI A;  5C3E G;  4A3M G;  1SE4 A;  4QGU A;  1TVC A;  2JIZ A;  4ILW A;  3QFT A;  1ICF B;  1KHI A;  1E24 A;  3AVT A;  1RTO A;  2ZZE A;  1EY5 A;  2MO0 A;  1C8C A;  5K36 G;  3DWA A;  2E76 C;  4NDX A;  5CV9 A;  2B39 A;  3ZZU A;  3E0E A;  1YNN C;  1HNZ Q;  4IJH A;  4Y7N H;  4X64 L;  1LTI D;  2E5L L;  1MHW C;  3LQ6 A;  1XYI A;  1L1O C;  4B44 A;  3FJO A;  2WII B;  4Z4V A;  1CQV A;  4IPD A;  5COR A;  4YHH L;  4PMW A;  2K28 A;  4A3K H;  1MJC A;  1SRO A;  2EY5 A;  1GR1 A;  4C3H G;  2C5B A;  2ZIT A;  4ZKB B;  3EN2 A;  1KNE A;  3NUC A;  1E7Z A;  3CCE A;  4NXN L;  5CYU A;  4G4K A;  4MTK A;  2YTX A;  4YIJ A;  3KUP A;  1TQO A;  5EMN A;  1IBM L;  1X3P A;  1YI2 B;  2E8G A;  1NAP A;  1XWE A;  1W2B A;  1QB5 D;  1X54 A;  4DUY Q;  3IFT A;  3F2B A;  2FX3 A;  2LMC B;  3L7Z C;  3I4O A;  2ALY B;  2C5C A;  4GLA C;  1WCM G;  2ATW A;  3A8J A;  1CKN B;  1KK0 A;  1OB2 A;  4JI2 L;  1QFJ A;  4RCO A;  1ZKO A;  3FHW A;  3NHH A;  4OXP A;  3UE1 A;  4Z1M A;  4A3B G;  1HR0 W;  1N32 L;  4A3I G;  3RN5 A;  4IPC A;  1HZB A;  3IFD A;  5CV6 A;  2JK8 A;  2KUM A;  3URY A;  4ZUI A;  2VBV A;  2NZH A;  1CZW A;  1ROD A;  2QW7 A;  1RD9 D;  4JOI C;  4LFA Q;  2FMC A;  1E3Z A;  3WOE A;  2GK6 A;  4DA2 A;  2B2T A;  5J3O A;  2EYH A;  5FO0 A;  2A1A A;  2VB3 X;  4JI4 L;  4POG A;  3MFY A;  1UD6 A;  5IP7 H;  4OGQ C;  3G6E A;  4JI1 L;  1D1I A;  4X07 A;  3CQZ H;  4LF4 L;  4XQQ A;  1CSP A;  4DNR B;  1HZE A;  4P9S A;  2D3L A;  1LAC A;  4DGZ A;  1V8Q A;  3I1F A;  4C43 A;  2UUB L;  1MI2 A;  2CKZ B;  1BF4 A;  4KY7 A;  4L5R C;  4ME5 A;  2EQS A;  1OHH A;  5TR9 A;  4ACA A;  2DIE A;  3CCS A;  4ODG A;  3G71 B;  4LBY A;  3L2P A;  1Y69 U;  2ZZF A;  1SFO B;  5FOB B;  1T9H A;  4JI6 L;  1QUQ B;  2BN4 A;  1TVX A;  4G7Z C;  5EPK A;  2EYL A;  1YNJ D;  1G7S A;  2I07 B;  2K5Q A;  2XN9 C;  4EQ5 A;  1OXS C;  2OQK A;  3GTJ B;  5KYL A;  2RSO A;  1IKL A;  2F0V A;  2EJG C;  2V4D A;  3S1Q B;  3LX0 A;  1PXU A;  1XNR Q;  1K83 B;  5A2Q L;  5A35 A;  3K0X A;  3NTK A;  2JA5 B;  1ZYR C;  3QJY A;  1CHQ D;  2MFI A;  3OIQ A;  1PH8 A;  2K1B A;  3E6Z X;  4PGO A;  2PO4 A;  4FF4 A;  1B4O A;  1SMY C;  3SJZ A;  3V7A A;  1EY8 A;  1Y8P B;  3BZK A;  2K04 A;  4R4O A;  4J0Q A;  3U58 A;  3C3L A;  1JE4 A;  2Q2T A;  2GJP A;  2LS0 1;  2E75 C;  3GO5 A;  1DD2 A;  1EY0 A; 
