3T53B

Crystal structures of the extrusion state of the cusba adaptor-transporter complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
322
structure length
322
Chain Sequence
b'ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusB
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 55
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t53B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t53B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t53B01
3ND9A 3A7LA 3LWUA 4KMUC 1B9MA 2BDOA 1QJOA 4JK1C 3VR5A 1HTPA 2D5DA 1Y8PB 2BE5D 2BA1A 2B8GA 1H9JA 4DNTB 1I6VC 1VF5C 3A8KE 3QIAA 5C0XG 1GUSA 1G291 1Q1EA 2D62A 3IKJA 1Q1BA 1BDOA 3A8IE 5JEAH 2AUJD 1VDZA 1HQMC 2YYZA 1DXMA 3W3AA 2JE6I 1YNJC 1H9SB 4RCNA 1Z6HA 3M85A 4BA1I 3H94A 1CTMA 2DNEA 4DNRB 3MXUA 3OPOA 3T53B 5KNCA 2O5IC 3VR2A 2K33A 1B9NA 3M7NA 1IYUA 5K36G 1O78A 1Q90A 1HPCA 1Y8OB 4OO1G 3WDNA 1CFMA 4L8JA 3L7ZC 1SMYC 3PUYA 5KNDA 3KLRA 2R6GA 3PUVA 3PUWA 4KN4C 3IFTA 1OXSC 3BG3A 3GD7A 1Z7TA 2DN8A 4KKSA 2A69D 2L5TA 1HCZA 1Y8NB 4TQUS 4H0LC 2DNCA 1A6XA 3SE0A 4BA2I 3T56B 4H13C 4KI0A 1K8OA 1IW7D 4KHZA 1IYVA 5KNBA 2Q8IB 2EVBA 5BN3A 3T51B 3M4YA 2D2CC 4IFDH 4LJZC 2E74C 2BA0A 3GQBA 3CRKC 1FYCA 4OO1H 2BE5C 2NN6I 2A69C 3D4RA 4G7OC 3MFYA 2JEBI 2QF7A 1V8QA 4KKTA 1FR3A 2E75C 2PNRC 1IW7C 1Q12A 4DK1A 5C0XH 1E2ZA 2A6ED 1OXUA 3FMCA 2PCFB 1GHJA 3DXJC 4LK1C 2AUKA 4KKUA 3QJYA 1O7LA 2NN6G 4KN7C 1H9MA 3OOCA 2EJFC 3PUZA 3HGBA 1E2WA 1YNNC 1VCIA 1GUGA 3OW7A 1GJXA 2A6EC 1PMRA 2K7VA 2E76C 4XTCS 2A68D 2IT1A 4H44C 4HR7B 2O5JC 5K36H 1K8MA 3A8JE 4I7ZC 3SDZA 5JEAG 5BN5A 3I4LA 2B8FA 3PUXA 3NE5B 2KCCA 1GUTA 2EDGA 1T5EA 1GUNA 2A6HD 3ND8A 2F1MA 4G7HC 4GZYC 1VF7A 5A35A 2A68C 3EQLC 3N6RA 3P20A 2EJGC 4JBWA 3AB9A 4OGQC 2K32A 3TZUA 3VR4A 5BN4A 2LMCB 1GUOA 4IQZA 2JEAI 3PV0A 1DCZA 1CI3M 1OXVA 1ZKOA 2A6HC 2ZT9C 2PPBC 2AWOA 3VA7A 3I72A 3VR6A 1LABA 1ONLA 2KA7A 2CW0C 3RLFA 1ZYRC 3U9SA 3VR3A 2V4DA 4TKOB 2JXMB 3LNNA 1OXXK 1TKWB 2EJMA 3BDOA 1EWHA 1V43A 3D31A 3I73A 1TU2B 4XIGS 3CRLC 1DD2A 1OXTA 1LACA 1Y69U 1H9RA 3A7AB 4PV1C 4IFDG 1E2VA 4DK0A 1H9KA 3FPPA 2NN6H 1H9SA 3QG1A 1GHKA 4G7ZC
chains in the Genus database with same CATH superfamily
3A74A 3W2GA 2H1EA 3H0GH 3LWUA 2AWNA 2P5ZX 1SE8A 4N8X1 1TWCB 4EVOA 4OPOA 1H9JA 2BH8A 2F0JA 3OYYA 2NVYH 2B29A 4ZLTF 1MIUA 1TY2A 4E0FA 3HOXB 3K7AH 3PIOA 4R8IA 4UAJA 1XPOA 4R1JA 4RD3A 3OEHA 5ELCA 1QVCA 1PLFA 3WWVA 2YWHA 5CBAE 1XTCD 4X6AH 2PE3A 2PIAA 1JICA 5DN6A 1NTGA 2Z4IA 4IUUA 3CCMA 1EWCA 3G71A 3U58A 2NYZD 4LBYA 1PRTC 3I4MG 1RDPD 1DARA 3OMGA 4JI2Q 5JBQA 4MHEA 3PUWA 2HDLA 3BNWA 2JA7B 2OTJB 3A35A 3GD7A 3M9BA 1JMCA 5ELBA 3OZUA 2HQLA 2PYKA 5CV5A 2FJ2A 4BA2I 1KAWA 2JQOA 5DLQE 3I4MH 4FWTA 2DY1A 3GQBA 4FXGC 1I94L 1KTVA 1F2YA 1HH2P 1EYAA 3PIP3 1V5VA 1AW7A 4POFA 3FDTA 2Q6OA 4ACBA 1IBMQ 2PNRC 3QO2A 2QEXB 2EFGA 4BY7H 1KD1D 5JJLA 4BBSH 1A63A 5EBDA 1NE3A 1XE1A 1K0SA 4KY6A 4HMJA 5J3BA 1SYFA 1GUGA 4A3BG 3CCSB 1DOKA 2A6EC 2HIXA 3DEPA 2E76C 3B8HA 3NXWA 2C4UA 1NR2A 2EY2A 3I4NB 3TP5A 2OQ0A 5JOBA 1OB0A 5JJZA 3N52A 4A3JH 1T5EA 2KENA 1UUPA 1CHQD 1F9RA 2IW3A 3MEHA 5IODA 3F2DA 4LF9Q 1K8AC 1AH9A 2K32A 1KLGD 4C3IG 4CDFC 5C44B 2ZM6Q 4RA8A 4HCEA 3MZ5A 1LV9A 4CBVA 5KIXA 4RHSA 4B3RL 2Z6BD 1MJCA 3E0EA 1YHQB 1LABA 2CHBD 2QDXA 2OTLB 4LF5L 4JI4L 1IXRA 5CDFA 5C3EG 5JJKA 1D1KA 1EY5A 1EZ6A 1RODA 1ASYA 3GTPH 4KV6A 3D0FA 3CW2C 1PJ5A 1DGSA 4C3JG 2KVOA 1HVXA 1AZQA 1HFNA 1R9TH 4FF1A 5BR8L 2WACA 5CYUA 4L5RC 1GHKA 2KHIA 3M3YB 5C4ZA 2D5DA 1Y8PB 3HOVG 4RDLA 3ZJYC 5A8AA 1EOVA 2F3IA 3BYTB 5FIUA 4JI1Q 1CHPD 2B2VC 1X65A 1WTVA 1BCPB 2F0TA 5HURA 1V1PA 2E5LL 4WJWA 1J5EL 3S1MB 2YTXA 1CM9A 1PH6A 3OTOL 1STHA 1SYDA 2FMMA 4QFMA 3SGIA 4DFAA 1HPCA 2MHVA 3S17H 3Q6QA 4TN1A 3CCEB 2SOBA 2HHHL 5CV8A 2PQAB 4ASUA 3B78A 5IYDG 5IGCA 2IJ0A 2A69D 3V2TA 3S2DH 4TMVA 1IB0A 2A73B 1CT1D 4YHHL 1HNWL 4ZAIA 1OO9B 1QE6A 5JVG3 2NVTH 1FNDA 4AYBG 3Q6SA 4DA2A 1VQJA 1PH2A 1PTOD 3EA6A 2E74C 2RC6A 5M3MG 4ZRZA 1JWUD 1WORA 1VQ9B 4RKBA 2YWFA 4HMIA 1LT4D 2EQSA 1O7YA 1WTOA 1VQNB 2R61A 3BY2A 1FNCA 5DEHA 2VNJA 4ACAA 3WNDA 2JA6B 4P2CB 2EYLA 4CGYB 1G7CA 2D0PA 2E8GA 4IUNA 3GTMH 3ISXA 3GTOH 4FXUA 1GJXA 4CQJA 2NVXH 1MKHA 3S14H 4XTCS 5M3FG 3R8BA 4QUZA 1K8MA 1PFMA 3QOLA 3T4AC 1SXTA 4A3FG 1AN8A 1GJRA 1Y1VH 1B8AA 4GNXA 1A2UA 1YEZA 2VUMG 1GUNA 1JB3A 5IGGA 3PF4A 3CMAB 2F1MA 2XZPA 1XMOL 1G7TA 2Q2UA 1KLUD 3V7AA 1UE6A 5CMDA 4U673 1TLLA 2C77A 4C1NK 3AB9A 3ZZ0A 2E2JH 2JEAI 4EQPA 5CC4A 3ICEA 1FNVA 3CAMA 3SK4A 3D6WA 3W5OA 3S16H 4LFBQ 1KK2A 3LX0A 5E1FA 3S24A 1B23P 3OE7A 2QILA 2EJMA 3GSIA 5H5JA 3QWNA 3QOJA 1N07A 4PNYA 3CRLC 1XNQQ 4QMGA 4N9PA 4B3GA 3A7AB 4A3LG 5E4WC 4YEJA 2QCPX 4XD7A 2JN4A 1EIGA 2Q2HA 4Q0FA 4B3TQ 2VNUD 1KRSA 2WZNA 1SDFA 3S9WA 2AQ1B 2OYNA 4IURA 4P6VF 1VQPB 1CKNA 2B2UA 3I8ZA 4ZUJA 5FO7B 4RCNA 4ZYSA 1ENCA 5KYIA 2DOGA 2VW9A 4DV0Q 1VMPA 1CSPA 5LMUL 4RD0A 1S5BD 3R6KA 1MHWC 2R93G 1K83B 1O78A 4XLEA 5THXA 4HJ8A 5TY0A 3I70A 2ZXRA 4AH6A 2MNAA 4QL5A 3OWEB 5KNDA 1ELOA 1N9WA 2ALYB 3OHXC 4ME5A 3BG3A 2BCOA 3CU7A 4UP7A 2A74C 4L5TA 1GM5A 4IUPA 5C4XG 4LF6Q 2QTLA 1MD2D 4RGOS 3BY1A 1YIJB 1EIFA 1SEBD 2MO1A 4IOCA 5M5WB 1A6XA 1PH1A 1KRHA 1OGIA 5E3FA 2QA4B 1VQ6A 2E2IH 2DGYA 2PI2A 2W6JA 3TQYA 3NUCA 2BDNA 1KIXA 3MFYA 2WYRA 2QF7A 3VA5A 4F7DA 4UP8A 4JI2L 3ULPA 2ZXOA 2L9HA 2E2DC 5FA6A 2PCFB 1QG7A 1TS4A 1FVIA 4RHRA 5LL6S 1A2TA 1O7LA 1W2BA 1X55A 4CDEC 4K1XA 1WOOA 3BU2A 4DR6Q 2F0NA 1Q82C 1M90C 5IGDA 3FKIB 3FPKA 3RZDB 4XQJA 3CXCA 1G91A 4HR7B 3U2QA 4BWGB 1IBML 3BZDB 2KUMA 1C9OA 1FNUA 1VQ7A 4DV4Q 4CJ2C 3OJWA 3QE2A 1PRTF 3EQLC 1K28A 3HOUG 3J81j 3P20A 4FF2A 3I56B 3VR4A 1JNYA 5GQOA 1FNWA 5JPNC 1PRTB 3CTAA 3IL8A 4GKJQ 2DERA 2XSCA 2C5HA 4L63B 4QY7A 5HZAA 3W1BA 3OAAA 1MGSA 3A8JA 4DAPA 2F0MA 2CC2A 2CK3A 5T1GA 2V4DA 3KEWA 3K0YA 1TXYA 3SK5A 1G2SA 3W5VA 1F2MA 5DM73 1SBBB 3SXHA 4RDJA 2EYHA 1BNZA 1I4RA 2C35B 4K14A 5KEEA 1AP0A 2OWOA 3DM1A 1K9MD 4LF9L 1E2VA 3CP2A 2Q8TA 1PA6A 3F2CA 2ZM6L 4LBWA 4DAMA 2BDOA 4A3KG 2NZ1D 4A4IA 3Q22A 2QMUA 1GUSA 3PO2B 1WTHD 2I5HA 1EP1B 4KLKA 3W2HA 1C7YA 3Q6RA 3GIRA 4NB3A 2PZTA 3S1QH 3NTHA 4RGTA 1XYIA 4OOVA 2X8KA 2QDBA 1CTMA 2JSOA 4Y52H 4OPVA 1HZBA 1E3PA 2F0LA 4DR2Q 3F2BA 1D5ZC 2IWHA 1VQ4A 4HN7A 3ERSX 3DMUA 2EYPA 1WDTA 1UD5A 3HEJA 4OO1G 1T5XD 3WDNA 4TMTA 1VLYA 2X85A 2OBTA 2R6GA 4RJLA 3R93A 4B9XA 4YWKA 3U4ZA 4JI1L 1N8RD 3H91A 2RQXA 1K9MC 4C0SA 5EPJA 3T56B 1VHEA 1G8ZD 3A3GA 1WCMH 5I9OA 3OMCA 4KHZA 3RLOA 3GTKH 1X56A 1IYVA 2Q8IB 1S72A 1IZ6A 5BN3A 2IHEA 2LFNA 4OO1H 1CKMA 3EIVA 4G7WA 3HS0C 4TMWA 2CH4W 2BMWA 1KNEA 4RCYA 1TVXA 2VXWA 4KKTA 3MXNA 1Q12A 3CD6B 1TWFH 2EY5A 3AFQA 4G1BA 5TRDA 4X62Q 1HNXQ 2M9VA 2KECA 1KZLA 2QGQA 4J6HA 4XQQA 3Q23A 3DXJC 4FXKC 4JI7Q 1BVSA 5C5MA 2R92G 3A1PA 5A88A 1H9MA 3JU4A 3ASTA 3OOCA 4P71A 1Y1WH 1GXDC 1DOLA 4LNQA 2F0VA 1PMRA 2I07B 4NKLA 4HJ9A 2CW5A 2K6AA 4XN3A 3CC7A 1EFWA 4RD1A 1CZGA 4K5WA 4A3GG 3KBXA 4U9UA 3MXPA 4R4CA 2KOLA 4O0AA 1B53A 2FINB 1B70B 1XX8A 4R4TA 4HCSA 2B63H 2UXBQ 2NB0A 3VYRA 1VF7A 2KHJA 4BY1H 2R7FA 3KJPA 3GVKA 4KD4A 3FJOA 1CQFA 4DN4M 5BN4A 1PYWD 2JIZA 1EOTA 3OFNA 2H4OA 1WTPA 4OXPA 2PLFA 1CI3M 2FHTA 3KJOA 2CWAA 2E1RA 4JI0Q 3L0OA 1VQ5B 4XR6A 1G2TA 2R7ZH 2D9UA 1QGZA 5LMNQ 2HCJB 2C78A 2L15A 2EYFA 3HOYG 1EWHA 2NUCA 4RDKA 2ICEC 3NWSA 3K57A 2F0IA 1FJGQ 3CC2A 4Z4UA 1S5CD 3SEBA 3URYA 4A3IB 3I55B 3MCAA 5FLXE 2JJ1A 3WYAA 4KMUC 1PZJD 3D8GA 3FHWA 3NQTA 1NCVA 2BF4A 4HE5A 1I3QB 1KDCA 4LFBL 3HOYH 5C0XJ 2XOKA 2N88A 3SK6A 1CKOA 1VDZA 4J1MA 3CCUA 2GQFA 2OK7A 2BPOA 4A93G 4OP7A 1UWVA 4GKKQ 2UXDQ 4C3HG 4JPBW 3QFTA 1XNQL 3A0JA 1D5XC 2CFMA 4DF7A 2Z4HA 3BS1A 4DNRB 2V7XA 1LT6D 3T1YQ 1T6ZA 3TS2A 3HOWG 1ENAA 1YITB 4X3SA 1TWAH 3PO3H 4B3TL 2J0TD 3S2HH 4IFDJ 2GPJA 2ZITA 3K80C 1SNCA 1E22A 5TSSA 1PTOF 4C3HH 1SNPA 4IUVA 4TVAB 5C3WA 3AEVA 4EQNA 1N33Q 3PGZA 4H0LC 1PTOB 5HXBA 4DV0L 1PV4A 4IZ8A 3M4QA 5F2DA 5EBCA 4L5QA 4QVJA 4A3EH 3GVJA 1TT2A 2B7CA 1UEBA 1Z9FA 3CRKC 5HGTA 2NN6I 4LF8Q 4OEMB 3WBJA 3CKIB 1WTWA 5D65A 2GN5A 4XOPA 3TDQA 1U9RA 4OELB 1HUMA 2VBUA 4OOSA 4NNJA 1YI2A 1ENFA 1PFBA 4BBRB 1G51A 3GTQH 2M2LA 4LF6L 2ZBVA 4CDCC 4LK1C 1KXLA 3H3VH 1SYBA 1EIHA 5CV4A 1M1KD 1T6XA 4PZ8A 3BZKA 4Z4WA 3S1NH 4ZCKA 3PUZA 1HA3A 3VMFA 2KBNA 1SLJA 1VCIA 3AGQA 5KGUA 4Y7NB 3J7A5 4JW0A 1PXUA 1E3XA 4YAWA 2K14A 4K6LA 1PJ7A 2XNCA 3GV3A 2ZTNA 2Z9HA 2R6HA 2PQEA 2ZXHA 2OT2A 3F1ZA 3HOZB 1YJNB 3HG9A 1GUTA 3V76A 4DUYQ 2R3ZA 1V9PA 1QFJA 2DEUA 3TZDA 2D3LA 3E5SA 2FMCA 4QUFA 4LMQD 5IP7G 2EJGC 5FO9B 2D3NA 4DR6L 1GUOA 2ZTCA 4IQZA 5IYNA 1A3UA 2UUBQ 2Q6KA 2NV4A 4A3DH 1PVOA 2GA4B 2WJVA 2PW7A 3AVTA 4GS3A 2X6XA 3OKXA 4DV4L 2OEOA 3PIPA 1AFPA 3BZCA 1X3GA 1B3AA 3I73A 3P7JA 1M1KC 1JT8A 4OOXA 4DXFA 5LL6X 1E63A 2JA5G 5IT9E 4F8MA 1YJ9B 1KK1A 1XQBA 3P26A 4DR4Q 2V7QA 3I3CA 4BS9A 1IL8A 4GKJL 2M5SA 1SAPA 1JJ2B 3CQZH 3GV6A 4K0KQ 2NVQB 3TSSA 1O7IA 1TWHB 2B8GA 4HSPA 4A76A 5C0XG 2N49A 4X65Q 2ZBUA 5FK9C 5K5PA 2PO4A 3AQQA 2JA5H 2SEBD 1B44D 1NR4A 1EFTA 3M85A 4GN5A 2V7TA 1RQPA 1JJGA 3ZIAA 3MXUA 1VQKB 3T53B 1D6EC 3ZC3A 3K7AB 2F0KA 4TSSA 3KF8B 1MBYA 5K36G 3ASSA 1U4PA 1VQMA 4R9WA 2MP1A 3R6JA 1SYEA 2NTSA 2HCCA 1O7ZA 2JA8H 2Q8RE 4ID6A 3A56A 3L2PA 1HCZA 1UEAB 2ZZQA 3BVMA 1XB2A 1BKBA 2NZOA 3HKZE 1FRQA 4DR2L 1WYDA 4IFDH 4A3MG 3LWEA 5IYRA 3PF5A 4CKEA 1VQ8A 4LW1A 1EEFD 2PMZB 1V8QA 3E9HA 4ZCMA 2GJKA 1ET6A 2B3GA 2E75C 1DDIA 3NBHA 1KL9A 1X3EA 2Z0SA 3Q38A 4IW3B 3STBC 2VNKA 2A6ED 2L4NA 2R9VA 3CC4A 4WZTA 3MFGA 4GLAC 4ZK9B 3CHBD 1U4RA 1KC8D 2QN6A 3R2IA 4Z4ZA 3TN2A 4XLCA 4JI3Q 3KLSX 1Y0YA 1W34A 4BY7B 1RQRA 1JJCB 4Q5VA 3HOXG 2YV5A 1VLOA 4Z9CB 5B6IA 4IN3A 3S1RH 3A5ZB 4BBSB 2R7DA 1XPRA 3KYHC 1CUKA 4LBZA 1K8AD 2IY5B 3CMEA 1HNXL 5IT9L 4X62L 1KQSA 2GVBA 1C48A 2EDGA 2WAQB 1NBMA 3J7AV 3HP3A 1WOPA 1VQGA 3K0XA 4JI7L 4EX5A 4FXDA 5IIFA 4DV3Q 1AE3A 2XIWA 1X3PA 1DZ1A 4A3JB 2JA7G 2QW7A 3CCRA 1BXTA 4MYUA 4G1VA 5GV7A 4QV2A 4B43A 1OXVA 1FRNA 3BCFA 3SJZA 5A2QE 5CGKA 3WXMA 2VBSA 1HA6A 2VBTA 1GAWA 3U4VA 3OW2A 1PZKD 2EY1A 1KC8C 2UXBL 1D1NA 1L0XB 3PUNA 3TS0A 1LACA 2MJ8A 4FF4A 1EUJA 2XGTA 4XT1B 3DWPA 1ZM4A 2LKVA 4HIZA 1EQQA 2DIEA 1W6KA 4C2MH 3A7LA 2LSSA 3QFSA 3RZOH 1EYDA 2EE1A 5EAYA 2K04A 1XJVA 2F4VQ 4A3BH 4JI0L 2BE5D 4DNTB 1EWIA 5D14A 1EYCA 5DSZA 1R9TB 1I5FA 1QX4A 1STAA 1E1TA 5LMNL 1V0EA 2X0KA 4YIJA 3PQIA 3RNUA 1N0UA 5TV2A 2BM0A 3JQRA 2XNDA 3OZWA 3CCJB 2GVAA 1FJGL 5DNFA 4DAYB 1VQOB 4P1VA 1NRKA 3I4NG 3VDYA 3J7YW 3DDYA 1YBYA 2BN4A 1FD7D 4DUZQ 1JWMD 4DV5Q 1EP2B 1H8EA 2K5VA 5KNLA 4C3IH 1QILA 5HGQA 4AF6A 1Y8OB 3MC0B 1IKLA 4QF4A 4POGA 