3T53B

Crystal structures of the extrusion state of the cusba adaptor-transporter complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein CusB
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 55
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t53B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t53B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t53B01
2BDOA 4KN7C 2K7VA 4DK0A 5C0XG 1IYUA 1Q90A 3I4LA 1ZKOA 2EJMA 1O78A 3BG3A 2EJFC 3DXJC 1Q1EA 4JK1C 4KN4C 5KNBA 1O7LA 2ZT9C 4H0LC 2KCCA 5A35A 1K8MA 2LMCB 1FR3A 3VR5A 3L7ZC 2AUKA 1E2WA 2A69C 3ND8A 3PUYA 1GUGA 4XTCS 4OO1G 1VF7A 4BA2I 2EVBA 1V8QA 2BA1A 2QF7A 3EQLC 1CFMA 3P20A 4KMUC 5K36H 2BE5D 2NN6I 4TQUS 3SE0A 1OXXK 3A8KE 1Q1BA 1SMYC 1GUSA 3M4YA 4OGQC 1Y8NB 2NN6G 2NN6H 4XIGS 1OXVA 3U9SA 4G7OC 2L5TA 3OW7A 1Y8OB 2A6EC 3GD7A 3OPOA 5C0XH 3VR6A 3W3AA 1E2ZA 2R6GA 3M7NA 2JEBI 1IW7C 2DN8A 1FYCA 4IFDH 4IFDG 2V4DA 2DNCA 1B9NA 3IKJA 1YNJC 2O5IC 5BN4A 1YNNC 3OOCA 4H44C 4KKUA 3PUXA 1OXSC 1GUOA 1H9KA 4OO1H 2AWOA 3I73A 3IFTA 2B8GA 1CI3M 2JXMB 3T56B 1VDZA 1H9RA 3PUZA 2A68C 1E2VA 3RLFA 3VR2A 3FMCA 3ND9A 1H9MA 1DXMA 1ONLA 5BN3A 1DCZA 1IW7D 2YYZA 2DNEA 3NE5B 1QJOA 3PV0A 3LNNA 2D62A 1Y69U 3LWUA 4BA1I 2A6HC 4KKSA 1H9SB 3T53B 4G7HC 2A69D 1Q12A 2E75C 1GUTA 3A8IE 1VCIA 1H9JA 4RCNA 1GHKA 3H94A 1K8OA 4LJZC 1T5EA 2EJGC 3A7AB 1Z7TA 2K33A 4I7ZC 1HQMC 1Z6HA 1ZYRC 3QG1A 2A68D 5BN5A 4KI0A 2KA7A 3M85A 3PUWA 3CRLC 1GUNA 3D4RA 1HPCA 1LABA 1TKWB 3A8JE 4G7ZC 4DNRB 4L8JA 3T51B 2A6HD 4TKOB 1OXTA 2A6ED 2Q8IB 2PNRC 1Y8PB 4JBWA 1VF5C 3KLRA 4HR7B 1B9MA 4DK1A 1PMRA 2E76C 3N6RA 2JEAI 1IYVA 2BE5C 3TZUA 1EWHA 3BDOA 3HGBA 1TU2B 1V43A 1CTMA 1DD2A 2K32A 3QJYA 3WDNA 1I6VC 2IT1A 2D2CC 2AUJD 1GHJA 2E74C 4IQZA 2O5JC 3AB9A 1HCZA 4LK1C 3VR4A 4KKTA 3D31A 3SDZA 3CRKC 3VR3A 5KNCA 4DNTB 3VA7A 1A6XA 4H13C 1HTPA 5KNDA 1LACA 2B8FA 3GQBA 3MFYA 4PV1C 2F1MA 4KHZA 5K36G 2PPBC 3QIAA 1G291 1OXUA 3PUVA 4GZYC 3A7LA 1GJXA 5JEAH 2JE6I 5JEAG 2D5DA 2EDGA 1BDOA 2BA0A 1H9SA 2PCFB 3I72A 3MXUA 3FPPA 2CW0C
chains in the Genus database with same CATH superfamily
2IHEA 2QEXA 4RLZA 2AQ1B 1ILPA 1I6HH 1FNUA 1JICA 3I4LA 4YAOA 1VQMA 4XMYA 1PTOD 4JI5Q 1OB0A 1LTTD 3AEVA 3BZDB 4CDFC 1C4QA 1NCVA 2Q2TA 2WIIB 4RCOA 4LAAA 5M9OA 2E1BA 4I65A 3BJUA 4YCUA 5K36H 4KMUC 1DOMA 1XNRQ 4LFAQ 5GAHC 3QSYA 1YJWB 5CR3A 3LX0A 1LLRD 2MUYA 3FRPB 4XIGS 2K50A 4L5SA 4NP5A 3URYA 4IUQA 3GD7A 3OPOA 1D1KA 3BQJA 3Q38A 4DV5Q 2F0HA 5C4JH 4KHPL 5A89A 1PH9A 2CK3A 2IPKD 2XWBB 3GTQB 4A75A 2KEEA 1V1PA 5IGGA 1D5ZC 4C0SA 1C48A 4LF9L 1X3PA 2RA4A 2XVSA 4X65Q 2HDMA 1YX2A 2Z0SA 3K5OA 2B2TC 2C9OA 3MZ5A 4NXMQ 2R92H 1WYDA 2JXMB 3UDXA 1F2MA 1IHMA 3OWEB 2Y0SE 3P1HA 5IYQA 2DNEA 3TEHB 4CJ1B 1XNQQ 1WTVA 3CCMB 4GQNA 1Y1WG 1U0LA 3HOWB 4JW0A 5I2XA 2XGTA 1EYGA 3A8JA 1JWMD 1KC8C 2WV6D 5JJLA 1LV9A 2ZTGA 1LUZA 2J0TD 4A3JG 4DFAA 4A3GG 1AN8A 3ULPA 2B7BA 3ZIAA 5CMDA 3JAML 3HOUG 5LMZA 2R93B 3RN5A 3A8JE 4X6AH 1EY5A 4Y9UA 3PF5A 1G2TA 3GVKA 3H3VI 3TZUA 3BDOA 4A3EG 1YHBA 5C3EB 1S4ZA 3U9OA 2I5HA 1CKNB 5C4XG 3ITPA 4AQYQ 5KNCA 3TDQA 2Y0SG 3K80C 5HGTA 4JI3L 3AVYA 1HTLD 4XL9A 2Q6OA 1WDTA 3GV6A 1VQ9A 2BH2A 1BCPD 4NBSA 2LY7A 4DUYQ 4L5RC 5TY0A 1PH1A 1QVGB 1S0UA 1EU4A 4DR2L 1TWFH 1SKYB 5I6YA 1UE6A 1DDIA 1NR2A 4KN7C 1DG1G 4DA2A 2C77A 5B6IA 1IYUA 1WD0A 2E1RA 2ATWA 5F4JA 1F20A 2AKWB 3UE1A 4JOIC 1JB7A 2B2WA 1S5FD 2QEJC 2VQEL 5EQ0A 2VQFQ 3ZZ0A 4AIMA 4BBSG 1M4VA 2A69C 4HSPA 2V7TA 3PIO3 3BNWA 1VQJA 1ML0D 1DGSA 2BA1A 2F0NA 4A3IG 5D65A 3A55A 3R6KA 3UE0A 3Q23A 1IBKL 3BY1A 3E20A 4I7AA 1QH0A 3SE0A 2ZL5A 1X65A 1J5EL 3BY2A 2IY5B 2IL8A 1XMQL 5K5PA 1ZM4A 3RZDB 5FJ8G 4K2LA 1KTKA 1KRTA 3W2GA 4HIDA 4R4OA 1OB2A 3TREA 1CHQD 1PH5A 2B2YA 2NV4A 2UXCL 1AIPA 2F3IA 1L1OB 1R5OA 2CQAA 1UWVA 4V0BA 3ULJA 4EGVA 2F0GA 4IPCA 4TSFA 5M3FG 1IHZA 1EWYA 3NXWA 2CW5A 1U9RA 4X3KA 5IGBA 2Z4HA 1W87A 4A3DG 4L6TB 3CCJB 1STAA 2R7ZG 1E2VA 4LC0A 2KBNA 3RLFA 3FMCA 3Q39A 4TMVA 4XM3A 4IPHA 3VYSA 3QE2A 1N8RC 1YNJD 5C5MA 4JI2L 4QCLA 3ULLA 1VQPA 2ZITA 2OTLA 2K5HA 2NVXB 1O7IA 2K01A 4GLAC 2QEXB 2KEDA 3ER0A 3HOXG 3A7AB 3W2FA 4ULLA 3GTLH 1LTAD 1KK3A 1ZYRC 3D0FA 1VQMB 4QUFA 2OXPA 4PZ7A 1JR0D 1Y1WB 5EBDA 4X8IA 2EY5A 4DNRB 5C5LA 3P7JA 3KYHC 2E2HB 1N08A 4A3JB 2XNJA 2VBUA 4B3RQ 1QNKA 5L46A 4QJFA 1VLYA 3HOUB 1PTOH 2XGJA 4QL5A 5EKIA 2EYFA 3PIOA 2B3GA 1TS4A 3D6CA 2JA8G 1F9SA 2L11A 1OGJA 4CBVA 3VDYA 5TSSA 3H9NA 5DLQE 4YHHQ 1AP0A 4K14A 5IGCA 5IWAQ 3E0EA 5EAYA 2EYHA 1EY7A 3G6JB 4AH6A 4A3EB 2C4UA 5C6AA 5IYBG 3CCSA 4IJLA 3OKXA 3K0YA 4TRDA 4Z1MA 2P3MA 1VQ6A 1D5XC 5C4XB 3J7AV 4FF1A 3ZC3A 2Y0SB 1I4GA 3MXUA 1WFQA 3CW2A 4G1BA 1I7PA 3QR8A 1ELOA 3FPKA 1HZEA 2JA7H 1K8AD 2VBTA 2Q6LA 2VBVA 5C0XG 4LNQA 5CDFA 1TWGH 1CT1D 1B23P 1YITA 3MXNA 3S2HH 5NUCA 2WZPP 1IJFA 4ZCMA 1Q3LA 2F0DA 4KN4C 4OIKA 1E1RA 1J9OA 4FVMA 1MJCA 1XTDA 3S24A 1M90D 1HNZL 3TP7A 1QVFA 4C3IH 5FOBB 2YU9B 2DCUA 4PMWA 3F2DA 1D8LA 1OXXK 2SDFA 1XMOQ 5FO0A 1VJSA 3RNUA 4JI3Q 4MZ9A 1C8CA 4ABNA 4UP8A 4RGOS 1PKVA 4P3IA 4Z4RA 1SE2A 2J7KA 3HZXA 4ILWA 4N8FA 1W34A 5EPJA 1MKHA 2YTYA 4G7WA 2QILA 3NBIA 2Z8LA 4IN3A 2QTZA 1O80A 2QCPX 5JJIA 3A8KA 4M53A 4ZV4A 5KNLA 4X64L 2HDNB 1SMYD 1I3QB 4XQJA 1H9KA 4B3SL 2RCFA 3K81C 1M1KD 3S15H 3BDLA 2X6GA 1VQ9B 1N0VC 1STYA 2KVMA 4AYBE 4C3HG 3PF4A 4FF2A 3R3OA 3ND9A 4QVJA 5M3FB 3T13A 2JA5G 4AVZA 1EEFD 1TS2A 4KY6A 4XN3A 4OEMB 5M3MG 1SROA 2F3VA 1PLFA 1Y1WH 3QOLA 2A6HC 3CC2B 4BA1I 4HIMA 1WTOA 1HNXL 3BCDA 3HFZB 3CCEA 2K03A 4MTKA 4A3DB 2N8NA 1ASZA 2BM0A 4BPRA 1I4XA 3NWTA 4N3NA 3RMHA 3OWFA 2WACA 1W3SA 4A3GH 1LYLA 4F8MA 2LKVA 4IPDA 2HLDA 1RODA 1XMQQ 2ZBUA 3VMFA 4CQJA 2TMPA 4RGMA 2V31A 1BNZA 3T1HL 3RLNA 3E3XA 4KHVA 4QF4A 3HOXB 2UXCQ 1F2ZA 2NYZD 1VQKA 4A3MH 1KQSA 4XXEA 2BGJA 2V7UA 2DJFC 2J7ZA 3WBJA 1Y0RA 4DV0L 1BUVT 4LW1A 1FD7D 1UEAB 1YNND 2AUJD 5J1ZA 4AYBG 1QX4A 3AGQA 3SDZA 4JYAL 4X3UA 5KYLA 2I46A 2PZWA 1COWA 2K05A 5GAEC 2JA8B 1M8AA 2ZXOA 1FGBD 1NRKA 1K3RA 3I91A 2XNDA 1FJGL 1KK2A 1QG0A 2QGQA 3PUVA 5COYA 2BVNA 3CD6A 1D5MC 4ZQ3A 2XRQD 4GLVB 2D3LA 1UAPA 4BY7G 4A3CG 1EIHA 3VYTA 3MTSA 2GJPA 4YWMA 4OX9L 2XNCA 4Z9CB 3SXHA 1V1QA 3H3VC 4FXUA 1KLGD 5HURA 1PH8A 4LFBL 5FO1A 1UD8A 4RD6A 1HH2P 1JQYD 3DEOA 3CF5A 4QB4A 3A0JA 3KF6B 3DWQA 3KLWA 1N32L 3K0XA 4IZ8A 2OTLB 1C9OA 4BBSH 3WNCA 1GO3E 3NBHA 1I4RA 2QW7A 3J80c 3BVMA 4A3FH 1STEA 4A3IH 2V7WA 2XSCA 4DR7Q 4ID6A 1EFID 4QQBX 3HS0C 1Q81D 4JI1Q 4KJOA 2UXDQ 1BKBA 1GUSA 3V2TA 3MMPA 5FJ8H 4ZKBB 1VQ4A 1TQOA 5TV2A 2WFWA 4OWWB 4LF6L 4IFDJ 1O7ZA 3VR6A 1I3QH 1SYCA 1WD1A 2MHVA 2VNIA 2NVTH 3S16B 3W5UA 2C78A 3RY8A 1YVCA 2D9UA 5I4DA 2PMZE 1NBMA 1VQ7B 4OOVA 4ZCLA 2XIWA 3MXGA 1S5ED 5CV7A 3R8BA 1FNWA 5M3FH 4XT1B 2YTXA 1XPOA 1H85A 1JWSD 3J7A5 4A3DH 3K57A 3T56B 5LMNL 3CCSB 3RR5A 2VUMH 2R7ZH 1X3QA 3LVBA 3VR2A 1G91A 1QVCA 5LL6X 1XQBA 3QWNA 1PTOF 1TWAH 1QZGA 2ALYB 2F0QA 5IGFA 2GK6A 1GVHA 2JA5B 2F0LA 2HIVA 5DM63 4H9GA 4NPSA 4OIJA 5M3MB 4C2MB 1X3EA 3W5VA 2LFNA 1YITB 3MXNB 1PZJD 3TQYA 1TKWB 4GOPA 3ZBUA 2QDLA 4L8JA 2Q2HA 4UZUA 1B4OA 4NKLA 1DONA 1QVFB 3S17B 3J7AF 1NJID 3SLDA 3MEHA 3I70A 1BQEA 2UUCL 1H8HA 4PC3A 1LTLA 3HRZC 3N52A 2OBTA 1YJNA 4NNJA 4DAMA 2G9HD 1CTMA 4ZYSA 3EN2A 3KDFA 3TP6A 5M5XB 2IWHA 5ELNA 2EZVA 3AU7A 2GREA 1NE3A 2JQOA 4YY3L 4ODGA 1EIGA 4FNFA 3W2DA 1HZ9A 1A3TA 1JNYA 3OMGA 5KNDA 1W0KA 4PV1C 1VQLA 4AYBB 3G4SA 3CPWA 2JA6H 3E5SA 3A7LA 2RQXA 1EOVA 3W2EA 1YHAA 3FKIG 1QGZA 3S1MB 5BN5A 5FIUA 1TVCA 2ZXRA 2YWHA 4RKLA 1MABA 1BXTA 3S1QB 4DK0A 2EYOA 1QZHA 3ERQA 3T1HQ 1FX0A 2VJIA 1T5XD 2L55A 2SEBD 4BY7B 1XNRL 3E1YE 4KV6A 4LFAL 3I55B 1K8GA 5IT9L 1HRJA 3CCEB 3R93A 2KCCA 5IGEA 4DN4M 2F4NA 1X54A 2EVBA 4BA2I 3F8TA 4DV0Q 3PQIA 1PHJA 2F0EA 4DV5L 3UDIA 1KDCA 1G2SA 2ZZFA 4JV5L 2GA4B 4JYAQ 5KYIA 3VO1A 3U9SA 5C0XJ 2H5XA 1DZ1A 5E6TA 3PUNA 5IGDA 4V190 1VQKB 4X65L 3DDYA 1FJGQ 3ASRA 4TT3A 1KQSB 4NXML 4DV1L 3QFTA 1F60A 1QFZA 2QN6A 1BCPF 3DEPA 2WZNA 2YWGA 3CU7A 3IKJA 1YI2A 4OX9Q 1DARA 1EU3A 3OOCA 1W35A 1B44D 1SNMA 3PUXA 3FJOA 1XNQL 4LF8Q 1PV4A 2ZZGA 2WAQE 3S14B 1RTNA 2RKSA 2PZUA 5FLXL 1E1QA 1VDZA 4OXPA 1KAWA 4C3HH 5GV8A 1L0XB 2JJ1A 2OK8A 3GV3A 1KNEA 4M8AA 2PNHA 3JC66 1CKNA 4DXFA 4HJ8A 4XLEA 1TTTA 1VQHA 1Q86C 5DN6A 3CCLA 2E2JB 3C1EA 1T5EA 2UU9Q 2MO1A 3TS2A 3GTKH 2KA7A 1QVGA 2F0FA 5J39A 4QUZA 2K5NA 3MVVA 1K0SA 1TS3A 3C1FA 3GTJB 1HR0W 4LF6Q 5ISRA 1FRQA 3I4NH 2ZZQA 4X7DA 3HOWG 2ICEC 2RCNA 4X06A 3NBHB 4JBWA 3FVQA 4AQYL 1A8VA 1XPRA 3WQZA 2VJJA 3MXPA 1PMRA 5M5WB 5JOBA 3V96A 5IYPA 4Z4TA 2F0SA 4IALA 4ALPA 1K3BC 3HGBA 1MHWC 1TU2B 2B2TA 2WAQG 5EMNA 3O13A 4P12A 4P74A 4DUYL 1J8IA 1GUWA 1I6VC 2PMZB 4JG2A 2R93G 4DXGA 1Y1VH 4J1MA 4IQZA 3G6EA 1VQ4B 4N9PA 3VR3A 1E3PA 2A73B 3GQBA 1MGSA 2FXQA 3NQIA 4XONA 2L9HA 2HUGA 2NVYB 5A2QE 1JJ2A 1BDOA 2K28A 1SNCA 2PCFB 1AW7A 2CWPA 5C3WA 