3T53B

Crystal structures of the extrusion state of the cusba adaptor-transporter complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 55
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t53B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t53B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t53B01
1Z6HA 3ND9A 1HTPA 1VF5C 2D2CC 1Q90A 3LWUA 4OGQC 5BN5A 2PNRC 1LACA 4I7ZC 3VR5A 2A69D 3PUZA 3EQLC 1CTMA 4TQUS 1IYUA 3GQBA 2V4DA 1GUNA 3M4YA 4XTCS 2BA1A 1DXMA 4DNTB 1GUSA 1IW7D 1GHJA 3VR6A 3PUWA 1E2VA 2K33A 3T56B 1GHKA 2QF7A 2AUKA 3A8IE 3P20A 1LABA 1V43A 1H9KA 2A6ED 4H0LC 4BA1I 3M85A 1V8QA 2PPBC 3QJYA 2K7VA 2O5JC 2DNEA 2A6HD 1E2WA 1HCZA 3PUXA 4LJZC 2AUJD 2L5TA 1Y69U 4OO1H 3RLFA 3QIAA 1SMYC 1DCZA 2D62A 4BA2I 1Q1EA 1EWHA 2F1MA 2A68D 1OXUA 1QJOA 2JE6I 3OW7A 2BDOA 3T53B 1CFMA 3A8JE 2O5IC 2A69C 1YNNC 2NN6I 1A6XA 1ONLA 1VCIA 1HQMC 5C0XG 1E2ZA 4PV1C 5JEAH 3IKJA 2ZT9C 3FMCA 1OXVA 3N6RA 2A6EC 1OXSC 1GUGA 4IFDH 4IFDG 4DK0A 1HPCA 1H9SB 1O7LA 3LNNA 2A6HC 3GD7A 1GJXA 2BA0A 1Q1BA 3PUYA 3D4RA 1OXXK 2BE5C 1ZYRC 4H44C 2JXMB 2EJFC 5KNDA 3I4LA 4L8JA 3MXUA 4KMUC 3BDOA 2B8GA 4TKOB 1CI3M 3M7NA 3AB9A 3CRKC 1O78A 2DN8A 3NE5B 4IQZA 2IT1A 1H9RA 1VF7A 2DNCA 2LMCB 2NN6G 2EDGA 4RCNA 3ND8A 5K36H 2E75C 3VR3A 3CRLC 1G291 2E74C 4KKUA 1H9JA 3MFYA 3U9SA 1Y8OB 1T5EA 4JK1C 3L7ZC 3T51B 1B9NA 3HGBA 4XIGS 3A7AB 3SE0A 3WDNA 2BE5D 1Z7TA 5KNCA 5BN3A 3OPOA 3I72A 1Q12A 2CW0C 4OO1G 2JEAI 3A7LA 3BG3A 1IYVA 2A68C 1OXTA 3PUVA 1GUOA 1Y8PB 4KN4C 2KA7A 1VDZA 4GZYC 3W3AA 3DXJC 1B9MA 2PCFB 3TZUA 1K8MA 1DD2A 3PV0A 4DK1A 2EJGC 5JEAG 1FYCA 4LK1C 2AWOA 1I6VC 3SDZA 1BDOA 1IW7C 2KCCA 2Q8IB 5KNBA 3QG1A 1Y8NB 2JEBI 5C0XH 4KKSA 4KHZA 4DNRB 1K8OA 1PMRA 5BN4A 1YNJC 3VR4A 2YYZA 2R6GA 3H94A 4KKTA 4KN7C 3VR2A 5A35A 3VA7A 3FPPA 1ZKOA 4JBWA 4G7OC 1H9MA 1TKWB 3D31A 3IFTA 1TU2B 1H9SA 3KLRA 2E76C 4H13C 4KI0A 3I73A 2EVBA 1GUTA 2EJMA 2B8FA 2K32A 2NN6H 3A8KE 5K36G 2D5DA 4G7HC 4G7ZC 1FR3A 3OOCA 4HR7B
chains in the Genus database with same CATH superfamily
3KF6B 2QTZA 2NVXB 3HAGA 3GTOB 1FRNA 2K5NA 2WV6D 3VR5A 4DUYL 1W9XA 2EY6A 1STHA 3HKZG 3VYSA 2WB1E 3TBIB 5M5XH 3JQRA 3CC2B 2I5MX 3I2ZA 4C3JB 3A35A 1K8AD 4LF7L 4CGYB 1VQCA 4AH6A 2PPBC 1K83H 1VQPA 4UHVA 2BGIA 4M8AA 3IL8A 1ASZA 3M4OB 4XQFA 1K9MC 3FKIG 4HN7A 2A6HD 2Q8RE 2EQSA 3TREA 2DJGC 2GJRA 3OP1A 1SXTA 5C3WA 1HNZQ 2XRQD 2GREA 2V31A 1IHMA 2JJQA 4LC0A 4MIUA 3MCAA 1PH8A 5C3EH 4PC7A 3STBD 2RKSA 2JQOA 1EY8A 3S9WA 4JG2A 2NZHA 1QFYA 2L1BA 3URYA 1TR5A 4NBSA 1WD0A 1ASYA 3S15H 1E2ZA 1OGJA 1HQRD 2EYMA 2VQEL 2OYNA 2ZT9C 3UE1A 2M2LA 5A2QL 2R9VA 1OXSC 2Q8TA 1LTLA 5IYCG 4DNIA 1ZM2A 1IBML 4WZKA 4L5TA 2K5HA 4BBRB 2ZITA 2BV3A 4A3FG 5IGCA 3W2IA 1Q1BA 1I6HH 4G7XA 3BVGA 4Q5VA 5EBCA 1BR9A 2WKDA 1MJCA 1BPLA 1BCPD 4PMWA 3CCUB 5FLXE 1LV9A 4JYAL 1EYDA 3FPKA 5T1GA 4O0AA 4NMZA 5M3FH 4JI6L 2A73B 5A89A 4KK7A 3CCRB 4XONA 4AF7A 5E4XA 4KHPQ 2F4NA 4AYBB 1L0XB 1QVCA 4GNXA 2E74C 5C3EG 2ZTEA 4DF7A 4OPSA 2M5SA 3RZDH 1YI2A 2KCTA 3CC7A 4NXMQ 1VQGA 3ASSA 2QA4B 1VQ5B 2GN5A 1YHQA 4MN3A 5JPMC 5COYA 3F1ZA 3R6KA 2VBVA 4YAOA 3AFPA 1KRSA 2PQAA 4XYQA 3I4MH 4II3A 2F1LA 4OO1I 2IHEA 3FKIH 1VQ8A 3OEHA 4DQLA 4XKVA 1JJCB 1LTTD 2MO1A 3CCUA 4GKKL 4BBSG 5HURA 4DPGA 2NV4A 2K5DA 1HFNA 5I9PA 4ASUA 5EPJA 3HOZH 1PRTB 3J80c 1B50A 3G6EB 2AWOA 2F0KA 1UE7A 1LO5D 2X0KA 3RLOA 3AGQA 3G4SA 2R93G 4N9TA 3S17H 2ZXPA 3KDFB 2MP1A 1DOLA 3VA7A 5IOCA 3ULPA 2ALYB 2K14A 4TSFA 1IKMA 1PHJA 2E8GA 3SK6A 3RR5A 2EJMA 4OOSA 1L1OC 4HIKA 4IPCA 1Z6HA 1L0WA 4JCVE 4XN3A 2UUBL 4A3DG 1LT6D 3PO2G 2HD3A 2MJ8A 2DY8A 1YJ9A 1KNEA 4QV2A 2BA1A 4K5WA 1GHJA 4RJLA 4DV2Q 5JVH3 1WOCA 5TY0A 5E3FA 1LABA 2DY7A 3FVQA 4FO2A 2GK7A 4G6IA 2XWBB 4II2A 4R4OA 2JK8A 1M90C 4N3NA 5G3LD 4Z4WA 1EQVA 3Q38A 1MBYA 2HIXA 1DCZA 3H6MA 4HJ9A 2F0IA 3OW7A 2R93B 2J0TD 1J6QA 3NK9A 2D0OA 3DLLA 4RWSC 1JWSD 2O5IC 2HIVA 4KHVA 3RZOB 4AIMA 2CCZA 4DUZQ 1LTGD 5CV9A 3HEJA 3RZOH 2I07B 2X69A 4A3BG 2UUCL 1MKHA 2CFMA 3U6KA 3DDYA 1BOSA 4Q7JB 3AQQA 2XNAC 1ELOA 5C4XG 1HPCA 1XMOQ 1S3OA 3NTHA 1GJXA 2NPFA 4DQKA 1M1KD 3MAQA 4WZLA 4AF6A 4IUPA 4JI2Q 2ZM6Q 4B3SQ 1WTVA 1G2SA 2Z4HA 5KNDA 2LZJA 5KSWB 1CHPD 1B2RA 1F2MA 2XIWA 3ULLA 1SSOA 1CNEA 2RDFA 5M3MG 1PDQA 4BY7B 1PFNA 3MXNA 3BS1A 1VF7A 5K36H 5IGFA 1QUQA 1T6YA 4BY7H 1BXTA 2OTLB 3L7ZC 4QVJA 1V9PA 4JI3L 2VL6A 1R9TH 2J7ZA 2PO4A 4A3FB 1S5BD 3TEHB 2ZXRA 4ZYSA 1W0JA 4JI6Q 4QF4A 1QNKA 2R7FA 4HSVA 4JI7Q 4XLHA 2B2YC 3V7AA 1GAWA 1VMPA 1BNZA 3AU7A 1LYLA 3K6OA 2F0HA 4JI8L 2JEBI 1EFRA 3FJOA 4XNFA 4QL5A 4DNRB 1ET9A 1I5FA 1CQVA 5J1ZA 3I56A 3LGJA 1KABA 3H94A 3PCOB 2VNKA 4LFAQ 5ELCA 4UY8C 3CCJB 3KLRA 5M5YB 1PFBA 5HGQA 1NB9A 3B8HA 1LLRD 2D5DA 4G7HC 1W2BB 1JMCA 1HTPA 3I1FA 3KEWA 1X32A 4I7ZC 3W5VA 5LL6S 5CC4A 5FLXc 2XEXA 2DYIA 1OB2A 2I5HA 4B9WA 2QMUA 1W6KA 4OXPA 4XQQA 1IW7D 5DNFA 4B3RQ 2MPMA 2BH8A 1UD2A 2LXKA 3VDYA 3R6JA 2K4KA 3X3MA 3M85A 4DV6L 4RAUC 2UXBQ 3ICEA 2VYQA 2WFWA 1GM5A 3SK4A 3AVUA 3AVVA 2EY1A 1ZM9A 2KUMA 2YTXA 2K75A 1WOSA 1TWGH 1V1PB 4KHPL 3OKXA 5EGTA 2F1MA 1A15A 1I4PA 1XMOL 1QVFA 1J9OA 1ZUNB 1RL2A 3WNDA 2A69C 4B3XA 2F3IA 1XXGA 1I94L 3VO2A 4PC2A 3VO1A 1U9RA 3GTOH 3CAMA 1NNXA 1Q3LA 5JEAH 3GTMB 2BM1A 3MHPA 2IPKD 2ASBA 1QVGA 1S0UA 1AZPA 5IGBA 4IFDH 3HOVH 1W2BA 5LMNL 1UUPA 4P3IA 4NXNL 5JVG3 4OX9L 1IBKQ 1K73D 4RDJA 1GKHA 2F0FA 4DV5L 4P25A 1JOOA 5I2YA 5CORA 4B3TQ 1WYDA 2VBTA 4KMUC 1GVPA 5HY6A 4OX9Q 1JOQA 1ZM3A 3OHXC 3DEPA 2B63H 3OSOA 4JI1L 2KEEA 2OTJA 1SYBA 1PH1A 4P75A 1WDTA 1AE3A 4V190 1SMXA 1NMGA 1PXUA 1F77A 4A3MH 1VQ4A 4G1BA 4JK1C 1RJTA 3T51B 4JPBW 5GAEC 1EYCA 2WZPP 1X3GA 4IURA 4YWLA 3A5UA 2YU9B 1UD6A 3I72A 2DCUA 2A68C 1HZAA 3U2QA 1V0FA 1AEXA 1VQKB 1ZYRD 1PTOH 4XT3B 4GLXA 4KTAA 5IYPA 1F9QA 1QE6A 3BY1A 4PC1A 3E3XA 2BN4A 4YY3Q 3NQTA 2EJGC 4DR1Q 1AFPA 1FYCA 2F0DA 1HZCA 2Z6KA 1IW7C 2KCCA 4NNJA 1CT1D 4U68A 1EFWA 4NXNQ 2QDBA 4NDXA 3T1YL 2A74C 4KN7C 3KFUA 1SYFA 3BYTB 3K7UC 1H9MA 4B3MQ 1QNUA 2ENBA 1XNRL 4CDDC 5K5PA 4NW2A 5E7NA 4H13C 3TP8A 1NCVA 2EVBA 3G6EA 3PF5A 5BSYA 5K36G 1SMYD 1RCVD 3L3OC 5JOBA 3EQLC 3OOCA 4DUYQ 2VJIA 2D2CC 3GP7A 1JA1A 2C77A 3DWQA 4N8X1 3STBC 5DM63 4RMFA 2A69D 4DFAA 3M4QA 2CC2A 4RGTA 4K1XA 3GQBA 4RPBA 3U4VA 1FDRA 1UEBA 1HR0L 3VYRA 3OW2B 1V5VA 4ZGNB 1JT8A 2YV5A 2DGYA 1V43A 5DEHA 1IB0A 2ZXIA 3I3CA 1Y1WB 2B29A 2VUMG 2F3VA 1OGIA 1PJ6A 4TMWA 3NHHA 2Y0SE 4LJZC 4P71A 2PW5A 3RZDB 1SMYC 1EU3A 2CWPA 4DV7L 3QFTA 1GO3E 1G8ZD 4JOIA 2G5DA 3J80E 1WCMG 1PV4A 1IBMQ 2E2IB 1EOTA 4OIKA 3JC66 2GA4B 5ELBA 3TQYA 1ESFA 1C4QA 4DA2A 4PGOA 3HOYH 4QB4A 3KF8B 5C0XG 4XLEA 4IPDA 1VQAA 3K7AB 1XYIA 3D8GA 2PI2E 2X6GA 3N6RA 3MWYW 3HOZB 3C2QA 4GKJL 5KIXA 1K0SA 4R4TA 5ISRA 1ENCA 1KLGD 5TSSA 3F2DA 1XPUA 1IBLL 5LMUQ 2WZNA 1PYSB 1WTHA 4B48A 3ZZUA 1N07A 4L8JA 3W2FA 1ZXTA 4R4IA 5M5WB 2L9HA 4ZKBB 1UAPA 1NBMA 2R92B 3EBEA 3NTIA 4M0LA 3R3OA 3AVTA 2CBXA 2LXJA 1EY6A 3S1NB 4XMYA 2Y0SB 1JJ2A 1HUMA 2ID0A 2LMCB 2F03A 2RDGA 1PJ7A 1DOMA 2QN6A 3P26A 5B6IA 3PO3G 3U9SA 2Y0SG 2OXPA 4L5SA 4B08A 5KEEA 1STBA 3A7AB 1PH9A 1MSGA 5L37A 1C9OA 1E7ZA 5KNCA 1XTCD 1M1KC 1BLIA 4RHSA 3DM1A 5FA6A 5DN6A 2KA7A 4HJ8A 2XZPA 1PJ5A 2NB0A 1DD2A 4KJNA 4C3JH 4DK1A 3KOJA 1B23P 4LK1C 4JI4Q 3V2TA 4P22A 3KBGA 2C78A 2F0WA 3KJOA 2E5LQ 3IFDA 5DLQE 5TR9A 1IBLQ 3ZJYC 3CU7A 2RA4A 4RFBA 1VQ7A 1AP0A 4R4CA 4F8MA 1TKWB 2J4XA 2B2VA 3P7JA 3H0GG 3OJXA 4KI0A 3MVVA 1UE5A 1BQQT 5J22A 4A3FH 2B5OA 2ZJRA 2VNHA 1ESRA 4H7BA 2F0SA 2X6WA 1MI2A 5C6AA 3V05A 2JYOA 4IJHA 1YJNA 4A75A 4K2LA 1CTMA 4LMQD 4ZV4A 1EZ8A 4NPSA 3X3NA 3M4YA 3C1FA 5IYBG 1E3XA 4R71A 3CB4A 3T56B 2Q2TA 1MIUA 3UDFA 2D9UA 3RUZA 4XM3A 2A6ED 3I8ZA 1NR2A 4Z4RA 1K73C 4X7FA 1FNVA 3ERQA 1E1TA 2DNEA 1VQPB 2WACA 1H8HA 1EU4A 1A2UA 3CD6B 1D2EA 2UUAL 3K5NA 1OXUA 5JBQA 4FP5D 3NQIA 1HJPA 1E3ZA 4Z4SA 1EY4A 1II3A 1GVHA 1CFMA 1STEA 3QOJA 5CBAE 3E1YE 1ONLA 4C1NI 5EKLA 3BH4A 1YHBA 4XORA 4PG3A 3I91A 5A2QE 4FNFA 1I94Q 3EFXD 3S2DH 1FNBA 3TP6A 1QX4A 3K81C 3OZWA 1RIPA 1X3EA 4IW3B 3DEOA 5FOBB 2LY7A 2IX0A 3BJUA 1YNXA 1A3UA 4OWWB 1GXDC 1CKNB 4PQXA 4UP8A 3S1QB 2JA7B 4CJ0B 4X3TA 3CCSA 5C44G 3MXUA 4Q0FA 3H3VH 3MTSA 5E4WC 5GV7A 3SLDA 1E1RA 5A8AA 2VB2X 3QB3A 1EP1B 2EFGA 4X7CA 3PIO3 4J8QA 3SK5A 2XTIA 4G57A 3BU2A 3OW2A 2X53S 1IL8A 3CRZA 4YWMA 2M9VA 1YNJD 4GNXB 3DHQA 2V7UA 1AE2A 3TMEA 1WP6A 1VQOA 3WXMA 4KY6A 1OO9B 1F9SA 4HIOA 3SVMA 4RDLA 3KDFA 1FVIA 3HOZG 5FNZA 4HJ7A 1EQQA 2FVGA 1A62A 3SDZA 3V76A 3UE0A 5KNBA 2QCPX 3BVZA 4C1NK 3QG1A 5C0XH 4KKSA 5FJ8H 4OOXA 3OIPA 2JN4A 3UI2A 4FXUA 4WWVA 5EMNA 1WCMB 1Y1VB 3K5OA 1VQBA 2B2UC 4A3LG 2F0MA 4B3TL 5EAYA 5JPNC 2IX3A 5THXA 4TVAB 4KD3A 1C7YA 2RSOA 2SOBA 4A3EB 3GDEA 5FLMG 4DXFA 4FXDA 1SFOH 4A3EH 2G9HD 4YAUA 4HE6A 4OOVA 3PUZA 3F2UA 5M5XB 4P74A 1KL9A 3HP3A 1XQBA 3AVYA 1G7TA 4C43A 3GTLH 1FGUA 2QF7A 2CH4A 2F0TA 3QR8A 4ZLTF 4Z4UA 3HOXG 4K0KL 1UD8A 2AQ2B 2H4OA 1E2WA 4RCOA 2JA5B 4JI2L 2L5TA 1QUQB 4PABA 5CV4A 3HOYG 3P1HA 1XE1A 3VNUA 1LTSD 1VQEA 3E9HA 3PF4A 1D8TA 3H0GB 3PIPA 1EXMA 2R7DA 4RM0A 1SJED 1WTPA 1YHAA 2IL8A 2XOKA 3K8AA 1QUEA 3ZPNA 4PV1C 3JU4A 3FMCA 5CV6A 4DR2L 3K57A 1N34Q 2A6EC 2C4UA 1GUGA 3DWAA 1UEAB 2F0GA 4XXEA 1H9SB 1KK3A 3CMAB 4IPHA 1JA0A 1HZEA 2A6HC 3TS2A 1EFTA 1DDGA 4DR5L 4Y7CA 4EX5A 1ZYRC 5IT9E 2YU9H 2KCNA 3E20A 4LFAL 3GTQB 1EZ6A 1FNDA 2JA7H 3ASQA 1PLFA 3PO3H 4IZ8A 5IK2A 2QGGA 3M7NA 1STNA 1PZID 4JI5Q 1O78A 2Z6BA 4F7XA 4IQZA 3VMFA 1U4MA 1QG7A 2VXWA 1QILA 3TSSA 2E2IH 3A3BA 1CQFA 2RVLA 1SNQA 2C35B 2F0EA 2V7QA 1X6OA 3RLNA 5H59A 4ID6A 3H3VC 1B9NA 1U4RA 2K5WA 4GN5A 4MHEA 1UNSA 1E3PA 3I4MB 5F4OA 2R92G 1Y0RA 1SR3A 3AYHB 1TWHB 3KK7A 3ER0A 2QTLA 4OELB 4YALA 3A7LA 2VB3X 3V96A 1YJWB 3I70A 4GKJQ 5IGDA 2UXDL 1KLUD 3CXCB 1HNXQ 2HDLA 3W3AA 2L55A 2XVSA 4HJ5A 3K5LA 4R8NA 4GOPA 4A3IH 1C8CA 4KHZA 1RHPA 5CR3A 1FNUA 2HUGA 3H15A 1YNJC 3W1GA 3K58A 4IALA 4GLAC 4QVAA 3HOUH 1O80A 1EP3B 4QHYA 4XT1B 1G2TA 2JA9A 4A3IG 3FKSA 3BCDA 3FPUB 4X06A 4YXWA 1QVGB 3DM3A 2WB1G 1Q90A 3A0JA 1TY2A 4RKBA 3WYAA 1Y1WG 4ZUJA 2KHJA 4B9XA 1VHEA 1DXMA 1I4HA 4LFBQ 2PW7A 3NBIA 1JJGA 1V1PA 1SN8A 2I5LX 2WB1B 4BXXH 4WZEA 1QVFB 1E62A 4WZTA 5E6TA 1L0YB 4LUVA 2OTLA 4ZCLA 1H9KA 3D26A 5JJKA 1KK0A 1I3QB 3FRPB 4FF3A 1ILPA 1BX1A 4A3DB 2K05A 1HCZA 1M8AA 2C4TA 1Q82C 1BBWA 4DR3Q 4DR2Q 2OF1A 3QIAA 1KC8D 2E1BA 3U4ZA 2D62A 1C48A 3G05A 4FXGC 1QUFA 1TS2A 5D65A 1B44D 1JB9A 4WQMA 4POGA 1LTID 2HT1A 1YNND 1JICA 5TRDA 3D0FA 5LL6X 2BPOA 1XWEA 2PZWA 3S1MH 4WFN3 1LT4D 1OXVA 4X3SA 4RCZA 3U6BA 4LBYA 3NELA 3ZBTA 1XPRA 1ENAA 4K6DA 1WD1A 2UXBL 5GV8A 1SKQA 3ZYYX 