3WBKA 1Z7TA 2DN8A 5C44G 4GKKL 2UXDL 3S17B 3I4NH 3ONUA 1AIPA 5C3EH 4DR5Q 4B08A 5EKIA 1TWGH 2D9RA 2JJQA 1ZM3A 2RDHA 3T1YL 1KK3A 4A3CG 3K81C 2SNSA 2WV6D 4QHYA 3M4YA 3S2DB 2D2CC 4C3JH 1E1OA 4B4DA 3ES9A 2BE5C 4IUTA 1XMQQ 2C4TA 3E1YE 4M1UB 4LF4Q 1QH0A 2TMPA 3NWTA 4X66Q 5EJWA 2OF1A 1R4QB 3HOVH 1I50H 4JI8Q 1N33L 2B2WA 4UP9A 3L3OC 4YCUA 3GTJH 1D8TA 4DKAC 4GOPA 3NENA 2IX3A 2NTTA 4AIMA 3MHBA 4KN7C 3K58A 2NN6G 5F4OA 3BVZA 5A2QL 2K28A 3HGBA 4XYOA 4RGMA 4LF8L 2F0EA 3CCVA 1N36Q 4OHJA 3W2IA 3UDGA 5HY6A 4A75A 3GTMB 4Z4VA 1QUQB 2A19A 3GTOB 2B8FA 2NVXB 3NE5B 3S14B 1IL2A 5IYDH 1AMOA 4KK7A 1UNSA 1X3QA 3JAMc 1SKQA 2VNIA 2AHOB 3HKZB 4R4IA 1PJ6A 1X9NA 1K8GA 2WJYA 2RCFA 1F20A 1F77A 1Y1VB 1WD1A 3M7GA 4ZKBB 4JMQA 4B3SQ 4XOTA 1LUZA 2P3MA 2AQ2B 2B2WC 2A6HC 5M3MH 4GOPC 2ES2A 3RLFA 1ZYRC 2V31A 2OQKA 5ELNA 3VR3A 4DUYL 4YCVA 4V0BA 3S16B 2SDFA 5LHY1 3PENA 4RFBA 1H9KA 4XLHA 1W35A 2XVSA 1QFZA 2UUBL 3LGJA 3VR5A 5EKLA 3W2EA 1TS5A 1GAQA 3U6BA 3CCLB 3H3VC 5M3FH 4BPRA 5FJ8G 2JDIA 1BBWA 2JA6G 3BVGA 3A8IE 3ZZUA 3J81c 3ONYA 1JB9A 3G4SB 5DS0A 2PZWA 4A3FH 1QVGB 1I4XA 2UXCQ 2WPDA 1DXMA 1D2BA 3W3AA 2VUMH 1AE2A 1H9SB 4LWCA 4JC0A 3SEJA 5JPMC 1H85A 5IYQA 1BOSA 2EYOA 4RM0A 4DR4L 2VQEQ 3OZVA 1DJRD 1LLRD 4XL9A 2LS01 5I2YA 1IYUA 4K0KL 2KEEA 1PH8A 1II3A 3D6CA 4L8JA 5D3IB 5JAVA 4X65L 2VJIA 3CPWB 3KF6B 4GNXC 1IHZA 3EFXD 4OONA 1RIPA 2Q2IA 4TQUS 2KEDA 3WNCA 4DR1Q 1TTTA 3NEMA 4JBJA 1QB5D 1EYGA 4A3LH 4XKWA 3T51B 4YWMA 3DHQA 1QVFA 2B2TA 2Z8LA 1JR0D 4G7OC 1STEA 2KQ3A 3B82A 2JEBI 2YWGA 2E2IB 1STGA 4NDXA 3ULLA 3NQIA 1Q82D 1M90D 2G5DA 2J7ZA 1UE5A 4ZQ3A 1A3VA 4H7BA 3FMCA 5DAUA 4RPBA 1IBLQ 2HQEA 1HJPA 1M8AA 1Q8KA 1SNDA 3DM3A 5CV6A 2IX0A 2RC5A 1S5ED 5C4JH 2K1BA 2SNMA 3CCQA 3GTLB 1VQFA 3Q8DA 5IYCG 2FVGA 1I8DA 4X7FA 3G6EB 1STNA 1L0WA 1YJWA 4XDXA 2R93H 3BYYB 5GV8A 2RKSA 5BN5A 4X06A 2B2UC 1GR1A 1JOKA 4HSVA 1MSHA 1E0BA 2B2TC 3NSWA 1JQYD 1L1OB 5C4XH 1JOQA 5A35A 4JI3L 3P75A 4NXNQ 3K5MA 3KFUA 2OBRA 5L37A 1Z47A 2ZTDA 3UDXA 4YAFA 5IGFA 1ZM2A 1B2TA 1NY4A 2VY3A 1UD3A 2ZT9C 5IP9G 3IAYA 1HZCA 4FP5D 4KY5A 2CH4A 3I72A 5M9OA 2ZJRA 1DONA 1FGBD 1P8LA 5ELFA 3LNNA 1OXXK 4XIGS 2CNDA 2FX3A 3D31A 3EJIA 3RMHA 4NPSA 4QCLA 1Q7YC 3GTGH 4B9WA 1K28D 1NB0A 1LM0A 1SE2A 2MFIA 4FVMA 4PV1C 4DV3L 5IWAQ 4DK0A 1JC7A 1LTTD 4OWXB 1HRJA 5I6YA 2B7BA 2ZZGA 3Q24A 1QJOA 1UE1A 3UE1A 5IY0A 5IYBG 1F9QA 1SJED 1EEID 2F3WA 1W3SA 4KJNA 3HAGA 2A1AA 5BSYA 3KDFB 1G291 1VQLB 5IK2A 3B6YA 1Q81C 4X64Q 1SYGA 4XLAA 1MI2A 1I4PA 1HQMC 2VYQA 4XQFA 2HMAA 3FKIG 1GO2A 1WVLA 1EFRA 2OTJA 4ULLA 4PC2A 2PMDA 2ZXPA 4AVZA 2GREA 3Q39A 2I5MX 2D74A 4PGOA 3OPOA 5M5YH 3HOUH 1J9ZA 1N32Q 1WTRA 1HR0Q 3S1QB 1UMKA 1W87A 2WKCA 2F4VL 3RN5A 3BDCA 3AMUA 4PZ7A 4EQ5A 1GVHA 3RUZA 2NPFA 4XNFA 2IX1A 2BV3A 2VL6A 2OCEA 2JA9A 4KN4C 4HJ5A 1OXSC 1YZ6A 3K5LA 5CV9A 1PH4A 1TS3A 3RN2A 5BSXA 2K52A 1VMCA 2E1BA 2D0OA 3UE0A 2QEXA 4DV2Q 4DR7Q 2ZZEA 5H59A 3CCMB 3G71B 1PH3A 4DUZL 4DV5L 2N55A 1L2FA 4R8NA 4YXWA 4RD6A 3ZBUA 1WCMB 1TS2A 3GTKB 4PG3A 4A3KH 2C2WA 4G5GA 3CB4A 3CCSA 4PC7A 5I2XA 2BSAA 1LO5D 1YLOA 4Z4TA 3FVQA 1IJFA 4P2NA 4JBMA 4DR5L 3D4DA 4P26A 2K03A 3QFRA 1KABA 1TWFB 2EIFA 1R5OA 3PO2G 2XWJB 3ERQA 5FO1A 1ICWA 4OX9Q 2L0CA 1YNNC 4U68A 1DM0B 3RD4A 1XMQL 4LFCQ 3CESA 1XWEA 1SNOA 3SLDA 4LF4L 3WY9A 3OIPA 4I7ZC 1HZAA 4X66L 1Y1WB 4J15A 5JEAJ 5E4XA 4JI8L 5J22A 1WP6A 5DM63 4KD3A 1YHQA 1A8VA 1OB5A 1FNMA 1BQEA 2OTLA 1PZID 1CQXA 1N06A 2Y0SE 3T1HQ 1EY7A 4MNOA 4TT3A 1ZUNB 3ASQA 2B63B 2JN9A 3TBIB 1NBWA 1QWYA 4BY1B 2K75A 1N36L 2X6LA 4B44A 2AWOA 4FDBA 4P22A 4Z1MA 3SHLA 3J80c 1HHVA 3AYHB 4N3GA 2F3VA 5CV7A 1SMYD 1V43A 2FFKB 4J0QA 4G7XA 3TREA 4PMBA 2R7ZB 2L55A 1BLIA 5GADC 1QOHA 2LXKA 2R92H 1GUWA 1RD9D 2PW5A 4BXXG 4B3SL 1OGJA 1HFGA 4E6IA 4IUQA 1UD4A 3A8KE 3CP0A 3CRZA 1Q1EA 3IKJA 2D62A 2K4KA 2H5XA 5KYLA 4A3GH 1XFOA 1YVCA 2XGJA 1QG0A 2E2HB 4PQXA 2GK6A 3CCEA 4P12A 2PQAA 4X3TA 1NAPA 4K5XA 3C46A 4YAOA 1JE4A 1I6HB 2PI2E 3K5NA 3VR2A 4LUVA 2HDMA 2EPBA 4PABA 1TR5A 2ID0A 1BPLA 1G7SA 1Q46A 3M4OH 2DJGC 2CKZB 4O2DA 5FLMG 3L9AX 1EFUA 2X6GA 2X6WA 1GO3E 1S3OA 3DWAA 2C5CA 4Z4YA 3L7ZC 1SMYC 3KLRA 1TWAB 3PO3B 1VQ9A 2KJXA 1BCPC 1V1PB 4KKSA 2EXZA 4G6IA 4NBSA 2ZJQA 2UXCL 1F9SA 2PMZE 3SVMA 1U4MA 1UD2A 2I1LA 4ZKCB 4WJ3M 4I65A 1VQNA 1W9XA 2EXDA 5KNBA 3H09A 4YY3Q 2VQEL 4JOIA 2BM1A 1TQOA 4DQKA 1ML0D 1NSNS 1SKYB 1B3QA 1RCVD 3JQPA 1RL2A 4A3EB 1FR3A 4DNIA 3WNBA 1K73D 3GO5A 4A3IG 2RSNA 3S15H 2L12A 1GHJA 1Y0RA 3KOJA 4A93H 4RG1A 1BX0A 4DR1L 2F0WA 4Y9UA 1LTGD 4S3SA 5KRUA 3CMAA 3JAML 3GTQB 5M5XB 2WAQE 4AQYQ 4RWSC 3HZXA 2ASBA 3HOWH 3H6MA 2CQAA 2K7VA 4KHPQ 1WJJA 3A8JE 3SDZA 3S1NB 4CKCA 5JEAG 1JOOA 1SFOH 1J6QA 3I7FA 4DV7Q 2DCUA 2KCCA 2DETA 3NELA 2HIVA 3UDIA 3ND8A 1U2RA 1IBLL 2C9OA 2CBXA 2A68C 1VQCA 3N6RA 1E64A 1L0YB 1G6PA 5HZBA 1D8LA 4MN3A 1F60A 5GAEC 1QZHA 2XNAC 1S5DD 4P9SA 4EQOA 1K73C 4GNXB 3A3BA 2YU9B 1A3TA 4QB4A 2ZL7A 1ONLA 2WB1B 4CDDC 3WOEA 4YAUA 2VNHA 4PC1A 2F0GA 1EFID 1TU2B 4A3DB 2LY7A 3J81L 1VQPA 3F8TA 4NXNL 4UZUA 1B2RA 3P1HA 4R4QA 1QNKA 4DK3C 4XQNA 4CJ1B 2KHSA 1YHBA 3FPPA 1EQTA 4BBRG 4NCNA 4GLVB 3J7AF 1V1OA 3BQJA 1B50A 1XXGA 3QIAA 1BJKA 1H42A 2QTZA 4RD4A 5GAHC 1E7ZA 4DV6Q 1MRZA 2YTYA 3CQZB 4RKLA 1C4QA 4WRDA 5FNZA 3K59A 4WJ4A 1RTNA 2JE6I 1CNFA 2Y0SB 2KVMA 3HFZB 4X3UA 5LMNW 5IWAL 3T16A 5EPKA 3OJXA 5IP7H 1SM4A 1HZEA 1YIJA 1SSOA 3HOZG 4Y9RA 1EXMA 1IBKQ 1N05A 4TMXA 1BUVT 3C1EA 1EQRA 3AFPA 4XMYA 4XM3A 2QA4A 3DWQA 4DPGA 1CKNB 5T1IA 4TRDA 4YELA 2WFWA 2XTIA 4X64L 1EY9A 3W5HA 4GLXA 1LTBD 2JA8B 3SE0A 1DYQA 3H0GB 2B2YA 1W6JA 4ME3A 4N8FA 4HIKA 2PNHA 1N32L 2EVBA 3STBD 4IPHA 2NVYB 1HR0L 1TY0A 1NUCA 1FYCA 3MHPA 2V7WA 2K5DA 4GN3B 4NW2A 1DG1G 4N3NA 2F0UA 1IW7C 5C0XH 4UZEA 4UZFA 1U0LA 4DR7L 4I7AA 4DV2L 1ASZA 2UUAQ 1VQ6B 2AUKA 5CR3A 2B39A 3NHHA 5ELEA 5FOBB 1R5BA 1SE3A 1SR3A 3P27A 4ZCIA 2NWGA 4HEDA 4CJ0B 1QUEA 1NNXA 1E24A 3LO8A 3I56A 5JJIA 1OB2A 4WQMA 5K36H 2DY8A 3ZYYX 2X6YA 1CQVA 3OSOA 1EIYB 5I9PA 4DV1Q 4XLFA 1W2BB 2TSSA 3EBEA 1EL0A 1DDGA 4GZYC 3I4MB 2XN9C 1ZM9A 2V1CC 4OX9L 2EOTA 3CXCB 4ZGNB 2LMCB 1GD7A 2I46A 4OPSA 4LFCL 4A3MH 1VQ7B 4WZLA 4HIOA 3SK8A 1C0AA 2V7UA 1NJIC 2QDLA 3BDOA 3MEFA 3JAMi 4HJ7A 3MWYW 2RSOA 1EY8A 3T1HL 1TWCH 2K50A 1ET9A 1PFSA 3J80E 2G9HD 3U9OA 2F0DA 3KBGA 1BF4A 3HOXH 1HTPA 4C43A 4K6DA 3G6JB 2BVNA 3A8IA 4JG2A 4O42A 3NK9A 4PZ6A 3SJPA 1Q1BA 3IRBA 4BY7G 4DU9A 1NMFA 4C2MB 3RZOB 2AUJD 2F0HA 2EYJA 5AN9A 1P16A 4BBSG 4A3BB 3M4PA 2AMCB 3DLLA 2MO0A 2X53S 4EGVA 4JV5Q 4K2KA 1PFNA 2DNEA 4IO9A 2CRVA 3W2FA 5KNCA 1G7RA 1BMFA 1PDQA 2K33A 2JA7H 3PMFA 3AVUA 2WAQG 3VYUA 5C3XA 1Q90A 3W2DA 1VQIA 3HKSA 1LT5D 3KLWA 1CFMA 5IGEA 2QGGA 4II3A 2Z6KA 3J81i 4A3JG 3GTPB 4C3IB 1UAPA 2UU9Q 2L5TA 4RAUC 3VYSA 1MJEA 1MSGA 3CD6A 2RDFA 3I90A 1G6ZA 1LTAD 4H13C 1VQ4B 3BJUA 3CW2A 2BA0A 1EY4A 5C3EB 1QGYA 5D3DA 1TWGB 3D4RA 5CBEE 2N78A 2XRQD 4H02A 3EVQA 2Q6IA 5EPLA 1U4LA 4C3JB 5I4DA 2IHFA 1AZPA 1SNMA 4V190 1H95A 1OXUA 1O80A 2VBVA 1Y14B 3D4WA 4B47A 1S72B 1W0KA 2B2VA 2IPKD 3EN2A 3UI2A 3HOVB 1I50B 4YY3L 5AJ3Q 2Z6KC 1XNRQ 4P72A 2A8VA 2UUCQ 3OW7A 3GTJB 4XYQA 3MXNB 1KD1C 5F4MA 3PIO3 1E43A 1CA6A 4H44C 2WZPP 4RD2A 2Z6BA 5NUCA 2WIIB 3FPUB 4WZKA 2VZLA 3PA1A 2OBSA 3PUXA 2RCNA 2NZHA 2NVTB 4K2LA 1VQ5A 3J80L 3E3XA 4WWVA 2A6HD 5C44H 1QNUA 4M8AA 4DR3Q 4CHTB 5EKKA 1ZYRD 4OGQC 3TZUA 4AQYL 3CC7B 4F7XA 1NB9A 4M53A 4A3CH 1ZEQX 1CA5A 2FXQA 1BCPF 1M4VA 1EZ8A 2J4XA 4KHPL 1X54A 4OO1I 3EROA 3I55A 4IPGA 2K5WA 2C5BA 4OWWB 4AYBB 3CP8A 1EU3A 5J35A 3PSIA 4DV7L 4XKVA 2XRSD 1LYLA 5M3MB 4TKOB 1X32A 4RH6A 4JI6Q 4M1KA 3M3YH 1JCKB 1Y69U 2BGIA 3NBIA 1N08A 2NN6H 5E6TA 4G7ZC 3ND9A 2CF4A 4JBKA 1PH5A 4WZEA 1EQVA 1FX0A 1S0UA 3C2PA 4UPAA 1YITA 3VNVA 2L1BA 2B5OA 1A0IA 1BDOA 2KCTA 3S1MH 3RY8A 4AF7A 3CC2B 1SRUA 4NXMQ 4APVA 2N3SA 2O2LD 3FEWX 5M3FB 1DOMA 3TEHB 2E2JB 3SKBA 4P6YA 3D26A 3ZZTA 4A3FB 4UDUC 1SE4A 2VUMB 3ITPA 1IJEA 3A54A 1D5MC 1KAAA 2IL8A 2F4NA 3CCUB 3AU7A 4DV6L 3HKZG 1RKNA 1S4MA 3VO2A 2WINB 4LAAA 3PUVA 1Y1VG 4L5SA 3IFTA 1J9OA 4IJHA 5ISRA 4QVAA 3LQEA 1COWA 4IJLA 1HNZQ 3UDFA 1K8OA 2RHQB 1D1IA 1ZXTA 4LFAQ 2VB3X 3GP7A 5F4JA 1IBKL 4B3XA 3MAQA 2A69C 2M00A 1UE7A 4JI5Q 1Q86D 1B7YB 4LUOA 2RHSB 1GKHA 1WSRA 2AKWB 1RTOA 2ZTEA 3V96A 2KCNA 5FJ8H 4QIWE 3KUPA 1PTOC 1E2ZA 2JA6H 1A8PA 1LTRD 1WSVA 3W5UA 1YJNA 4KKUA 4P25A 4EH1A 1QUFA 3PUMA 1HQRD 5J39A 1PH7A 4TMZA 4XONA 5FLXc 1YI2B 2GK7A 4ABNA 2CCZA 2IT1A 2O5JC 2G9DA 4JCVE 4LC0A 5C4JB 4ALPA 1PKVA 2CVRA 3I4LA 3CF5A 4Y7CA 1CK1A 2F4IA 1BBXC 4AC9A 3K6OA 2UUAL 2R93B 2O4XA 3IFDA 4GQNA 1HTLD 4PMCA 5CORA 2LXJA 1N34Q 3U6KA 3F2UA 3V05A 4M4SA 1E3ZA 4Q7JB 1RJTA 1FGUA 4H9GA 4MTKA 1Q86C 2ZXIA 2GJPA 1YJ9A 2XZLA 3E9IA 5C4XB 2OK8A 4B3FX 4DQLA 4Z4SA 1Q7YD 3ZBTA 3AVXA 1I4GA 3NP8A 4F87A 2F0FA 2ZJPA 3VA7A 1GVPA 1JJ2A 1EP3B 4DV1L 2XNJA 3I4OA 3OP1A 3JQQA 3X3MA 1R5NA 1Q81D 3H3VI 5G3LF 1BBUA 1T9HA 3GTGB 3A8KA 1VQKA 2HLDA 5IYCH 4ZCLA 5GAGC 1WI5A 3I91A 2BA1A 4HIDA 3ER0A 3KF8A 3J80i 2N8NA 1WU8A 1Q9SA 3G48A 3FP9A 3K7UC 3DUZA 4JYAQ 1D7QA 3MA2B 3H9NA 1QGAA 1AEXA 1SYCA 4MYTA 4BA1I 1K83H 4FNFA 2I5LX 2F52A 3I1FA 1SMXA 4XORA 4O1NA 1E1RA 1B4OA 1B9NA 3M7NA 3R2TA 2HCIA 3TP6A 1VS0A 4FN5A 2EYMA 2VB2X 3ONAB 4RGNA 1H8HA 2VQFQ 4LF7Q 3HOUB 5M5YB 4IOAA 3ASPA 3GTLH 5IP9H 1KMHA 1X6OA 4YALA 5M5WH 1KHIA 4KTAA 3TP8A 3H15A 2BGJA 4JV5L 2DNCA 3T13A 1PYBA 3ZPNA 4K8IA 2F0OA 1F2LA 2EZVA 4KI0A 1SN8A 5FKAC 1VQMB 4XN0A 3JC66 3BDLA 2MPMA 1VQAA 2K05A 4PC6A 4NP5A 4K8JA 2V7VA 1RF2D 5IYBH 5FL7A 3SR1A 4L6TB 1VQHA 4MIUA 2F0PA 2DUDA 1SNQA 1YNND 1TUIA 2UU9L 2JJ2A 3OEEA 2RF4A 2YTVA 2DY7A 4A3KB 1XPUA 3FKIH 5L46A 3RZDH 4HTHA 5IT9c 1VQ8B 4RCZA 5AFWA 1E2WA 1GOZA 4WORA 4RLZA 4B3MQ 1MABA 4IPCA 3NBHB 4XXEA 3QFCA 1V1QA 3MTSA 5C0XI 4TSFA 3CC4B 1S4ZA 2RDGA 3ULJA 1WTXA 1ILQA 4OIKA 1Q8IA 5KSWB 1CNEA 1S5FD 4ILWA 5ELDA 1QZGA 5HKKA 3K5OA 1WD0A 1WOSA 4FO2A 4K5VA 4LUZA 2WB1E 1K0RA 2MUYA 3RLNA 5AJ3L 1WTQA 4JBWA 1XNRL 1SJHD 2AQ3B 1FL0A 2ICIA 4P74A 5A89A 4NMZA 2ZZFA 2UUCL 3OWFA 4J8QA 2WSSA 1HXYD 4II2A 3CMEB 3K8AA 4IFDI 1KQSB 3BC9A 1OHHA 2MGSA 3KK7A 2EIXA 2K5HA 1B1ZA 1WTHA 2XEXA 4QIWB 2KA7A 2YWEA 4HAEA 4P73A 2XZOA 3C1FA 3Q0AA 2JXMB 3OIQA 1T6YA 1WCMG 1ESFA 1Q3LA 1X3FA 3CCRB 4DR3L 2ZL6A 3E6ZX 3CCJA 1QCBD 2X3UA 1UD8A 3R3OA 1E62A 2OXPA 3VYTA 3PO2H 1ILPA 1NDHA 4DAYA 1VQOA 5EQ0A 4ZUIA 1ICFB 1WOCA 1RHPA 5FO0A 4RMFA 4WFN3 1KK0A 1VF5C 2ATWA 4C56C 3OW2B 2R92B 3C3LA 2EY6A 4X05A 4QJFA 1VQDA 4P75A 3JAME 4JI6L 5E7NA 4FF3A 4GN4B 1QFYA 3WQZA 1OTCA 4A3GB 3H94A 4LBVA 4XT3B 1Y1WG 4FK8A 1YX2A 1CSQA 1BCPD 3BCDA 1I94Q 