3T53B

Crystal structures of the extrusion state of the cusba adaptor-transporter complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t53B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t53B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t53B01
1QJOA 4L8JA 3M4YA 1DXMA 2A68C 4TKOB 1O7LA 1OXVA 1VF5C 1H9SA 2AUJD 2B8GA 2E75C 1GUSA 1B9MA 1FR3A 1B9NA 1Q90A 2JEBI 4KKTA 3CRLC 4RCNA 4IFDG 5C0XH 4XIGS 3FPPA 1Z6HA 3U9SA 4OO1G 3PV0A 5JEAH 2O5IC 2E74C 3BDOA 4KMUC 3HGBA 4H0LC 2AUKA 1I6VC 2R6GA 1T5EA 3T51B 4KI0A 3PUWA 3OOCA 1Y8OB 2A6HD 3A8IE 2IT1A 2L5TA 1OXXK 2JXMB 2D5DA 3WDNA 1Q1EA 2NN6H 1H9KA 2BE5C 3DXJC 3OPOA 3FMCA 1Q12A 3NE5B 1VDZA 1Y8PB 1O78A 2Q8IB 1E2ZA 3A7AB 3VR5A 2LMCB 1IYUA 1IW7D 3M7NA 1TU2B 1GUGA 4KN4C 3LWUA 4IQZA 3I4LA 4G7OC 2A69D 3A8KE 5KNDA 3M85A 3I73A 3QJYA 2KA7A 1CI3M 1EWHA 3GD7A 2O5JC 1OXSC 3PUXA 2A68D 2K7VA 2E76C 4JK1C 1GHJA 4DNRB 1YNJC 2EJGC 2A6EC 2EVBA 2KCCA 3AB9A 3PUYA 5K36G 2JE6I 2BA0A 3PUVA 1V43A 3MFYA 1OXTA 2F1MA 3VR2A 3I72A 1Y69U 1GHKA 3A7LA 3BG3A 3QG1A 3VA7A 3KLRA 4BA1I 1DD2A 2CW0C 4TQUS 1GUNA 2EJMA 1GUOA 2QF7A 1GJXA 1K8MA 1HCZA 2DNCA 2V4DA 3EQLC 3P20A 2BA1A 4KHZA 4KKUA 4XTCS 1LABA 2D62A 3SDZA 5BN5A 2BE5D 1CTMA 4G7ZC 3ND9A 3L7ZC 3ND8A 2NN6G 3T53B 1ZKOA 2BDOA 4BA2I 4KKSA 1VF7A 1LACA 5KNCA 2PPBC 4G7HC 4GZYC 5K36H 1Q1BA 1HQMC 1VCIA 3TZUA 1IYVA 5KNBA 2DN8A 2JEAI 1OXUA 4OGQC 4PV1C 4DK1A 1E2WA 4IFDH 2NN6I 4HR7B 1A6XA 5C0XG 3IKJA 2PNRC 1SMYC 2YYZA 1Z7TA 2K33A 3W3AA 5BN3A 2A6ED 2D2CC 1H9RA 3IFTA 4I7ZC 4OO1H 1K8OA 4JBWA 5JEAG 3QIAA 1GUTA 3MXUA 4H13C 4DNTB 4LK1C 1HTPA 5BN4A 1TKWB 1PMRA 4H44C 1HPCA 1H9MA 2A6HC 2B8FA 3PUZA 1DCZA 3RLFA 3A8JE 1H9JA 1V8QA 4KN7C 3VR3A 2EDGA 1YNNC 3N6RA 3SE0A 3LNNA 1E2VA 2AWOA 1ONLA 3T56B 2DNEA 3VR6A 1ZYRC 1CFMA 1FYCA 4DK0A 3OW7A 3D31A 2EJFC 3VR4A 1G291 3D4RA 1IW7C 3H94A 2ZT9C 2K32A 5A35A 3CRKC 1BDOA 2A69C 2PCFB 3GQBA 4LJZC 1H9SB 1Y8NB
chains in the Genus database with same CATH superfamily
3QB3A 1L1OC 4XIGS 3V05A 5TRDA 2JA5B 1MGSA 4FYDA 1FNMA 3I4NB 2BH8A 1JORA 2WFWA 4C0SA 1YHBA 5M5WH 4DV0Q 3PIP3 2QDXA 3MEFA 4KMUC 4P75A 4R4CA 4H0LC 4DKAC 4ULLA 1GVHA 4KI0A 4K8IA 1KTVA 1XPUA 4X7CA 1Y1WH 1X6OA 1R9TB 4OPVA 2NYZD 3D0FA 4GKJL 2PZUA 4DV6L 2WP8J 1QG7A 1D2BA 1LLRD 2Q2TA 1I3QB 4Z4RA 3CMAB 1WCMG 1VQNB 1O78A 4YWMA 1TR5A 2YTYA 3I55A 1LTRD 2VNUD 3P26A 4IQZA 2RHQB 3GTPH 3AU7A 2QEJC 4PGOA 3U9OA 1WPCA 2KCNA 1SYEA 2KQ3A 1PZID 2K5DA 1FNUA 1EFRA 5FNZA 2L15A 4RPDA 3C2QA 1YVCA 4XOPA 2ZJQA 5M5WB 1W0KA 4M4SA 3PO2H 3Q6RA 2QF7A 3D3RA 1WOPA 2OTJB 1G2TA 3OE7A 1Y1VG 1JWSD 1V1QA 1B3QA 5IYDG 1U4RA 1I4GA 1UE6A 5IGDA 3CCMA 1TVCA 5JAVA 2B2WA 1RF2D 2ALYB 3D6WA 1NTGA 1AH9A 2BGJA 1QZHA 2HCJB 1N33L 1U9RA 2VNJA 4IUQA 1VCIA 3SR1A 5FIUA 1IYVA 3FKIH 1GUWA 1WTOA 1ZEQX 3UDXA 3C46A 4PV1C 3GTPB 1UE7A 3KBXA 4O0AA 1A6XA 2KBNA 3S17H 4JV5Q 1WI5A 1QUQB 1PV4A 1SE8A 1M1KC 3MEHA 3T1YQ 1EFCA 1Q81C 1HA3A 4IUPA 4XD7A 5KYLA 2YU9H 3K5NA 4B3TQ 2SOBA 4DN4M 1Y14B 3CC2B 1PMRA 2EIXA 3HKZG 5LL6X 2KUMA 4JI6L 3PO2B 1QZGA 2ZL5A 1YNNC 1EFUA 3GVKA 4QQBX 4Q0FA 1WTXA 3QSYA 1F9PA 4F7DA 2AHOB 1MJCA 1IBMQ 3PA1A 1JOKA 2HDMA 1F9QA 4F87A 5EPKA 3R6KA 5HZAA 1X65A 2ZM6L 1K3RA 3FKIB 2A68C 1VF5C 4IO9A 1Q82C 2JEBI 1PH6A 2XZOA 1WD1A 1SYCA 4QHYA 4X66Q 3R8BA 3GTQB 3S17B 1V1OA 1TY0A 2E74C 2UUAL 3MVVA 1KDAA 3ZUGA 4QVJA 4DNIA 2JK8A 2DERA 2HT1A 1XNQQ 4QVAA 1VQBA 4GQNA 2VQEL 5LMNQ 1Y8OB 4C3IB 2N3SA 2YU9B 4JG2A 2KHJA 1UEBA 4A3CG 1M90C 4OELB 5F4OA 4R71A 2D5DA 5CORA 1TT2A 3HKZE 2MFIA 4X3UA 2AQ1B 4TMTA 3OPOA 3HOXB 2O4XA 4LAAA 3CXCA 3J81E 1HZBA 1BQQT 3ONAB 3VR5A 2HIXA 4XYOA 2J7ZA 1GUGA 2R7DA 1VQKB 5HZBA 4KN4C 2OYNA 3M85A 2AMCB 2GREA 1E63A 3GSIA 1HHVA 3Q24A 2A6EC 4XOTA 1QVFA 2WINB 2D74A 2B2VC 2WB1E 1X3GA 3VR2A 2G9DA 4WJWA 3J7A5 5EGTA 3HOYH 2ZL7A 5IYNA 3R6JA 2F43A 3PMFA 3CMEB 1D2EA 3BU2A 3OEHA 1JCKB 5KIXA 2B2UC 3GTOH 4NMZA 1F20A 2ZTNA 3EJIA 3NENA 3BQJA 1VQ7A 2R7FA 2Z8LA 4BA2I 3W5OA 2PPBC 1TS2A 1YIJB 4GZYC 1Q1BA 4IUVA 5F4JA 4ZV4A 1II3A 4M53A 1SBBB 1SEBD 1QVGB 2X6YA 1TWHB 2N78A 4IFDH 1BUVT 2KECA 3B82A 4XQQA 2QDLA 3SGIA 1K8OA 3U58A 1U4MA 1VQ9A 4B3RL 3OAAA 3GVJA 1DJRD 2NVYH 4B4DA 2OQKA 4UAJA 3NBHA 4NCNA 4XN3A 3EVQA 2NZOA 4PZ7A 3HOYB 1DCZA 4DV7Q 1YX2A 1ZM2A 1E22A 1H9JA 4FK8A 3G4SB 2K75A 4CDCC 2ZXOA 3K80C 5E1FA 5IYCH 4PC6A 3MA2B 1LM0A 3N6RA 3GTOB 2DUDA 3LNNA 1JWMD 4M1KA 3VMFA 1FNWA 4JMQA 3BVMA 4EQNA 1RTOA 4DXFA 4XL9A 4FO2A 5DM73 4LF8L 3GTJB 1C7YA 2PCFB 2UU9Q 4L8JA 2F4NA 1SMYD 2B8GA 2XNDA 1N36Q 2PMZB 1B9NA 1PFSA 3PIO3 3KOJA 1VQ5A 2B7BA 3P7JA 1TS4A 2DCUA 2CWAA 4LFBQ 4BBRG 1NAPA 3RZDB 1EEID 1S5ED 5GAGC 2NVYB 4DAYB 3STBD 2CC2A 1I6VC 4RFBA 2XGJA 4HMIA 4Y7NB 3K8AA 2C5HA 3CPXA 4A3GG 1K8AD 2IT1A 5GADC 2I0QA 2KHIA 3PUMA 5DAUA 2JXMB 1PRTF 2WYRA 2LSSA 1EL0A 1R4QB 4ZUJA 3JAMc 3QOJA 4G7WA 2Q8IB 3A7AB 1IW7D 2F4IA 3ONYA 4TSSA 3JAML 1CK1A 4B44A 3PF4A 3A8KE 2KEEA 1WTHA 2LKVA 4HJAA 2RDGA 4LNQA 2NPFA 1DYQA 3BY2A 2ZBVA 4C2MH 2KCCA 2E2IH 1PRTB 1GAQA 2X6WA 4K6LA 1A2TA 2B39A 1PFBA 3I90A 1BKBA 2VNIA 2HQEA 1TIID 3D8GA 3BCFA 2CBXA 3PVDA 3SLDA 4DQLA 1Q8KA 3EQLC 2CW0D 1DG1G 2BDNA 4G6IA 5M5XH 1RODA 3A55A 5A2QL 4IW3B 1ET9A 1X3QA 1B4OA 3WOFA 3HOWH 5E6TA 4FF3A 3CRZA 2H4OA 3A74A 5HGQA 4JI5L 4XLCA 1HXYD 1U4PA 1HR0L 4GKJQ 1KMHA 2V7WA 4OOXA 4DV6Q 1SNCA 3CCQB 1QCBD 3A56A 3BS1A 1EIYB 2JA6B 1W0JA 3C2PA 2X85A 4A3IG 4JBMA 2NN6I 1I4XA 5IIFA 4YWKA 3KL9A 2KEDA 3U2QA 1HH2P 2ZXHA 4C2MB 3G71B 1IJFA 3PIPA 4P6YA 1B44D 1HTPA 2LZJA 2JJQA 1SKYB 3E6ZX 1FVIA 2F0EA 5F2DA 4PC7A 1YJNB 4B9XA 2A6HC 3OIQA 3MTSA 2ZXRA 5EBCA 3J7ZC 2BPOA 2SDFA 3KF8A 5G3LD 4A3KG 3L0OA 4UP9A 1W35A 1KD1C 4ACAA 3EBEA 5M5XB 2GPJA 3OW2A 1CFMA 5C44B 3HOWB 3G6EA 1KL9A 3D6CA 1U5KA 2A1AA 4Z9CB 5FO7B 2JA9A 2BN4A 1VS0A 1EYDA 1K0SA 5KNCA 1D8TA 1N33Q 3KJOA 5IWAL 2JA5G 2ZXIA 3I4NG 2N55A 2F0FA 4OO1G 5JEAH 2VUMH 2V7UA 3BDOA 3GV6A 3KLSA 4RAUC 1MSHA 2BMWA 4A3LG 4K5XA 3Q39A 4G1VA 2EXDA 2EE1A 4N3NA 3CCVA 3TS2A 1H42A 2AQ2B 2I5MX 3BNWA 2VS1A 4BY1B 3JC66 1CSQA 1IXRA 4A75A 5IYBG 2GJPA 3K0XA 2QEXA 4JI6Q 2B7CA 2ZITA 4P74A 1STBA 1D7QA 4PC1A 4L6TB 3VYTA 3JAMi 4AF7A 1GR1A 3QWNA 2F52A 1QE6A 4OXPA 5M9OA 3P27A 3Q0AA 4ALPA 3GTGH 1F2LA 1T5XD 4K8JA 3OZVA 4G1BA 4JOIC 4RWSC 4RD2A 3NTIA 3T16A 1FNBA 5J39A 3S2HH 2SNSA 1HZAA 3KDFB 4DV3L 4TMZA 4XONA 3MFGA 5JJLA 4P3YA 1DDIA 2ZM6Q 1CZWA 3E3XA 1YZ6A 2VUMB 2GQFA 2Y0SB 4DV4L 1VQJA 4QV2A 4CDDC 2OBRA 3HOVH 2X6GA 1O7IA 5EMNA 3IFDA 4YCVA 1C4QA 3NEMA 2DEUA 4DR4L 3BY1A 5THXA 1DOLA 2RBMA 1DGSA 1U4LA 2XNAC 1ZKOA 3T1YL 1FDRA 2FJ2A 2C2WA 3QFTA 2KCTA 1JB9A 1ZM4A 4MIUA 2V7TA 3R93A 2RHSB 3GTGB 1QGZA 2K33A 1ASZA 2D9RA 2NVXH 1CKNA 1GUTA 3CESA 2KCMA 5K5PA 4NNJA 4LF7L 3H3VH 4IZ8A 4K14A 2VBUA 2ZZGA 5H1SE 4RGMA 2O2LD 1LTID 4XR6A 5AFWA 3KF6B 3FVQA 1XQBA 3CCLB 2R93H 1VQCA 2BOSA 1EP3B 3U6KA 1CHPD 1L0YB 2PNHA 2YTVA 3TZDA 3PO2G 2K03A 3HOVB 1N06A 4B3MQ 5JJIA 1PFMA 2R7ZH 1ZYRC 3DWQA 3OMGA 5KEEA 3D31A 4V0BA 3D4RA 1ILQA 2RA4A 1U0LA 4EX5A 2K28A 3J80c 4IPDA 4RJLA 4P72A 4YAOA 4R4OA 3RD4A 1AFPA 5LMNL 2R9VA 5DLQE 5IT9E 4P26A 1AE3A 3FKIG 4HEDA 3J80L 4RDJA 4DXGA 3CRLC 1EXMA 3CCJB 4X06A 3CD6A 1M1KD 2NVXB 1TWAB 2F0JA 1Q81D 2EY1A 1K8AC 1KXLA 5CBAE 5LMUL 1E1QA 1PJ5A 3RR5A 4DK6C 4B3RQ 4C3IG 1MKHA 1Q7YD 2NVTB 3A3GA 4OWXB 1OXXK 4IOCA 4RD6A 2ZBUA 2R93B 4Z4WA 1VQMA 3CHBD 4WZLA 2PQEA 1R5OA 4P9SA 3U50C 3HOXG 2WKCA 1W2BB 3TRZA 4KY6A 3E5SA 1OB5A 4ZKBB 2VJIA 2R7ZB 1NE3A 1LTTD 1TUIA 2Q6KA 4KLKA 4EH1A 3CC7B 3K6OA 2ZJPA 1EWHA 3I56B 1OXSC 2A68D 1X3EA 3NWSA 2NV4A 1X32A 4NDXA 4RH6A 4F7XA 1JB7A 4LF8Q 2CCZA 4IUNA 4G57A 3ASRA 1I50H 1W3SA 2LS01 2I5LX 3WXMA 3CCUA 3I72A 1GVPA 1TWFH 4J1MA 2P3MA 2DIEA 3H9NA 2CW0C 2HMAA 1AN8A 1HFGA 2F3VA 3A8JA 4QUZA 4XQFA 1JR0D 3TP5A 5C0XJ 2IY5B 2HIVA 2QA4A 1M90D 1GKHA 2NTSA 1WTQA 4FVMA 3I7FA 1CM9A 5M3MH 2Q6LA 3RUZA 4DQKA 3SXHA 5IODA 1Z9FA 4N9PA 5ELOA 3CCRB 3JQPA 3CC4B 2F0HA 1Y0RA 1JWUD 4HIDA 5HGTA 1PH1A 1QWYA 1I6HB 2GK6A 1MHWC 1GAWA 1EY8A 1SE2A 2DN8A 3UE1A 2GJKA 3MAQA 1B2TA 4TMWA 3PIOA 1K3BC 1A8VA 2A6ED 1PDQA 1SNOA 4NP5A 4JYAL 2I07B 1PJ7A 1NDHA 3QIAA 4BXXG 4P1VA 1EYAA 1I50B 3EFXD 1G51A 3K5MA 4RM0A 3VNVA 4YAFA 3DDYA 2FVGA 1ENCA 1ELOA 2L12A 4XM3A 3CPWA 1STYA 3HOYG 4CHTB 3TSSA 1B1ZA 2JA8H 4YXWA 1V1PA 5F4MA 1QVCA 4KN7C 1IBLQ 1A63A 3ZJYC 4ZYSA 1UD2A 4QUCA 1N08A 1BCPF 2QE7A 1WSRA 1EIHA 4X3KA 1JJ2A 4LWCA 5M3MB 5CV5A 4IURA 4II2A 4PAAA 5IGGA 1UD5A 1K83H 4JI3L 3Q23A 1EOTA 3GQBA 4X07A 2NUCA 3QR8A 3I8ZA 4JI5Q 4II3A 1HR0Q 2VZLA 5BN3A 3J80i 1H9SA 5IGFA 4A3JB 4GS3A 1CA5A 1SLJA 4IFDG 5FO8B 1KNAA 3ZPNA 2KJXA 1BMFA 1YI2B 4GOPA 2O5IC 1G2SA 4AYBB 4QGUA 3TS0A 2JDIA 3M3YH 1EWYA 1T5EA 4A3KB 4P6VF 5CV9A 3ES9A 1PRTC 1VMCA 4NXNL 3EIVA 1PH4A 3GV3A 4RMFA 4DV5L 2K05A 2Z6BD 1EQRA 5ELEA 3URYA 5ELDA 2A19A 3HEJA 3O13A 2JA8B 2BE5C 5CV6A 1HTLD 4DUZL 3NE5B 2K1BA 2ZJRA 5IYCG 4B3GA 1IYUA 2HD3A 1TTTA 2Q8TA 2JN9A 1L1OA 5IP7H 3M7NA 4HJ5A 4K2LA 1WTVA 2K5NA 4OEMB 3G05A 1EY4A 4XT1B 3X3MA 1K83B 5M5YH 2KA7A 2NZ1D 4KK7A 3C1EA 1N0VC 4I7AA 1RIPA 3TEHB 1HZEA 3AVVA 3NPPA 3M4OH 4OOVA 2B2YA 3AEVA 1STEA 1KK2A 2PZWA 4JI7L 3MFYA 5DS0A 4MN3A 4IJHA 4OOSA 1VQ8B 1RQRA 3DUZA 2PMZE 3KLRA 5M3FH 1J9OA 5IWAQ 2HQLA 2BH2A 1KTKA 5FL7A 3CCEB 2EJMA 3SEBA 2K5QA 4XLAA 4BY7B 2VBSA 1E43A 3RY8A 4FF4A 3H3VI 3M3YB 3F2UA 5C4XH 4OONA 5FA6A 3NP8A 3ULLA 4XTCS 3BZCA 1VQLB 1IKLA 1O80A 4IN3A 3FDTA 1N34L 3ISXA 4XLHA 3ASQA 2HCIA 2WJVA 1VQPB 4EQOA 4CQJA 4R1JA 2A5HA 4WJ3M 2XIWA 1PZKD 3TMEA 3Q38A 2A74C 1YJ9B 4DV2L 3I4MH 2X69A 4ZRZA 3G6EB 4WORA 2JA6G 1VQ6A 1WOOA 2W6JA 1UD3A 4C43A 2EYOA 5EPLA 2KENA 5M5YB 5C0XG 5LHY1 2PNRC 4PG3A 1T6XA 1H9RA 4GNXB 3AVXA 2I5HA 3FP9A 4QL5A 4KTAA 2F0NA 4RDKA 1WORA 2JA7H 4OHJA 2PQAA 2JJ1A 4LK1C 2IW3A 4AF6A 1IYJB 1N0UA 3A5ZB 4DR2L 1WD0A 4POFA 4LF6Q 2GK7A 1Y1WB 2BV3A 4DV3Q 1STHA 5EBDA 5M3FB 2ID0A 3CU7A 3KYHC 3KEWA 1S72A 2L55A 1OHHA 2EYFA 2EOTA 5JPNC 3S9WA 4DV4Q 5C4XB 3NBIA 3OWFA 3GTLH 3T56B 1HUMA 5EAYA 4E6IA 1I18A 1GO3E 5C44G 3CB4A 2EJFC 4AQYQ 3PF5A 1E1RA 2R92H 3HOWG 1V9PA 4CKEA 3WBKA 2JJ2A 2PI2A 2DOGA 4DR4Q 4RD3A 1YEZA 2VQFL 4GN5A 4LJZC 2BVNA 1VQOA 2KHSA 5CYUA 2OTLA 3I4MB 4WZTA 2XRQD 5DNFA 2Q6OA 4NBSA 4QJFA 1BNZA 3S14H 3NQTA 1UAPA 2V31A 1IL2A 4A93H 1SM4A 1PHJA 5FLXE 1D1KA 3A54A 2RC5A 3HG9A 1TLLA 4HIKA 3HP3A 1DZ1A 1WFQA 3WYAA 1Q7YC 2EYJA 3A5UA 1Q8IA 1ZM9A 1O7ZA 4X7DA 2A6HD 3SJPA 3AVYA 2NBFA 3RZOH 4LF7Q 1H95A 1TS3A 3PA2A 1Q1EA 2NN6H 4BY1G 4G5GA 1KQSB 4YELA 1KD1D 3HRZC 1X55A 2UXCL 1NNXA 4A76A 1ILPA 4TVAB 3GTLB 5C3EH 2WV6D 4Y9UA 4DUYQ 2QKIC 