3EJIA 3CF5A 2UXCQ 3AMUA 2F4VL 4X66L 2E2DC 1SNMA 4QJFA 1JWMD 1BF4A 2EE1A 3P75A 4DN4M 2X6LA 2JA6B 1KTVA 1JE4A 2MHVA 2ZTGA 3DWPA 1WTXA 1FX0A 4FDBA 3AB9A 4OONA 1NR4A 1DONA 4ZUIA 2CWAA 4EQ5A 2CF4A 1KAWA 3MXGA 3D4DA 3CXCA 4KKUA 3CCSB 3ES9A 3ZUGA 5IIFA 4B3FX 1SBBB 3GO5A 1IBKL 1X3PA 4DR4Q 3U9OA 2RC6A 4GN4B 1R5OA 3JAMi 1TWHH 1EY0A 3ULJA 4GZYC 2X3UA 4UPAA 2ICEC 1T6ZA 3PV0A 1SNCA 4IUQA 1XB2A 3L2PA 4DR7L 2B2TC 2PZTA 4C56C 4J15A 2PLFA 3PIOA 4DV1Q 2D3LA 5I6YA 4DKAC 4JYAQ 1D6EC 3G71A 4EQNA 2ZXHA 1COWA 1NSNS 4X66Q 1VHOA 3PA2A 3D31A 3CPXA 2JA5G 5BSXA 2FFKB 1H9SA 3ASTA 1Q82D 1SM4A 2FMMA 1WJJA 1GUTA 4ME3A 4QIWB 3HOXB 1E1QA 4DV0Q 1KTKA 3ISXA 1GAQA 4DAMA 3GTJB 2B7CA 3QOLA 4Z9CB 1MGSA 2H1EA 2WAQG 1IYUA 3J81E 2WAQB 2BM0A 4ZRZA 1AZQA 2IX1A 2F0NA 4HMJA 1B7YB 1UE6A 3CC4A 4XR6A 2OQ0A 1D5MC 1DM0B 1HA5A 4GOPB 4JBMA 3EROA 3S1NH 2BMWA 4MYUA 3PUNA 1EY9A 4XLAA 1PYWD 5ELNA 4A3EG 4RHRA 1B3AA 2UU9Q 3MA2B 5M5WH 1HZBA 3IRBA 4FN5A 1YJWA 1VQMA 1TT2A 4GS3A 3RN5A 4HIDA 4BA2I 3W2GA 4NB3A 2K5VA 2LKVA 1KRHA 2KCMA 2QEXA 4P26A 4X65L 4P12A 4JI8Q 3QO2A 3ZZ0A 2JN9A 2RQXA 1XJVA 2Z6BD 1BBUA 3S17B 1JR0D 2VJJA 2PMZE 4RGOS 1HQMC 1Q7YC 2ICIA 1B1ZA 1IHZA 1K3BC 2NVTB 4BBSB 4X65Q 4EQOA 3TP5A 2EPBA 2N8NA 1PH3A 3PUMA 4YWKA 2EY5A 1O7LA 3GD7A 2BA0A 4B47A 5KW9A 4X07A 3AGPA 1VQHA 4Y9RA 3H09A 2UXCL 4IN3A 4JMQA 1N32L 4I65A 1P4MA 3J7AF 4QUZA 4FYDA 2R3ZA 5E1FA 4AYBG 2B8GA 3Q22A 3ERSX 4HMIA 1DZ1A 2IWHA 4LWCA 5CYUA 2EYLA 2N55A 1KQSB 1N36L 2KOLA 2JA6G 4QIWE 3GVKA 1G291 3CESA 4LW1A 4YHBA 4PC3A 1LT5D 5C44B 1MSHA 2C9OA 2K5QA 1CUKA 2JA7G 3E0JA 3O13A 3SE0A 3T4AC 1EL0A 1HA6A 1B8AA 4HSPA 1IZ6A 2K6AA 1S40A 2HCIA 1BCPB 3D6CA 4FF1A 1SRUA 1I18A 3PUVA 3VYUA 1ZEQX 5C4XH 3LVBA 3IAYA 3NWTA 2BH2A 1D5ZC 1Y14B 4OPOA 1PH6A 1TVXA 3CPWA 1FJGQ 2VW9A 4FWTA 1PTOF 3H0GH 4ROXA 4LBZA 1CKNA 4R9WA 3CCMB 3FEWX 1ZKOA 4DAVA 1M4VA 1WFQA 4J1MA 2YWGA 1T9HA 5IWAQ 5CV7A 1RQRA 3SGIA 2OT2A 1W6JA 4DK3C 4ZKCB 1B53A 1MJEA 4RPDA 1SNPA 2B8FA 3MEFA 4RLZA 2FJ2A 3GTPB 2V7TA 2EIXA 3S2HH 1HXYD 2P5ZX 1DDIA 5J3BA 4JI7L 1JB3A 1I4QA 2CH4W 4C3JG 3HOXH 3LWUA 1BCPC 2PNRC 3I7FA 3F2BA 3S1RB 4XTCS 3NSWA 4PMCA 2V4DA 3HKZB 4DNTB 4X6AH 1E2VA 4XDXA 2EZVA 2QDXA 3WOEA 1K8AC 5HXBA 1STGA 3A8IE 1QGZA 2F4IA 4A3IB 2K04A 5IYCH 2ZL6A 2HDMA 1VQNB 2AHOA 2NVYH 3PUXA 2AUJD 1Q8KA 4WJ4A 1Y69U 4KLKA 3UDIA 3HOUB 3HKSA 2B39A 2J7KA 2JJ1A 3OAAA 4P6VF 1QJOA 4XOPA 4A3LH 2HCCA 1FNCA 3WWVA 2MFIA 4ODGA 5A88A 4S3SA 2VBSA 1VQOB 1HFGA 3CC7B 3K7AH 3SEJA 1PVOA 1A6XA 4OPVA 1VCIA 1YHQB 2O4XA 2VBUA 5FLXL 3ASRA 2PMDA 1TTTA 4OL7A 3LX0A 1TVCA 3H3VI 1G51A 2EIFA 1TWAH 4UAJA 4FF2A 1EOVA 2KQ3A 2I1LA 4PC6A 1QFZA 1I50H 2PE3A 4O42A 3CCQA 5JJZA 3PUYA 3D4RA 4DR3L 4M1KA 1YEZA 5EKIA 1JORA 2CRVA 2BGJA 1BKBA 1NMFA 4JOIC 4OEMB 4RGNA 2B2YA 2N3SA 4A3DH 2Z8LA 4IUNA 3CW2C 1SJHD 1BO0A 1T5XD 1WCMH 2K03A 3SR1A 1JE5A 5BR8L 2VZAA 2FHTA 4ZGQB 1S5FD 3DMUA 4J6HA 2L12A 1G7CA 5C3EB 1Q81C 4YHHQ 1Q9SA 5C4HA 5DS0A 1E79A 3T13A 2VY3A 3S1MB 1T5EA 2ZTCA 1DJRD 1HZ9A 5CDFA 5KGUA 3CCEB 3WDNA 2GJPA 1PYBA 3OPOA 4I7AA 1IJEA 2OK8A 2ZBUA 2F0LA 4RD2A 5ELOA 2WSSA 3WBKA 3G7LA 1CNFA 2PCFB 5C4ZA 4BBRG 1HNWL 2ZXOA 3MFGA 3CMAA 5EPLA 1BMFA 2QKIC 4K6LA 4ZQ3A 1KIXA 4LF6Q 2Q6KA 4A4IA 5KNLA 1VQFA 1K8OA 5FKAC 1HHVA 5BN4A 1WPCA 4JW0A 4TN1A 3VR2A 5I9OA 3QWNA 2UXDQ 4LF9L 2OK7A 2RCFA 4DAYA 3BNWA 1V1OA 2ZM6L 4B3RL 1BBXC 3A3GA 4G4KA 1VQ5A 1XMQL 3B6YA 4DV7Q 2DIEA 4YELA 3BY2A 3WNBA 4B4DA 1NUCA 1Q46A 4RGMA 3M4OH 2ZL7A 1U2RA 2CW0D 3NEMA 4K5XA 3M3YB 1NTGA 4JV5L 3W5UA 2OWOA 3RNUA 1FNMA 1QH0A 3S14B 4M1UB 1W34A 1GUSA 1QG0A 5IYBH 3J81L 1SNDA 2KHIA 4CKEA 1Q7YD 3F2CA 3D3RA 5GAHC 1CA6A 4XLFA 4LFBL 5G3LF 1NB0A 1I4XA 3PGZA 2XNCA 3PENA 1UD4A 1CZGA 3CP2A 1EY7A 1U4LA 3QJYA 1SEBD 2K52A 4IPGA 3GTQH 4P1VA 4XOTA 2K7VA 2OEOA 1KD1C 1JCKB 4UZFA 5D3IB 1VQLA 3I55B 4DR5Q 3BC9A 2B2WC 1EUJA 2ZZQA 5HZAA 4OO1H 1FNWA 4QMGA 4Y9UA 1H95A 1SYEA 3J81j 1X3FA 1PH2A 1XNQQ 2B63G 4JV5Q 4B43A 2W6IA 2UUBQ 3A8JE 2SNSA 5EQ0A 1TQOA 2JA6H 3D6WA 1W35A 2C5CA 3G4SB 1E0BA 3KYHC 2QEJC 1H8EA 2XWJB 2VQEQ 4IFDG 4LF4L 4AQYL 2KEDA 4ACBA 2ZZGA 4POFA 1TWGB 5M9OA 4IJLA 1F9PA 1FL0A 4EGVA 3F8TA 3U58A 2BE5C 2NVQH 1BQEA 3CC2A 3I4NB 2IY5B 2DY1A 1S5ED 1CK1A 2JXMB 2QDLA 4LAAA 1HH2P 2FX3A 3I4LA 1KC8C 2N88A 3Q24A 1HR0W 4OP7A 3CTAA 4GQNA 2E5LL 2BF4A 4IOAA 2BVNA 3QFSA 5HKKA 2NN6G 2JA8G 3WOFA 5KYLA 4C2MH 1PH4A 3VR3A 4FF4A 2QE7A 3T16A 1PZJD 4AQYQ 1SFOB 4XIGS 2BSAA 1X54A 4Z4TA 4LF6L 2KENA 3AEVA 4X62Q 2I46A 2SDFA 2UUAQ 1KQSA 2XNDA 3E5SA 3Q6RA 3I4NG 5J35A 4C0SA 3C46A 2ZZFA 3GVLA 2BDNA 2LS01 1YVCA 2NTSA 4XQJA 2Q2UA 4LF5L 3BDCA 1N0VC 4X64L 1L2FA 4ALPA 2XRSD 3G6JB 2Q8IB 1WTRA 1J8IA 4ZCMA 1D1NA 1NJID 4ILWA 2DEUA 1X55A 3MC0B 5FK9C 4GNXC 4DV4L 4HEDA 1ML0D 1R5NA 3FPPA 3HOUG 1SYDA 3OMGA 3U50C 3TS0A 4JI3Q 3CCLB 2B63B 1BJKA 1EWYA 3W2HA 3A8KE 4OHJA 2CQOA 1JJ2B 4G7ZC 1YLOA 4TT3A 2QW7A 1VF5C 2XNJA 3BZKA 3NENA 1VQ9A 4M2LA 1W3SA 2VUMB 2F43A 4C3HH 4Y7NH 1N33Q 1QGAA 3QE2A 2EYHA 2QGQA 3E9IA 2K33A 3K80C 3W1BA 1J5EL 2AUKA 4RDKA 1FD7D 2B2UA 4QFMA 1QOHA 1S5DD 5L46A 4A3MG 1F2ZA 1MABA 2O5JC 2KHSA 4NCNA 3CP8A 4JI1Q 1VQJA 2F3WA 2YTYA 4J0QA 5F4JA 2UUCQ 3CPFA 4APVA 3JAME 1YITA 3L0OA 1Q1EA 1VQLB 1AH9A 5LHY1 4X7EA 2WINB 5DAUA 2AHOB 3S16H 2E2JB 2KBNA 3S2DB 1DOKA 1A2TA 1P8LA 4IUVA 1G91A 2YTVA 4JC0A 2MUYA 4ME5A 4UP7A 3TZDA 5FO9B 5AJ3L 3Q8DA 4P3YA 5IYWA 4NKLA 4HJAA 1J9ZA 4XQNA 1VS0A 1A3VA 3CCJA 5FO7B 2GVAA 4NP5A 1HRJA 1OTCA 4QUCA 2MNAA 2ATWA 4PNYA 4R1JA 3T1YQ 2NVYB 3GVJA 2RDHA 3AVWA 3JAML 2R7ZB 1YX2A 1S72B 4BY7G 3HOWG 1LTRD 2RCNA 2R6HA 3KF8A 1YBYA 3HRZC 5M3MB 5F4MA 2EYFA 3P27A 2DNCA 1YIJB 3AVXA 5IP9G 4LF8Q 1TUIA 3CRLC 5NUCA 5M3MH 1HNXL 3CD6A 4DR6L 4B44A 3S1RH 1O7ZA 1KRTA 4LBWA 2B2VC 3JAMc 4BY1H 1U0LA 2TMPA 2DJFC 3QFRA 4XLCA 2CW5A 1Q12A 1QFJA 3RMHA 2NZ1D 3CMEA 1K3RA 4Y52H 3N52A 1G6PA 1I50B 3TN2A 1UWVA 3BYYB 3TZUA 1HNZL 3JQQA 4A3JB 2WJYA 3VYTA 5JEAG 1SDFA 1Y1VH 4A76A 4DXGA 5D3DA 4A3BH 1WOOA 4GKKQ 1LUZA 4U9UA 1PMRA 4LFCQ 4C3HG 4G1VA 2R6GA 1SYGA 1TLLA 2X85A 4DR6Q 3L9AX 3AFQA 4DV5Q 3IFTA 2X6XA 1TU2B 4P2NA 1N06A 4HTHA 3R93A 2JDIA 3ZC3A 4KY7A 5C3XA 1JC7A 1FRQA 3OFNA 2NN6H 2JA8H 1D8LA 1N08A 5IGGA 2EXZA 3PA1A 1O7IA 4DV3L 4HR7B 3KLWA 1EQTA 1XNRQ 3BVMA 3LWEA 2Q6LA 4IOCA 2A19A 3BZDB 1E64A 4TRDA 4V0BA 4Z4ZA 2L15A 2VQFQ 4BBSH 1GHKA 4TQUS 3GTLB 1F9RA 4CBVA 4GOPC 4XN0A 3VNVA 4UP9A 3OTOQ 5IT9L 4Y7NB 4H02A 2RHQB 1IXRA 5GAGC 2RF4A 3GTGH 2DETA 1I4GA 4DR1L 2WR8A 3CMEB 4HE5A 1GUWA 5J3OA 1G7RA 1KJZA 2JP1A 1ZM4A 1BUVT 5IP7H 1CKMA 5LMNW 4K0KQ 3OZVA 1R9TB 2WYRA 1VQDA 1N36Q 5IYNA 4M4SA 4OWXB 3OEEA 1VQMB 2XSCA 2MQHA 4A3KB 5C44H 3A74A 3EN2A 2OTJB 2VNJA 4P6YA 1EP2B 4A93H 1WI5A 2Q2HA 1PTOB 3IKJA 2E2HH 3W2DA 2ZL5A 2OBRA 5FO1A 1KK2A 2WKCA 1NE3A 2PYKA 2BOSA 3A8JA 4P72A 3B78A 4EH1A 5GADC 1Z47A 4JBKA 3J7A5 1ICFB 1OXXK 3E6ZX 4X05A 1K83B 2L11A 3H91A 2EJFC 5M5YH 1QZGA 4DV0L 3BDOA 4BS9A 4TKOB 4YAWA 1EWCA 5C0XI 1ET6A 5C0XJ 1TWCH 1ILQA 3I4OA 3NE5B 1EIHA 1MRZA 1VQ4B 2ES2A 1VQNA 4PZ8A 5M3FB 5M3FG 1K28A 1H9JA 1BX0A 4DV4Q 3ZIAA 2RBMA 4XL9A 3HGBA 5H1SE 1EFUA 2Z4IA 3R2IA 4G5GA 3GTJH 3HFZB 1XNQL 5BN3A 4RD1A 4OO1G 1L1OA 4KY5A 4PMBA 5I4DA 1YJNB 1IYVA 4O2DA 4BBRH 4B3ML 1H85A 3UDGA 1ICWA 1OB0A 3DXJC 4K14A 4FVMA 3I55A 5CV8A 3J81i 3A5ZB 2XGJA 4JVZA 4ULLA 1BDOA 2FINB 1Y8NB 1PFMA 4XKWA 2K50A 1QCBD 4K5VA 3J7AV 3S14H 1PKVA 1WTOA 4A3BB 2R7ZH 1FGBD 3VR4A 5A35A 5JJIA 3C1EA 3FP9A 3KLSA 3KLSX 3G48A 1YIJA 4WJ3M 4B3SL 4A3KG 5KRUA 4CKCA 4WORA 1VLYA 2A1AA 2YWHA 1W87A 3BZCA 2PZUA 4DK6C 1BCPF 1XMQQ 4FXKC 5C5LA 3K5MA 4XD7A 1UMKA 1NDHA 2C5HA 1WTWA 2ZBVA 1CZWA 4JI0Q 2B2TA 1IYJB 2HMAA 2F0PA 3MMPA 2Z6KC 1OHHA 3HZXA 4LF8L 3ZZTA 3NBHA 3M4PA 4RD0A 1CQXA 3C2PA 2ZTNA 2AWNA 4DGZA 1K8GA 4UDUC 1HR0Q 1NRKA 1A8PA 4AVZA 4H0LC 4BA1I 3SXHA 4UZUA 3NUCA 1I7PA 4EQPA 2EYPA 2W6JA 3B82A 1QGYA 1F2YA 1N8RD 4MTNA 4JI4L 4PAAA 1C0AA 1WU8A 1TS4A 2CVRA 3FHWA 4P2CB 5I2XA 3CCEA 1G6ZA 2KECA 2TSSA 4P73A 1B3QA 4LBVA 1IKLA 2DUDA 1WTQA 3RY8A 1PRTF 2NVTH 2PNHA 1YZ6A 1UD3A 4X64Q 2L0CA 4C3HB 4DAYB 1CSPA 1VQKA 4DR4L 1PH7A 1PTOD 4HCEA 3A8KA 3KF6A 1JOKA 1S5CD 5I6WA 4A3JG 3LNNA 2NVXH 3OZUA 3I4MG 1KD1D 4MTKA 1N0UA 4ZAIA 4L5RC 4CJ1B 1STYA 3A1PA 2MO0A 3CCVB 4HIMA 4CDFC 1I4RA 1IJFA 1G7SA 2F52A 1YJ9B 2DN8A 4QUFA 4CHTB 4P9SA 4IO9A 4TMXA 3T1HL 2XN9C 1EFID 5GROA 2EDGA 5LMUL 1LT3D 2E2JH 3KUPA 4GLVB 2VUMH 1BVSA 4ZCKA 4EVOA 4A3KH 4A3CG 4R8IA 3WNCA 3HOWB 1W0KA 4YHHL 2R7ZG 2IHFA 2AQ3B 1AIPA 2JIZA 5IYDG 2NTTA 3PSIA 5FO8B 1GR1A 2NUCA 4MNOA 4JI5L 5C4XB 5F2DA 2XZOA 1UD5A 1VLOA 1OXTA 1V0EA 1V1QA 1JB7A 1K0RA 3Q39A 2GPJA 1VDZA 1K8MA 4HCSA 2H5XA 4C3IB 1KAAA 4MZ9A 4ZK9B 1VQ9B 3NPPA 1I6VC 4RD6A 3S24A 4DV2L 5IYDH 3G71B 1RF2D 2EYOA 5H5JA 5CGKA 2E1RA 2L4NA 1VQ8B 1NJIC 3J81k 3HOYB 4BPRA 3HG9A 4JBWA 4A3CH 3MXNB 3GTPH 4N3GA 3M9BA 2F0QA 1RODA 3MHBA 4F87A 2K1BA 1CSQA 1CM9A 2NYZD 4Z4VA 3ND9A 1CA5A 1LACA 4Z4YA 1KZLA 2XZLA 3A55A 1TWAB 2N78A 3PO2B 3I90A 4A3JH 4RD4A 3CCQB 1RKNA 4TMZA 1T6XA 1DGSA 4XYOA 1Q86D 2NVQB 4UZEA 4ACAA 2ZTDA 3J7YW 2FMCA 4LUOA 3TDQA 3OJWA 1GOZA 1SKYB 1N33L 2QA4A 2YWEA 1JQYD 1WSVA 4YAFA 2QILA 5T1IA 3DUZA 2GQFA 4HIZA 2A68D 4BY1B 2JE6I 1AW7A 3GIRA 5C4JH 4CDCC 3HKZE 3Q0AA 5AN9A 3T53B 4R4QA 2IJ0A 3K0YA 1GO2A 2OBSA 1KDAA 1RD9D 3J80L 4B3GA 1A3TA 3LQEA 5IWAL 2GVBA 5JJLA 3A56A 3NTKA 1NAPA 3HOVG 1XPOA 4A3GH 4QCLA 4L6TB 5IYRA 4RA8A 4DU9A 1SE8A 1TS3A 1N34L 4RH6A 1FJGL 3MEHA 2D74A 2PI2A 2RSNA 2Z9HA 3E0EA 2NWGA 4LF5Q 3PMFA 4AC9A 1IL2A 3TRZA 1GD7A 3W5OA 5AJ3Q 3ONUA 3CKIB 2IT1A 5BR8Q 1H9RA 2GJKA 4CQJA 5JAVA 3CQZB 1STAA 3K59A 3Q6QA 2V7VA 1EWIA 2CQAA 2E75C 4X62L 4M53A 1PTOC 2K28A 1LM0A 2K01A 2M00A 4O1NA 2C2WA 3GSIA 1SAPA 3NXWA 5D14A 3SJZA 1NBWA 5EKKA 2BE5D 3M3YH 3EIVA 2HQLA 4JI0L 1I8DA 4Z1MA 3NP8A 4LFCL 3GTGB 4QQBX 5CBEE 4CKBA 1XFOA 4K8JA 4F88A 5FO0A 4QY7A 4KN4C 4G7WA 4FK8A 1X3QA 1N8RC 2I0QA 1B9MA 3M7GA 1ENFA 1EFCA 1TWFB 1SE2A 1X56A 4H9GA 2Q2IA 3SEBA 1EEFD 1SROA 4L63B 4C3IH 1L1OB 1WOPA 1GJRA 1YI2B 1OB5A 2AMCB 3S16B 4G7OC 1DYQA 4DV6Q 1B70B 3CP0A 1E63A 1RDPD 3FKIB 4KD4A 2E76C 1M90D 5IP7G 1X65A 1AMOA 3RD4A 3CCVA 3R8BA 3HOWH 4X3KA 4LNQA 2JA5H 5BN5A 3Q23A 4PZ6A 1NY4A 2V7XA 3S15B 4CDEC 1GUNA 3J7ZC 3GTKH 1E22A 5JEAJ 3PUWA 1YITB 2HQEA 1F60A 3PQIA 3P20A 3GTKB 2BCOA 4DV3Q 3EVQA 2EYJA 3CC4B 1I6HB 1Q8IA 1U5KA 2VNIA 4A93G 3H9NA 3RLFA 2B3GA 1MD2D 4JBJA 1EWHA 4N8FA 1O7YA 3R2TA 2WAQE 1DARA 2A8VA 1SNOA 1N05A 1YNNC 3PIP3 2MGSA 1TXYA 2ZJPA 1PFSA 3T1HQ 1Y1VG 3PVDA 2GK6A 2PIAA 4QGUA 2OCEA 1S4MA 4A3GG 1A63A 4DK0A 3MXPA 