3FPPA 1FNMA 1KMHA 4KY7A 1Q8IA 2ZTNA 1SE8A 2E2IB 2QE7A 3FKIB 3KJOA 5FNZA 1Q1EA 3GTGB 1XXGA 1WTWA 2CWAA 4MIUA 2BSAA 3W5OA 1TUIA 2KQ3A 1TY0A 3CCJA 5LMNW 4BXXG 1UD6A 4B3ML 3GTMB 1WI5A 1CFMA 1T6ZA 3ASTA 3P20A 4ZUJA 1DOLA 1EQRA 1QB5D 1ESRA 1PRTC 4DAVA 1DM0B 1K83B 3M4YA 4YY3Q 1Y8NB 4A76A 4R4QA 4XKWA 3ICEA 2L5TA 4IOAA 1S40A 4BBRH 1EFRA 1PA6A 4RD3A 1YJNB 2FFKB 4RG1A 4BWGB 3KDFB 1QUEA 1UD5A 1Q82C 3A35A 4XN0A 1VQIA 1PVOA 3CKIB 4LF4L 1EUJA 4K2KA 2KJXA 1KZLA 3TN2A 1WCMH 4JOIA 3PIP3 3FPUB 2BV3A 5CV8A 3EA6A 1ENAA 3NTKA 1VQLB 3KL9A 2XNAC 1TWCB 3G4SB 3CPWB 2HDLA 4HCSA 3A54A 4A3BH 1FVIA 3SGIA 4OOSA 1SYFA 2NTTA 2QA4A 3HKZE 3KF8A 3HOZH 3EBEA 4DF7A 1OTCA 1VCIA 1PJ6A 2Z9HA 3HP3A 1A3VA 3K7AB 4AF7A 3OE7A 4IUPA 4B3RL 3HG9A 4JV5Q 4PC2A 1A2UA 2R7DA 1EEID 4ACAA 4UZEA 4UAIA 5E4XA 3V76A 1D7QA 2GQFA 4L5TA 4TMTA 1I50H 5HZAA 3VNUA 1PTOC 2CKZB 5EBCA 2UXBL 5J3OA 3KK7A 2VNUD 2NZ1D 2X6XA 2X53S 2Q2IA 4R1JA 4YHHL 2A19A 5IYDG 4K5VA 4DV1Q 5IWAL 1VF5C 3GTPH 1KC8D 1R4PB 3OEEA 1GKHA 4DV7L 3MA2B 1EXMA 1KK0A 1QUFA 3M3YB 3RUZA 1SR3A 4LUOA 3JQQA 3JAMc 5E7NA 2JSOA 2NVYH 3U50C 3D31A 2EE1A 4Y52H 3QFSA 1D2EA 1NNXA 2WAQB 3KUPA 5JPMC 1X32A 2ZJQA 3HKZG 4BY1G 4GZYC 5A8AA 4RA8A 3ASQA 3W2HA 1YI2B 4Y9RA 4DR4Q 4Y7NH 4WORA 1VQNB 2D3NA 4TVAB 1MSHA 4RGNA 2EFGA 1G51A 3DHQA 2ICIA 1LTBD 1EFCA 4RDLA 3CXCA 5BSYA 3CPXA 4ZGNB 3E9IA 3PIPA 1F2LA 2CHBD 2K4KA 3C3LA 2GJRA 4WZTA 3BG3A 1X55A 1SNPA 1I4HA 3DXJC 4JK1C 1YEZA 1XMOL 1NSNS 4LF7L 2OF1A 1CM9A 1SFOB 4A4IA 3RLOA 3CCLB 1AZPA 1G7TA 3NTIA 2N49A 5FKAC 3CCVA 3GSIA 1SN8A 3S2DB 4DV4Q 5TRDA 1QWYA 1TIID 2BE5D 2PZTA 3SK8A 1TWHB 3HOYG 4JI8L 2PQEA 3CC2A 3GTOB 3FDTA 3WWVA 2NN6G 4JBMA 5FO7B 1BOSA 4JVZA 1HZAA 2B29A 3J81L 1B2RA 3STBC 5F4MA 3Q24A 4TSSA 4K0KL 4O2DA 1SNDA 4JI4Q 4IFDG 3K5MA 4OO1I 2JK8A 2R61A 1RJTA 1KDAA 2MNAA 2O5IC 4B48A 3GIRA 3G6EB 1R5NA 1W9XA 4X07A 1EQQA 1KD1C 1ZM3A 1WTXA 1BBXC 2ZXHA 1IYJB 3IFTA 2F0KA 4HIOA 1LT4D 1CQFA 1BCPC 4TMZA 2IX0A 4PQXA 3RZOB 3W2IA 3OMCA 4DU9A 3OP1A 3OIPA 3A56A 3GTQH 1WSVA 1JJ2B 1ENFA 5IYCG 4B3MQ 1PH4A 4FXDA 4FN5A 2HCIA 4XNFA 3A8IE 4RCNA 3TMEA 2F0UA 4CJ0B 2F0WA 1FNBA 1HQMC 4IPGA 2RHSB 2BF4A 1NBWA 3H0GB 3Q6SA 1JA0A 1FNVA 1PH3A 1GUNA 3AVVA 4OONA 4RD0A 1I4QA 5EPKA 4C43A 1N8RD 3T51B 3HOWH 2Q8IB 1GM5A 2DGYA 2B7CA 1ZEQX 1PFSA 1VQDA 1NB9A 1B9MA 2DUDA 5AN9A 2CQOA 1SBBB 3CTAA 1EZ6A 2JEAI 3C46A 3TP8A 1ZYRD 4LF4Q 4AF6A 2PI2A 3KF6A 1N33Q 5KW9A 2R93H 3VYUA 2YV5A 3IL8A 3SEJA 2B63B 1STHA 3AB9A 5I2YA 1HZCA 4R4TA 4A93G 4DNTB 2CH4A 4KK7A 4H13C 1PH6A 1SKQA 4YALA 2RDFA 4RHSA 2HD3A 2PI2E 1BX0A 1ILQA 4LUVA 5KEEA 1WOPA 4CDDC 1HA6A 2VY3A 5J22A 5FLMH 1II3A 3AFQA 1GJXA 1CKMA 3ONYA 5C3EH 4O42A 2EPBA 4WZEA 1UD2A 1W2BA 1STNA 3T4AC 2RHQB 1V1OA 5IP9G 2CW0C 4JBJA 3HKZB 4BY1B 2K7VA 1HVXA 1VQEA 5KGUA 2BCOA 4S3SA 1VQ7A 4JC0A 2UXBQ 1B3AA 4RJLA 3S2DH 3NK9A 4DR7L 1OGIA 3Q0AA 4EH1A 2QA4B 4JI1L 2UXDL 1PJ7A 2H4OA 3NHHA 1O7YA 3KF8B 4E6IA 4X66Q 4DR3L 1R9TB 4XTCS 5EKLA 4DV7Q 1UE7A 2XEXA 3WY9A 4PMCA 1I94L 1W6KA 4G1VA 4NXNQ 3EROA 4R9WA 2R7FA 4TQUS 2MPMA 1S5DD 1BBUA 4B9XA 1N36Q 4HJAA 3ZJYC 5JPNC 4OGQC 2TSSA 3U6BA 4UY8C 4GKJQ 3K5NA 3BDCA 2GPJA 4A3KB 1EL0A 1K73D 1SYDA 2KHSA 3HOYB 3Q22A 2C5BA 2DN8A 3JAMi 4MN3A 1HA5A 3NELA 1Q46A 4IUUA 3J80E 3M4OB 4NB3A 1SRUA 3B78A 3RZDH 5KSWB 1UUPA 3X3NA 5AFWA 5BR8L 5EKKA 1SMXA 1QGAA 2I1LA 2F43A 2A68C 4LF7Q 1AFPA 1BX1A 1DCZA 3QB3A 3SVMA 3CP8A 4YIJA 3LQ6A 3I2ZA 2KUMA 1F77A 1CUKA 3CXCB 2FINB 4WFN3 3G05A 4JI8Q 1ET9A 2F0PA 1K8AC 1HFGA 3T16A 3PUMA 2EYPA 1CKOA 3CCQB 2FX3A 3CRLC 1LABA 1T6YA 2G9DA 2A74C 4CJ2C 2A6HD 2BGIA 1XJVA 3KEWA 1EFWA 1GVPA 4A3LG 4K0KQ 3CCVB 3QFCA 2Q6KA 2CFMA 2NVXH 2Q2UA 1LTRD 2HCCA 5M5YB 2K14A 2DY8A 3DWPA 3J7YW 4ZK9B 1EWCA 1E22A 3I55A 4O1NA 2IT1A 3WXMA 4P25A 4LUZA 5LMUQ 4X3TA 2D9RA 3VR4A 2E2HH 2EIXA 4P72A 1HTPA 4A3JH 1Z9FA 1QFJA 1CNEA 1LACA 3AVXA 3HOUH 5HKKA 4JI7L 4WJWA 5G3LF 5IP7G 2BPOA 3K58A 1N34L 4A93B 1QE6A 2LXJA 4P71A 3I1FA 1LM0A 1SJHD 3AYHB 1UD4A 4OP7A 1WU8A 4WWVA 3U4VA 4PGOA 4P2NA 2D0OA 3BH4A 1CA6A 4A3EH 1BQQT 4L63B 4HJ9A 5H5JA 1Q90A 2Q8TA 4MYTA 2CVRA 4QFMA 1ZKOA 1Q9SA 1D6EC 2Z6KC 2ZXIA 2DY1A 1GOZA 5C4XH 4H0LC 1CHPD 3TRZA 3NQTA 5A35A 1K8MA 1A8PA 2BN4A 3SK6A 1VMPA 4DPGA 3NSWA 3PUYA 5AJ3Q 4OO1G 3J7ZC 3KJPA 5FA6A 2M5SA 2OBRA 4RCZA 3OIQA 1PFNA 1CZGA 4EQOA 4U68A 1EFTA 3HOYH 3P26A 2RDGA 2F4IA 2KHJA 2L12A 1SAPA 2M2LA 2NN6H 4NMZA 1OXVA 2HHHL 1VHOA 1DDGA 2F0OA 2F03A 1B7YB 1VQBA 5F2DA 5GV7A 2ZJRA 4RAUC 1W6JA 4LF8L 2KVOA 1JCKB 2A1AA 1E2ZA 1F9PA 5D14A 4HE5A 1E43A 3WBKA 3PO3G 4B3GA 2YU9H 1PRTF 2WYRA 4IFDH 2DIEA 5HY6A 1YJ9B 3BVGA 1YNNC 1EYCA 4CGYB 4POGA 1NMFA 1GUOA 4JBKA 4BS9A 1IXRA 4ZRZA 4GLXA 2UU9L 2K52A 4TMXA 1H9MA 3ISXA 1IJEA 3WNDA 1TLLA 2YYZA 1QJOA 3NEMA 3PV0A 3I4MG 1NTGA 4DR3Q 1W2BB 3U4ZA 1CNFA 4KKSA 3D8GA 3D4DA 1I94Q 1A3UA 1GUTA 1MRZA 2EJGC 2MQHA 4RPDA 2NTSA 3UDGA 2X6YA 1STGA 4HSVA 3KFUA 3MHBA 1PZID 3TBIB 2IW3A 4M4SA 4Q5VA 3D4RA 3CMEA 4RH6A 4RD2A 3D4WA 2HIXA 1SYGA 2X85A 1Y8PB 1OB5A 1JMCA 1KJZA 4K8JA 3VA5A 1UMKA 2YWFA 1RHPA 2E76C 1LT5D 3P75A 3TZDA 1S72A 2AWNA 4II2A 1EWHA 2GVAA 2K32A 4ZCIA 4FF3A 2K75A 5DM73 3FKSA 5BR8Q 1HCZA 4CDCC 3HOXH 2WSSA 2YWEA 3AMUA 4DR6Q 1WOSA 4IURA 5JEAJ 2ZL7A 3CHBD 5K36G 4J0QA 1H8EA 2FHTA 2K5QA 4XLHA 1A62A 1HXYD 3SKBA 4P2CB 3PENA 4G4KA 1UD3A 3QOJA 2CNDA 1JC7A 1GD7A 2MGSA 4TN1A 3TSSA 1Q7YC 1JB9A 5IE8A 2JA8H 1HA3A 4G7XA 2LXKA 4XYQA 2B2UC 5CBAE 1WPCA 3DM1A 2GN5A 2F0VA 2VBSA 4RGTA 4WRDA 4PC7A 3PA2A 1O7LA 4YAWA 1A2TA 3OZVA 2LMCB 3CPFA 1E1OA 1N0UA 4WZKA 2V1CC 5IYBH 1N06A 1BF4A 3SK4A 1YIJA 3I8ZA 4NW2A 2R92G 4Z4UA 2ES2A 1MSGA 3EIVA 4MTNA 4N8X1 1EP1B 4GNXC 3SJZA 2JN4A 4G6IA 4B9WA 4QY7A 5IT9c 2UUAQ 1SNOA 1Y8OB 1BLIA 1AE3A 5C0XH 1D2BA 4JI7Q 1WTPA 3DMUA 1XX8A 1N34Q 3W1BA 2V4DA 1RQPA 1L0YB 2DNCA 3K8AA 5T1IA 4DV3L 2K5VA 2B2VC 1EQVA 1E79A 1OXSC 1R5BA 3ZZUA 1X3GA 1G7SA 3PO3B 3IAYA 1KHIA 1SDFA 2KCNA 4UHVA 2ZJPA 2NVQB 5I9OA 5BN3A 4M1UB 3S16H 3ZUGA 1I4PA 3CC4B 1T9HA 3NE5B 4LF5Q 4GN4B 4AC9A 4RPBA 4PZ8A 1KXLA 1J9ZA 5HGQA 1ET6A 5JJKA 2EY2A 4ME3A 4OPVA 4K8IA 4RCYA 2PW5A 3I4MB 5FLXc 3B82A 4KI0A 2HQEA 2RVLA 1RDPD 4B3TL 2RF4A 3L2PA 1LO5D 2HHHQ 3DUZA 1HPCA 1VQNA 2DYIA 4G57A 3A5UA 1MI2A 2ZBVA 2K5DA 2A6ED 3S1NB 2PNRC 1V0FA 4EQ5A 4E0FA 3J81j 2KHIA 2WP8J 1H95A 5C4ZA 2JA5H 2MJ8A 1IYVA 2EY6A 1JORA 5M3MH 4C2MH 4LBVA 2P5ZX 5GROA 3I90A 1RL2A 1JA1A 4XOPA 5CYUA 3KBXA 3V7AA 3H3VH 4CHTB 1L2FA 3PO2G 4DR4L 3W5HA 4KKTA 1EWIA 1NR4A 1B53A 1G8ZD 4GNXB 1I6HB 5ELBA 3CAMA 3S17H 2NB0A 1D1IA 3BZKA 2F1MA 1KLUD 2E2DC 3DLLA 2W6JA 2OYNA 5IP7H 2D5DA 3CP2A 2QTLA 4ME5A 1H9SA 1D8TA 1TR5A 5M5XH 1JWUD 4YEJA 1BR9A 4RM0A 4B44A 1V9PA 4KJNA 4ACBA 3BC9A 1RCVD 2L0CA 3JAME 4DV4L 1O78A 2C35B 2VZLA 4Q7JB 2EQSA 2DJGC 3VR5A 3S1MH 1STBA 1QGYA 3AFPA 2VZAA 5C4JB 5I9PA 4PC6A 3EVQA 4QUCA 5HXBA 4K5XA 4X3SA 2OBSA 3LWEA 3NTHA 5EPLA 1ENCA 1BMFA 3ZZTA 3UI2A 3JQRA 3CMEB 4JI4L 4BY7H 4A3CH 4UP9A 1SNQA 2EYMA 1S5BD 4UDUC 2Q6IA 5JJZA 4GKKQ 2R92B 3ERSX 3L3OC 4JI6Q 2RC6A 3G7LA 4RMFA 1K9MC 1S72B 2B39A 4KD3A 2MP1A 2WB1E 1IW7C 4U9UA 4B43A 4P75A 5J3BA 1EQTA 1QNUA 1C7YA 1E0BA 3SK5A 1IKLA 2SNSA 4QVAA 1S5CD 3F2BA 1EIYB 4NCNA 2D74A 4XOTA 1AEXA 3AQQA 3PUZA 2IX3A 1ONLA 3ZYYX 1VS0A 1Q82D 3LWUA 5D3IB 4DUZL 3RN2A 1IKMA 1WSRA 3CMAB 3T53B 1KL9A 1SEBD 1T6XA 1E62A 3A3GA 2WJYA 2E5LQ 1GHKA 1H9JA 3S14H 1X9NA 4RDKA 1KDBA 3OHXC 4FWTA 1BBWA 1BVSA 2EOTA 4GN5A 4HMJA 1PYWD 2OEOA 3PSIA 2N78A 1FNDA 1IBLQ 2N88A 4J8QA 1IL8A 4G7ZC 1FGUA 1N33L 1JJCB 1KK1A 1SLJA 2AHOB 3H6MA 2WB1G 4FDBA 4OOXA 3OEHA 1VQCA 1AH9A 1YIJB 2E2JH 4OPSA 2JA7G 3RD4A 4H02A 2XN9C 4P26A 4DV3Q 3E6ZX 5CORA 2CC2A 1SYBA 3H0GG 4TMWA 1SE3A 3L9AX 1TWFB 5FO8B 4P22A 4XT3B 4EQPA 2R6HA 4LK1C 1P8LA 5IOCA 3GTJH 1PH2A 1A6XA 3Q8DA 4JMQA 3I56A 1EIFA 2EXZA 3CCUA 4C3IG 1B70B 3MFYA 3PA1A 5M5WH 2PPBC 4UZFA 3ZPNA 1TXYA 2O2LD 1I18A 3PO2B 4K5WA 1YZ6A 3HOVG 1WP6A 4B08A 3CQZB 3I72A 4XORA 5C0XI 2B63G 1J6QA 2W6IA 3KLSA 4IUTA 4X66L 4KD4A 3OW2B 4B3TQ 2CF4A 3U6KA 4LFCQ 5CV9A 4NXNL 1EP3B 1PYBA 4HJ5A 1XPUA 3G71A 1U4MA 2F0JA 1N36L 1GAWA 3P27A 3CRZA 2YTVA 4HAEA 4CKBA 4FF4A 2HT1A 3HAGA 1PRTB 1JT8A 1P16A 4R8NA 1KIXA 4IUVA 1F9QA 5IIFA 1OHHA 1VQ5A 1QOHA 3OJWA 4GKJL 4X7EA 2QF7A 4DV2Q 2GK7A 5CGKA 4YELA 2E2IH 1WTRA 3NP8A 3FKIH 3U2QA 1JOKA 4ZGQB 3GTGH 1RKNA 1U5KA 3OSOA 1FL0A 4RKBA 5DNFA 2VS1A 3BVZA 4II3A 4HCEA 5ELOA 1JE5A 1HUNA 1EY9A 3W1GA 4DV6Q 2EY1A 1EFUA 1HFNA 3CCQA 3KLSX 4P73A 3GTMH 1ZUNB 1FYCA 4IW3B 1B3QA 4XD7A 4YAUA 2GVBA 1K83H 2CRVA 3SJPA 3MHPA 1L1OC 3OTOQ 3A3BA 3CMMA 3GTLB 4XQFA 4U673 3STBD 4A3MG 3J81c 2FMMA 2RSOA 4A3KG 1XB2A 1K28A 5H1SE 1PFBA 1XWEA 3BZCA 3OAAA 3E9HA 5A2QL 4B3XA 1BPLA 1H9SB 2NBFA 1I5FA 2C5CA 2OWOA 4IUNA 1E3ZA 2A69D 2E75C 5GADC 3NPPA 1KD1D 3H94A 1PTOB 2PW7A 1Z7TA 3GVJA 2K33A 3JU4A 