2F3WA 4Z4SA 4FNFA 5HKKA 1UNSA 1ZM3A 4XLFA 3V2TA 1E0BA 1AZPA 1BR9A 1A3UA 2E8GA 5FO1A 2JE6I 5IGBA 1CSPA 1PH5A 1SR3A 1QFZA 1U2RA 5FK9C 3S14B 4HE6A 3Q22A 3QG1A 4A93B 3OFNA 5JPMC 1DD2A 2V7QA 4UAIA 1N8RC 3S15H 2VUMG 1GXDC 2Y0SG 2Q2UA 3JQQA 3S2DH 1NMFA 4ZCMA 4C3HH 1QUFA 2F4VL 1Q9SA 3P1HA 1OO9B 2ZZFA 2JYOA 3RMHA 2F0WA 3EN2A 3KK7A 2DY1A 1ESFA 1MIUA 5LMUQ 4M1UB 3Q6QA 3S16H 1VQ4A 3OTOL 2PI2E 3C1FA 1E3PA 3HKSA 4X64Q 3AYHB 1EY6A 1HRJA 1CA6A 1TS5A 1VQIA 1DOKA 2ZZQA 1KAAA 2B2VA 3BZKA 4B08A 1YITA 4AIMA 1KHIA 1HNWL 3AGPA 3GTKH 3J81j 2Z9HA 4B3ML 4B3XA 4TMVA 4QY7A 1A8PA 3T4AC 1K28D 4MTNA 2DJGC 1YHQA 1LTBD 1LUZA 4ME3A 2B2UA 4UDUC 1Q86C 4IFDJ 2BCOA 3SKBA 1JICA 3TP6A 1A2UA 2EIFA 3FPUB 1H9MA 3S15B 1LTGD 3ZBTA 3S2DB 4C3HB 1XMQL 2Y0SE 3GIRA 1AEXA 2SEBD 3MXGA 3HOVG 1ML0D 4DAVA 3QFSA 2Z4IA 4RGNA 4X6AH 2B2TA 2RSOA 1H85A 4N9TA 4F88A 3CQZH 1HA6A 2DY7A 3MXNB 2D3NA 3A8KA 1STGA 2WR8A 1PXUA 2CH4A 3VA5A 1MBYA 2P5ZX 3BC9A 1ET6A 2A69C 4LF5L 3D26A 1NMGA 1QJOA 2ENBA 2E75C 4O42A 1JMCA 4HIOA 3MC0B 3MWYW 3SJZA 4B43A 1YJWA 2L11A 2CH4W 1MSGA 4LW1A 4ME5A 2VZAA 4N8X1 1K9MC 3GTKB 1AMOA 1PH8A 3U6BA 4N8FA 2D9UA 2Z6BA 4JYAQ 1SNPA 1EP1B 2EY2A 4KY7A 5EKIA 2QTZA 2OQ0A 1NBMA 3K81C 4QIWB 3A8IE 1RTNA 2Q2IA 4F8MA 1EEFD 2R93G 4DR6L 4P73A 1EQQA 1VDZA 2FINB 1ZYRD 1PH3A 5JVH3 1K73C 3V7AA 1G91A 4A3EH 2R7ZG 1SKQA 3CQZB 3LWUA 2A73B 2PW7A 1X9NA 5G3LF 3AVWA 1W6KA 5C4JH 1CUKA 1LT4D 2K7VA 5I4DA 5GV8A 5LL6S 1GHJA 3PUYA 4JI3Q 5D3IB 3F2BA 1VJSA 4WRDA 2BA0A 4R4QA 4Z4UA 4G4KA 2VW9A 1JA0A 4A3FH 4RHSA 1QUEA 1RHPA 3CP8A 3J7AV 4R8NA 3CMMA 4DR7Q 4YHHL 1S3OA 3K5LA 2K5HA 2QCPX 1K8MA 1PLFA 5TSSA 3OP1A 2V4DA 1S5FD 3CPWB 1UE1A 1HFNA 4RD0A 3S1NH 4KKUA 5IYQA 2F0GA 1CTMA 4NXNQ 4AH6A 5KRUA 2YWHA 1WOSA 4Z4YA 2B3GA 4DV5Q 3WNBA 1F9RA 2A8VA 5KNLA 1PJ6A 2RC6A 4RA8A 5LMZA 4JI2L 2OEOA 2F0MA 1D1IA 1WOCA 1PYBA 4DUZQ 4A3EB 2JEAI 2RDHA 4DK1A 2JIZA 1E2WA 1HA5A 1SYDA 1TWGH 4ZCIA 1CKOA 2D0OA 2FHTA 1NR2A 2XVSA 4I7ZC 5C4JB 1IBLL 2I46A 1YLOA 3W2FA 5I6YA 1SN8A 1KDBA 4A3FB 3AQQA 4ZKCB 3Q8DA 3NSWA 2F0IA 3KLSX 4JI7Q 4APVA 2RDFA 4ZQ3A 2MUYA 3TN2A 1BF4A 1KK1A 1PYSB 1I4QA 5IYDH 3WNCA 3DLLA 1NJIC 5IK2A 4LC0A 3I70A 5M3MG 2NZHA 3OJXA 4J0QA 4JW0A 2ZT9C 4A4IA 1WTPA 1N34Q 2HCCA 4YY3L 1RD9D 1Y8NB 2F0DA 2E2IB 3S1QH 1LT6D 2AUJD 2MHVA 3QO2A 4DV2Q 4NPSA 4A3JG 2UUBL 1PZJD 1TWGB 3QE2A 3RLOA 3U9SA 4CBVA 2GN5A 4LBYA 1LTLA 1W34A 2JSOA 2V7VA 4EGVA 3B6YA 5DM63 4OPOA 1EY0A 4AYBG 1F9SA 1NB9A 3TDQA 2HDLA 4EQPA 4MYTA 3T51B 2Z0SA 2CK3A 1VHOA 5IYRA 1E1TA 3NHHA 2G9HD 3SK8A 1EYCA 4JPBW 4DR2Q 1V0FA 3F8TA 4JC0A 2JA8G 1H9KA 4K5VA 4KJNA 2OT2A 3I55B 3M4QA 1EIGA 1E2ZA 4JCVE 3CMAA 5IYWA 1IB0A 2MO0A 2TSSA 4Y52H 4FXGC 4KV6A 1HNZL 2E2JH 2UUCQ 1VQNA 2Q6IA 3L9AX 4H02A 2O5JC 2RVLA 1DARA 2RF4A 2CQAA 4C1NK 5EKKA 2C4UA 2GVAA 2ZTCA 4OIJA 1DONA 1L0XB 4IUUA 1FJGL 3S1QB 1RDPD 3OHXC 2VQFQ 2ASBA 3ZYYX 1I5FA 1Y69U 2XGTA 2XN9C 1CQXA 4HE5A 2RKSA 3TREA 1P16A 2B29A 4ROXA 4K5WA 3S24A 1GUNA 1UD6A 3VDYA 4XXEA 1PRTD 1CNFA 1LO5D 4JBJA 4GNXC 4BY7G 4A3DH 4BPRA 2F0PA 3CCMB 2Q8RE 5ELBA 2OTJA 1TXYA 3KBGA 1SAPA 5ELNA 2BE5D 3KFUA 4GLAC 3L3OC 3W2IA 3ND9A 5J22A 4Q7JB 1HR0W 5GAEC 1NR4A 5E7NA 1FGBD 4JOIA 4LF6L 1EWIA 3UI2A 2UXCQ 3QOLA 2V1CC 1JC7A 2MJ8A 1BBUA 4K2KA 4O1NA 1K28A 2JQOA 1Z47A 1Z7TA 1B7YB 3PQIA 3IFTA 1KK3A 3KUPA 3CW2C 3LGJA 1FX0A 3R2IA 3IL8A 2WB1B 4X62Q 1H8EA 1TWCH 3MXUA 1J5EQ 1QUQA 1CKMA 1HVXA 5B6IA 5BSYA 2AWNA 2WAQB 2QW7A 2ZTDA 4AQYL 2VB3X 1Y1WG 3G7LA 5M3FG 5GV7A 3SVMA 3JAME 4A3BH 3CC2A 4A3DB 5IE8A 3ER0A 3VR3A 1QX4A 2B5OA 1KDCA 4RKBA 4LFAL 2PIAA 3NTHA 1PTOH 5C4XG 1E2VA 4LUZA 2F4VQ 4N3GA 4Y7CA 4R4TA 1WYDA 4AC9A 1FD7D 2BGIA 3OZWA 3HOUH 2AHOA 1RL2A 1EFTA 3OTOQ 3S2HB 3FMCA 2D3LA 3I4MG 2MQHA 2JP1A 4IALA 3SLNA 5ELCA 2OCEA 2I1LA 1Z6HA 3K5OA 1PTOF 2F0TA 5A2QE 1DM0B 3PCOB 3H0GH 1T9HA 3B8HA 1HNWQ 2GA4B 3JQRA 3BCDA 4DUYL 2F3IA 4ASUA 1EU3A 4UZUA 1LTAD 3Q6SA 2NWGA 4JI0Q 4A3BB 2BM0A 3CXCB 3BYYB 3MHBA 2QGQA 3LO8A 4FP5D 2N88A 3E0JA 4FXUA 4EQ5A 1EY7A 1SNMA 5E3FA 3T13A 1R5BA 3HFZB 5C6AA 1XMQQ 2XEXA 2WJYA 2HLDA 4IOAA 1W9XA 2FXQA 1V5VA 2CKZB 4G7OC 3I3CA 1VQKA 1NCVA 2B63H 2DY8A 3HOUB 4PNYA 1QVFB 1YNJC 4DNRB 3VNUA 2EVBA 3AB9A 1KRTA 3PUVA 1HNXQ 4LF5Q 4OIKA 4OX9L 2IHFA 3D4DA 4UPAA 4B3FX 2PO4A 1P8LA 2QMUA 4U9UA 2R61A 3BDCA 4A93G 4BBRH 3D4WA 5L37A 4X64L 5T1GA 2X6LA 2ZTGA 1Q3LA 3H0GB 1A3VA 4LBVA 1OB2A 1HCZA 3CMEA 2N49A 3CP2A 1IHZA 3P20A 2XRSD 4A3GH 1VQ7B 1EQVA 1VQAA 1XXGA 1FRQA 4QF4A 2K50A 2NN6G 4DR3L 2EYMA 2BDOA 1ICWA 1UD8A 4FF2A 4DR6Q 1I94Q 1HQMC 1BBWA 4MZ9A 4HJ7A 4V190 1YIJA 3E1YE 4M2LA 1OXUA 5CC4A 5CDFA 3B78A 3PENA 3BYTB 3IKJA 1XPRA 1QVGA 1VQ9B 3VYRA 1TQOA 2B63B 5JOBA 4JBWA 4XORA 3PGZA 1K8GA 3NBHB 3K57A 4ZUIA 3KJPA 1A0IA 5DN6A 5E4WC 4LF4L 1N8RD 3ASSA 4K1XA 3HAGA 4RCYA 1NB0A 3A0JA 2E1BA 4H44C 1HPCA 4LMQD 3PUZA 1S5BD 2X53S 3ASPA 4LFCL 2C78A 3OMCA 2EDGA 4C3HG 4YHHQ 3NQIA 4BBSH 3G4SA 3VO2A 5IP9H 1SXTA 2LY7A 2CF4A 1NRKA 2HDNB 1UUPA 1VQHA 3CRKC 3OYYA 4FDBA 5LMNW 2E2DC 1O7LA 1VQ5B 2MP1A 4JI2Q 5C4ZA 3OSOA 1FR3A 4Z4TA 4XKWA 1EOVA 1TWFB 1WVLA 2G5DA 2CW5A 1E3ZA 4DR1L 2M00A 1Q86D 2UXBL 1G6PA 3CPFA 5IGEA 2Z6KC 1WJJA 1FRNA 4DAYA 1FGUA 2UXDL 3SHLA 2L5TA 4DV1L 4M0LA 4RKLA 3CAMA 4R8IA 2F0KA 3WDNA 1BJKA 1JJCB 1G7TA 1Q12A 4A3MH 1A15A 4BBSB 4YAUA 3HOZH 4XN0A 5FKAC 4C3JH 4TT3A 1N32L 1J6QA 4DR7L 2A69D 3UDFA 4B3SL 3I73A 1BCPB 1A3TA 1CI3M 4DA2A 4ID6A 1CZGA 1D5ZC 2L4NA 3VYUA 3CP0A 2EJGC 4Z4VA 3IAYA 4YY3Q 2XOKA 3U4ZA 2JA5H 1UWVA 4KJOA 3T1HL 1K9MD 4RCOA 5EJWA 3I4NH 4ACBA 1LYLA 5IGCA 2IPKD 1D5MC 2UUBQ 1F2YA 4LF9L 5A88A 1SMXA 5J35A 1BPLA 1TVXA 5EKLA 1D5XC 1GJXA 2DNCA 2WACA 4QFMA 5JEAJ 2K14A 3DM3A 3W2GA 4YCWA 1BXTA 4KHZA 5D14A 2XTIA 5BN5A 1R9TH 1WSVA 5T1IA 4QIWE 3J80E 2GVBA 3KLWA 2W6IA 4PMCA 1KIXA 1K73D 4A3MB 4FXKC 2VL6A 1D1NA 1NUCA 3FJOA 5JBQA 3HOZB 5K36H 4X0CA 4C3JB 1E79A 3P75A 4CDEC 3CCQA 2R6HA 3J81c 1OGJA 4A3EG 5DSZA 4OGQC 4LBZA 5FLMH 3K0YA 3MZ5A 1HNZQ 3NUCA 3W3AA 1HUNA 4X05A 3VO1A 3J81L 2KOLA 4AVZA 1HQRD 2IX3A 4FF1A 3SK6A 1WU8A 4H13C 4X8IA 3G71A 3MXPA 1Q46A 4RD4A 2TMPA 4A3FG 1FJGQ 1KK0A 1COWA 5A8AA 4KD4A 5E4XA 3AMUA 3KF8B 2YWGA 1V8QA 2B2YC 1YJNA 3FEWX 2LXJA 1C48A 4XDXA 1B3AA 1D8LA 3OW2B 4M8AA 2AWOA 1ONLA 3NELA 1XMOL 1B2RA 3MHPA 3FPKA 4QB4A 3W2EA 1VQGA 3DWPA 1KRHA 5CMDA 4PC2A 3M4OB 3PUNA 4TKOB 1OXVA 1GJRA 5I2XA 5I9PA 2EXZA 3W2DA 1BO0A 3A1PA 2E5LL 4I65A 2K6AA 3CF5A 3AVTA 3UDIA 5GROA 2CWPA 2N8NA 1IJEA 1WTHD 3OEEA 2J0TD 1KC8C 2R6GA 1CHQD 5EQ0A 2UUCL 4Y9RA 4IPGA 3CCVB 1BCPD 4YCUA 4NW2A 4HSVA 1F60A 3FHWA 4O2DA 2WZNA 1QFYA 1VLOA 1C9OA 2QEXB 1NJID 4DF7A 2VJJA 2ICEC 4C1NI 4DU9A 1ESRA 2AKWB 1KNEA 2QN6A 4XYQA 1QG0A 4LFAQ 1TU2B 1G7SA 2B2WC 3I4LA 4X7FA 4JI8L 4YAWA 5KNDA 2ZL6A 4GLXA 4X3SA 4GN3B 1WTWA 4X3TA 4H9GA 3K59A 2JA7B 1K0RA 1M8AA 1STNA 4HCSA 4CKCA 4JI4L 1W87A 3J81k 3GO5A 3KDFA 1XJVA 4FXDA 3VA7A 3GTQH 2PLFA 4DR5Q 1XYIA 3DEOA 2VBVA 4KD3A 1WTRA 4ZGNB 1BQEA 3TBIB 4C3IH 1CT1D 2ES2A 1LABA 1SE3A 4P12A 3HS0C 2R92B 4P3IA 3RNUA 1EFID 5FJ8H 3L2PA 3BVGA 2RCFA 3WY9A 4RDLA 2LFNA 3OJWA 4X62L 4JBKA 1J5EL 3HOXH 4HIMA 4RD1A 4XKVA 3PO3H 4PABA 1PH7A 3LX0A 1IL8A 1WP6A 1X56A 4PMBA 1CKNB 3ONUA 3J81i 2OBSA 2NVQH 5JEAG 2YWEA 1NBWA 3DHQA 3MMPA 2OF1A 3GVLA 2WB1G 4GKKL 1A62A 2EFGA 3ZZ0A 5AN9A 2Z4HA 2WAQG 4CJ0B 3H15A 3RZOB 3A8IA 3BH4A 1HZ9A 2L0CA 2ATWA 1MD2D 4OX9Q 3ZZUA 3RLFA 3X3NA 3KF6A 4A3DG 1XTCD 3CCLA 2JN4A 1OGIA 1E3XA 1KRSA 2DNEA 5C3EB 3J7YW 1FYCA 3BDLA 1LT3D 1QFJA 4HN7A 4K0KQ 5KSWB 5GAHC 1JNYA 1HZCA 1D6EC 2K32A 3V76A 3PO3B 2WPDA 1AE2A 4DR3Q 3ZIAA 2CRVA 4B47A 3M4YA 2LXKA 1PTOC 2AQ3B 3CD6B 1GUSA 1B9MA 2VB2X 1TWHH 4S3SA 4RCNA 4KKTA 2K4KA 2SNMA 5GQOA 3V96A 4JI0L 1C8CA 2Q2HA 4OL7A 3PV0A 2EYPA 4MTKA 3CCJA 2PE3A 1EYGA 5AJ3L 2NVQB 1S5CD 4BXXH 1XWEA 3ICEA 1SSOA 4HCEA 5ELFA 2QTLA 2AUKA 2CFMA 5BSXA 5H5JA 1W6JA 3K58A 1BLIA 3H3VC 2X8KA 2J4XA 4OO1I 1VQMB 2WAQE 4YHBA 4LF4Q 2F0SA 3S16B 4PC3A 4E0FA 1KAWA 2VNHA 5CV8A 4WZEA 1BX1A 4NKLA 4A3BG 1VQFA 2V7XA 3LQEA 4B9WA 3QFCA 2F0OA 4PZ6A 4FN5A 1HNXL 1QOHA 4LFCQ 5TV2A 1N05A 1RKNA 2LMCB 2R3ZA 1W2BA 1XX8A 2QDBA 2OWOA 4ODGA 3GDEA 1QNUA 4J6HA 4RLZA 5KYIA 5J1ZA 3PUXA 1VQEA 3GTJH 3CC7A 3HOUG 2XZLA 2B2TC 3I56A 3WOEA 4TSFA 3RLNA 4CGYB 1XNRL 1B70B 3CCUB 1JOQA 1EP2B 3AFQA 4U68A 3H6MA 3M9BA 4CJ2C 4OWTB 1LT5D 1GOZA 1BOSA 4U673 4HJ9A 3RZDH 3AVUA 2QA4B 2CNDA 3K7AH 3K7UC 2ZTEA 3H0GG 4PZ8A 4R4IA 1E1OA 1I94L 4HTHA 2MGSA 4DR1Q 2F0LA 4Y7NH 2UXBQ 5BR8L 1RCVD 2D62A 4TRDA 2DYIA 3RN2A 2C35B 1M4VA 1VLYA 1UEAB 3BZDB 3NTKA 5C3XA 4G7ZC 2UXDQ 2VNKA 3T53B 4DV1Q 1EY9A 3OKXA 3CCRA 3S1MH 3CC4A 4JI1L 1JE4A 3TP8A 1B23P 2Z1CA 1C0AA 4P71A 5IYPA 1JOOA 1N32Q 2K01A 2RQXA 1YNJD 1PVOA 2OK8A 1XPOA 3I4OA 4P25A 2B63G 2C9OA 2VY3A 4RGTA 4B3SQ 1YNXA 5JJZA 2CVRA 1KLUD 2C5CA 2HUGA 1TKWB 4B48A 4QUFA 1MRZA 3E0EA 2HHHL 1V1PB 3T1HQ 1JJGA 3K7AB 1TY2A 1O7YA 3I91A 3LVBA 1S4ZA 2EZVA 1WCMH 3W1BA 4LF9Q 4ZGQB 1JJ2B 3G48A 3SK4A 4ZCLA 1AZQA 4G7XA 4YEJA 1KZLA 5J3BA 2XWBB 1X54A 3S1MB 3R3OA 1H9SB 3EROA 2JA6H 5JJKA 3QFRA 1Q90A 3M7GA 1KJZA 4GOPB 5C5MA 5C0XH 3PSIA 3FPPA 1FNCA 3DMUA 1BCPC 4L5TA 1S5DD 1YI2A 3W5HA 2VBTA 4X65L 3C3LA 1SYGA 1AW7A 1Y1VH 4Z1MA 3N52A 1FNVA 2VXWA 3S1NB 4NXML 4NB3A 1BBXC 2NTTA 1SNQA 1WCMB 4RGOS 5D3DA 3A3BA 1L1OB 3JU4A 4XNFA 1SFOH 4BBSG 3CCSA 2BM1A 5J3OA 5C44H 2YWFA 5IP9G 4XQJA 2DETA 3W2HA 1XMOQ 4IJLA 1N9WA 1EU4A 1E24A 3HZXA 4TMXA 3I2ZA 5JVG3 4KHPL 3MCAA 1SJHD 4L5SA 1ASYA 3GTMH 1SJED 4H7BA 4OWWB 1V43A 5IT9c 2GJRA 2X0KA 1G6ZA 1IBKL 3BG3A 1DDGA 4PQXA 4TQUS 1VQ8A 5IT9L 1T6ZA 4WJ4A 4YALA 4HJ8A 3CCEA 1XE1A 2E5LQ 1Y1VB 1MJEA 1Y0YA 1F2MA 1B53A 4KY5A 4CKBA 1VQLA 3L7ZC 2IX0A 3SK5A 4BY1H 1UE5A 2RCNA 4KKSA 1ENAA 1VQ6B 1VF7A 5IOCA 4A3MG 1KABA 1VQPA 1SFOB 1SNDA 2WZPP 3HOZG 4ZLTF 4C3JG 3ASTA 1YJ9A 1PH2A 1SYBA 4XMYA 2PW5A 4DV0L 4YIJA 3M4PA 2BSAA 2YTXA 2YYZA 1XTDA 1IHMA 3RN5A 1EQTA 2D2CC 1VMPA 2XWJB 1EIFA 2PQAB 3IRBA 4JI8Q 5C4HA 3J7AF 5I2YA 4IPHA 4GNXA 5I6WA 3GTMB 4ZAIA 4DPGA 4AYBE 3U4VA 4A3CH 2FMMA 1S72B 3HKZB 1R4PB 4JI4Q 4UP7A 1SE4A 3H09A 4J8QA 4UZFA 4QCLA 1DOMA 1OTCA 3F2DA 4C56C 5KW9A 5IP7G 2E2JB 3E9HA 1G7RA 1UMKA 1G291 4RG1A 5HXBA 3ULJA 3WWVA 3F1ZA 4WZKA 4XT3B 1VQOB 4FWTA 2OTLB 4BS9A 1N07A 4HAEA 3CW2A 1B8AA 5HURA 1E62A 5K36G 1PFNA 2MO1A 4RHRA 3H91A 3E9IA 4L5QA 2IL8A 1PA6A 5FLMG 3NK9A 4DAPA 4DK3C 1ZUNB 3UE0A 1E64A 1QGAA 2M2LA 2IX1A 4MHEA 2MPMA 2EY6A 5CR3A 3HGBA 4Z4ZA 4UZEA 4YWLA 4IFDI 1QH0A 3BVZA 3PUWA 3OOCA 3CTAA 1F2ZA 2PZTA 5COYA 4GKKQ 3W5VA 1KLGD 2EPBA 2PYKA 5FO9B 2IJ0A 4IUTA 1PH9A 