3CCLA 2YWFA 5IGEA 4WJWA 2A5HA 3S2HB 1K9MD 2D9RA 4BXXG 4HAEA 5IE8A 2V1CC 4TMTA 4YCWA 1TS5A 1X9NA 2KJXA 2D3NA 2B2WA 4N9PA 3LO8A 2WJVA 2IW3A 2JJ2A 1EY5A 1LTAD 4H44C 4LF9Q 1MHWC 1Y1WH 2VZLA 4YEJA 1A8VA 1H42A 5IY0A 1TY0A 3S1QH 1SLJA 2HLDA 4X8IA 2JA8B 3EA6A 1KXLA 2X6YA 3SJPA 2RHSB 4X7DA 3ASPA 1CI3M 4LF7Q 4LF4Q 5IP9H 4AYBE 4C2MB 1P16A 4NXML 4RCYA 5IT9c 4K2KA 4DAPA 2SNMA 2Z0SA 4RCNA 1KDCA 4KJOA 2X8KA 3FDTA 4K8IA 2HDNB 4L5QA 1Y8OB 2VS1A 1KMHA 5IYQA 3KJPA 1D7QA 2NZOA 3OYYA 4MYTA 1A0IA 1SYCA 1PRTD 4X3UA 1Z7TA 1KK1A 2CW0C 3HOVB 2JEAI 2NBFA 1TIID 2D0PA 3MZ5A 1GUOA 1EYAA 1Y8PB 3W5HA 5J39A 2P3MA 5HGTA 2EOTA 4CJ2C 2ZJQA 1D2BA 4YCVA 2F4VQ 1PZKD 4X0CA 1CHQD 3KBXA 5TV2A 2LSSA 1Y0YA 4E0FA 1EIGA 4IUTA 2SEBD 2PMZB 4BY1G 5CMDA 1VMCA 4YY3L 3C3LA 2R92H 3CCRA 2OBTA 1EQRA 3W2EA 4KKTA 4YIJA 3Q6SA 3ZBUA 3QFCA 1WVLA 4F7DA 1U4PA 1VJSA 1JWUD 2Z1CA 2HCJB 1EEID 3D4WA 1PRTC 2R93H 3OWFA 2K32A 1I3QH 1XTDA 2LFNA 4LUZA 4OWTB 1FR3A 1SE4A 2CKZB 1R5BA 3BCFA 2DERA 5KYIA 1KHIA 3SK8A 5ELDA 4A93B 4OGQC 1QWYA 2E2HB 2WPDA 4A3MB 4GN3B 4RKLA 4DUZL 3K0XA 1DG1G 3VR6A 1E43A 3QSYA 1TWFH 5IODA 1RQPA 3J81c 3JQPA 3J80i 1VQ6A 1WSRA 1TWCB 1HTLD 2B7BA 1V8QA 1HNWQ 4YCUA 1R4PB 3RN2A 2WP8J 2F0JA 4WRDA 2O2LD 1UE1A 1AN8A 3A8IA 3OIQA 1D5XC 3GV6A 1HA3A 1VQ7B 2VNUD 2KVOA 3KL9A 2V7WA 2ZZEA 5DSZA 4ABNA 5LMZA 2WIIB 1PA6A 4DV1L 2BDOA 3CW2A 5FL7A 3CPWB 1F2LA 2NN6I 2RC5A 3OE7A 1VQIA 4RD3A 1QZHA 2FXQA 1B4OA 4C3IG 2HHHL 1K28D 4DR7Q 1N9WA 3BQJA 4E6IA 4U673 3UDXA 2N49A 3Q3AA 2F0OA 1VQ6B 3CHBD 3SKBA 3PO2H 2F0UA 1JNYA 3SLNA 3I4NH 2JSOA 1B2TA 3ITPA 2KVMA 1RTNA 1PH5A 1EIFA 3A54A 1R4QB 5C5MA 4BWGB 4IFDI 4IFDJ 2UU9L 2AQ1B 3WY9A 3WQZA 4OIJA 5HZBA 1WORA 5EBDA 1F20A 2QEXB 2EXDA 3CRKC 4TMVA 5FJ8G 5FLMH 1XX8A 3CCMA 1EIYB 2OQKA 1Q81D 2PQEA 5C4JB 3PO3B 3ND8A 5EPKA 3HS0C 5FIUA 4KV6A 4RG1A 3MFYA 2Q6IA 2XGTA 1SE3A 1HVXA 1J5EQ 1RTOA 2PQAB 3ONAB 1Z9FA 1S72A 3GV3A 2DOGA 2EY2A 3NBHB 4UAIA 2R61A 3WBJA 3OWEB 3I56B 1CKOA 5ELFA 3CMMA 4A3GB 2CK3A 3BG3A 1LTBD 2F0VA 3NWSA 5AFWA 1EYGA 2CNDA 2Q6OA 4TSSA 3VA5A 1WTHD 3GTMH 3BDLA 1HUNA 1QB5D 5DM73 5EJWA 1E24A 1KNAA 3OMCA 3TP7A 4IUUA 4PZ7A 1KDBA 5ELEA 3SHLA 2HHHQ 5LMNQ 1D1IA 2YYZA 3CQZH 2VQFL 2AKWB 1N32Q 1S4ZA 3ONYA 1Q86C 1E1OA 3OTOL 2CHBD 3I73A 2C5BA 3LQ6A 4ZCIA 5GQOA 1D1KA 5CV5A 2G9DA
chains in the Genus database with same CATH topology
2NVXB 3HAGA 3GTOB 2WV6D 3VR5A 1W9XA 2EY6A 1STHA 3VYSA 3TBIB 4C3JB 3A35A 4CGYB 2PPBC 4M8AA 3IL8A 3M4OB 4XQFA 4HN7A 2A6HD 2Q8RE 2GJRA 1SXTA 5C3WA 2XRQD 2V31A 4MIUA 2RKSA 1EY8A 3S9WA 3URYA 2L1BA 1TR5A 1WD0A 1E2ZA 1HQRD 2EYMA 2ZT9C 2M2LA 5A2QL 2R9VA 1OXSC 2Q8TA 4BBRB 5IGCA 1Q1BA 4G7XA 3BVGA 4Q5VA 5EBCA 1BR9A 2WKDA 1BPLA 1BCPD 4PMWA 5FLXE 1LV9A 1EYDA 5T1GA 4NMZA 2A73B 5E4XA 4KK7A 4XONA 4AYBB 1L0XB 2E74C 4DF7A 2M5SA 4MN3A 5JPMC 5COYA 4XYQA 4II3A 4OO1I 3OEHA 4XKVA 1LTTD 5HURA 2K5DA 1HFNA 5I9PA 4ASUA 5EPJA 1PRTB 1B50A 2AWOA 2F0KA 1LO5D 4N9TA 2ZXPA 2MP1A 1DOLA 3VA7A 5IOCA 4TSFA 1IKMA 3SK6A 2EJMA 1Z6HA 4XN3A 1LT6D 2MJ8A 2DY8A 1KNEA 2BA1A 4K5WA 1GHJA 5JVH3 5E3FA 1LABA 2DY7A 3FVQA 4FO2A 2GK7A 4G6IA 2XWBB 4II2A 5G3LD 1EQVA 1MBYA 1DCZA 3H6MA 2F0IA 3OW7A 2R93B 2J0TD 3NK9A 4RWSC 1JWSD 2O5IC 4KHVA 3RZOB 1LTGD 5CV9A 3HEJA 2I07B 2X69A 1BOSA 3DDYA 2XNAC 1HPCA 3NTHA 1GJXA 3MAQA 4IUPA 1WTVA 1G2SA 2Z4HA 5KNDA 2LZJA 1CHPD 1F2MA 2XIWA 1SSOA 2RDFA 1PDQA 4BY7B 1PFNA 3MXNA 3BS1A 1VF7A 5K36H 5IGFA 1BXTA 3L7ZC 2J7ZA 2PO4A 4A3FB 1S5BD 2ZXRA 4ZYSA 1W0JA 4QF4A 1QNKA 4HSVA 4XLHA 2B2YC 1VMPA 1BNZA 3AU7A 3K6OA 2F0HA 2JEBI 1EFRA 4XNFA 4DNRB 1ET9A 5J1ZA 1CQVA 1KABA 3H94A 5ELCA 5M5YB 3KLRA 1PFBA 1LLRD 2D5DA 4G7HC 1HTPA 1X32A 3KEWA 4I7ZC 5LL6S 5CC4A 4B9WA 1W6KA 4XQQA 1IW7D 5DNFA 2MPMA 1UD2A 3X3MA 3M85A 4RAUC 3SK4A 2EY1A 2KUMA 1V1PB 5EGTA 2F1MA 1A15A 1I4PA 1J9OA 2A69C 1XXGA 1U9RA 3GTMB 1Q3LA 5JEAH 2IPKD 1AZPA 5IGBA 4IFDH 1UUPA 5JVG3 2F0FA 1JOOA 5I2YA 5CORA 4KMUC 1JOQA 3OHXC 3DEPA 3OSOA 2KEEA 1SYBA 4V190 1PXUA 1F77A 4JK1C 1RJTA 3T51B 1EYCA 2WZPP 4IURA 2YU9B 1UD6A 3I72A 2A68C 1V0FA 1AEXA 1ZYRD 1PTOH 4XT3B 4KTAA 1F9QA 1QE6A 3NQTA 2EJGC 1AFPA 1FYCA 2F0DA 1IW7C 2KCCA 4NNJA 1CT1D 4U68A 2QDBA 4NDXA 2A74C 4KN7C 1SYFA 3BYTB 1H9MA 1QNUA 2ENBA 5K5PA 4NW2A 4H13C 3TP8A 1NCVA 2EVBA 5K36G 1SMYD 1RCVD 3L3OC 5JOBA 3EQLC 3OOCA 2VJIA 2D2CC 3GP7A 3DWQA 5DM63 2A69D 4DFAA 4RGTA 3GQBA 3VYRA 1V43A 5DEHA 2ZXIA 3I3CA 1Y1WB 2F3VA 3NHHA 4LJZC 2PW5A 3RZDB 1SMYC 1EU3A 1G8ZD 3J80E 2E2IB 1EOTA 4OIKA 2GA4B 5ELBA 4DA2A 1ESFA 1C4QA 4QB4A 5C0XG 4XLEA 3K7AB 1XYIA 3D8GA 2X6GA 3N6RA 3MWYW 3HOZB 5KIXA 5ISRA 1ENCA 1KLGD 5TSSA 1ZXTA 4L8JA 5M5WB 2L9HA 4ZKBB 1UAPA 1NBMA 2R92B 3NTIA 3R3OA 1EY6A 3S1NB 4XMYA 2Y0SB 1HUMA 2ID0A 2LMCB 2F03A 2RDGA 1DOMA 3U9SA 2OXPA 4B08A 5KEEA 1STBA 3A7AB 1MSGA 5KNCA 1XTCD 1BLIA 4RHSA 3DM1A 5DN6A 2KA7A 2XZPA 2NB0A 1DD2A 4KJNA 4DK1A 4LK1C 3V2TA 4P22A 3KBGA 2F0WA 3IFDA 3CU7A 2RA4A 4RFBA 1AP0A 4F8MA 1TKWB 2J4XA 2B2VA 3P7JA 4KI0A 3MVVA 5J22A 1BQQT 1ESRA 4H7BA 2F0SA 2X6WA 1MI2A 5C6AA 3V05A 2JYOA 4K2LA 1CTMA 4LMQD 1EZ8A 3X3NA 3M4YA 3C1FA 1E3XA 3T56B 2D9UA 3RUZA 4XM3A 2A6ED 3I8ZA 1NR2A 1FNVA 3ERQA 2DNEA 2WACA 1H8HA 1EU4A 1A2UA 3K5NA 1OXUA 4FP5D 3NQIA 1E3ZA 1EY4A 1II3A 1CFMA 1STEA 3QOJA 5CBAE 1ONLA 4C1NI 5EKLA 3BH4A 4XORA 3I91A 5A2QE 4FNFA 3EFXD 3TP6A 3DEOA 5FOBB 2LY7A 2IX0A 3S1QB 1A3UA 1GXDC 4PQXA 2JA7B 4CJ0B 4X3TA 3MXUA 4Q0FA 3MTSA 5E4WC 1E1RA 2VB2X 3QB3A 3PIO3 4J8QA 3SK5A 4G57A 2X53S 1IL8A 2M9VA 1YNJD 3DHQA 3TMEA 1WP6A 4KY6A 1OO9B 1F9SA 3SVMA 3SDZA 5KNBA 2QCPX 3BVZA 4C1NK 3QG1A 5C0XH 4KKSA 3OIPA 3UI2A 4FXUA 1WCMB 1Y1VB 3K5OA 2B2UC 2F0MA 5JPNC 2IX3A 4KD3A 2RSOA 2SOBA 4A3EB 4DXFA 4FXDA 2G9HD 3PUZA 3F2UA 5M5XB 3HP3A 2QF7A 2F0TA 4ZLTF 1UD8A 2AQ2B 2H4OA 1E2WA 4RCOA 2JA5B 2L5TA 5CV4A 3P1HA 1LTSD 3H0GB 1SJED 1WTPA 2IL8A 2XOKA 3ZPNA 4PV1C 3JU4A 3FMCA 5CV6A 3K57A 2A6EC 3DWAA 1GUGA 1UEAB 2F0GA 4XXEA 1H9SB 1HZEA 2A6HC 1ZYRC 5IT9E 2KCNA 3GTQB 1EZ6A 1PLFA 4IZ8A 5IK2A 3M7NA 1STNA 1PZID 1O78A 4F7XA 4IQZA 1U4MA 1QG7A 2VXWA 3TSSA 1QILA 3A3BA 1CQFA 2RVLA 1SNQA 2F0EA 2V7QA 4ID6A 3H3VC 1B9NA 1U4RA 2K5WA 4MHEA 1UNSA 3I4MB 1TWHB 3KK7A 3A7LA 2VB3X 3V96A 3I70A 5IGDA 1KLUD 2HDLA 3W3AA 2L55A 2XVSA 3K5LA 4R8NA 1C8CA 4KHZA 1RHPA 5CR3A 1FNUA 2HUGA 1YNJC 3K58A 4IALA 1O80A 4XT1B 1G2TA 3FKSA 3BCDA 3FPUB 4YXWA 1Q90A 1TY2A 4RKBA 4ZUJA 4B9XA 1DXMA 1I4HA 2PW7A 3NBIA 1V1PA 2WB1B 1L0YB 1H9KA 1I3QB 3FRPB 4FF3A 1ILPA 4A3DB 2K05A 1HCZA 1M8AA 2OF1A 3QIAA 2E1BA 2D62A 1C48A 3G05A 4FXGC 1TS2A 5D65A 1B44D 1LTID 1YNND 1JICA 5LL6X 1XWEA 2PZWA 4WFN3 1LT4D 1OXVA 4X3SA 1ENAA 4K6DA 1WD1A 3ZYYX 3EJIA 3AMUA 2E2DC 1SNMA 1BF4A 1JWMD 2EE1A 3P75A 4DN4M 2X6LA 2JA6B 1JE4A 2MHVA 1WTXA 2ZTGA 3DWPA 1FX0A 3AB9A 1NR4A 1DONA 4ZUIA 3MXGA 3D4DA 4KKUA 5IIFA 4B3FX 1SBBB 3GO5A 1X3PA 3U9OA 1EY0A 4GZYC 2ICEC 3PV0A 1SNCA 4IUQA 2B2TC 2PZTA 4C56C 2D3LA 5I6YA 1D6EC 4EQNA 2ZXHA 1COWA 1NSNS 3D31A 2FFKB 1H9SA 2FMMA 1GUTA 4QIWB 3HOXB 1E1QA 1KTKA 3GTJB 3QOLA 4Z9CB 1MGSA 2H1EA 1IYUA 3J81E 2WAQB 4ZRZA 1AZQA 2IX1A 2F0NA 4HMJA 4XR6A 1D5MC 1DM0B 1HA5A 3EROA 1EY9A 4XLAA 1PYWD 4RHRA 1B3AA 3MA2B 1TT2A 4BA2I 2LKVA 3QO2A 3S17B 2RQXA 2Z6BD 1JR0D 2VJJA 4RGOS 1HQMC 2ICIA 1B1ZA 1IHZA 2NVTB 4BBSB 4EQOA 3TP5A 2EPBA 2EY5A 1O7LA 3GD7A 2BA0A 3H09A 4IN3A 4JMQA 4I65A 3J7AF 4FYDA 2R3ZA 5E1FA 2B8GA 3Q22A 4HMIA 1DZ1A 2IWHA 5CYUA 2EYLA 2N55A 2KOLA 3GVKA 1G291 3CESA 1LT5D 5C44B 1MSHA 2C9OA 2K5QA 3E0JA 3O13A 3SE0A 3T4AC 1EL0A 1HA6A 4HSPA 2K6AA 2HCIA 1BCPB 3D6CA 4FF1A 1I18A 3PUVA 3VYUA 1ZEQX 3IAYA 3NWTA 1D5ZC 1TVXA 1PTOF 4R9WA 3FEWX 1ZKOA 4DAVA 1M4VA 4J1MA 5CV7A 2OT2A 1W6JA 4ZKCB 1B53A 1SNPA 2B8FA 2FJ2A 3GTPB 1HXYD 1JB3A 1I4QA 4C3JG 3LWUA 1BCPC 2PNRC 3S1RB 4XTCS 3NSWA 4PMCA 2V4DA 3HKZB 4DNTB 1E2VA 4XDXA 2EZVA 3WOEA 1STGA 3A8IE 2F4IA 4A3IB 2K04A 2HDMA 3PUXA 2AUJD 1Y69U 3HOUB 2B39A 2JJ1A 3OAAA 1QJOA 4XOPA 2HCCA 4ODGA 4S3SA 1HFGA 1A6XA 1VCIA 2O4XA 5FLXL 4OL7A 3LX0A 4FF2A 2KQ3A 4O42A 5JJZA 3PUYA 3D4RA 5EKIA 1JORA 4RGNA 2B2YA 2Z8LA 4IUNA 1SJHD 1BO0A 1T5XD 3SR1A 2K03A 2FHTA 1S5FD 3DMUA 4J6HA 2L12A 5C3EB 5C4HA 1E79A 3T13A 3S1MB 1T5EA 1DJRD 5CDFA 5KGUA 3WDNA 2GJPA 3OPOA 2F0LA 2WSSA 3G7LA 5C4ZA 2PCFB 2ZXOA 3MFGA 5EPLA 1BMFA 2QKIC 4K6LA 4ZQ3A 5KNLA 1K8OA 5FKAC 1HHVA 5BN4A 1WPCA 3VR2A 5I9OA 3QWNA 4DAYA 1V1OA 1BBXC 3A3GA 4G4KA 2DIEA 4YELA 1NUCA 4RGMA 2CW0D 4K5XA 3M3YB 3S14B 4M1UB 1GUSA 3J81L 1SNDA 4CKEA 3D3RA 1CA6A 4XLFA 5G3LF 1I4XA 1UD4A 1CZGA 3CP2A 1EY7A 1U4LA 3QJYA 1SEBD 2OEOA 4XOTA 2K7VA 1JCKB 5D3IB 3BC9A 2B2WC 4OO1H 2ZZQA 1FNWA 4QMGA 1SYEA 2W6IA 3A8JE 2SNSA 5EQ0A 1TQOA 3D6WA 2C5CA 1E0BA 2QEJC 1H8EA 2XWJB 4IFDG 2KEDA 2ZZGA 1TWGB 5M9OA 1F9PA 4EGVA 2BE5C 3I4NB 4LAAA 1S5ED 1CK1A 2JXMB 3I4LA 2N88A 3Q24A 4GQNA 5HKKA 2NN6G 3WOFA 5KYLA 3VR3A 4FF4A 2QE7A 3T16A 1PZJD 1SFOB 4XIGS 2I46A 2SDFA 2XNDA 3E5SA 3C46A 2ZZFA 3GVLA 2BDNA 2LS01 2NTSA 4XQJA 3BDCA 2XRSD 3G6JB 2Q8IB 1WTRA 1J8IA 4ILWA 3MC0B 5FK9C 4HEDA 1ML0D 3FPPA 1SYDA 3OMGA 2B63B 3A8KE 4OHJA 4G7ZC 4TT3A 1VF5C 2VUMB 2F43A 2EYHA 2K33A 2AUKA 1FD7D 2B2UA 1QOHA 1S5DD 1F2ZA 1MABA 2O5JC 2KHSA 3CP8A 2F3WA 3JAME 1Q1EA 5LHY1 2WINB 5DAUA 2E2JB 3S2DB 1DOKA 1A2TA 4IUVA 1G91A 2MUYA 4ME5A 3TZDA 5FO9B 4NKLA 4XQNA 1A3VA 5FO7B 1HRJA 4NP5A 4QUCA 4PNYA 2NVYB 3GVJA 2RDHA 3JAML 2R7ZB 1LTRD 3KF8A 5M3MB 3HRZC 2EYFA 2DNCA 3CRLC 5NUCA 1O7ZA 2B2VC 2TMPA 4XLCA 1Q12A 3RMHA 2NZ1D 3N52A 1I50B 3TN2A 3BYYB 3TZUA 4A3JB 2WJYA 3VYTA 5JEAG 1SDFA 4DXGA 5D3DA 1PMRA 4C3HG 2R6GA 1SYGA 2X85A 3L9AX 3IFTA 2X6XA 1TU2B 5C3XA 4HTHA 2JDIA 4KY7A 3R93A 1JC7A 3OFNA 2NN6H 5IGGA 2EXZA 4HR7B 1EQTA 3BVMA 3LWEA 3BZDB 4TRDA 4V0BA 1GHKA 4TQUS 3GTLB 1F9RA 4CBVA 4XN0A 5IT9L 4Y7NB 1I4GA 1GUWA 2JP1A 1BUVT 1R9TB 3OEEA 2XSCA 4A3KB 1PTOB 3IKJA 3W2DA 2WKCA 2PYKA 2BOSA 1Z47A 1OXXK 3E6ZX 1K83B 2L11A 3H91A 2EJFC 3BDOA 4BS9A 4TKOB 1EWCA 5C0XI 5C0XJ 1ET6A 1ILQA 3NE5B 1EIHA 5M3FB 1H9JA 3ZIAA 2RBMA 4XL9A 3HGBA 2Z4IA 3R2IA 5BN3A 4OO1G 4KY5A 4PMBA 5I4DA 1IYVA 1ICWA 1OB0A 3DXJC 4K14A 4FVMA 5CV8A 2XGJA 4ULLA 1BDOA 2FINB 1Y8NB 1PFMA 4XKWA 4K5VA 1QCBD 3J7AV 4A3BB 1PKVA 1WTOA 1FGBD 3VR4A 5A35A 3C1EA 3KLSA 3KLSX 5KRUA 4CKCA 4WORA 1VLYA 2PZUA 1BCPF 4FXKC 5C5LA 3K5MA 4XD7A 1WTWA 1CZWA 2B2TA 2F0PA 1OHHA 3HZXA 3NBHA 3C2PA 2ZTNA 2AWNA 4DGZA 4UDUC 1NRKA 4AVZA 4H0LC 4BA1I 3SXHA 4UZUA 3NUCA 4EQPA 2EYPA 2W6JA 1F2YA 1TS4A 2CVRA 5I2XA 4P2CB 1G6ZA 2KECA 2TSSA 1IKLA 1WTQA 1PRTF 1UD3A 2L0CA 4C3HB 1PTOD 4HCEA 1JOKA 1S5CD 5I6WA 3LNNA 4ZAIA 4CJ1B 1STYA 1I4RA 2DN8A 4QUFA 