#chains in the Genus database with same CATH homology
 2PQE A;  1EYD A;  2CW0 C;  2D62 A;  4L8J A;  4WRD A;  4G7W A;  2KA7 A;  2GK7 A;  2VJJ A;  1LT5 D;  3HOW B;  1PZI D;  5IGE A;  1IW7 D;  4WJW A;  2X6W A;  1FD7 D;  1B53 A;  2PNR C;  1STA A;  4DU9 A;  1I4H A;  1AN8 A;  3T56 B;  1MSG A;  2AWO A;  4DK1 A;  4H0L C;  1W6J A;  3QWN A;  4KY6 A;  1PKV A;  2EE1 A;  2LKV A;  2XNA C;  3HG9 A;  2HCI A;  2FIN B;  1E79 A;  1GUT A;  2B2U C;  1BCP D;  3UI2 A;  1DXM A;  2L4N A;  3KLS X;  2ZT9 C;  1VCI A;  2K03 A;  4C3I B;  1F9S A;  5EBC A;  2ICE C;  1PRT F;  3GD7 A;  2N88 A;  1HTL D;  1HQM C;  1DYQ A;  4IUV A;  3G05 A;  3A56 A;  4II3 A;  2K5D A;  2L55 A;  2L1B A;  2HCC A;  4FNF A;  2HDL A;  4HMJ A;  1ESR A;  1IYV A;  2JA7 B;  4OO1 I;  3FPU B;  2WJV A;  3DWQ A;  4S3S A;  3EQL C;  5JEA H;  3MTS A;  1B9N A;  1GJX A;  1Y8N B;  4LMQ D;  1LTS D;  3HP3 A;  4RGM A;  5C5L A;  4EVO A;  1EY6 A;  1V0F A;  2J7Z A;  1SNQ A;  4UAI A;  1NRK A;  1CTM A;  4XON A;  3ZYY X;  1KLU D;  2F0U A;  5LHY 1;  1O80 A;  1TKW B;  1Y8O B;  4XKV A;  5M3F B;  2IW3 A;  2HUG A;  1H9S A;  2BE5 C;  4YEJ A;  4QUF A;  4XYQ A;  5D14 A;  1G8Z D;  2XWB B;  1EEF D;  1SYC A;  1PZJ D;  2VJI A;  5E4X A;  4HTH A;  4DF7 A;  5JEA J;  4IUT A;  4IFD H;  3A8K E;  1RTN A;  1DCZ A;  3IKJ A;  1PDQ A;  2ZXI A;  3A3B A;  4BY7 B;  1W0K A;  3VR5 A;  4B08 A;  5JVG 3;  4TRD A;  2IWH A;  2MHV A;  3TZD A;  1Q3L A;  4TT3 A;  5DNF A;  3TDQ A;  3NE5 B;  4QIW B;  1VF7 A;  2G9H D;  2EYF A;  1WTW A;  2EXZ A;  4DK0 A;  4LJZ C;  3M4Y A;  2KCN A;  2A6E C;  1STY A;  2B8G A;  1I6H B;  3NWT A;  2BDN A;  3OPO A;  1EWC A;  1SNO A;  4IFD J;  1DOK A;  1LTG D;  3OWF A;  5C44 B;  1HA6 A;  4CJ2 C;  1UD8 A;  2WP8 J;  3RD4 A;  1LTR D;  5IK2 A;  2K7V A;  3CRK C;  2KHS A;  4XLE A;  2F43 A;  3OW7 A;  3NWS A;  3CP2 A;  1UAP A;  2PYK A;  3ZIA A;  1PRT B;  3TP5 A;  5CBA E;  1W6K A;  3HOY B;  1E0B A;  2PCF B;  2FMM A;  4Q0F A;  1WTR A;  1U4P A;  2E74 C;  4HN7 A;  4IN3 A;  3ITP A;  3I4L A;  3LWE A;  1V0E A;  3R3O A;  2SEB D;  2X8K A;  3GVK A;  1TWC B;  4K2L A;  5KNC A;  1D2B A;  1IL8 A;  2F0O A;  