4R4OA 1E1QA 4QUCA 1WPCA 5EGTA 1A15A 2WR8A 3PUYA 5C5LA 2QKIC 5IYPA 3M4OB 1TIID 1JWSD 2B63G 1K3RA 3U50C 4NXML 2HD3A 4BY1G 2BOSA 5C6AA 2DJFC 4X7DA 5TR9A 4G4KA 1I18A 4X07A 3C2QA 1IHMA 4LJZC 1CZWA 3HOYB 1YHAA 1IKMA 4UAIA 4QGUA 4BXXH 1VHOA 1N8RC 1ESRA 2R7ZG 1KDBA 1HR0W 4YCWA 3AVYA 3J81E 4DK1A 1PH9A 4ZV4A 1EU4A 5COYA 4CKBA 3J7ZC 2HDNB 1QUQA 1PHJA 1HNZL 1I7PA 4ZGQB 1KNAA 1U5KA 1I4HA 3NPPA 1P4MA 3QJYA 1JORA 3S2HB 3Q3AA 2WKDA 3S15B 3KL9A 4LFAL 1LTSD 3E0JA 4JVZA 2AHOA 4A93B 4N9TA 5EMNA 4JI5L 4DXGA 4MTNA 4C3HB 3TMEA 1FDRA 2A68D 3G7LA 3KLSA 4G57A 1J8IA 4P3YA 4OIJA 5FLMH 4B3RQ 2ENBA 1JE5A 1LTLA 4GOPB 3HOWB 1SROA 4OL7A 4LF5Q 4JI4Q 5IOCA 3QB3A 1SFOB 1YNJD 2LZJA 4DK6C 2F1LA 2E2HH 3CCVB 3PO3G 2CQOA 3G05A 5BR8Q 4OWTB 2F0SA 1DCZA 1I6HH 2DYIA 5KW9A 4X3KA 3E20A 1LTID 3A5UA 3VR6A 2CWPA 3VNUA 1NMGA 2K5QA 3CCLA 3U9SA 4A3IH 2MQHA 1W0JA 1JA1A 2VZAA 1STYA 2BH2A 4RPDA 2GJRA 3G4SA 3GVLA 4Z4RA 1F2ZA 1H9RA 2RBMA 4JOIC 4A3EG 5C4HA 1QVGA 1N34L 1J5EQ 2E5LQ 1H9SA 1I3QH 3QG1A 2K01A 4B48A 1N0VC 3OTOQ 1BQQT 1B9MA 4JK1C 2HUGA 1XTDA 4X7EA 2JYOA 1BR9A 4IPDA 1I6VC 2O5IC 3ASRA 5FO8B 5IGBA 2QEJC 5JEAH 2HHHQ 1EY6A 3I2ZA 3W1GA 2L11A 2YYZA 3KF6A 3CPWA 2F43A 1A62A 3RR5A 1YNJC 1HNWQ 4YHHQ 1Z6HA 1YNXA 4PMWA 4ODGA 5JVH3 1KRTA 2PZUA 2VS1A 3O13A 3MXGA 1IYJB 1R4PB 2ZTGA 5M5XH 4DGZA 1K3BC 2XWBB 4UHVA 1PTOH 2Q6LA 2J7KA 4JYAL 3D3RA 1KDAA 2KCMA 2F03A 1Y8NB 4X7CA 3DEOA 3AGPA 1IW7D 5G3LD 4F88A 3QSYA 2WB1G 4M2LA 5GROA 1VJSA 4M0LA 4ROXA 4RCOA 4X8IA 4HJAA 3PA2A 3PVDA 2JP1A 1PYSB 4BBRH 2VQFL 2QE7A 1D2EA 3MMPA 4X0CA 4LF7L 3AVWA 4A3DG 2JA5B 4DAVA 1LT3D 5I6WA 1JB7A 3G6EA 5FLXL 5ELOA 4YHBA 5H1SE 2CW0D 2RA4A 1WFQA 2YU9H 5IYWA 5LMZA 1KTKA 1XMOQ 3X3NA 1FNBA 4Y7NH 2HT1A 1QVFB 4HE6A 3QR8A 1L1OA 1EY0A 3AVVA 2EJFC 1VQBA 4KHVA 2I0QA 3ZUGA 3HOZH 4R71A 3TRZA 2W6IA 1F9PA 4YWLA 3WOFA 2Y0SG 3CPXA 1HUNA 3GDEA 3BH4A 2VJJA 2WP8J 3CPFA 1EFCA 4P3IA 3NTIA 1EWYA 2JK8A 2RVLA 3NTKA 1KJZA 3CMMA 3J81k 1STBA 4KJOA 4G7HC 1HZ9A 2A5HA 3CCQB 1VQEA 2Q2TA 3VO1A 4AYBE 4C1NI 5J1ZA 2K5NA 3PCOB 3LQ6A 1YJWB 2X69A 3MVVA 1JA0A 4HIMA 1NJID 1C8CA 4B3ML 3PV0A 3FKSA 4KY7A 1BO0A 4PC3A 1ZKOA 2Z1CA 4MZ9A 3TP7A 2PPBC 4IALA 3HRZC 1UD6A 2JA8G 2F0QA 3H0GG 4PAAA 1PRTD 4UY8C 2ZL5A 2CW0C 1I4QA 1TVCA 1L1OC 4A3MB 1HA5A 3KDFA 1TKWB 1VQLA 3SLNA 1V0FA 1DD2A 2B2YC 4FYDA 1OXTA 3S1RB 5J3OA 1E79A 1S40A 2NVQH 4IFDG 1TWHH 3A55A 4QQBX 1BX1A 5IE8A 5LMUQ 3FRPB 2NBFA 3LVBA
chains in the Genus database with same CATH topology
2H1EA 3LWUA 2AWNA 1TWCB 4EVOA 1H9JA 2F0JA 4ZLTF 1TY2A 4E0FA 3HOXB 4R8IA 3OEHA 5ELCA 1PLFA 5CBAE 1XTCD 1JICA 5DN6A 4IUUA 2Z4IA 1EWCA 2NYZD 1PRTC 1RDPD 3OMGA 4MHEA 3PUWA 2HDLA 2JA7B 3A35A 3GD7A 5ELBA 2PYKA 5CV5A 2FJ2A 4BA2I 3GQBA 4FXGC 1F2YA 1EYAA 3PIP3 1AW7A 3FDTA 2PNRC 3QO2A 5EBDA 4KY6A 4HMJA 1SYFA 1GUGA 1DOKA 2A6EC 3DEPA 2E76C 3NXWA 1NR2A 2EY2A 3I4NB 3TP5A 5JOBA 1OB0A 5JJZA 3N52A 1T5EA 1UUPA 1CHQD 1F9RA 2IW3A 3MEHA 5IODA 2K32A 1KLGD 4C3IG 5C44B 4RA8A 4HCEA 3MZ5A 1LV9A 4CBVA 5KIXA 4RHSA 2Z6BD 1LABA 2CHBD 5CDFA 1D1KA 1EY5A 1EZ6A 1RODA 4KV6A 4C3JG 1AZQA 2KVOA 1HVXA 1HFNA 4FF1A 2WACA 5CYUA 1GHKA 3M3YB 5C4ZA 2D5DA 1Y8PB 3BYTB 1CHPD 2B2VC 1WTVA 1BCPB 2F0TA 5HURA 1V1PA 4WJWA 3S1MB 1CM9A 1STHA 1SYDA 2FMMA 4DFAA 1HPCA 2MHVA 2SOBA 5CV8A 4ASUA 5IGCA 2IJ0A 2A69D 3V2TA 2A73B 1CT1D 4ZAIA 1OO9B 1QE6A 5JVG3 3Q6SA 4DA2A 1PTOD 3EA6A 2E74C 4ZRZA 1JWUD 4RKBA 4HMIA 1LT4D 1O7YA 1WTOA 2R61A 5DEHA 2JA6B 4P2CB 2EYLA 4CGYB 4IUNA 4FXUA 1GJXA 4XTCS 3R8BA 1K8MA 1PFMA 3QOLA 3T4AC 1SXTA 1AN8A 1A2UA 1GUNA 1JB3A 5IGGA 2F1MA 2XZPA 1KLUD 5CMDA 4U673 4C1NK 3AB9A 2JEAI 4EQPA 5CC4A 1FNVA 3SK4A 3D6WA 3LX0A 5E1FA 3OE7A 2QILA 2EJMA 3QWNA 3QOJA 4PNYA 3CRLC 4QMGA 4N9PA 4B3GA 3A7AB 5E4WC 4YEJA 2QCPX 4XD7A 1EIGA 2VNUD 4Q0FA 1SDFA 3S9WA 2AQ1B 4IURA 2B2UA 3I8ZA 4ZUJA 5FO7B 4RCNA 4ZYSA 1ENCA 5KYIA 1VMPA 1S5BD 1K83B 1O78A 4XLEA 3I70A 2ZXRA 3OWEB 5KNDA 3OHXC 4ME5A 3BG3A 2BCOA 3CU7A 2A74C 4IUPA 1MD2D 4RGOS 1A6XA 5M5WB 1SEBD 5E3FA 2W6JA 3NUCA 2BDNA 3MFYA 2QF7A 3VA5A 2ZXOA 2L9HA 2E2DC 2PCFB 1QG7A 1TS4A 4RHRA 5LL6S 1A2TA 1O7LA 2F0NA 5IGDA 3FKIB 3RZDB 4XQJA 1G91A 4HR7B 4BWGB 3BZDB 2KUMA 1FNUA 4CJ2C 1PRTF 3EQLC 3P20A 4FF2A 3VR4A 1FNWA 5JPNC 1PRTB 3IL8A 2XSCA 4L63B 3OAAA 1MGSA 4DAPA 2F0MA 2CK3A 5T1GA 2V4DA 3KEWA 3K0YA 3SK5A 1G2SA 1F2MA 5DM73 1SBBB 3SXHA 2EYHA 1AP0A 1BNZA 1I4RA 4K14A 5KEEA 3DM1A 1E2VA 3CP2A 2Q8TA 2BDOA 2NZ1D 3Q22A 1GUSA 3PO2B 1WTHD 2PZTA 3NTHA 4RGTA 1XYIA 2X8KA 2QDBA 1CTMA 2JSOA 2F0LA 1D5ZC 2IWHA 4HN7A 3DMUA 2EYPA 1UD5A 3HEJA 4OO1G 1T5XD 3WDNA 1VLYA 2X85A 2R6GA 3R93A 4B9XA 3H91A 2RQXA 5EPJA 3T56B 1G8ZD 5I9OA 3A3GA 3OMCA 4KHZA 1IYVA 2Q8IB 5BN3A 2LFNA 4OO1H 4G7WA 3HS0C 1KNEA 1TVXA 2VXWA 4KKTA 3MXNA 1Q12A 2EY5A 2M9VA 2KECA 1KZLA 4J6HA 4XQQA 3Q23A 3DXJC 4FXKC 5C5MA 1H9MA 3JU4A 3OOCA 1GXDC 1DOLA 2F0VA 1PMRA 2I07B 4NKLA 2K6AA 4XN3A 1CZGA 4K5WA 3KBXA 3MXPA 2KOLA 1B53A 2FINB 1XX8A 4HCSA 2NB0A 3VYRA 1VF7A 3GVKA 4KD4A 1CQFA 4DN4M 5BN4A 1PYWD 2JIZA 1EOTA 3OFNA 2H4OA 1WTPA 2FHTA 1CI3M 4XR6A 1G2TA 2D9UA 2EYFA 1EWHA 2NUCA 2ICEC 3NWSA 3K57A 2F0IA 1S5CD 3SEBA 3URYA 4A3IB 5FLXE 2JJ1A 4KMUC 1PZJD 3D8GA 3NQTA 1NCVA 1I3QB 1KDCA 5C0XJ 2XOKA 2N88A 3SK6A 1VDZA 4J1MA 4C3HG 1D5XC 4DF7A 2Z4HA 3BS1A 4DNRB 1LT6D 1ENAA 4X3SA 2J0TD 4IFDJ 1SNCA 5TSSA 1PTOF 1SNPA 4IUVA 5C3WA 4EQNA 4H0LC 1PTOB 4IZ8A 5F2DA 5EBCA 3GVJA 1TT2A 3CRKC 5HGTA 2NN6I 1WTWA 3CKIB 5D65A 4XOPA 3TDQA 1U9RA 1HUMA 4NNJA 1ENFA 1PFBA 4BBRB 2M2LA 4LK1C 1EIHA 1SYBA 5CV4A 3PUZA 1VCIA 5KGUA 4Y7NB 1PXUA 1E3XA 4K6LA 3GV3A 2ZTNA 2PQEA 2ZXHA 2OT2A 3HOZB 3HG9A 1GUTA 2R3ZA 3TZDA 2D3LA 3E5SA 2FMCA 4QUFA 4LMQD 2EJGC 5FO9B 2D3NA 1GUOA 4IQZA 1A3UA 2GA4B 2WJVA 2PW7A 2X6XA 2OEOA 1AFPA 3P7JA 1B3AA 3I73A 4DXFA 5LL6X 5IT9E 4F8MA 2V7QA 3I3CA 4BS9A 1IL8A 2M5SA 1SAPA 3GV6A 2NVQB 3TSSA 1TWHB 2B8GA 4HSPA 5C0XG 5FK9C 5K5PA 2PO4A 2SEBD 1B44D 1NR4A 3M85A 3ZIAA 3MXUA 3T53B 1D6EC 3K7AB 2F0KA 4TSSA 1MBYA 5K36G 1U4PA 4R9WA 2MP1A 1SYEA 2NTSA 2HCCA 1O7ZA 2Q8RE 4ID6A 3A56A 1HCZA 1UEAB 2ZZQA 3BVMA 4IFDH 3LWEA 4CKEA 1EEFD 2PMZB 1V8QA 2GJKA 1ET6A 2E75C 3NBHA 2A6ED 2L4NA 2R9VA 3MFGA 4ZK9B 3CHBD 1U4RA 3R2IA 3TN2A 4XLCA 3KLSX 4BY7B 4Q5VA 4Z9CB 4BBSB 4IN3A 5IT9L 1C48A 2EDGA 2WAQB 1NBMA 3J7AV 3HP3A 4FXDA 5IIFA 2XIWA 1X3PA 1DZ1A 4A3JB 1BXTA 1OXVA 3BCFA 5A2QE 5CGKA 1HA6A 1PZKD 2EY1A 1L0XB 1LACA 2MJ8A 4FF4A 4XT1B 3DWPA 2LKVA 4HIZA 2DIEA 1W6KA 3A7LA 1EYDA 2EE1A 2K04A 2BE5D 4DNTB 5D14A 1EYCA 1R9TB 1STAA 1V0EA 4YIJA 2XNDA 5DNFA 1NRKA 3J7YW 3DDYA 1FD7D 1JWMD 1H8EA 5KNLA 1QILA 1Y8OB 3MC0B 1IKLA 4QF4A 1Z7TA 2DN8A 3S17B 4B08A 5EKIA 2RDHA 2SNSA 2WV6D 3S2DB 3M4YA 2D2CC 2BE5C 4IUTA 4M1UB 2TMPA 3NWTA 5EJWA 2OF1A 1R4QB 2B2WA 3L3OC 2IX3A 2NTTA 3MHBA 4KN7C 3K58A 2NN6G 3BVZA 5A2QL 2K28A 3HGBA 4XYOA 4RGMA 2F0EA 4OHJA 3GTMB 3GTOB 2B8FA 2NVXB 3NE5B 3S14B 4KK7A 1UNSA 1X3QA 3HKZB 2WJYA 1WD1A 1F77A 1Y1VB 3M7GA 4ZKBB 4JMQA 4XOTA 2AQ2B 2B2WC 2A6HC 3RLFA 1ZYRC 2V31A 3VR3A 4V0BA 3S16B 2SDFA 5LHY1 4RFBA 1H9KA 4XLHA 2XVSA 3VR5A 5EKLA 1TS5A 3H3VC 2JDIA 3BVGA 3A8IE 2PZWA 1I4XA 2WPDA 1DXMA 1D2BA 3W3AA 1H9SB 5JPMC 1BOSA 2EYOA 1DJRD 1LLRD 4XL9A 2LS01 5I2YA 1IYUA 2KEEA 1II3A 3D6CA 4L8JA 5D3IB 5JAVA 2VJIA 1IHZA 3EFXD 4TQUS 2KEDA 1QB5D 4XKWA 3T51B 3DHQA 2B2TA 2Z8LA 1JR0D 4G7OC 1STEA 2KQ3A 2JEBI 2E2IB 1STGA 4NDXA 3NQIA 2J7ZA 4ZQ3A 1A3VA 4H7BA 3FMCA 5DAUA 2HQEA 1M8AA 1SNDA 5CV6A 2IX0A 1S5ED 2K1BA 2SNMA 3GTLB 1I8DA 1STNA 4XDXA 3BYYB 2RKSA 5BN5A 2B2UC 1JOKA 4HSVA 1MSHA 1E0BA 2B2TC 3NSWA 1JQYD 1JOQA 5A35A 3P75A 3K5MA 1Z47A 5IGFA 1B2TA 1UD3A 2ZT9C 3IAYA 4FP5D 4KY5A 3I72A 5M9OA 1DONA 1FGBD 5ELFA 3LNNA 4XIGS 1OXXK 3EJIA 3RMHA 3D31A 4QCLA 4B9WA 1K28D 1SE2A 4FVMA 4PV1C 4DK0A 1JC7A 1LTTD 1HRJA 5I6YA 2ZZGA 3Q24A 1QJOA 1F9QA 1SJED 1EEID 2F3WA 4KJNA 3HAGA 1G291 5IK2A 1SYGA 4XLAA 1MI2A 1I4PA 1HQMC 4XQFA 1WVLA 1EFRA 4ULLA 2ZXPA 4AVZA 3OPOA 1WTRA 3S1QB 2WKCA 3AMUA 3BDCA 3RUZA 4XNFA 2IX1A 4KN4C 1OXSC 3K5LA 5CV9A 1TS3A 1VMCA 2E1BA 2ZZEA 2N55A 4R8NA 4YXWA 1WCMB 1TS2A 3GTKB 5I2XA 1LO5D 3FVQA 3D4DA 2K03A 1KABA 1TWFB 2XWJB 3ERQA 1ICWA 2L0CA 1YNNC 4U68A 1DM0B 3RD4A 3CESA 1XWEA 1SNOA 3OIPA 4I7ZC 1Y1WB 5JEAJ 5E4XA 5J22A 1WP6A 5DM63 4KD3A 1PZID 1EY7A 4TT3A 2B63B 3TBIB 1QWYA 4BY1B 2X6LA 2AWOA 4P22A 4Z1MA 3SHLA 1HHVA 2F3VA 5CV7A 1SMYD 1V43A 2FFKB 4G7XA 4PMBA 2R7ZB 2L55A 1BLIA 1QOHA 1GUWA 1RD9D 2PW5A 1HFGA 4E6IA 4IUQA 1UD4A 3A8KE 1Q1EA 3IKJA 5KYLA 2D62A 2XGJA 2E2HB 4PQXA 2GK6A 4X3TA 1NAPA 4K5XA 3C46A 1JE4A 1I6HB 3K5NA 3VR2A 2HDMA 2EPBA 1TR5A 2ID0A 1BPLA 3L9AX 2X6GA 2X6WA 3DWAA 2C5CA 3L7ZC 1SMYC 3KLRA 1TWAB 3PO3B 2KJXA 1BCPC 1V1PB 4KKSA 2EXZA 4G6IA 1F9SA 3SVMA 1U4MA 1UD2A 4ZKCB 4I65A 1W9XA 5KNBA 3H09A 1TQOA 1ML0D 1NSNS 1SKYB 1RCVD 4A3EB 1FR3A 3GO5A 2RSNA 2L12A 1GHJA 2F0WA 1LTGD 4S3SA 5KRUA 3JAML 3GTQB 5M5XB 4RWSC 3HZXA 3H6MA 2CQAA 2K7VA 3A8JE 3SDZA 3S1NB 4CKCA 5JEAG 1JOOA 2KCCA 3ND8A 2C9OA 2A68C 3N6RA 1L0YB 4MN3A 2XNAC 1S5DD 4EQOA 3A3BA 2YU9B 1A3TA 4QB4A 1ONLA 2WB1B 3WOEA 2F0GA 1EFID 1TU2B 4A3DB 2LY7A 3J81L 4UZUA 3P1HA 1QNKA 4XQNA 4CJ1B 2KHSA 3FPPA 1EQTA 3J7AF 1V1OA 1B50A 1XXGA 3QIAA 3CQZB 4RKLA 1C4QA 4WRDA 3K59A 1RTNA 2JE6I 2Y0SB 2KVMA 4X3UA 3T16A 5EPKA 1HZEA 1SSOA 1BUVT 3C1EA 4XMYA 4XM3A 3DWQA 5T1IA 4TRDA 4YELA 1EY9A 1LTBD 2JA8B 3SE0A 1DYQA 3H0GB 2B2YA 1W6JA 2EVBA 2NVYB 1TY0A 1NUCA 1FYCA 2K5DA 4NW2A 2F0UA 1IW7C 5C0XH 2AUKA 5CR3A 2B39A 3NHHA 5ELEA 5FOBB 1SE3A 4HEDA 4CJ0B 2NWGA 5K36H 2DY8A 3ZYYX 2X6YA 1CQVA 3OSOA 5I9PA 4XLFA 2TSSA 1EL0A 4GZYC 3I4MB 2XN9C 2EOTA 2LMCB 2I46A 3SK8A 3BDOA 3MWYW 2RSOA 1EY8A 1ET9A 3J80E 2G9HD 3U9OA 2F0DA 3KBGA 1BF4A 1HTPA 4K6DA 3G6JB 4O42A 3NK9A 1Q1BA 4DU9A 4C2MB 3RZOB 2AUJD 2F0HA 2EYJA 4A3BB 2X53S 4EGVA 4K2KA 1PFNA 2DNEA 5KNCA 1BMFA 1PDQA 2K33A 3PMFA 5C3XA 3VYUA 1Q90A 3W2DA 1LT5D 1CFMA 5IGEA 4II3A 3GTPB 4C3IB 1UAPA 2L5TA 4RAUC 3VYSA 1MSGA 2RDFA 3I90A 1G6ZA 1LTAD 4H13C 2BA0A 1EY4A 5C3EB 5D3DA 1TWGB 3D4RA 5CBEE 2XRQD 3EVQA 5EPLA 1U4LA 4C3JB 5I4DA 1AZPA 1SNMA 4V190 1OXUA 1O80A 3D4WA 1W0KA 2B2VA 2IPKD 3UI2A 3HOVB 1I50B 3OW7A 3GTJB 4XYQA 3PIO3 1E43A 1CA6A 4H44C 2WZPP 5NUCA 2WIIB 3FPUB 3PUXA 2NVTB 4K2LA 3J80L 2A6HD 1QNUA 4M8AA 4CHTB 5EKKA 1ZYRD 4OGQC 3TZUA 4F7XA 1ZEQX 1CA5A 1BCPF 1M4VA 1EZ8A 2J4XA 4OO1I 3EROA 2K5WA 4AYBB 3CP8A 1EU3A 4XKVA 2XRSD 5M3MB 4TKOB 1X32A 4RH6A 1JCKB 1Y69U 3NBIA 2NN6H 4G7ZC 3ND9A 1EQVA 1FX0A 3C2PA 2L1BA 1BDOA 2O2LD 3FEWX 5M3FB 1DOMA 2E2JB 4A3FB 4UDUC 1SE4A 2VUMB 3ITPA 3A54A 1D5MC 1KAAA 2IL8A 3AU7A 1RKNA 2WINB 4LAAA 