4CHTB 2XN9C 1EFID 2EDGA 1LT3D 3KUPA 4EVOA 4R8IA 3HOWB 1W0KA 2AQ3B 2JIZA 2NTTA 5FO8B 2NUCA 5C4XB 5F2DA 2XZOA 1UD5A 1OXTA 1V0EA 1VDZA 1K8MA 4HCSA 4C3IB 1KAAA 4ZK9B 3NPPA 1I6VC 1RF2D 2EYOA 5CGKA 2L4NA 3HOYB 3HG9A 4JBWA 2F0QA 1RODA 3MHBA 4F87A 2K1BA 1CM9A 2NYZD 3ND9A 1CA5A 1LACA 1KZLA 2XZLA 3A55A 1TWAB 3PO2B 3I90A 1RKNA 2NVQB 4XYOA 3J7YW 2FMCA 3TDQA 1GOZA 1SKYB 1JQYD 2QILA 5T1IA 3DUZA 4HIZA 2A68D 4BY1B 2JE6I 1AW7A 3Q0AA 3T53B 2IJ0A 3K0YA 1KDAA 1RD9D 3J80L 4B3GA 1A3TA 3A56A 3NTKA 1NAPA 4QCLA 4L6TB 4RA8A 4DU9A 1TS3A 4RH6A 3MEHA 2RSNA 2NWGA 3PMFA 3CKIB 2IT1A 1H9RA 2GJKA 5JAVA 3CQZB 1STAA 3K59A 2CQAA 2E75C 1PTOC 2K28A 2K01A 2M00A 4O1NA 1SAPA 3NXWA 5D14A 5EKKA 2BE5D 1I8DA 4Z1MA 3NP8A 3GTGB 5CBEE 4CKBA 4K8JA 4F88A 4KN4C 4G7WA 1X3QA 1B9MA 3M7GA 1ENFA 1TWFB 1SE2A 3SEBA 1EEFD 4L63B 3S16B 4G7OC 1DYQA 1RDPD 3FKIB 4KD4A 2E76C 3RD4A 3R8BA 4X3KA 5BN5A 3Q23A 3S15B 1GUNA 5JEAJ 3PUWA 2HQEA 3P20A 3GTKB 2BCOA 3EVQA 2EYJA 1I6HB 1Q8IA 3RLFA 1MD2D 1EWHA 1O7YA 3R2TA 1SNOA 1YNNC 3PIP3 2MGSA 2GK6A 4DK0A 3MXPA 3S2HB 5IGEA 4WJWA 2A5HA 4HAEA 1TS5A 2KJXA 2D3NA 2B2WA 4N9PA 2WJVA 2IW3A 2JJ2A 1EY5A 1LTAD 4H44C 4YEJA 1TY0A 2HLDA 2JA8B 3EA6A 2X6YA 1CI3M 4C2MB 4K2KA 4DAPA 2SNMA 4RCNA 1KDCA 4KJOA 2X8KA 3FDTA 4K8IA 1Y8OB 1KMHA 1SYCA 4X3UA 1PRTD 1Z7TA 2CW0C 3HOVB 2JEAI 2NBFA 1TIID 3MZ5A 1GUOA 1EYAA 1Y8PB 5J39A 5HGTA 2EOTA 4CJ2C 1D2BA 1PZKD 1CHQD 3KBXA 4E0FA 1EIGA 3C3LA 4IUTA 2SEBD 2PMZB 5CMDA 1VMCA 4YIJA 4KKTA 3Q6SA 1WVLA 1U4PA 1VJSA 1JWUD 2Z1CA 1EEID 3D4WA 1PRTC 3OWFA 2K32A 2LFNA 1FR3A 1SE4A 3BCFA 5KYIA 3SK8A 5ELDA 4A93B 4OGQC 1QWYA 2E2HB 2WPDA 4A3MB 4RKLA 3VR6A 1E43A 5IODA 1TWCB 1HTLD 1V8QA 1R4PB 2WP8J 2F0JA 4WRDA 2O2LD 3OIQA 1AN8A 1D5XC 3GV6A 2VNUD 2KVOA 2ZZEA 4ABNA 2WIIB 2BDOA 5FL7A 1F2LA 2NN6I 3OE7A 4C3IG 1B4OA 1K28D 4E6IA 4U673 2F0OA 3CHBD 2F0UA 2JSOA 1B2TA 3ITPA 2KVMA 1RTNA 3A54A 1R4QB 5C5MA 4BWGB 4IFDI 4IFDJ 2AQ1B 3WQZA 4OIJA 5EBDA 3CRKC 1XX8A 5C4JB 3PO3B 2PQEA 3ND8A 5EPKA 3HS0C 4KV6A 3MFYA 1SE3A 1HVXA 1RTOA 3ONAB 3GV3A 2EY2A 4UAIA 2R61A 3OWEB 5ELFA 3CMMA 4A3GB 2CK3A 3BG3A 1LTBD 2F0VA 3NWSA 5AFWA 4TSSA 3VA5A 1WTHD 3BDLA 1HUNA 1QB5D 5DM73 5EJWA 1KNAA 3OMCA 3TP7A 4IUUA 5ELEA 1KDBA 3SHLA 1D1IA 2YYZA 1S4ZA 2CHBD 3I73A 1D1KA 5CV5A 2G9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6H A;  3ND9 A;  1HTP A;  1VF5 C;  2D2C C;  1Q90 A;  3LWU A;  4OGQ C;  5BN5 A;  2PNR C;  1LAC A;  4I7Z C;  3VR5 A;  2A69 D;  3PUZ A;  3EQL C;  1CTM A;  4TQU S;  1IYU A;  3GQB A;  2V4D A;  1GUN A;  3M4Y A;  4XTC S;  2BA1 A;  1DXM A;  4DNT B;  1GUS A;  1IW7 D;  1GHJ A;  3VR6 A;  3PUW A;  1E2V A;  2K33 A;  3T56 B;  1GHK A;  2QF7 A;  2AUK A;  3A8I E;  3P20 A;  1LAB A;  1V43 A;  1H9K A;  2A6E D;  4H0L C;  4BA1 I;  3M85 A;  1V8Q A;  2PPB C;  3QJY A;  2K7V A;  2O5J C;  2DNE A;  2A6H D;  1E2W A;  1HCZ A;  3PUX A;  4LJZ C;  2AUJ D;  2L5T A;  1Y69 U;  4OO1 H;  3RLF A;  3QIA A;  1SMY C;  1DCZ A;  2D62 A;  4BA2 I;  1Q1E A;  1EWH A;  2F1M A;  2A68 D;  1OXU A;  1QJO A;  2JE6 I;  3OW7 A;  2BDO A;  3T53 B;  1CFM A;  3A8J E;  2O5I C;  2A69 C;  1YNN C;  2NN6 I;  1A6X A;  1ONL A;  1VCI A;  1HQM C;  5C0X G;  1E2Z A;  4PV1 C;  5JEA H;  3IKJ A;  2ZT9 C;  3FMC A;  1OXV A;  3N6R A;  2A6E C;  1OXS C;  1GUG A;  4IFD H;  4IFD G;  4DK0 A;  1HPC A;  1H9S B;  1O7L A;  3LNN A;  2A6H C;  3GD7 A;  1GJX A;  2BA0 A;  1Q1B A;  3PUY A;  3D4R A;  1OXX K;  2BE5 C;  1ZYR C;  4H44 C;  2JXM B;  2EJF C;  5KND A;  3I4L A;  4L8J A;  3MXU A;  4KMU C;  3BDO A;  2B8G A;  4TKO B;  1CI3 M;  3M7N A;  3AB9 A;  3CRK C;  1O78 A;  2DN8 A;  3NE5 B;  4IQZ A;  2IT1 A;  1H9R A;  1VF7 A;  2DNC A;  2LMC B;  2NN6 G;  2EDG A;  4RCN A;  3ND8 A;  5K36 H;  2E75 C;  3VR3 A;  3CRL C;  1G29 1;  2E74 C;  4KKU A;  1H9J A;  3MFY A;  3U9S A;  1Y8O B;  1T5E A;  4JK1 C;  3L7Z C;  3T51 B;  1B9N A;  3HGB A;  4XIG S;  3A7A B;  3SE0 A;  3WDN A;  2BE5 D;  1Z7T A;  5KNC A;  5BN3 A;  3OPO A;  3I72 A;  1Q12 A;  2CW0 C;  4OO1 G;  2JEA I;  3A7L A;  3BG3 A;  1IYV A;  2A68 C;  1OXT A;  3PUV A;  1GUO A;  1Y8P B;  4KN4 C;  2KA7 A;  1VDZ A;  4GZY C;  3W3A A;  3DXJ C;  1B9M A;  2PCF B;  3TZU A;  1K8M A;  1DD2 A;  3PV0 A;  4DK1 A;  2EJG C;  5JEA G;  1FYC A;  4LK1 C;  2AWO A;  1I6V C;  3SDZ A;  1BDO A;  1IW7 C;  2KCC A;  2Q8I B;  5KNB A;  3QG1 A;  1Y8N B;  2JEB I;  5C0X H;  4KKS A;  4KHZ A;  4DNR B;  1K8O A;  1PMR A;  5BN4 A;  1YNJ C;  3VR4 A;  2YYZ A;  2R6G A;  3H94 A;  4KKT A;  4KN7 C;  3VR2 A;  5A35 A;  3VA7 A;  3FPP A;  1ZKO A;  4JBW A;  4G7O C;  1H9M A;  1TKW B;  3D31 A;  3IFT A;  1TU2 B;  1H9S A;  3KLR A;  2E76 C;  4H13 C;  4KI0 A;  3I73 A;  2EVB A;  1GUT A;  2EJM A;  2B8F A;  2K32 A;  2NN6 H;  3A8K E;  5K36 G;  2D5D A;  4G7H C;  4G7Z C;  1FR3 A;  3OOC A;  4HR7 B; 
#chains in the Genus database with same CATH topology
 3KF6 B;  2QTZ A;  2NVX B;  3HAG A;  3GTO B;  1FRN A;  2K5N A;  2WV6 D;  3VR5 A;  4DUY L;  1W9X A;  2EY6 A;  1STH A;  3HKZ G;  3VYS A;  2WB1 E;  3TBI B;  5M5X H;  3JQR A;  3CC2 B;  2I5M X;  3I2Z A;  4C3J B;  3A35 A;  1K8A D;  4LF7 L;  4CGY B;  1VQC A;  4AH6 A;  2PPB C;  1K83 H;  1VQP A;  4UHV A;  2BGI A;  4M8A A;  3IL8 A;  1ASZ A;  3M4O B;  4XQF A;  1K9M C;  3FKI G;  4HN7 A;  2A6H D;  2Q8R E;  2EQS A;  3TRE A;  2DJG C;  2GJR A;  3OP1 A;  1SXT A;  5C3W A;  1HNZ Q;  2XRQ D;  2GRE A;  2V31 A;  1IHM A;  2JJQ A;  4LC0 A;  4MIU A;  3MCA A;  1PH8 A;  5C3E H;  4PC7 A;  3STB D;  2RKS A;  2JQO A;  1EY8 A;  3S9W A;  4JG2 A;  2NZH A;  1QFY A;  2L1B A;  3URY A;  1TR5 A;  4NBS A;  1WD0 A;  1ASY A;  3S15 H;  1E2Z A;  1OGJ A;  1HQR D;  2EYM A;  2VQE L;  2OYN A;  2ZT9 C;  3UE1 A;  2M2L A;  5A2Q L;  2R9V A;  1OXS C;  2Q8T A;  1LTL A;  5IYC G;  4DNI A;  1ZM2 A;  1IBM L;  4WZK A;  4L5T A;  2K5H A;  4BBR B;  2ZIT A;  2BV3 A;  4A3F G;  5IGC A;  3W2I A;  1Q1B A;  1I6H H;  4G7X A;  3BVG A;  4Q5V A;  5EBC A;  1BR9 A;  2WKD A;  1MJC A;  1BPL A;  1BCP D;  4PMW A;  3CCU B;  5FLX E;  1LV9 A;  4JYA L;  1EYD A;  3FPK A;  5T1G A;  4O0A A;  4NMZ A;  5M3F H;  4JI6 L;  2A73 B;  5A89 A;  4KK7 A;  3CCR B;  4XON A;  4AF7 A;  5E4X A;  4KHP Q;  2F4N A;  4AYB B;  1L0X B;  1QVC A;  4GNX A;  2E74 C;  5C3E G;  2ZTE A;  4DF7 A;  4OPS A;  2M5S A;  3RZD H;  1YI2 A;  2KCT A;  3CC7 A;  4NXM Q;  1VQG A;  3ASS A;  2QA4 B;  1VQ5 B;  2GN5 A;  1YHQ A;  4MN3 A;  5JPM C;  5COY A;  3F1Z A;  3R6K A;  2VBV A;  4YAO A;  3AFP A;  1KRS A;  2PQA A;  4XYQ A;  3I4M H;  4II3 A;  2F1L A;  4OO1 I;  2IHE A;  3FKI H;  1VQ8 A;  3OEH A;  4DQL A;  4XKV A;  1JJC B;  1LTT D;  2MO1 A;  3CCU A;  4GKK L;  4BBS G;  5HUR A;  4DPG A;  2NV4 A;  2K5D A;  1HFN A;  5I9P A;  4ASU A;  5EPJ A;  3HOZ H;  1PRT B;  3J80 c;  1B50 A;  3G6E B;  2AWO A;  2F0K A;  1UE7 A;  1LO5 D;  2X0K A;  3RLO A;  3AGQ A;  3G4S A;  2R93 G;  4N9T A;  3S17 H;  2ZXP A;  3KDF B;  2MP1 A;  1DOL A;  3VA7 A;  5IOC A;  3ULP A;  2ALY B;  2K14 A;  4TSF A;  1IKM A;  1PHJ A;  2E8G A;  3SK6 A;  3RR5 A;  2EJM A;  4OOS A;  1L1O C;  4HIK A;  4IPC A;  1Z6H A;  1L0W A;  4JCV E;  4XN3 A;  2UUB L;  4A3D G;  1LT6 D;  3PO2 G;  2HD3 A;  2MJ8 A;  2DY8 A;  1YJ9 A;  1KNE A;  4QV2 A;  2BA1 A;  4K5W A;  1GHJ A;  4RJL A;  4DV2 Q;  5JVH 3;  1WOC A;  5TY0 A;  5E3F A;  1LAB A;  2DY7 A;  3FVQ A;  4FO2 A;  2GK7 A;  4G6I A;  2XWB B;  4II2 A;  4R4O A;  2JK8 A;  1M90 C;  4N3N A;  5G3L D;  4Z4W A;  1EQV A;  3Q38 A;  1MBY A;  2HIX A;  1DCZ A;  3H6M A;  4HJ9 A;  2F0I A;  3OW7 A;  2R93 B;  2J0T D;  1J6Q A;  3NK9 A;  2D0O A;  3DLL A;  4RWS C;  1JWS D;  2O5I C;  2HIV A;  4KHV A;  3RZO B;  4AIM A;  2CCZ A;  4DUZ Q;  1LTG D;  5CV9 A;  3HEJ A;  3RZO H;  2I07 B;  2X69 A;  4A3B G;  2UUC L;  1MKH A;  2CFM A;  3U6K A;  3DDY A;  1BOS A;  4Q7J B;  3AQQ A;  2XNA C;  1ELO A;  5C4X G;  1HPC A;  1XMO Q;  1S3O A;  3NTH A;  1GJX A;  2NPF A;  4DQK A;  1M1K D;  3MAQ A;  4WZL A;  4AF6 A;  4IUP A;  4JI2 Q;  2ZM6 Q;  4B3S Q;  1WTV A;  1G2S A;  2Z4H A;  5KND A;  2LZJ A;  5KSW B;  1CHP D;  1B2R A;  1F2M A;  2XIW A;  3ULL A;  1SSO A;  1CNE A;  2RDF A;  5M3M G;  1PDQ A;  4BY7 B;  1PFN A;  3MXN A;  3BS1 A;  1VF7 A;  5K36 H;  5IGF A;  1QUQ A;  1T6Y A;  4BY7 H;  1BXT A;  2OTL B;  3L7Z C;  4QVJ A;  1V9P A;  4JI3 L;  2VL6 A;  1R9T H;  2J7Z A;  2PO4 A;  4A3F B;  1S5B D;  3TEH B;  2ZXR A;  4ZYS A;  1W0J A;  4JI6 Q;  4QF4 A;  1QNK A;  2R7F A;  4HSV A;  4JI7 Q;  4XLH A;  2B2Y C;  3V7A A;  1GAW A;  1VMP A;  1BNZ A;  3AU7 A;  1LYL A;  3K6O A;  2F0H A;  4JI8 L;  2JEB I;  1EFR A;  3FJO A;  4XNF A;  4QL5 A;  4DNR B;  1ET9 A;  1I5F A;  1CQV A;  5J1Z A;  3I56 A;  3LGJ A;  1KAB A;  3H94 A;  3PCO B;  2VNK A;  4LFA Q;  5ELC A;  4UY8 C;  3CCJ B;  3KLR A;  5M5Y B;  1PFB A;  5HGQ A;  1NB9 A;  3B8H A;  1LLR D;  2D5D A;  4G7H C;  1W2B B;  1JMC A;  1HTP A;  3I1F A;  3KEW A;  1X32 A;  4I7Z C;  3W5V A;  5LL6 S;  5CC4 A;  5FLX c;  2XEX A;  2DYI A;  1OB2 A;  2I5H A;  4B9W A;  2QMU A;  1W6K A;  4OXP A;  4XQQ A;  1IW7 D;  5DNF A;  4B3R Q;  2MPM A;  2BH8 A;  1UD2 A;  2LXK A;  3VDY A;  3R6J A;  2K4K A;  3X3M A;  3M85 A;  4DV6 L;  4RAU C;  2UXB Q;  3ICE A;  2VYQ A;  2WFW A;  1GM5 A;  3SK4 A;  3AVU A;  3AVV A;  2EY1 A;  1ZM9 A;  2KUM A;  2YTX A;  2K75 A;  1WOS A;  1TWG H;  1V1P B;  4KHP L;  3OKX A;  5EGT A;  2F1M A;  1A15 A;  1I4P A;  1XMO L;  1QVF A;  1J9O A;  1ZUN B;  1RL2 A;  3WND A;  2A69 C;  4B3X A;  2F3I A;  1XXG A;  1I94 L;  3VO2 A;  4PC2 A;  3VO1 A;  1U9R A;  3GTO H;  3CAM A;  1NNX A;  1Q3L A;  5JEA H;  3GTM B;  2BM1 A;  3MHP A;  2IPK D;  2ASB A;  1QVG A;  1S0U A;  1AZP A;  5IGB A;  4IFD H;  3HOV H;  1W2B A;  5LMN L;  1UUP A;  4P3I A;  4NXN L;  5JVG 3;  4OX9 L;  1IBK Q;  1K73 D;  4RDJ A;  1GKH A;  2F0F A;  4DV5 L;  4P25 A;  1JOO A;  5I2Y A;  5COR A;  4B3T Q;  1WYD A;  2VBT A;  4KMU C;  1GVP A;  5HY6 A;  4OX9 Q;  1JOQ A;  1ZM3 A;  3OHX C;  3DEP A;  2B63 H;  3OSO A;  4JI1 L;  2KEE A;  2OTJ A;  1SYB A;  1PH1 A;  4P75 A;  1WDT A;  1AE3 A;  4V19 0;  1SMX A;  1NMG A;  1PXU A;  1F77 A;  4A3M H;  1VQ4 A;  4G1B A;  4JK1 C;  1RJT A;  3T51 B;  4JPB W;  5GAE C;  1EYC A;  2WZP P;  1X3G A;  4IUR A;  4YWL A;  3A5U A;  2YU9 B;  1UD6 A;  3I72 A;  2DCU A;  2A68 C;  1HZA A;  3U2Q A;  1V0F A;  1AEX A;  1VQK B;  1ZYR D;  1PTO H;  4XT3 B;  4GLX A;  4KTA A;  5IYP A;  1F9Q A;  1QE6 A;  3BY1 A;  4PC1 A;  3E3X A;  2BN4 A;  4YY3 Q;  3NQT A;  2EJG C;  4DR1 Q;  1AFP A;  1FYC A;  