5A2Q E;  1KMH A;  4CKB A;  3D6C A;  4M1U B;  5C0X H;  2EVB A;  3DMU A;  2K01 A;  3H0G B;  1STH A;  1FNW A;  1LT3 D;  1JWM D;  1Z47 A;  2K05 A;  1BDO A;  3W3A A;  4KV6 A;  4MN3 A;  4XYO A;  2DNE A;  1QOH A;  2EYM A;  1G2T A;  1BUV T;  2F0I A;  1ENA A;  1R4P B;  2PZT A;  4XQJ A;  5LL6 X;  1B9M A;  1BQQ T;  2JJ1 A;  4FYD A;  1BCP B;  1H9K A;  1JOR A;  4XQF A;  1CA5 A;  2JEB I;  3EJI A;  4KHZ A;  1JOK A;  1OO9 B;  3I3C A;  2ZXO A;  5LL6 S;  5C0X J;  4A3D B;  1IKM A;  3ERQ A;  1SEB D;  1T5X D;  1I4X A;  2KED A;  4P2C B;  3K0Y A;  5AFW A;  3FVQ A;  1ET9 A;  3DHQ A;  2WAQ B;  5KYI A;  3R8B A;  4XN0 A;  1B2T A;  1KNA A;  2M00 A;  4E0F A;  1EEI D;  5FO7 B;  1BCP C;  4RFB A;  5CDF A;  1WTP A;  2NWG A;  2F0S A;  2OF1 A;  3BC9 A;  1BLI A;  3K58 A;  5DM7 3;  5C3E B;  4OIK A;  4A3M B;  4H13 C;  3OE7 A;  1C48 A;  4X3S A;  4B9X A;  1UD3 A;  4X3K A;  5CR3 A;  2OXP A;  4XT1 B;  3I72 A;  2EOT A;  1PFM A;  4F8M A;  2NN6 I;  4C3H B;  5I4D A;  1TWA B;  2XGJ A;  2LY7 A;  2Q8T A;  2PZU A;  2RDG A;  3M4O B;  1QNU A;  5IOC A;  1TWG B;  3KEW A;  4RKL A;  5FK9 C;  1WCM B;  1SNC A;  1OXV A;  2ZTG A;  4XXE A;  2XZO A;  1G91 A;  4TSS A;  2X85 A;  2JEA I;  4A3B B;  2WAC A;  5IGG A;  4A3I B;  4XKW A;  4XL9 A;  5I9O A;  2CQA A;  3BDL A;  2O5I C;  1KDC A;  4WFN 3;  1SDF A;  4QUC A;  1EYA A;  3Q23 A;  5I6W A;  1AP0 A;  4XLC A;  3I90 A;  1Q1E A;  1KZL A;  1XTC D;  2D9U A;  3EFX D;  4Y7N B;  4X3U A;  4Q5V A;  2ICI A;  3AU7 A;  3V05 A;  3FDT A;  2QKI C;  3SVM A;  1F9P A;  3CU7 A;  1O78 A;  1IHZ A;  1VLY A;  2QF7 A;  3HGB A;  5BN3 A;  1H9M A;  1K8O A;  5I2X A;  1TWH B;  3HZX A;  4RH6 A;  1V1P B;  4GQN A;  3W2D A;  3CHB D;  3K57 A;  5IT9 L;  1AW7 A;  3S1M B;  4C1N K;  1O7Z A;  4V19 0;  4KKU A;  1CT1 D;  5KRU A;  2B2T C;  3QB3 A;  2PW5 A;  1VMC A;  2HQE A;  5C5M A;  2XND A;  1WP6 A;  1NSN S;  1DOM A;  2V7Q A;  3N6R A;  4QMG A;  2WZP P;  2F3V A;  4IZ8 A;  4F88 A;  1UEA B;  4FXG C;  3DUZ A;  1V43 A;  1JR0 D;  1MSH A;  3NP8 A;  1G6Z A;  3P75 A;  3QOJ A;  1CA6 A;  4NP5 A;  5KGU A;  1PMR A;  5EQ0 A;  3HRZ C;  4MIU A;  5C4Z A;  1U4M A;  2FFK B;  4PNY A;  1EL0 A;  1MAB A;  3TSS A;  5CC4 A;  3HEJ A;  2NVX B;  3K6O A;  1EZ8 