2WINB 3NENA 3CCRA 1TWCH 1MIUA 4X05A 4PZ6A 3OZWA 4TKOB 5LMUL 4HE6A 3A8IA 2A8VA 3K7AH 3D6WA 4PG3A 1HUMA 2BE5C 4ZLTF 4RD4A 3WDNA 1DD2A 2WB1B 4M0LA 1U4RA 1WORA 2M00A 1GHJA 2NUCA 1HJPA 2OT2A 2ZTEA 3PO2H 3A1PA 2JA7B 1BJKA 2VYQA 1F9RA 2AMCB 4K6LA 2VNHA 1DOKA 3CQZH 1TWGB 2B8FA 1RTOA 4A3FG 2PO4A 2LZJA 1GO2A 1PDQA 4DUZQ 4RFBA 4HJ7A 3S2HB 3HKSA 5JEAG 4WJ3M 2EIFA 3M3YH 5LHY1 2BA0A 1V0EA 4X7CA 3SR1A 4UP7A 4UAJA 2F52A 3BYTB 4C3IB 2O5JC 3SLNA 1IB0A 4F88A 5D3DA 2BDOA 5AJ3L 2JN9A 3HOVB 4Z4YA 1F2YA 2F0TA 3F2CA 2PE3A 2WKDA 1Y0YA 1YJ9A 5FL7A 2X69A 5E1FA 2I0QA 3LGJA 3WYAA 1E1TA 4FO2A 1IBMQ 1E3XA 4QIWE 1FR3A 1WTHA 2ZTDA 1GUGA 3MEFA 2CW0D 2EXDA 1S4MA 2IHFA 2ZXPA 3G48A 3L0OA 2ID0A 3B8HA 2VUMG 3CB4A 1RQRA 1B8AA 4B3FX 4H7BA 3K5LA 2B5OA 3CP0A 1VLOA 4LWCA 4YWKA 2A5HA 5KIXA 4EQNA 4X62L 1KRHA 1ZM2A 3MAQA 3S1QH 4F7XA 2K1BA 3S15B 2K5WA 1SFOH 1K28D 1SM4A 2F4VL 4LBYA 1PYSB 3BU2A 4KLKA 2R6GA 2OTJA 1VQAA 1KTVA 4DAYA 1B9NA 1TWHH 1G7CA 1YNJC 5CV5A 1BCPB 3GTOH 4OWTB 2I5LX 4XR6A 4BXXH 2HQLA 2WJVA 2Z6KA 4J6HA 1ZXTA 1MBYA 3I56B 3I3CA 2UUBL 2B8GA 3BYYB 4FP5D 4A3GB 2C4TA 3I7FA 4KHPQ 3UDFA 4CKEA 3CCUB 5C44G 3U58A 1SXTA 1N05A 4RWSC 2VNKA 1DXMA 1GXDC 1Z47A 2X6LA 1GJRA 1A63A 1FDRA 5I6WA 4DQKA 1K0RA 4LF9Q 2OK7A 3LNNA 1CQVA 3M7GA 4LBZA 2XWJB 3LQEA 1HNWL 2SOBA 1DJRD 4A3MB 4LJZC 1XFOA 2SNMA 1X3FA 5FK9C 5DEHA 4I7ZC 4P9SA 1AMOA 4HIKA 3QG1A 2A68D 3G71B 3RZOH 3PUWA 4CDEC 4YXWA 4DGZA 1V1PB 1ASYA 4IJHA 2JA6G 4K1XA 1XTCD 5JVG3 4HIZA 1EY0A 4RDJA 1VQ5B 5JBQA 1Y14B 4HR7B 4R4CA 4DR5L 4DK1A 2B2WC 4DR6L 5LL6S 1P4MA 3S1RB 1VQOA 3FEWX 3H0GH 1A15A 2BM1A 4OELB 2E74C 5KRUA 3GDEA 2QGGA 4ZUIA 3CRKC 4FXGC 5C4HA 4IOCA 1G6ZA 2VXWA 2AQ2B 3WNBA 1K73C 1LTGD 1HZBA 3JQPA 1B50A 1EY8A 4DQLA 3HOVH 1WTHD 2B2YC 2N3SA 1SJED 1V5VA 1XE1A 1M90C 4BBSB 5IYDH 2R9VA 2F3WA 4ZCKA 2B63H 2XZLA 3SHLA 3CC7A 4A3FB 1EOTA 4A3IB 1SE4A 4ZKCB 2RC5A 3PCOB 3J81i 3MC0B 1VQ8A 4M1KA 1E7ZA 2BOSA 1L0WA 2BMWA 1SSOA 2JA9A 4DK3C 3VO2A 5KNBA 2VB2X 4DR2Q 4XLAA 2AUKA 2UUAL 2NVTB 1HQRD 1CZWA 1XYIA 3GO5A 3NWSA 2X0KA 2X6WA 1V8QA 3EQLC 4YWLA 4BY1H 4OPOA 3CC4A 4FYDA 3A8KE 3CCRB 1DYQA 2K04A 1H42A 2I5MX 1SYEA 4KY5A 2VQEQ 2IX1A 2XZPA 2D0PA 1SMYC 2KENA 4XQQA 2WPDA 4G7OC 3AVTA 2WR8A 1MJEA 3OW7A 3Q6RA 2ZM6L 1M1KC 2LSSA 2VUMB 4B47A 2R7ZB 1QILA 3W3AA 1R9TH 1IBKQ 5DAUA 2JEBI 2PYKA 1J5EQ 3QO2A 4XLFA 3F2UA 1QG7A 4LF5L 2OQ0A 5BN4A 1TWAB 4QGUA 2B2UA 2M9VA 4P6VF 1PJ5A 5CBEE 3I4NG 2DEUA 1CI3M 4F87A 1I8DA 1H9RA 4KTAA 4UPAA 4XYOA 3C2QA 1CSQA 2EYJA 4A3KH 4Q0FA 2I07B 5IT9E 2PLFA 5H59A 1RIPA 5IYNA 4C3JG 1Y1VG 5C44B 3M4OH 1TT2A 2OCEA 4GNXA 1PZKD 1ESFA 1KRSA 2Q8RE 5JVH3 4QIWB 1G7RA 3QFRA 3AVWA 3H15A 2E8GA 4MHEA 1PXUA 4X62Q 3CW2C 1BO0A 4K6DA 4P3YA 5DS0A 3H91A 2PQAA 4JI2Q 2DETA 5ELEA 3PMFA 3S1RH 4R4IA 2F4VQ 4QMGA 1QUQA 1LTID 2PIAA 1HR0L 2B2VA 1PFMA 1KABA 4Z4SA 3OJXA 2IJ0A 3N6RA 2CCZA 1JOQA 2QKIC 3S9WA 2JA6B 4Z4ZA 3QJYA 1E64A 3OYYA 5IYCH 5CV6A 3H09A 2UUBQ 3Q6QA 4Z4WA 2QMUA 1RD9D 4L5QA 5FLXE 1VQPB 1C0AA 1X56A 4R8IA 4R71A 1R4QB 2OTJB 4KHZA 2ASBA 5M5YH 2WKCA 3LO8A 1G291 4DAYB 1U2RA 1WOCA 3IFDA 1HNWQ 5JEAH 4RHRA 2MO0A 3NUCA 1IL2A 3GVLA 2VNJA 1MD2D 2QDXA 1KAAA 5DSZA 1X6OA 3J80L 3VYRA 5E4WC 3ONUA 2NPFA 1VQGA 2LS01 1TVXA 3OFNA 3ASPA 4WZLA 2EYLA 3EFXD 4BBRG 1YLOA 3M4PA 2JP1A 1Q81C 2XZOA 2KOLA 5EJWA 2ZL6A 4DR5Q 4A93H 1IZ6A 4APVA 3L7ZC 3ND8A 4HN7A 2DY7A 5THXA 3C2PA 1VF7A 4GKKL 1CQXA 4N3GA 2JDIA 1WCMG 4XDXA 4XKVA 1OO9B 4QV2A 2J4XA 2JJQA 1WTQA 1CA5A 4JI6L 4CKCA 1Q7YD 2DOGA 3M9BA 2XOKA 3BS1A 1VQ6B 4DR1L 3R6JA 3CMAA 4A3BG 2OQKA 2KCMA 3I4OA 1LT3D 4FXKC 5IP9H 3M4QA 1HNZQ 5A88A 1ICWA 4DNIA 5TR9A 4C3HB 3HOZG 3OZUA 4MNOA 1NUCA 4ZAIA 5IK2A 1N9WA 3T1YL 1VQOB 2N55A 1RF2D 2K6AA 2RBMA 2AHOA 3ONAB 4H44C 2FVGA 1EY6A 3WOFA 2VW9A 4DK6C 1YHQA 3I73A 1G6PA 4DKAC 4C1NK 3X3MA 2E5LL 4JI0L 3K59A 5C44H 3GTKB 4XQNA 2ENBA 2RSNA 3WOEA 4X64Q 3Q3AA 1FRNA 2D62A 3ES9A 3I4NB 4ROXA 5IODA 2BH8A 5GAGC 4G7HC 4B3SQ 3ZBTA 1IBLL 4IO9A 3CC7B 1TS5A 1NJIC 2CBXA 1E63A 2F1LA 3D26A 4G5GA 1VQ8B 1Z6HA 2Z6BA 3TS0A 1HNXQ 4M2LA 4C3JB 5EGTA 1Y1VB 3ASSA 1LT6D 2ZM6Q 1YJWA 1EY4A 3VNVA 5E3FA 1OXTA 2NZOA 3MFGA 4JI5L 3OW2A 3AGPA 2RDHA 3KLRA 2F0MA 4Z4VA 4WQMA 4X7FA 4XLCA 1S3OA 1JB3A 1V43A 1UE5A 1HHVA 3SEBA 3A5ZB 4OWXB 3KOJA 5L37A 3GP7A 1EYDA 2Z1CA 4GS3A 2X8KA 1QFYA 3K6OA 2O4XA 4J15A 4C1NI 5CC4A 2GJKA 1GAQA 2Z4IA 3DM3A 2ZTCA 4QHYA 2QDBA 3QIAA 4LFCL 1WVLA 3PGZA 1GR1A 4OL7A 1N07A 4EVOA 1JOOA 1NMGA 2MFIA 3R2TA 3CCMA 5GQOA 1Q86D 1EP2B 2VB3X 4A3LH 1QCBD 1U4LA 1EYAA 3MCAA 4PAAA 2G5DA 4YHBA 1CK1A 4LBWA 1UE1A 2VL6A 3KBGA 4DV2L 2FJ2A 2L15A 4C56C 4PABA 2EJMA 2EJFC 2V7QA 4MYUA 1ZM9A 2ZT9C 1HR0Q 2C5HA 3FP9A 4O0AA 5FO9B 4BBRB 4LMQD 5BSXA 1E2WA 3IRBA 1NB0A 4LFBQ 2XTIA 4YCVA 4P6YA 3DWAA 2NN6I 4DV6L 2V7XA 1AE2A 1Q1BA 4PMBA 2PQAB 5C3XA 1N32Q 5G3LD 2HCJB 2JYOA 3F1ZA 3CD6B 2CH4W 1D1NA 1QUQB 1WCMB 2A6EC 4YAFA 2JJ2A 3J81k 5IYWA 1WJJA 3BCFA 4N9TA 4IFDI 3OTOL 1Q8KA 4EX5A 4GOPC 4HTHA 3M7NA 1UEBA 4A3BB 2PMDA 3V05A 4B4DA 2FMCA 2H1EA 3TP5A 2JIZA 1KNAA 4YCWA 3EJIA 3HOZB 3AVUA 1B2TA 5JAVA 4KKUA 1VHEA 3E0JA 4OO1H 2AWOA 4HMIA 2Z6BD 5F4OA 5CV4A 1LTSD 2L4NA 3D3RA 3J80i 1K9MD 5IY0A 1JE4A 3K7UC 3B6YA 1IW7D 3MWYW 4F7DA 1I50B 4ASUA 4JPBW 1Y69U 1AZQA 2X3UA 2R3ZA 4C3JH 1Q12A 1TY2A 3GTPB 5LMNQ 4POFA 1K8OA 3PO3H 1YBYA 1FNCA 4PC1A 4DR1Q 2BDNA 2NVQH 3PVDA 1YNXA 1PRTD 5ELCA 4HEDA 3HEJA 1EZ8A 1NAPA 1VQFA 3M85A 1ICFB 4RD1A 5FLMG 2XRSD 1W0JA 2HMAA 5C3EG 3CESA 1PH7A 1NDHA 4PNYA 3J81E 1UNSA 2DERA 3T1YQ 2V7VA 2VQFL 1CSPA 4P1VA 4DAPA 5J35A 3I4MH 1A0IA 1L1OA 2C2WA 4GN3B 3A74A 4Y7NB 2ZZEA 2D2CC 2KCTA 2AQ3B 4JI0Q 5IYRA 3VA7A 1VMCA 1NY4A 3S1NH 4NDXA 2UUCQ 2NZHA 3R2IA 1E24A 2NWGA 4OHJA 1JJGA 5ELDA 5ELFA 4X0CA 5T1GA 3FHWA 1OXUA 1WOOA 2L1BA 1B1ZA 2JE6I 4FK8A 5HZBA 2EDGA 2F0IA 4JCVE 1U4PA 4Y7CA 4GOPB 1YHQB 4WJ4A 2KECA 1IBML
chains in the Genus database with same CATH topology
2AQ1B 1ILPA 1FNUA 1JICA 3I4LA 4XMYA 1PTOD 1OB0A 1LTTD 3BZDB 1C4QA 1NCVA 2WIIB 4RCOA 4LAAA 5M9OA 2E1BA 4I65A 5K36H 4KMUC 1DOMA 5CR3A 3LX0A 1LLRD 2MUYA 3FRPB 4XIGS 4NP5A 3URYA 4IUQA 3GD7A 3OPOA 1D1KA 2F0HA 2CK3A 2IPKD 2XWBB 3GTQB 2KEEA 1V1PA 5IGGA 1D5ZC 1C48A 1X3PA 2RA4A 2XVSA 2HDMA 3K5OA 2B2TC 2C9OA 3MZ5A 2JXMB 1F2MA 3OWEB 3P1HA 2DNEA 4CJ1B 1WTVA 4GQNA 3HOWB 5I2XA 1JWMD 2WV6D 1LV9A 2ZTGA 2J0TD 4DFAA 1AN8A 3ZIAA 5CMDA 3JAML 2R93B 3A8JE 1EY5A 1G2TA 3GVKA 3TZUA 3BDOA 5C3EB 1S4ZA 3U9OA 3ITPA 5KNCA 3TDQA 5HGTA 1HTLD 4XL9A 3GV6A 1BCPD 2LY7A 1EU4A 1SKYB 5I6YA 1NR2A 4KN7C 4DA2A 1WD0A 1IYUA 2B2WA 1S5FD 2QEJC 5EQ0A 1M4VA 2A69C 4HSPA 3PIO3 1ML0D 2F0NA 2BA1A 5D65A 3A55A 3Q23A 3SE0A 2IL8A 5K5PA 3RZDB 4K2LA 1KTKA 1CHQD 2B2YA 2CQAA 4V0BA 4EGVA 2F0GA 4TSFA 1IHZA 3NXWA 1U9RA 4X3KA 5IGBA 2Z4HA 4L6TB 1STAA 1E2VA 3RLFA 3FMCA 4XM3A 3VYSA 1YNJD 5C5MA 4QCLA 2NVXB 2K01A 2KEDA 3A7AB 4ULLA 1LTAD 1ZYRC 1Y1WB 4QUFA 2OXPA 1JR0D 5EBDA 2EY5A 4DNRB 5C5LA 3P7JA 2E2HB 4A3JB 1QNKA 1VLYA 3HOUB 1PTOH 2XGJA 5EKIA 2EYFA 3D6CA 1TS4A 1F9SA 2L11A 4CBVA 5TSSA 1AP0A 4K14A 5IGCA 2EYHA 1EY7A 3G6JB 4A3EB 5C6AA 3K0YA 4TRDA 4Z1MA 1D5XC 5C4XB 3J7AV 4FF1A 2Y0SB 1I4GA 3MXUA 1HZEA 5C0XG 5CDFA 1CT1D 3MXNA 5NUCA 2WZPP 1Q3LA 2F0DA 4KN4C 4OIKA 1E1RA 1J9OA 4FVMA 3TP7A 5FOBB 2YU9B 4PMWA 1OXXK 2SDFA 1VJSA 1C8CA 4ABNA 4RGOS 1PKVA 1SE2A 4ILWA 3HZXA 5EPJA 4G7WA 2QILA 3NBIA 2Z8LA 4IN3A 1O80A 2QCPX 5KNLA 1SMYD 1I3QB 4XQJA 1H9KA 3BDLA 2X6GA 2KVMA 1STYA 4C3HG 4FF2A 3R3OA 3ND9A 5M3FB 3T13A 4AVZA 1EEFD 1TS2A 4KY6A 4XN3A 2F3VA 1PLFA 3QOLA 2A6HC 4BA1I 1WTOA 3BCDA 4A3DB 2K03A 1I4XA 3NWTA 3RMHA 3OWFA 2WACA 4F8MA 2LKVA 2HLDA 1RODA 2TMPA 4RGMA 2V31A 1BNZA 4KHVA 4QF4A 3HOXB 1F2ZA 2NYZD 4XXEA 2J7ZA 1BUVT 1FD7D 1UEAB 1YNND 2AUJD 5J1ZA 3SDZA 4X3UA 5KYLA 2I46A 2PZWA 1COWA 2K05A 2JA8B 1M8AA 2ZXOA 1FGBD 1NRKA 3I91A 2XNDA 3PUVA 5COYA 1D5MC 4ZQ3A 2XRQD 2D3LA 1UAPA 1EIHA 3VYTA 3MTSA 2GJPA 3H3VC 4Z9CB 3SXHA 4FXUA 1KLGD 5HURA 1UD8A 1JQYD 3DEOA 4QB4A 3DWQA 4IZ8A 3NBHA 1I4RA 3BVMA 1STEA 2XSCA 4ID6A 1EFID 3HS0C 4KJOA 1GUSA 3V2TA 4ZKBB 1TQOA 4IFDJ 1O7ZA 3VR6A 1SYCA 1WD1A 2MHVA 3S16B 2D9UA 5I4DA 1NBMA 3MXGA 5CV7A 2XIWA 1S5ED 3R8BA 1FNWA 4XT1B 1JWSD 3K57A 3T56B 1X3QA 3VR2A 1G91A 5LL6X 3QWNA 1PTOF 2F0QA 5IGFA 2GK6A 2JA5B 2F0LA 5DM63 4OIJA 5M3MB 4C2MB 2LFNA 1PZJD 1TKWB 4L8JA 4UZUA 1B4OA 4NKLA 1DONA 3S17B 3J7AF 3MEHA 3I70A 1H8HA 3HRZC 3N52A 4NNJA 2G9HD 1CTMA 4ZYSA 3TP6A 5M5XB 2IWHA 2EZVA 3AU7A 4ODGA 1EIGA 4FNFA 3W2DA 1A3TA 3OMGA 5KNDA 1W0KA 4PV1C 4AYBB 3A7LA 2RQXA 3S1MB 5BN5A 2ZXRA 4RKLA 1MABA 1BXTA 3S1QB 4DK0A 2EYOA 3ERQA 1FX0A 2VJIA 1T5XD 2L55A 2SEBD 4BY7B 4KV6A 5IT9L 1HRJA 3R93A 2KCCA 5IGEA 4DN4M 4BA2I 2EVBA 2F0EA 1KDCA 1G2SA 2ZZFA 2GA4B 5KYIA 3U9SA 5C0XJ 1DZ1A 5IGDA 4V190 3DDYA 4TT3A 1BCPF 3DEPA 3CU7A 3IKJA 1EU3A 3OOCA 1B44D 1SNMA 