2F0D A;  1HZC A;  2Z6K A;  1IW7 C;  2KCC A;  4NNJ A;  1CT1 D;  4U68 A;  1EFW A;  4NXN Q;  2QDB A;  4NDX A;  3T1Y L;  2A74 C;  4KN7 C;  3KFU A;  1SYF A;  3BYT B;  3K7U C;  1H9M A;  4B3M Q;  1QNU A;  2ENB A;  1XNR L;  4CDD C;  5K5P A;  4NW2 A;  5E7N A;  4H13 C;  3TP8 A;  1NCV A;  2EVB A;  3G6E A;  3PF5 A;  5BSY A;  5K36 G;  1SMY D;  1RCV D;  3L3O C;  5JOB A;  3EQL C;  3OOC A;  4DUY Q;  2VJI A;  2D2C C;  3GP7 A;  1JA1 A;  2C77 A;  3DWQ A;  4N8X 1;  3STB C;  5DM6 3;  4RMF A;  2A69 D;  4DFA A;  3M4Q A;  2CC2 A;  4RGT A;  4K1X A;  3GQB A;  4RPB A;  3U4V A;  1FDR A;  1UEB A;  1HR0 L;  3VYR A;  3OW2 B;  1V5V A;  4ZGN B;  1JT8 A;  2YV5 A;  2DGY A;  1V43 A;  5DEH A;  1IB0 A;  2ZXI A;  3I3C A;  1Y1W B;  2B29 A;  2VUM G;  2F3V A;  1OGI A;  1PJ6 A;  4TMW A;  3NHH A;  2Y0S E;  4LJZ C;  4P71 A;  2PW5 A;  3RZD B;  1SMY C;  1EU3 A;  2CWP A;  4DV7 L;  3QFT A;  1GO3 E;  1G8Z D;  4JOI A;  2G5D A;  3J80 E;  1WCM G;  1PV4 A;  1IBM Q;  2E2I B;  1EOT A;  4OIK A;  3JC6 6;  2GA4 B;  5ELB A;  3TQY A;  1ESF A;  1C4Q A;  4DA2 A;  4PGO A;  3HOY H;  4QB4 A;  3KF8 B;  5C0X G;  4XLE A;  4IPD A;  1VQA A;  3K7A B;  1XYI A;  3D8G A;  2PI2 E;  2X6G A;  3N6R A;  3MWY W;  3HOZ B;  3C2Q A;  4GKJ L;  5KIX A;  1K0S A;  4R4T A;  5ISR A;  1ENC A;  1KLG D;  5TSS A;  3F2D A;  1XPU A;  1IBL L;  5LMU Q;  2WZN A;  1PYS B;  1WTH A;  4B48 A;  3ZZU A;  1N07 A;  4L8J A;  3W2F A;  1ZXT A;  4R4I A;  5M5W B;  2L9H A;  4ZKB B;  1UAP A;  1NBM A;  2R92 B;  3EBE A;  3NTI A;  4M0L A;  3R3O A;  3AVT A;  2CBX A;  2LXJ A;  1EY6 A;  3S1N B;  4XMY A;  2Y0S B;  1JJ2 A;  1HUM A;  2ID0 A;  2LMC B;  2F03 A;  2RDG A;  1PJ7 A;  1DOM A;  2QN6 A;  3P26 A;  5B6I A;  3PO3 G;  3U9S A;  2Y0S G;  2OXP A;  4L5S A;  4B08 A;  5KEE A;  1STB A;  3A7A B;  1PH9 A;  1MSG A;  5L37 A;  1C9O A;  1E7Z A;  5KNC A;  1XTC D;  1M1K C;  1BLI A;  4RHS A;  3DM1 A;  5FA6 A;  5DN6 A;  2KA7 A;  4HJ8 A;  2XZP A;  1PJ5 A;  2NB0 A;  1DD2 A;  4KJN A;  4C3J H;  4DK1 A;  3KOJ A;  1B23 P;  4LK1 C;  4JI4 Q;  3V2T A;  4P22 A;  3KBG A;  2C78 A;  2F0W A;  3KJO A;  2E5L Q;  3IFD A;  5DLQ E;  5TR9 A;  1IBL Q;  3ZJY C;  3CU7 A;  2RA4 A;  4RFB A;  1VQ7 A;  1AP0 A;  4R4C A;  4F8M A;  1TKW B;  2J4X A;  2B2V A;  3P7J A;  3H0G G;  3OJX A;  4KI0 A;  3MVV A;  1UE5 A;  1BQQ T;  5J22 A;  4A3F H;  2B5O A;  2ZJR A;  2VNH A;  1ESR A;  4H7B A;  2F0S A;  2X6W A;  1MI2 A;  5C6A A;  3V05 A;  2JYO A;  4IJH A;  1YJN A;  4A75 A;  4K2L A;  1CTM A;  4LMQ D;  4ZV4 A;  1EZ8 A;  4NPS A;  3X3N A;  3M4Y A;  3C1F A;  5IYB G;  1E3X A;  4R71 A;  3CB4 A;  3T56 B;  2Q2T A;  1MIU A;  3UDF A;  2D9U A;  3RUZ A;  4XM3 A;  2A6E D;  3I8Z A;  1NR2 A;  4Z4R A;  1K73 C;  4X7F A;  1FNV A;  3ERQ A;  1E1T A;  2DNE A;  1VQP B;  2WAC A;  1H8H A;  1EU4 A;  1A2U A;  3CD6 B;  1D2E A;  2UUA L;  3K5N A;  1OXU A;  5JBQ A;  4FP5 D;  3NQI A;  1HJP A;  1E3Z A;  4Z4S A;  1EY4 A;  1II3 A;  1GVH A;  1CFM A;  1STE A;  3QOJ A;  5CBA E;  3E1Y E;  1ONL A;  4C1N I;  5EKL A;  3BH4 A;  1YHB A;  4XOR A;  4PG3 A;  3I91 A;  5A2Q E;  4FNF A;  1I94 Q;  3EFX D;  3S2D H;  1FNB A;  3TP6 A;  1QX4 A;  3K81 C;  3OZW A;  1RIP A;  1X3E A;  4IW3 B;  3DEO A;  5FOB B;  2LY7 A;  2IX0 A;  3BJU A;  1YNX A;  1A3U A;  4OWW B;  1GXD C;  1CKN B;  4PQX A;  4UP8 A;  3S1Q B;  2JA7 B;  4CJ0 B;  4X3T A;  3CCS A;  5C44 G;  3MXU A;  4Q0F A;  3H3V H;  3MTS A;  5E4W C;  5GV7 A;  3SLD A;  1E1R A;  5A8A A;  2VB2 X;  3QB3 A;  1EP1 B;  2EFG A;  4X7C A;  3PIO 3;  4J8Q A;  3SK5 A;  2XTI A;  4G57 A;  3BU2 A;  3OW2 A;  2X53 S;  1IL8 A;  3CRZ A;  4YWM A;  2M9V A;  1YNJ D;  4GNX B;  3DHQ A;  2V7U A;  1AE2 A;  3TME A;  1WP6 A;  1VQO A;  3WXM A;  4KY6 A;  1OO9 B;  1F9S A;  4HIO A;  3SVM A;  4RDL A;  3KDF A;  1FVI A;  3HOZ G;  5FNZ A;  4HJ7 A;  1EQQ A;  2FVG A;  1A62 A;  3SDZ A;  3V76 A;  3UE0 A;  5KNB A;  2QCP X;  3BVZ A;  4C1N K;  3QG1 A;  5C0X H;  4KKS A;  5FJ8 H;  4OOX A;  3OIP A;  2JN4 A;  3UI2 A;  4FXU A;  4WWV A;  5EMN A;  1WCM B;  1Y1V B;  3K5O A;  1VQB A;  2B2U C;  4A3L G;  2F0M A;  4B3T L;  5EAY A;  5JPN C;  2IX3 A;  5THX A;  4TVA B;  4KD3 A;  1C7Y A;  2RSO A;  2SOB A;  4A3E B;  3GDE A;  5FLM G;  4DXF A;  4FXD A;  1SFO H;  4A3E H;  2G9H D;  4YAU A;  4HE6 A;  4OOV A;  3PUZ A;  3F2U A;  5M5X B;  4P74 A;  1KL9 A;  3HP3 A;  1XQB A;  3AVY A;  1G7T A;  4C43 A;  3GTL H;  1FGU A;  2QF7 A;  2CH4 A;  2F0T A;  3QR8 A;  4ZLT F;  4Z4U A;  3HOX G;  4K0K L;  1UD8 A;  2AQ2 B;  2H4O A;  1E2W A;  4RCO A;  2JA5 B;  4JI2 L;  2L5T A;  1QUQ B;  4PAB A;  5CV4 A;  3HOY G;  3P1H A;  1XE1 A;  3VNU A;  1LTS D;  1VQE A;  3E9H A;  3PF4 A;  1D8T A;  3H0G B;  3PIP A;  1EXM A;  2R7D A;  4RM0 A;  1SJE D;  1WTP A;  1YHA A;  2IL8 A;  2XOK A;  3K8A A;  1QUE A;  3ZPN A;  4PV1 C;  3JU4 A;  3FMC A;  5CV6 A;  4DR2 L;  3K57 A;  1N34 Q;  2A6E C;  2C4U A;  1GUG A;  3DWA A;  1UEA B;  2F0G A;  4XXE A;  1H9S B;  1KK3 A;  3CMA B;  4IPH A;  1JA0 A;  1HZE A;  2A6H C;  3TS2 A;  1EFT A;  1DDG A;  4DR5 L;  4Y7C A;  4EX5 A;  1ZYR C;  5IT9 E;  2YU9 H;  2KCN A;  3E20 A;  4LFA L;  3GTQ B;  1EZ6 A;  1FND A;  2JA7 H;  3ASQ A;  1PLF A;  3PO3 H;  4IZ8 A;  5IK2 A;  2QGG A;  3M7N A;  1STN A;  1PZI D;  4JI5 Q;  1O78 A;  2Z6B A;  4F7X A;  4IQZ A;  3VMF A;  1U4M A;  1QG7 A;  2VXW A;  1QIL A;  3TSS A;  2E2I H;  3A3B A;  1CQF A;  2RVL A;  1SNQ A;  2C35 B;  2F0E A;  2V7Q A;  1X6O A;  3RLN A;  5H59 A;  4ID6 A;  3H3V C;  1B9N A;  1U4R A;  2K5W A;  4GN5 A;  4MHE A;  1UNS A;  1E3P A;  3I4M B;  5F4O A;  2R92 G;  1Y0R A;  1SR3 A;  3AYH B;  1TWH B;  3KK7 A;  3ER0 A;  2QTL A;  4OEL B;  4YAL A;  3A7L A;  2VB3 X;  3V96 A;  1YJW B;  3I70 A;  4GKJ Q;  5IGD A;  2UXD L;  1KLU D;  3CXC B;  1HNX Q;  2HDL A;  3W3A A;  2L55 A;  2XVS A;  4HJ5 A;  3K5L A;  4R8N A;  4GOP A;  4A3I H;  1C8C A;  4KHZ A;  1RHP A;  5CR3 A;  1FNU A;  2HUG A;  3H15 A;  1YNJ C;  3W1G A;  3K58 A;  4IAL A;  4GLA C;  4QVA A;  3HOU H;  1O80 A;  1EP3 B;  4QHY A;  4XT1 B;  1G2T A;  2JA9 A;  4A3I G;  3FKS A;  3BCD A;  3FPU B;  4X06 A;  4YXW A;  1QVG B;  3DM3 A;  2WB1 G;  1Q90 A;  3A0J A;  1TY2 A;  4RKB A;  3WYA A;  1Y1W G;  4ZUJ A;  2KHJ A;  4B9X A;  1VHE A;  1DXM A;  1I4H A;  4LFB Q;  2PW7 A;  3NBI A;  1JJG A;  1V1P A;  1SN8 A;  2I5L X;  2WB1 B;  4BXX H;  4WZE A;  1QVF B;  1E62 A;  4WZT A;  5E6T A;  1L0Y B;  4LUV A;  2OTL A;  4ZCL A;  1H9K A;  3D26 A;  5JJK A;  1KK0 A;  1I3Q B;  3FRP B;  4FF3 A;  1ILP A;  1BX1 A;  4A3D B;  2K05 A;  1HCZ A;  1M8A A;  2C4T A;  1Q82 C;  1BBW A;  4DR3 Q;  4DR2 Q;  2OF1 A;  3QIA A;  1KC8 D;  2E1B A;  3U4Z A;  2D62 A;  1C48 A;  3G05 A;  4FXG C;  1QUF A;  1TS2 A;  5D65 A;  1B44 D;  1JB9 A;  4WQM A;  4POG A;  1LTI D;  2HT1 A;  1YNN D;  1JIC A;  5TRD A;  3D0F A;  5LL6 X;  2BPO A;  1XWE A;  2PZW A;  3S1M H;  4WFN 3;  1LT4 D;  1OXV A;  4X3S A;  4RCZ A;  3U6B A;  4LBY A;  3NEL A;  3ZBT A;  1XPR A;  1ENA A;  4K6D A;  1WD1 A;  2UXB L;  5GV8 A;  1SKQ A;  3ZYY X;  3EJI A;  3CF5 A;  2UXC Q;  3AMU A;  2F4V L;  4X66 L;  2E2D C;  1SNM A;  4QJF A;  1JWM D;  1BF4 A;  2EE1 A;  3P75 A;  4DN4 M;  2X6L A;  2JA6 B;  1KTV A;  1JE4 A;  2MHV A;  2ZTG A;  3DWP A;  1WTX A;  1FX0 A;  4FDB A;  3AB9 A;  4OON A;  1NR4 A;  1DON A;  4ZUI A;  2CWA A;  4EQ5 A;  2CF4 A;  1KAW A;  3MXG A;  3D4D A;  3CXC A;  4KKU A;  3CCS B;  3ES9 A;  3ZUG A;  5IIF A;  4B3F X;  1SBB B;  3GO5 A;  1IBK L;  1X3P A;  4DR4 Q;  3U9O A;  2RC6 A;  4GN4 B;  1R5O A;  3JAM i;  1TWH H;  1EY0 A;  3ULJ A;  4GZY C;  2X3U A;  4UPA A;  2ICE C;  1T6Z A;  3PV0 A;  1SNC A;  4IUQ A;  1XB2 A;  3L2P A;  4DR7 L;  2B2T C;  2PZT A;  4C56 C;  4J15 A;  2PLF A;  3PIO A;  4DV1 Q;  2D3L A;  5I6Y A;  4DKA C;  4JYA Q;  1D6E C;  3G71 A;  4EQN A;  2ZXH A;  1COW A;  1NSN S;  4X66 Q;  1VHO A;  3PA2 A;  3D31 A;  3CPX A;  2JA5 G;  5BSX A;  2FFK B;  1H9S A;  3AST A;  1Q82 D;  1SM4 A;  2FMM A;  1WJJ A;  1GUT A;  4ME3 A;  4QIW B;  3HOX B;  1E1Q A;  4DV0 Q;  1KTK A;  3ISX A;  1GAQ A;  4DAM A;  3GTJ B;  2B7C A;  3QOL A;  4Z9C B;  1MGS A;  2H1E A;  2WAQ G;  1IYU A;  3J81 E;  2WAQ B;  2BM0 A;  4ZRZ A;  1AZQ A;  2IX1 A;  2F0N A;  4HMJ A;  1B7Y B;  1UE6 A;  3CC4 A;  4XR6 A;  2OQ0 A;  1D5M C;  1DM0 B;  1HA5 A;  4GOP B;  4JBM A;  3ERO A;  3S1N H;  2BMW A;  4MYU A;  3PUN A;  1EY9 A;  4XLA A;  1PYW D;  5ELN A;  4A3E G;  4RHR A;  1B3A A;  2UU9 Q;  3MA2 B;  5M5W H;  1HZB A;  3IRB A;  4FN5 A;  1YJW A;  1VQM A;  1TT2 A;  4GS3 A;  3RN5 A;  4HID A;  4BA2 I;  3W2G A;  4NB3 A;  2K5V A;  2LKV A;  1KRH A;  2KCM A;  2QEX A;  4P26 A;  4X65 L;  4P12 A;  4JI8 Q;  3QO2 A;  3ZZ0 A;  2JN9 A;  2RQX A;  1XJV A;  2Z6B D;  1BBU A;  3S17 B;  1JR0 D;  2VJJ A;  2PMZ E;  4RGO S;  1HQM C;  1Q7Y C;  2ICI A;  1B1Z A;  1IHZ A;  1K3B C;  2NVT B;  4BBS B;  4X65 Q;  4EQO A;  3TP5 A;  2EPB A;  2N8N A;  1PH3 A;  3PUM A;  4YWK A;  2EY5 A;  1O7L A;  3GD7 A;  2BA0 A;  4B47 A;  5KW9 A;  4X07 A;  3AGP A;  1VQH A;  4Y9R A;  3H09 A;  2UXC L;  4IN3 A;  4JMQ A;  1N32 L;  4I65 A;  1P4M A;  3J7A F;  4QUZ A;  4FYD A;  2R3Z A;  5E1F A;  4AYB G;  2B8G A;  3Q22 A;  3ERS X;  4HMI A;  1DZ1 A;  2IWH A;  4LWC A;  5CYU A;  2EYL A;  2N55 A;  1KQS B;  1N36 L;  2KOL A;  2JA6 G;  4QIW E;  3GVK A;  1G29 1;  3CES A;  4LW1 A;  4YHB A;  4PC3 A;  1LT5 D;  5C44 B;  1MSH A;  2C9O A;  2K5Q A;  1CUK A;  2JA7 G;  3E0J A;  3O13 A;  3SE0 A;  3T4A C;  1EL0 A;  1HA6 A;  1B8A A;  4HSP A;  1IZ6 A;  2K6A A;  1S40 A;  2HCI A;  1BCP B;  3D6C A;  4FF1 A;  1SRU A;  1I18 A;  3PUV A;  3VYU A;  1ZEQ X;  5C4X H;  3LVB A;  3IAY A;  3NWT A;  2BH2 A;  1D5Z C;  1Y14 B;  4OPO A;  1PH6 A;  1TVX A;  3CPW A;  1FJG Q;  2VW9 A;  4FWT A;  1PTO F;  3H0G H;  4ROX A;  4LBZ A;  1CKN A;  4R9W A;  3CCM B;  3FEW X;  1ZKO A;  4DAV A;  1M4V A;  1WFQ A;  4J1M A;  2YWG A;  1T9H A;  5IWA Q;  5CV7 A;  1RQR A;  3SGI A;  2OT2 A;  1W6J A;  4DK3 C;  4ZKC B;  1B53 A;  1MJE A;  4RPD A;  1SNP A;  2B8F A;  3MEF A;  4RLZ A;  2FJ2 A;  3GTP B;  2V7T A;  2EIX A;  3S2H H;  1HXY D;  2P5Z X;  1DDI A;  5J3B A;  4JI7 L;  1JB3 A;  1I4Q A;  2CH4 W;  4C3J G;  3HOX H;  3LWU A;  1BCP C;  2PNR C;  3I7F A;  3F2B A;  3S1R B;  4XTC S;  3NSW A;  4PMC A;  2V4D A;  3HKZ B;  4DNT B;  4X6A H;  1E2V A;  4XDX A;  2EZV A;  2QDX A;  3WOE A;  1K8A C;  5HXB A;  1STG A;  3A8I E;  1QGZ A;  2F4I A;  4A3I B;  2K04 A;  5IYC H;  2ZL6 A;  2HDM A;  1VQN B;  2AHO A;  2NVY