5CBEE 4XQNA 1X3FA 3LWEA 2YV5A 4CJ1B 2UUAQ 4L5RC 1X3PA 4POGA 1KQSA 3AGQA 4X7EA 3GP7A 1ENFA 1NY4A 4DAMA 1BX0A 4RPBA 2VQEQ 3ULPA 1L0WA 4UY8C 4JV5L 1V0EA 2D0PA 4DR5L 5CV7A 2RSNA 1WDTA 4GN4B 5KGUA 2E76C 1S4MA 1XFOA 1NSNS 2FMCA 1GD7A 3CKIB 1TWCB 5EPJA 1STAA 2JA7G 1IKMA 2QILA 4B3TL 1FL0A 3LQ6A 4DGZA 1OXTA 2F1MA 1GHKA 2DGYA 1GM5A 4DFAA 2DJFC 4P2CB 5ISRA 1TWAH 1KC8D 1E7ZA 1YHAA 5CGKA 1I4RA 2E2HH 4HIZA 4LBWA 2WSSA 2IHEA 5AJ3Q 1J8IA 5TR9A 1PTOB 4JVZA 4BWGB 1UD4A 2EYHA 1IBML 1VQ4B 2NVTH 5H59A 3SEJA 3DEPA 4EVOA 2XNCA 2F0QA 3DM1A 2R92G 4UP8A 3ND8A 1I8DA 4IPCA 1RQPA 1QB5D 5D65A 3NXWA 1QNKA 3ERQA 5KNBA 4X66L 1LTSD 1YITB 3DWAA 1SROA 1B50A 2PMDA 4HR7B 1SMYC 4CDFC 2OK7A 1QILA 1BVSA 3A35A 1YHQB 1XNQL 4WQMA 1G8ZD 2L9HA 2K5WA 4TN1A 2FX3A 2XZPA 2WKDA 3FKSA 1J9ZA 5C0XI 1XNRQ 3STBC 4K0KL 4WFN3 2B8FA 3VYSA 5C3WA 1S0UA 4R9WA 2K52A 2EYLA 2E2HB 1EZ8A 1I4PA 3SE0A 5C3EG 1VHEA 3OW7A 5IY0A 4P22A 1JQYD 1IW7C 1YNND 4HMJA 3W1GA 5BR8Q 4ILWA 3W5UA 5FJ8G 3FRPB 3WNDA 4Q5VA 3F2CA 1EFWA 2EY5A 3MXNA 2VYQA 1BDOA 1I6HH 3PO3G 1SRUA 1JA1A 1DXMA 1YJWB 1IZ6A 1PKVA 4ABNA 1YBYA 4JI1Q 3WQZA 4BBRB 4PMWA 1MABA 2QGGA 1Q82D 2E1RA 2J7KA 1VQDA 5C5LA 2WIIB 1S40A 4A3GB 1JB3A 3Q3AA 3ZZTA 2BF4A 4LUVA 2XNJA 5FOBB 5DEHA 3EA6A 3G6JB 1F77A 1OB0A 1L2FA 3ERSX 5CV4A 2C4TA 3DXJC 2HHHQ 2FFKB 2K5VA 1Y8PB 3OIPA 3S1RH 1CQVA 2X3UA 2F0UA 1LV9A 2KVOA 1ZXTA 4A3IH 2ZXPA 1EUJA 3QJYA 2K04A 3GD7A 1PTOD 2F1LA 4JK1C 5A89A 3AFPA 5TY0A 1I7PA 5HY6A 4K6DA 4ZCKA 3TQYA 2Z6KA 4A3JH 4DV7L 2EQSA 2H5XA 3A7LA 2M5SA 4L63B 1ICFB 4BA1I 1HJPA 1CNEA 4MYUA 4J15A 1FNDA 1GUOA 4OP7A 5FLXc 2C5BA 1EWCA 2X6XA 3OZUA 2ICIA 5FO0A 3I1FA 3ITPA 1AIPA 3ZBUA 4MNOA 4A3KH 2BA1A 4X65Q 2ZZEA 5FLXL 3SDZA 1JE5A 1T6YA 4NXMQ 3R2TA 1CQFA 2UU9L 4WWVA 1EZ6A 1G7CA 1LACA 3S1RB 1N36L 4G7HC 4P2NA 3TP7A 2H1EA 3TZUA 1JT8A 1EY5A 2NB0A 4LFBL 4A3IB 3WBJA 2CHBD 4KHVA 4OO1H 2IWHA 1MI2A 2M9VA 1SYFA 3NWTA 1R5NA 2L1BA 1SDFA 4DNTB 2CQOA 5BN4A 5I9OA 4A3LH 2XSCA 4UHVA 4KHPQ 2OXPA 2KVMA 1AP0A 3UDGA 4RCZA 4OPSA 1H8HA 4GOPC 1P4MA 1QGYA 5L46A 4GLVB 1IBKQ 3A8JE 4ZK9B 4BY7H 5IYBH 3E20A 2C77A 1I3QH 5NUCA 3OWEB 4XLEA 2OBTA 1XB2A 4LUOA 2F0VA 3VR6A 4HSPA 4DK0A 1GO2A 3VR4A 1I4HA 3H94A 2F03A 1PYWD 3ZC3A 5A35A 3CCSB 4QMGA 1RJTA 3BJUA 2MNAA
chains in the Genus database with same CATH topology
3QB3A 4XIGS 3V05A 2JA5B 1MGSA 4FYDA 3I4NB 1JORA 3PIP3 4KMUC 4H0LC 4ULLA 4KI0A 4K8IA 1R9TB 2NYZD 2PZUA 2WP8J 1QG7A 1D2BA 1LLRD 1I3QB 1O78A 1TR5A 1LTRD 2VNUD 4IQZA 3AU7A 2QEJC 3U9OA 1WPCA 2KCNA 1SYEA 2KQ3A 1PZID 2K5DA 1FNUA 1EFRA 4XOPA 5M5WB 1W0KA 2QF7A 3D3RA 1G2TA 3OE7A 1JWSD 1U4RA 1I4GA 5IGDA 5JAVA 2B2WA 1RF2D 3D6WA 1U9RA 4IUQA 1VCIA 3SR1A 1IYVA 1GUWA 1WTOA 1ZEQX 3C46A 4PV1C 3GTPB 3KBXA 1A6XA 3MEHA 4IUPA 4XD7A 5KYLA 3K5NA 2SOBA 4DN4M 1PMRA 5LL6X 2KUMA 3PO2B 1YNNC 3GVKA 4Q0FA 1WTXA 1F9PA 1JOKA 2HDMA 1F9QA 4F87A 5EPKA 3FKIB 2A68C 1VF5C 2JEBI 2XZOA 1WD1A 1SYCA 3R8BA 3GTQB 3S17B 1V1OA 1TY0A 2E74C 3MVVA 1KDAA 4GQNA 1Y8OB 4C3IB 2YU9B 2D5DA 5CORA 1TT2A 4X3UA 2AQ1B 3OPOA 3HOXB 2O4XA 4LAAA 3J81E 1BQQT 3ONAB 3VR5A 4XYOA 2J7ZA 1GUGA 4KN4C 3M85A 1HHVA 3Q24A 2A6EC 4XOTA 2WINB 2B2VC 3VR2A 2G9DA 4WJWA 5EGTA 2F43A 3PMFA 3OEHA 1JCKB 5KIXA 2B2UC 4NMZA 2ZTNA 3EJIA 2Z8LA 4BA2I 2PPBC 1TS2A 4GZYC 1Q1BA 4IUVA 1II3A 1SBBB 1SEBD 2X6YA 1TWHB 4IFDH 1BUVT 2KECA 4XQQA 1K8OA 1U4MA 3OAAA 3GVJA 1DJRD 3NBHA 4XN3A 3EVQA 3HOYB 1DCZA 1H9JA 2ZXOA 5E1FA 3MA2B 3N6RA 3GTOB 3LNNA 1JWMD 1FNWA 4JMQA 3BVMA 4EQNA 1RTOA 4DXFA 4XL9A 4FO2A 5DM73 3GTJB 2PCFB 4L8JA 1SMYD 2B8GA 2XNDA 2PMZB 1B9NA 3PIO3 3P7JA 1TS4A 1NAPA 3RZDB 1EEID 1S5ED 2NVYB 1I6VC 4RFBA 2XGJA 4HMIA 4Y7NB 2IT1A 5DAUA 2JXMB 1PRTF 1EL0A 1R4QB 4ZUJA 3QOJA 4G7WA 2Q8IB 3A7AB 1IW7D 2F4IA 4TSSA 3JAML 1CK1A 3A8KE 2KEEA 2LKVA 2RDGA 1DYQA 2KCCA 1PRTB 2X6WA 4K6LA 1A2TA 2B39A 1PFBA 3I90A 2HQEA 1TIID 3D8GA 3BCFA 3EQLC 2CW0D 2BDNA 4G6IA 1RODA 3A55A 5A2QL 1ET9A 1X3QA 1B4OA 3WOFA 4FF3A 2H4OA 4XLCA 1HXYD 1U4PA 1KMHA 1SNCA 1QCBD 3A56A 3BS1A 2JA6B 1W0JA 3C2PA 2X85A 2NN6I 1I4XA 5IIFA 2KEDA 2ZXHA 4C2MB 1B44D 1HTPA 2LZJA 1SKYB 3E6ZX 2F0EA 5F2DA 4B9XA 2A6HC 3OIQA 3MTSA 2ZXRA 5EBCA 2SDFA 3KF8A 5G3LD 5M5XB 1CFMA 5C44B 3HOWB 3D6CA 4Z9CB 5FO7B 1EYDA 5KNCA 2ZXIA 2N55A 2F0FA 4OO1G 5JEAH 3BDOA 3GV6A 3KLSA 4RAUC 1MSHA 4K5XA 2EE1A 2AQ2B 4BY1B 2GJPA 1STBA 4L6TB 3VYTA 3QWNA 5M9OA 1QE6A 3Q0AA 1F2LA 1T5XD 4K8JA 4RWSC 3T16A 3NTIA 5J39A 2SNSA 4XONA 3MFGA 1CZWA 2VUMB 2Y0SB 2X6GA 3IFDA 1C4QA 1DOLA 2RBMA 1U4LA 2XNAC 1ZKOA 2FJ2A 4MIUA 3R93A 3GTGB 2K33A 1GUTA 3CESA 5K5PA 4NNJA 4IZ8A 4K14A 2ZZGA 4RGMA 2O2LD 1LTID 4XR6A 5AFWA 3FVQA 4IFDJ 2BOSA 1L0YB 1CHPD 3TZDA 2K03A 3HOVB 1PFMA 1ZYRC 3DWQA 3OMGA 5KEEA 3D31A 4V0BA 3D4RA 1ILQA 2RA4A 2K28A 1AFPA 3RD4A 2R9VA 5IT9E 4HEDA 3J80L 4DXGA 3CRLC 2NVXB 1TWAB 2F0JA 2EY1A 5CBAE 1E1QA 4C3IG 2NVTB 3A3GA 1OXXK 2R93B 3CHBD 2PQEA 2WKCA 4KY6A 3E5SA 4ZKBB 2VJIA 2R7ZB 1LTTD 3K6OA 1EWHA 1OXSC 3NWSA 2A68D 4NDXA 4RH6A 4F7XA 1X32A 4IUNA 4G57A 2LS01 3I72A 4J1MA 2DIEA 2CW0C 1AN8A 1HFGA 2F3VA 1JR0D 4XQFA 3TP5A 5C0XJ 2NTSA 1WTQA 4FVMA 1CM9A 3RUZA 3SXHA 5IODA 4N9PA 2F0HA 1JWUD 5HGTA 1QWYA 1I6HB 2GK6A 1SE2A 1EY8A 2DN8A 2GJKA 3MAQA 1B2TA 2A6ED 1PDQA 1SNOA 4NP5A 2I07B 3QIAA 1EYAA 1I50B 3EFXD 3K5MA 3DDYA 1ENCA 2L12A 4XM3A 1STYA 4CHTB 3TSSA 1B1ZA 4YXWA 1V1PA 4KN7C 4ZYSA 1UD2A 4QUCA 1BCPF 2QE7A 1EIHA 4X3KA 5M3MB 5CV5A 4IURA 4II2A 5IGGA 1UD5A 3Q23A 1EOTA 3GQBA 2NUCA 3I8ZA 4II3A 5BN3A 1H9SA 5IGFA 4A3JB 1CA5A 4IFDG 5FO8B 1KNAA 3ZPNA 2KJXA 1BMFA 2O5IC 1G2SA 4AYBB 2JDIA 1T5EA 4A3KB 5CV9A 1PRTC 1VMCA 3GV3A 2K05A 2Z6BD 5ELEA 3URYA 5ELDA 2JA8B 3HEJA 3O13A 2BE5C 5CV6A 1HTLD 3NE5B 2K1BA 4B3GA 1IYUA 2Q8TA 3M7NA 4K2LA 1WTVA 3G05A 1EY4A 4XT1B 3X3MA 1K83B 2KA7A 2NZ1D 4KK7A 3C1EA 1HZEA 3NPPA 2B2YA 1STEA 2PZWA 3MFYA 4MN3A 3DUZA 3KLRA 1J9OA 1KTKA 5FL7A 2EJMA 3SEBA 2K5QA 4XLAA 4BY7B 4FF4A 1E43A 3M3YB 3F2UA 3NP8A 4XTCS 1IKLA 1O80A 4IN3A 3FDTA 4XLHA 2HCIA 2WJVA 4EQOA 2A5HA 2XIWA 1PZKD 3TMEA 2A74C 2X69A 4ZRZA 4WORA 2W6JA 1UD3A 2EYOA 5EPLA 5M5YB 5C0XG 5LHY1 2PNRC 1H9RA 4KTAA 2F0NA 4OHJA 2JJ1A 4LK1C 2IW3A 1WD0A 2GK7A 1Y1WB 5EBDA 1STHA 5M3FB 2ID0A 3CU7A 3KEWA 2L55A 1OHHA 2EYFA 2EOTA 5JPNC 3S9WA 5C4XB 3NBIA 3OWFA 3T56B 1HUMA 4E6IA 1I18A 2EJFC 1E1RA 4CKEA 2JJ2A 4LJZC 3I4MB 2KHSA 5CYUA 2XRQD 5DNFA 1BNZA 3NQTA 1UAPA 2V31A 5FLXE 1D1KA 3A54A 3HG9A 1DZ1A 3HP3A 2EYJA 1Q8IA 1O7ZA 2A6HD 2NBFA 1TS3A 1Q1EA 2NN6H 3HRZC 4YELA 1ILPA 3GTLB 2WV6D 2QKIC 2F3WA 4FNFA 5HKKA 1UNSA 4XLFA 3V2TA 1E0BA 1AZPA 1BR9A 1A3UA 2JE6I 5IGBA 5FK9C 3S14B 3Q22A 3QG1A 4A93B 3OFNA 5JPMC 1DD2A 2V7QA 4UAIA 1GXDC 3P1HA 1OO9B 2ZZFA 2JYOA 3RMHA 2F0WA 3KK7A 1ESFA 4M1UB 3C1FA 1EY6A 1HRJA 1CA6A 1TS5A 1DOKA 2ZZQA 1KAAA 2B2VA 4B08A 3T4AC 1K28D 1LTBD 4UDUC 2B2UA 2BCOA 1JICA 3TP6A 1A2UA 3FPUB 1H9MA 3S15B 1LTGD 3S2DB 4C3HB 1AEXA 2SEBD 3MXGA 1ML0D 4DAVA 2Z4IA 4RGNA 2B2TA 2RSOA 4N9TA 4F88A 1HA6A 2DY7A 2D3NA 1STGA 1PXUA 3VA5A 1MBYA 3BC9A 1ET6A 2A69C 1QJOA 2ENBA 2E75C 4O42A 3MC0B 3MWYW 2L11A 1MSGA 4ME5A 3GTKB 2D9UA 1SNPA 2EY2A 4KY7A 5EKIA 1NBMA 4QIWB 3A8IE 1RTNA 4F8MA 1EEFD 1VDZA 2FINB 1ZYRD 5JVH3 1G91A 3CQZB 3LWUA 2A73B 2PW7A 5G3LF 1W6KA 2K7VA 1LT4D 5I4DA 5LL6S 1GHJA 3PUYA 5D3IB 1VJSA 4WRDA 2BA0A 4G4KA 4RHSA 1RHPA 3CP8A 3J7AV 4R8NA 3CMMA 3K5LA 2QCPX 1K8MA 1PLFA 5TSSA 2V4DA 1S5FD 1HFNA 4KKUA 2F0GA 1CTMA 5KRUA 1F9RA 5KNLA 4RA8A 2OEOA 2F0MA 1D1IA 4A3EB 2JEAI 2RDHA 4DK1A 2JIZA 1E2WA 1HA5A 1SYDA 2FHTA 1NR2A 2XVSA 4I7ZC 5C4JB 2I46A 5I6YA 1KDBA 4A3FB 4ZKCB 3NSWA 2F0IA 3KLSX 2RDFA 4ZQ3A 2MUYA 3TN2A 1BF4A 1I4QA 5IK2A 3I70A 2ZT9C 1WTPA 2HCCA 1RD9D 1Y8NB 2F0DA 2E2IB 1LT6D 2AUJD 2MHVA 3QO2A 1PZJD 1TWGB 3U9SA 4CBVA 2JSOA 4EGVA 5DM63 1EY0A 1F9SA 3TDQA 2HDLA 4EQPA 3T51B 2CK3A 3NHHA 2G9HD 3SK8A 1EYCA 1V0FA 1H9KA 4K5VA 4KJNA 2OT2A 1EIGA 1E2ZA 2TSSA 4FXGC 4KV6A 3L9AX 2O5JC 2RVLA 4C1NK 2CQAA 5EKKA 4OIJA 1DONA 1L0XB 4IUUA 3S1QB 1RDPD 3OHXC 3ZYYX 1Y69U 2XN9C 2RKSA 4K5WA 1GUNA 1UD6A 4XXEA 1PRTD 1LO5D 2F0PA 2Q8RE 5ELBA 3KBGA 1SAPA 2BE5D 3L3OC 3ND9A 5J22A 1NR4A 1FGBD 3UI2A 3QOLA 1JC7A 2MJ8A 4O1NA 4K2KA 1Z47A 1Z7TA 3IFTA 3KUPA 1FX0A 3R2IA 3IL8A 2WB1B 1H8EA 3MXUA 1HVXA 2AWNA 2WAQB 2VB3X 3G7LA 3SVMA 3JAME 4A3DB 3VR3A 1KDCA 4RKBA 3NTHA 1PTOH 1E2VA 1FD7D 3S2HB 3FMCA 2D3LA 2JP1A 4IALA 5ELCA 1Z6HA 3K5OA 1PTOF 2F0TA 5A2QE 1DM0B 2GA4B 3BCDA 4ASUA 1EU3A 4UZUA 1LTAD 3Q6SA 2NWGA 4A3BB 3MHBA 3BYYB 4FP5D 2N88A 3E0JA 4FXUA 1EY7A 1SNMA 5E3FA 3T13A 5C6AA 2WJYA 2HLDA 1W9XA 4G7OC 3I3CA 1NCVA 2DY8A 3HOUB 4PNYA 1YNJC 4DNRB 3AB9A 2EVBA 3PUVA 4OIKA 3D4DA 4B3FX 2PO4A 2R61A 3BDCA 3D4WA 5T1GA 2X6LA 2ZTGA 1Q3LA 3H0GB 1A3VA 1HCZA 3CP2A 1IHZA 3P20A 2XRSD 1EQVA 1XXGA 4QF4A 2NN6G 2EYMA 2BDOA 1ICWA 1UD8A 4FF2A 1HQMC 4V190 1OXUA 5CC4A 5CDFA 3BYTB 3IKJA 3VYRA 1TQOA 2B63B 5JOBA 4JBWA 4XORA 3K57A 4ZUIA 5DN6A 5E4WC 3HAGA 2E1BA 4H44C 1HPCA 4LMQD 3PUZA 1S5BD 2X53S 3OMCA 2EDGA 4C3HG 3NQIA 1SXTA 2LY7A 1NRKA 1UUPA 3CRKC 2E2DC 1O7LA 2MP1A 5C4ZA 3OSOA 1FR3A 4XKWA 1TWFB 1WVLA 1E3ZA 2M00A 5IGEA 4DAYA 3SHLA 2L5TA 4RKLA 4R8IA 2F0KA 3WDNA 1Q12A 1A15A 4BBSB 4XN0A 5FKAC 4TT3A 2A69D 3I73A 1BCPB 1A3TA 1CI3M 4DA2A 4ID6A 1CZGA 1D5ZC 2L4NA 3VYUA 2EJGC 3IAYA 2XOKA 4KJOA 4RCOA 5EJWA 5IGCA 2IPKD 1D5MC 1F2YA 1BPLA 1TVXA 5EKLA 1D5XC 1GJXA 2DNCA 2WACA 5JEAJ 5D14A 1BXTA 4KHZA 5BN5A 5T1IA 3J80E 2W6IA 4PMCA 4A3MB 4FXKC 1NUCA 5K36H 3HOZB 4C3JB 1E79A 3P75A 4OGQC 3K0YA 3MZ5A 3NUCA 3W3AA 1HUNA 3J81L 2KOLA 4AVZA 1HQRD 2IX3A 4FF1A 3SK6A 4H13C 3MXPA 2TMPA 1COWA 4KD4A 5E4XA 3AMUA 1V8QA 2B2YC 3FEWX 1C48A 4XDXA 1B3AA 4M8AA 2AWOA 1ONLA 4QB4A 3DWPA 5CMDA 3M4OB 4TKOB 1OXVA 5I2XA 5I9PA 2EXZA 3W2DA 1BO0A 4I65A 2K6AA 1WTHD 3OEEA 2J0TD 2R6GA 1CHQD 5EQ0A 1BCPD 4NW2A 4HSVA 4DF7A 2VJJA 2ICEC 4C1NI 4DU9A 1ESRA 1KNEA 4XYQA 1TU2B 2B2WC 3I4LA 5KNDA 4X3SA 1WTWA 4X3TA 3K59A 2JA7B 1M8AA 1STNA 4HCSA 4CKCA 3GO5A 4FXDA 3VA7A 1XYIA 3DEOA 4KD3A 1WTRA 3TBIB 1CT1D 1LABA 1SE3A 3HS0C 2R92B 1EFID 3BVGA 2LFNA 4XKVA 3LX0A 1IL8A 1WP6A 4PMBA 5JEAG 3DHQA 2OF1A 3GVLA 2Z4HA 4CJ0B 3RZOB 2L0CA 3BH4A 1MD2D 3RLFA 3X3NA 1XTCD 1E3XA 2DNEA 5C3EB 3J7YW 1FYCA 3BDLA 1LT3D 4HN7A 1D6EC 2K32A 3PO3B 2WPDA 3ZIAA 3M4YA 1PTOC 2AQ3B 1GUSA 1B9MA 2VB2X 4S3SA 4RCNA 4KKTA 2SNMA 3V96A 1C8CA 4OL7A 3PV0A 2EYPA 2NVQB 1S5CD 1XWEA 1SSOA 4HCEA 5ELFA 2AUKA 1W6JA 3K58A 1BLIA 3H3VC 2X8KA 2J4XA 4OO1I 2F0SA 3S16B 5CV8A 4E0FA 4NKLA 4B9WA 2F0OA 1QOHA 1RKNA 2LMCB 2R3ZA 1XX8A 2QDBA 4ODGA 4J6HA 1QNUA 5KYIA 5J1ZA 3PUXA 2XZLA 2B2TC 3WOEA 