A;  1V1O A;  3HOZ B;  2ZXH A;  3SK4 A;  3HAG A;  3TP7 A;  3WDN A;  3DM1 A;  1Q1B A;  3U9S A;  4G7O C;  3SK8 A;  1WPC A;  5NUC A;  4RGT A;  4X3T A;  4K6L A;  3E5S A;  2NBF A;  1HQR D;  2QEJ C;  4A3E B;  4F87 A;  4J6H A;  4B3F X;  4KN4 C;  2D5D A;  3OMC A;  2IX3 A;  3WOF A;  4O42 A;  2L9H A;  3MXN A;  1HHV A;  1PTO H;  3MEH A;  1A3V A;  3K5M A;  2BCO A;  4I65 A;  2E2I B;  4PQX A;  2EJM A;  3GVL A;  4BY1 B;  4M8A A;  3VR3 A;  3A55 A;  3T13 A;  5KIX A;  4J8Q A;  1W0J A;  2SNS A;  2GA4 B;  2F3W A;  1Y1W B;  2F0K A;  1AZQ A;  2X6L A;  1H8H A;  5HUR A;  2VNU D;  3FPP A;  5T1G A;  3I70 A;  2A74 C;  4CKC A;  1K28 D;  3H91 A;  4LK1 C;  3JAM L;  1C4Q A;  3H09 A;  5CMD A;  1LT4 D;  1CZG A;  4K5X A;  1H9S B;  3DXJ C;  1ZXT A;  4FXK C;  1VMP A;  3BDO A;  1L0Y B;  3TN2 A;  3MHB A;  5KNL A;  1OXT A;  1SBB B;  1A15 A;  1EY7 A;  2KEC A;  1KAB A;  1U4R A;  1WTO A;  1GHK A;  5J22 A;  4XQN A;  1E1Q A;  3J7A F;  1HA5 A;  2RDH A;  1EY4 A;  3BZD B;  1S4Z A;  2LFN A;  4ZLT F;  1K8M A;  2ENB A;  1FYC A;  2J4X A;  3KLR A;  4C3J B;  4K5V A;  5TSS A;  2IPK D;  5FO8 B;  1S5D D;  2SDF A;  4RCN A;  2JP1 A;  4QF4 A;  4FP5 D;  3GTG B;  3FEW X;  3MVV A;  1NR4 A;  3VYU A;  4XN3 A;  2A6H D;  3BYT B;  1NCV A;  1SYG A;  1PZK D;  5DAU A;  5EPJ A;  2RVL A;  4ABN A;  1VF5 C;  5J1Z A;  5G3L D;  2RA4 A;  5IIF A;  2EJF C;  2YYZ A;  2B2V A;  3IL8 A;  2MP1 A;  3TP6 A;  1UD5 A;  1S5B D;  1VDZ A;  3NTH A;  2F0D A;  2BDO A;  4N9T A;  4XLF A;  1HPC A;  4I7Z C;  5T1I A;  2A68 C;  2BOS A;  2NVQ B;  1COW A;  1EWH A;  2NZ1 D;  4UZU A;  5ELD A;  1BCP F;  3T4A C;  3NPP A;  3A7A B;  5CV4 A;  2M5S A;  1GUG A;  1QE6 A;  2YU9 B;  2IX1 A;  1BOS A;  4IUQ A;  4BBS B;  1W9X A;  3CMM A;  5DEH A;  1DOL A;  3K5N A;  2H1E A;  3BVG A;  3G6J B;  3TP8 A;  1STG A;  4ZUJ A;  2I46 A;  2XZP A;  1I8D A;  4IUR A;  5IT9 E;  5JEA G;  2EDG A;  2TMP A;  4H7B A;  2M2L A;  2X6X A;  2R3Z A;  2MGS A;  1Q8I A;  1GOZ A;  4OIJ A;  1T5E A;  1F9R A;  4UDU C;  4CGY B;  3M85 A;  4C2M B;  4C3J G;  5EJW A;  5IGC A;  5ISR A;  1CHP D;  4DXG A;  1I4G A;  4BWG B;  2Y0S B;  1HCZ A;  1TWF B;  4CJ0 B;  2JXM B;  3V96 A;  4DNT B;  3EVQ A;  5E1F A;  2AQ2 B;  1JCK B;  2FHT A;  