3PUVA 3IFTA 1J9OA 5ISRA 1COWA 1K8OA 1D1IA 1ZXTA 2VB3X 3GP7A 3MAQA 2A69C 2M00A 1RTOA 3V96A 2KCNA 3KUPA 1PTOC 1E2ZA 1LTRD 4KKUA 1HQRD 5J39A 4XONA 2GK7A 4ABNA 2IT1A 2O5JC 2G9DA 5C4JB 1PKVA 2CVRA 3I4LA 2F4IA 1CK1A 1BBXC 3K6OA 2R93B 2O4XA 3IFDA 4GQNA 1HTLD 4PMCA 5CORA 3F2UA 3V05A 1RJTA 1E3ZA 2ZXIA 2GJPA 5C4XB 2XZLA 4B3FX 3NP8A 1I4GA 4F87A 2F0FA 3VA7A 3X3MA 5G3LF 3GTGB 2HLDA 3I91A 2BA1A 3KF8A 3DUZA 3MA2B 1AEXA 1SYCA 4BA1I 4FNFA 4O1NA 4XORA 1E1RA 1B4OA 1B9NA 3M7NA 3R2TA 2HCIA 3TP6A 2EYMA 4RGNA 2VB2X 3ONAB 1H8HA 3HOUB 5M5YB 1KMHA 4KTAA 3TP8A 2DNCA 3T13A 4K8IA 3ZPNA 2F0OA 1F2LA 2EZVA 4KI0A 5FKAC 4XN0A 3BDLA 2MPMA 2K05A 4NP5A 4K8JA 1RF2D 5FL7A 3SR1A 4L6TB 4MIUA 2F0PA 1SNQA 1YNND 2JJ2A 3OEEA 4A3KB 2DY7A 4HTHA 5AFWA 1E2WA 1GOZA 4WORA 1MABA 4XXEA 3MTSA 5C0XI 4TSFA 1S4ZA 2RDGA 1WTXA 1ILQA 4OIKA 1Q8IA 1S5FD 4ILWA 5ELDA 5HKKA 3K5OA 1WD0A 4FO2A 4K5VA 1WTQA 2MUYA 4JBWA 1SJHD 2AQ3B 2ICIA 4NMZA 2ZZFA 3OWFA 4J8QA 2WSSA 1HXYD 4II2A 4IFDI 3BC9A 1OHHA 2MGSA 3KK7A 1B1ZA 4QIWB 2KA7A 4HAEA 2XZOA 3C1FA 3Q0AA 2JXMB 3OIQA 1ESFA 1Q3LA 3E6ZX 1QCBD 1UD8A 3R3OA 2OXPA 3VYTA 1ILPA 4DAYA 5EQ0A 4ZUIA 1RHPA 4WFN3 1VF5C 4C56C 2R92B 3C3LA 2EY6A 3JAME 4FF3A 3WQZA 4A3GB 3H94A 4XT3B 1BCPD 3BCDA 1E1QA 4QUCA 1WPCA 5EGTA 1A15A 3PUYA 5C5LA 2QKIC 3M4OB 1TIID 1JWSD 2BOSA 5C6AA 4G4KA 1I18A 4LJZC 1CZWA 3HOYB 1IKMA 4UAIA 1ESRA 1KDBA 3J81E 4DK1A 1EU4A 5COYA 4CKBA 1KNAA 1I4HA 3NPPA 3QJYA 1JORA 3S2HB 2WKDA 3S15B 1LTSD 3E0JA 4A93B 4N9TA 4DXGA 4C3HB 3TMEA 2A68D 3G7LA 3KLSA 4G57A 1J8IA 4OIJA 2ENBA 3HOWB 4OL7A 5IOCA 3QB3A 1SFOB 1YNJD 2LZJA 3G05A 2F0SA 1DCZA 4X3KA 1LTID 3VR6A 2K5QA 3U9SA 1W0JA 1STYA 2GJRA 3GVLA 1F2ZA 1H9RA 2RBMA 5C4HA 1H9SA 3QG1A 2K01A 1BQQT 1B9MA 4JK1C 2HUGA 2JYOA 1BR9A 1I6VC 2O5IC 5FO8B 5IGBA 2QEJC 5JEAH 1EY6A 2L11A 2YYZA 2F43A 1YNJC 1Z6HA 5JVH3 4PMWA 4ODGA 2PZUA 3O13A 3MXGA 1R4PB 2ZTGA 4DGZA 2XWBB 1PTOH 3D3RA 1KDAA 2F03A 1Y8NB 3DEOA 1IW7D 5G3LD 4F88A 1VJSA 4RCOA 2JP1A 2QE7A 2JA5B 4DAVA 1LT3D 5I6WA 5FLXL 2CW0D 2RA4A 1KTKA 3X3NA 1EY0A 2EJFC 4KHVA 2W6IA 1F9PA 3WOFA 1HUNA 3BH4A 2VJJA 2WP8J 3NTIA 2RVLA 3NTKA 3CMMA 1STBA 4KJOA 4G7HC 2A5HA 4C1NI 5J1ZA 2X69A 3MVVA 1C8CA 3PV0A 3FKSA 4KY7A 1BO0A 1ZKOA 2Z1CA 3TP7A 2PPBC 4IALA 3HRZC 1UD6A 2F0QA 1PRTD 2CW0C 1I4QA 4A3MB 1HA5A 1TKWB 1V0FA 2B2YC 4FYDA 1OXTA 3S1RB 1E79A 4IFDG 3A55A 1DD2A 3FRPB 2NBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ND9 A;  3A7L A;  3LWU A;  4KMU C;  1B9M A;  2BDO A;  1QJO A;  4JK1 C;  3VR5 A;  1HTP A;  2D5D A;  1Y8P B;  2BE5 D;  2BA1 A;  2B8G A;  1H9J A;  4DNT B;  1I6V C;  1VF5 C;  3A8K E;  3QIA A;  5C0X G;  1GUS A;  1G29 1;  1Q1E A;  2D62 A;  3IKJ A;  1Q1B A;  1BDO A;  3A8I E;  5JEA H;  2AUJ D;  1VDZ A;  1HQM C;  2YYZ A;  1DXM A;  3W3A A;  2JE6 I;  1YNJ C;  1H9S B;  4RCN A;  1Z6H A;  3M85 A;  4BA1 I;  3H94 A;  1CTM A;  2DNE A;  4DNR B;  3MXU A;  3OPO A;  3T53 B;  5KNC A;  2O5I C;  3VR2 A;  2K33 A;  1B9N A;  3M7N A;  1IYU A;  5K36 G;  1O78 A;  1Q90 A;  1HPC A;  1Y8O B;  4OO1 G;  3WDN A;  1CFM A;  4L8J A;  3L7Z C;  1SMY C;  3PUY A;  5KND A;  3KLR A;  2R6G A;  3PUV A;  3PUW A;  4KN4 C;  3IFT A;  1OXS C;  3BG3 A;  3GD7 A;  1Z7T A;  2DN8 A;  4KKS A;  2A69 D;  2L5T A;  1HCZ A;  1Y8N B;  4TQU S;  4H0L C;  2DNC A;  1A6X A;  3SE0 A;  4BA2 I;  3T56 B;  4H13 C;  4KI0 A;  1K8O A;  1IW7 D;  4KHZ A;  1IYV A;  5KNB A;  2Q8I B;  2EVB A;  5BN3 A;  3T51 B;  3M4Y A;  2D2C C;  4IFD H;  4LJZ C;  2E74 C;  2BA0 A;  3GQB A;  3CRK C;  1FYC A;  4OO1 H;  2BE5 C;  2NN6 I;  2A69 C;  3D4R A;  4G7O C;  3MFY A;  2JEB I;  2QF7 A;  1V8Q A;  4KKT A;  1FR3 A;  2E75 C;  2PNR C;  1IW7 C;  1Q12 A;  4DK1 A;  5C0X H;  1E2Z A;  2A6E D;  1OXU A;  3FMC A;  2PCF B;  1GHJ A;  3DXJ C;  4LK1 C;  2AUK A;  4KKU A;  3QJY A;  1O7L A;  2NN6 G;  4KN7 C;  1H9M A;  3OOC A;  2EJF C;  3PUZ A;  3HGB A;  1E2W A;  1YNN C;  1VCI A;  1GUG A;  3OW7 A;  1GJX A;  2A6E C;  1PMR A;  2K7V A;  2E76 C;  4XTC S;  2A68 D;  2IT1 A;  4H44 C;  4HR7 B;  2O5J C;  5K36 H;  1K8M A;  3A8J E;  4I7Z C;  3SDZ A;  5JEA G;  5BN5 A;  3I4L A;  2B8F A;  3PUX A;  3NE5 B;  2KCC A;  1GUT A;  2EDG A;  1T5E A;  1GUN A;  2A6H D;  3ND8 A;  2F1M A;  4G7H C;  4GZY C;  1VF7 A;  5A35 A;  2A68 C;  3EQL C;  3N6R A;  3P20 A;  2EJG C;  4JBW A;  3AB9 A;  4OGQ C;  2K32 A;  3TZU A;  3VR4 A;  5BN4 A;  2LMC B;  1GUO A;  4IQZ A;  2JEA I;  3PV0 A;  1DCZ A;  1CI3 M;  1OXV A;  1ZKO A;  2A6H C;  2ZT9 C;  2PPB C;  2AWO A;  3VA7 A;  3I72 A;  3VR6 A;  1LAB A;  1ONL A;  2KA7 A;  2CW0 C;  3RLF A;  1ZYR C;  3U9S A;  3VR3 A;  2V4D A;  4TKO B;  2JXM B;  3LNN A;  1OXX K;  1TKW B;  2EJM A;  3BDO A;  1EWH A;  1V43 A;  3D31 A;  3I73 A;  1TU2 B;  4XIG S;  3CRL C;  1DD2 A;  1OXT A;  1LAC A;  1Y69 U;  1H9R A;  3A7A B;  4PV1 C;  4IFD G;  1E2V A;  4DK0 A;  1H9K A;  3FPP A;  2NN6 H;  1H9S A;  3QG1 A;  1GHK A;  4G7Z C; 
#chains in the Genus database with same CATH topology
 3A74 A;  3W2G A;  2H1E A;  3H0G H;  3LWU A;  2AWN A;  2P5Z X;  1SE8 A;  4N8X 1;  1TWC B;  4EVO A;  4OPO A;  1H9J A;  2BH8 A;  2F0J A;  3OYY A;  2NVY H;  2B29 A;  4ZLT F;  1MIU A;  1TY2 A;  4E0F A;  3HOX B;  3K7A H;  3PIO A;  4R8I A;  4UAJ A;  1XPO A;  4R1J A;  4RD3 A;  3OEH A;  5ELC A;  1QVC A;  1PLF A;  3WWV A;  2YWH A;  5CBA E;  1XTC D;  4X6A H;  2PE3 A;  2PIA A;  1JIC A;  5DN6 A;  1NTG A;  2Z4I A;  4IUU A;  3CCM A;  1EWC A;  3G71 A;  3U58 A;  2NYZ D;  4LBY A;  1PRT C;  3I4M G;  1RDP D;  1DAR A;  3OMG A;  4JI2 Q;  5JBQ A;  4MHE A;  3PUW A;  2HDL A;  3BNW A;  2JA7 B;  2OTJ B;  3A35 A;  3GD7 A;  3M9B A;  1JMC A;  5ELB A;  3OZU A;  2HQL A;  2PYK A;  5CV5 A;  2FJ2 A;  4BA2 I;  1KAW A;  2JQO A;  5DLQ E;  3I4M H;  4FWT A;  2DY1 A;  3GQB A;  4FXG C;  1I94 L;  1KTV A;  1F2Y A;  1HH2 P;  1EYA A;  3PIP 3;  1V5V A;  1AW7 A;  4POF A;  3FDT A;  2Q6O A;  4ACB A;  1IBM Q;  2PNR C;  3QO2 A;  2QEX B;  2EFG A;  4BY7 H;  1KD1 D;  5JJL A;  4BBS H;  1A63 A;  5EBD A;  1NE3 A;  1XE1 A;  1K0S A;  4KY6 A;  4HMJ A;  5J3B A;  1SYF A;  1GUG A;  4A3B G;  3CCS B;  1DOK A;  2A6E C;  2HIX A;  3DEP A;  2E76 C;  3B8H A;  3NXW A;  2C4U A;  1NR2 A;  2EY2 A;  3I4N B;  3TP5 A;  2OQ0 A;  5JOB A;  1OB0 A;  5JJZ A;  3N52 A;  4A3J H;  1T5E A;  2KEN A;  1UUP A;  1CHQ D;  1F9R A;  2IW3 A;  3MEH A;  5IOD A;  3F2D A;  4LF9 Q;  1K8A C;  1AH9 A;  2K32 A;  1KLG D;  4C3I G;  4CDF C;  5C44 B;  2ZM6 Q;  4RA8 A;  4HCE A;  3MZ5 A;  1LV9 A;  4CBV A;  5KIX A;  4RHS A;  4B3R L;  2Z6B D;  1MJC A;  3E0E A;  1YHQ B;  1LAB A;  2CHB D;  2QDX A;  2OTL B;  4LF5 L;  4JI4 L;  1IXR A;  5CDF A;  5C3E G;  5JJK A;  1D1K A;  1EY5 A;  1EZ6 A;  1ROD A;  1ASY A;  3GTP H;  4KV6 A;  3D0F A;  3CW2 C;  1PJ5 A;  1DGS A;  4C3J G;  2KVO A;  1HVX A;  1AZQ A;  1HFN A;  1R9T H;  4FF1 A;  5BR8 L;  2WAC A;  5CYU A;  4L5R C;  1GHK A;  2KHI A;  3M3Y B;  5C4Z A;  2D5D A;  1Y8P B;  3HOV G;  4RDL A;  3ZJY C;  5A8A A;  1EOV A;  2F3I A;  3BYT B;  5FIU A;  4JI1 Q;  1CHP D;  2B2V C;  1X65 A;  1WTV A;  1BCP B;  2F0T A;  5HUR A;  1V1P A;  2E5L L;  4WJW A;  1J5E L;  3S1M B;  2YTX A;  1CM9 A;  1PH6 A;  3OTO L;  1STH A;  1SYD A;  2FMM A;  4QFM A;  3SGI A;  4DFA A;  1HPC A;  2MHV A;  3S17 H;  3Q6Q A;  4TN1 A;  3CCE B;  2SOB A;  2HHH L;  5CV8 A;  2PQA B;  4ASU A;  3B78 A;  5IYD G;  5IGC A;  2IJ0 A;  2A69 D;  3V2T A;  3S2D H;  4TMV A;  1IB0 A;  2A73 B;  1CT1 D;  4YHH L;  1HNW L;  4ZAI A;  1OO9 B;  1QE6 A;  5JVG 3;  2NVT H;  1FND A;  4AYB G;  3Q6S A;  4DA2 A;  1VQJ A;  1PH2 A;  1PTO D;  3EA6 A;  2E74 C;  2RC6 A;  5M3M G;  4ZRZ A;  1JWU D;  1WOR A;  1VQ9 B;  4RKB A;  2YWF A;  4HMI A;  1LT4 D;  2EQS A;  1O7Y A;  1WTO A;  1VQN B;  2R61 A;  3BY2 A;  1FNC A;  5DEH A;  2VNJ A;  4ACA A;  3WND A;  2JA6 B;  4P2C B;  2EYL A;  4CGY B;  1G7C A;  2D0P A;  2E8G A;  4IUN A;  3GTM H;  3ISX A;  3GTO H;  4FXU A;  1GJX A;  4CQJ A;  2NVX H;  1MKH A;  3S14 H;  4XTC S;  5M3F G;  3R8B A;  4QUZ A;  1K8M A;  1PFM A;  3QOL A;  3T4A C;  1SXT A;  4A3F G;  1AN8 A;  1GJR A;  1Y1V H;  1B8A A;  4GNX A;  1A2U A;  1YEZ A;  2VUM G;  1GUN A;  1JB3 A;  5IGG A;  3PF4 A;  3CMA B;  2F1M A;  2XZP A;  1XMO L;  1G7T A;  2Q2U A;  1KLU D;  3V7A A;  1UE6 A;  5CMD A;  4U67 3;  1TLL A;  2C77 A;  4C1N K;  3AB9 A;  3ZZ0 A;  2E2J H;  2JEA I;  4EQP A;  5CC4 A;  3ICE A;  1FNV A;  3CAM A;  3SK4 A;  3D6W A;  3W5O A;  3S16 H;  4LFB Q;  1KK2 A;  3LX0 A;  5E1F A;  3S24 A;  1B23 P;  3OE7 A;  2QIL A;  2EJM A;  3GSI A;  5H5J A;  3QWN A;  3QOJ A;  1N07 A;  4PNY A;  3CRL C;  1XNQ Q;  4QMG A;  4N9P A;  4B3G A;  3A7A B;  4A3L G;  5E4W C;  4YEJ A;  2QCP X;  4XD7 A;  2JN4 A;  1EIG A;  2Q2H A;  4Q0F A;  4B3T Q;  2VNU D;  1KRS A;  2WZN A;  1SDF A;  3S9W A;  2AQ1 B;  2OYN A;  4IUR A;  4P6V F;  1VQP B;  1CKN A;  2B2U A;  3I8Z A;  4ZUJ A;  5FO7 B;  4RCN A;  4ZYS A;  1ENC A;  5KYI A;  2DOG A;  2VW9 A;  4DV0 Q;  1VMP A;  1CSP A;  5LMU L;  4RD0 A;  1S5B D;  3R6K A;  1MHW C;  2R93 G;  1K83 B;  1O78 A;  4XLE A;  5THX A;  4HJ8 A;  5TY0 A;  3I70 A;  2ZXR A;  4AH6 A;  2MNA A;  4QL5 A;  3OWE B;  5KND A;  1ELO A;  1N9W A;  2ALY B;  3OHX C;  4ME5 A;  3BG3 A;  2BCO A;  3CU7 A;  4UP7 A;  2A74 C;  4L5T A;  1GM5 A;  4IUP A;  5C4X G;  4LF6 Q;  2QTL A;  1MD2 D;  4RGO S;  3BY1 A;  1YIJ B;  1EIF A;  1SEB D;  2MO1 A;  4IOC A;  5M5W B;  1A6X A;  1PH1 A;  1KRH A;  1OGI A;  5E3F A;  2QA4 B;  1VQ6 A;  2E2I H;  2DGY A;  2PI2 A;  2W6J A;  3TQY A;  3NUC A;  2BDN A;  1KIX A;  3MFY A;  2WYR A;  2QF7 A;  3VA5 A;  4F7D A;  4UP8 A;  4JI2 L;  3ULP A;  2ZXO A;  2L9H A;  2E2D C;  5FA6 A;  2PCF B;  1QG7 A;  1TS4 A;  1FVI A;  4RHR A;  5LL6 S;  1A2T A;  1O7L A;  1W2B A;  1X55 A;  4CDE C;  4K1X A;  1WOO A;  3BU2 A;  4DR6 Q;  2F0N A;  1Q82 C;  1M90 C;  5IGD A;  3FKI B;  3FPK A;  3RZD B;  4XQJ A;  3CXC A;  1G91 A;  4HR7 B;  3U2Q A;  4BWG B;  1IBM L;  3BZD B;  2KUM A;  1C9O A;  1FNU A;  1VQ7 A;  4DV4 Q;  4CJ2 C;  3OJW A;  3QE2 A;  1PRT F;  3EQL C;  1K28 A;  3HOU G;  3J81 j;  3P20 A;  4FF2 A;  3I56 B;  3VR4 A;  1JNY A;  5GQO A;  1FNW A;  5JPN C;  1PRT B;  3CTA A;  3IL8 A;  4GKJ Q;  2DER A;  2XSC A;  2C5H A;  4L63 B;  4QY7 A;  5HZA A;  3W1B A;  3OAA A;  1MGS A;  3A8J A;  4DAP A;  2F0M A;  2CC2 A;  2CK3 A;  5T1G A;  2V4D A;  3KEW A;  3K0Y A;  1TXY A;  3SK5 A;  1G2S A;  3W5V A;  1F2M A;  5DM7 3;  1SBB B;  3SXH A;  4RDJ A;  2EYH A;  1BNZ A;  1I4R A;  2C35 B;  4K14 A;  5KEE A;  1AP0 A;  2OWO