H;  3PUX A;  2AUJ D;  1Q8K A;  4WJ4 A;  1Y69 U;  4KLK A;  3UDI A;  3HOU B;  3HKS A;  2B39 A;  2J7K A;  2JJ1 A;  3OAA A;  4P6V F;  1QJO A;  4XOP A;  4A3L H;  2HCC A;  1FNC A;  3WWV A;  2MFI A;  4ODG A;  5A88 A;  4S3S A;  2VBS A;  1VQO B;  1HFG A;  3CC7 B;  3K7A H;  3SEJ A;  1PVO A;  1A6X A;  4OPV A;  1VCI A;  1YHQ B;  2O4X A;  2VBU A;  5FLX L;  3ASR A;  2PMD A;  1TTT A;  4OL7 A;  3LX0 A;  1TVC A;  3H3V I;  1G51 A;  2EIF A;  1TWA H;  4UAJ A;  4FF2 A;  1EOV A;  2KQ3 A;  2I1L A;  4PC6 A;  1QFZ A;  1I50 H;  2PE3 A;  4O42 A;  3CCQ A;  5JJZ A;  3PUY A;  3D4R A;  4DR3 L;  4M1K A;  1YEZ A;  5EKI A;  1JOR A;  2CRV A;  2BGJ A;  1BKB A;  1NMF A;  4JOI C;  4OEM B;  4RGN A;  2B2Y A;  2N3S A;  4A3D H;  2Z8L A;  4IUN A;  3CW2 C;  1SJH D;  1BO0 A;  1T5X D;  1WCM H;  2K03 A;  3SR1 A;  1JE5 A;  5BR8 L;  2VZA A;  2FHT A;  4ZGQ B;  1S5F D;  3DMU A;  4J6H A;  2L12 A;  1G7C A;  5C3E B;  1Q81 C;  4YHH Q;  1Q9S A;  5C4H A;  5DS0 A;  1E79 A;  3T13 A;  2VY3 A;  3S1M B;  1T5E A;  2ZTC A;  1DJR D;  1HZ9 A;  5CDF A;  5KGU A;  3CCE B;  3WDN A;  2GJP A;  1PYB A;  3OPO A;  4I7A A;  1IJE A;  2OK8 A;  2ZBU A;  2F0L A;  4RD2 A;  5ELO A;  2WSS A;  3WBK A;  3G7L A;  1CNF A;  2PCF B;  5C4Z A;  4BBR G;  1HNW L;  2ZXO A;  3MFG A;  3CMA A;  5EPL A;  1BMF A;  2QKI C;  4K6L A;  4ZQ3 A;  1KIX A;  4LF6 Q;  2Q6K A;  4A4I A;  5KNL A;  1VQF A;  1K8O A;  5FKA C;  1HHV A;  5BN4 A;  1WPC A;  4JW0 A;  4TN1 A;  3VR2 A;  5I9O A;  3QWN A;  2UXD Q;  4LF9 L;  2OK7 A;  2RCF A;  4DAY A;  3BNW A;  1V1O A;  2ZM6 L;  4B3R L;  1BBX C;  3A3G A;  4G4K A;  1VQ5 A;  1XMQ L;  3B6Y A;  4DV7 Q;  2DIE A;  4YEL A;  3BY2 A;  3WNB A;  4B4D A;  1NUC A;  1Q46 A;  4RGM A;  3M4O H;  2ZL7 A;  1U2R A;  2CW0 D;  3NEM A;  4K5X A;  3M3Y B;  1NTG A;  4JV5 L;  3W5U A;  2OWO A;  3RNU A;  1FNM A;  1QH0 A;  3S14 B;  4M1U B;  1W34 A;  1GUS A;  1QG0 A;  5IYB H;  3J81 L;  1SND A;  2KHI A;  4CKE A;  1Q7Y D;  3F2C A;  3D3R A;  5GAH C;  1CA6 A;  4XLF A;  4LFB L;  5G3L F;  1NB0 A;  1I4X A;  3PGZ A;  2XNC A;  3PEN A;  1UD4 A;  1CZG A;  3CP2 A;  1EY7 A;  1U4L A;  3QJY A;  1SEB D;  2K52 A;  4IPG A;  3GTQ H;  4P1V A;  4XOT A;  2K7V A;  2OEO A;  1KD1 C;  1JCK B;  4UZF A;  5D3I B;  1VQL A;  3I55 B;  4DR5 Q;  3BC9 A;  2B2W C;  1EUJ A;  2ZZQ A;  5HZA A;  4OO1 H;  1FNW A;  4QMG A;  4Y9U A;  1H95 A;  1SYE A;  3J81 j;  1X3F A;  1PH2 A;  1XNQ Q;  2B63 G;  4JV5 Q;  4B43 A;  2W6I A;  2UUB Q;  3A8J E;  2SNS A;  5EQ0 A;  1TQO A;  2JA6 H;  3D6W A;  1W35 A;  2C5C A;  3G4S B;  1E0B A;  3KYH C;  2QEJ C;  1H8E A;  2XWJ B;  2VQE Q;  4IFD G;  4LF4 L;  4AQY L;  2KED A;  4ACB A;  2ZZG A;  4POF A;  1TWG B;  5M9O A;  4IJL A;  1F9P A;  1FL0 A;  4EGV A;  3F8T A;  3U58 A;  2BE5 C;  2NVQ H;  1BQE A;  3CC2 A;  3I4N B;  2IY5 B;  2DY1 A;  1S5E D;  1CK1 A;  2JXM B;  2QDL A;  4LAA A;  1HH2 P;  2FX3 A;  3I4L A;  1KC8 C;  2N88 A;  3Q24 A;  1HR0 W;  4OP7 A;  3CTA A;  4GQN A;  2E5L L;  2BF4 A;  4IOA A;  2BVN A;  3QFS A;  5HKK A;  2NN6 G;  2JA8 G;  3WOF A;  5KYL A;  4C2M H;  1PH4 A;  3VR3 A;  4FF4 A;  2QE7 A;  3T16 A;  1PZJ D;  4AQY Q;  1SFO B;  4XIG S;  2BSA A;  1X54 A;  4Z4T A;  4LF6 L;  2KEN A;  3AEV A;  4X62 Q;  2I46 A;  2SDF A;  2UUA Q;  1KQS A;  2XND A;  3E5S A;  3Q6R A;  3I4N G;  5J35 A;  4C0S A;  3C46 A;  2ZZF A;  3GVL A;  2BDN A;  2LS0 1;  1YVC A;  2NTS A;  4XQJ A;  2Q2U A;  4LF5 L;  3BDC A;  1N0V C;  4X64 L;  1L2F A;  4ALP A;  2XRS D;  3G6J B;  2Q8I B;  1WTR A;  1J8I A;  4ZCM A;  1D1N A;  1NJI D;  4ILW A;  2DEU A;  1X55 A;  3MC0 B;  5FK9 C;  4GNX C;  4DV4 L;  4HED A;  1ML0 D;  1R5N A;  3FPP A;  3HOU G;  1SYD A;  3OMG A;  3U50 C;  3TS0 A;  4JI3 Q;  3CCL B;  2B63 B;  1BJK A;  1EWY A;  3W2H A;  3A8K E;  4OHJ A;  2CQO A;  1JJ2 B;  4G7Z C;  1YLO A;  4TT3 A;  2QW7 A;  1VF5 C;  2XNJ A;  3BZK A;  3NEN A;  1VQ9 A;  4M2L A;  1W3S A;  2VUM B;  2F43 A;  4C3H H;  4Y7N H;  1N33 Q;  1QGA A;  3QE2 A;  2EYH A;  2QGQ A;  3E9I A;  2K33 A;  3K80 C;  3W1B A;  1J5E L;  2AUK A;  4RDK A;  1FD7 D;  2B2U A;  4QFM A;  1QOH A;  1S5D D;  5L46 A;  4A3M G;  1F2Z A;  1MAB A;  2O5J C;  2KHS A;  4NCN A;  3CP8 A;  4JI1 Q;  1VQJ A;  2F3W A;  2YTY A;  4J0Q A;  5F4J A;  2UUC Q;  3CPF A;  4APV A;  3JAM E;  1YIT A;  3L0O A;  1Q1E A;  1VQL B;  1AH9 A;  5LHY 1;  4X7E A;  2WIN B;  5DAU A;  2AHO B;  3S16 H;  2E2J B;  2KBN A;  3S2D B;  1DOK A;  1A2T A;  1P8L A;  4IUV A;  1G91 A;  2YTV A;  4JC0 A;  2MUY A;  4ME5 A;  4UP7 A;  3TZD A;  5FO9 B;  5AJ3 L;  3Q8D A;  4P3Y A;  5IYW A;  4NKL A;  4HJA A;  1J9Z A;  4XQN A;  1VS0 A;  1A3V A;  3CCJ A;  5FO7 B;  2GVA A;  4NP5 A;  1HRJ A;  1OTC A;  4QUC A;  2MNA A;  2ATW A;  4PNY A;  4R1J A;  3T1Y Q;  2NVY B;  3GVJ A;  2RDH A;  3AVW A;  3JAM L;  2R7Z B;  1YX2 A;  1S72 B;  4BY7 G;  3HOW G;  1LTR D;  2RCN A;  2R6H A;  3KF8 A;  1YBY A;  3HRZ C;  5M3M B;  5F4M A;  2EYF A;  3P27 A;  2DNC A;  1YIJ B;  3AVX A;  5IP9 G;  4LF8 Q;  1TUI A;  3CRL C;  5NUC A;  5M3M H;  1HNX L;  3CD6 A;  4DR6 L;  4B44 A;  3S1R H;  1O7Z A;  1KRT A;  4LBW A;  2B2V C;  3JAM c;  4BY1 H;  1U0L A;  2TMP A;  2DJF C;  3QFR A;  4XLC A;  2CW5 A;  1Q12 A;  1QFJ A;  3RMH A;  2NZ1 D;  3CME A;  1K3R A;  4Y52 H;  3N52 A;  1G6P A;  1I50 B;  3TN2 A;  1UWV A;  3BYY B;  3TZU A;  1HNZ L;  3JQQ A;  4A3J B;  2WJY A;  3VYT A;  5JEA G;  1SDF A;  1Y1V H;  4A76 A;  4DXG A;  5D3D A;  4A3B H;  1WOO A;  4GKK Q;  1LUZ A;  4U9U A;  1PMR A;  4LFC Q;  4C3H G;  4G1V A;  2R6G A;  1SYG A;  1TLL A;  2X85 A;  4DR6 Q;  3L9A X;  3AFQ A;  4DV5 Q;  3IFT A;  2X6X A;  1TU2 B;  4P2N A;  1N06 A;  4HTH A;  3R93 A;  2JDI A;  3ZC3 A;  4KY7 A;  5C3X A;  1JC7 A;  1FRQ A;  3OFN A;  2NN6 H;  2JA8 H;  1D8L A;  1N08 A;  5IGG A;  2EXZ A;  3PA1 A;  1O7I A;  4DV3 L;  4HR7 B;  3KLW A;  1EQT A;  1XNR Q;  3BVM A;  3LWE A;  2Q6L A;  4IOC A;  2A19 A;  3BZD B;  1E64 A;  4TRD A;  4V0B A;  4Z4Z A;  2L15 A;  2VQF Q;  4BBS H;  1GHK A;  4TQU S;  3GTL B;  1F9R A;  4CBV A;  4GOP C;  4XN0 A;  3VNV A;  4UP9 A;  3OTO Q;  5IT9 L;  4Y7N B;  4H02 A;  2RHQ B;  1IXR A;  5GAG C;  2RF4 A;  3GTG H;  2DET A;  1I4G A;  4DR1 L;  2WR8 A;  3CME B;  4HE5 A;  1GUW A;  5J3O A;  1G7R A;  1KJZ A;  2JP1 A;  1ZM4 A;  1BUV T;  5IP7 H;  1CKM A;  5LMN W;  4K0K Q;  3OZV A;  1R9T B;  2WYR A;  1VQD A;  1N36 Q;  5IYN A;  4M4S A;  4OWX B;  3OEE A;  1VQM B;  2XSC A;  2MQH A;  4A3K B;  5C44 H;  3A74 A;  3EN2 A;  2OTJ B;  2VNJ A;  4P6Y A;  1EP2 B;  4A93 H;  1WI5 A;  2Q2H A;  1PTO B;  3IKJ A;  2E2H H;  3W2D A;  2ZL5 A;  2OBR A;  5FO1 A;  1KK2 A;  2WKC A;  1NE3 A;  2PYK A;  2BOS A;  3A8J A;  4P72 A;  3B78 A;  4EH1 A;  5GAD C;  1Z47 A;  4JBK A;  3J7A 5;  1ICF B;  1OXX K;  3E6Z X;  4X05 A;  1K83 B;  2L11 A;  3H91 A;  2EJF C;  5M5Y H;  1QZG A;  4DV0 L;  3BDO A;  4BS9 A;  4TKO B;  4YAW A;  1EWC A;  5C0X I;  1ET6 A;  5C0X J;  1TWC H;  1ILQ A;  3I4O A;  3NE5 B;  1EIH A;  1MRZ A;  1VQ4 B;  2ES2 A;  1VQN A;  4PZ8 A;  5M3F B;  5M3F G;  1K28 A;  1H9J A;  1BX0 A;  4DV4 Q;  3ZIA A;  2RBM A;  4XL9 A;  3HGB A;  5H1S E;  1EFU A;  2Z4I A;  3R2I A;  4G5G A;  3GTJ H;  3HFZ B;  1XNQ L;  5BN3 A;  4RD1 A;  4OO1 G;  1L1O A;  4KY5 A;  4PMB A;  5I4D A;  1YJN B;  1IYV A;  4O2D A;  4BBR H;  4B3M L;  1H85 A;  3UDG A;  1ICW A;  1OB0 A;  3DXJ C;  4K14 A;  4FVM A;  3I55 A;  5CV8 A;  3J81 i;  3A5Z B;  2XGJ A;  4JVZ A;  4ULL A;  1BDO A;  2FIN B;  1Y8N B;  1PFM A;  4XKW A;  2K50 A;  1QCB D;  4K5V A;  3J7A V;  3S14 H;  1PKV A;  1WTO A;  4A3B B;  2R7Z H;  1FGB D;  3VR4 A;  5A35 A;  5JJI A;  3C1E A;  3FP9 A;  3KLS A;  3KLS X;  3G48 A;  1YIJ A;  4WJ3 M;  4B3S L;  4A3K G;  5KRU A;  4CKC A;  4WOR A;  1VLY A;  2A1A A;  2YWH A;  1W87 A;  3BZC A;  2PZU A;  4DK6 C;  1BCP F;  1XMQ Q;  4FXK C;  5C5L A;  3K5M A;  4XD7 A;  1UMK A;  1NDH A;  2C5H A;  1WTW A;  2ZBV A;  1CZW A;  4JI0 Q;  2B2T A;  1IYJ B;  2HMA A;  2F0P A;  3MMP A;  2Z6K C;  1OHH A;  3HZX A;  4LF8 L;  3ZZT A;  3NBH A;  3M4P A;  4RD0 A;  1CQX A;  3C2P A;  2ZTN A;  2AWN A;  4DGZ A;  1K8G A;  4UDU C;  1HR0 Q;  1NRK A;  1A8P A;  4AVZ A;  4H0L C;  4BA1 I;  3SXH A;  4UZU A;  3NUC A;  1I7P A;  4EQP A;  2EYP A;  2W6J A;  3B82 A;  1QGY A;  1F2Y A;  1N8R D;  4MTN A;  4JI4 L;  4PAA A;  1C0A A;  1WU8 A;  1TS4 A;  2CVR A;  3FHW A;  4P2C B;  5I2X A;  3CCE A;  1G6Z A;  2KEC A;  2TSS A;  4P73 A;  1B3Q A;  4LBV A;  1IKL A;  2DUD A;  1WTQ A;  3RY8 A;  1PRT F;  2NVT H;  2PNH A;  1YZ6 A;  1UD3 A;  4X64 Q;  2L0C A;  4C3H B;  4DAY B;  1CSP A;  1VQK A;  4DR4 L;  1PH7 A;  1PTO D;  4HCE A;  3A8K A;  3KF6 A;  1JOK A;  1S5C D;  5I6W A;  4A3J G;  3LNN A;  2NVX H;  3OZU A;  3I4M G;  1KD1 D;  4MTK A;  1N0U A;  4ZAI A;  4L5R C;  4CJ1 B;  1STY A;  3A1P A;  2MO0 A;  3CCV B;  4HIM A;  4CDF C;  1I4R A;  1IJF A;  1G7S A;  2F52 A;  1YJ9 B;  2DN8 A;  4QUF A;  4CHT B;  4P9S A;  4IO9 A;  4TMX A;  3T1H L;  2XN9 C;  1EFI D;  5GRO A;  2EDG A;  5LMU L;  1LT3 D;  2E2J H;  3KUP A;  4GLV B;  2VUM H;  1BVS A;  4ZCK A;  4EVO A;  4A3K H;  4A3C G;  4R8I A;  3WNC A;  3HOW B;  1W0K A;  4YHH L;  2R7Z G;  2IHF A;  2AQ3 B;  1AIP A;  2JIZ A;  5IYD G;  2NTT A;  3PSI A;  5FO8 B;  1GR1 A;  2NUC A;  4MNO A;  4JI5 L;  5C4X B;  5F2D A;  2XZO A;  1UD5 A;  1VLO A;  1OXT A;  1V0E A;  1V1Q A;  1JB7 A;  1K0R A;  3Q39 A;  2GPJ A;  1VDZ A;  1K8M A;  4HCS A;  2H5X A;  4C3I B;  1KAA A;  4MZ9 A;  4ZK9 B;  1VQ9 B;  3NPP A;  1I6V C;  4RD6 A;  3S24 A;  4DV2 L;  5IYD H;  3G71 B;  1RF2 D;  2EYO A;  5H5J A;  5CGK A;  2E1R A;  2L4N A;  1VQ8 B;  1NJI C;  3J81 k;  3HOY B;  4BPR A;  3HG9 A;  4JBW A;  4A3C H;  3MXN B;  3GTP H;  4N3G A;  3M9B A;  2F0Q A;  1ROD A;  3MHB A;  4F87 A;  2K1B A;  1CSQ A;  1CM9 A;  2NYZ D;  4Z4V A;  3ND9 A;  1CA5 A;  1LAC A;  4Z4Y A;  1KZL A;  2XZL A;  3A55 A;  1TWA B;  2N78 A;  3PO2 B;  3I90 A;  4A3J H;  4RD4 A;  3CCQ B;  1RKN A;  4TMZ A;  1T6X A;  1DGS A;  4XYO A;  1Q86 D;  2NVQ B;  4UZE A;  4ACA A;  2ZTD A;  3J7Y W;  2FMC A;  4LUO A;  3TDQ A;  3OJW A;  1GOZ A;  1SKY B;  1N33 L;  2QA4 A;  2YWE A;  1JQY D;  1WSV A;  4YAF A;  2QIL A;  5T1I A;  3DUZ A;  2GQF A;  4HIZ A;  2A68 D;  4BY1 B;  2JE6 I;  1AW7 A;  3GIR A;  5C4J H;  4CDC C;  3HKZ E;  3Q0A A;  5AN9 A;  3T53 B;  4R4Q A;  2IJ0 A;  3K0Y A;  1GO2 A;  2OBS A;  1KDA A;  1RD9 D;  3J80 L;  4B3G A;  1A3T A;  3LQE A;  5IWA L;  2GVB A;  5JJL A;  3A56 A;  3NTK A;  1NAP A;  3HOV