3GV6 A;  2F0T A;  4HSP A;  1G2S A;  2AQ1 B;  5BN5 A;  1SJH D;  3P7J A;  4XT3 B;  4B3G A;  2F0H A;  2IX0 A;  4IFD G;  3WQZ A;  1F2L A;  1BXT A;  1DJR D;  4XR6 A;  3PO3 B;  4ZRZ A;  2F0P A;  5D3I B;  2R61 A;  1SYE A;  3L9A X;  2KOL A;  2F0G A;  1MBY A;  4BA2 I;  3J7Y W;  4TKO B;  1QG7 A;  1JIC A;  3D4D A;  4EGV A;  3A8I E;  5IOD A;  1GXD C;  2Z6B D;  5HKK A;  3N52 A;  3QOL A;  3A35 A;  3PUV A;  2ZTN A;  4A3G B;  3LWU A;  4DAV A;  5FKA C;  1YNJ C;  2EZV A;  4PV1 C;  5D3D A;  4RKB A;  4HAE A;  4KJO A;  2NYZ D;  2B2Y A;  3S1R B;  2PMZ B;  2W6I A;  4C56 C;  2ZZQ A;  5I9P A;  1I4P A;  3JAM E;  2VB2 X;  3MFG A;  2Q8R E;  1B44 D;  3OWE B;  1RHP A;  1JC7 A;  3A54 A;  1O7L A;  1PTO D;  4TSF A;  3GTO B;  4R8N A;  4HIZ A;  2D2C C;  5EKI A;  1E43 A;  1SSO A;  1EIH A;  4G57 A;  4RHR A;  2EYJ A;  1IW7 C;  5CV5 A;  4JBW A;  4RGN A;  3S15 B;  3OIP A;  4ZQ3 A;  2XWJ B;  1FNU A;  2EYO A;  1FR3 A;  1GUO A;  3MC0 B;  5C0X G;  2QIL A;  1SYD A;  2ID0 A;  1E3X A;  1AZP A;  2C9O A;  1ESF A;  3BCF A;  3BH4 A;  1WTQ A;  3MXG A;  1KAA A;  4E6I A;  3SEB A;  1X3Q A;  5KND A;  3X3M A;  1JOO A;  2AQ3 B;  1HTP A;  2K33 A;  3D8G A;  4A3F B;  3CP8 A;  4XOR A;  3QIA A;  1BR9 A;  4YEL A;  1RDP D;  1H8E A;  3L3O C;  4OO1 H;  4XNF A;  1SND A;  4IUP A;  3DEP A;  3SDZ A;  1E1R A;  1XXG A;  1QWY A;  3RLF A;  4K5W A;  1F2Z A;  2B8F A;  1M8A A;  4DFA A;  3BS1 A;  2EY2 A;  2DY7 A;  2NVT B;  2BA0 A;  1RCV D;  3SR1 A;  5COY A;  3C46 A;  1D5M C;  3HOX B;  4BBR B;  2E2J B;  1HUN A;  3GTL B;  1HFG A;  3NQI A;  1SXT A;  3VYT A;  3T51 B;  3PUZ A;  5M3M B;  1BPL A;  4MHE A;  1SNM A;  4ID6 A;  3KF8 A;  1OXX K;  2F0L A;  2HLD A;  2B63 B;  5CV8 A;  4II2 A;  4XIG S;  5K36 H;  1EFR A;  2JE6 I;  3PMF A;  4RWS C;  2Z4H A;  5E4W C;  4FVM A;  1KLG D;  4KK7 A;  3GV3 A;  3X3N A;  4XLH A;  4PMC A;  1GUN A;  3BVM A;  3HOV B;  1ILP A;  2A5H A;  3PO2 B;  3MXU A;  2BE5 D;  3SK6 A;  1IYU A;  3S1N B;  2OEO A;  2JSO A;  5DN6 A;  1SE3 A;  1CK1 A;  2GJK A;  1A3T A;  1B50 A;  2ZXR A;  3S2D B;  1B3A A;  2B2W A;  4R8I A;  4OO1 G;  4IFD I;  1TS4 A;  5CGK A;  3HS0 C;  3VA7 A;  2HDM A;  4XDX A;  1GUW A;  3VR6 A;  3ZPN A;  3T16 A;  3M3Y B;  4A3K B;  2F0J