A;  3DM1 A;  1K9M D;  4LF9 L;  1E2V A;  3CP2 A;  2Q8T A;  1PA6 A;  3F2C A;  2ZM6 L;  4LBW A;  4DAM A;  2BDO A;  4A3K G;  2NZ1 D;  4A4I A;  3Q22 A;  2QMU A;  1GUS A;  3PO2 B;  1WTH D;  2I5H A;  1EP1 B;  4KLK A;  3W2H A;  1C7Y A;  3Q6R A;  3GIR A;  4NB3 A;  2PZT A;  3S1Q H;  3NTH A;  4RGT A;  1XYI A;  4OOV A;  2X8K A;  2QDB A;  1CTM A;  2JSO A;  4Y52 H;  4OPV A;  1HZB A;  1E3P A;  2F0L A;  4DR2 Q;  3F2B A;  1D5Z C;  2IWH A;  1VQ4 A;  4HN7 A;  3ERS X;  3DMU A;  2EYP A;  1WDT A;  1UD5 A;  3HEJ A;  4OO1 G;  1T5X D;  3WDN A;  4TMT A;  1VLY A;  2X85 A;  2OBT A;  2R6G A;  4RJL A;  3R93 A;  4B9X A;  4YWK A;  3U4Z A;  4JI1 L;  1N8R D;  3H91 A;  2RQX A;  1K9M C;  4C0S A;  5EPJ A;  3T56 B;  1VHE A;  1G8Z D;  3A3G A;  1WCM H;  5I9O A;  3OMC A;  4KHZ A;  3RLO A;  3GTK H;  1X56 A;  1IYV A;  2Q8I B;  1S72 A;  1IZ6 A;  5BN3 A;  2IHE A;  2LFN A;  4OO1 H;  1CKM A;  3EIV A;  4G7W A;  3HS0 C;  4TMW A;  2CH4 W;  2BMW A;  1KNE A;  4RCY A;  1TVX A;  2VXW A;  4KKT A;  3MXN A;  1Q12 A;  3CD6 B;  1TWF H;  2EY5 A;  3AFQ A;  4G1B A;  5TRD A;  4X62 Q;  1HNX Q;  2M9V A;  2KEC A;  1KZL A;  2QGQ A;  4J6H A;  4XQQ A;  3Q23 A;  3DXJ C;  4FXK C;  4JI7 Q;  1BVS A;  5C5M A;  2R92 G;  3A1P A;  5A88 A;  1H9M A;  3JU4 A;  3AST A;  3OOC A;  4P71 A;  1Y1W H;  1GXD C;  1DOL A;  4LNQ A;  2F0V A;  1PMR A;  2I07 B;  4NKL A;  4HJ9 A;  2CW5 A;  2K6A A;  4XN3 A;  3CC7 A;  1EFW A;  4RD1 A;  1CZG A;  4K5W A;  4A3G G;  3KBX A;  4U9U A;  3MXP A;  4R4C A;  2KOL A;  4O0A A;  1B53 A;  2FIN B;  1B70 B;  1XX8 A;  4R4T A;  4HCS A;  2B63 H;  2UXB Q;  2NB0 A;  3VYR A;  1VF7 A;  2KHJ A;  4BY1 H;  2R7F A;  3KJP A;  3GVK A;  4KD4 A;  3FJO A;  1CQF A;  4DN4 M;  5BN4 A;  1PYW D;  2JIZ A;  1EOT A;  3OFN A;  2H4O A;  1WTP A;  4OXP A;  2PLF A;  1CI3 M;  2FHT A;  3KJO A;  2CWA A;  2E1R A;  4JI0 Q;  3L0O A;  1VQ5 B;  4XR6 A;  1G2T A;  2R7Z H;  2D9U A;  1QGZ A;  5LMN Q;  2HCJ B;  2C78 A;  2L15 A;  2EYF A;  3HOY G;  1EWH A;  2NUC A;  4RDK A;  2ICE C;  3NWS A;  3K57 A;  2F0I A;  1FJG Q;  3CC2 A;  4Z4U A;  1S5C D;  3SEB A;  3URY A;  4A3I B;  3I55 B;  3MCA A;  5FLX E;  2JJ1 A;  3WYA A;  4KMU C;  1PZJ D;  3D8G A;  3FHW A;  3NQT A;  1NCV A;  2BF4 A;  4HE5 A;  1I3Q B;  1KDC A;  4LFB L;  3HOY H;  5C0X J;  2XOK A;  2N88 A;  3SK6 A;  1CKO A;  1VDZ A;  4J1M A;  3CCU A;  2GQF A;  2OK7 A;  2BPO A;  4A93 G;  4OP7 A;  1UWV A;  4GKK Q;  2UXD Q;  4C3H G;  4JPB W;  3QFT A;  1XNQ L;  3A0J A;  1D5X C;  2CFM A;  4DF7 A;  2Z4H A;  3BS1 A;  4DNR B;  2V7X A;  1LT6 D;  3T1Y Q;  1T6Z A;  3TS2 A;  3HOW G;  1ENA A;  1YIT B;  4X3S A;  1TWA H;  3PO3 H;  4B3T L;  2J0T D;  3S2H H;  4IFD J;  2GPJ A;  2ZIT A;  3K80 C;  1SNC A;  1E22 A;  5TSS A;  1PTO F;  4C3H H;  1SNP A;  4IUV A;  4TVA B;  5C3W A;  3AEV A;  4EQN A;  1N33 Q;  3PGZ A;  4H0L C;  1PTO B;  5HXB A;  4DV0 L;  1PV4 A;  4IZ8 A;  3M4Q A;  5F2D A;  5EBC A;  4L5Q A;  4QVJ A;  4A3E H;  3GVJ A;  1TT2 A;  2B7C A;  1UEB A;  1Z9F A;  3CRK C;  5HGT A;  2NN6 I;  4LF8 Q;  4OEM B;  3WBJ A;  3CKI B;  1WTW A;  5D65 A;  2GN5 A;  4XOP A;  3TDQ A;  1U9R A;  4OEL B;  1HUM A;  2VBU A;  4OOS A;  4NNJ A;  1YI2 A;  1ENF A;  1PFB A;  4BBR B;  1G51 A;  3GTQ H;  2M2L A;  4LF6 L;  2ZBV A;  4CDC C;  4LK1 C;  1KXL A;  3H3V H;  1SYB A;  1EIH A;  5CV4 A;  1M1K D;  1T6X A;  4PZ8 A;  3BZK A;  4Z4W A;  3S1N H;  4ZCK A;  3PUZ A;  1HA3 A;  3VMF A;  2KBN A;  1SLJ A;  1VCI A;  3AGQ A;  5KGU A;  4Y7N B;  3J7A 5;  4JW0 A;  1PXU A;  1E3X A;  4YAW A;  2K14 A;  4K6L A;  1PJ7 A;  2XNC A;  3GV3 A;  2ZTN A;  2Z9H A;  2R6H A;  2PQE A;  2ZXH A;  2OT2 A;  3F1Z A;  3HOZ B;  1YJN B;  3HG9 A;  1GUT A;  3V76 A;  4DUY Q;  2R3Z A;  1V9P A;  1QFJ A;  2DEU A;  3TZD A;  2D3L A;  3E5S A;  2FMC A;  4QUF A;  4LMQ D;  5IP7 G;  2EJG C;  5FO9 B;  2D3N A;  4DR6 L;  1GUO A;  2ZTC A;  4IQZ A;  5IYN A;  1A3U A;  2UUB Q;  2Q6K A;  2NV4 A;  4A3D H;  1PVO A;  2GA4 B;  2WJV A;  2PW7 A;  3AVT A;  4GS3 A;  2X6X A;  3OKX A;  4DV4 L;  2OEO A;  3PIP A;  1AFP A;  3BZC A;  1X3G A;  1B3A A;  3I73 A;  3P7J A;  1M1K C;  1JT8 A;  4OOX A;  4DXF A;  5LL6 X;  1E63 A;  2JA5 G;  5IT9 E;  4F8M A;  1YJ9 B;  1KK1 A;  1XQB A;  3P26 A;  4DR4 Q;  2V7Q A;  3I3C A;  4BS9 A;  1IL8 A;  4GKJ L;  2M5S A;  1SAP A;  1JJ2 B;  3CQZ H;  3GV6 A;  4K0K Q;  2NVQ B;  3TSS A;  1O7I A;  1TWH B;  2B8G A;  4HSP A;  4A76 A;  5C0X G;  2N49 A;  4X65 Q;  2ZBU A;  5FK9 C;  5K5P A;  2PO4 A;  3AQQ A;  2JA5 H;  2SEB D;  1B44 D;  1NR4 A;  1EFT A;  3M85 A;  4GN5 A;  2V7T A;  1RQP A;  1JJG A;  3ZIA A;  3MXU A;  1VQK B;  3T53 B;  1D6E C;  3ZC3 A;  3K7A B;  2F0K A;  4TSS A;  3KF8 B;  1MBY A;  5K36 G;  3ASS A;  1U4P A;  1VQM A;  4R9W A;  2MP1 A;  3R6J A;  1SYE A;  2NTS A;  2HCC A;  1O7Z A;  2JA8 H;  2Q8R E;  4ID6 A;  3A56 A;  3L2P A;  1HCZ A;  1UEA B;  2ZZQ A;  3BVM A;  1XB2 A;  1BKB A;  2NZO A;  3HKZ E;  1FRQ A;  4DR2 L;  1WYD A;  4IFD H;  4A3M G;  3LWE A;  5IYR A;  3PF5 A;  4CKE A;  1VQ8 A;  4LW1 A;  1EEF D;  2PMZ B;  1V8Q A;  3E9H A;  4ZCM A;  2GJK A;  1ET6 A;  2B3G A;  2E75 C;  1DDI A;  3NBH A;  1KL9 A;  1X3E A;  2Z0S A;  3Q38 A;  4IW3 B;  3STB C;  2VNK A;  2A6E D;  2L4N A;  2R9V A;  3CC4 A;  4WZT A;  3MFG A;  4GLA C;  4ZK9 B;  3CHB D;  1U4R A;  1KC8 D;  2QN6 A;  3R2I A;  4Z4Z A;  3TN2 A;  4XLC A;  4JI3 Q;  3KLS X;  1Y0Y A;  1W34 A;  4BY7 B;  1RQR A;  1JJC B;  4Q5V A;  3HOX G;  2YV5 A;  1VLO A;  4Z9C B;  5B6I A;  4IN3 A;  3S1R H;  3A5Z B;  4BBS B;  2R7D A;  1XPR A;  3KYH C;  1CUK A;  4LBZ A;  1K8A D;  2IY5 B;  3CME A;  1HNX L;  5IT9 L;  4X62 L;  1KQS A;  2GVB A;  1C48 A;  2EDG A;  2WAQ B;  1NBM A;  3J7A V;  3HP3 A;  1WOP A;  1VQG A;  3K0X A;  4JI7 L;  4EX5 A;  4FXD A;  5IIF A;  4DV3 Q;  1AE3 A;  2XIW A;  1X3P A;  1DZ1 A;  4A3J B;  2JA7 G;  2QW7 A;  3CCR A;  1BXT A;  4MYU A;  4G1V A;  5GV7 A;  4QV2 A;  4B43 A;  1OXV A;  1FRN A;  3BCF A;  3SJZ A;  5A2Q E;  5CGK A;  3WXM A;  2VBS A;  1HA6 A;  2VBT A;  1GAW A;  3U4V A;  3OW2 A;  1PZK D;  2EY1 A;  1KC8 C;  2UXB L;  1D1N A;  1L0X B;  3PUN A;  3TS0 A;  1LAC A;  2MJ8 A;  4FF4 A;  1EUJ A;  2XGT A;  4XT1 B;  3DWP A;  1ZM4 A;  2LKV A;  4HIZ A;  1EQQ A;  2DIE A;  1W6K A;  4C2M H;  3A7L A;  2LSS A;  3QFS A;  3RZO H;  1EYD A;  2EE1 A;  5EAY A;  2K04 A;  1XJV A;  2F4V Q;  4A3B H;  4JI0 L;  2BE5 D;  4DNT B;  1EWI A;  5D14 A;  1EYC A;  5DSZ A;  1R9T B;  1I5F A;  1QX4 A;  1STA A;  1E1T A;  5LMN L;  1V0E A;  2X0K A;  4YIJ A;  3PQI A;  3RNU A;  1N0U A;  5TV2 A;  2BM0 A;  3JQR A;  2XND A;  3OZW A;  3CCJ B;  2GVA A;  1FJG L;  5DNF A;  4DAY B;  1VQO B;  4P1V A;  1NRK A;  3I4N G;  3VDY A;  3J7Y W;  3DDY A;  1YBY A;  2BN4 A;  1FD7 D;  4DUZ Q;  1JWM D;  4DV5 Q;  1EP2 B;  1H8E A;  2K5V A;  5KNL A;  4C3I H;  1QIL A;  5HGQ A;  4AF6 A;  1Y8O B;  3MC0 B;  1IKL A;  4QF4 A;  4POG A;  3WBK A;  1Z7T A;  2DN8 A;  5C44 G;  4GKK L;  2UXD L;  3S17 B;  3I4N H;  3ONU A;  1AIP A;  5C3E H;  4DR5 Q;  4B08 A;  5EKI A;  1TWG H;  2D9R A;  2JJQ A;  1ZM3 A;  2RDH A;  3T1Y L;  1KK3 A;  4A3C G;  3K81 C;  2SNS A;  2WV6 D;  4QHY A;  3M4Y A;  3S2D B;  2D2C C;  4C3J H;  1E1O A;  4B4D A;  3ES9 A;  2BE5 C;  4IUT A;  1XMQ Q;  2C4T A;  3E1Y E;  4M1U B;  4LF4 Q;  1QH0 A;  2TMP A;  3NWT A;  4X66 Q;  5EJW A;  2OF1 A;  1R4Q B;  3HOV H;  1I50 H;  4JI8 Q;  1N33 L;  2B2W A;  4UP9 A;  3L3O C;  4YCU A;  3GTJ H;  1D8T A;  4DKA C;  4GOP A;  3NEN A;  2IX3 A;  2NTT A;  4AIM A;  3MHB A;  4KN7 C;  3K58 A;  2NN6 G;  5F4O A;  3BVZ A;  5A2Q L;  2K28 A;  3HGB A;  4XYO A;  4RGM A;  4LF8 L;  2F0E A;  3CCV A;  1N36 Q;  4OHJ A;  3W2I A;  3UDG A;  5HY6 A;  4A75 A;  3GTM B;  4Z4V A;  1QUQ B;  2A19 A;  3GTO B;  2B8F A;  2NVX B;  3NE5 B;  3S14 B;  1IL2 A;  5IYD H;  1AMO A;  4KK7 A;  1UNS A;  1X3Q A;  3JAM c;  1SKQ A;  2VNI A;  2AHO B;  3HKZ B;  4R4I A;  1PJ6 A;  1X9N A;  1K8G A;  2WJY A;  2RCF A;  1F20 A;  1F77 A;  1Y1V B;  1WD1 A;  3M7G A;  4ZKB B;  4JMQ A;  4B3S Q;  4XOT A;  1LUZ A;  2P3M A;  2AQ2 B;  2B2W C;  2A6H C;  5M3M H;  4GOP C;  2ES2 A;  3RLF A;  1ZYR C;  2V31 A;  2OQK A;  5ELN A;  3VR3 A;  4DUY L;  4YCV A;  4V0B A;  3S16 B;  2SDF A;  5LHY 1;  3PEN A;  4RFB A;  1H9K A;  4XLH A;  1W35 A;  2XVS A;  1QFZ A;  2UUB L;  3LGJ A;  3VR5 A;  5EKL A;  3W2E A;  1TS5 A;  1GAQ A;  3U6B A;  3CCL B;  3H3V C;  5M3F H;  4BPR A;  5FJ8 G;  2JDI A;  1BBW A;  2JA6 G;  3BVG A;  3A8I E;  3ZZU A;  3J81 c;  3ONY A;  1JB9 A;  3G4S B;  5DS0 A;  2PZW A;  4A3F H;  1QVG B;  1I4X A;  2UXC Q;  2WPD A;  1DXM A;  1D2B A;  3W3A A;  2VUM H;  1AE2 A;  1H9S B;  4LWC A;  4JC0 A;  3SEJ A;  5JPM C;  1H85 A;  5IYQ A;  1BOS A;  2EYO A;  4RM0 A;  4DR4 L;  2VQE Q;  3OZV A;  1DJR D;  1LLR D;  4XL9 A;  2LS0 1;  5I2Y A;  1IYU A;  4K0K L;  2KEE A;  1PH8 A;  1II3 A;  3D6C A;  4L8J A;  5D3I B;  5JAV A;  4X65 L;  2VJI A;  3CPW B;  3KF6 B;  4GNX C;  1IHZ A;  3EFX D;  4OON A;  1RIP A;  2Q2I A;  4TQU S;  2KED A;  3WNC A;  4DR1 Q;  1TTT A;  3NEM A;  4JBJ A;  1QB5 D;  1EYG A;  4A3L H;  4XKW A;  3T51 B;  4YWM A;  3DHQ A;  1QVF A;  2B2T A;  2Z8L A;  1JR0 D;  4G7O C;  1STE A;  2KQ3 A;  3B82 A;  2JEB I;  2YWG A;  2E2I B;  1STG A;  4NDX A;  3ULL A;  3NQI A;  1Q82 D;  1M90 D;  2G5D A;  2J7Z A;  1UE5 A;  4ZQ3 A;  1A3V A;  4H7B A;  3FMC A;  5DAU A;  4RPB A;  1IBL Q;  2HQE A;  1HJP A;  1M8A A;  1Q8K A;  1SND A;  3DM3 A;  5CV6 A;  2IX0 A;  2RC5 A;  1S5E D;  5C4J H;  2K1B A;  2SNM A;  3CCQ A;  3GTL B;  1VQF A;  3Q8D A;  5IYC G;  2FVG A;  1I8D A;  4X7F A;  3G6E B;  1STN A;  1L0W A;  1YJW A;  4XDX A;  2R93 H;  3BYY B;  5GV8 A;  2RKS A;  5BN5 A;  4X06 A;  2B2U C;  1GR1 A;  1JOK A;  4HSV A;  1MSH A;  1E0B A;  2B2T C;  3NSW A;  1JQY D;  1L1O B;  5C4X H;  1JOQ A;  5A35 A;  4JI3 L;  3P75 A;  4NXN Q;  3K5M A;  3KFU A;  2OBR A;  5L37 A;  1Z47 A;  2ZTD A;  3UDX A;  4YAF A;  5IGF A;  1ZM2 A;  1B2T A;  1NY4 A;  2VY3 A;  1UD3 A;  2ZT9 C;  5IP9 G;  3IAY A;  1HZC A;  4FP5 D;  4KY5 A;  2CH4 A;  3I72 A;  5M9O A;  2ZJR A;  1DON A;  1FGB D;  1P8L A;  5ELF A;  3LNN A;  1OXX K;  4XIG S;  2CND A;  2FX3 A;  3D31 A;  3EJI A;  3RMH A;  4NPS A;  4QCL A;  1Q7Y C;  3GTG H;  4B9W A;  1K28 D;  1NB0 A;  1LM0 A;  1SE2 A;  2MFI A;  4FVM A;  4PV1 C;  4DV3 L;  5IWA Q;  4DK0 A;  1JC7 A;  1LTT D;  4OWX B;  1HRJ A;  5I6Y A;  2B7B A;  2ZZG A;  3Q24 A;  1QJO A;  1UE1 A;  3UE1 A;  5IY0 A;  5IYB G;  1F9Q A;  1SJE D;  1EEI D;  2F3W A;  