3PUXA 2ZZGA 3S14B 1RTNA 2RKSA 2PZUA 5FLXL 1E1QA 1VDZA 1L0XB 2JJ1A 3GV3A 1KNEA 4M8AA 4DXFA 4XLEA 5DN6A 2E2JB 3C1EA 1T5EA 2KA7A 2F0FA 5J39A 3MVVA 1TS3A 3C1FA 3GTJB 5ISRA 2ZZQA 2ICEC 4JBWA 3FVQA 3WQZA 2VJJA 3MXPA 1PMRA 5M5WB 5JOBA 3V96A 2F0SA 4IALA 3HGBA 1TU2B 2B2TA 1J8IA 3O13A 1GUWA 1I6VC 2PMZB 4DXGA 4J1MA 4IQZA 4N9PA 3VR3A 2A73B 3GQBA 1MGSA 3NQIA 4XONA 2L9HA 2HUGA 2NVYB 5A2QE 1BDOA 2K28A 1SNCA 2PCFB 1AW7A 5C3WA 3FPPA 1KMHA 4KY7A 1Q8IA 2ZTNA 2E2IB 2QE7A 3FKIB 1Q1EA 3GTGB 1XXGA 1WTWA 4MIUA 2KQ3A 1TY0A 1UD6A 3GTMB 4ZUJA 1CFMA 3P20A 1DOLA 1QB5D 1ESRA 1PRTC 4DAVA 1DM0B 1K83B 3M4YA 1Y8NB 4XKWA 2L5TA 1EFRA 2FFKB 4BWGB 1UD5A 3A35A 4XN0A 3CKIB 4K2KA 2KJXA 1KZLA 3TN2A 3PIP3 3FPUB 5CV8A 3EA6A 1ENAA 3NTKA 2XNAC 1TWCB 4HCSA 2HDLA 3A54A 1SYFA 2NTTA 3KF8A 4DF7A 1VCIA 3HP3A 3K7AB 1A3VA 4IUPA 3OE7A 3HG9A 1A2UA 1EEID 5E4XA 4UAIA 1PTOC 5EBCA 2VNUD 3KK7A 2NZ1D 2X6XA 2X53S 4K5VA 1VF5C 1R4PB 3OEEA 3MA2B 3M3YB 3RUZA 2JSOA 3D31A 2EE1A 2WAQB 3KUPA 5JPMC 1X32A 4GZYC 4RA8A 4WORA 2D3NA 1MSHA 4RGNA 3DHQA 2ICIA 1LTBD 1F2LA 2CHBD 3C3LA 2GJRA 3BG3A 1SNPA 1I4HA 3DXJC 4JK1C 1NSNS 2OF1A 1CM9A 1SFOB 1AZPA 3NTIA 5FKAC 3S2DB 2BE5D 1QWYA 1TIID 2PZTA 3SK8A 1TWHB 2PQEA 3GTOB 3FDTA 2NN6G 5FO7B 1BOSA 3J81L 3Q24A 4TSSA 1SNDA 4IFDG 3K5MA 4OO1I 2R61A 1RJTA 1KDAA 2O5IC 1W9XA 1WTXA 1BBXC 2ZXHA 3IFTA 2F0KA 1LT4D 1CQFA 1BCPC 2IX0A 4PQXA 3RZOB 3OMCA 4DU9A 3OIPA 3A56A 1ENFA 4FXDA 2HCIA 3A8IE 4XNFA 4RCNA 3TMEA 2F0UA 4CJ0B 2F0WA 1HQMC 3H0GB 3Q6SA 1FNVA 1GUNA 1I4QA 5EPKA 3T51B 2Q8IB 1ZEQX 1B9MA 1SBBB 1EZ6A 2JEAI 3C46A 3TP8A 1ZYRD 3VYUA 3IL8A 2B63B 1STHA 3AB9A 5I2YA 4DNTB 4KK7A 4H13C 4RHSA 2RDFA 1ILQA 5KEEA 1HA6A 5J22A 1II3A 1GJXA 4O42A 2EPBA 1UD2A 1STNA 3T4AC 1V1OA 2CW0C 3HKZB 4BY1B 2K7VA 1HVXA 5KGUA 2BCOA 4S3SA 1B3AA 3NK9A 3Q0AA 2H4OA 3NHHA 1O7YA 4E6IA 1R9TB 4XTCS 5EKLA 4PMCA 1W6KA 3EROA 4R9WA 4TQUS 2MPMA 1S5DD 4B9XA 5JPNC 4OGQC 2TSSA 3K5NA 3BDCA 4A3KB 1EL0A 2KHSA 1SYDA 3HOYB 3Q22A 2DN8A 4MN3A 1HA5A 3J80E 4IUUA 3M4OB 1UUPA 3X3NA 5AFWA 5EKKA 2A68C 2F43A 1AFPA 1DCZA 3QB3A 3SVMA 3CP8A 4YIJA 2KUMA 1F77A 2FINB 4WFN3 3G05A 1ET9A 2F0PA 1HFGA 3T16A 2EYPA 3CRLC 1LABA 2G9DA 2A74C 4CJ2C 2A6HD 3KEWA 1LTRD 2HCCA 5M5YB 2DY8A 3DWPA 3J7YW 4ZK9B 1EWCA 4O1NA 2IT1A 4X3TA 3VR4A 1HTPA 1LACA 5HKKA 4WJWA 5G3LF 3K58A 4A93B 1QE6A 1SJHD 1UD4A 3BH4A 1CA6A 1BQQT 4L63B 1Q90A 2Q8TA 2CVRA 1ZKOA 1D6EC 2ZXIA 1GOZA 4H0LC 1CHPD 3NQTA 5A35A 1K8MA 3SK6A 1VMPA 3NSWA 3PUYA 4OO1G 2M5SA 3OIQA 1PFNA 1CZGA 4EQOA 4U68A 2RDGA 2F4IA 2L12A 1SAPA 2M2LA 2NN6H 4NMZA 1OXVA 2F0OA 2F03A 5F2DA 4RAUC 1W6JA 2KVOA 1JCKB 1E2ZA 1F9PA 5D14A 1E43A 4B3GA 1PRTF 4IFDH 2DIEA 3BVGA 1YNNC 1EYCA 4CGYB 1GUOA 4BS9A 4ZRZA 1H9MA 2YYZA 1QJOA 3PV0A 4KKSA 3D8GA 3D4DA 1A3UA 1GUTA 2EJGC 2NTSA 2X6YA 1STGA 4HSVA 3MHBA 1PZID 3TBIB 2IW3A 4Q5VA 3D4RA 4RH6A 3D4WA 1SYGA 2X85A 1Y8PB 4K8JA 3VA5A 1RHPA 2E76C 1LT5D 3P75A 3TZDA 2AWNA 4II2A 1EWHA 2K32A 4FF3A 5DM73 3FKSA 1HCZA 2WSSA 3AMUA 4IURA 5JEAJ 3CHBD 5K36G 1H8EA 2FHTA 2K5QA 4XLHA 1HXYD 4P2CB 4G4KA 1UD3A 3QOJA 1JC7A 2MGSA 3TSSA 4G7XA 5CBAE 4XYQA 2B2UC 1WPCA 3DM1A 2F0VA 4RGTA 4WRDA 1O7LA 1A2TA 2LMCB 1BF4A 3SK4A 3I8ZA 4NW2A 1MSGA 4G6IA 4B9WA 1SNOA 1Y8OB 1BLIA 5C0XH 1D2BA 1WTPA 3DMUA 1XX8A 2V4DA 1L0YB 2DNCA 5T1IA 2B2VC 1EQVA 1E79A 1OXSC 3PO3B 3IAYA 1SDFA 2KCNA 2NVQB 5I9OA 5BN3A 4M1UB 1I4PA 3NE5B 1ET6A 2EY2A 4K8IA 2PW5A 3I4MB 4KI0A 2HQEA 2RVLA 1RDPD 1LO5D 3DUZA 1HPCA 4G57A 1MI2A 2K5DA 2A6ED 3S1NB 2PNRC 1V0FA 4E0FA 2WP8J 5C4ZA 2MJ8A 1IYVA 2EY6A 1JORA 3I90A 4XOPA 5CYUA 3KBXA 4CHTB 4KKTA 1NR4A 1B53A 1G8ZD 1I6HB 5ELBA 2NB0A 1D1IA 2F1MA 1KLUD 2E2DC 2W6JA 2KECA 2D5DA 3CP2A 4ME5A 1H9SA 1TR5A 1JWUD 4YEJA 1BR9A 4KJNA 3BC9A 1RCVD 2L0CA 3JAME 1O78A 3VR5A 1STBA 5C4JB 5I9PA 3EVQA 4QUCA 4K5XA 4X3SA 3UI2A 3LWEA 3NTHA 5EPLA 1ENCA 1BMFA 1SNQA 2EYMA 1S5BD 4UDUC 5JJZA 2R92B 3L3OC 3G7LA 2B39A 4KD3A 2MP1A 1IW7C 1EQTA 1QNUA 1E0BA 3SK5A 1IKLA 2SNSA 1S5CD 4XOTA 1AEXA 3PUZA 2IX3A 1ONLA 3ZYYX 3LWUA 5D3IB 1IKMA 3T53B 1SEBD 3A3GA 2WJYA 1GHKA 1H9JA 1KDBA 3OHXC 4HMJA 2EOTA 1PYWD 2OEOA 2N88A 4J8QA 1IL8A 4G7ZC 3H6MA 3OEHA 3RD4A 2XN9C 3E6ZX 5CORA 1SYBA 1SE3A 3L9AX 1TWFB 5FO8B 4P22A 4XT3B 4EQPA 4LK1C 5IOCA 1A6XA 4JMQA 2EXZA 4C3IG 3MFYA 2PPBC 3ZPNA 2O2LD 1I18A 3PO2B 4K5WA 1WP6A 4B08A 3CQZB 3I72A 4XORA 5C0XI 2W6IA 3KLSA 4IUTA 4KD4A 5CV9A 1U4MA 2F0JA 4HAEA 4CKBA 4FF4A 3HAGA 1PRTB 4R8NA 4IUVA 1F9QA 5IIFA 1OHHA 1QOHA 2QF7A 2GK7A 5CGKA 4YELA 1WTRA 3NP8A 1JOKA 1RKNA 3OSOA 4RKBA 5DNFA 3BVZA 4II3A 4HCEA 1HUNA 1EY9A 2EY1A 1HFNA 3KLSX 1FYCA 4XD7A 3A3BA 3CMMA 3GTLB 4XQFA 4U673 2FMMA 2RSOA 1PFBA 1XWEA 3OAAA 5A2QL 1BPLA 1H9SB 2NBFA 2C5CA 4IUNA 1E3ZA 2A69D 2E75C 3NPPA 3H94A 1PTOB 2PW7A 1Z7TA 3GVJA 2K33A 3JU4A 2WINB 4TKOB 3D6WA 1HUMA 2BE5C 4ZLTF 1DD2A 3WDNA 2WB1B 1U4RA 2M00A 2NUCA 1GHJA 2OT2A 2JA7B 4K6LA 1F9RA 1DOKA 1TWGB 2B8FA 1RTOA 2PO4A 2LZJA 1PDQA 3S2HB 4RFBA 5JEAG 5LHY1 2BA0A 1V0EA 3SR1A 3BYTB 2O5JC 4C3IB 4F88A 5D3DA 2BDOA 3HOVB 1F2YA 2F0TA 2WKDA 5FL7A 2X69A 5E1FA 4FO2A 1E3XA 1FR3A 1GUGA 2CW0D 2ZXPA 2ID0A 4H7BA 4B3FX 3K5LA 2A5HA 5KIXA 4EQNA 3MAQA 4F7XA 2K1BA 3S15B 2K5WA 1K28D 2R6GA 4DAYA 1B9NA 1YNJC 5CV5A 1BCPB 4XR6A 2WJVA 4J6HA 1ZXTA 1MBYA 3I3CA 2B8GA 3BYYB 4FP5D 4A3GB 4CKEA 1SXTA 4RWSC 1GXDC 1DXMA 1Z47A 2X6LA 5I6WA 3LNNA 1CQVA 3M7GA 2XWJB 2SOBA 1DJRD 4A3MB 4LJZC 2SNMA 5FK9C 5DEHA 4I7ZC 3QG1A 2A68D 3PUWA 4YXWA 4DGZA 1V1PB 1XTCD 5JVG3 4HIZA 1EY0A 4HR7B 4DK1A 2B2WC 5LL6S 3S1RB 3FEWX 1A15A 2E74C 5KRUA 4ZUIA 3CRKC 4FXGC 5C4HA 1G6ZA 2VXWA 2AQ2B 1LTGD 1B50A 1EY8A 1WTHD 2B2YC 1SJED 4BBSB 2R9VA 2F3WA 2XZLA 3SHLA 4A3FB 1EOTA 4A3IB 1SE4A 4ZKCB 3MC0B 2BOSA 1SSOA 5KNBA 2VB2X 4XLAA 2AUKA 2NVTB 1HQRD 1CZWA 1XYIA 3GO5A 3NWSA 1V8QA 2X6WA 3EQLC 4FYDA 3A8KE 2K04A 1DYQA 4KY5A 1SYEA 2IX1A 2XZPA 1SMYC 4XQQA 2WPDA 4G7OC 3OW7A 2VUMB 2R7ZB 1QILA 3W3AA 5DAUA 2JEBI 2PYKA 3QO2A 4XLFA 3F2UA 1QG7A 5BN4A 1TWAB 2B2UA 2M9VA 5CBEE 1CI3M 4F87A 1I8DA 1H9RA 4KTAA 4XYOA 2EYJA 4Q0FA 2I07B 5IT9E 4C3JG 5C44B 1TT2A 1PZKD 1ESFA 2Q8RE 5JVH3 4QIWB 4MHEA 1PXUA 1BO0A 4K6DA 3H91A 5ELEA 3PMFA 4QMGA 1LTID 2B2VA 1PFMA 1KABA 2IJ0A 3N6RA 1JOQA 2QKIC 3S9WA 2JA6B 3QJYA 5CV6A 3H09A 1RD9D 5FLXE 4R8IA 1R4QB 4KHZA 2WKCA 1G291 3IFDA 5JEAH 4RHRA 3NUCA 3GVLA 1MD2D 1KAAA 3J80L 3VYRA 5E4WC 2LS01 1TVXA 3OFNA 2EYLA 3EFXD 2JP1A 2XZOA 2KOLA 5EJWA 3L7ZC 3ND8A 4HN7A 2DY7A 3C2PA 1VF7A 2JDIA 4XDXA 4XKVA 1OO9B 2J4XA 1WTQA 1CA5A 4CKCA 2XOKA 3BS1A 1LT3D 4FXKC 1ICWA 4C3HB 1NUCA 4ZAIA 5IK2A 2N55A 1RF2D 2K6AA 2RBMA 3ONAB 4H44C 1EY6A 3WOFA 3I73A 4C1NK 3X3MA 3K59A 3GTKB 4XQNA 2ENBA 2RSNA 3WOEA 2D62A 3I4NB 5IODA 4G7HC 1TS5A 1Z6HA 4C3JB 5EGTA 1Y1VB 1LT6D 1EY4A 5E3FA 1OXTA 3MFGA 2RDHA 3KLRA 2F0MA 4XLCA 1JB3A 1V43A 1HHVA 3SEBA 3GP7A 1EYDA 2Z1CA 4C1NI 2X8KA 3K6OA 5CC4A 2O4XA 2GJKA 2Z4IA 3QIAA 2QDBA 1WVLA 4OL7A 4EVOA 1JOOA 3R2TA 2VB3X 1QCBD 1U4LA 1EYAA 1CK1A 3KBGA 2FJ2A 4C56C 2EJMA 2EJFC 2V7QA 2ZT9C 5FO9B 4BBRB 4LMQD 1E2WA 3DWAA 2NN6I 1Q1BA 4PMBA 5C3XA 5G3LD 2JYOA 1WCMB 2A6EC 2JJ2A 4N9TA 3BCFA 4IFDI 4HTHA 3M7NA 4A3BB 3V05A 2FMCA 2H1EA 3TP5A 2JIZA 1KNAA 3EJIA 3HOZB 1B2TA 5JAVA 4KKUA 3E0JA 4OO1H 2AWOA 4HMIA 2Z6BD 5CV4A 1LTSD 2L4NA 3D3RA 1JE4A 1IW7D 3MWYW 1I50B 4ASUA 1Y69U 1AZQA 2R3ZA 1Q12A 1TY2A 3GTPB 1K8OA 2BDNA 5ELCA 1PRTD 4HEDA 3HEJA 1EZ8A 1NAPA 3M85A 2XRSD 1W0JA 3CESA 4PNYA 3J81E 1UNSA 4DAPA 4Y7NB 2ZZEA 2D2CC 2AQ3B 3VA7A 1VMCA 4NDXA 3R2IA 2NWGA 4OHJA 5ELDA 5ELFA 5T1GA 1OXUA 2L1BA 1B1ZA 2JE6I 2EDGA 2F0IA 1U4PA 3E5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDO A;  4KN7 C;  2K7V A;  4DK0 A;  5C0X G;  1IYU A;  1Q90 A;  3I4L A;  1ZKO A;  2EJM A;  1O78 A;  3BG3 A;  2EJF C;  3DXJ C;  1Q1E A;  4JK1 C;  4KN4 C;  5KNB A;  1O7L A;  2ZT9 C;  4H0L C;  2KCC A;  5A35 A;  1K8M A;  2LMC B;  1FR3 A;  3VR5 A;  3L7Z C;  2AUK A;  1E2W A;  2A69 C;  3ND8 A;  3PUY A;  1GUG A;  4XTC S;  4OO1 G;  1VF7 A;  4BA2 I;  2EVB A;  1V8Q A;  2BA1 A;  2QF7 A;  3EQL C;  1CFM A;  3P20 A;  4KMU C;  5K36 H;  2BE5 D;  2NN6 I;  4TQU S;  3SE0 A;  1OXX K;  3A8K E;  1Q1B A;  1SMY C;  1GUS A;  3M4Y A;  4OGQ C;  1Y8N B;  2NN6 G;  2NN6 H;  4XIG S;  1OXV A;  3U9S A;  4G7O C;  2L5T A;  3OW7 A;  1Y8O B;  2A6E C;  3GD7 A;  3OPO A;  5C0X H;  3VR6 A;  3W3A A;  1E2Z A;  2R6G A;  3M7N A;  2JEB I;  1IW7 C;  2DN8 A;  1FYC A;  4IFD H;  4IFD G;  2V4D A;  2DNC A;  1B9N A;  3IKJ A;  1YNJ C;  2O5I C;  5BN4 A;  1YNN C;  3OOC A;  4H44 C;  4KKU A;  3PUX A;  1OXS C;  1GUO A;  1H9K A;  4OO1 H;  2AWO A;  3I73 A;  3IFT A;  2B8G A;  1CI3 M;  2JXM B;  3T56 B;  1VDZ A;  1H9R A;  3PUZ A;  2A68 C;  1E2V A;  3RLF A;  3VR2 A;  3FMC A;  3ND9 A;  1H9M A;  1DXM A;  1ONL A;  5BN3 A;  1DCZ A;  1IW7 D;  2YYZ A;  2DNE A;  3NE5 B;  1QJO A;  3PV0 A;  3LNN A;  2D62 A;  1Y69 U;  3LWU A;  4BA1 I;  2A6H C;  4KKS A;  1H9S B;  3T53 B;  4G7H C;  2A69 D;  1Q12 A;  2E75 C;  1GUT A;  3A8I E;  1VCI A;  1H9J A;  4RCN A;  1GHK A;  3H94 A;  1K8O A;  4LJZ C;  1T5E A;  2EJG C;  3A7A B;  1Z7T A;  2K33 A;  4I7Z C;  1HQM C;  1Z6H A;  1ZYR C;  3QG1 A;  2A68 D;  5BN5 A;  4KI0 A;  2KA7 A;  3M85 A;  3PUW A;  3CRL C;  1GUN A;  3D4R A;  1HPC A;  1LAB A;  1TKW B;  3A8J E;  4G7Z C;  4DNR B;  4L8J A;  3T51 B;  2A6H D;  4TKO B;  1OXT A;  2A6E D;  2Q8I B;  2PNR C;  1Y8P B;  4JBW A;  1VF5 C;  3KLR A;  4HR7 B;  1B9M A;  4DK1 A;  1PMR A;  2E76 C;  3N6R A;  2JEA I;  1IYV A;  2BE5 C;  3TZU A;  1EWH A;  3BDO A;  3HGB A;  1TU2 B;  1V43 A;  1CTM A;  1DD2 A;  2K32 A;  3QJY A;  3WDN A;  1I6V C;  2IT1 A;  2D2C C;  2AUJ D;  1GHJ A;  2E74 C;  4IQZ A;  2O5J C;  3AB9 A;  1HCZ A;  4LK1 C;  3VR4 A;  4KKT A;  3D31 A;  3SDZ A;  3CRK C;  3VR3 A;  5KNC A;  4DNT B;  3VA7 A;  1A6X A;  4H13 C;  1HTP A;  5KND A;  1LAC A;  2B8F A;  3GQB A;  3MFY A;  4PV1 C;  2F1M A;  4KHZ A;  5K36 G;  2PPB C;  3QIA A;  1G29 1;  1OXU A;  3PUV A;  4GZY C;  3A7L A;  1GJX A;  5JEA H;  2JE6 I;  5JEA G;  2D5D A;  2EDG A;  1BDO A;  2BA0 A;  1H9S A;  2PCF B;  3I72 A;  3MXU A;  3FPP A;  2CW0 C; 