A;  3V2T A;  1L0X B;  4XOP A;  1F2Y A;  1FNV A;  1VJS A;  5JAV A;  2EY1 A;  5IGF A;  3D31 A;  2Q8I B;  5C4X B;  1UD4 A;  2WB1 B;  3Q6S A;  3SHL A;  2QDB A;  3K59 A;  4XM3 A;  5EGT A;  1X32 A;  1D6E C;  4RHS A;  4K8J A;  3C2P A;  2F0W A;  1LLR D;  1EFI D;  3BG3 A;  3VR2 A;  1O7Y A;  3ND9 A;  1U4L A;  1TR5 A;  4HSV A;  1NUC A;  3RUZ A;  2O4X A;  3EA6 A;  2NTT A;  3CQZ B;  3NTI A;  3G7L A;  1HRJ A;  1Q90 A;  4KN7 C;  3P20 A;  5ELF A;  4OHJ A;  2EY6 A;  3M7N A;  3U9O A;  1JQY D;  1CI3 M;  1DM0 B;  1OB0 A;  4WOR A;  3MA2 B;  5CBE E;  2K32 A;  1SKY B;  4O1N A;  3T53 B;  2DY8 A;  4U68 A;  1PTO B;  1R4Q B;  2M9V A;  3D4R A;  2N55 A;  4P22 A;  4G7X A;  4HMI A;  2K6A A;  4IUU A;  4GZY C;  1UNS A;  3I73 A;  3LNN A;  2BA1 A;  4HED A;  4XTC S;  3J80 L;  2WKD A;  1A3U A;  1AFP A;  1LO5 D;  3P1H A;  1PRT D;  1E2W A;  3MWY W;  5C0X I;  5C4J B;  2E2H B;  3PUX A;  1EU4 A;  1SNP A;  2AWN A;  5M5Y B;  2F0E A;  3NBI A;  5EKK A;  3C1F A;  1V1P A;  3KLS A;  1JOQ A;  2TSS A;  2O2L D;  2WPD A;  1BBX C;  3DEO A;  1KTK A;  2X6Y A;  1MD2 D;  1KDA A;  4EQP A;  1PTO C;  4K2K A;  2D3N A;  4QCL A;  4RGO S;  4RAU C;  5I6Y A;  2OT2 A;  5C3X A;  4N9P A;  4KTA A;  1MGS A;  2W6J A;  5JPN C;  3D3R A;  4KMU C;  2F0N A;  1Z7T A;  4ZYS A;  2CK3 A;  3QG1 A;  2KEE A;  3PV0 A;  5FLX L;  4DAP A;  1D1K A;  1D5X C;  1LT6 D;  2LZJ A;  1J8I A;  4OL7 A;  4AVZ A;  3MAQ A;  1NR2 A;  2A69 D;  1WTH D;  3OFN A;  3KK7 A;  4KKS A;  2E1B A;  4HCE A;  2PPB C;  4KKT A;  4U67 3;  4C1N I;  4H44 C;  5E3F A;  2EYP A;  2R93 B;  2E2D C;  3NSW A;  2B2V C;  2X6G A;  4TQU S;  4FXD A;  5EKL A;  2NN6 H;  1TII D;  2Z1C A;  2JDI A;  3DDY A;  2ZZG A;  3OHX C;  5C4H A;  2F0F A;  3NK9 A;  4K14 A;  1WTV A;  3OEE A;  1ET6 A;  1Y1V B;  2B2U A;  2F4I A;  3NQT A;  4IUN A;  1NBM A;  4KD3 A;  2PW7 A;  4AYB B;  3GTQ B;  1ML0 D;  2CHB D;  1TU2 B;  1EU3 A;  4KHV A;  5JPM C;  3OSO A;  2R7Z B;  1LV9 A;  3PUW A;  1HUM A;  2R6G A;  2G9D A;  2XOK A;  3J7A V;  1TY0 A;  3A3G A;  3TBI B;  4FF3 A;  5ELC A;  2NTS A;  1SJE D;  1J9O A;  2F03 A;  1I4R A;  2RQX A;  4G7H C;  5KNB A;  4R9W A;  2RBM A;  3RZD B;  2MPM A;  2DN8 A;  3F2U A;  3JU4 A;  2SNM A;  4LAA A;  1A6X