1W3S A;  4KJN A;  3HAG A;  2A1A A;  5BSY A;  3KDF B;  1G29 1;  1VQL B;  5IK2 A;  3B6Y A;  1Q81 C;  4X64 Q;  1SYG A;  4XLA A;  1MI2 A;  1I4P A;  1HQM C;  2VYQ A;  4XQF A;  2HMA A;  3FKI G;  1GO2 A;  1WVL A;  1EFR A;  2OTJ A;  4ULL A;  4PC2 A;  2PMD A;  2ZXP A;  4AVZ A;  2GRE A;  3Q39 A;  2I5M X;  2D74 A;  4PGO A;  3OPO A;  5M5Y H;  3HOU H;  1J9Z A;  1N32 Q;  1WTR A;  1HR0 Q;  3S1Q B;  1UMK A;  1W87 A;  2WKC A;  2F4V L;  3RN5 A;  3BDC A;  3AMU A;  4PZ7 A;  4EQ5 A;  1GVH A;  3RUZ A;  2NPF A;  4XNF A;  2IX1 A;  2BV3 A;  2VL6 A;  2OCE A;  2JA9 A;  4KN4 C;  4HJ5 A;  1OXS C;  1YZ6 A;  3K5L A;  5CV9 A;  1PH4 A;  1TS3 A;  3RN2 A;  5BSX A;  2K52 A;  1VMC A;  2E1B A;  2D0O A;  3UE0 A;  2QEX A;  4DV2 Q;  4DR7 Q;  2ZZE A;  5H59 A;  3CCM B;  3G71 B;  1PH3 A;  4DUZ L;  4DV5 L;  2N55 A;  1L2F A;  4R8N A;  4YXW A;  4RD6 A;  3ZBU A;  1WCM B;  1TS2 A;  3GTK B;  4PG3 A;  4A3K H;  2C2W A;  4G5G A;  3CB4 A;  3CCS A;  4PC7 A;  5I2X A;  2BSA A;  1LO5 D;  1YLO A;  4Z4T A;  3FVQ A;  1IJF A;  4P2N A;  4JBM A;  4DR5 L;  3D4D A;  4P26 A;  2K03 A;  3QFR A;  1KAB A;  1TWF B;  2EIF A;  1R5O A;  3PO2 G;  2XWJ B;  3ERQ A;  5FO1 A;  1ICW A;  4OX9 Q;  2L0C A;  1YNN C;  4U68 A;  1DM0 B;  3RD4 A;  1XMQ L;  4LFC Q;  3CES A;  1XWE A;  1SNO A;  3SLD A;  4LF4 L;  3WY9 A;  3OIP A;  4I7Z C;  1HZA A;  4X66 L;  1Y1W B;  4J15 A;  5JEA J;  5E4X A;  4JI8 L;  5J22 A;  1WP6 A;  5DM6 3;  4KD3 A;  1YHQ A;  1A8V A;  1OB5 A;  1FNM A;  1BQE A;  2OTL A;  1PZI D;  1CQX A;  1N06 A;  2Y0S E;  3T1H Q;  1EY7 A;  4MNO A;  4TT3 A;  1ZUN B;  3ASQ A;  2B63 B;  2JN9 A;  3TBI B;  1NBW A;  1QWY A;  4BY1 B;  2K75 A;  1N36 L;  2X6L A;  4B44 A;  2AWO A;  4FDB A;  4P22 A;  4Z1M A;  3SHL A;  3J80 c;  1HHV A;  3AYH B;  4N3G A;  2F3V A;  5CV7 A;  1SMY D;  1V43 A;  2FFK B;  4J0Q A;  4G7X A;  3TRE A;  4PMB A;  2R7Z B;  2L55 A;  1BLI A;  5GAD C;  1QOH A;  2LXK A;  2R92 H;  1GUW A;  1RD9 D;  2PW5 A;  4BXX G;  4B3S L;  1OGJ A;  1HFG A;  4E6I A;  4IUQ A;  1UD4 A;  3A8K E;  3CP0 A;  3CRZ A;  1Q1E A;  3IKJ A;  2D62 A;  2K4K A;  2H5X A;  5KYL A;  4A3G H;  1XFO A;  1YVC A;  2XGJ A;  1QG0 A;  2E2H B;  4PQX A;  2GK6 A;  3CCE A;  4P12 A;  2PQA A;  4X3T A;  1NAP A;  4K5X A;  3C46 A;  4YAO A;  1JE4 A;  1I6H B;  2PI2 E;  3K5N A;  3VR2 A;  4LUV A;  2HDM A;  2EPB A;  4PAB A;  1TR5 A;  2ID0 A;  1BPL A;  1G7S A;  1Q46 A;  3M4O H;  2DJG C;  2CKZ B;  4O2D A;  5FLM G;  3L9A X;  1EFU A;  2X6G A;  2X6W A;  1GO3 E;  1S3O A;  3DWA A;  2C5C A;  4Z4Y A;  3L7Z C;  1SMY C;  3KLR A;  1TWA B;  3PO3 B;  1VQ9 A;  2KJX A;  1BCP C;  1V1P B;  4KKS A;  2EXZ A;  4G6I A;  4NBS A;  2ZJQ A;  2UXC L;  1F9S A;  2PMZ E;  3SVM A;  1U4M A;  1UD2 A;  2I1L A;  4ZKC B;  4WJ3 M;  4I65 A;  1VQN A;  1W9X A;  2EXD A;  5KNB A;  3H09 A;  4YY3 Q;  2VQE L;  4JOI A;  2BM1 A;  1TQO A;  4DQK A;  1ML0 D;  1NSN S;  1SKY B;  1B3Q A;  1RCV D;  3JQP A;  1RL2 A;  4A3E B;  1FR3 A;  4DNI A;  3WNB A;  1K73 D;  3GO5 A;  4A3I G;  2RSN A;  3S15 H;  2L12 A;  1GHJ A;  1Y0R A;  3KOJ A;  4A93 H;  4RG1 A;  1BX0 A;  4DR1 L;  2F0W A;  4Y9U A;  1LTG D;  4S3S A;  5KRU A;  3CMA A;  3JAM L;  3GTQ B;  5M5X B;  2WAQ E;  4AQY Q;  4RWS C;  3HZX A;  2ASB A;  3HOW H;  3H6M A;  2CQA A;  2K7V A;  4KHP Q;  1WJJ A;  3A8J E;  3SDZ A;  3S1N B;  4CKC A;  5JEA G;  1JOO A;  1SFO H;  1J6Q A;  3I7F A;  4DV7 Q;  2DCU A;  2KCC A;  2DET A;  3NEL A;  2HIV A;  3UDI A;  3ND8 A;  1U2R A;  1IBL L;  2C9O A;  2CBX A;  2A68 C;  1VQC A;  3N6R A;  1E64 A;  1L0Y B;  1G6P A;  5HZB A;  1D8L A;  4MN3 A;  1F60 A;  5GAE C;  1QZH A;  2XNA C;  1S5D D;  4P9S A;  4EQO A;  1K73 C;  4GNX B;  3A3B A;  2YU9 B;  1A3T A;  4QB4 A;  2ZL7 A;  1ONL A;  2WB1 B;  4CDD C;  3WOE A;  4YAU A;  2VNH A;  4PC1 A;  2F0G A;  1EFI D;  1TU2 B;  4A3D B;  2LY7 A;  3J81 L;  1VQP A;  3F8T A;  4NXN L;  4UZU A;  1B2R A;  3P1H A;  4R4Q A;  1QNK A;  4DK3 C;  4XQN A;  4CJ1 B;  2KHS A;  1YHB A;  3FPP A;  1EQT A;  4BBR G;  4NCN A;  4GLV B;  3J7A F;  1V1O A;  3BQJ A;  1B50 A;  1XXG A;  3QIA A;  1BJK A;  1H42 A;  2QTZ A;  4RD4 A;  5GAH C;  1E7Z A;  4DV6 Q;  1MRZ A;  2YTY A;  3CQZ B;  4RKL A;  1C4Q A;  4WRD A;  5FNZ A;  3K59 A;  4WJ4 A;  1RTN A;  2JE6 I;  1CNF A;  2Y0S B;  2KVM A;  3HFZ B;  4X3U A;  5LMN W;  5IWA L;  3T16 A;  5EPK A;  3OJX A;  5IP7 H;  1SM4 A;  1HZE A;  1YIJ A;  1SSO A;  3HOZ G;  4Y9R A;  1EXM A;  1IBK Q;  1N05 A;  4TMX A;  1BUV T;  3C1E A;  1EQR A;  3AFP A;  4XMY A;  4XM3 A;  2QA4 A;  3DWQ A;  4DPG A;  1CKN B;  5T1I A;  4TRD A;  4YEL A;  2WFW A;  2XTI A;  4X64 L;  1EY9 A;  3W5H A;  4GLX A;  1LTB D;  2JA8 B;  3SE0 A;  1DYQ A;  3H0G B;  2B2Y A;  1W6J A;  4ME3 A;  4N8F A;  4HIK A;  2PNH A;  1N32 L;  2EVB A;  3STB D;  4IPH A;  2NVY B;  1HR0 L;  1TY0 A;  1NUC A;  1FYC A;  3MHP A;  2V7W A;  2K5D A;  4GN3 B;  4NW2 A;  1DG1 G;  4N3N A;  2F0U A;  1IW7 C;  5C0X H;  4UZE A;  4UZF A;  1U0L A;  4DR7 L;  4I7A A;  4DV2 L;  1ASZ A;  2UUA Q;  1VQ6 B;  2AUK A;  5CR3 A;  2B39 A;  3NHH A;  5ELE A;  5FOB B;  1R5B A;  1SE3 A;  1SR3 A;  3P27 A;  4ZCI A;  2NWG A;  4HED A;  4CJ0 B;  1QUE A;  1NNX A;  1E24 A;  3LO8 A;  3I56 A;  5JJI A;  1OB2 A;  4WQM A;  5K36 H;  2DY8 A;  3ZYY X;  2X6Y A;  1CQV A;  3OSO A;  1EIY B;  5I9P A;  4DV1 Q;  4XLF A;  1W2B B;  2TSS A;  3EBE A;  1EL0 A;  1DDG A;  4GZY C;  3I4M B;  2XN9 C;  1ZM9 A;  2V1C C;  4OX9 L;  2EOT A;  3CXC B;  4ZGN B;  2LMC B;  1GD7 A;  2I46 A;  4OPS A;  4LFC L;  4A3M H;  1VQ7 B;  4WZL A;  4HIO A;  3SK8 A;  1C0A A;  2V7U A;  1NJI C;  2QDL A;  3BDO A;  3MEF A;  3JAM i;  4HJ7 A;  3MWY W;  2RSO A;  1EY8 A;  3T1H L;  1TWC H;  2K50 A;  1ET9 A;  1PFS A;  3J80 E;  2G9H D;  3U9O A;  2F0D A;  3KBG A;  1BF4 A;  3HOX H;  1HTP A;  4C43 A;  4K6D A;  3G6J B;  2BVN A;  3A8I A;  4JG2 A;  4O42 A;  3NK9 A;  4PZ6 A;  3SJP A;  1Q1B A;  3IRB A;  4BY7 G;  4DU9 A;  1NMF A;  4C2M B;  3RZO B;  2AUJ D;  2F0H A;  2EYJ A;  5AN9 A;  1P16 A;  4BBS G;  4A3B B;  3M4P A;  2AMC B;  3DLL A;  2MO0 A;  2X53 S;  4EGV A;  4JV5 Q;  4K2K A;  1PFN A;  2DNE A;  4IO9 A;  2CRV A;  3W2F A;  5KNC A;  1G7R A;  1BMF A;  1PDQ A;  2K33 A;  2JA7 H;  3PMF A;  3AVU A;  2WAQ G;  3VYU A;  5C3X A;  1Q90 A;  3W2D A;  1VQI A;  3HKS A;  1LT5 D;  3KLW A;  1CFM A;  5IGE A;  2QGG A;  4II3 A;  2Z6K A;  3J81 i;  4A3J G;  3GTP B;  4C3I B;  1UAP A;  2UU9 Q;  2L5T A;  4RAU C;  3VYS A;  1MJE A;  1MSG A;  3CD6 A;  2RDF A;  3I90 A;  1G6Z A;  1LTA D;  4H13 C;  1VQ4 B;  3BJU A;  3CW2 A;  2BA0 A;  1EY4 A;  5C3E B;  1QGY A;  5D3D A;  1TWG B;  3D4R A;  5CBE E;  2N78 A;  2XRQ D;  4H02 A;  3EVQ A;  2Q6I A;  5EPL A;  1U4L A;  4C3J B;  5I4D A;  2IHF A;  1AZP A;  1SNM A;  4V19 0;  1H95 A;  1OXU A;  1O80 A;  2VBV A;  1Y14 B;  3D4W A;  4B47 A;  1S72 B;  1W0K A;  2B2V A;  2IPK D;  3EN2 A;  3UI2 A;  3HOV B;  1I50 B;  4YY3 L;  5AJ3 Q;  2Z6K C;  1XNR Q;  4P72 A;  2A8V A;  2UUC Q;  3OW7 A;  3GTJ B;  4XYQ A;  3MXN B;  1KD1 C;  5F4M A;  3PIO 3;  1E43 A;  1CA6 A;  4H44 C;  2WZP P;  4RD2 A;  2Z6B A;  5NUC A;  2WII B;  3FPU B;  4WZK A;  2VZL A;  3PA1 A;  2OBS A;  3PUX A;  2RCN A;  2NZH A;  2NVT B;  4K2L A;  1VQ5 A;  3J80 L;  3E3X A;  4WWV A;  2A6H D;  5C44 H;  1QNU A;  4M8A A;  4DR3 Q;  4CHT B;  5EKK A;  1ZYR D;  4OGQ C;  3TZU A;  4AQY L;  3CC7 B;  4F7X A;  1NB9 A;  4M53 A;  4A3C H;  1ZEQ X;  1CA5 A;  2FXQ A;  1BCP F;  1M4V A;  1EZ8 A;  2J4X A;  4KHP L;  1X54 A;  4OO1 I;  3ERO A;  3I55 A;  4IPG A;  2K5W A;  2C5B A;  4OWW B;  4AYB B;  3CP8 A;  1EU3 A;  5J35 A;  3PSI A;  4DV7 L;  4XKV A;  2XRS D;  1LYL A;  5M3M B;  4TKO B;  1X32 A;  4RH6 A;  4JI6 Q;  4M1K A;  3M3Y H;  1JCK B;  1Y69 U;  2BGI A;  3NBI A;  1N08 A;  2NN6 H;  5E6T A;  4G7Z C;  3ND9 A;  2CF4 A;  4JBK A;  1PH5 A;  4WZE A;  1EQV A;  1FX0 A;  1S0U A;  3C2P A;  4UPA A;  1YIT A;  3VNV A;  2L1B A;  2B5O A;  1A0I A;  1BDO A;  2KCT A;  3S1M H;  3RY8 A;  4AF7 A;  3CC2 B;  1SRU A;  4NXM Q;  4APV A;  2N3S A;  2O2L D;  3FEW X;  5M3F B;  1DOM A;  3TEH B;  2E2J B;  3SKB A;  4P6Y A;  3D26 A;  3ZZT A;  4A3F B;  4UDU C;  1SE4 A;  2VUM B;  3ITP A;  1IJE A;  3A54 A;  1D5M C;  1KAA A;  2IL8 A;  2F4N A;  3CCU B;  3AU7 A;  4DV6 L;  3HKZ G;  1RKN A;  1S4M A;  3VO2 A;  2WIN B;  4LAA A;  3PUV A;  1Y1V G;  4L5S A;  3IFT A;  1J9O A;  4IJH A;  5ISR A;  4QVA A;  3LQE A;  1COW A;  4IJL A;  1HNZ Q;  3UDF A;  1K8O A;  2RHQ B;  1D1I A;  1ZXT A;  4LFA Q;  2VB3 X;  3GP7 A;  5F4J A;  1IBK L;  4B3X A;  3MAQ A;  2A69 C;  2M00 A;  1UE7 A;  4JI5 Q;  1Q86 D;  1B7Y B;  4LUO A;  2RHS B;  1GKH A;  1WSR A;  2AKW B;  1RTO A;  2ZTE A;  3V96 A;  2KCN A;  5FJ8 H;  4QIW E;  3KUP A;  1PTO C;  1E2Z A;  2JA6 H;  1A8P A;  1LTR D;  1WSV A;  3W5U A;  1YJN A;  4KKU A;  4P25 A;  4EH1 A;  1QUF A;  3PUM A;  1HQR D;  5J39 A;  1PH7 A;  4TMZ A;  4XON A;  5FLX c;  1YI2 B;  2GK7 A;  4ABN A;  2CCZ A;  2IT1 A;  2O5J C;  2G9D A;  4JCV E;  4LC0 A;  5C4J B;  4ALP A;  1PKV A;  2CVR A;  3I4L A;  3CF5 A;  4Y7C A;  1CK1 A;  2F4I A;  1BBX C;  4AC9 A;  3K6O A;  2UUA L;  2R93 B;  2O4X A;  3IFD A;  4GQN A;  1HTL D;  4PMC A;  5COR A;  2LXJ A;  1N34 Q;  3U6K A;  3F2U A;  3V05 A;  4M4S A;  1E3Z A;  4Q7J B;  1RJT A;  1FGU A;  4H9G A;  4MTK A;  1Q86 C;  2ZXI A;  2GJP A;  1YJ9 A;  2XZL A;  3E9I A;  5C4X B;  2OK8 A;  4B3F X;  4DQL A;  4Z4S A;  1Q7Y D;  3ZBT A;  3AVX A;  1I4G A;  3NP8 A;  4F87 A;  2F0F A;  2ZJP A;  3VA7 A;  1GVP A;  1JJ2 A;  1EP3 B;  4DV1 L;  2XNJ A;  3I4O A;  3OP1 A;  3JQQ A;  3X3M A;  1R5N A;  1Q81 D;  3H3V I;  5G3L F;  1BBU A;  1T9H A;  3GTG B;  3A8K A;  1VQK A;  2HLD A;  5IYC H;  4ZCL A;  5GAG C;  1WI5 A;  3I91 A;  2BA1 A;  4HID A;  3ER0 A;  3KF8 A;  3J80 i;  2N8N A;  1WU8 A;  1Q9S A;  3G48 A;  3FP9 A;  3K7U C;  3DUZ A;  4JYA Q;  1D7Q A;  3MA2 B;  3H9N A;  1QGA A;  1AEX A;  1SYC A;  4MYT A;  4BA1 I;  1K83 H;  4FNF A;  2I5L X;  2F52 A;  3I1F A;  1SMX A;  4XOR A;  4O1N A;  1E1R A;  1B4O A;  1B9N A;  3M7N A;  3R2T A;  2HCI A;  3TP6 A;  1VS0 A;  4FN5 A;  2EYM A;  2VB2 X;  3ONA B;  4RGN A;  1H8H A;  2VQF Q;  4LF7 Q;  3HOU B;  5M5Y B;  4IOA A;  3ASP A;  3GTL H;  5IP9 H;  1KMH A;  1X6O A;  4YAL A;  5M5W H;  1KHI A;  4KTA A;  3TP8 A;  3H15 A;  2BGJ A;  4JV5 L;  2DNC A;  3T13 A;  1PYB A;  3ZPN A;  4K8I A;  2F0O A;  1F2L A;  2EZV A;  4KI0 A;  1SN8 A;  5FKA C;  1VQM B;  4XN0 A;  3JC6 6;  3BDL A;  2MPM A;  1VQA A;  2K05 A;  4PC6 A;  4NP5 