G;  1XPO A;  4A3G H;  4QCL A;  4L6T B;  5IYR A;  4RA8 A;  4DU9 A;  1SE8 A;  1TS3 A;  1N34 L;  4RH6 A;  1FJG L;  3MEH A;  2D74 A;  2PI2 A;  2RSN A;  2Z9H A;  3E0E A;  2NWG A;  4LF5 Q;  3PMF A;  4AC9 A;  1IL2 A;  3TRZ A;  1GD7 A;  3W5O A;  5AJ3 Q;  3ONU A;  3CKI B;  2IT1 A;  5BR8 Q;  1H9R A;  2GJK A;  4CQJ A;  5JAV A;  3CQZ B;  1STA A;  3K59 A;  3Q6Q A;  2V7V A;  1EWI A;  2CQA A;  2E75 C;  4X62 L;  4M53 A;  1PTO C;  2K28 A;  1LM0 A;  2K01 A;  2M00 A;  4O1N A;  2C2W A;  3GSI A;  1SAP A;  3NXW A;  5D14 A;  3SJZ A;  1NBW A;  5EKK A;  2BE5 D;  3M3Y H;  3EIV A;  2HQL A;  4JI0 L;  1I8D A;  4Z1M A;  3NP8 A;  4LFC L;  3GTG B;  4QQB X;  5CBE E;  4CKB A;  1XFO A;  4K8J A;  4F88 A;  5FO0 A;  4QY7 A;  4KN4 C;  4G7W A;  4FK8 A;  1X3Q A;  1N8R C;  2I0Q A;  1B9M A;  3M7G A;  1ENF A;  1EFC A;  1TWF B;  1SE2 A;  1X56 A;  4H9G A;  2Q2I A;  3SEB A;  1EEF D;  1SRO A;  4L63 B;  4C3I H;  1L1O B;  1WOP A;  1GJR A;  1YI2 B;  1OB5 A;  2AMC B;  3S16 B;  4G7O C;  1DYQ A;  4DV6 Q;  1B70 B;  3CP0 A;  1E63 A;  1RDP D;  3FKI B;  4KD4 A;  2E76 C;  1M90 D;  5IP7 G;  1X65 A;  1AMO A;  3RD4 A;  3CCV A;  3R8B A;  3HOW H;  4X3K A;  4LNQ A;  2JA5 H;  5BN5 A;  3Q23 A;  4PZ6 A;  1NY4 A;  2V7X A;  3S15 B;  4CDE C;  1GUN A;  3J7Z C;  3GTK H;  1E22 A;  5JEA J;  3PUW A;  1YIT B;  2HQE A;  1F60 A;  3PQI A;  3P20 A;  3GTK B;  2BCO A;  4DV3 Q;  3EVQ A;  2EYJ A;  3CC4 B;  1I6H B;  1Q8I A;  1U5K A;  2VNI A;  4A93 G;  3H9N A;  3RLF A;  2B3G A;  1MD2 D;  4JBJ A;  1EWH A;  4N8F A;  1O7Y A;  3R2T A;  2WAQ E;  1DAR A;  2A8V A;  1SNO A;  1N05 A;  1YNN C;  3PIP 3;  2MGS A;  1TXY A;  2ZJP A;  1PFS A;  3T1H Q;  1Y1V G;  3PVD A;  2GK6 A;  2PIA A;  4QGU A;  2OCE A;  1S4M A;  4A3G G;  1A63 A;  4DK0 A;  3MXP A;  3CCL A;  2YWF A;  5IGE A;  4WJW A;  2A5H A;  3S2H B;  1K9M D;  2D9R A;  4BXX G;  4HAE A;  5IE8 A;  2V1C C;  4TMT A;  4YCW A;  1TS5 A;  1X9N A;  2KJX A;  2D3N A;  2B2W A;  4N9P A;  3LO8 A;  2WJV A;  2IW3 A;  2JJ2 A;  1EY5 A;  1LTA D;  4H44 C;  4LF9 Q;  1MHW C;  1Y1W H;  2VZL A;  4YEJ A;  1A8V A;  1H42 A;  5IY0 A;  1TY0 A;  3S1Q H;  1SLJ A;  2HLD A;  4X8I A;  2JA8 B;  3EA6 A;  1KXL A;  2X6Y A;  3SJP A;  2RHS B;  4X7D A;  3ASP A;  1CI3 M;  4LF7 Q;  4LF4 Q;  5IP9 H;  4AYB E;  4C2M B;  1P16 A;  4NXM L;  4RCY A;  5IT9 c;  4K2K A;  4DAP A;  2SNM A;  2Z0S A;  4RCN A;  1KDC A;  4KJO A;  2X8K A;  3FDT A;  4K8I A;  2HDN B;  4L5Q A;  1Y8O B;  2VS1 A;  1KMH A;  5IYQ A;  3KJP A;  1D7Q A;  2NZO A;  3OYY A;  4MYT A;  1A0I A;  1SYC A;  1PRT D;  4X3U A;  1Z7T A;  1KK1 A;  2CW0 C;  3HOV B;  2JEA I;  2NBF A;  1TII D;  2D0P A;  3MZ5 A;  1GUO A;  1EYA A;  1Y8P B;  3W5H A;  5J39 A;  2P3M A;  5HGT A;  2EOT A;  4CJ2 C;  2ZJQ A;  1D2B A;  4YCV A;  2F4V Q;  1PZK D;  4X0C A;  1CHQ D;  3KBX A;  5TV2 A;  2LSS A;  1Y0Y A;  4E0F A;  1EIG A;  4IUT A;  2SEB D;  2PMZ B;  4BY1 G;  5CMD A;  1VMC A;  4YY3 L;  3C3L A;  2R92 H;  3CCR A;  2OBT A;  1EQR A;  3W2E A;  4KKT A;  4YIJ A;  3Q6S A;  3ZBU A;  3QFC A;  1WVL A;  4F7D A;  1U4P A;  1VJS A;  1JWU D;  2Z1C A;  2HCJ B;  1EEI D;  3D4W A;  1PRT C;  2R93 H;  3OWF A;  2K32 A;  1I3Q H;  1XTD A;  2LFN A;  4LUZ A;  4OWT B;  1FR3 A;  1SE4 A;  2CKZ B;  1R5B A;  3BCF A;  2DER A;  5KYI A;  1KHI A;  3SK8 A;  5ELD A;  4A93 B;  4OGQ C;  1QWY A;  2E2H B;  2WPD A;  4A3M B;  4GN3 B;  4RKL A;  4DUZ L;  3K0X A;  1DG1 G;  3VR6 A;  1E43 A;  3QSY A;  1TWF H;  5IOD A;  1RQP A;  3J81 c;  3JQP A;  3J80 i;  1VQ6 A;  1WSR A;  1TWC B;  1HTL D;  2B7B A;  1V8Q A;  1HNW Q;  4YCU A;  1R4P B;  3RN2 A;  2WP8 J;  2F0J A;  4WRD A;  2O2L D;  1UE1 A;  1AN8 A;  3A8I A;  3OIQ A;  1D5X C;  3GV6 A;  1HA3 A;  1VQ7 B;  2VNU D;  2KVO A;  3KL9 A;  2V7W A;  2ZZE A;  5DSZ A;  4ABN A;  5LMZ A;  2WII B;  1PA6 A;  4DV1 L;  2BDO A;  3CW2 A;  5FL7 A;  3CPW B;  1F2L A;  2NN6 I;  2RC5 A;  3OE7 A;  1VQI A;  4RD3 A;  1QZH A;  2FXQ A;  1B4O A;  4C3I G;  2HHH L;  1K28 D;  4DR7 Q;  1N9W A;  3BQJ A;  4E6I A;  4U67 3;  3UDX A;  2N49 A;  3Q3A A;  2F0O A;  1VQ6 B;  3CHB D;  3SKB A;  3PO2 H;  2F0U A;  1JNY A;  3SLN A;  3I4N H;  2JSO A;  1B2T A;  3ITP A;  2KVM A;  1RTN A;  1PH5 A;  1EIF A;  3A54 A;  1R4Q B;  5C5M A;  4BWG B;  4IFD I;  4IFD J;  2UU9 L;  2AQ1 B;  3WY9 A;  3WQZ A;  4OIJ A;  5HZB A;  1WOR A;  5EBD A;  1F20 A;  2QEX B;  2EXD A;  3CRK C;  4TMV A;  5FJ8 G;  5FLM H;  1XX8 A;  3CCM A;  1EIY B;  2OQK A;  1Q81 D;  2PQE A;  5C4J B;  3PO3 B;  3ND8 A;  5EPK A;  3HS0 C;  5FIU A;  4KV6 A;  4RG1 A;  3MFY A;  2Q6I A;  2XGT A;  1SE3 A;  1HVX A;  1J5E Q;  1RTO A;  2PQA B;  3ONA B;  1Z9F A;  1S72 A;  3GV3 A;  2DOG A;  2EY2 A;  3NBH B;  4UAI A;  2R61 A;  3WBJ A;  3OWE B;  3I56 B;  1CKO A;  5ELF A;  3CMM A;  4A3G B;  2CK3 A;  3BG3 A;  1LTB D;  2F0V A;  3NWS A;  5AFW A;  1EYG A;  2CND A;  2Q6O A;  4TSS A;  3VA5 A;  1WTH D;  3GTM H;  3BDL A;  1HUN A;  1QB5 D;  5DM7 3;  5EJW A;  1E24 A;  1KNA A;  3OMC A;  3TP7 A;  4IUU A;  4PZ7 A;  1KDB A;  5ELE A;  3SHL A;  2HHH Q;  5LMN Q;  1D1I A;  2YYZ A;  3CQZ H;  2VQF L;  2AKW B;  1N32 Q;  1S4Z A;  3ONY A;  1Q86 C;  1E1O A;  3OTO L;  2CHB D;  3I73 A;  2C5B A;  3LQ6 A;  4ZCI A;  5GQO A;  1D1K A;  5CV5 A;  2G9D A; 
#chains in the Genus database with same CATH homology
 2NVX B;  3HAG A;  3GTO B;  2WV6 D;  3VR5 A;  1W9X A;  2EY6 A;  1STH A;  3VYS A;  3TBI B;  4C3J B;  3A35 A;  4CGY B;  2PPB C;  4M8A A;  3IL8 A;  3M4O B;  4XQF A;  4HN7 A;  2A6H D;  2Q8R E;  2GJR A;  1SXT A;  5C3W A;  2XRQ D;  2V31 A;  4MIU A;  2RKS A;  1EY8 A;  3S9W A;  3URY A;  2L1B A;  1TR5 A;  1WD0 A;  1E2Z A;  1HQR D;  2EYM A;  2ZT9 C;  2M2L A;  5A2Q L;  2R9V A;  1OXS C;  2Q8T A;  4BBR B;  5IGC A;  1Q1B A;  4G7X A;  3BVG A;  4Q5V A;  5EBC A;  1BR9 A;  2WKD A;  1BPL A;  1BCP D;  4PMW A;  5FLX E;  1LV9 A;  1EYD A;  5T1G A;  4NMZ A;  2A73 B;  5E4X A;  4KK7 A;  4XON A;  4AYB B;  1L0X B;  2E74 C;  4DF7 A;  2M5S A;  4MN3 A;  5JPM C;  5COY A;  4XYQ A;  4II3 A;  4OO1 I;  3OEH A;  4XKV A;  1LTT D;  5HUR A;  2K5D A;  1HFN A;  5I9P A;  4ASU A;  5EPJ A;  1PRT B;  1B50 A;  2AWO A;  2F0K A;  1LO5 D;  4N9T A;  2ZXP A;  2MP1 A;  1DOL A;  3VA7 A;  5IOC A;  4TSF A;  1IKM A;  3SK6 A;  2EJM A;  1Z6H A;  4XN3 A;  1LT6 D;  2MJ8 A;  2DY8 A;  1KNE A;  2BA1 A;  4K5W A;  1GHJ A;  5JVH 3;  5E3F A;  1LAB A;  2DY7 A;  3FVQ A;  4FO2 A;  2GK7 A;  4G6I A;  2XWB B;  4II2 A;  5G3L D;  1EQV A;  1MBY A;  1DCZ A;  3H6M A;  2F0I A;  3OW7 A;  2R93 B;  2J0T D;  3NK9 A;  4RWS C;  1JWS D;  2O5I C;  4KHV A;  3RZO B;  1LTG D;  5CV9 A;  3HEJ A;  2I07 B;  2X69 A;  1BOS A;  3DDY A;  2XNA C;  1HPC A;  3NTH A;  1GJX A;  3MAQ A;  4IUP A;  1WTV A;  1G2S A;  2Z4H A;  5KND A;  2LZJ A;  1CHP D;  1F2M A;  2XIW A;  1SSO A;  2RDF A;  1PDQ A;  4BY7 B;  1PFN A;  3MXN A;  3BS1 A;  1VF7 A;  5K36 H;  5IGF A;  1BXT A;  3L7Z C;  2J7Z A;  2PO4 A;  4A3F B;  1S5B D;  2ZXR A;  4ZYS A;  1W0J A;  4QF4 A;  1QNK A;  4HSV A;  4XLH A;  2B2Y C;  1VMP A;  1BNZ A;  3AU7 A;  3K6O A;  2F0H A;  2JEB I;  1EFR A;  4XNF A;  4DNR B;  1ET9 A;  5J1Z A;  1CQV A;  1KAB A;  3H94 A;  5ELC A;  5M5Y B;  3KLR A;  1PFB A;  1LLR D;  2D5D A;  4G7H C;  1HTP A;  1X32 A;  3KEW A;  4I7Z C;  5LL6 S;  5CC4 A;  4B9W A;  1W6K A;  4XQQ A;  1IW7 D;  5DNF A;  2MPM A;  1UD2 A;  3X3M A;  3M85 A;  4RAU C;  3SK4 A;  2EY1 A;  2KUM A;  1V1P B;  5EGT A;  2F1M A;  1A15 A;  1I4P A;  1J9O A;  2A69 C;  1XXG A;  1U9R A;  3GTM B;  1Q3L A;  5JEA H;  2IPK D;  1AZP A;  5IGB A;  4IFD H;  1UUP A;  5JVG 3;  2F0F A;  1JOO A;  5I2Y A;  5COR A;  4KMU C;  1JOQ A;  3OHX C;  3DEP A;  3OSO A;  2KEE A;  1SYB A;  4V19 0;  1PXU A;  1F77 A;  4JK1 C;  1RJT A;  3T51 B;  1EYC A;  2WZP P;  4IUR A;  2YU9 B;  1UD6 A;  3I72 A;  2A68 C;  1V0F A;  1AEX A;  1ZYR D;  1PTO H;  4XT3 B;  4KTA A;  1F9Q A;  1QE6 A;  3NQT A;  2EJG C;  1AFP A;  1FYC A;  2F0D A;  1IW7 C;  2KCC A;  4NNJ A;  1CT1 D;  4U68 A;  2QDB A;  4NDX A;  2A74 C;  4KN7 C;  1SYF A;  3BYT B;  1H9M A;  1QNU A;  2ENB A;  5K5P A;  4NW2 A;  4H13 C;  3TP8 A;  1NCV A;  2EVB A;  5K36 G;  1SMY D;  1RCV D;  3L3O C;  5JOB A;  3EQL C;  3OOC A;  2VJI A;  2D2C C;  3GP7 A;  3DWQ A;  5DM6 3;  2A69 D;  4DFA A;  4RGT A;  3GQB A;  3VYR A;  1V43 A;  5DEH A;  2ZXI A;  3I3C A;  1Y1W B;  2F3V A;  3NHH A;  4LJZ C;  2PW5 A;  3RZD B;  1SMY C;  1EU3 A;  1G8Z D;  3J80 E;  2E2I B;  1EOT A;  4OIK A;  2GA4 B;  5ELB A;  4DA2 A;  1ESF A;  1C4Q A;  4QB4 A;  5C0X G;  4XLE A;  3K7A B;  1XYI A;  3D8G A;  2X6G A;  3N6R A;  3MWY W;  3HOZ B;  5KIX A;  5ISR A;  1ENC A;  1KLG D;  5TSS A;  1ZXT A;  4L8J A;  5M5W B;  2L9H A;  4ZKB B;  1UAP A;  1NBM A;  2R92 B;  3NTI A;  3R3O A;  1EY6 A;  3S1N B;  4XMY A;  2Y0S B;  1HUM A;  2ID0 A;  2LMC B;  2F03 A;  2RDG A;  1DOM A;  3U9S A;  2OXP A;  4B08 A;  5KEE A;  1STB A;  3A7A B;  1MSG A;  5KNC A;  1XTC D;  1BLI A;  4RHS A;  3DM1 A;  5DN6 A;  2KA7 A;  2XZP A;  2NB0 A;  1DD2 A;  4KJN A;  4DK1 A;  4LK1 C;  3V2T A;  4P22 A;  3KBG A;  2F0W A;  3IFD A;  3CU7 A;  2RA4 A;  4RFB A;  1AP0 A;  4F8M A;  1TKW B;  2J4X A;  2B2V A;  3P7J A;  4KI0 A;  3MVV A;  5J22 A;  1BQQ T;  1ESR A;  4H7B A;  2F0S A;  2X6W A;  1MI2 A;  5C6A A;  3V05 A;  2JYO A;  4K2L A;  1CTM A;  4LMQ D;  1EZ8 A;  3X3N A;  3M4Y A;  3C1F A;  1E3X A;  3T56 B;  2D9U A;  3RUZ A;  4XM3 A;  2A6E D;  3I8Z A;  1NR2 A;  1FNV A;  3ERQ A;  2DNE A;  2WAC A;  1H8H A;  1EU4 A;  1A2U A;  3K5N A;  1OXU A;  4FP5 D;  3NQI A;  1E3Z A;  1EY4 A;  1II3 A;  1CFM A;  1STE A;  3QOJ A;  5CBA E;  1ONL A;  4C1N I;  5EKL A;  3BH4 A;  4XOR A;  3I91 A;  5A2Q E;  4FNF A;  3EFX D;  3TP6 A;  3DEO A;  5FOB B;  2LY7 A;  2IX0 A;  3S1Q B;  1A3U A;  1GXD C;  4PQX A;  2JA7 B;  4CJ0 B;  4X3T A;  3MXU A;  4Q0F A;  3MTS A;  5E4W C;  1E1R A;  2VB2 X;  3QB3 A;  3PIO 3;  4J8Q A;  3SK5 A;  4G57 A;  2X53 S;  1IL8 A;  2M9V A;  1YNJ D;  3DHQ A;  3TME A;  1WP6 A;  4KY6 A;  1OO9 B;  1F9S A;  3SVM A;  3SDZ A;  5KNB A;  2QCP X;  3BVZ A;  4C1N K;  3QG1 A;  5C0X H;  4KKS A;  3OIP A;  3UI2 A;  4FXU A;  1WCM B;  1Y1V B;  3K5O A;  2B2U C;  2F0M A;  5JPN C;  2IX3 A;  4KD3 A;  2RSO A;  2SOB A;  4A3E B;  4DXF A;  4FXD A;  2G9H D;  3PUZ A;  3F2U A;  5M5X B;  3HP3 A;  2QF7 A;  2F0T A;  4ZLT F;  1UD8 A;  2AQ2 B;  2H4O A;  1E2W A;  4RCO A;  2JA5 B;  2L5T A;  5CV4 A;  3P1H A;  1LTS D;  3H0G B;  1SJE D;  1WTP A;  2IL8 A;  2XOK A;  