4TSFA 4CGYB 1JOQA 4U68A 3H6MA 4CJ2C 1LT5D 1GOZA 1BOSA 4U673 4HTHA 2MGSA 2F0LA 1RCVD 2D62A 4TRDA 1M4VA 1VLYA 1UEAB 3BZDB 3NTKA 5C3XA 4G7ZC 3T53B 1EY9A 1JE4A 3TP8A 2Z1CA 1JOOA 2K01A 2RQXA 1YNJD 2C9OA 4RGTA 5JJZA 2CVRA 1KLUD 2C5CA 2HUGA 1TKWB 4QUFA 1V1PB 3K7AB 1TY2A 1O7YA 3I91A 1S4ZA 2EZVA 3SK4A 1AZQA 4G7XA 4YEJA 1KZLA 2XWBB 3S1MB 3R3OA 1H9SB 3EROA 1Q90A 3M7GA 5C5MA 5C0XH 3FPPA 3DMUA 1BCPC 1S5DD 3C3LA 1SYGA 1AW7A 4Z1MA 3N52A 1FNVA 2VXWA 3S1NB 1BBXC 2NTTA 1SNQA 1WCMB 4RGOS 5D3DA 3A3BA 3JU4A 4XNFA 4XQJA 1EU4A 3HZXA 5JVG3 1SJHD 1SJED 4H7BA 1V43A 1G6ZA 2GJRA 3BG3A 4PQXA 4TQUS 5IT9L 1Y1VB 1F2MA 1B53A 4KY5A 4CKBA 3L7ZC 2IX0A 3SK5A 4KKSA 1ENAA 5IOCA 1VF7A 1KABA 1SFOB 1SNDA 2WZPP 4ZLTF 4C3JG 1SYBA 4XMYA 2PW5A 4YIJA 2YYZA 1EQTA 2D2CC 1VMPA 2XWJB 5C4HA 3J7AF 5I2YA 5I6WA 3GTMB 4ZAIA 2FMMA 3HKZB 1R4PB 1SE4A 3H09A 4J8QA 4QCLA 1DOMA 4C56C 2E2JB 1G291 4XT3B 4BS9A 4HAEA 5HURA 5K36G 1PFNA 4RHRA 3H91A 2IL8A 3NK9A 4DAPA 2M2LA 2IX1A 4MHEA 2MPMA 2EY6A 5CR3A 3HGBA 4IFDI 3BVZA 3PUWA 3OOCA 1F2ZA 2PZTA 5COYA 1KLGD 2EPBA 2PYKA 5FO9B 2IJ0A 4IUTA 5CBEE 4XQNA 3LWEA 4CJ1B 1X3PA 3GP7A 1ENFA 1V0EA 5CV7A 2RSNA 5KGUA 2E76C 1NSNS 2FMCA 3CKIB 1TWCB 5EPJA 1STAA 1IKMA 2QILA 4DGZA 1OXTA 2F1MA 1GHKA 4DFAA 4P2CB 5ISRA 5CGKA 1I4RA 4HIZA 2WSSA 1J8IA 1PTOB 4BWGB 1UD4A 2EYHA 4EVOA 3DEPA 2F0QA 3DM1A 3ND8A 1I8DA 1QB5D 5D65A 3NXWA 1QNKA 3ERQA 5KNBA 1LTSD 3DWAA 1B50A 4HR7B 1SMYC 1QILA 3A35A 1G8ZD 2L9HA 2K5WA 2XZPA 2WKDA 3FKSA 5C0XI 4WFN3 2B8FA 3VYSA 5C3WA 4R9WA 2E2HB 2EYLA 1EZ8A 1I4PA 3SE0A 3OW7A 4P22A 1JQYD 1IW7C 1YNND 4HMJA 4Q5VA 4ILWA 3FRPB 2EY5A 3MXNA 1BDOA 1DXMA 1PKVA 4ABNA 3WQZA 4BBRB 4PMWA 1MABA 5C5LA 2WIIB 4A3GB 1JB3A 5FOBB 5DEHA 3EA6A 3G6JB 1F77A 1OB0A 5CV4A 3DXJC 2FFKB 1Y8PB 3OIPA 1CQVA 2F0UA 1LV9A 2KVOA 1ZXTA 2ZXPA 3QJYA 2K04A 3GD7A 1PTOD 4JK1C 4K6DA 3A7LA 2M5SA 4L63B 4BA1I 1GUOA 1EWCA 2X6XA 2ICIA 3ITPA 2BA1A 2ZZEA 5FLXL 3SDZA 3R2TA 1CQFA 1EZ6A 1LACA 3S1RB 4G7HC 3TP7A 2H1EA 3TZUA 1EY5A 2NB0A 4A3IB 2CHBD 4KHVA 4OO1H 2IWHA 1MI2A 2M9VA 1SYFA 3NWTA 2L1BA 1SDFA 4DNTB 5BN4A 5I9OA 2XSCA 2OXPA 2KVMA 1AP0A 1H8HA 3A8JE 4ZK9B 5NUCA 3OWEB 4XLEA 2F0VA 3VR6A 4HSPA 4DK0A 3VR4A 1I4HA 3H94A 2F03A 1PYWD 5A35A 4QMGA 1RJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJO A;  4L8J A;  3M4Y A;  1DXM A;  2A68 C;  4TKO B;  1O7L A;  1OXV A;  1VF5 C;  1H9S A;  2AUJ D;  2B8G A;  2E75 C;  1GUS A;  1B9M A;  1FR3 A;  1B9N A;  1Q90 A;  2JEB I;  4KKT A;  3CRL C;  4RCN A;  4IFD G;  5C0X H;  4XIG S;  3FPP A;  1Z6H A;  3U9S A;  4OO1 G;  3PV0 A;  5JEA H;  2O5I C;  2E74 C;  3BDO A;  4KMU C;  3HGB A;  4H0L C;  2AUK A;  1I6V C;  2R6G A;  1T5E A;  3T51 B;  4KI0 A;  3PUW A;  3OOC A;  1Y8O B;  2A6H D;  3A8I E;  2IT1 A;  2L5T A;  1OXX K;  2JXM B;  2D5D A;  3WDN A;  1Q1E A;  2NN6 H;  1H9K A;  2BE5 C;  3DXJ C;  3OPO A;  3FMC A;  1Q12 A;  3NE5 B;  1VDZ A;  1Y8P B;  1O78 A;  2Q8I B;  1E2Z A;  3A7A B;  3VR5 A;  2LMC B;  1IYU A;  1IW7 D;  3M7N A;  1TU2 B;  1GUG A;  4KN4 C;  3LWU A;  4IQZ A;  3I4L A;  4G7O C;  2A69 D;  3A8K E;  5KND A;  3M85 A;  3I73 A;  3QJY A;  2KA7 A;  1CI3 M;  1EWH A;  3GD7 A;  2O5J C;  1OXS C;  3PUX A;  2A68 D;  2K7V A;  2E76 C;  4JK1 C;  1GHJ A;  4DNR B;  1YNJ C;  2EJG C;  2A6E C;  2EVB A;  2KCC A;  3AB9 A;  3PUY A;  5K36 G;  2JE6 I;  2BA0 A;  3PUV A;  1V43 A;  3MFY A;  1OXT A;  2F1M A;  3VR2 A;  3I72 A;  1Y69 U;  1GHK A;  3A7L A;  3BG3 A;  3QG1 A;  3VA7 A;  3KLR A;  4BA1 I;  1DD2 A;  2CW0 C;  4TQU S;  1GUN A;  2EJM A;  1GUO A;  2QF7 A;  1GJX A;  1K8M A;  1HCZ A;  2DNC A;  2V4D A;  3EQL C;  3P20 A;  2BA1 A;  4KHZ A;  4KKU A;  4XTC S;  1LAB A;  2D62 A;  3SDZ A;  5BN5 A;  2BE5 D;  1CTM A;  4G7Z C;  3ND9 A;  3L7Z C;  3ND8 A;  2NN6 G;  3T53 B;  1ZKO A;  2BDO A;  4BA2 I;  4KKS A;  1VF7 A;  1LAC A;  5KNC A;  2PPB C;  4G7H C;  4GZY C;  5K36 H;  1Q1B A;  1HQM C;  1VCI A;  3TZU A;  1IYV A;  5KNB A;  2DN8 A;  2JEA I;  1OXU A;  4OGQ C;  4PV1 C;  4DK1 A;  1E2W A;  4IFD H;  2NN6 I;  4HR7 B;  1A6X A;  5C0X G;  3IKJ A;  2PNR C;  1SMY C;  2YYZ A;  1Z7T A;  2K33 A;  3W3A A;  5BN3 A;  2A6E D;  2D2C C;  1H9R A;  3IFT A;  4I7Z C;  4OO1 H;  1K8O A;  4JBW A;  5JEA G;  3QIA A;  1GUT A;  3MXU A;  4H13 C;  4DNT B;  4LK1 C;  1HTP A;  5BN4 A;  1TKW B;  1PMR A;  4H44 C;  1HPC A;  1H9M A;  2A6H C;  2B8F A;  3PUZ A;  1DCZ A;  3RLF A;  3A8J E;  1H9J A;  1V8Q A;  4KN7 C;  3VR3 A;  2EDG A;  1YNN C;  3N6R A;  3SE0 A;  3LNN A;  1E2V A;  2AWO A;  1ONL A;  3T56 B;  2DNE A;  3VR6 A;  1ZYR C;  1CFM A;  1FYC A;  4DK0 A;  3OW7 A;  3D31 A;  2EJF C;  3VR4 A;  1G29 1;  3D4R A;  1IW7 C;  3H94 A;  2ZT9 C;  2K32 A;  5A35 A;  3CRK C;  1BDO A;  2A69 C;  2PCF B;  3GQB A;  4LJZ C;  1H9S B;  1Y8N B; 
#chains in the Genus database with same CATH topology
 3QB3 A;  1L1O C;  4XIG S;  3V05 A;  5TRD A;  2JA5 B;  1MGS A;  4FYD A;  1FNM A;  3I4N B;  2BH8 A;  1JOR A;  2WFW A;  4C0S A;  1YHB A;  5M5W H;  4DV0 Q;  3PIP 3;  2QDX A;  3MEF A;  4KMU C;  4P75 A;  4R4C A;  4H0L C;  4DKA C;  4ULL A;  1GVH A;  4KI0 A;  4K8I A;  1KTV A;  1XPU A;  4X7C A;  1Y1W H;  1X6O A;  1R9T B;  4OPV A;  2NYZ D;  3D0F A;  4GKJ L;  2PZU A;  4DV6 L;  2WP8 J;  1QG7 A;  1D2B A;  1LLR D;  2Q2T A;  1I3Q B;  4Z4R A;  3CMA B;  1WCM G;  1VQN B;  1O78 A;  4YWM A;  1TR5 A;  2YTY A;  3I55 A;  1LTR D;  2VNU D;  3P26 A;  4IQZ A;  2RHQ B;  3GTP H;  3AU7 A;  2QEJ C;  4PGO A;  3U9O A;  1WPC A;  2KCN A;  1SYE A;  2KQ3 A;  1PZI D;  2K5D A;  1FNU A;  1EFR A;  5FNZ A;  2L15 A;  4RPD A;  3C2Q A;  1YVC A;  4XOP A;  2ZJQ A;  5M5W B;  1W0K A;  4M4S A;  3PO2 H;  3Q6R A;  2QF7 A;  3D3R A;  1WOP A;  2OTJ B;  1G2T A;  3OE7 A;  1Y1V G;  1JWS D;  1V1Q A;  1B3Q A;  5IYD G;  1U4R A;  1I4G A;  1UE6 A;  5IGD A;  3CCM A;  1TVC A;  5JAV A;  2B2W A;  1RF2 D;  2ALY B;  3D6W A;  1NTG A;  1AH9 A;  2BGJ A;  1QZH A;  2HCJ B;  1N33 L;  1U9R A;  2VNJ A;  4IUQ A;  1VCI A;  3SR1 A;  5FIU A;  1IYV A;  3FKI H;  1GUW A;  1WTO A;  1ZEQ X;  3UDX A;  3C46 A;  4PV1 C;  3GTP B;  1UE7 A;  3KBX A;  4O0A A;  1A6X A;  2KBN A;  3S17 H;  4JV5 Q;  1WI5 A;  1QUQ B;  1PV4 A;  1SE8 A;  1M1K C;  3MEH A;  3T1Y Q;  1EFC A;  1Q81 C;  1HA3 A;  4IUP A;  4XD7 A;  5KYL A;  2YU9 H;  3K5N A;  4B3T Q;  2SOB A;  4DN4 M;  1Y14 B;  3CC2 B;  1PMR A;  2EIX A;  3HKZ G;  5LL6 X;  2KUM A;  4JI6 L;  3PO2 B;  1QZG A;  2ZL5 A;  1YNN C;  1EFU A;  3GVK A;  4QQB X;  4Q0F A;  1WTX A;  3QSY A;  1F9P A;  4F7D A;  2AHO B;  1MJC A;  1IBM Q;  3PA1 A;  1JOK A;  2HDM A;  1F9Q A;  4F87 A;  5EPK A;  3R6K A;  5HZA A;  1X65 A;  2ZM6 L;  1K3R A;  3FKI B;  2A68 C;  1VF5 C;  4IO9 A;  1Q82 C;  2JEB I;  1PH6 A;  2XZO A;  1WD1 A;  1SYC A;  4QHY A;  4X66 Q;  3R8B A;  3GTQ B;  3S17 B;  1V1O A;  1TY0 A;  2E74 C;  2UUA L;  3MVV A;  1KDA A;  3ZUG A;  4QVJ A;  4DNI A;  2JK8 A;  2DER A;  2HT1 A;  1XNQ Q;  4QVA A;  1VQB A;  4GQN A;  2VQE L;  5LMN Q;  1Y8O B;  4C3I B;  2N3S A;  2YU9 B;  4JG2 A;  2KHJ A;  1UEB A;  4A3C G;  1M90 C;  4OEL B;  5F4O A;  4R71 A;  2D5D A;  5COR A;  1TT2 A;  3HKZ E;  2MFI A;  4X3U A;  2AQ1 B;  4TMT A;  3OPO A;  3HOX B;  2O4X A;  4LAA A;  3CXC A;  3J81 E;  1HZB A;  1BQQ T;  3ONA B;  3VR5 A;  2HIX A;  4XYO A;  2J7Z A;  1GUG A;  2R7D A;  1VQK B;  5HZB A;  4KN4 C;  2OYN A;  3M85 A;  2AMC B;  2GRE A;  1E63 A;  3GSI A;  1HHV A;  3Q24 A;  2A6E C;  4XOT A;  1QVF A;  2WIN B;  2D74 A;  2B2V C;  2WB1 E;  1X3G A;  3VR2 A;  2G9D A;  4WJW A;  3J7A 5;  5EGT A;  3HOY H;  2ZL7 A;  5IYN A;  3R6J A;  2F43 A;  3PMF A;  3CME B;  1D2E A;  3BU2 A;  3OEH A;  1JCK B;  5KIX A;  2B2U C;  3GTO H;  4NMZ A;  1F20 A;  2ZTN A;  3EJI A;  3NEN A;  3BQJ A;  1VQ7 A;  2R7F A;  2Z8L A;  4BA2 I;  3W5O A;  2PPB C;  1TS2 A;  1YIJ B;  4GZY C;  1Q1B A;  4IUV A;  5F4J A;  4ZV4 A;  1II3 A;  4M53 A;  1SBB B;  1SEB D;  1QVG B;  2X6Y A;  1TWH B;  2N78 A;  4IFD H;  1BUV T;  2KEC A;  3B82 A;  4XQQ A;  2QDL A;  3SGI A;  1K8O A;  3U58 A;  1U4M A;  1VQ9 A;  4B3R L;  3OAA A;  3GVJ A;  1DJR D;  2NVY H;  4B4D A;  2OQK A;  4UAJ A;  3NBH A;  4NCN A;  4XN3 A;  3EVQ A;  2NZO A;  4PZ7 A;  3HOY B;  1DCZ A;  4DV7 Q;  1YX2 A;  1ZM2 A;  1E22 A;  1H9J A;  4FK8 A;  3G4S B;  2K75 A;  4CDC C;  2ZXO A;  3K80 C;  5E1F A;  5IYC H;  4PC6 A;  3MA2 B;  1LM0 A;  3N6R A;  3GTO B;  2DUD A;  3LNN A;  1JWM D;  4M1K A;  3VMF A;  1FNW A;  4JMQ A;  3BVM A;  4EQN A;  1RTO A;  4DXF A;  4XL9 A;  4FO2 A;  5DM7 3;  4LF8 L;  3GTJ B;  1C7Y A;  2PCF B;  2UU9 Q;  4L8J A;  2F4N A;  1SMY D;  2B8G A;  2XND A;  1N36 Q;  2PMZ B;  1B9N A;  1PFS A;  3PIO 3;  3KOJ A;  1VQ5 A;  2B7B A;  3P7J A;  1TS4 A;  2DCU A;  2CWA A;  4LFB Q;  4BBR G;  1NAP A;  3RZD B;  1EEI D;  1S5E D;  5GAG C;  2NVY B;  4DAY B;  3STB D;  2CC2 A;  1I6V C;  4RFB A;  2XGJ A;  4HMI A;  4Y7N B;  3K8A A;  2C5H A;  3CPX A;  4A3G G;  1K8A D;  2IT1 A;  5GAD C;  2I0Q A;  2KHI A;  3PUM A;  5DAU A;  2JXM B;  1PRT F;  2WYR A;  2LSS A;  1EL0 A;  1R4Q B;  4ZUJ A;  3JAM c;  3QOJ A;  4G7W A;  2Q8I B;  3A7A B;  1IW7 D;  2F4I A;  3ONY A;  4TSS A;  3JAM L;  1CK1 A;  4B44 A;  3PF4 A;  3A8K E;  2KEE A;  1WTH A;  2LKV A;  4HJA A;  2RDG A;  4LNQ A;  2NPF A;  1DYQ A;  3BY2 A;  2ZBV A;  4C2M H;  2KCC A;  2E2I H;  1PRT B;  1GAQ A;  2X6W A;  4K6L A;  1A2T A;  2B39 A;  1PFB A;  3I90 A;  1BKB A;  2VNI A;  2HQE A;  1TII D;  3D8G A;  3BCF A;  2CBX A;  3PVD A;  3SLD A;  4DQL A;  1Q8K A;  3EQL C;  2CW0 D;  1DG1 G;  2BDN A;  4G6I A;  5M5X H;  1ROD A;  3A55 A;  5A2Q L;  4IW3 B;  1ET9 A;  1X3Q A;  1B4O A;  3WOF A;  3HOW H;  5E6T A;  4FF3 A;  3CRZ A;  2H4O A;  3A74 A;  5HGQ A;  4JI5 L;  4XLC A;  1HXY D;  1U4P A;  1HR0 L;  4GKJ Q;  1KMH A;  2V7W A;  4OOX A;  4DV6 Q;  1SNC A;  3CCQ B;  1QCB D;  3A56 A;  3BS1 A;  1EIY B;  2JA6 B;  1W0J A;  3C2P A;  2X85 A;  4A3I G;  4JBM A;  2NN6 I;  1I4X A;  5IIF A;  4YWK A;  3KL9 A;  2KED A;  3U2Q A;  1HH2 P;  2ZXH A;  4C2M B;  3G71 B;  1IJF A;  3PIP A;  4P6Y A;  1B44 D;  1HTP A;  2LZJ A;  2JJQ A;  1SKY B;  3E6Z X;  1FVI A;  2F0E A;  5F2D A;  4PC7 A;  1YJN B;  4B9X A;  2A6H C;  3OIQ A;  3MTS A;  2ZXR A;  5EBC A;  3J7Z C;  2BPO A;  2SDF A;  3KF8 A;  5G3L D;  4A3K G;  3L0O A;  4UP9 A;  1W35 A;  1KD1 C;  4ACA A;  3EBE A;  5M5X B;  2GPJ A;  3OW2 A;  1CFM A;  5C44 B;  3HOW B;  3G6E A;  1KL9 A;  3D6C A;  1U5K A;  2A1A A;  4Z9C B;  5FO7 B;  2JA9 A;  2BN4 A;  1VS0 A;  1EYD A;  1K0S A;  