A;  4K8J A;  2V7V A;  1RF2 D;  5IYB H;  5FL7 A;  3SR1 A;  4L6T B;  1VQH A;  4MIU A;  2F0P A;  2DUD A;  1SNQ A;  1YNN D;  1TUI A;  2UU9 L;  2JJ2 A;  3OEE A;  2RF4 A;  2YTV A;  2DY7 A;  4A3K B;  1XPU A;  3FKI H;  5L46 A;  3RZD H;  4HTH A;  5IT9 c;  1VQ8 B;  4RCZ A;  5AFW A;  1E2W A;  1GOZ A;  4WOR A;  4RLZ A;  4B3M Q;  1MAB A;  4IPC A;  3NBH B;  4XXE A;  3QFC A;  1V1Q A;  3MTS A;  5C0X I;  4TSF A;  3CC4 B;  1S4Z A;  2RDG A;  3ULJ A;  1WTX A;  1ILQ A;  4OIK A;  1Q8I A;  5KSW B;  1CNE A;  1S5F D;  4ILW A;  5ELD A;  1QZG A;  5HKK A;  3K5O A;  1WD0 A;  1WOS A;  4FO2 A;  4K5V A;  4LUZ A;  2WB1 E;  1K0R A;  2MUY A;  3RLN A;  5AJ3 L;  1WTQ A;  4JBW A;  1XNR L;  1SJH D;  2AQ3 B;  1FL0 A;  2ICI A;  4P74 A;  5A89 A;  4NMZ A;  2ZZF A;  2UUC L;  3OWF A;  4J8Q A;  2WSS A;  1HXY D;  4II2 A;  3CME B;  3K8A A;  4IFD I;  1KQS B;  3BC9 A;  1OHH A;  2MGS A;  3KK7 A;  2EIX A;  2K5H A;  1B1Z A;  1WTH A;  2XEX A;  4QIW B;  2KA7 A;  2YWE A;  4HAE A;  4P73 A;  2XZO A;  3C1F A;  3Q0A A;  2JXM B;  3OIQ A;  1T6Y A;  1WCM G;  1ESF A;  1Q3L A;  1X3F A;  3CCR B;  4DR3 L;  2ZL6 A;  3E6Z X;  3CCJ A;  1QCB D;  2X3U A;  1UD8 A;  3R3O A;  1E62 A;  2OXP A;  3VYT A;  3PO2 H;  1ILP A;  1NDH A;  4DAY A;  1VQO A;  5EQ0 A;  4ZUI A;  1ICF B;  1WOC A;  1RHP A;  5FO0 A;  4RMF A;  4WFN 3;  1KK0 A;  1VF5 C;  2ATW A;  4C56 C;  3OW2 B;  2R92 B;  3C3L A;  2EY6 A;  4X05 A;  4QJF A;  1VQD A;  4P75 A;  3JAM E;  4JI6 L;  5E7N A;  4FF3 A;  4GN4 B;  1QFY A;  3WQZ A;  1OTC A;  4A3G B;  3H94 A;  4LBV A;  4XT3 B;  1Y1W G;  4FK8 A;  1YX2 A;  1CSQ A;  1BCP D;  3BCD A;  1I94 Q;  4R4O A;  1E1Q A;  4QUC A;  1WPC A;  5EGT A;  1A15 A;  2WR8 A;  3PUY A;  5C5L A;  2QKI C;  5IYP A;  3M4O B;  1TII D;  1JWS D;  2B63 G;  1K3R A;  3U50 C;  4NXM L;  2HD3 A;  4BY1 G;  2BOS A;  5C6A A;  2DJF C;  4X7D A;  5TR9 A;  4G4K A;  1I18 A;  4X07 A;  3C2Q A;  1IHM A;  4LJZ C;  1CZW A;  3HOY B;  1YHA A;  1IKM A;  4UAI A;  4QGU A;  4BXX H;  1VHO A;  1N8R C;  1ESR A;  2R7Z G;  1KDB A;  1HR0 W;  4YCW A;  3AVY A;  3J81 E;  4DK1 A;  1PH9 A;  4ZV4 A;  1EU4 A;  5COY A;  4CKB A;  3J7Z C;  2HDN B;  1QUQ A;  1PHJ A;  1HNZ L;  1I7P A;  4ZGQ B;  1KNA A;  1U5K A;  1I4H A;  3NPP A;  1P4M A;  3QJY A;  1JOR A;  3S2H B;  3Q3A A;  2WKD A;  3S15 B;  3KL9 A;  4LFA L;  1LTS D;  3E0J A;  4JVZ A;  2AHO A;  4A93 B;  4N9T A;  5EMN A;  4JI5 L;  4DXG A;  4MTN A;  4C3H B;  3TME A;  1FDR A;  2A68 D;  3G7L A;  3KLS A;  4G57 A;  1J8I A;  4P3Y A;  4OIJ A;  5FLM H;  4B3R Q;  2ENB A;  1JE5 A;  1LTL A;  4GOP B;  3HOW B;  1SRO A;  4OL7 A;  4LF5 Q;  4JI4 Q;  5IOC A;  3QB3 A;  1SFO B;  1YNJ D;  2LZJ A;  4DK6 C;  2F1L A;  2E2H H;  3CCV B;  3PO3 G;  2CQO A;  3G05 A;  5BR8 Q;  4OWT B;  2F0S A;  1DCZ A;  1I6H H;  2DYI A;  5KW9 A;  4X3K A;  3E20 A;  1LTI D;  3A5U A;  3VR6 A;  2CWP A;  3VNU A;  1NMG A;  2K5Q A;  3CCL A;  3U9S A;  4A3I H;  2MQH A;  1W0J A;  1JA1 A;  2VZA A;  1STY A;  2BH2 A;  4RPD A;  2GJR A;  3G4S A;  3GVL A;  4Z4R A;  1F2Z A;  1H9R A;  2RBM A;  4JOI C;  4A3E G;  5C4H A;  1QVG A;  1N34 L;  1J5E Q;  2E5L Q;  1H9S A;  1I3Q H;  3QG1 A;  2K01 A;  4B48 A;  1N0V C;  3OTO Q;  1BQQ T;  1B9M A;  4JK1 C;  2HUG A;  1XTD A;  4X7E A;  2JYO A;  1BR9 A;  4IPD A;  1I6V C;  2O5I C;  3ASR A;  5FO8 B;  5IGB A;  2QEJ C;  5JEA H;  2HHH Q;  1EY6 A;  3I2Z A;  3W1G A;  2L11 A;  2YYZ A;  3KF6 A;  3CPW A;  2F43 A;  1A62 A;  3RR5 A;  1YNJ C;  1HNW Q;  4YHH Q;  1Z6H A;  1YNX A;  4PMW A;  4ODG A;  5JVH 3;  1KRT A;  2PZU A;  2VS1 A;  3O13 A;  3MXG A;  1IYJ B;  1R4P B;  2ZTG A;  5M5X H;  4DGZ A;  1K3B C;  2XWB B;  4UHV A;  1PTO H;  2Q6L A;  2J7K A;  4JYA L;  3D3R A;  1KDA A;  2KCM A;  2F03 A;  1Y8N B;  4X7C A;  3DEO A;  3AGP A;  1IW7 D;  5G3L D;  4F88 A;  3QSY A;  2WB1 G;  4M2L A;  5GRO A;  1VJS A;  4M0L A;  4ROX A;  4RCO A;  4X8I A;  4HJA A;  3PA2 A;  3PVD A;  2JP1 A;  1PYS B;  4BBR H;  2VQF L;  2QE7 A;  1D2E A;  3MMP A;  4X0C A;  4LF7 L;  3AVW A;  4A3D G;  2JA5 B;  4DAV A;  1LT3 D;  5I6W A;  1JB7 A;  3G6E A;  5FLX L;  5ELO A;  4YHB A;  5H1S E;  2CW0 D;  2RA4 A;  1WFQ A;  2YU9 H;  5IYW A;  5LMZ A;  1KTK A;  1XMO Q;  3X3N A;  1FNB A;  4Y7N H;  2HT1 A;  1QVF B;  4HE6 A;  3QR8 A;  1L1O A;  1EY0 A;  3AVV A;  2EJF C;  1VQB A;  4KHV A;  2I0Q A;  3ZUG A;  3HOZ H;  4R71 A;  3TRZ A;  2W6I A;  1F9P A;  4YWL A;  3WOF A;  2Y0S G;  3CPX A;  1HUN A;  3GDE A;  3BH4 A;  2VJJ A;  2WP8 J;  3CPF A;  1EFC A;  4P3I A;  3NTI A;  1EWY A;  2JK8 A;  2RVL A;  3NTK A;  1KJZ A;  3CMM A;  3J81 k;  1STB A;  4KJO A;  4G7H C;  1HZ9 A;  2A5H A;  3CCQ B;  1VQE A;  2Q2T A;  3VO1 A;  4AYB E;  4C1N I;  5J1Z A;  2K5N A;  3PCO B;  3LQ6 A;  1YJW B;  2X69 A;  3MVV A;  1JA0 A;  4HIM A;  1NJI D;  1C8C A;  4B3M L;  3PV0 A;  3FKS A;  4KY7 A;  1BO0 A;  4PC3 A;  1ZKO A;  2Z1C A;  4MZ9 A;  3TP7 A;  2PPB C;  4IAL A;  3HRZ C;  1UD6 A;  2JA8 G;  2F0Q A;  3H0G G;  4PAA A;  1PRT D;  4UY8 C;  2ZL5 A;  2CW0 C;  1I4Q A;  1TVC A;  1L1O C;  4A3M B;  1HA5 A;  3KDF A;  1TKW B;  1VQL A;  3SLN A;  1V0F A;  1DD2 A;  2B2Y C;  4FYD A;  1OXT A;  3S1R B;  5J3O A;  1E79 A;  1S40 A;  2NVQ H;  4IFD G;  1TWH H;  3A55 A;  4QQB X;  1BX1 A;  5IE8 A;  5LMU Q;  3FRP B;  2NBF A;  3LVB A; 
#chains in the Genus database with same CATH homology
 2H1E A;  3LWU A;  2AWN A;  1TWC B;  4EVO A;  1H9J A;  2F0J A;  4ZLT F;  1TY2 A;  4E0F A;  3HOX B;  4R8I A;  3OEH A;  5ELC A;  1PLF A;  5CBA E;  1XTC D;  1JIC A;  5DN6 A;  4IUU A;  2Z4I A;  1EWC A;  2NYZ D;  1PRT C;  1RDP D;  3OMG A;  4MHE A;  3PUW A;  2HDL A;  2JA7 B;  3A35 A;  3GD7 A;  5ELB A;  2PYK A;  5CV5 A;  2FJ2 A;  4BA2 I;  3GQB A;  4FXG C;  1F2Y A;  1EYA A;  3PIP 3;  1AW7 A;  3FDT A;  2PNR C;  3QO2 A;  5EBD A;  4KY6 A;  4HMJ A;  1SYF A;  1GUG A;  1DOK A;  2A6E C;  3DEP A;  2E76 C;  3NXW A;  1NR2 A;  2EY2 A;  3I4N B;  3TP5 A;  5JOB A;  1OB0 A;  5JJZ A;  3N52 A;  1T5E A;  1UUP A;  1CHQ D;  1F9R A;  2IW3 A;  3MEH A;  5IOD A;  2K32 A;  1KLG D;  4C3I G;  5C44 B;  4RA8 A;  4HCE A;  3MZ5 A;  1LV9 A;  4CBV A;  5KIX A;  4RHS A;  2Z6B D;  1LAB A;  2CHB D;  5CDF A;  1D1K A;  1EY5 A;  1EZ6 A;  1ROD A;  4KV6 A;  4C3J G;  1AZQ A;  2KVO A;  1HVX A;  1HFN A;  4FF1 A;  2WAC A;  5CYU A;  1GHK A;  3M3Y B;  5C4Z A;  2D5D A;  1Y8P B;  3BYT B;  1CHP D;  2B2V C;  1WTV A;  1BCP B;  2F0T A;  5HUR A;  1V1P A;  4WJW A;  3S1M B;  1CM9 A;  1STH A;  1SYD A;  2FMM A;  4DFA A;  1HPC A;  2MHV A;  2SOB A;  5CV8 A;  4ASU A;  5IGC A;  2IJ0 A;  2A69 D;  3V2T A;  2A73 B;  1CT1 D;  4ZAI A;  1OO9 B;  1QE6 A;  5JVG 3;  3Q6S A;  4DA2 A;  1PTO D;  3EA6 A;  2E74 C;  4ZRZ A;  1JWU D;  4RKB A;  4HMI A;  1LT4 D;  1O7Y A;  1WTO A;  2R61 A;  5DEH A;  2JA6 B;  4P2C B;  2EYL A;  4CGY B;  4IUN A;  4FXU A;  1GJX A;  4XTC S;  3R8B A;  1K8M A;  1PFM A;  3QOL A;  3T4A C;  1SXT A;  1AN8 A;  1A2U A;  1GUN A;  1JB3 A;  5IGG A;  2F1M A;  2XZP A;  1KLU D;  5CMD A;  4U67 3;  4C1N K;  3AB9 A;  2JEA I;  4EQP A;  5CC4 A;  1FNV A;  3SK4 A;  3D6W A;  3LX0 A;  5E1F A;  3OE7 A;  2QIL A;  2EJM A;  3QWN A;  3QOJ A;  4PNY A;  3CRL C;  4QMG A;  4N9P A;  4B3G A;  3A7A B;  5E4W C;  4YEJ A;  2QCP X;  4XD7 A;  1EIG A;  2VNU D;  4Q0F A;  1SDF A;  3S9W A;  2AQ1 B;  4IUR A;  2B2U A;  3I8Z A;  4ZUJ A;  5FO7 B;  4RCN A;  4ZYS A;  1ENC A;  5KYI A;  1VMP A;  1S5B D;  1K83 B;  1O78 A;  4XLE A;  3I70 A;  2ZXR A;  3OWE B;  5KND A;  3OHX C;  4ME5 A;  3BG3 A;  2BCO A;  3CU7 A;  2A74 C;  4IUP A;  1MD2 D;  4RGO S;  1A6X A;  5M5W B;  1SEB D;  5E3F A;  2W6J A;  3NUC A;  2BDN A;  3MFY A;  2QF7 A;  3VA5 A;  2ZXO A;  2L9H A;  2E2D C;  2PCF B;  1QG7 A;  1TS4 A;  4RHR A;  5LL6 S;  1A2T A;  1O7L A;  2F0N A;  5IGD A;  3FKI B;  3RZD B;  4XQJ A;  1G91 A;  4HR7 B;  4BWG B;  3BZD B;  2KUM A;  1FNU A;  4CJ2 C;  1PRT F;  3EQL C;  3P20 A;  4FF2 A;  3VR4 A;  1FNW A;  5JPN C;  1PRT B;  3IL8 A;  2XSC A;  4L63 B;  3OAA A;  1MGS A;  4DAP A;  2F0M A;  2CK3 A;  5T1G A;  2V4D A;  3KEW A;  3K0Y A;  3SK5 A;  1G2S A;  1F2M A;  5DM7 3;  1SBB B;  3SXH A;  2EYH A;  1AP0 A;  1BNZ A;  1I4R A;  4K14 A;  5KEE A;  3DM1 A;  1E2V A;  3CP2 A;  2Q8T A;  2BDO A;  2NZ1 D;  3Q22 A;  1GUS A;  3PO2 B;  1WTH D;  2PZT A;  3NTH A;  4RGT A;  1XYI A;  2X8K A;  2QDB A;  1CTM A;  2JSO A;  2F0L A;  1D5Z C;  2IWH A;  4HN7 A;  3DMU A;  2EYP A;  1UD5 A;  3HEJ A;  4OO1 G;  1T5X D;  3WDN A;  1VLY A;  2X85 A;  2R6G A;  3R93 A;  4B9X A;  3H91 A;  2RQX A;  5EPJ A;  3T56 B;  1G8Z D;  5I9O A;  3A3G A;  3OMC A;  4KHZ A;  1IYV A;  2Q8I B;  5BN3 A;  2LFN A;  4OO1 H;  4G7W A;  3HS0 C;  1KNE A;  1TVX A;  2VXW A;  4KKT A;  3MXN A;  1Q12 A;  2EY5 A;  2M9V A;  2KEC A;  1KZL A;  4J6H A;  4XQQ A;  3Q23 A;  3DXJ C;  4FXK C;  5C5M A;  1H9M A;  3JU4 A;  3OOC A;  1GXD C;  1DOL A;  2F0V A;  1PMR A;  2I07 B;  4NKL A;  2K6A A;  4XN3 A;  1CZG A;  4K5W A;  3KBX A;  3MXP A;  2KOL A;  1B53 A;  2FIN B;  1XX8 A;  4HCS A;  2NB0 A;  3VYR A;  1VF7 A;  3GVK A;  4KD4 A;  1CQF A;  4DN4 M;  5BN4 A;  1PYW D;  2JIZ A;  1EOT A;  3OFN A;  2H4O A;  1WTP A;  2FHT A;  1CI3 M;  4XR6 A;  1G2T A;  2D9U A;  2EYF A;  1EWH A;  2NUC A;  2ICE C;  3NWS A;  3K57 A;  2F0I A;  1S5C D;  3SEB A;  3URY A;  4A3I B;  5FLX E;  2JJ1 A;  4KMU C;  1PZJ D;  3D8G A;  3NQT A;  1NCV A;  1I3Q B;  1KDC A;  5C0X J;  2XOK A;  2N88 A;  3SK6 A;  1VDZ A;  4J1M A;  4C3H G;  1D5X C;  4DF7 A;  2Z4H A;  3BS1 A;  4DNR B;  1LT6 D;  1ENA A;  4X3S A;  2J0T D;  4IFD J;  1SNC A;  5TSS A;  1PTO F;  1SNP A;  4IUV A;  5C3W A;  4EQN A;  4H0L C;  1PTO B;  4IZ8 A;  5F2D A;  5EBC A;  3GVJ A;  1TT2 A;  3CRK C;  5HGT A;  2NN6 I;  1WTW A;  3CKI B;  5D65 A;  4XOP A;  3TDQ A;  1U9R A;  1HUM A;  4NNJ A;  1ENF A;  1PFB A;  4BBR B;  2M2L A;  4LK1 C;  1EIH A;  1SYB A;  5CV4 A;  3PUZ A;  1VCI A;  5KGU A;  4Y7N B;  1PXU A;  1E3X A;  4K6L A;  3GV3 A;  2ZTN A;  2PQE A;  2ZXH A;  2OT2 A;  3HOZ B;  3HG9 A;  1GUT A;  2R3Z A;  3TZD A;  2D3L A;  3E5S A;  2FMC A;  4QUF A;  4LMQ D;  2EJG C;  5FO9 B;  2D3N A;  1GUO A;  4IQZ A;  1A3U A;  2GA4 B;  2WJV A;  2PW7 A;  2X6X A;  2OEO A;  1AFP A;  3P7J A;  1B3A A;  3I73 A;  4DXF A;  5LL6 X;  5IT9 E;  4F8M A;  2V7Q A;  3I3C A;  4BS9 A;  1IL8 A;  2M5S A;  1SAP A;  3GV6 A;  2NVQ B;  3TSS A;  1TWH B;  2B8G A;  4HSP A;  5C0X G;  5FK9 C;  5K5P A;  2PO4 A;  2SEB D;  1B44 D;  1NR4 A;  3M85 A;  3ZIA A;  3MXU A;  3T53 B;  1D6E C;  