#chains in the Genus database with same CATH topology
 2IHE A;  2QEX A;  4RLZ A;  2AQ1 B;  1ILP A;  1I6H H;  1FNU A;  1JIC A;  3I4L A;  4YAO A;  1VQM A;  4XMY A;  1PTO D;  4JI5 Q;  1OB0 A;  1LTT D;  3AEV A;  3BZD B;  4CDF C;  1C4Q A;  1NCV A;  2Q2T A;  2WII B;  4RCO A;  4LAA A;  5M9O A;  2E1B A;  4I65 A;  3BJU A;  4YCU A;  5K36 H;  4KMU C;  1DOM A;  1XNR Q;  4LFA Q;  5GAH C;  3QSY A;  1YJW B;  5CR3 A;  3LX0 A;  1LLR D;  2MUY A;  3FRP B;  4XIG S;  2K50 A;  4L5S A;  4NP5 A;  3URY A;  4IUQ A;  3GD7 A;  3OPO A;  1D1K A;  3BQJ A;  3Q38 A;  4DV5 Q;  2F0H A;  5C4J H;  4KHP L;  5A89 A;  1PH9 A;  2CK3 A;  2IPK D;  2XWB B;  3GTQ B;  4A75 A;  2KEE A;  1V1P A;  5IGG A;  1D5Z C;  4C0S A;  1C48 A;  4LF9 L;  1X3P A;  2RA4 A;  2XVS A;  4X65 Q;  2HDM A;  1YX2 A;  2Z0S A;  3K5O A;  2B2T C;  2C9O A;  3MZ5 A;  4NXM Q;  2R92 H;  1WYD A;  2JXM B;  3UDX A;  1F2M A;  1IHM A;  3OWE B;  2Y0S E;  3P1H A;  5IYQ A;  2DNE A;  3TEH B;  4CJ1 B;  1XNQ Q;  1WTV A;  3CCM B;  4GQN A;  1Y1W G;  1U0L A;  3HOW B;  4JW0 A;  5I2X A;  2XGT A;  1EYG A;  3A8J A;  1JWM D;  1KC8 C;  2WV6 D;  5JJL A;  1LV9 A;  2ZTG A;  1LUZ A;  2J0T D;  4A3J G;  4DFA A;  4A3G G;  1AN8 A;  3ULP A;  2B7B A;  3ZIA A;  5CMD A;  3JAM L;  3HOU G;  5LMZ A;  2R93 B;  3RN5 A;  3A8J E;  4X6A H;  1EY5 A;  4Y9U A;  3PF5 A;  1G2T A;  3GVK A;  3H3V I;  3TZU A;  3BDO A;  4A3E G;  1YHB A;  5C3E B;  1S4Z A;  3U9O A;  2I5H A;  1CKN B;  5C4X G;  3ITP A;  4AQY Q;  5KNC A;  3TDQ A;  2Y0S G;  3K80 C;  5HGT A;  4JI3 L;  3AVY A;  1HTL D;  4XL9 A;  2Q6O A;  1WDT A;  3GV6 A;  1VQ9 A;  2BH2 A;  1BCP D;  4NBS A;  2LY7 A;  4DUY Q;  4L5R C;  5TY0 A;  1PH1 A;  1QVG B;  1S0U A;  1EU4 A;  4DR2 L;  1TWF H;  1SKY B;  5I6Y A;  1UE6 A;  1DDI A;  1NR2 A;  4KN7 C;  1DG1 G;  4DA2 A;  2C77 A;  5B6I A;  1IYU A;  1WD0 A;  2E1R A;  2ATW A;  5F4J A;  1F20 A;  2AKW B;  3UE1 A;  4JOI C;  1JB7 A;  2B2W A;  1S5F D;  2QEJ C;  2VQE L;  5EQ0 A;  2VQF Q;  3ZZ0 A;  4AIM A;  4BBS G;  1M4V A;  2A69 C;  4HSP A;  2V7T A;  3PIO 3;  3BNW A;  1VQJ A;  1ML0 D;  1DGS A;  2BA1 A;  2F0N A;  4A3I G;  5D65 A;  3A55 A;  3R6K A;  3UE0 A;  3Q23 A;  1IBK L;  3BY1 A;  3E20 A;  4I7A A;  1QH0 A;  3SE0 A;  2ZL5 A;  1X65 A;  1J5E L;  3BY2 A;  2IY5 B;  2IL8 A;  1XMQ L;  5K5P A;  1ZM4 A;  3RZD B;  5FJ8 G;  4K2L A;  1KTK A;  1KRT A;  3W2G A;  4HID A;  4R4O A;  1OB2 A;  3TRE A;  1CHQ D;  1PH5 A;  2B2Y A;  2NV4 A;  2UXC L;  1AIP A;  2F3I A;  1L1O B;  1R5O A;  2CQA A;  1UWV A;  4V0B A;  3ULJ A;  4EGV A;  2F0G A;  4IPC A;  4TSF A;  5M3F G;  1IHZ A;  1EWY A;  3NXW A;  2CW5 A;  1U9R A;  4X3K A;  5IGB A;  2Z4H A;  1W87 A;  4A3D G;  4L6T B;  3CCJ B;  1STA A;  2R7Z G;  1E2V A;  4LC0 A;  2KBN A;  3RLF A;  3FMC A;  3Q39 A;  4TMV A;  4XM3 A;  4IPH A;  3VYS A;  3QE2 A;  1N8R C;  1YNJ D;  5C5M A;  4JI2 L;  4QCL A;  3ULL A;  1VQP A;  2ZIT A;  2OTL A;  2K5H A;  2NVX B;  1O7I A;  2K01 A;  4GLA C;  2QEX B;  2KED A;  3ER0 A;  3HOX G;  3A7A B;  3W2F A;  4ULL A;  3GTL H;  1LTA D;  1KK3 A;  1ZYR C;  3D0F A;  1VQM B;  4QUF A;  2OXP A;  4PZ7 A;  1JR0 D;  1Y1W B;  5EBD A;  4X8I A;  2EY5 A;  4DNR B;  5C5L A;  3P7J A;  3KYH C;  2E2H B;  1N08 A;  4A3J B;  2XNJ A;  2VBU A;  4B3R Q;  1QNK A;  5L46 A;  4QJF A;  1VLY A;  3HOU B;  1PTO H;  2XGJ A;  4QL5 A;  5EKI A;  2EYF A;  3PIO A;  2B3G A;  1TS4 A;  3D6C A;  2JA8 G;  1F9S A;  2L11 A;  1OGJ A;  4CBV A;  3VDY A;  5TSS A;  3H9N A;  5DLQ E;  4YHH Q;  1AP0 A;  4K14 A;  5IGC A;  5IWA Q;  3E0E A;  5EAY A;  2EYH A;  1EY7 A;  3G6J B;  4AH6 A;  4A3E B;  2C4U A;  5C6A A;  5IYB G;  3CCS A;  4IJL A;  3OKX A;  3K0Y A;  4TRD A;  4Z1M A;  2P3M A;  1VQ6 A;  1D5X C;  5C4X B;  3J7A V;  4FF1 A;  3ZC3 A;  2Y0S B;  1I4G A;  3MXU A;  1WFQ A;  3CW2 A;  4G1B A;  1I7P A;  3QR8 A;  1ELO A;  3FPK A;  1HZE A;  2JA7 H;  1K8A D;  2VBT A;  2Q6L A;  2VBV A;  5C0X G;  4LNQ A;  5CDF A;  1TWG H;  1CT1 D;  1B23 P;  1YIT A;  3MXN A;  3S2H H;  5NUC A;  2WZP P;  1IJF A;  4ZCM A;  1Q3L A;  2F0D A;  4KN4 C;  4OIK A;  1E1R A;  1J9O A;  4FVM A;  1MJC A;  1XTD A;  3S24 A;  1M90 D;  1HNZ L;  3TP7 A;  1QVF A;  4C3I H;  5FOB B;  2YU9 B;  2DCU A;  4PMW A;  3F2D A;  1D8L A;  1OXX K;  2SDF A;  1XMO Q;  5FO0 A;  1VJS A;  3RNU A;  4JI3 Q;  4MZ9 A;  1C8C A;  4ABN A;  4UP8 A;  4RGO S;  1PKV A;  4P3I A;  4Z4R A;  1SE2 A;  2J7K A;  3HZX A;  4ILW A;  4N8F A;  1W34 A;  5EPJ A;  1MKH A;  2YTY A;  4G7W A;  2QIL A;  3NBI A;  2Z8L A;  4IN3 A;  2QTZ A;  1O80 A;  2QCP X;  5JJI A;  3A8K A;  4M53 A;  4ZV4 A;  5KNL A;  4X64 L;  2HDN B;  1SMY D;  1I3Q B;  4XQJ A;  1H9K A;  4B3S L;  2RCF A;  3K81 C;  1M1K D;  3S15 H;  3BDL A;  2X6G A;  1VQ9 B;  1N0V C;  1STY A;  2KVM A;  4AYB E;  4C3H G;  3PF4 A;  4FF2 A;  3R3O A;  3ND9 A;  4QVJ A;  5M3F B;  3T13 A;  2JA5 G;  4AVZ A;  1EEF D;  1TS2 A;  4KY6 A;  4XN3 A;  4OEM B;  5M3M G;  1SRO A;  2F3V A;  1PLF A;  1Y1W H;  3QOL A;  2A6H C;  3CC2 B;  4BA1 I;  4HIM A;  1WTO A;  1HNX L;  3BCD A;  3HFZ B;  3CCE A;  2K03 A;  4MTK A;  4A3D B;  2N8N A;  1ASZ A;  2BM0 A;  4BPR A;  1I4X A;  3NWT A;  4N3N A;  3RMH A;  3OWF A;  2WAC A;  1W3S A;  4A3G H;  1LYL A;  4F8M A;  2LKV A;  4IPD A;  2HLD A;  1ROD A;  1XMQ Q;  2ZBU A;  3VMF A;  4CQJ A;  2TMP A;  4RGM A;  2V31 A;  1BNZ A;  3T1H L;  3RLN A;  3E3X A;  4KHV A;  4QF4 A;  3HOX B;  2UXC Q;  1F2Z A;  2NYZ D;  1VQK A;  4A3M H;  1KQS A;  4XXE A;  2BGJ A;  2V7U A;  2DJF C;  2J7Z A;  3WBJ A;  1Y0R A;  4DV0 L;  1BUV T;  4LW1 A;  1FD7 D;  1UEA B;  1YNN D;  2AUJ D;  5J1Z A;  4AYB G;  1QX4 A;  3AGQ A;  3SDZ A;  4JYA L;  4X3U A;  5KYL A;  2I46 A;  2PZW A;  1COW A;  2K05 A;  5GAE C;  2JA8 B;  1M8A A;  2ZXO A;  1FGB D;  1NRK A;  1K3R A;  3I91 A;  2XND A;  1FJG L;  1KK2 A;  1QG0 A;  2QGQ A;  3PUV A;  5COY A;  2BVN A;  3CD6 A;  1D5M C;  4ZQ3 A;  2XRQ D;  4GLV B;  2D3L A;  1UAP A;  4BY7 G;  4A3C G;  1EIH A;  3VYT A;  3MTS A;  2GJP A;  4YWM A;  4OX9 L;  2XNC A;  4Z9C B;  3SXH A;  1V1Q A;  3H3V C;  4FXU A;  1KLG D;  5HUR A;  1PH8 A;  4LFB L;  5FO1 A;  1UD8 A;  4RD6 A;  1HH2 P;  1JQY D;  3DEO A;  3CF5 A;  4QB4 A;  3A0J A;  3KF6 B;  3DWQ A;  3KLW A;  1N32 L;  3K0X A;  4IZ8 A;  2OTL B;  1C9O A;  4BBS H;  3WNC A;  1GO3 E;  3NBH A;  1I4R A;  2QW7 A;  3J80 c;  3BVM A;  4A3F H;  1STE A;  4A3I H;  2V7W A;  2XSC A;  4DR7 Q;  4ID6 A;  1EFI D;  4QQB X;  3HS0 C;  1Q81 D;  4JI1 Q;  4KJO A;  2UXD Q;  1BKB A;  1GUS A;  3V2T A;  3MMP A;  5FJ8 H;  4ZKB B;  1VQ4 A;  1TQO A;  5TV2 A;  2WFW A;  4OWW B;  4LF6 L;  4IFD J;  1O7Z A;  3VR6 A;  1I3Q H;  1SYC A;  1WD1 A;  2MHV A;  2VNI A;  2NVT H;  3S16 B;  3W5U A;  2C78 A;  3RY8 A;  1YVC A;  2D9U A;  5I4D A;  2PMZ E;  1NBM A;  1VQ7 B;  4OOV A;  4ZCL A;  2XIW A;  3MXG A;  1S5E D;  5CV7 A;  3R8B A;  1FNW A;  5M3F H;  4XT1 B;  2YTX A;  1XPO A;  1H85 A;  1JWS D;  3J7A 5;  4A3D H;  3K57 A;  3T56 B;  5LMN L;  3CCS B;  3RR5 A;  2VUM H;  2R7Z H;  1X3Q A;  3LVB A;  3VR2 A;  1G91 A;  1QVC A;  5LL6 X;  1XQB A;  3QWN A;  1PTO F;  1TWA H;  1QZG A;  2ALY B;  2F0Q A;  5IGF A;  2GK6 A;  1GVH A;  2JA5 B;  2F0L A;  2HIV A;  5DM6 3;  4H9G A;  4NPS A;  4OIJ A;  5M3M B;  4C2M B;  1X3E A;  3W5V A;  2LFN A;  1YIT B;  3MXN B;  1PZJ D;  3TQY A;  1TKW B;  4GOP A;  3ZBU A;  2QDL A;  4L8J A;  2Q2H A;  4UZU A;  1B4O A;  4NKL A;  1DON A;  1QVF B;  3S17 B;  3J7A F;  1NJI D;  3SLD A;  3MEH