5KNC A;  1D8T A;  1N33 Q;  3KJO A;  5IWA L;  2JA5 G;  2ZXI A;  3I4N G;  2N55 A;  2F0F A;  4OO1 G;  5JEA H;  2VUM H;  2V7U A;  3BDO A;  3GV6 A;  3KLS A;  4RAU C;  1MSH A;  2BMW A;  4A3L G;  4K5X A;  3Q39 A;  4G1V A;  2EXD A;  2EE1 A;  4N3N A;  3CCV A;  3TS2 A;  1H42 A;  2AQ2 B;  2I5M X;  3BNW A;  2VS1 A;  4BY1 B;  3JC6 6;  1CSQ A;  1IXR A;  4A75 A;  5IYB G;  2GJP A;  3K0X A;  2QEX A;  4JI6 Q;  2B7C A;  2ZIT A;  4P74 A;  1STB A;  1D7Q A;  4PC1 A;  4L6T B;  3VYT A;  3JAM i;  4AF7 A;  1GR1 A;  3QWN A;  2F52 A;  1QE6 A;  4OXP A;  5M9O A;  3P27 A;  3Q0A A;  4ALP A;  3GTG H;  1F2L A;  1T5X D;  4K8J A;  3OZV A;  4G1B A;  4JOI C;  4RWS C;  4RD2 A;  3NTI A;  3T16 A;  1FNB A;  5J39 A;  3S2H H;  2SNS A;  1HZA A;  3KDF B;  4DV3 L;  4TMZ A;  4XON A;  3MFG A;  5JJL A;  4P3Y A;  1DDI A;  2ZM6 Q;  1CZW A;  3E3X A;  1YZ6 A;  2VUM B;  2GQF A;  2Y0S B;  4DV4 L;  1VQJ A;  4QV2 A;  4CDD C;  2OBR A;  3HOV H;  2X6G A;  1O7I A;  5EMN A;  3IFD A;  4YCV A;  1C4Q A;  3NEM A;  2DEU A;  4DR4 L;  3BY1 A;  5THX A;  1DOL A;  2RBM A;  1DGS A;  1U4L A;  2XNA C;  1ZKO A;  3T1Y L;  1FDR A;  2FJ2 A;  2C2W A;  3QFT A;  2KCT A;  1JB9 A;  1ZM4 A;  4MIU A;  2V7T A;  3R93 A;  2RHS B;  3GTG B;  1QGZ A;  2K33 A;  1ASZ A;  2D9R A;  2NVX H;  1CKN A;  1GUT A;  3CES A;  2KCM A;  5K5P A;  4NNJ A;  4LF7 L;  3H3V H;  4IZ8 A;  4K14 A;  2VBU A;  2ZZG A;  5H1S E;  4RGM A;  2O2L D;  1LTI D;  4XR6 A;  5AFW A;  3KF6 B;  3FVQ A;  1XQB A;  3CCL B;  2R93 H;  1VQC A;  2BOS A;  1EP3 B;  3U6K A;  1CHP D;  1L0Y B;  2PNH A;  2YTV A;  3TZD A;  3PO2 G;  2K03 A;  3HOV B;  1N06 A;  4B3M Q;  5JJI A;  1PFM A;  2R7Z H;  1ZYR C;  3DWQ A;  3OMG A;  5KEE A;  3D31 A;  4V0B A;  3D4R A;  1ILQ A;  2RA4 A;  1U0L A;  4EX5 A;  2K28 A;  3J80 c;  4IPD A;  4RJL A;  4P72 A;  4YAO A;  4R4O A;  3RD4 A;  1AFP A;  5LMN L;  2R9V A;  5DLQ E;  5IT9 E;  4P26 A;  1AE3 A;  3FKI G;  4HED A;  3J80 L;  4RDJ A;  4DXG A;  3CRL C;  1EXM A;  3CCJ B;  4X06 A;  3CD6 A;  1M1K D;  2NVX B;  1TWA B;  2F0J A;  1Q81 D;  2EY1 A;  1K8A C;  1KXL A;  5CBA E;  5LMU L;  1E1Q A;  1PJ5 A;  3RR5 A;  4DK6 C;  4B3R Q;  4C3I G;  1MKH A;  1Q7Y D;  2NVT B;  3A3G A;  4OWX B;  1OXX K;  4IOC A;  4RD6 A;  2ZBU A;  2R93 B;  4Z4W A;  1VQM A;  3CHB D;  4WZL A;  2PQE A;  1R5O A;  4P9S A;  3U50 C;  3HOX G;  2WKC A;  1W2B B;  3TRZ A;  4KY6 A;  3E5S A;  1OB5 A;  4ZKB B;  2VJI A;  2R7Z B;  1NE3 A;  1LTT D;  1TUI A;  2Q6K A;  4KLK A;  4EH1 A;  3CC7 B;  3K6O A;  2ZJP A;  1EWH A;  3I56 B;  1OXS C;  2A68 D;  1X3E A;  3NWS A;  2NV4 A;  1X32 A;  4NDX A;  4RH6 A;  4F7X A;  1JB7 A;  4LF8 Q;  2CCZ A;  4IUN A;  4G57 A;  3ASR A;  1I50 H;  1W3S A;  2LS0 1;  2I5L X;  3WXM A;  3CCU A;  3I72 A;  1GVP A;  1TWF H;  4J1M A;  2P3M A;  2DIE A;  3H9N A;  2CW0 C;  2HMA A;  1AN8 A;  1HFG A;  2F3V A;  3A8J A;  4QUZ A;  4XQF A;  1JR0 D;  3TP5 A;  5C0X J;  2IY5 B;  2HIV A;  2QA4 A;  1M90 D;  1GKH A;  2NTS A;  1WTQ A;  4FVM A;  3I7F A;  1CM9 A;  5M3M H;  2Q6L A;  3RUZ A;  4DQK A;  3SXH A;  5IOD A;  1Z9F A;  4N9P A;  5ELO A;  3CCR B;  3JQP A;  3CC4 B;  2F0H A;  1Y0R A;  1JWU D;  4HID A;  5HGT A;  1PH1 A;  1QWY A;  1I6H B;  2GK6 A;  1MHW C;  1GAW A;  1EY8 A;  1SE2 A;  2DN8 A;  3UE1 A;  2GJK A;  3MAQ A;  1B2T A;  4TMW A;  3PIO A;  1K3B C;  1A8V A;  2A6E D;  1PDQ A;  1SNO A;  4NP5 A;  4JYA L;  2I07 B;  1PJ7 A;  1NDH A;  3QIA A;  4BXX G;  4P1V A;  1EYA A;  1I50 B;  3EFX D;  1G51 A;  3K5M A;  4RM0 A;  3VNV A;  4YAF A;  3DDY A;  2FVG A;  1ENC A;  1ELO A;  2L12 A;  4XM3 A;  3CPW A;  1STY A;  3HOY G;  4CHT B;  3TSS A;  1B1Z A;  2JA8 H;  4YXW A;  1V1P A;  5F4M A;  1QVC A;  4KN7 C;  1IBL Q;  1A63 A;  3ZJY C;  4ZYS A;  1UD2 A;  4QUC A;  1N08 A;  1BCP F;  2QE7 A;  1WSR A;  1EIH A;  4X3K A;  1JJ2 A;  4LWC A;  5M3M B;  5CV5 A;  4IUR A;  4II2 A;  4PAA A;  5IGG A;  1UD5 A;  1K83 H;  4JI3 L;  3Q23 A;  1EOT A;  3GQB A;  4X07 A;  2NUC A;  3QR8 A;  3I8Z A;  4JI5 Q;  4II3 A;  1HR0 Q;  2VZL A;  5BN3 A;  3J80 i;  1H9S A;  5IGF A;  4A3J B;  4GS3 A;  1CA5 A;  1SLJ A;  4IFD G;  5FO8 B;  1KNA A;  3ZPN A;  2KJX A;  1BMF A;  1YI2 B;  4GOP A;  2O5I C;  1G2S A;  4AYB B;  4QGU A;  3TS0 A;  2JDI A;  3M3Y H;  1EWY A;  1T5E A;  4A3K B;  4P6V F;  5CV9 A;  3ES9 A;  1PRT C;  1VMC A;  4NXN L;  3EIV A;  1PH4 A;  3GV3 A;  4RMF A;  4DV5 L;  2K05 A;  2Z6B D;  1EQR A;  5ELE A;  3URY A;  5ELD A;  2A19 A;  3HEJ A;  3O13 A;  2JA8 B;  2BE5 C;  5CV6 A;  1HTL D;  4DUZ L;  3NE5 B;  2K1B A;  2ZJR A;  5IYC G;  4B3G A;  1IYU A;  2HD3 A;  1TTT A;  2Q8T A;  2JN9 A;  1L1O A;  5IP7 H;  3M7N A;  4HJ5 A;  4K2L A;  1WTV A;  2K5N A;  4OEM B;  3G05 A;  1EY4 A;  4XT1 B;  3X3M A;  1K83 B;  5M5Y H;  2KA7 A;  2NZ1 D;  4KK7 A;  3C1E A;  1N0V C;  4I7A A;  1RIP A;  3TEH B;  1HZE A;  3AVV A;  3NPP A;  3M4O H;  4OOV A;  2B2Y A;  3AEV A;  1STE A;  1KK2 A;  2PZW A;  4JI7 L;  3MFY A;  5DS0 A;  4MN3 A;  4IJH A;  4OOS A;  1VQ8 B;  1RQR A;  3DUZ A;  2PMZ E;  3KLR A;  5M3F H;  1J9O A;  5IWA Q;  2HQL A;  2BH2 A;  1KTK A;  5FL7 A;  3CCE B;  2EJM A;  3SEB A;  2K5Q A;  4XLA A;  4BY7 B;  2VBS A;  1E43 A;  3RY8 A;  4FF4 A;  3H3V I;  3M3Y B;  3F2U A;  5C4X H;  4OON A;  5FA6 A;  3NP8 A;  3ULL A;  4XTC S;  3BZC A;  1VQL B;  1IKL A;  1O80 A;  4IN3 A;  3FDT A;  1N34 L;  3ISX A;  4XLH A;  3ASQ A;  2HCI A;  2WJV A;  1VQP B;  4EQO A;  4CQJ A;  4R1J A;  2A5H A;  4WJ3 M;  2XIW A;  1PZK D;  3TME A;  3Q38 A;  2A74 C;  1YJ9 B;  4DV2 L;  3I4M H;  2X69 A;  4ZRZ A;  3G6E B;  4WOR A;  2JA6 G;  1VQ6 A;  1WOO A;  2W6J A;  1UD3 A;  4C43 A;  2EYO A;  5EPL A;  2KEN A;  5M5Y B;  5C0X G;  5LHY 1;  2PNR C;  4PG3 A;  1T6X A;  1H9R A;  4GNX B;  3AVX A;  2I5H A;  3FP9 A;  4QL5 A;  4KTA A;  2F0N A;  4RDK A;  1WOR A;  2JA7 H;  4OHJ A;  2PQA A;  2JJ1 A;  4LK1 C;  2IW3 A;  4AF6 A;  1IYJ B;  1N0U A;  3A5Z B;  4DR2 L;  1WD0 A;  4POF A;  4LF6 Q;  2GK7 A;  1Y1W B;  2BV3 A;  4DV3 Q;  1STH A;  5EBD A;  5M3F B;  2ID0 A;  3CU7 A;  3KYH C;  3KEW A;  1S72 A;  2L55 A;  1OHH A;  2EYF A;  2EOT A;  5JPN C;  3S9W A;  4DV4 Q;  5C4X B;  3NBI A;  3OWF A;  3GTL H;  3T56 B;  1HUM A;  5EAY A;  4E6I A;  1I18 A;  1GO3 E;  5C44 G;  3CB4 A;  2EJF C;  4AQY Q;  3PF5 A;  1E1R A;  2R92 H;  3HOW G;  1V9P A;  4CKE A;  3WBK A;  2JJ2 A;  2PI2 A;  2DOG A;  4DR4 Q;  4RD3 A;  1YEZ A;  2VQF L;  4GN5 A;  4LJZ C;  2BVN A;  1VQO A;  2KHS A;  5CYU A;  2OTL A;  3I4M B;  4WZT A;  2XRQ D;  5DNF A;  2Q6O A;  4NBS A;  4QJF A;  1BNZ A;  3S14 H;  3NQT A;  1UAP A;  2V31 A;  1IL2 A;  4A93 H;  1SM4 A;  1PHJ A;  5FLX E;  1D1K A;  3A54 A;  2RC5 A;  3HG9 A;  1TLL A;  4HIK A;  3HP3 A;  1DZ1 A;  1WFQ A;  3WYA A;  1Q7Y C;  2EYJ A;  3A5U A;  1Q8I A;  1ZM9 A;  1O7Z A;  4X7D A;  2A6H D;  3SJP A;  3AVY A;  2NBF A;  3RZO H;  4LF7 Q;  1H95 A;  1TS3 A;  3PA2 A;  1Q1E A;  2NN6 H;  4BY1 G;  4G5G A;  1KQS B;  4YEL A;  1KD1 D;  3HRZ C;  1X55 A;  2UXC L;  1NNX A;  4A76 A;  1ILP A;  4TVA B;  3GTL B;  5C3E H;  2WV6 D;  4Y9U A;  4DUY Q;  2QKI C;  2F3W A;  4Z4S A;  4FNF A;  5HKK A;  1UNS A;  1ZM3 A;  4XLF A;  3V2T A;  1E0B A;  1AZP A;  1BR9 A;  1A3U A;  2E8G A;  5FO1 A;  2JE6 I;  5IGB A;  1CSP A;  1PH5 A;  1SR3 A;  1QFZ A;  1U2R A;  5FK9 C;  3S14 B;  4HE6 A;  3Q22 A;  3QG1 A;  4A93 B;  3OFN A;  5JPM C;  1DD2 A;  2V7Q A;  4UAI A;  1N8R C;  3S15 H;  2VUM G;  1GXD C;  2Y0S G;  2Q2U A;  3JQQ A;  3S2D H;  1NMF A;  4ZCM A;  4C3H H;  1QUF A;  2F4V L;  1Q9S A;  3P1H A;  1OO9 B;  2ZZF A;  2JYO A;  3RMH A;  2F0W A;  3EN2 A;  3KK7 A;  2DY1 A;  1ESF A;  1MIU A;  5LMU Q;  4M1U B;  3Q6Q A;  3S16 H;  1VQ4 A;  3OTO L;  2PI2 E;  3C1F A;  1E3P A;  3HKS A;  4X64 Q;  3AYH B;  1EY6 A;  1HRJ A;  1CA6 A;  1TS5 A;  1VQI A;  1DOK A;  2ZZQ A;  1KAA A;  2B2V A;  3BZK A;  4B08 A;  1YIT A;  4AIM A;  1KHI A;  1HNW L;  3AGP A;  3GTK H;  3J81 j;  2Z9H A;  4B3M L;  4B3X A;  4TMV A;  4QY7 A;  1A8P A;  3T4A C;  1K28 D;  4MTN A;  2DJG C;  1YHQ A;  1LTB D;  1LUZ A;  4ME3 A;  2B2U A;  4UDU C;  1Q86 C;  4IFD J;  2BCO A;  3SKB A;  1JIC A;  3TP6 A;  1A2U A;  2EIF A;  3FPU B;  1H9M A;  3S15 B;  1LTG D;  3ZBT A;  3S2D B;  4C3H B;  1XMQ L;  2Y0S E;  3GIR A;  1AEX A;  2SEB D;  3MXG A;  3HOV G;  1ML0 D;  4DAV A;  3QFS A;  2Z4I A;  4RGN A;  4X6A H;  2B2T A;  2RSO A;  1H85 A;  4N9T A;  4F88 A;  3CQZ H;  1HA6 A;  2DY7 A;  3MXN B;  2D3N A;  3A8K A;  1STG A;  2WR8 A;  1PXU A;  2CH4 A;  3VA5 A;  1MBY A;  2P5Z X;  3BC9 A;  1ET6 A;  2A69 C;  4LF5 L;  3D26 A;  1NMG A;  1QJO A;  2ENB A;  2E75 C;  4O42 A;  1JMC A;  4HIO A;  3MC0 B;  3MWY W;  3SJZ A;  4B43 A;  1YJW A;  2L11 A;  2CH4 W;  1MSG A;  4LW1 A;  4ME5 A;  2VZA A;  4N8X 1;  1K9M C;  3GTK B;  1AMO A;  1PH8 A;  3U6B A;  4N8F A;  2D9U A;  2Z6B A;  4JYA Q;  1SNP A;  1EP1 B;  2EY2 A;  4KY7 A;  5EKI A;  2QTZ A;  2OQ0 A;  1NBM A;  3K81 C;  4QIW B;  3A8I E;  1RTN A;  2Q2I A;  4F8M A;  1EEF D;  2R93 G;  4DR6 L;  4P73 A;  1EQQ A;  1VDZ A;  2FIN B;  1ZYR D;  1PH3 A;  5JVH 3;  1K73 C;  3V7A A;  1G91 A;  4A3E H;  2R7Z G;  1SKQ A;  3CQZ B;  3LWU A;  2A73 B;  2PW7 A;  1X9N A;  5G3L F;  3AVW A;  1W6K A;  5C4J H;  1CUK A;  1LT4 D;  2K7V A;  5I4D A;  5GV8 A;  5LL6 S;  1GHJ A;  3PUY A;  4JI3 Q;  5D3I B;  3F2B A;  1VJS A;  4WRD A;  2BA0 A;  4R4Q A;  4Z4U A;  4G4K A;  2VW9 A;  1JA0 A;  4A3F H;  4RHS A;  1QUE A;  1RHP A;  3CP8 A;  3J7A V;  4R8N A;  3CMM A;  4DR7 Q;  4YHH L;  1S3O A;  3K5L A;  2K5H A;  2QCP X;  1K8M A;  1PLF A;  5TSS A;  3OP1 A;  2V4D A;  1S5F D;  3CPW B;  1UE1 A;  1HFN A;  4RD0 A;  3S1N H;  4KKU A;  5IYQ A;  2F0G A;  1CTM A;  4NXN Q;  4AH6 A;  5KRU A;  2YWH A;  1WOS A;  4Z4Y A;  2B3G A;  4DV5 Q;  3WNB A;  1F9R A;  2A8V A;  5KNL A;  1PJ6 A;  2RC6 A;  4RA8 A;  5LMZ A;  4JI2 L;  2OEO A;  2F0M A;  1D1I A;  1WOC A;  1PYB A;  4DUZ Q;  4A3E B;  2JEA I;  2RDH A;  4DK1 A;  2JIZ A;  1E2W A;  1HA5 A;  1SYD A;  1TWG H;  4ZCI A;  1CKO A;  2D0O A;  2FHT A;  1NR2 A;  2XVS A;  4I7Z C;  5C4J B;  1IBL L;  2I46 A;  1YLO A;  3W2F A;  5I6Y A;  1SN8 A;  1KDB A;  4A3F B;  3AQQ A;  4ZKC B;  3Q8D A;  3NSW A;  2F0I A;  3KLS X;  4JI7 Q;  4APV A;  2RDF A;  4ZQ3 A;  2MUY A;  3TN2 A;  1BF4 A;  1KK1 A;  1PYS B;  1I4Q A;  5IYD H;  3WNC A;  3DLL A;  1NJI C;  5IK2 A;  4LC0 A;  3I70 A;  5M3M G;  2NZH A;  3OJX A;  4J0Q A;  4JW0 A;  2ZT9 C;  4A4I A;  1WTP A;  1N34 Q;  2HCC A;  4YY3 L;  1RD9 D;  1Y8N