3K7A B;  2F0K A;  4TSS A;  1MBY A;  5K36 G;  1U4P A;  4R9W A;  2MP1 A;  1SYE A;  2NTS A;  2HCC A;  1O7Z A;  2Q8R E;  4ID6 A;  3A56 A;  1HCZ A;  1UEA B;  2ZZQ A;  3BVM A;  4IFD H;  3LWE A;  4CKE A;  1EEF D;  2PMZ B;  1V8Q A;  2GJK A;  1ET6 A;  2E75 C;  3NBH A;  2A6E D;  2L4N A;  2R9V A;  3MFG A;  4ZK9 B;  3CHB D;  1U4R A;  3R2I A;  3TN2 A;  4XLC A;  3KLS X;  4BY7 B;  4Q5V A;  4Z9C B;  4BBS B;  4IN3 A;  5IT9 L;  1C48 A;  2EDG A;  2WAQ B;  1NBM A;  3J7A V;  3HP3 A;  4FXD A;  5IIF A;  2XIW A;  1X3P A;  1DZ1 A;  4A3J B;  1BXT A;  1OXV A;  3BCF A;  5A2Q E;  5CGK A;  1HA6 A;  1PZK D;  2EY1 A;  1L0X B;  1LAC A;  2MJ8 A;  4FF4 A;  4XT1 B;  3DWP A;  2LKV A;  4HIZ A;  2DIE A;  1W6K A;  3A7L A;  1EYD A;  2EE1 A;  2K04 A;  2BE5 D;  4DNT B;  5D14 A;  1EYC A;  1R9T B;  1STA A;  1V0E A;  4YIJ A;  2XND A;  5DNF A;  1NRK A;  3J7Y W;  3DDY A;  1FD7 D;  1JWM D;  1H8E A;  5KNL A;  1QIL A;  1Y8O B;  3MC0 B;  1IKL A;  4QF4 A;  1Z7T A;  2DN8 A;  3S17 B;  4B08 A;  5EKI A;  2RDH A;  2SNS A;  2WV6 D;  3S2D B;  3M4Y A;  2D2C C;  2BE5 C;  4IUT A;  4M1U B;  2TMP A;  3NWT A;  5EJW A;  2OF1 A;  1R4Q B;  2B2W A;  3L3O C;  2IX3 A;  2NTT A;  3MHB A;  4KN7 C;  3K58 A;  2NN6 G;  3BVZ A;  5A2Q L;  2K28 A;  3HGB A;  4XYO A;  4RGM A;  2F0E A;  4OHJ A;  3GTM B;  3GTO B;  2B8F A;  2NVX B;  3NE5 B;  3S14 B;  4KK7 A;  1UNS A;  1X3Q A;  3HKZ B;  2WJY A;  1WD1 A;  1F77 A;  1Y1V B;  3M7G A;  4ZKB B;  4JMQ A;  4XOT A;  2AQ2 B;  2B2W C;  2A6H C;  3RLF A;  1ZYR C;  2V31 A;  3VR3 A;  4V0B A;  3S16 B;  2SDF A;  5LHY 1;  4RFB A;  1H9K A;  4XLH A;  2XVS A;  3VR5 A;  5EKL A;  1TS5 A;  3H3V C;  2JDI A;  3BVG A;  3A8I E;  2PZW A;  1I4X A;  2WPD A;  1DXM A;  1D2B A;  3W3A A;  1H9S B;  5JPM C;  1BOS A;  2EYO A;  1DJR D;  1LLR D;  4XL9 A;  2LS0 1;  5I2Y A;  1IYU A;  2KEE A;  1II3 A;  3D6C A;  4L8J A;  5D3I B;  5JAV A;  2VJI A;  1IHZ A;  3EFX D;  4TQU S;  2KED A;  1QB5 D;  4XKW A;  3T51 B;  3DHQ A;  2B2T A;  2Z8L A;  1JR0 D;  4G7O C;  1STE A;  2KQ3 A;  2JEB I;  2E2I B;  1STG A;  4NDX A;  3NQI A;  2J7Z A;  4ZQ3 A;  1A3V A;  4H7B A;  3FMC A;  5DAU A;  2HQE A;  1M8A A;  1SND A;  5CV6 A;  2IX0 A;  1S5E D;  2K1B A;  2SNM A;  3GTL B;  1I8D A;  1STN A;  4XDX A;  3BYY B;  2RKS A;  5BN5 A;  2B2U C;  1JOK A;  4HSV A;  1MSH A;  1E0B A;  2B2T C;  3NSW A;  1JQY D;  1JOQ A;  5A35 A;  3P75 A;  3K5M A;  1Z47 A;  5IGF A;  1B2T A;  1UD3 A;  2ZT9 C;  3IAY A;  4FP5 D;  4KY5 A;  3I72 A;  5M9O A;  1DON A;  1FGB D;  5ELF A;  3LNN A;  4XIG S;  1OXX K;  3EJI A;  3RMH A;  3D31 A;  4QCL A;  4B9W A;  1K28 D;  1SE2 A;  4FVM A;  4PV1 C;  4DK0 A;  1JC7 A;  1LTT D;  1HRJ A;  5I6Y A;  2ZZG A;  3Q24 A;  1QJO A;  1F9Q A;  1SJE D;  1EEI D;  2F3W A;  4KJN A;  3HAG A;  1G29 1;  5IK2 A;  1SYG A;  4XLA A;  1MI2 A;  1I4P A;  1HQM C;  4XQF A;  1WVL A;  1EFR A;  4ULL A;  2ZXP A;  4AVZ A;  3OPO A;  1WTR A;  3S1Q B;  2WKC A;  3AMU A;  3BDC A;  3RUZ A;  4XNF A;  2IX1 A;  4KN4 C;  1OXS C;  3K5L A;  5CV9 A;  1TS3 A;  1VMC A;  2E1B A;  2ZZE A;  2N55 A;  4R8N A;  4YXW A;  1WCM B;  1TS2 A;  3GTK B;  5I2X A;  1LO5 D;  3FVQ A;  3D4D A;  2K03 A;  1KAB A;  1TWF B;  2XWJ B;  3ERQ A;  1ICW A;  2L0C A;  1YNN C;  4U68 A;  1DM0 B;  3RD4 A;  3CES A;  1XWE A;  1SNO A;  3OIP A;  4I7Z C;  1Y1W B;  5JEA J;  5E4X A;  5J22 A;  1WP6 A;  5DM6 3;  4KD3 A;  1PZI D;  1EY7 A;  4TT3 A;  2B63 B;  3TBI B;  1QWY A;  4BY1 B;  2X6L A;  2AWO A;  4P22 A;  4Z1M A;  3SHL A;  1HHV A;  2F3V A;  5CV7 A;  1SMY D;  1V43 A;  2FFK B;  4G7X A;  4PMB A;  2R7Z B;  2L55 A;  1BLI A;  1QOH A;  1GUW A;  1RD9 D;  2PW5 A;  1HFG A;  4E6I A;  4IUQ A;  1UD4 A;  3A8K E;  1Q1E A;  3IKJ A;  5KYL A;  2D62 A;  2XGJ A;  2E2H B;  4PQX A;  2GK6 A;  4X3T A;  1NAP A;  4K5X A;  3C46 A;  1JE4 A;  1I6H B;  3K5N A;  3VR2 A;  2HDM A;  2EPB A;  1TR5 A;  2ID0 A;  1BPL A;  3L9A X;  2X6G A;  2X6W A;  3DWA A;  2C5C A;  3L7Z C;  1SMY C;  3KLR A;  1TWA B;  3PO3 B;  2KJX A;  1BCP C;  1V1P B;  4KKS A;  2EXZ A;  4G6I A;  1F9S A;  3SVM A;  1U4M A;  1UD2 A;  4ZKC B;  4I65 A;  1W9X A;  5KNB A;  3H09 A;  1TQO A;  1ML0 D;  1NSN S;  1SKY B;  1RCV D;  4A3E B;  1FR3 A;  3GO5 A;  2RSN A;  2L12 A;  1GHJ A;  2F0W A;  1LTG D;  4S3S A;  5KRU A;  3JAM L;  3GTQ B;  5M5X B;  4RWS C;  3HZX A;  3H6M A;  2CQA A;  2K7V A;  3A8J E;  3SDZ A;  3S1N B;  4CKC A;  5JEA G;  1JOO A;  2KCC A;  3ND8 A;  2C9O A;  2A68 C;  3N6R A;  1L0Y B;  4MN3 A;  2XNA C;  1S5D D;  4EQO A;  3A3B A;  2YU9 B;  1A3T A;  4QB4 A;  1ONL A;  2WB1 B;  3WOE A;  2F0G A;  1EFI D;  1TU2 B;  4A3D B;  2LY7 A;  3J81 L;  4UZU A;  3P1H A;  1QNK A;  4XQN A;  4CJ1 B;  2KHS A;  3FPP A;  1EQT A;  3J7A F;  1V1O A;  1B50 A;  1XXG A;  3QIA A;  3CQZ B;  4RKL A;  1C4Q A;  4WRD A;  3K59 A;  1RTN A;  2JE6 I;  2Y0S B;  2KVM A;  4X3U A;  3T16 A;  5EPK A;  1HZE A;  1SSO A;  1BUV T;  3C1E A;  4XMY A;  4XM3 A;  3DWQ A;  5T1I A;  4TRD A;  4YEL A;  1EY9 A;  1LTB D;  2JA8 B;  3SE0 A;  1DYQ A;  3H0G B;  2B2Y A;  1W6J A;  2EVB A;  2NVY B;  1TY0 A;  1NUC A;  1FYC A;  2K5D A;  4NW2 A;  2F0U A;  1IW7 C;  5C0X H;  2AUK A;  5CR3 A;  2B39 A;  3NHH A;  5ELE A;  5FOB B;  1SE3 A;  4HED A;  4CJ0 B;  2NWG A;  5K36 H;  2DY8 A;  3ZYY X;  2X6Y A;  1CQV A;  3OSO A;  5I9P A;  4XLF A;  2TSS A;  1EL0 A;  4GZY C;  3I4M B;  2XN9 C;  2EOT A;  2LMC B;  2I46 A;  3SK8 A;  3BDO A;  3MWY W;  2RSO A;  1EY8 A;  1ET9 A;  3J80 E;  2G9H D;  3U9O A;  2F0D A;  3KBG A;  1BF4 A;  1HTP A;  4K6D A;  3G6J B;  4O42 A;  3NK9 A;  1Q1B A;  4DU9 A;  4C2M B;  3RZO B;  2AUJ D;  2F0H A;  2EYJ A;  4A3B B;  2X53 S;  4EGV A;  4K2K A;  1PFN A;  2DNE A;  5KNC A;  1BMF A;  1PDQ A;  2K33 A;  3PMF A;  5C3X A;  3VYU A;  1Q90 A;  3W2D A;  1LT5 D;  1CFM A;  5IGE A;  4II3 A;  3GTP B;  4C3I B;  1UAP A;  2L5T A;  4RAU C;  3VYS A;  1MSG A;  2RDF A;  3I90 A;  1G6Z A;  1LTA D;  4H13 C;  2BA0 A;  1EY4 A;  5C3E B;  5D3D A;  1TWG B;  3D4R A;  5CBE E;  2XRQ D;  3EVQ A;  5EPL A;  1U4L A;  4C3J B;  5I4D A;  1AZP A;  1SNM A;  4V19 0;  1OXU A;  1O80 A;  3D4W A;  1W0K A;  2B2V A;  2IPK D;  3UI2 A;  3HOV B;  1I50 B;  3OW7 A;  3GTJ B;  4XYQ A;  3PIO 3;  1E43 A;  1CA6 A;  4H44 C;  2WZP P;  5NUC A;  2WII B;  3FPU B;  3PUX A;  2NVT B;  4K2L A;  3J80 L;  2A6H D;  1QNU A;  4M8A A;  4CHT B;  5EKK A;  1ZYR D;  4OGQ C;  3TZU A;  4F7X A;  1ZEQ X;  1CA5 A;  1BCP F;  1M4V A;  1EZ8 A;  2J4X A;  4OO1 I;  3ERO A;  2K5W A;  4AYB B;  3CP8 A;  1EU3 A;  4XKV A;  2XRS D;  5M3M B;  4TKO B;  1X32 A;  4RH6 A;  1JCK B;  1Y69 U;  3NBI A;  2NN6 H;  4G7Z C;  3ND9 A;  1EQV A;  1FX0 A;  3C2P A;  2L1B A;  1BDO A;  2O2L D;  3FEW X;  5M3F B;  1DOM A;  2E2J B;  4A3F B;  4UDU C;  1SE4 A;  2VUM B;  3ITP A;  3A54 A;  1D5M C;  1KAA A;  2IL8 A;  3AU7 A;  1RKN A;  2WIN B;  4LAA A;  3PUV A;  3IFT A;  1J9O A;  5ISR A;  1COW A;  1K8O A;  1D1I A;  1ZXT A;  2VB3 X;  3GP7 A;  3MAQ A;  2A69 C;  2M00 A;  1RTO A;  3V96 A;  2KCN A;  3KUP A;  1PTO C;  1E2Z A;  1LTR D;  4KKU A;  1HQR D;  5J39 A;  4XON A;  2GK7 A;  4ABN A;  2IT1 A;  2O5J C;  2G9D A;  5C4J B;  1PKV A;  2CVR A;  3I4L A;  2F4I A;  1CK1 A;  1BBX C;  3K6O A;  2R93 B;  2O4X A;  3IFD A;  4GQN A;  1HTL D;  4PMC A;  5COR A;  3F2U A;  3V05 A;  1RJT A;  1E3Z A;  2ZXI A;  2GJP A;  5C4X B;  2XZL A;  4B3F X;  3NP8 A;  1I4G A;  4F87 A;  2F0F A;  3VA7 A;  3X3M A;  5G3L F;  3GTG B;  2HLD A;  3I91 A;  2BA1 A;  3KF8 A;  3DUZ A;  3MA2 B;  1AEX A;  1SYC A;  4BA1 I;  4FNF A;  4O1N A;  4XOR A;  1E1R A;  1B4O A;  1B9N A;  3M7N A;  3R2T A;  2HCI A;  3TP6 A;  2EYM A;  4RGN A;  2VB2 X;  3ONA B;  1H8H A;  3HOU B;  5M5Y B;  1KMH A;  4KTA A;  3TP8 A;  2DNC A;  3T13 A;  4K8I A;  3ZPN A;  2F0O A;  1F2L A;  2EZV A;  4KI0 A;  5FKA C;  4XN0 A;  3BDL A;  2MPM A;  2K05 A;  4NP5 A;  4K8J A;  1RF2 D;  5FL7 A;  3SR1 A;  4L6T B;  4MIU A;  2F0P A;  1SNQ A;  1YNN D;  2JJ2 A;  3OEE A;  4A3K B;  2DY7 A;  4HTH A;  5AFW A;  1E2W A;  1GOZ A;  4WOR A;  1MAB A;  4XXE A;  3MTS A;  5C0X I;  4TSF A;  1S4Z A;  2RDG A;  1WTX A;  1ILQ A;  4OIK A;  1Q8I A;  1S5F D;  4ILW A;  5ELD A;  5HKK A;  3K5O A;  1WD0 A;  4FO2 A;  4K5V A;  1WTQ A;  2MUY A;  4JBW A;  1SJH D;  2AQ3 B;  2ICI A;  4NMZ A;  2ZZF A;  3OWF A;  4J8Q A;  2WSS A;  1HXY D;  4II2 A;  4IFD I;  3BC9 A;  1OHH A;  2MGS A;  3KK7 A;  1B1Z A;  4QIW B;  2KA7 A;  4HAE A;  2XZO A;  3C1F A;  3Q0A A;  2JXM B;  3OIQ A;  1ESF A;  1Q3L A;  3E6Z X;  1QCB D;  1UD8 A;  3R3O A;  2OXP A;  3VYT A;  1ILP A;  4DAY A;  5EQ0 A;  4ZUI A;  1RHP A;  4WFN 3;  1VF5 C;  4C56 C;  2R92 B;  3C3L A;  2EY6 A;  3JAM E;  4FF3 A;  3WQZ A;  4A3G B;  3H94 A;  4XT3 B;  1BCP D;  3BCD A;  1E1Q A;  4QUC A;  1WPC A;  5EGT A;  1A15 A;  3PUY A;  5C5L A;  2QKI C;  3M4O B;  1TII D;  1JWS D;  2BOS A;  5C6A A;  4G4K A;  1I18 A;  4LJZ C;  1CZW A;  3HOY B;  1IKM A;  4UAI A;  1ESR A;  1KDB A;  3J81 E;  4DK1 A;  1EU4 A;  5COY A;  4CKB A;  1KNA A;  1I4H A;  3NPP A;  3QJY A;  1JOR A;  3S2H B;  2WKD A;  3S15 B;  1LTS D;  3E0J A;  4A93 B;  4N9T A;  4DXG A;  4C3H B;  3TME A;  2A68 D;  3G7L A;  3KLS A;  4G57 A;  1J8I A;  4OIJ A;  2ENB A;  3HOW B;  4OL7 A;  5IOC A;  3QB3 A;  1SFO B;  1YNJ D;  2LZJ A;  3G05 A;  2F0S A;  1DCZ A;  4X3K A;  1LTI D;  3VR6 A;  2K5Q A;  3U9S A;  1W0J A;  1STY A;  2GJR A;  3GVL A;  1F2Z A;  1H9R A;  2RBM A;  5C4H A;  1H9S A;  3QG1 A;  2K01 A;  1BQQ T;  1B9M A;  4JK1 C;  2HUG A;  2JYO A;  1BR9 A;  1I6V C;  2O5I C;  5FO8 B;  5IGB A;  2QEJ C;  5JEA H;  1EY6 A;  2L11 A;  2YYZ A;  2F43 A;  1YNJ C;  1Z6H A;  5JVH 3;  4PMW A;  4ODG A;  2PZU A;  3O13 A;  3MXG A;  1R4P B;  2ZTG A;  4DGZ A;  2XWB B;  1PTO H;  3D3R A;  1KDA A;  2F03 A;  1Y8N B;  3DEO A;  1IW7 D;  5G3L D;  4F88 A;  1VJS A;  4RCO A;  2JP1 A;  2QE7 A;  2JA5 B;  4DAV A;  1LT3 D;  5I6W A;  5FLX L;  2CW0 D;  2RA4 A;  1KTK A;  3X3N A;  1EY0 A;  2EJF C;  4KHV A;  2W6I A;  1F9P A;  3WOF A;  1HUN A;  3BH4 A;  2VJJ A;  2WP8 J;  3NTI A;  2RVL A;  3NTK A;  3CMM A;  1STB A;  4KJO A;  4G7H C;  2A5H A;  4C1N I;  5J1Z A;  2X69 A;  3MVV A;  1C8C A;  3PV0 A;  3FKS A;  4KY7 A;  1BO0 A;  1ZKO A;  2Z1C A;  3TP7 A;  2PPB C;  4IAL A;  3HRZ C;  1UD6 A;  2F0Q A;  1PRT D;  2CW0 C;  1I4Q A;  4A3M B;  1HA5 A;  1TKW B;  1V0F A;  2B2Y C;  4FYD A;  1OXT A;  3S1R B;  1E79 A;  4IFD G;  3A55 A;  1DD2 A;  3FRP B;  2NBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...