A;  3I70 A;  1BQE A;  2UUC L;  1H8H A;  4PC3 A;  1LTL A;  3HRZ C;  3N52 A;  2OBT A;  1YJN A;  4NNJ A;  4DAM A;  2G9H D;  1CTM A;  4ZYS A;  3EN2 A;  3KDF A;  3TP6 A;  5M5X B;  2IWH A;  5ELN A;  2EZV A;  3AU7 A;  2GRE A;  1NE3 A;  2JQO A;  4YY3 L;  4ODG A;  1EIG A;  4FNF A;  3W2D A;  1HZ9 A;  1A3T A;  1JNY A;  3OMG A;  5KND A;  1W0K A;  4PV1 C;  1VQL A;  4AYB B;  3G4S A;  3CPW A;  2JA6 H;  3E5S A;  3A7L A;  2RQX A;  1EOV A;  3W2E A;  1YHA A;  3FKI G;  1QGZ A;  3S1M B;  5BN5 A;  5FIU A;  1TVC A;  2ZXR A;  2YWH A;  4RKL A;  1MAB A;  1BXT A;  3S1Q B;  4DK0 A;  2EYO A;  1QZH A;  3ERQ A;  3T1H Q;  1FX0 A;  2VJI A;  1T5X D;  2L55 A;  2SEB D;  4BY7 B;  1XNR L;  3E1Y E;  4KV6 A;  4LFA L;  3I55 B;  1K8G A;  5IT9 L;  1HRJ A;  3CCE B;  3R93 A;  2KCC A;  5IGE A;  4DN4 M;  2F4N A;  1X54 A;  2EVB A;  4BA2 I;  3F8T A;  4DV0 Q;  3PQI A;  1PHJ A;  2F0E A;  4DV5 L;  3UDI A;  1KDC A;  1G2S A;  2ZZF A;  4JV5 L;  2GA4 B;  4JYA Q;  5KYI A;  3VO1 A;  3U9S A;  5C0X J;  2H5X A;  1DZ1 A;  5E6T A;  3PUN A;  5IGD A;  4V19 0;  1VQK B;  4X65 L;  3DDY A;  1FJG Q;  3ASR A;  4TT3 A;  1KQS B;  4NXM L;  4DV1 L;  3QFT A;  1F60 A;  1QFZ A;  2QN6 A;  1BCP F;  3DEP A;  2WZN A;  2YWG A;  3CU7 A;  3IKJ A;  1YI2 A;  4OX9 Q;  1DAR A;  1EU3 A;  3OOC A;  1W35 A;  1B44 D;  1SNM A;  3PUX A;  3FJO A;  1XNQ L;  4LF8 Q;  1PV4 A;  2ZZG A;  2WAQ E;  3S14 B;  1RTN A;  2RKS A;  2PZU A;  5FLX L;  1E1Q A;  1VDZ A;  4OXP A;  1KAW A;  4C3H H;  5GV8 A;  1L0X B;  2JJ1 A;  2OK8 A;  3GV3 A;  1KNE A;  4M8A A;  2PNH A;  3JC6 6;  1CKN A;  4DXF A;  4HJ8 A;  4XLE A;  1TTT A;  1VQH A;  1Q86 C;  5DN6 A;  3CCL A;  2E2J B;  3C1E A;  1T5E A;  2UU9 Q;  2MO1 A;  3TS2 A;  3GTK H;  2KA7 A;  1QVG A;  2F0F A;  5J39 A;  4QUZ A;  2K5N A;  3MVV A;  1K0S A;  1TS3 A;  3C1F A;  3GTJ B;  1HR0 W;  4LF6 Q;  5ISR A;  1FRQ A;  3I4N H;  2ZZQ A;  4X7D A;  3HOW G;  2ICE C;  2RCN A;  4X06 A;  3NBH B;  4JBW A;  3FVQ A;  4AQY L;  1A8V A;  1XPR A;  3WQZ A;  2VJJ A;  3MXP A;  1PMR A;  5M5W B;  5JOB A;  3V96 A;  5IYP A;  4Z4T A;  2F0S A;  4IAL A;  4ALP A;  1K3B C;  3HGB A;  1MHW C;  1TU2 B;  2B2T A;  2WAQ G;  5EMN A;  3O13 A;  4P12 A;  4P74 A;  4DUY L;  1J8I A;  1GUW A;  1I6V C;  2PMZ B;  4JG2 A;  2R93 G;  4DXG A;  1Y1V H;  4J1M A;  4IQZ A;  3G6E A;  1VQ4 B;  4N9P A;  3VR3 A;  1E3P A;  2A73 B;  3GQB A;  1MGS A;  2FXQ A;  3NQI A;  4XON A;  2L9H A;  2HUG A;  2NVY B;  5A2Q E;  1JJ2 A;  1BDO A;  2K28 A;  1SNC A;  2PCF B;  1AW7 A;  2CWP A;  5C3W A;  3FPP A;  1FNM A;  1KMH A;  4KY7 A;  1Q8I A;  2ZTN A;  1SE8 A;  2E2I B;  2QE7 A;  3FKI B;  3KJO A;  5FNZ A;  1Q1E A;  3GTG B;  1XXG A;  1WTW A;  2CWA A;  4MIU A;  2BSA A;  3W5O A;  1TUI A;  2KQ3 A;  1TY0 A;  3CCJ A;  5LMN W;  4BXX G;  1UD6 A;  4B3M L;  3GTM B;  1WI5 A;  1CFM A;  1T6Z A;  3AST A;  3P20 A;  4ZUJ A;  1DOL A;  1EQR A;  1QB5 D;  1ESR A;  1PRT C;  4DAV A;  1DM0 B;  1K83 B;  3M4Y A;  4YY3 Q;  1Y8N B;  4A76 A;  4R4Q A;  4XKW A;  3ICE A;  2L5T A;  4IOA A;  1S40 A;  4BBR H;  1EFR A;  1PA6 A;  4RD3 A;  1YJN B;  2FFK B;  4RG1 A;  4BWG B;  3KDF B;  1QUE A;  1UD5 A;  1Q82 C;  3A35 A;  4XN0 A;  1VQI A;  1PVO A;  3CKI B;  4LF4 L;  1EUJ A;  4K2K A;  2KJX A;  1KZL A;  3TN2 A;  1WCM H;  4JOI A;  3PIP 3;  3FPU B;  2BV3 A;  5CV8 A;  3EA6 A;  1ENA A;  3NTK A;  1VQL B;  3KL9 A;  2XNA C;  1TWC B;  3G4S B;  3CPW B;  2HDL A;  4HCS A;  3A54 A;  4A3B H;  1FVI A;  3SGI A;  4OOS A;  1SYF A;  2NTT A;  2QA4 A;  3HKZ E;  3KF8 A;  3HOZ H;  3EBE A;  4DF7 A;  1OTC A;  1VCI A;  1PJ6 A;  2Z9H A;  3HP3 A;  1A3V A;  3K7A B;  4AF7 A;  3OE7 A;  4IUP A;  4B3R L;  3HG9 A;  4JV5 Q;  4PC2 A;  1A2U A;  2R7D A;  1EEI D;  4ACA A;  4UZE A;  4UAI A;  5E4X A;  3V76 A;  1D7Q A;  2GQF A;  4L5T A;  4TMT A;  1I50 H;  5HZA A;  3VNU A;  1PTO C;  2CKZ B;  5EBC A;  2UXB L;  5J3O A;  3KK7 A;  2VNU D;  2NZ1 D;  2X6X A;  2X53 S;  2Q2I A;  4R1J A;  4YHH L;  2A19 A;  5IYD G;  4K5V A;  4DV1 Q;  5IWA L;  1VF5 C;  3GTP H;  1KC8 D;  1R4P B;  3OEE A;  1GKH A;  4DV7 L;  3MA2 B;  1EXM A;  1KK0 A;  1QUF A;  3M3Y B;  3RUZ A;  1SR3 A;  4LUO A;  3JQQ A;  3JAM c;  5E7N A;  2JSO A;  2NVY H;  3U50 C;  3D31 A;  2EE1 A;  4Y52 H;  3QFS A;  1D2E A;  1NNX A;  2WAQ B;  3KUP A;  5JPM C;  1X32 A;  2ZJQ A;  3HKZ G;  4BY1 G;  4GZY C;  5A8A A;  4RA8 A;  3ASQ A;  3W2H A;  1YI2 B;  4Y9R A;  4DR4 Q;  4Y7N H;  4WOR A;  1VQN B;  2D3N A;  4TVA B;  1MSH A;  4RGN A;  2EFG A;  1G51 A;  3DHQ A;  2ICI A;  1LTB D;  1EFC A;  4RDL A;  3CXC A;  5BSY A;  3CPX A;  4ZGN B;  3E9I A;  3PIP A;  1F2L A;  2CHB D;  2K4K A;  3C3L A;  2GJR A;  4WZT A;  3BG3 A;  1X55 A;  1SNP A;  1I4H A;  3DXJ C;  4JK1 C;  1YEZ A;  1XMO L;  1NSN S;  4LF7 L;  2OF1 A;  1CM9 A;  1SFO B;  4A4I A;  3RLO A;  3CCL B;  1AZP A;  1G7T A;  3NTI A;  2N49 A;  5FKA C;  3CCV A;  3GSI A;  1SN8 A;  3S2D B;  4DV4 Q;  5TRD A;  1QWY A;  1TII D;  2BE5 D;  2PZT A;  3SK8 A;  1TWH B;  3HOY G;  4JI8 L;  2PQE A;  3CC2 A;  3GTO B;  3FDT A;  3WWV A;  2NN6 G;  4JBM A;  5FO7 B;  1BOS A;  4JVZ A;  1HZA A;  2B29 A;  3J81 L;  1B2R A;  3STB C;  5F4M A;  3Q24 A;  4TSS A;  4K0K L;  4O2D A;  1SND A;  4JI4 Q;  4IFD G;  3K5M A;  4OO1 I;  2JK8 A;  2R61 A;  1RJT A;  1KDA A;  2MNA A;  2O5I C;  4B48 A;  3GIR A;  3G6E B;  1R5N A;  1W9X A;  4X07 A;  1EQQ A;  1KD1 C;  1ZM3 A;  1WTX A;  1BBX C;  2ZXH A;  1IYJ B;  3IFT A;  2F0K A;  4HIO A;  1LT4 D;  1CQF A;  1BCP C;  4TMZ A;  2IX0 A;  4PQX A;  3RZO B;  3W2I A;  3OMC A;  4DU9 A;  3OP1 A;  3OIP A;  3A56 A;  3GTQ H;  1WSV A;  1JJ2 B;  1ENF A;  5IYC G;  4B3M Q;  1PH4 A;  4FXD A;  4FN5 A;  2HCI A;  4XNF A;  3A8I E;  4RCN A;  3TME A;  2F0U A;  4CJ0 B;  2F0W A;  1FNB A;  1HQM C;  4IPG A;  2RHS B;  2BF4 A;  1NBW A;  3H0G B;  3Q6S A;  1JA0 A;  1FNV A;  1PH3 A;  1GUN A;  3AVV A;  4OON A;  4RD0 A;  1I4Q A;  5EPK A;  4C43 A;  1N8R D;  3T51 B;  3HOW H;  2Q8I B;  1GM5 A;  2DGY A;  2B7C A;  1ZEQ X;  1PFS A;  1VQD A;  1NB9 A;  1B9M A;  2DUD A;  5AN9 A;  2CQO A;  1SBB B;  3CTA A;  1EZ6 A;  2JEA I;  3C46 A;  3TP8 A;  1ZYR D;  4LF4 Q;  4AF6 A;  2PI2 A;  3KF6 A;  1N33 Q;  5KW9 A;  2R93 H;  3VYU A;  2YV5 A;  3IL8 A;  3SEJ A;  2B63 B;  1STH A;  3AB9 A;  5I2Y A;  1HZC A;  4R4T A;  4A93 G;  4DNT B;  2CH4 A;  4KK7 A;  4H13 C;  1PH6 A;  1SKQ A;  4YAL A;  2RDF A;  4RHS A;  2HD3 A;  2PI2 E;  1BX0 A;  1ILQ A;  4LUV A;  5KEE A;  1WOP A;  4CDD C;  1HA6 A;  2VY3 A;  5J22 A;  5FLM H;  1II3 A;  3AFQ A;  1GJX A;  1CKM A;  3ONY A;  5C3E H;  4O42 A;  2EPB A;  4WZE A;  1UD2 A;  1W2B A;  1STN A;  3T4A C;  2RHQ B;  1V1O A;  5IP9 G;  2CW0 C;  4JBJ A;  3HKZ B;  4BY1 B;  2K7V A;  1HVX A;  1VQE A;  5KGU A;  2BCO A;  4S3S A;  1VQ7 A;  4JC0 A;  2UXB Q;  1B3A A;  4RJL A;  3S2D H;  3NK9 A;  4DR7 L;  1OGI A;  3Q0A A;  4EH1 A;  2QA4 B;  4JI1 L;  2UXD L;  1PJ7 A;  2H4O A;  3NHH A;  1O7Y A;  3KF8 B;  4E6I A;  4X66 Q;  4DR3 L;  1R9T B;  4XTC S;  5EKL A;  4DV7 Q;  1UE7 A;  2XEX A;  3WY9 A;  4PMC A;  1I94 L;  1W6K A;  4G1V A;  4NXN Q;  3ERO A;  4R9W A;  2R7F A;  4TQU S;  2MPM A;  1S5D D;  1BBU A;  4B9X A;  1N36 Q;  4HJA A;  3ZJY C;  5JPN C;  4OGQ C;  2TSS A;  3U6B A;  4UY8 C;  4GKJ Q;  3K5N A;  3BDC A;  2GPJ A;  4A3K B;  1EL0 A;  1K73 D;  1SYD A;  2KHS A;  3HOY B;  3Q22 A;  2C5B A;  2DN8 A;  3JAM i;  4MN3 A;  1HA5 A;  3NEL A;  1Q46 A;  4IUU A;  3J80 E;  3M4O B;  4NB3 A;  1SRU A;  3B78 A;  3RZD H;  5KSW B;  1UUP A;  3X3N A;  5AFW A;  5BR8 L;  5EKK A;  1SMX A;  1QGA A;  2I1L A;  2F43 A;  2A68 C;  4LF7 Q;  1AFP A;  1BX1 A;  1DCZ A;  3QB3 A;  3SVM A;  3CP8 A;  4YIJ A;  3LQ6 A;  3I2Z A;  2KUM A;  1F77 A;  1CUK A;  3CXC B;  2FIN B;  4WFN 3;  3G05 A;  4JI8 Q;  1ET9 A;  2F0P A;  1K8A C;  1HFG A;  3T16 A;  3PUM A;  2EYP A;  1CKO A;  3CCQ B;  2FX3 A;  3CRL C;  1LAB A;  1T6Y A;  2G9D A;  2A74 C;  4CJ2 C;  2A6H D;  2BGI A;  1XJV A;  3KEW A;  1EFW A;  1GVP A;  4A3L G;  4K0K Q;  3CCV B;  3QFC A;  2Q6K A;  2CFM A;  2NVX H;  2Q2U A;  1LTR D;  2HCC A;  5M5Y B;  2K14 A;  2DY8 A;  3DWP A;  3J7Y W;  4ZK9 B;  1EWC A;  1E22 A;  3I55 A;  4O1N A;  2IT1 A;  3WXM A;  4P25 A;  4LUZ A;  5LMU Q;  4X3T A;  2D9R A;  3VR4 A;  2E2H H;  2EIX A;  4P72 A;  1HTP A;  4A3J H;  1Z9F A;  1QFJ A;  1CNE A;  1LAC A;  3AVX A;  3HOU H;  5HKK A;  4JI7 L;  4WJW A;  5G3L F;  5IP7 G;  2BPO A;  3K58 A;  1N34 L;  4A93 B;  1QE6 A;  2LXJ A;  4P71 A;  3I1F A;  1LM0 A;  1SJH D;  3AYH B;  1UD4 A;  4OP7 A;  1WU8 A;  4WWV A;  3U4V A;  4PGO A;  4P2N A;  2D0O A;  3BH4 A;  1CA6 A;  4A3E H;  1BQQ T;  4L63 B;  4HJ9 A;  5H5J A;  1Q90 A;  2Q8T A;  4MYT A;  2CVR A;  4QFM A;  1ZKO A;  1Q9S A;  1D6E C;  2Z6K C;  2ZXI A;  2DY1 A;  