B;  2F0D A;  2E2I B;  3S1Q H;  1LT6 D;  2AUJ D;  2MHV A;  3QO2 A;  4DV2 Q;  4NPS A;  4A3J G;  2UUB L;  1PZJ D;  1TWG B;  3QE2 A;  3RLO A;  3U9S A;  4CBV A;  2GN5 A;  4LBY A;  1LTL A;  1W34 A;  2JSO A;  2V7V A;  4EGV A;  3B6Y A;  5DM6 3;  4OPO A;  1EY0 A;  4AYB G;  1F9S A;  1NB9 A;  3TDQ A;  2HDL A;  4EQP A;  4MYT A;  3T51 B;  2Z0S A;  2CK3 A;  1VHO A;  5IYR A;  1E1T A;  3NHH A;  2G9H D;  3SK8 A;  1EYC A;  4JPB W;  4DR2 Q;  1V0F A;  3F8T A;  4JC0 A;  2JA8 G;  1H9K A;  4K5V A;  4KJN A;  2OT2 A;  3I55 B;  3M4Q A;  1EIG A;  1E2Z A;  4JCV E;  3CMA A;  5IYW A;  1IB0 A;  2MO0 A;  2TSS A;  4Y52 H;  4FXG C;  4KV6 A;  1HNZ L;  2E2J H;  2UUC Q;  1VQN A;  2Q6I A;  3L9A X;  4H02 A;  2O5J C;  2RVL A;  1DAR A;  2RF4 A;  2CQA A;  4C1N K;  5EKK A;  2C4U A;  2GVA A;  2ZTC A;  4OIJ A;  1DON A;  1L0X B;  4IUU A;  1FJG L;  3S1Q B;  1RDP D;  3OHX C;  2VQF Q;  2ASB A;  3ZYY X;  1I5F A;  1Y69 U;  2XGT A;  2XN9 C;  1CQX A;  4HE5 A;  2RKS A;  3TRE A;  1P16 A;  2B29 A;  4ROX A;  4K5W A;  3S24 A;  1GUN A;  1UD6 A;  3VDY A;  4XXE A;  1PRT D;  1CNF A;  1LO5 D;  4JBJ A;  4GNX C;  4BY7 G;  4A3D H;  4BPR A;  2F0P A;  3CCM B;  2Q8R E;  5ELB A;  2OTJ A;  1TXY A;  3KBG A;  1SAP A;  5ELN A;  2BE5 D;  3KFU A;  4GLA C;  3L3O C;  3W2I A;  3ND9 A;  5J22 A;  4Q7J B;  1HR0 W;  5GAE C;  1NR4 A;  5E7N A;  1FGB D;  4JOI A;  4LF6 L;  1EWI A;  3UI2 A;  2UXC Q;  3QOL A;  2V1C C;  1JC7 A;  2MJ8 A;  1BBU A;  4K2K A;  4O1N A;  1K28 A;  2JQO A;  1Z47 A;  1Z7T A;  1B7Y B;  3PQI A;  3IFT A;  1KK3 A;  3KUP A;  3CW2 C;  3LGJ A;  1FX0 A;  3R2I A;  3IL8 A;  2WB1 B;  4X62 Q;  1H8E A;  1TWC H;  3MXU A;  1J5E Q;  1QUQ A;  1CKM A;  1HVX A;  5B6I A;  5BSY A;  2AWN A;  2WAQ B;  2QW7 A;  2ZTD A;  4AQY L;  2VB3 X;  1Y1W G;  3G7L A;  5M3F G;  5GV7 A;  3SVM A;  3JAM E;  4A3B H;  3CC2 A;  4A3D B;  5IE8 A;  3ER0 A;  3VR3 A;  1QX4 A;  2B5O A;  1KDC A;  4RKB A;  4LFA L;  2PIA A;  3NTH A;  1PTO H;  5C4X G;  1E2V A;  4LUZ A;  2F4V Q;  4N3G A;  4Y7C A;  4R4T A;  1WYD A;  4AC9 A;  1FD7 D;  2BGI A;  3OZW A;  3HOU H;  2AHO A;  1RL2 A;  1EFT A;  3OTO Q;  3S2H B;  3FMC A;  2D3L A;  3I4M G;  2MQH A;  2JP1 A;  4IAL A;  3SLN A;  5ELC A;  2OCE A;  2I1L A;  1Z6H A;  3K5O A;  1PTO F;  2F0T A;  5A2Q E;  1DM0 B;  3PCO B;  3H0G H;  1T9H A;  3B8H A;  1HNW Q;  2GA4 B;  3JQR A;  3BCD A;  4DUY L;  2F3I A;  4ASU A;  1EU3 A;  4UZU A;  1LTA D;  3Q6S A;  2NWG A;  4JI0 Q;  4A3B B;  2BM0 A;  3CXC B;  3BYY B;  3MHB A;  2QGQ A;  3LO8 A;  4FP5 D;  2N88 A;  3E0J A;  4FXU A;  4EQ5 A;  1EY7 A;  1SNM A;  5E3F A;  3T13 A;  1R5B A;  3HFZ B;  5C6A A;  1XMQ Q;  2XEX A;  2WJY A;  2HLD A;  4IOA A;  1W9X A;  2FXQ A;  1V5V A;  2CKZ B;  4G7O C;  3I3C A;  1VQK A;  1NCV A;  2B63 H;  2DY8 A;  3HOU B;  4PNY A;  1QVF B;  1YNJ C;  4DNR B;  3VNU A;  2EVB A;  3AB9 A;  1KRT A;  3PUV A;  1HNX Q;  4LF5 Q;  4OIK A;  4OX9 L;  2IHF A;  3D4D A;  4UPA A;  4B3F X;  2PO4 A;  1P8L A;  2QMU A;  4U9U A;  2R61 A;  3BDC A;  4A93 G;  4BBR H;  3D4W A;  5L37 A;  4X64 L;  5T1G A;  2X6L A;  2ZTG A;  1Q3L A;  3H0G B;  1A3V A;  4LBV A;  1OB2 A;  1HCZ A;  3CME A;  2N49 A;  3CP2 A;  1IHZ A;  3P20 A;  2XRS D;  4A3G H;  1VQ7 B;  1EQV A;  1VQA A;  1XXG A;  1FRQ A;  4QF4 A;  2K50 A;  2NN6 G;  4DR3 L;  2EYM A;  2BDO A;  1ICW A;  1UD8 A;  4FF2 A;  4DR6 Q;  1I94 Q;  1HQM C;  1BBW A;  4MZ9 A;  4HJ7 A;  4V19 0;  1YIJ A;  3E1Y E;  4M2L A;  1OXU A;  5CC4 A;  5CDF A;  3B78 A;  3PEN A;  3BYT B;  3IKJ A;  1XPR A;  1QVG A;  1VQ9 B;  3VYR A;  1TQO A;  2B63 B;  5JOB A;  4JBW A;  4XOR A;  3PGZ A;  1K8G A;  3NBH B;  3K57 A;  4ZUI A;  3KJP A;  1A0I A;  5DN6 A;  5E4W C;  4LF4 L;  1N8R D;  3ASS A;  4K1X A;  3HAG A;  4RCY A;  1NB0 A;  3A0J A;  2E1B A;  4H44 C;  1HPC A;  4LMQ D;  3PUZ A;  1S5B D;  2X53 S;  3ASP A;  4LFC L;  2C78 A;  3OMC A;  2EDG A;  4C3H G;  4YHH Q;  3NQI A;  4BBS H;  3G4S A;  3VO2 A;  5IP9 H;  1SXT A;  2LY7 A;  2CF4 A;  1NRK A;  2HDN B;  1UUP A;  1VQH A;  3CRK C;  3OYY A;  4FDB A;  5LMN W;  2E2D C;  1O7L A;  1VQ5 B;  2MP1 A;  4JI2 Q;  5C4Z A;  3OSO A;  1FR3 A;  4Z4T A;  4XKW A;  1EOV A;  1TWF B;  1WVL A;  2G5D A;  2CW5 A;  1E3Z A;  4DR1 L;  2M00 A;  1Q86 D;  2UXB L;  1G6P A;  3CPF A;  5IGE A;  2Z6K C;  1WJJ A;  1FRN A;  4DAY A;  1FGU A;  2UXD L;  3SHL A;  2L5T A;  4DV1 L;  4M0L A;  4RKL A;  3CAM A;  4R8I A;  2F0K A;  3WDN A;  1BJK A;  1JJC B;  1G7T A;  1Q12 A;  4A3M H;  1A15 A;  4BBS B;  4YAU A;  3HOZ H;  4XN0 A;  5FKA C;  4C3J H;  4TT3 A;  1N32 L;  1J6Q A;  4DR7 L;  2A69 D;  3UDF A;  4B3S L;  3I73 A;  1BCP B;  1A3T A;  1CI3 M;  4DA2 A;  4ID6 A;  1CZG A;  1D5Z C;  2L4N A;  3VYU A;  3CP0 A;  2EJG C;  4Z4V A;  3IAY A;  4YY3 Q;  2XOK A;  3U4Z A;  2JA5 H;  1UWV A;  4KJO A;  3T1H L;  1K9M D;  4RCO A;  5EJW A;  3I4N H;  4ACB A;  1LYL A;  5IGC A;  2IPK D;  1D5M C;  2UUB Q;  1F2Y A;  4LF9 L;  5A88 A;  1SMX A;  5J35 A;  1BPL A;  1TVX A;  5EKL A;  1D5X C;  1GJX A;  2DNC A;  2WAC A;  4QFM A;  5JEA J;  2K14 A;  3DM3 A;  3W2G A;  4YCW A;  1BXT A;  4KHZ A;  5D14 A;  2XTI A;  5BN5 A;  1R9T H;  1WSV A;  5T1I A;  4QIW E;  3J80 E;  2GVB A;  3KLW A;  2W6I A;  4PMC A;  1KIX A;  1K73 D;  4A3M B;  4FXK C;  2VL6 A;  1D1N A;  1NUC A;  3FJO A;  5JBQ A;  3HOZ B;  5K36 H;  4X0C A;  4C3J B;  1E79 A;  3P75 A;  4CDE C;  3CCQ A;  2R6H A;  3J81 c;  1OGJ A;  4A3E G;  5DSZ A;  4OGQ C;  4LBZ A;  5FLM H;  3K0Y A;  3MZ5 A;  1HNZ Q;  3NUC A;  3W3A A;  1HUN A;  4X05 A;  3VO1 A;  3J81 L;  2KOL A;  4AVZ A;  1HQR D;  2IX3 A;  4FF1 A;  3SK6 A;  1WU8 A;  4H13 C;  4X8I A;  3G71 A;  3MXP A;  1Q46 A;  4RD4 A;  2TMP A;  4A3F G;  1FJG Q;  1KK0 A;  1COW A;  5A8A A;  4KD4 A;  5E4X A;  3AMU A;  3KF8 B;  2YWG A;  1V8Q A;  2B2Y C;  1YJN A;  3FEW X;  2LXJ A;  1C48 A;  4XDX A;  1B3A A;  1D8L A;  3OW2 B;  4M8A A;  2AWO A;  1ONL A;  3NEL A;  1XMO L;  1B2R A;  3MHP A;  3FPK A;  4QB4 A;  3W2E A;  1VQG A;  3DWP A;  1KRH A;  5CMD A;  4PC2 A;  3M4O B;  3PUN A;  4TKO B;  1OXV A;  1GJR A;  5I2X A;  5I9P A;  2EXZ A;  3W2D A;  1BO0 A;  3A1P A;  2E5L L;  4I65 A;  2K6A A;  3CF5 A;  3AVT A;  3UDI A;  5GRO A;  2CWP A;  2N8N A;  1IJE A;  1WTH D;  3OEE A;  2J0T D;  1KC8 C;  2R6G A;  1CHQ D;  5EQ0 A;  2UUC L;  4Y9R A;  4IPG A;  3CCV B;  1BCP D;  4YCU A;  4NW2 A;  4HSV A;  1F60 A;  3FHW A;  4O2D A;  2WZN A;  1QFY A;  1VLO A;  1C9O A;  2QEX B;  1NJI D;  4DF7 A;  2VJJ A;  2ICE C;  4C1N I;  4DU9 A;  1ESR A;  2AKW B;  1KNE A;  2QN6 A;  4XYQ A;  1QG0 A;  4LFA Q;  1TU2 B;  1G7S A;  2B2W C;  3I4L A;  4X7F A;  4JI8 L;  4YAW A;  5KND A;  2ZL6 A;  4GLX A;  4X3S A;  4GN3 B;  1WTW A;  4X3T A;  4H9G A;  3K59 A;  2JA7 B;  1K0R A;  1M8A A;  1STN A;  4HCS A;  4CKC A;  4JI4 L;  1W87 A;  3J81 k;  3GO5 A;  3KDF A;  1XJV A;  4FXD A;  3VA7 A;  3GTQ H;  2PLF A;  4DR5 Q;  1XYI A;  3DEO A;  2VBV A;  4KD3 A;  1WTR A;  4ZGN B;  1BQE A;  3TBI B;  4C3I H;  1CT1 D;  2ES2 A;  1LAB A;  1SE3 A;  4P12 A;  3HS0 C;  2R92 B;  4P3I A;  3RNU A;  1EFI D;  5FJ8 H;  3L2P A;  3BVG A;  2RCF A;  3WY9 A;  4RDL A;  2LFN A;  3OJW A;  4X62 L;  4JBK A;  1J5E L;  3HOX H;  4HIM A;  4RD1 A;  4XKV A;  3PO3 H;  4PAB A;  1PH7 A;  3LX0 A;  1IL8 A;  1WP6 A;  1X56 A;  4PMB A;  1CKN B;  3ONU A;  3J81 i;  2OBS A;  2NVQ H;  5JEA G;  2YWE A;  1NBW A;  3DHQ A;  3MMP A;  2OF1 A;  3GVL A;  2WB1 G;  4GKK L;  1A62 A;  2EFG A;  3ZZ0 A;  5AN9 A;  2Z4H A;  2WAQ G;  4CJ0 B;  3H15 A;  3RZO B;  3A8I A;  3BH4 A;  1HZ9 A;  2L0C A;  2ATW A;  1MD2 D;  4OX9 Q;  3ZZU A;  3RLF A;  3X3N A;  3KF6 A;  4A3D G;  1XTC D;  3CCL A;  2JN4 A;  1OGI A;  1E3X A;  1KRS A;  2DNE A;  5C3E B;  3J7Y W;  1FYC A;  3BDL A;  1LT3 D;  1QFJ A;  4HN7 A;  4K0K Q;  5KSW B;  5GAH C;  1JNY A;  1HZC A;  1D6E C;  2K32 A;  3V76 A;  3PO3 B;  2WPD A;  1AE2 A;  4DR3 Q;  3ZIA A;  2CRV A;  4B47 A;  3M4Y A;  2LXK A;  1PTO C;  2AQ3 B;  3CD6 B;  1GUS A;  1B9M A;  2VB2 X;  1TWH H;  4S3S A;  4RCN A;  4KKT A;  2K4K A;  2SNM A;  5GQO A;  3V96 A;  4JI0 L;  1C8C A;  2Q2H A;  4OL7 A;  3PV0 A;  2EYP A;  4MTK A;  3CCJ A;  2PE3 A;  1EYG A;  5AJ3 L;  2NVQ B;  1S5C D;  4BXX H;  1XWE A;  3ICE A;  1SSO A;  4HCE A;  5ELF A;  2QTL A;  2AUK A;  2CFM A;  5BSX A;  5H5J A;  1W6J A;  3K58 A;  1BLI A;  3H3V C;  2X8K A;  2J4X A;  4OO1 I;  1VQM B;  2WAQ E;  4YHB A;  4LF4 Q;  2F0S A;  3S16 B;  4PC3 A;  4E0F A;  1KAW A;  2VNH A;  5CV8 A;  4WZE A;  1BX1 A;  4NKL A;  4A3B G;  1VQF A;  2V7X A;  3LQE A;  4B9W A;  3QFC A;  2F0O A;  4PZ6 A;  4FN5 A;  1HNX L;  1QOH A;  4LFC Q;  5TV2 A;  1N05 A;  1RKN A;  2LMC B;  2R3Z A;  1W2B A;  1XX8 A;  2QDB A;  2OWO A;  4ODG A;  3GDE A;  1QNU A;  4J6H A;  4RLZ A;  5KYI A;  5J1Z A;  3PUX A;  1VQE A;  3GTJ H;  3CC7 A;  3HOU G;  2XZL A;  2B2T C;  3I56 A;  3WOE A;  4TSF A;  3RLN A;  4CGY B;  1XNR L;  1B70 B;  3CCU B;  1JOQ A;  1EP2 B;  3AFQ A;  4U68 A;  3H6M A;  3M9B A;  4CJ2 C;  4OWT B;  1LT5 D;  1GOZ A;  1BOS A;  4U67 3;  4HJ9 A;  3RZD H;  3AVU A;  2QA4 B;  2CND A;  3K7A H;  3K7U C;  2ZTE A;  3H0G G;  4PZ8 A;  4R4I A;  1E1O A;  1I94 L;  4HTH A;  2MGS A;  4DR1 Q;  2F0L A;  4Y7N H;  2UXB Q;  5BR8 L;  1RCV D;  2D62 A;  4TRD A;  2DYI A;  3RN2 A;  2C35 B;  1M4V A;  1VLY A;  1UEA B;  3BZD B;  3NTK A;  5C3X A;  4G7Z C;  2UXD Q;  2VNK A;  3T53 B;  4DV1 Q;  1EY9 A;  3OKX A;  3CCR A;  3S1M H;  3CC4 A;  4JI1 L;  1JE4 A;  3TP8 A;  1B23 P;  2Z1C A;  1C0A A;  4P71 A;  5IYP A;  1JOO A;  1N32 Q;  2K01 A;  2RQX A;  1YNJ D;  1PVO A;  2OK8 A;  1XPO A;  3I4O A;  4P25 A;  2B63 G;  2C9O A;  2VY3 A;  4RGT A;  4B3S Q;  1YNX A;  5JJZ A;  2CVR A;  1KLU D;  2C5C A;  2HUG A;  1TKW B;  4B48 A;  4QUF A;  1MRZ A;  3E0E A;  2HHH L;  1V1P B;  3T1H Q;  1JJG A;  3K7A B;  1TY2 A;  1O7Y A;  3I91 A;  3LVB A;  1S4Z A;  2EZV A;  1WCM H;  3W1B A;  4LF9 Q;  4ZGQ B;  1JJ2 B;  3G48 A;  3SK4 A;  4ZCL A;  1AZQ A;  4G7X A;  4YEJ A;  1KZL A;  5J3B A;  2XWB B;  1X54 A;  3S1M B;  3R3O A;  1H9S B;  3ERO A;  2JA6 H;  5JJK A;  3QFR A;  1Q90 A;  3M7G A;  1KJZ A;  4GOP B;  5C5M A;  5C0X H;  3PSI A;  3FPP A;  1FNC A;  3DMU A;  1BCP C;  4L5T A;  1S5D D;  1YI2 A;  3W5H A;  2VBT A;  4X65 L;  3C3L A;  1SYG A;  1AW7 A;  1Y1V H;  4Z1M A;  3N52 A;  1FNV A;  2VXW A;  3S1N B;  4NXM L;  4NB3 A;  1BBX C;  2NTT A;  1SNQ A;  1WCM B;  4RGO S;  5D3D A;  3A3B A;  1L1O B;  3JU4 A;  4XNF A;  1SFO H;  4BBS G;  3CCS A;  2BM1 