3ZPN A;  4PV1 C;  3JU4 A;  3FMC A;  5CV6 A;  3K57 A;  2A6E C;  3DWA A;  1GUG A;  1UEA B;  2F0G A;  4XXE A;  1H9S B;  1HZE A;  2A6H C;  1ZYR C;  5IT9 E;  2KCN A;  3GTQ B;  1EZ6 A;  1PLF A;  4IZ8 A;  5IK2 A;  3M7N A;  1STN A;  1PZI D;  1O78 A;  4F7X A;  4IQZ A;  1U4M A;  1QG7 A;  2VXW A;  3TSS A;  1QIL A;  3A3B A;  1CQF A;  2RVL A;  1SNQ A;  2F0E A;  2V7Q A;  4ID6 A;  3H3V C;  1B9N A;  1U4R A;  2K5W A;  4MHE A;  1UNS A;  3I4M B;  1TWH B;  3KK7 A;  3A7L A;  2VB3 X;  3V96 A;  3I70 A;  5IGD A;  1KLU D;  2HDL A;  3W3A A;  2L55 A;  2XVS A;  3K5L A;  4R8N A;  1C8C A;  4KHZ A;  1RHP A;  5CR3 A;  1FNU A;  2HUG A;  1YNJ C;  3K58 A;  4IAL A;  1O80 A;  4XT1 B;  1G2T A;  3FKS A;  3BCD A;  3FPU B;  4YXW A;  1Q90 A;  1TY2 A;  4RKB A;  4ZUJ A;  4B9X A;  1DXM A;  1I4H A;  2PW7 A;  3NBI A;  1V1P A;  2WB1 B;  1L0Y B;  1H9K A;  1I3Q B;  3FRP B;  4FF3 A;  1ILP A;  4A3D B;  2K05 A;  1HCZ A;  1M8A A;  2OF1 A;  3QIA A;  2E1B A;  2D62 A;  1C48 A;  3G05 A;  4FXG C;  1TS2 A;  5D65 A;  1B44 D;  1LTI D;  1YNN D;  1JIC A;  5LL6 X;  1XWE A;  2PZW A;  4WFN 3;  1LT4 D;  1OXV A;  4X3S A;  1ENA A;  4K6D A;  1WD1 A;  3ZYY X;  3EJI A;  3AMU A;  2E2D C;  1SNM A;  1BF4 A;  1JWM D;  2EE1 A;  3P75 A;  4DN4 M;  2X6L A;  2JA6 B;  1JE4 A;  2MHV A;  1WTX A;  2ZTG A;  3DWP A;  1FX0 A;  3AB9 A;  1NR4 A;  1DON A;  4ZUI A;  3MXG A;  3D4D A;  4KKU A;  5IIF A;  4B3F X;  1SBB B;  3GO5 A;  1X3P A;  3U9O A;  1EY0 A;  4GZY C;  2ICE C;  3PV0 A;  1SNC A;  4IUQ A;  2B2T C;  2PZT A;  4C56 C;  2D3L A;  5I6Y A;  1D6E C;  4EQN A;  2ZXH A;  1COW A;  1NSN S;  3D31 A;  2FFK B;  1H9S A;  2FMM A;  1GUT A;  4QIW B;  3HOX B;  1E1Q A;  1KTK A;  3GTJ B;  3QOL A;  4Z9C B;  1MGS A;  2H1E A;  1IYU A;  3J81 E;  2WAQ B;  4ZRZ A;  1AZQ A;  2IX1 A;  2F0N A;  4HMJ A;  4XR6 A;  1D5M C;  1DM0 B;  1HA5 A;  3ERO A;  1EY9 A;  4XLA A;  1PYW D;  4RHR A;  1B3A A;  3MA2 B;  1TT2 A;  4BA2 I;  2LKV A;  3QO2 A;  3S17 B;  2RQX A;  2Z6B D;  1JR0 D;  2VJJ A;  4RGO S;  1HQM C;  2ICI A;  1B1Z A;  1IHZ A;  2NVT B;  4BBS B;  4EQO A;  3TP5 A;  2EPB A;  2EY5 A;  1O7L A;  3GD7 A;  2BA0 A;  3H09 A;  4IN3 A;  4JMQ A;  4I65 A;  3J7A F;  4FYD A;  2R3Z A;  5E1F A;  2B8G A;  3Q22 A;  4HMI A;  1DZ1 A;  2IWH A;  5CYU A;  2EYL A;  2N55 A;  2KOL A;  3GVK A;  1G29 1;  3CES A;  1LT5 D;  5C44 B;  1MSH A;  2C9O A;  2K5Q A;  3E0J A;  3O13 A;  3SE0 A;  3T4A C;  1EL0 A;  1HA6 A;  4HSP A;  2K6A A;  2HCI A;  1BCP B;  3D6C A;  4FF1 A;  1I18 A;  3PUV A;  3VYU A;  1ZEQ X;  3IAY A;  3NWT A;  1D5Z C;  1TVX A;  1PTO F;  4R9W A;  3FEW X;  1ZKO A;  4DAV A;  1M4V A;  4J1M A;  5CV7 A;  2OT2 A;  1W6J A;  4ZKC B;  1B53 A;  1SNP A;  2B8F A;  2FJ2 A;  3GTP B;  1HXY D;  1JB3 A;  1I4Q A;  4C3J G;  3LWU A;  1BCP C;  2PNR C;  3S1R B;  4XTC S;  3NSW A;  4PMC A;  2V4D A;  3HKZ B;  4DNT B;  1E2V A;  4XDX A;  2EZV A;  3WOE A;  1STG A;  3A8I E;  2F4I A;  4A3I B;  2K04 A;  2HDM A;  3PUX A;  2AUJ D;  1Y69 U;  3HOU B;  2B39 A;  2JJ1 A;  3OAA A;  1QJO A;  4XOP A;  2HCC A;  4ODG A;  4S3S A;  1HFG A;  1A6X A;  1VCI A;  2O4X A;  5FLX L;  4OL7 A;  3LX0 A;  4FF2 A;  2KQ3 A;  4O42 A;  5JJZ A;  3PUY A;  3D4R A;  5EKI A;  1JOR A;  4RGN A;  2B2Y A;  2Z8L A;  4IUN A;  1SJH D;  1BO0 A;  1T5X D;  3SR1 A;  2K03 A;  2FHT A;  1S5F D;  3DMU A;  4J6H A;  2L12 A;  5C3E B;  5C4H A;  1E79 A;  3T13 A;  3S1M B;  1T5E A;  1DJR D;  5CDF A;  5KGU A;  3WDN A;  2GJP A;  3OPO A;  2F0L A;  2WSS A;  3G7L A;  5C4Z A;  2PCF B;  2ZXO A;  3MFG A;  5EPL A;  1BMF A;  2QKI C;  4K6L A;  4ZQ3 A;  5KNL A;  1K8O A;  5FKA C;  1HHV A;  5BN4 A;  1WPC A;  3VR2 A;  5I9O A;  3QWN A;  4DAY A;  1V1O A;  1BBX C;  3A3G A;  4G4K A;  2DIE A;  4YEL A;  1NUC A;  4RGM A;  2CW0 D;  4K5X A;  3M3Y B;  3S14 B;  4M1U B;  1GUS A;  3J81 L;  1SND A;  4CKE A;  3D3R A;  1CA6 A;  4XLF A;  5G3L F;  1I4X A;  1UD4 A;  1CZG A;  3CP2 A;  1EY7 A;  1U4L A;  3QJY A;  1SEB D;  2OEO A;  4XOT A;  2K7V A;  1JCK B;  5D3I B;  3BC9 A;  2B2W C;  4OO1 H;  2ZZQ A;  1FNW A;  4QMG A;  1SYE A;  2W6I A;  3A8J E;  2SNS A;  5EQ0 A;  1TQO A;  3D6W A;  2C5C A;  1E0B A;  2QEJ C;  1H8E A;  2XWJ B;  4IFD G;  2KED A;  2ZZG A;  1TWG B;  5M9O A;  1F9P A;  4EGV A;  2BE5 C;  3I4N B;  4LAA A;  1S5E D;  1CK1 A;  2JXM B;  3I4L A;  2N88 A;  3Q24 A;  4GQN A;  5HKK A;  2NN6 G;  3WOF A;  5KYL A;  3VR3 A;  4FF4 A;  2QE7 A;  3T16 A;  1PZJ D;  1SFO B;  4XIG S;  2I46 A;  2SDF A;  2XND A;  3E5S A;  3C46 A;  2ZZF A;  3GVL A;  2BDN A;  2LS0 1;  2NTS A;  4XQJ A;  3BDC A;  2XRS D;  3G6J B;  2Q8I B;  1WTR A;  1J8I A;  4ILW A;  3MC0 B;  5FK9 C;  4HED A;  1ML0 D;  3FPP A;  1SYD A;  3OMG A;  2B63 B;  3A8K E;  4OHJ A;  4G7Z C;  4TT3 A;  1VF5 C;  2VUM B;  2F43 A;  2EYH A;  2K33 A;  2AUK A;  1FD7 D;  2B2U A;  1QOH A;  1S5D D;  1F2Z A;  1MAB A;  2O5J C;  2KHS A;  3CP8 A;  2F3W A;  3JAM E;  1Q1E A;  5LHY 1;  2WIN B;  5DAU A;  2E2J B;  3S2D B;  1DOK A;  1A2T A;  4IUV A;  1G91 A;  2MUY A;  4ME5 A;  3TZD A;  5FO9 B;  4NKL A;  4XQN A;  1A3V A;  5FO7 B;  1HRJ A;  4NP5 A;  4QUC A;  4PNY A;  2NVY B;  3GVJ A;  2RDH A;  3JAM L;  2R7Z B;  1LTR D;  3KF8 A;  5M3M B;  3HRZ C;  2EYF A;  2DNC A;  3CRL C;  5NUC A;  1O7Z A;  2B2V C;  2TMP A;  4XLC A;  1Q12 A;  3RMH A;  2NZ1 D;  3N52 A;  1I50 B;  3TN2 A;  3BYY B;  3TZU A;  4A3J B;  2WJY A;  3VYT A;  5JEA G;  1SDF A;  4DXG A;  5D3D A;  1PMR A;  4C3H G;  2R6G A;  1SYG A;  2X85 A;  3L9A X;  3IFT A;  2X6X A;  1TU2 B;  5C3X A;  4HTH A;  2JDI A;  4KY7 A;  3R93 A;  1JC7 A;  3OFN A;  2NN6 H;  5IGG A;  2EXZ A;  4HR7 B;  1EQT A;  3BVM A;  3LWE A;  3BZD B;  4TRD A;  4V0B A;  1GHK A;  4TQU S;  3GTL B;  1F9R A;  4CBV A;  4XN0 A;  5IT9 L;  4Y7N B;  1I4G A;  1GUW A;  2JP1 A;  1BUV T;  1R9T B;  3OEE A;  2XSC A;  4A3K B;  1PTO B;  3IKJ A;  3W2D A;  2WKC A;  2PYK A;  2BOS A;  1Z47 A;  1OXX K;  3E6Z X;  1K83 B;  2L11 A;  3H91 A;  2EJF C;  3BDO A;  4BS9 A;  4TKO B;  1EWC A;  5C0X I;  5C0X J;  1ET6 A;  1ILQ A;  3NE5 B;  1EIH A;  5M3F B;  1H9J A;  3ZIA A;  2RBM A;  4XL9 A;  3HGB A;  2Z4I A;  3R2I A;  5BN3 A;  4OO1 G;  4KY5 A;  4PMB A;  5I4D A;  1IYV A;  1ICW A;  1OB0 A;  3DXJ C;  4K14 A;  4FVM A;  5CV8 A;  2XGJ A;  4ULL A;  1BDO A;  2FIN B;  1Y8N B;  1PFM A;  4XKW A;  4K5V A;  1QCB D;  3J7A V;  4A3B B;  1PKV A;  1WTO A;  1FGB D;  3VR4 A;  5A35 A;  3C1E A;  3KLS A;  3KLS X;  5KRU A;  4CKC A;  4WOR A;  1VLY A;  2PZU A;  1BCP F;  4FXK C;  5C5L A;  3K5M A;  4XD7 A;  1WTW A;  1CZW A;  2B2T A;  2F0P A;  1OHH A;  3HZX A;  3NBH A;  3C2P A;  2ZTN A;  2AWN A;  4DGZ A;  4UDU C;  1NRK A;  4AVZ A;  4H0L C;  4BA1 I;  3SXH A;  4UZU A;  3NUC A;  4EQP A;  2EYP A;  2W6J A;  1F2Y A;  1TS4 A;  2CVR A;  5I2X A;  4P2C B;  1G6Z A;  2KEC A;  2TSS A;  1IKL A;  1WTQ A;  1PRT F;  1UD3 A;  2L0C A;  4C3H B;  1PTO D;  4HCE A;  1JOK A;  1S5C D;  5I6W A;  3LNN A;  4ZAI A;  4CJ1 B;  1STY A;  1I4R A;  2DN8 A;  4QUF A;  4CHT B;  2XN9 C;  1EFI D;  2EDG A;  1LT3 D;  3KUP A;  4EVO A;  4R8I A;  3HOW B;  1W0K A;  2AQ3 B;  2JIZ A;  2NTT A;  5FO8 B;  2NUC A;  5C4X B;  5F2D A;  2XZO A;  1UD5 A;  1OXT A;  1V0E A;  1VDZ A;  1K8M A;  4HCS A;  4C3I B;  1KAA A;  4ZK9 B;  3NPP A;  1I6V C;  1RF2 D;  2EYO A;  5CGK A;  2L4N A;  3HOY B;  3HG9 A;  4JBW A;  2F0Q A;  1ROD A;  3MHB A;  4F87 A;  2K1B A;  1CM9 A;  2NYZ D;  3ND9 A;  1CA5 A;  1LAC A;  1KZL A;  2XZL A;  3A55 A;  1TWA B;  3PO2 B;  3I90 A;  1RKN A;  2NVQ B;  4XYO A;  3J7Y W;  2FMC A;  3TDQ A;  1GOZ A;  1SKY B;  1JQY D;  2QIL A;  5T1I A;  3DUZ A;  4HIZ A;  2A68 D;  4BY1 B;  2JE6 I;  1AW7 A;  3Q0A A;  3T53 B;  2IJ0 A;  3K0Y A;  1KDA A;  1RD9 D;  3J80 L;  4B3G A;  1A3T A;  3A56 A;  3NTK A;  1NAP A;  4QCL A;  4L6T B;  4RA8 A;  4DU9 A;  1TS3 A;  4RH6 A;  3MEH A;  2RSN A;  2NWG A;  3PMF A;  3CKI B;  2IT1 A;  1H9R A;  2GJK A;  5JAV A;  3CQZ B;  1STA A;  3K59 A;  2CQA A;  2E75 C;  1PTO C;  2K28 A;  2K01 A;  2M00 A;  4O1N A;  1SAP A;  3NXW A;  5D14 A;  5EKK A;  2BE5 D;  1I8D A;  4Z1M A;  3NP8 A;  3GTG B;  5CBE E;  4CKB A;  4K8J A;  4F88 A;  4KN4 C;  4G7W A;  1X3Q A;  1B9M A;  3M7G A;  1ENF A;  1TWF B;  1SE2 A;  3SEB A;  1EEF D;  4L63 B;  3S16 B;  4G7O C;  1DYQ A;  1RDP D;  3FKI B;  4KD4 A;  2E76 C;  3RD4 A;  3R8B A;  4X3K A;  5BN5 A;  3Q23 A;  3S15 B;  1GUN A;  5JEA J;  3PUW A;  2HQE A;  3P20 A;  3GTK B;  2BCO A;  3EVQ A;  2EYJ A;  1I6H B;  1Q8I A;  3RLF A;  1MD2 D;  1EWH A;  1O7Y A;  3R2T A;  1SNO A;  1YNN C;  3PIP 3;  2MGS A;  2GK6 A;  4DK0 A;  3MXP A;  3S2H B;  5IGE A;  4WJW A;  2A5H A;  4HAE A;  1TS5 A;  2KJX A;  2D3N A;  2B2W A;  4N9P A;  2WJV A;  2IW3 A;  2JJ2 A;  1EY5 A;  1LTA D;  4H44 C;  4YEJ A;  1TY0 A;  2HLD A;  2JA8 B;  3EA6 A;  2X6Y A;  1CI3 M;  4C2M B;  4K2K A;  4DAP A;  2SNM A;  4RCN A;  1KDC A;  4KJO A;  2X8K A;  3FDT A;  4K8I A;  1Y8O B;  1KMH A;  1SYC A;  4X3U A;  1PRT D;  1Z7T A;  2CW0 C;  3HOV B;  2JEA I;  2NBF A;  1TII D;  3MZ5 A;  1GUO A;  1EYA A;  1Y8P B;  5J39 A;  5HGT A;  2EOT A;  4CJ2 C;  1D2B A;  1PZK D;  1CHQ D;  3KBX A;  4E0F A;  1EIG A;  3C3L A;  4IUT A;  2SEB D;  2PMZ B;  5CMD A;  1VMC A;  4YIJ A;  4KKT A;  3Q6S A;  1WVL A;  1U4P A;  1VJS A;  1JWU D;  2Z1C A;  1EEI D;  3D4W A;  1PRT C;  3OWF A;  2K32 A;  2LFN A;  1FR3 A;  1SE4 A;  3BCF A;  5KYI A;  3SK8 A;  5ELD A;  4A93 B;  4OGQ C;  1QWY A;  2E2H B;  2WPD A;  4A3M B;  4RKL A;  3VR6 A;  1E43 A;  5IOD A;  1TWC B;  1HTL D;  1V8Q A;  1R4P B;  2WP8 J;  2F0J A;  4WRD A;  2O2L D;  3OIQ A;  1AN8 A;  1D5X C;  3GV6 A;  2VNU D;  2KVO A;  2ZZE A;  4ABN A;  2WII B;  2BDO A;  5FL7 A;  1F2L A;  2NN6 I;  3OE7 A;  4C3I G;  1B4O A;  1K28 D;  4E6I A;  4U67 3;  2F0O A;  3CHB D;  2F0U A;  2JSO A;  1B2T A;  3ITP A;  2KVM A;  1RTN A;  3A54 A;  1R4Q B;  5C5M A;  4BWG B;  4IFD I;  4IFD J;  2AQ1 B;  3WQZ A;  4OIJ A;  5EBD A;  3CRK C;  1XX8 A;  5C4J B;  3PO3 B;  2PQE A;  3ND8 A;  5EPK A;  3HS0 C;  4KV6 A;  3MFY A;  1SE3 A;  1HVX A;  1RTO A;  3ONA B;  3GV3 A;  2EY2 A;  4UAI A;  2R61 A;  3OWE B;  5ELF A;  3CMM A;  4A3G B;  2CK3 A;  3BG3 A;  1LTB D;  2F0V A;  3NWS A;  5AFW A;  4TSS A;  3VA5 A;  1WTH D;  3BDL A;  1HUN A;  1QB5 D;  5DM7 3;  5EJW A;  1KNA A;  3OMC A;  3TP7 A;  4IUU A;  5ELE A;  1KDB A;  3SHL A;  1D1I A;  2YYZ A;  1S4Z A;  2CHB D;  3I73 A;  1D1K A;  5CV5 A;  2G9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...