A;  1F2M A;  3HOU B;  3ND8 A;  1JWS D;  1ONL A;  1KDB A;  3BVZ A;  1EOT A;  1JWU D;  1SE2 A;  1SYF A;  4HR7 B;  4XD7 A;  2NN6 G;  1M4V A;  5ELE A;  4F7X A;  1RKN A;  4EQO A;  4NNJ A;  1PYW D;  1I3Q B;  2WJY A;  2R9V A;  4JMQ A;  1A2T A;  3VA5 A;  2KJX A;  4C3I G;  2L5T A;  4EQN A;  1H9R A;  5M5W B;  3IAY A;  1I18 A;  3C1E A;  3GTK B;  3TME A;  3J81 L;  1RF2 D;  2XZL A;  1S5F D;  1BMF A;  3O13 A;  5G3L F;  3NXW A;  2XIW A;  1QIL A;  1WD0 A;  1EY9 A;  4NW2 A;  2VUM B;  1TS2 A;  1YNN D;  3GP7 A;  3RZO B;  3I91 A;  2QE7 A;  3RMH A;  1QCB D;  4Z9C B;  5DM6 3;  3KBG A;  1I4Q A;  5D65 A;  3QO2 A;  4G6I A;  2NUC A;  4BS9 A;  5CV7 A;  3K5L A;  1ILQ A;  4V0B A;  3PUY A;  1EY0 A;  5EBD A;  3GVJ A;  3S17 B;  1QNK A;  4IAL A;  2KVO A;  4A3J B;  1BNZ A;  3ERO A;  1GHJ A;  3I4M B;  4A93 B;  3SE0 A;  1U9R A;  1UUP A;  5BN4 A;  4FF1 A;  2B2Y C;  2RKS A;  2R92 B;  2XSC A;  3J80 E;  3OMG A;  2EPB A;  1TY2 A;  3Q0A A;  5M9O A;  1Z6H A;  2IL8 A;  2KQ3 A;  2PZW A;  2V31 A;  4ASU A;  2L11 A;  1TS3 A;  3S2H B;  1XX8 A;  1E2Z A;  1ENF A;  4DAY A;  3MZ5 A;  2IJ0 A;  2XRQ D;  4BA1 I;  1S5E D;  1HVX A;  1FGB D;  5C6A A;  3BYY B;  4DXF A;  2WV6 D;  1UD2 A;  3FRP B;  2L0C A;  4JK1 C;  1PRT C;  2Z8L A;  1I50 B;  1RJT A;  4HCS A;  3R2I A;  1BO0 A;  1EZ6 A;  2X69 A;  3NBH A;  3FKS A;  4KI0 A;  1EQT A;  2VXW A;  1ENC A;  4K8I A;  3GTP B;  1ZYR D;  4XLA A;  5FLX E;  4ZKC B;  3GQB A;  1Q12 A;  1PFB A;  2L12 A;  5JVH 3;  1SMY D;  1G29 1;  3R93 A;  1OXU A;  3CKI B;  4FXU A;  2JA6 B;  3FMC A;  2SOB A;  5J39 A;  1AEX A;  1E2V A;  1STN A;  1PFN A;  1WVL A;  2MUY A;  1II3 A;  2CW0 D;  1F77 A;  3TZU A;  1EIG A;  1STB A;  1QJO A;  5IGD A;  1B1Z A;  2CVR A;  5C3W A;  2JYO A;  2QCP X;  2GJR A;  4KJN A;  5FL7 A;  4RA8 A;  2ZXP A;  5K5P A;  3I8Z A;  1CQF A;  5JJZ A;  2NVY B;  4L6T B;  3K5O A;  3H94 A;  2A69 C;  3A7L A;  2F0Q A;  2Z4I A;  3R2T A;  5I2Y A;  1DON A;  2AUJ D;  1LTA D;  4DN4 M;  2RDF A;  1EYC A;  3GTM B;  3DWP A;  1WD1 A;  1R9T B;  2MJ8 A;  3H3V C;  2WKC A;  4B9W A;  3AB9 A;  5ELB A;  1F9Q A;  1STE A;  4ZK9 B;  4NMZ A;  4ULL A;  3OAA A;  2RSN A;  3S9W A;  5HGT A;  1SAP A;  5EPL A;  3HKZ B;  2O5J C;  5M5X B;  