A;  5J3O A;  5C44 H;  2YWF A;  5IP9 G;  4XQJ A;  2DET A;  3W2H A;  1XMO Q;  4IJL A;  1N9W A;  1EU4 A;  1E24 A;  3HZX A;  4TMX A;  3I2Z A;  5JVG 3;  4KHP L;  3MCA A;  1SJH D;  4L5S A;  1ASY A;  3GTM H;  1SJE D;  4H7B A;  4OWW B;  1V43 A;  5IT9 c;  2GJR A;  2X0K A;  1G6Z A;  1IBK L;  3BG3 A;  1DDG A;  4PQX A;  4TQU S;  1VQ8 A;  5IT9 L;  1T6Z A;  4WJ4 A;  4YAL A;  4HJ8 A;  3CCE A;  1XE1 A;  2E5L Q;  1Y1V B;  1MJE A;  1Y0Y A;  1F2M A;  1B53 A;  4KY5 A;  4CKB A;  1VQL A;  3L7Z C;  2IX0 A;  3SK5 A;  4BY1 H;  1UE5 A;  2RCN A;  4KKS A;  1ENA A;  1VQ6 B;  1VF7 A;  5IOC A;  4A3M G;  1KAB A;  1VQP A;  1SFO B;  1SND A;  2WZP P;  3HOZ G;  4ZLT F;  4C3J G;  3AST A;  1YJ9 A;  1PH2 A;  1SYB A;  4XMY A;  2PW5 A;  4DV0 L;  4YIJ A;  3M4P A;  2BSA A;  2YTX A;  2YYZ A;  1XTD A;  1IHM A;  3RN5 A;  1EQT A;  2D2C C;  1VMP A;  2XWJ B;  1EIF A;  2PQA B;  3IRB A;  4JI8 Q;  5C4H A;  3J7A F;  5I2Y A;  4IPH A;  4GNX A;  5I6W A;  3GTM B;  4ZAI A;  4DPG A;  4AYB E;  3U4V A;  4A3C H;  2FMM A;  1S72 B;  3HKZ B;  1R4P B;  4JI4 Q;  4UP7 A;  1SE4 A;  3H09 A;  4J8Q A;  4UZF A;  4QCL A;  1DOM A;  1OTC A;  3F2D A;  4C56 C;  5KW9 A;  5IP7 G;  2E2J B;  3E9H A;  1G7R A;  1UMK A;  1G29 1;  4RG1 A;  5HXB A;  3ULJ A;  3WWV A;  3F1Z A;  4WZK A;  4XT3 B;  1VQO B;  4FWT A;  2OTL B;  4BS9 A;  1N07 A;  4HAE A;  3CW2 A;  1B8A A;  5HUR A;  1E62 A;  5K36 G;  1PFN A;  2MO1 A;  4RHR A;  3H91 A;  3E9I A;  4L5Q A;  2IL8 A;  1PA6 A;  5FLM G;  3NK9 A;  4DAP A;  4DK3 C;  1ZUN B;  3UE0 A;  1E64 A;  1QGA A;  2M2L A;  2IX1 A;  4MHE A;  2MPM A;  2EY6 A;  5CR3 A;  3HGB A;  4Z4Z A;  4UZE A;  4YWL A;  4IFD I;  1QH0 A;  3BVZ A;  3PUW A;  3OOC A;  3CTA A;  1F2Z A;  2PZT A;  5COY A;  4GKK Q;  3W5V A;  1KLG D;  2EPB A;  2PYK A;  5FO9 B;  2IJ0 A;  4IUT A;  1PH9 A;  5CBE E;  4XQN A;  1X3F A;  3LWE A;  2YV5 A;  4CJ1 B;  2UUA Q;  4L5R C;  1X3P A;  4POG A;  1KQS A;  3AGQ A;  4X7E A;  3GP7 A;  1ENF A;  1NY4 A;  4DAM A;  1BX0 A;  4RPB A;  2VQE Q;  3ULP A;  1L0W A;  4UY8 C;  4JV5 L;  1V0E A;  2D0P A;  4DR5 L;  5CV7 A;  2RSN A;  1WDT A;  4GN4 B;  5KGU A;  2E76 C;  1S4M A;  1XFO A;  1NSN S;  2FMC A;  1GD7 A;  3CKI B;  1TWC B;  5EPJ A;  1STA A;  2JA7 G;  1IKM A;  2QIL A;  4B3T L;  1FL0 A;  3LQ6 A;  4DGZ A;  1OXT A;  2F1M A;  1GHK A;  2DGY A;  1GM5 A;  4DFA A;  2DJF C;  4P2C B;  5ISR A;  1TWA H;  1KC8 D;  1E7Z A;  1YHA A;  5CGK A;  1I4R A;  2E2H H;  4HIZ A;  4LBW A;  2WSS A;  2IHE A;  5AJ3 Q;  1J8I A;  5TR9 A;  1PTO B;  4JVZ A;  4BWG B;  1UD4 A;  2EYH A;  1IBM L;  1VQ4 B;  2NVT H;  5H59 A;  3SEJ A;  3DEP A;  4EVO A;  2XNC A;  2F0Q A;  3DM1 A;  2R92 G;  4UP8 A;  3ND8 A;  1I8D A;  4IPC A;  1RQP A;  1QB5 D;  5D65 A;  3NXW A;  1QNK A;  3ERQ A;  5KNB A;  4X66 L;  1LTS D;  1YIT B;  3DWA A;  1SRO A;  1B50 A;  2PMD A;  4HR7 B;  1SMY C;  4CDF C;  2OK7 A;  1QIL A;  1BVS A;  3A35 A;  1YHQ B;  1XNQ L;  4WQM A;  1G8Z D;  2L9H A;  2K5W A;  4TN1 A;  2FX3 A;  2XZP A;  2WKD A;  3FKS A;  1J9Z A;  5C0X I;  1XNR Q;  3STB C;  4K0K L;  4WFN 3;  2B8F A;  3VYS A;  5C3W A;  1S0U A;  4R9W A;  2K52 A;  2EYL A;  2E2H B;  1EZ8 A;  1I4P A;  3SE0 A;  5C3E G;  1VHE A;  3OW7 A;  5IY0 A;  4P22 A;  1JQY D;  1IW7 C;  1YNN D;  4HMJ A;  3W1G A;  5BR8 Q;  4ILW A;  3W5U A;  5FJ8 G;  3FRP B;  3WND A;  4Q5V A;  3F2C A;  1EFW A;  2EY5 A;  3MXN A;  2VYQ A;  1BDO A;  1I6H H;  3PO3 G;  1SRU A;  1JA1 A;  1DXM A;  1YJW B;  1IZ6 A;  1PKV A;  4ABN A;  1YBY A;  4JI1 Q;  3WQZ A;  4BBR B;  4PMW A;  1MAB A;  2QGG A;  1Q82 D;  2E1R A;  2J7K A;  1VQD A;  5C5L A;  2WII B;  1S40 A;  4A3G B;  1JB3 A;  3Q3A A;  3ZZT A;  2BF4 A;  4LUV A;  2XNJ A;  5FOB B;  5DEH A;  3EA6 A;  3G6J B;  1F77 A;  1OB0 A;  1L2F A;  3ERS X;  5CV4 A;  2C4T A;  3DXJ C;  2HHH Q;  2FFK B;  2K5V A;  1Y8P B;  3OIP A;  3S1R H;  1CQV A;  2X3U A;  2F0U A;  1LV9 A;  2KVO A;  1ZXT A;  4A3I H;  2ZXP A;  1EUJ A;  3QJY A;  2K04 A;  3GD7 A;  1PTO D;  2F1L A;  4JK1 C;  5A89 A;  3AFP A;  5TY0 A;  1I7P A;  5HY6 A;  4K6D A;  4ZCK A;  3TQY A;  2Z6K A;  4A3J H;  4DV7 L;  2EQS A;  2H5X A;  3A7L A;  2M5S A;  4L63 B;  1ICF B;  4BA1 I;  1HJP A;  1CNE A;  4MYU A;  4J15 A;  1FND A;  1GUO A;  4OP7 A;  5FLX c;  2C5B A;  1EWC A;  2X6X A;  3OZU A;  2ICI A;  5FO0 A;  3I1F A;  3ITP A;  1AIP A;  3ZBU A;  4MNO A;  4A3K H;  2BA1 A;  4X65 Q;  2ZZE A;  5FLX L;  3SDZ A;  1JE5 A;  1T6Y A;  4NXM Q;  3R2T A;  1CQF A;  2UU9 L;  4WWV A;  1EZ6 A;  1G7C A;  1LAC A;  3S1R B;  1N36 L;  4G7H C;  4P2N A;  3TP7 A;  2H1E A;  3TZU A;  1JT8 A;  1EY5 A;  2NB0 A;  4LFB L;  4A3I B;  3WBJ A;  2CHB D;  4KHV A;  4OO1 H;  2IWH A;  1MI2 A;  2M9V A;  1SYF A;  3NWT A;  1R5N A;  2L1B A;  1SDF A;  4DNT B;  2CQO A;  5BN4 A;  5I9O A;  4A3L H;  2XSC A;  4UHV A;  4KHP Q;  2OXP A;  2KVM A;  1AP0 A;  3UDG A;  4RCZ A;  4OPS A;  1H8H A;  4GOP C;  1P4M A;  1QGY A;  5L46 A;  4GLV B;  1IBK Q;  3A8J E;  4ZK9 B;  4BY7 H;  5IYB H;  3E20 A;  2C77 A;  1I3Q H;  5NUC A;  3OWE B;  4XLE A;  2OBT A;  1XB2 A;  4LUO A;  2F0V A;  3VR6 A;  4HSP A;  4DK0 A;  1GO2 A;  3VR4 A;  1I4H A;  3H94 A;  2F03 A;  1PYW D;  3ZC3 A;  5A35 A;  3CCS B;  4QMG A;  1RJT A;  3BJU A;  2MNA A; 
#chains in the Genus database with same CATH homology
 3QB3 A;  4XIG S;  3V05 A;  2JA5 B;  1MGS A;  4FYD A;  3I4N B;  1JOR A;  3PIP 3;  4KMU C;  4H0L C;  4ULL A;  4KI0 A;  4K8I A;  1R9T B;  2NYZ D;  2PZU A;  2WP8 J;  1QG7 A;  1D2B A;  1LLR D;  1I3Q B;  1O78 A;  1TR5 A;  1LTR D;  2VNU D;  4IQZ A;  3AU7 A;  2QEJ C;  3U9O A;  1WPC A;  2KCN A;  1SYE A;  2KQ3 A;  1PZI D;  2K5D A;  1FNU A;  1EFR A;  4XOP A;  5M5W B;  1W0K A;  2QF7 A;  3D3R A;  1G2T A;  3OE7 A;  1JWS D;  1U4R A;  1I4G A;  5IGD A;  5JAV A;  2B2W A;  1RF2 D;  3D6W A;  1U9R A;  4IUQ A;  1VCI A;  3SR1 A;  1IYV A;  1GUW A;  1WTO A;  1ZEQ X;  3C46 A;  4PV1 C;  3GTP B;  3KBX A;  1A6X A;  3MEH A;  4IUP A;  4XD7 A;  5KYL A;  3K5N A;  2SOB A;  4DN4 M;  1PMR A;  5LL6 X;  2KUM A;  3PO2 B;  1YNN C;  3GVK A;  4Q0F A;  1WTX A;  1F9P A;  1JOK A;  2HDM A;  1F9Q A;  4F87 A;  5EPK A;  3FKI B;  2A68 C;  1VF5 C;  2JEB I;  2XZO A;  1WD1 A;  1SYC A;  3R8B A;  3GTQ B;  3S17 B;  1V1O A;  1TY0 A;  2E74 C;  3MVV A;  1KDA A;  4GQN A;  1Y8O B;  4C3I B;  2YU9 B;  2D5D A;  5COR A;  1TT2 A;  4X3U A;  2AQ1 B;  3OPO A;  3HOX B;  2O4X A;  4LAA A;  3J81 E;  1BQQ T;  3ONA B;  3VR5 A;  4XYO A;  2J7Z A;  1GUG A;  4KN4 C;  3M85 A;  1HHV A;  3Q24 A;  2A6E C;  4XOT A;  2WIN B;  2B2V C;  3VR2 A;  2G9D A;  4WJW A;  5EGT A;  2F43 A;  3PMF A;  3OEH A;  1JCK B;  5KIX A;  2B2U C;  4NMZ A;  2ZTN A;  3EJI A;  2Z8L A;  4BA2 I;  2PPB C;  1TS2 A;  4GZY C;  1Q1B A;  4IUV A;  1II3 A;  1SBB B;  1SEB D;  2X6Y A;  1TWH B;  4IFD H;  1BUV T;  2KEC A;  4XQQ A;  1K8O A;  1U4M A;  3OAA A;  3GVJ A;  1DJR D;  3NBH A;  4XN3 A;  3EVQ A;  3HOY B;  1DCZ A;  1H9J A;  2ZXO A;  5E1F A;  3MA2 B;  3N6R A;  3GTO B;  3LNN A;  1JWM D;  1FNW A;  4JMQ A;  3BVM A;  4EQN A;  1RTO A;  4DXF A;  4XL9 A;  4FO2 A;  5DM7 3;  3GTJ B;  2PCF B;  4L8J A;  1SMY D;  2B8G A;  2XND A;  2PMZ B;  1B9N A;  3PIO 3;  3P7J A;  1TS4 A;  1NAP A;  3RZD B;  1EEI D;  1S5E D;  2NVY B;  1I6V C;  4RFB A;  2XGJ A;  4HMI A;  4Y7N B;  2IT1 A;  5DAU A;  2JXM B;  1PRT F;  1EL0 A;  1R4Q B;  4ZUJ A;  3QOJ A;  4G7W A;  2Q8I B;  3A7A B;  1IW7 D;  2F4I A;  4TSS A;  3JAM L;  1CK1 A;  3A8K E;  2KEE A;  2LKV A;  2RDG A;  1DYQ A;  2KCC A;  1PRT B;  2X6W A;  4K6L A;  1A2T A;  2B39 A;  1PFB A;  3I90 A;  2HQE A;  1TII D;  3D8G A;  3BCF A;  3EQL C;  2CW0 D;  2BDN A;  4G6I A;  1ROD A;  3A55 A;  5A2Q L;  1ET9 A;  1X3Q A;  1B4O A;  3WOF A;  4FF3 A;  2H4O A;  4XLC A;  1HXY D;  1U4P A;  1KMH A;  1SNC A;  1QCB D;  3A56 A;  3BS1 A;  2JA6 B;  1W0J A;  3C2P A;  2X85 A;  2NN6 I;  1I4X A;  5IIF A;  2KED A;  2ZXH A;  4C2M B;  1B44 D;  1HTP A;  2LZJ A;  1SKY B;  3E6Z X;  2F0E A;  5F2D A;  4B9X A;  2A6H C;  3OIQ A;  3MTS A;  2ZXR A;  5EBC A;  2SDF A;  3KF8 A;  5G3L D;  5M5X B;  1CFM A;  5C44 B;  3HOW B;  3D6C A;  4Z9C B;  5FO7 B;  1EYD A;  5KNC A;  2ZXI A;  2N55 A;  2F0F A;  4OO1 G;  5JEA H;  3BDO A;  3GV6 A;  3KLS A;  4RAU C;  1MSH A;  4K5X A;  2EE1 A;  2AQ2 B;  4BY1 B;  2GJP A;  1STB A;  4L6T B;  3VYT A;  3QWN A;  5M9O A;  1QE6 A;  3Q0A A;  1F2L A;  1T5X D;  4K8J A;  4RWS C;  3T16 A;  3NTI A;  5J39 A;  2SNS A;  4XON A;  3MFG A;  1CZW A;  2VUM B;  2Y0S B;  2X6G A;  3IFD A;  1C4Q A;  1DOL A;  2RBM A;  1U4L A;  2XNA C;  1ZKO A;  2FJ2 A;  4MIU A;  3R93 A;  3GTG B;  2K33 A;  1GUT A;  3CES A;  5K5P A;  4NNJ A;  4IZ8 A;  4K14 A;  2ZZG A;  4RGM A;  2O2L D;  1LTI D;  4XR6 A;  5AFW A;  3FVQ A;  4IFD J;  2BOS A;  1L0Y B;  1CHP D;  3TZD A;  2K03 A;  3HOV B;  1PFM A;  1ZYR C;  3DWQ A;  3OMG A;  5KEE A;  3D31 A;  4V0B A;  3D4R A;  1ILQ A;  2RA4 A;  2K28 A;  1AFP A;  3RD4 A;  2R9V A;  5IT9 E;  4HED A;  3J80 L;  4DXG A;  3CRL C;  2NVX B;  1TWA B;  2F0J A;  2EY1 A;  5CBA E;  1E1Q A;  4C3I G;  2NVT B;  3A3G A;  1OXX K;  2R93 B;  3CHB D;  2PQE A;  2WKC A;  4KY6 A;  3E5S A;  4ZKB B;  2VJI A;  2R7Z B;  1LTT D;  3K6O A;  1EWH A;  1OXS C;  3NWS A;  2A68 D;  4NDX A;  4RH6 A;  4F7X A;  1X32 A;  4IUN A;  4G57 A;  2LS0 1;  3I72 A;  4J1M A;  2DIE A;  2CW0 C;  1AN8 A;  1HFG A;  2F3V A;  1JR0 D;  4XQF A;  3TP5 A;  5C0X J;  2NTS A;  1WTQ A;  4FVM A;  1CM9 A;  3RUZ A;  3SXH A;  5IOD A;  4N9P A;  2F0H A;  1JWU D;  5HGT A;  1QWY A;  1I6H B;  2GK6 A;  1SE2 A;  1EY8 A;  2DN8 A;  2GJK A;  3MAQ A;  1B2T A;  2A6E D;  1PDQ A;  1SNO A;  4NP5 A;  2I07 B;  3QIA A;  1EYA A;  1I50 B;  3EFX D;  3K5M A;  3DDY A;  1ENC A;  2L12 A;  4XM3 A;  1STY A;  4CHT B;  3TSS A;  1B1Z A;  4YXW A;  1V1P A;  4KN7 C;  4ZYS A;  1UD2 A;  4QUC A;  1BCP F;  2QE7 A;  1EIH A;  4X3K A;  5M3M B;  5CV5 A;  4IUR A;  4II2 A;  5IGG A;  1UD5 A;  3Q23 A;  1EOT A;  3GQB A;  2NUC A;  3I8Z A;  4II3 A;  5BN3 A;  1H9S A;  5IGF A;  4A3J B;  1CA5 A;  4IFD G;  5FO8 B;  1KNA A;  3ZPN A;  2KJX A;  1BMF A;  2O5I C;  1G2S A;  4AYB B;  2JDI A;  1T5E A;  4A3K B;  5CV9 A;  1PRT C;  1VMC A;  3GV3 A;  2K05 A;  2Z6B D;  5ELE A;  3URY A;  5ELD A;  2JA8 B;  3HEJ A;  3O13 A;  2BE5 C;  5CV6 A;  1HTL D;  3NE5 B;  2K1B A;  4B3G A;  1IYU A;  2Q8T A;  3M7N A;  4K2L A;  1WTV A;  3G05 A;  1EY4 A;  4XT1 B;  3X3M A;  1K83 B;  2KA7 A;  2NZ1 D;  4KK7 A;  3C1E A;  1HZE A;  3NPP A;  