1GOZ A;  5C4X H;  4H0L C;  1CHP D;  3TRZ A;  3NQT A;  5A35 A;  1K8M A;  1A8P A;  2BN4 A;  3SK6 A;  1VMP A;  4DPG A;  3NSW A;  3PUY A;  5AJ3 Q;  4OO1 G;  3J7Z C;  3KJP A;  5FA6 A;  2M5S A;  2OBR A;  4RCZ A;  3OIQ A;  1PFN A;  1CZG A;  4EQO A;  4U68 A;  1EFT A;  3HOY H;  3P26 A;  2RDG A;  2F4I A;  2KHJ A;  2L12 A;  1SAP A;  2M2L A;  2NN6 H;  4NMZ A;  1OXV A;  2HHH L;  1VHO A;  1DDG A;  2F0O A;  2F03 A;  1B7Y B;  1VQB A;  5F2D A;  5GV7 A;  2ZJR A;  4RAU C;  1W6J A;  4LF8 L;  2KVO A;  1JCK B;  2A1A A;  1E2Z A;  1F9P A;  5D14 A;  4HE5 A;  1E43 A;  3WBK A;  3PO3 G;  4B3G A;  2YU9 H;  1PRT F;  2WYR A;  4IFD H;  2DIE A;  5HY6 A;  1YJ9 B;  3BVG A;  1YNN C;  1EYC A;  4CGY B;  4POG A;  1NMF A;  1GUO A;  4JBK A;  4BS9 A;  1IXR A;  4ZRZ A;  4GLX A;  2UU9 L;  2K52 A;  4TMX A;  1H9M A;  3ISX A;  1IJE A;  3WND A;  1TLL A;  2YYZ A;  1QJO A;  3NEM A;  3PV0 A;  3I4M G;  1NTG A;  4DR3 Q;  1W2B B;  3U4Z A;  1CNF A;  4KKS A;  3D8G A;  3D4D A;  1I94 Q;  1A3U A;  1GUT A;  1MRZ A;  2EJG C;  2MQH A;  4RPD A;  2NTS A;  3UDG A;  2X6Y A;  1STG A;  4HSV A;  3KFU A;  3MHB A;  1PZI D;  3TBI B;  2IW3 A;  4M4S A;  4Q5V A;  3D4R A;  3CME A;  4RH6 A;  4RD2 A;  3D4W A;  2HIX A;  1SYG A;  2X85 A;  1Y8P B;  1OB5 A;  1JMC A;  1KJZ A;  4K8J A;  3VA5 A;  1UMK A;  2YWF A;  1RHP A;  2E76 C;  1LT5 D;  3P75 A;  3TZD A;  1S72 A;  2AWN A;  4II2 A;  1EWH A;  2GVA A;  2K32 A;  4ZCI A;  4FF3 A;  2K75 A;  5DM7 3;  3FKS A;  5BR8 Q;  1HCZ A;  4CDC C;  3HOX H;  2WSS A;  2YWE A;  3AMU A;  4DR6 Q;  1WOS A;  4IUR A;  5JEA J;  2ZL7 A;  3CHB D;  5K36 G;  4J0Q A;  1H8E A;  2FHT A;  2K5Q A;  4XLH A;  1A62 A;  1HXY D;  3SKB A;  4P2C B;  3PEN A;  4G4K A;  1UD3 A;  3QOJ A;  2CND A;  1JC7 A;  1GD7 A;  2MGS A;  4TN1 A;  3TSS A;  1Q7Y C;  1JB9 A;  5IE8 A;  2JA8 H;  1HA3 A;  4G7X A;  2LXK A;  4XYQ A;  2B2U C;  5CBA E;  1WPC A;  3DM1 A;  2GN5 A;  2F0V A;  2VBS A;  4RGT A;  4WRD A;  4PC7 A;  3PA2 A;  1O7L A;  4YAW A;  1A2T A;  3OZV A;  2LMC B;  3CPF A;  1E1O A;  1N0U A;  4WZK A;  2V1C C;  5IYB H;  1N06 A;  1BF4 A;  3SK4 A;  1YIJ A;  3I8Z A;  4NW2 A;  2R92 G;  4Z4U A;  2ES2 A;  1MSG A;  3EIV A;  4MTN A;  4N8X 1;  1EP1 B;  4GNX C;  3SJZ A;  2JN4 A;  4G6I A;  4B9W A;  4QY7 A;  5IT9 c;  2UUA Q;  1SNO A;  1Y8O B;  1BLI A;  1AE3 A;  5C0X H;  1D2B A;  4JI7 Q;  1WTP A;  3DMU A;  1XX8 A;  1N34 Q;  3W1B A;  2V4D A;  1RQP A;  1L0Y B;  2DNC A;  3K8A A;  5T1I A;  4DV3 L;  2K5V A;  2B2V C;  1EQV A;  1E79 A;  1OXS C;  1R5B A;  3ZZU A;  1X3G A;  1G7S A;  3PO3 B;  3IAY A;  1KHI A;  1SDF A;  2KCN A;  4UHV A;  2ZJP A;  2NVQ B;  5I9O A;  5BN3 A;  4M1U B;  3S16 H;  3ZUG A;  1I4P A;  3CC4 B;  1T9H A;  3NE5 B;  4LF5 Q;  4GN4 B;  4AC9 A;  4RPB A;  4PZ8 A;  1KXL A;  1J9Z A;  5HGQ A;  1ET6 A;  5JJK A;  2EY2 A;  4ME3 A;  4OPV A;  4K8I A;  4RCY A;  2PW5 A;  3I4M B;  5FLX c;  3B82 A;  4KI0 A;  2HQE A;  2RVL A;  1RDP D;  4B3T L;  2RF4 A;  3L2P A;  1LO5 D;  2HHH Q;  3DUZ A;  1HPC A;  1VQN A;  2DYI A;  4G57 A;  3A5U A;  1MI2 A;  2ZBV A;  2K5D A;  2A6E D;  3S1N B;  2PNR C;  1V0F A;  4EQ5 A;  4E0F A;  3J81 j;  2KHI A;  2WP8 J;  1H95 A;  5C4Z A;  2JA5 H;  2MJ8 A;  1IYV A;  2EY6 A;  1JOR A;  5M3M H;  4C2M H;  4LBV A;  2P5Z X;  5GRO A;  3I90 A;  1RL2 A;  1JA1 A;  4XOP A;  5CYU A;  3KBX A;  3V7A A;  3H3V H;  4CHT B;  1L2F A;  3PO2 G;  4DR4 L;  3W5H A;  4KKT A;  1EWI A;  1NR4 A;  1B53 A;  1G8Z D;  4GNX B;  1I6H B;  5ELB A;  3CAM A;  3S17 H;  2NB0 A;  1D1I A;  3BZK A;  2F1M A;  1KLU D;  2E2D C;  3DLL A;  2W6J A;  2OYN A;  5IP7 H;  2D5D A;  3CP2 A;  2QTL A;  4ME5 A;  1H9S A;  1D8T A;  1TR5 A;  5M5X H;  1JWU D;  4YEJ A;  1BR9 A;  4RM0 A;  4B44 A;  1V9P A;  4KJN A;  4ACB A;  3BC9 A;  1RCV D;  2L0C A;  3JAM E;  4DV4 L;  1O78 A;  2C35 B;  2VZL A;  4Q7J B;  2EQS A;  2DJG C;  3VR5 A;  3S1M H;  1STB A;  1QGY A;  3AFP A;  2VZA A;  5C4J B;  5I9P A;  4PC6 A;  3EVQ A;  4QUC A;  5HXB A;  4K5X A;  4X3S A;  2OBS A;  3LWE A;  3NTH A;  5EPL A;  1ENC A;  1BMF A;  3ZZT A;  3UI2 A;  3JQR A;  3CME B;  4JI4 L;  4BY7 H;  4A3C H;  4UP9 A;  1SNQ A;  2EYM A;  1S5B D;  4UDU C;  2Q6I A;  5JJZ A;  4GKK Q;  2R92 B;  3ERS X;  3L3O C;  4JI6 Q;  2RC6 A;  3G7L A;  4RMF A;  1K9M C;  1S72 B;  2B39 A;  4KD3 A;  2MP1 A;  2WB1 E;  1IW7 C;  4U9U A;  4B43 A;  4P75 A;  5J3B A;  1EQT A;  1QNU A;  1C7Y A;  1E0B A;  3SK5 A;  1IKL A;  2SNS A;  4QVA A;  1S5C D;  3F2B A;  1EIY B;  4NCN A;  2D74 A;  4XOT A;  1AEX A;  3AQQ A;  3PUZ A;  2IX3 A;  1ONL A;  3ZYY X;  1VS0 A;  1Q82 D;  3LWU A;  5D3I B;  4DUZ L;  3RN2 A;  1IKM A;  1WSR A;  3CMA B;  3T53 B;  1KL9 A;  1SEB D;  1T6X A;  1E62 A;  3A3G A;  2WJY A;  2E5L Q;  1GHK A;  1H9J A;  3S14 H;  1X9N A;  4RDK A;  1KDB A;  3OHX C;  4FWT A;  1BBW A;  1BVS A;  2EOT A;  4GN5 A;  4HMJ A;  1PYW D;  2OEO A;  3PSI A;  2N78 A;  1FND A;  1IBL Q;  2N88 A;  4J8Q A;  1IL8 A;  4G7Z C;  1FGU A;  1N33 L;  1JJC B;  1KK1 A;  1SLJ A;  2AHO B;  3H6M A;  2WB1 G;  4FDB A;  4OOX A;  3OEH A;  1VQC A;  1AH9 A;  1YIJ B;  2E2J H;  4OPS A;  2JA7 G;  3RD4 A;  4H02 A;  2XN9 C;  4P26 A;  4DV3 Q;  3E6Z X;  5COR A;  2CC2 A;  1SYB A;  3H0G G;  4TMW A;  1SE3 A;  3L9A X;  1TWF B;  5FO8 B;  4P22 A;  4XT3 B;  4EQP A;  2R6H A;  4LK1 C;  1P8L A;  5IOC A;  3GTJ H;  1PH2 A;  1A6X A;  3Q8D A;  4JMQ A;  3I56 A;  1EIF A;  2EXZ A;  3CCU A;  4C3I G;  1B70 B;  3MFY A;  3PA1 A;  5M5W H;  2PPB C;  4UZF A;  3ZPN A;  1TXY A;  2O2L D;  1I18 A;  3PO2 B;  4K5W A;  1YZ6 A;  3HOV G;  1WP6 A;  4B08 A;  3CQZ B;  3I72 A;  4XOR A;  5C0X I;  2B63 G;  1J6Q A;  2W6I A;  3KLS A;  4IUT A;  4X66 L;  4KD4 A;  3OW2 B;  4B3T Q;  2CF4 A;  3U6K A;  4LFC Q;  5CV9 A;  4NXN L;  1EP3 B;  1PYB A;  4HJ5 A;  1XPU A;  3G71 A;  1U4M A;  2F0J A;  1N36 L;  1GAW A;  3P27 A;  3CRZ A;  2YTV A;  4HAE A;  4CKB A;  4FF4 A;  2HT1 A;  3HAG A;  1PRT B;  1JT8 A;  1P16 A;  4R8N A;  1KIX A;  4IUV A;  1F9Q A;  5IIF A;  1OHH A;  1VQ5 A;  1QOH A;  3OJW A;  4GKJ L;  4X7E A;  2QF7 A;  4DV2 Q;  2GK7 A;  5CGK A;  4YEL A;  2E2I H;  1WTR A;  3NP8 A;  3FKI H;  3U2Q A;  1JOK A;  4ZGQ B;  3GTG H;  1RKN A;  1U5K A;  3OSO A;  1FL0 A;  4RKB A;  5DNF A;  2VS1 A;  3BVZ A;  4II3 A;  4HCE A;  5ELO A;  1JE5 A;  1HUN A;  1EY9 A;  3W1G A;  4DV6 Q;  2EY1 A;  1EFU A;  1HFN A;  3CCQ A;  3KLS X;  4P73 A;  3GTM H;  1ZUN B;  1FYC A;  4IW3 B;  1B3Q A;  4XD7 A;  4YAU A;  2GVB A;  1K83 H;  2CRV A;  3SJP A;  3MHP A;  1L1O C;  3OTO Q;  3A3B A;  3CMM A;  3GTL B;  4XQF A;  4U67 3;  3STB D;  4A3M G;  3J81 c;  2FMM A;  2RSO A;  4A3K G;  1XB2 A;  1K28 A;  5H1S E;  1PFB A;  1XWE A;  3BZC A;  3OAA A;  3E9H A;  5A2Q L;  4B3X A;  1BPL A;  1H9S B;  2NBF A;  1I5F A;  2C5C A;  2OWO A;  4IUN A;  1E3Z A;  2A69 D;  2E75 C;  5GAD C;  3NPP A;  1KD1 D;  3H94 A;  1PTO B;  2PW7 A;  1Z7T A;  3GVJ A;  2K33 A;  3JU4 A;  2WIN B;  3NEN A;  3CCR A;  1TWC H;  1MIU A;  4X05 A;  4PZ6 A;  3OZW A;  4TKO B;  5LMU L;  4HE6 A;  3A8I A;  2A8V A;  3K7A H;  3D6W A;  4PG3 A;  1HUM A;  2BE5 C;  4ZLT F;  4RD4 A;  3WDN A;  1DD2 A;  2WB1 B;  4M0L A;  1U4R A;  1WOR A;  2M00 A;  1GHJ A;  2NUC A;  1HJP A;  2OT2 A;  2ZTE A;  3PO2 H;  3A1P A;  2JA7 B;  1BJK A;  2VYQ A;  1F9R A;  2AMC B;  4K6L A;  2VNH A;  1DOK A;  3CQZ H;  1TWG B;  2B8F A;  1RTO A;  4A3F G;  2PO4 A;  2LZJ A;  1GO2 A;  1PDQ A;  4DUZ Q;  4RFB A;  4HJ7 A;  3S2H B;  3HKS A;  5JEA G;  4WJ3 M;  2EIF A;  3M3Y H;  5LHY 1;  2BA0 A;  1V0E A;  4X7C A;  3SR1 A;  4UP7 A;  4UAJ A;  2F52 A;  3BYT B;  4C3I B;  2O5J C;  3SLN A;  1IB0 A;  4F88 A;  5D3D A;  2BDO A;  5AJ3 L;  2JN9 A;  3HOV B;  4Z4Y A;  1F2Y A;  2F0T A;  3F2C A;  2PE3 A;  2WKD A;  1Y0Y A;  1YJ9 A;  5FL7 A;  2X69 A;  5E1F A;  2I0Q A;  3LGJ A;  3WYA A;  1E1T A;  4FO2 A;  1IBM Q;  1E3X A;  4QIW E;  1FR3 A;  1WTH A;  2ZTD A;  1GUG A;  3MEF A;  2CW0 D;  2EXD A;  1S4M A;  2IHF A;  2ZXP A;  3G48 A;  3L0O A;  2ID0 A;  3B8H A;  2VUM G;  3CB4 A;  1RQR A;  1B8A A;  4B3F X;  4H7B A;  3K5L A;  2B5O A;  3CP0 A;  1VLO A;  4LWC A;  4YWK A;  2A5H A;  5KIX A;  4EQN A;  4X62 L;  1KRH A;  1ZM2 A;  3MAQ A;  3S1Q H;  4F7X A;  2K1B A;  3S15 B;  2K5W A;  1SFO H;  1K28 D;  1SM4 A;  2F4V L;  4LBY A;  1PYS B;  3BU2 A;  4KLK A;  2R6G A;  2OTJ A;  1VQA A;  1KTV A;  4DAY A;  1B9N A;  1TWH H;  1G7C A;  1YNJ C;  5CV5 A;  1BCP B;  3GTO H;  4OWT B;  2I5L X;  4XR6 A;  4BXX H;  2HQL A;  2WJV A;  2Z6K A;  4J6H A;  1ZXT A;  1MBY A;  3I56 B;  3I3C A;  2UUB L;  2B8G A;  3BYY B;  4FP5 D;  4A3G B;  2C4T A;  3I7F A;  4KHP Q;  3UDF A;  4CKE A;  3CCU B;  5C44 G;  3U58 A;  1SXT A;  1N05 A;  4RWS C;  2VNK A;  1DXM A;  1GXD C;  1Z47 A;  2X6L A;  1GJR A;  