3SK5 A;  1WTX A;  2A6H C;  3PIP 3;  2WSS A;  3VR4 A;  5KEE A;  2J0T D;  4IQZ A;  1CM9 A;  2WIN B;  1PTO F;  3CRL C;  5F2D A;  2XRS D;  3PIO 3;  2F0M A;  3D4W A;  1TS5 A;  2X53 S;  2NB0 A;  3BDC A;  3AMU A;  3MXP A;  4CHT B;  2JJ2 A;  4XOT A;  3Q24 A;  4QB4 A;  1HXY D;  3E0J A;  5IGB A;  2B2W C;  3M7G A;  4PMB A;  1GUS A;  2KCC A;  2FJ2 A;  1PLF A;  2H4O A;  3K7A B;  3Q22 A;  2DNC A;  1DZ1 A;  3A8J E;  1LTT D;  4CKE A;  3SXH A;  1SYB A;  3S14 B;  4L63 B;  2AUK A;  3VYS A;  1D5Z C;  2A73 B;  2IT1 A;  1CFM A;  3KBX A;  1TT2 A;  3H6M A;  1FX0 A;  3S16 B;  4FF2 A;  2A68 D;  5FO9 B;  4J1M A;  4NKL A;  3ONA B;  3FKI B;  4CJ1 B;  4ZAI A;  4FO2 A;  3OOC A;  2JA8 B;  3D6W A;  1ZEQ X;  4KY5 A;  3J81 E;  3BCD A;  1A2U A;  2K5W A;  1LTB D;  1HFN A;  5JOB A;  3VYR A;  4K6D A;  1EQV A;  2XVS A;  4XMY A;  1LAB A;  2F1M A;  1ICW A;  4CBV A;  2KVM A;  3CES A;  2A6E D;  3OEH A;  4KD4 A;  1H9J A;  3I4N B;  4YXW A;  1S5C D;  1I6V C;  1SE4 A;  2JIZ A;  4ILW A;  1RTO A;  2ZZE A;  1EY5 A;  1C8C A;  5K36 G;  3DWA A;  2E76 C;  4NDX A;  5CV9 A;  2B39 A;  1YNN C;  1LTI D;  1XYI A;  2WII B;  1CQV A;  5COR A;  4PMW A;  2K28 A;  4C3H G;  2EY5 A;  4ZKB B;  1KNE A;  3NUC A;  5CYU A;  4G4K A;  4YIJ A;  3KUP A;  1TQO A;  1X3P A;  1NAP A;  1XWE A;  1QB5 D;  3IFT A;  2LMC B;  3L7Z C;  2C5C A;  4RCO A;  1ZKO A;  3NHH A;  4Z1M A;  3IFD A;  5CV6 A;  2KUM A;  3URY A;  4ZUI A;  1CZW A;  1ROD A;  1RD9 D;  3WOE A;  2FMC A;  1E3Z A;  2GK6 A;  4DA2 A;  2B2T A;  2EYH A;  2VB3 X;  3MFY A;  1UD6 A;  4OGQ C;  1D1I A;  4XQQ A;  4DNR B;  1HZE A;  4DGZ A;  2D3L A;  1LAC A;  1V8Q A;  1MI2 A;  1BF4 A;  4KY7 A;  4ME5 A;  1OHH A;  2DIE A;  4ODG A;  1Y69 U;  2ZZF A;  1SFO B;  5FOB B;  1TVX A;  4G7Z C;  5EPK A;  2EYL A;  1YNJ D;  2I07 B;  2XN9 C;  2K5Q A;  1OXS C;  3GTJ B;  5KYL A;  2RSO A;  1IKL A;  2F0V A;  2EJG C;  2V4D A;  3S1Q B;  3LX0 A;  1PXU A;  1K83 B;  5A2Q L;  5A35 A;  3NTK A;  2JA5 B;  1ZYR C;  3QJY A;  1CHQ D;  3OIQ A;  2K1B A;  3E6Z X;  2PO4 A;  4FF4 A;  1B4O A;  1SMY C;  1EY8 A;  1Y8P B;  2K04 A;  3C3L A;  1JE4 A;  2GJP A;  2LS0 1;  2E75 C;  3GO5 A;  1DD2 A;  1JB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...