2B2Y A;  1STE A;  2PZW A;  3MFY A;  4MN3 A;  3DUZ A;  3KLR A;  1J9O A;  1KTK A;  5FL7 A;  2EJM A;  3SEB A;  2K5Q A;  4XLA A;  4BY7 B;  4FF4 A;  1E43 A;  3M3Y B;  3F2U A;  3NP8 A;  4XTC S;  1IKL A;  1O80 A;  4IN3 A;  3FDT A;  4XLH A;  2HCI A;  2WJV A;  4EQO A;  2A5H A;  2XIW A;  1PZK D;  3TME A;  2A74 C;  2X69 A;  4ZRZ A;  4WOR A;  2W6J A;  1UD3 A;  2EYO A;  5EPL A;  5M5Y B;  5C0X G;  5LHY 1;  2PNR C;  1H9R A;  4KTA A;  2F0N A;  4OHJ A;  2JJ1 A;  4LK1 C;  2IW3 A;  1WD0 A;  2GK7 A;  1Y1W B;  5EBD A;  1STH A;  5M3F B;  2ID0 A;  3CU7 A;  3KEW A;  2L55 A;  1OHH A;  2EYF A;  2EOT A;  5JPN C;  3S9W A;  5C4X B;  3NBI A;  3OWF A;  3T56 B;  1HUM A;  4E6I A;  1I18 A;  2EJF C;  1E1R A;  4CKE A;  2JJ2 A;  4LJZ C;  3I4M B;  2KHS A;  5CYU A;  2XRQ D;  5DNF A;  1BNZ A;  3NQT A;  1UAP A;  2V31 A;  5FLX E;  1D1K A;  3A54 A;  3HG9 A;  1DZ1 A;  3HP3 A;  2EYJ A;  1Q8I A;  1O7Z A;  2A6H D;  2NBF A;  1TS3 A;  1Q1E A;  2NN6 H;  3HRZ C;  4YEL A;  1ILP A;  3GTL B;  2WV6 D;  2QKI C;  2F3W A;  4FNF A;  5HKK A;  1UNS A;  4XLF A;  3V2T A;  1E0B A;  1AZP A;  1BR9 A;  1A3U A;  2JE6 I;  5IGB A;  5FK9 C;  3S14 B;  3Q22 A;  3QG1 A;  4A93 B;  3OFN A;  5JPM C;  1DD2 A;  2V7Q A;  4UAI A;  1GXD C;  3P1H A;  1OO9 B;  2ZZF A;  2JYO A;  3RMH A;  2F0W A;  3KK7 A;  1ESF A;  4M1U B;  3C1F A;  1EY6 A;  1HRJ A;  1CA6 A;  1TS5 A;  1DOK A;  2ZZQ A;  1KAA A;  2B2V A;  4B08 A;  3T4A C;  1K28 D;  1LTB D;  4UDU C;  2B2U A;  2BCO A;  1JIC A;  3TP6 A;  1A2U A;  3FPU B;  1H9M A;  3S15 B;  1LTG D;  3S2D B;  4C3H B;  1AEX A;  2SEB D;  3MXG A;  1ML0 D;  4DAV A;  2Z4I A;  4RGN A;  2B2T A;  2RSO A;  4N9T A;  4F88 A;  1HA6 A;  2DY7 A;  2D3N A;  1STG A;  1PXU A;  3VA5 A;  1MBY A;  3BC9 A;  1ET6 A;  2A69 C;  1QJO A;  2ENB A;  2E75 C;  4O42 A;  3MC0 B;  3MWY W;  2L11 A;  1MSG A;  4ME5 A;  3GTK B;  2D9U A;  1SNP A;  2EY2 A;  4KY7 A;  5EKI A;  1NBM A;  4QIW B;  3A8I E;  1RTN A;  4F8M A;  1EEF D;  1VDZ A;  2FIN B;  1ZYR D;  5JVH 3;  1G91 A;  3CQZ B;  3LWU A;  2A73 B;  2PW7 A;  5G3L F;  1W6K A;  2K7V A;  1LT4 D;  5I4D A;  5LL6 S;  1GHJ A;  3PUY A;  5D3I B;  1VJS A;  4WRD A;  2BA0 A;  4G4K A;  4RHS A;  1RHP A;  3CP8 A;  3J7A V;  4R8N A;  3CMM A;  3K5L A;  2QCP X;  1K8M A;  1PLF A;  5TSS A;  2V4D A;  1S5F D;  1HFN A;  4KKU A;  2F0G A;  1CTM A;  5KRU A;  1F9R A;  5KNL A;  4RA8 A;  2OEO A;  2F0M A;  1D1I A;  4A3E B;  2JEA I;  2RDH A;  4DK1 A;  2JIZ A;  1E2W A;  1HA5 A;  1SYD A;  2FHT A;  1NR2 A;  2XVS A;  4I7Z C;  5C4J B;  2I46 A;  5I6Y A;  1KDB A;  4A3F B;  4ZKC B;  3NSW A;  2F0I A;  3KLS X;  2RDF A;  4ZQ3 A;  2MUY A;  3TN2 A;  1BF4 A;  1I4Q A;  5IK2 A;  3I70 A;  2ZT9 C;  1WTP A;  2HCC A;  1RD9 D;  1Y8N B;  2F0D A;  2E2I B;  1LT6 D;  2AUJ D;  2MHV A;  3QO2 A;  1PZJ D;  1TWG B;  3U9S A;  4CBV A;  2JSO A;  4EGV A;  5DM6 3;  1EY0 A;  1F9S A;  3TDQ A;  2HDL A;  4EQP A;  3T51 B;  2CK3 A;  3NHH A;  2G9H D;  3SK8 A;  1EYC A;  1V0F A;  1H9K A;  4K5V A;  4KJN A;  2OT2 A;  1EIG A;  1E2Z A;  2TSS A;  4FXG C;  4KV6 A;  3L9A X;  2O5J C;  2RVL A;  4C1N K;  2CQA A;  5EKK A;  4OIJ A;  1DON A;  1L0X B;  4IUU A;  3S1Q B;  1RDP D;  3OHX C;  3ZYY X;  1Y69 U;  2XN9 C;  2RKS A;  4K5W A;  1GUN A;  1UD6 A;  4XXE A;  1PRT D;  1LO5 D;  2F0P A;  2Q8R E;  5ELB A;  3KBG A;  1SAP A;  2BE5 D;  3L3O C;  3ND9 A;  5J22 A;  1NR4 A;  1FGB D;  3UI2 A;  3QOL A;  1JC7 A;  2MJ8 A;  4O1N A;  4K2K A;  1Z47 A;  1Z7T A;  3IFT A;  3KUP A;  1FX0 A;  3R2I A;  3IL8 A;  2WB1 B;  1H8E A;  3MXU A;  1HVX A;  2AWN A;  2WAQ B;  2VB3 X;  3G7L A;  3SVM A;  3JAM E;  4A3D B;  3VR3 A;  1KDC A;  4RKB A;  3NTH A;  1PTO H;  1E2V A;  1FD7 D;  3S2H B;  3FMC A;  2D3L A;  2JP1 A;  4IAL A;  5ELC A;  1Z6H A;  3K5O A;  1PTO F;  2F0T A;  5A2Q E;  1DM0 B;  2GA4 B;  3BCD A;  4ASU A;  1EU3 A;  4UZU A;  1LTA D;  3Q6S A;  2NWG A;  4A3B B;  3MHB A;  3BYY B;  4FP5 D;  2N88 A;  3E0J A;  4FXU A;  1EY7 A;  1SNM A;  5E3F A;  3T13 A;  5C6A A;  2WJY A;  2HLD A;  1W9X A;  4G7O C;  3I3C A;  1NCV A;  2DY8 A;  3HOU B;  4PNY A;  1YNJ C;  4DNR B;  3AB9 A;  2EVB A;  3PUV A;  4OIK A;  3D4D A;  4B3F X;  2PO4 A;  2R61 A;  3BDC A;  3D4W A;  5T1G A;  2X6L A;  2ZTG A;  1Q3L A;  3H0G B;  1A3V A;  1HCZ A;  3CP2 A;  1IHZ A;  3P20 A;  2XRS D;  1EQV A;  1XXG A;  4QF4 A;  2NN6 G;  2EYM A;  2BDO A;  1ICW A;  1UD8 A;  4FF2 A;  1HQM C;  4V19 0;  1OXU A;  5CC4 A;  5CDF A;  3BYT B;  3IKJ A;  3VYR A;  1TQO A;  2B63 B;  5JOB A;  4JBW A;  4XOR A;  3K57 A;  4ZUI A;  5DN6 A;  5E4W C;  3HAG A;  2E1B A;  4H44 C;  1HPC A;  4LMQ D;  3PUZ A;  1S5B D;  2X53 S;  3OMC A;  2EDG A;  4C3H G;  3NQI A;  1SXT A;  2LY7 A;  1NRK A;  1UUP A;  3CRK C;  2E2D C;  1O7L A;  2MP1 A;  5C4Z A;  3OSO A;  1FR3 A;  4XKW A;  1TWF B;  1WVL A;  1E3Z A;  2M00 A;  5IGE A;  4DAY A;  3SHL A;  2L5T A;  4RKL A;  4R8I A;  2F0K A;  3WDN A;  1Q12 A;  1A15 A;  4BBS B;  4XN0 A;  5FKA C;  4TT3 A;  2A69 D;  3I73 A;  1BCP B;  1A3T A;  1CI3 M;  4DA2 A;  4ID6 A;  1CZG A;  1D5Z C;  2L4N A;  3VYU A;  2EJG C;  3IAY A;  2XOK A;  4KJO A;  4RCO A;  5EJW A;  5IGC A;  2IPK D;  1D5M C;  1F2Y A;  1BPL A;  1TVX A;  5EKL A;  1D5X C;  1GJX A;  2DNC A;  2WAC A;  5JEA J;  5D14 A;  1BXT A;  4KHZ A;  5BN5 A;  5T1I A;  3J80 E;  2W6I A;  4PMC A;  4A3M B;  4FXK C;  1NUC A;  5K36 H;  3HOZ B;  4C3J B;  1E79 A;  3P75 A;  4OGQ C;  3K0Y A;  3MZ5 A;  3NUC A;  3W3A A;  1HUN A;  3J81 L;  2KOL A;  4AVZ A;  1HQR D;  2IX3 A;  4FF1 A;  3SK6 A;  4H13 C;  3MXP A;  2TMP A;  1COW A;  4KD4 A;  5E4X A;  3AMU A;  1V8Q A;  2B2Y C;  3FEW X;  1C48 A;  4XDX A;  1B3A A;  4M8A A;  2AWO A;  1ONL A;  4QB4 A;  3DWP A;  5CMD A;  3M4O B;  4TKO B;  1OXV A;  5I2X A;  5I9P A;  2EXZ A;  3W2D A;  1BO0 A;  4I65 A;  2K6A A;  1WTH D;  3OEE A;  2J0T D;  2R6G A;  1CHQ D;  5EQ0 A;  1BCP D;  4NW2 A;  4HSV A;  4DF7 A;  2VJJ A;  2ICE C;  4C1N I;  4DU9 A;  1ESR A;  1KNE A;  4XYQ A;  1TU2 B;  2B2W C;  3I4L A;  5KND A;  4X3S A;  1WTW A;  4X3T A;  3K59 A;  2JA7 B;  1M8A A;  1STN A;  4HCS A;  4CKC A;  3GO5 A;  4FXD A;  3VA7 A;  1XYI A;  3DEO A;  4KD3 A;  1WTR A;  3TBI B;  1CT1 D;  1LAB A;  1SE3 A;  3HS0 C;  2R92 B;  1EFI D;  3BVG A;  2LFN A;  4XKV A;  3LX0 A;  1IL8 A;  1WP6 A;  4PMB A;  5JEA G;  3DHQ A;  2OF1 A;  3GVL A;  2Z4H A;  4CJ0 B;  3RZO B;  2L0C A;  3BH4 A;  1MD2 D;  3RLF A;  3X3N A;  1XTC D;  1E3X A;  2DNE A;  5C3E B;  3J7Y W;  1FYC A;  3BDL A;  1LT3 D;  4HN7 A;  1D6E C;  2K32 A;  3PO3 B;  2WPD A;  3ZIA A;  3M4Y A;  1PTO C;  2AQ3 B;  1GUS A;  1B9M A;  2VB2 X;  4S3S A;  4RCN A;  4KKT A;  2SNM A;  3V96 A;  1C8C A;  4OL7 A;  3PV0 A;  2EYP A;  2NVQ B;  1S5C D;  1XWE A;  1SSO A;  4HCE A;  5ELF A;  2AUK A;  1W6J A;  3K58 A;  1BLI A;  3H3V C;  2X8K A;  2J4X A;  4OO1 I;  2F0S A;  3S16 B;  5CV8 A;  4E0F A;  4NKL A;  4B9W A;  2F0O A;  1QOH A;  1RKN A;  2LMC B;  2R3Z A;  1XX8 A;  2QDB A;  4ODG A;  4J6H A;  1QNU A;  5KYI A;  5J1Z A;  3PUX A;  2XZL A;  2B2T C;  3WOE A;  4TSF A;  4CGY B;  1JOQ A;  4U68 A;  3H6M A;  4CJ2 C;  1LT5 D;  1GOZ A;  1BOS A;  4U67 3;  4HTH A;  2MGS A;  2F0L A;  1RCV D;  2D62 A;  4TRD A;  1M4V A;  1VLY A;  1UEA B;  3BZD B;  3NTK A;  5C3X A;  4G7Z C;  3T53 B;  1EY9 A;  1JE4 A;  3TP8 A;  2Z1C A;  1JOO A;  2K01 A;  2RQX A;  1YNJ D;  2C9O A;  4RGT A;  5JJZ A;  2CVR A;  1KLU D;  2C5C A;  2HUG A;  1TKW B;  4QUF A;  1V1P B;  3K7A B;  1TY2 A;  1O7Y A;  3I91 A;  1S4Z A;  2EZV A;  3SK4 A;  1AZQ A;  4G7X A;  4YEJ A;  1KZL A;  2XWB B;  3S1M B;  3R3O A;  1H9S B;  3ERO A;  1Q90 A;  3M7G A;  5C5M A;  5C0X H;  3FPP A;  3DMU A;  1BCP C;  1S5D D;  3C3L A;  1SYG A;  1AW7 A;  4Z1M A;  3N52 A;  1FNV A;  2VXW A;  3S1N B;  1BBX C;  2NTT A;  1SNQ A;  1WCM B;  4RGO S;  5D3D A;  3A3B A;  3JU4 A;  4XNF A;  4XQJ A;  1EU4 A;  3HZX A;  5JVG 3;  1SJH D;  1SJE D;  4H7B A;  1V43 A;  1G6Z A;  2GJR A;  3BG3 A;  4PQX A;  4TQU S;  5IT9 L;  1Y1V B;  1F2M A;  1B53 A;  4KY5 A;  4CKB A;  3L7Z C;  2IX0 A;  3SK5 A;  4KKS A;  1ENA A;  5IOC A;  1VF7 A;  1KAB A;  1SFO B;  1SND A;  2WZP P;  4ZLT F;  4C3J G;  1SYB A;  4XMY A;  2PW5 A;  4YIJ A;  2YYZ A;  1EQT A;  2D2C C;  1VMP A;  2XWJ B;  5C4H A;  3J7A F;  5I2Y A;  5I6W A;  3GTM B;  4ZAI A;  2FMM A;  3HKZ B;  1R4P B;  1SE4 A;  3H09 A;  4J8Q A;  4QCL A;  1DOM A;  4C56 C;  2E2J B;  1G29 1;  4XT3 B;  4BS9 A;  4HAE A;  5HUR A;  5K36 G;  1PFN A;  4RHR A;  3H91 A;  2IL8 A;  3NK9 A;  4DAP A;  2M2L A;  2IX1 A;  4MHE A;  2MPM A;  2EY6 A;  5CR3 A;  3HGB A;  4IFD I;  3BVZ A;  3PUW A;  3OOC A;  1F2Z A;  2PZT A;  5COY A;  1KLG D;  2EPB A;  2PYK A;  5FO9 B;  2IJ0 A;  4IUT A;  5CBE E;  4XQN A;  3LWE A;  4CJ1 B;  1X3P A;  3GP7 A;  1ENF A;  1V0E A;  5CV7 A;  2RSN A;  5KGU A;  2E76 C;  1NSN S;  2FMC A;  3CKI B;  1TWC B;  5EPJ A;  1STA A;  1IKM A;  2QIL A;  4DGZ A;  1OXT A;  2F1M A;  1GHK A;  4DFA A;  4P2C B;  5ISR A;  5CGK A;  1I4R A;  4HIZ A;  2WSS A;  1J8I A;  1PTO B;  4BWG B;  1UD4 A;  2EYH A;  4EVO A;  3DEP A;  2F0Q A;  3DM1 A;  3ND8 A;  1I8D A;  1QB5 D;  5D65 A;  3NXW A;  1QNK A;  3ERQ A;  5KNB A;  1LTS D;  3DWA A;  1B50 A;  4HR7 B;  1SMY C;  1QIL A;  3A35 A;  1G8Z D;  2L9H A;  2K5W A;  2XZP A;  2WKD A;  3FKS A;  5C0X I;  4WFN 3;  2B8F A;  3VYS A;  5C3W A;  4R9W A;  2E2H B;  2EYL A;  1EZ8 A;  1I4P A;  3SE0 A;  3OW7 A;  4P22 A;  1JQY D;  1IW7 C;  1YNN D;  4HMJ A;  4Q5V A;  4ILW A;  3FRP B;  2EY5 A;  3MXN A;  1BDO A;  1DXM A;  1PKV A;  4ABN A;  3WQZ A;  4BBR B;  4PMW A;  1MAB A;  5C5L A;  2WII B;  4A3G B;  1JB3 A;  5FOB B;  5DEH A;  3EA6 A;  3G6J B;  1F77 A;  1OB0 A;  5CV4 A;  3DXJ C;  2FFK B;  1Y8P B;  3OIP A;  1CQV A;  2F0U A;  1LV9 A;  2KVO A;  1ZXT A;  2ZXP A;  3QJY A;  2K04 A;  3GD7 A;  1PTO D;  4JK1 C;  4K6D A;  3A7L A;  2M5S A;  4L63 B;  4BA1 I;  1GUO A;  1EWC A;  2X6X A;  2ICI A;  3ITP A;  2BA1 A;  2ZZE A;  5FLX L;  3SDZ A;  3R2T A;  1CQF A;  1EZ6 A;  1LAC A;  3S1R B;  4G7H C;  3TP7 A;  2H1E A;  3TZU A;  1EY5 A;  2NB0 A;  4A3I B;  2CHB D;  4KHV A;  4OO1 H;  2IWH A;  1MI2 A;  2M9V A;  1SYF A;  3NWT A;  2L1B A;  1SDF A;  4DNT B;  5BN4 A;  5I9O A;  2XSC A;  2OXP A;  2KVM A;  1AP0 A;  1H8H A;  3A8J E;  4ZK9 B;  5NUC A;  3OWE B;  4XLE A;  2F0V A;  3VR6 A;  4HSP A;  4DK0 A;  3VR4 A;  1I4H A;  3H94 A;  2F03 A;  1PYW D;  5A35 A;  4QMG A;  1RJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...