1A63 A;  1FDR A;  5I6W A;  4DQK A;  1K0R A;  4LF9 Q;  2OK7 A;  3LNN A;  1CQV A;  3M7G A;  4LBZ A;  2XWJ B;  3LQE A;  1HNW L;  2SOB A;  1DJR D;  4A3M B;  4LJZ C;  1XFO A;  2SNM A;  1X3F A;  5FK9 C;  5DEH A;  4I7Z C;  4P9S A;  1AMO A;  4HIK A;  3QG1 A;  2A68 D;  3G71 B;  3RZO H;  3PUW A;  4CDE C;  4YXW A;  4DGZ A;  1V1P B;  1ASY A;  4IJH A;  2JA6 G;  4K1X A;  1XTC D;  5JVG 3;  4HIZ A;  1EY0 A;  4RDJ A;  1VQ5 B;  5JBQ A;  1Y14 B;  4HR7 B;  4R4C A;  4DR5 L;  4DK1 A;  2B2W C;  4DR6 L;  5LL6 S;  1P4M A;  3S1R B;  1VQO A;  3FEW X;  3H0G H;  1A15 A;  2BM1 A;  4OEL B;  2E74 C;  5KRU A;  3GDE A;  2QGG A;  4ZUI A;  3CRK C;  4FXG C;  5C4H A;  4IOC A;  1G6Z A;  2VXW A;  2AQ2 B;  3WNB A;  1K73 C;  1LTG D;  1HZB A;  3JQP A;  1B50 A;  1EY8 A;  4DQL A;  3HOV H;  1WTH D;  2B2Y C;  2N3S A;  1SJE D;  1V5V A;  1XE1 A;  1M90 C;  4BBS B;  5IYD H;  2R9V A;  2F3W A;  4ZCK A;  2B63 H;  2XZL A;  3SHL A;  3CC7 A;  4A3F B;  1EOT A;  4A3I B;  1SE4 A;  4ZKC B;  2RC5 A;  3PCO B;  3J81 i;  3MC0 B;  1VQ8 A;  4M1K A;  1E7Z A;  2BOS A;  1L0W A;  2BMW A;  1SSO A;  2JA9 A;  4DK3 C;  3VO2 A;  5KNB A;  2VB2 X;  4DR2 Q;  4XLA A;  2AUK A;  2UUA L;  2NVT B;  1HQR D;  1CZW A;  1XYI A;  3GO5 A;  3NWS A;  2X0K A;  2X6W A;  1V8Q A;  3EQL C;  4YWL A;  4BY1 H;  4OPO A;  3CC4 A;  4FYD A;  3A8K E;  3CCR B;  1DYQ A;  2K04 A;  1H42 A;  2I5M X;  1SYE A;  4KY5 A;  2VQE Q;  2IX1 A;  2XZP A;  2D0P A;  1SMY C;  2KEN A;  4XQQ A;  2WPD A;  4G7O C;  3AVT A;  2WR8 A;  1MJE A;  3OW7 A;  3Q6R A;  2ZM6 L;  1M1K C;  2LSS A;  2VUM B;  4B47 A;  2R7Z B;  1QIL A;  3W3A A;  1R9T H;  1IBK Q;  5DAU A;  2JEB I;  2PYK A;  1J5E Q;  3QO2 A;  4XLF A;  3F2U A;  1QG7 A;  4LF5 L;  2OQ0 A;  5BN4 A;  1TWA B;  4QGU A;  2B2U A;  2M9V A;  4P6V F;  1PJ5 A;  5CBE E;  3I4N G;  2DEU A;  1CI3 M;  4F87 A;  1I8D A;  1H9R A;  4KTA A;  4UPA A;  4XYO A;  3C2Q A;  1CSQ A;  2EYJ A;  4A3K H;  4Q0F A;  2I07 B;  5IT9 E;  2PLF A;  5H59 A;  1RIP A;  5IYN A;  4C3J G;  1Y1V G;  5C44 B;  3M4O H;  1TT2 A;  2OCE A;  4GNX A;  1PZK D;  1ESF A;  1KRS A;  2Q8R E;  5JVH 3;  4QIW B;  1G7R A;  3QFR A;  3AVW A;  3H15 A;  2E8G A;  4MHE A;  1PXU A;  4X62 Q;  3CW2 C;  1BO0 A;  4K6D A;  4P3Y A;  5DS0 A;  3H91 A;  2PQA A;  4JI2 Q;  2DET A;  5ELE A;  3PMF A;  3S1R H;  4R4I A;  2F4V Q;  4QMG A;  1QUQ A;  1LTI D;  2PIA A;  1HR0 L;  2B2V A;  1PFM A;  1KAB A;  4Z4S A;  3OJX A;  2IJ0 A;  3N6R A;  2CCZ A;  1JOQ A;  2QKI C;  3S9W A;  2JA6 B;  4Z4Z A;  3QJY A;  1E64 A;  3OYY A;  5IYC H;  5CV6 A;  3H09 A;  2UUB Q;  3Q6Q A;  4Z4W A;  2QMU A;  1RD9 D;  4L5Q A;  5FLX E;  1VQP B;  1C0A A;  1X56 A;  4R8I A;  4R71 A;  1R4Q B;  2OTJ B;  4KHZ A;  2ASB A;  5M5Y H;  2WKC A;  3LO8 A;  1G29 1;  4DAY B;  1U2R A;  1WOC A;  3IFD A;  1HNW Q;  5JEA H;  4RHR A;  2MO0 A;  3NUC A;  1IL2 A;  3GVL A;  2VNJ A;  1MD2 D;  2QDX A;  1KAA A;  5DSZ A;  1X6O A;  3J80 L;  3VYR A;  5E4W C;  3ONU A;  2NPF A;  1VQG A;  2LS0 1;  1TVX A;  3OFN A;  3ASP A;  4WZL A;  2EYL A;  3EFX D;  4BBR G;  1YLO A;  3M4P A;  2JP1 A;  1Q81 C;  2XZO A;  2KOL A;  5EJW A;  2ZL6 A;  4DR5 Q;  4A93 H;  1IZ6 A;  4APV A;  3L7Z C;  3ND8 A;  4HN7 A;  2DY7 A;  5THX A;  3C2P A;  1VF7 A;  4GKK L;  1CQX A;  4N3G A;  2JDI A;  1WCM G;  4XDX A;  4XKV A;  1OO9 B;  4QV2 A;  2J4X A;  2JJQ A;  1WTQ A;  1CA5 A;  4JI6 L;  4CKC A;  1Q7Y D;  2DOG A;  3M9B A;  2XOK A;  3BS1 A;  1VQ6 B;  4DR1 L;  3R6J A;  3CMA A;  4A3B G;  2OQK A;  2KCM A;  3I4O A;  1LT3 D;  4FXK C;  5IP9 H;  3M4Q A;  1HNZ Q;  5A88 A;  1ICW A;  4DNI A;  5TR9 A;  4C3H B;  3HOZ G;  3OZU A;  4MNO A;  1NUC A;  4ZAI A;  5IK2 A;  1N9W A;  3T1Y L;  1VQO B;  2N55 A;  1RF2 D;  2K6A A;  2RBM A;  2AHO A;  3ONA B;  4H44 C;  2FVG A;  1EY6 A;  3WOF A;  2VW9 A;  4DK6 C;  1YHQ A;  3I73 A;  1G6P A;  4DKA C;  4C1N K;  3X3M A;  2E5L L;  4JI0 L;  3K59 A;  5C44 H;  3GTK B;  4XQN A;  2ENB A;  2RSN A;  3WOE A;  4X64 Q;  3Q3A A;  1FRN A;  2D62 A;  3ES9 A;  3I4N B;  4ROX A;  5IOD A;  2BH8 A;  5GAG C;  4G7H C;  4B3S Q;  3ZBT A;  1IBL L;  4IO9 A;  3CC7 B;  1TS5 A;  1NJI C;  2CBX A;  1E63 A;  2F1L A;  3D26 A;  4G5G A;  1VQ8 B;  1Z6H A;  2Z6B A;  3TS0 A;  1HNX Q;  4M2L A;  4C3J B;  5EGT A;  1Y1V B;  3ASS A;  1LT6 D;  2ZM6 Q;  1YJW A;  1EY4 A;  3VNV A;  5E3F A;  1OXT A;  2NZO A;  3MFG A;  4JI5 L;  3OW2 A;  3AGP A;  2RDH A;  3KLR A;  2F0M A;  4Z4V A;  4WQM A;  4X7F A;  4XLC A;  1S3O A;  1JB3 A;  1V43 A;  1UE5 A;  1HHV A;  3SEB A;  3A5Z B;  4OWX B;  3KOJ A;  5L37 A;  3GP7 A;  1EYD A;  2Z1C A;  4GS3 A;  2X8K A;  1QFY A;  3K6O A;  2O4X A;  4J15 A;  4C1N I;  5CC4 A;  2GJK A;  1GAQ A;  2Z4I A;  3DM3 A;  2ZTC A;  4QHY A;  2QDB A;  3QIA A;  4LFC L;  1WVL A;  3PGZ A;  1GR1 A;  4OL7 A;  1N07 A;  4EVO A;  1JOO A;  1NMG A;  2MFI A;  3R2T A;  3CCM A;  5GQO A;  1Q86 D;  1EP2 B;  2VB3 X;  4A3L H;  1QCB D;  1U4L A;  1EYA A;  3MCA A;  4PAA A;  2G5D A;  4YHB A;  1CK1 A;  4LBW A;  1UE1 A;  2VL6 A;  3KBG A;  4DV2 L;  2FJ2 A;  2L15 A;  4C56 C;  4PAB A;  2EJM A;  2EJF C;  2V7Q A;  4MYU A;  1ZM9 A;  2ZT9 C;  1HR0 Q;  2C5H A;  3FP9 A;  4O0A A;  5FO9 B;  4BBR B;  4LMQ D;  5BSX A;  1E2W A;  3IRB A;  1NB0 A;  4LFB Q;  2XTI A;  4YCV A;  4P6Y A;  3DWA A;  2NN6 I;  4DV6 L;  2V7X A;  1AE2 A;  1Q1B A;  4PMB A;  2PQA B;  5C3X A;  1N32 Q;  5G3L D;  2HCJ B;  2JYO A;  3F1Z A;  3CD6 B;  2CH4 W;  1D1N A;  1QUQ B;  1WCM B;  2A6E C;  4YAF A;  2JJ2 A;  3J81 k;  5IYW A;  1WJJ A;  3BCF A;  4N9T A;  4IFD I;  3OTO L;  1Q8K A;  4EX5 A;  4GOP C;  4HTH A;  3M7N A;  1UEB A;  4A3B B;  2PMD A;  3V05 A;  4B4D A;  2FMC A;  2H1E A;  3TP5 A;  2JIZ A;  1KNA A;  4YCW A;  3EJI A;  3HOZ B;  3AVU A;  1B2T A;  5JAV A;  4KKU A;  1VHE A;  3E0J A;  4OO1 H;  2AWO A;  4HMI A;  2Z6B D;  5F4O A;  5CV4 A;  1LTS D;  2L4N A;  3D3R A;  3J80 i;  1K9M D;  5IY0 A;  1JE4 A;  3K7U C;  3B6Y A;  1IW7 D;  3MWY W;  4F7D A;  1I50 B;  4ASU A;  4JPB W;  1Y69 U;  1AZQ A;  2X3U A;  2R3Z A;  4C3J H;  1Q12 A;  1TY2 A;  3GTP B;  5LMN Q;  4POF A;  1K8O A;  3PO3 H;  1YBY A;  1FNC A;  4PC1 A;  4DR1 Q;  2BDN A;  2NVQ H;  3PVD A;  1YNX A;  1PRT D;  5ELC A;  4HED A;  3HEJ A;  1EZ8 A;  1NAP A;  1VQF A;  3M85 A;  1ICF B;  4RD1 A;  5FLM G;  2XRS D;  1W0J A;  2HMA A;  5C3E G;  3CES A;  1PH7 A;  1NDH A;  4PNY A;  3J81 E;  1UNS A;  2DER A;  3T1Y Q;  2V7V A;  2VQF L;  1CSP A;  4P1V A;  4DAP A;  5J35 A;  3I4M H;  1A0I A;  1L1O A;  2C2W A;  4GN3 B;  3A74 A;  4Y7N B;  2ZZE A;  2D2C C;  2KCT A;  2AQ3 B;  4JI0 Q;  5IYR A;  3VA7 A;  1VMC A;  1NY4 A;  3S1N H;  4NDX A;  2UUC Q;  2NZH A;  3R2I A;  1E24 A;  2NWG A;  4OHJ A;  1JJG A;  5ELD A;  5ELF A;  4X0C A;  5T1G A;  3FHW A;  1OXU A;  1WOO A;  2L1B A;  1B1Z A;  2JE6 I;  4FK8 A;  5HZB A;  2EDG A;  2F0I A;  4JCV E;  1U4P A;  4Y7C A;  4GOP B;  1YHQ B;  4WJ4 A;  2KEC A;  1IBM L; 
#chains in the Genus database with same CATH homology
 2AQ1 B;  1ILP A;  1FNU A;  1JIC A;  3I4L A;  4XMY A;  1PTO D;  1OB0 A;  1LTT D;  3BZD B;  1C4Q A;  1NCV A;  2WII B;  4RCO A;  4LAA A;  5M9O A;  2E1B A;  4I65 A;  5K36 H;  4KMU C;  1DOM A;  5CR3 A;  3LX0 A;  1LLR D;  2MUY A;  3FRP B;  4XIG S;  4NP5 A;  3URY A;  4IUQ A;  3GD7 A;  3OPO A;  1D1K A;  2F0H A;  2CK3 A;  2IPK D;  2XWB B;  3GTQ B;  2KEE A;  1V1P A;  5IGG A;  1D5Z C;  1C48 A;  1X3P A;  2RA4 A;  2XVS A;  2HDM A;  3K5O A;  2B2T C;  2C9O A;  3MZ5 A;  2JXM B;  1F2M A;  3OWE B;  3P1H A;  2DNE A;  4CJ1 B;  1WTV A;  4GQN A;  3HOW B;  5I2X A;  1JWM D;  2WV6 D;  1LV9 A;  2ZTG A;  2J0T D;  4DFA A;  1AN8 A;  3ZIA A;  5CMD A;  3JAM L;  2R93 B;  3A8J E;  1EY5 A;  1G2T A;  3GVK A;  3TZU A;  3BDO A;  5C3E B;  1S4Z A;  3U9O A;  3ITP A;  5KNC A;  3TDQ A;  5HGT A;  1HTL D;  4XL9 A;  3GV6 A;  1BCP D;  2LY7 A;  1EU4 A;  1SKY B;  5I6Y A;  1NR2 A;  4KN7 C;  4DA2 A;  1WD0 A;  1IYU A;  2B2W A;  1S5F D;  2QEJ C;  5EQ0 A;  1M4V A;  2A69 C;  4HSP A;  3PIO 3;  1ML0 D;  2F0N A;  2BA1 A;  5D65 A;  3A55 A;  3Q23 A;  3SE0 A;  2IL8 A;  5K5P A;  3RZD B;  4K2L A;  1KTK A;  1CHQ D;  2B2Y A;  2CQA A;  4V0B A;  4EGV A;  2F0G A;  4TSF A;  1IHZ A;  3NXW A;  1U9R A;  4X3K A;  5IGB A;  2Z4H A;  4L6T B;  1STA A;  1E2V A;  3RLF A;  3FMC A;  4XM3 A;  3VYS A;  1YNJ D;  5C5M A;  4QCL A;  2NVX B;  2K01 A;  2KED A;  3A7A B;  4ULL A;  1LTA D;  1ZYR C;  1Y1W B;  4QUF A;  2OXP A;  1JR0 D;  5EBD A;  2EY5 A;  4DNR B;  5C5L A;  3P7J A;  2E2H B;  4A3J B;  1QNK A;  1VLY A;  3HOU B;  1PTO H;  2XGJ A;  5EKI A;  2EYF A;  3D6C A;  1TS4 A;  1F9S A;  2L11 A;  4CBV A;  5TSS A;  1AP0 A;  4K14 A;  5IGC A;  2EYH A;  1EY7 A;  3G6J B;  4A3E B;  5C6A A;  3K0Y A;  4TRD A;  4Z1M A;  1D5X C;  5C4X B;  3J7A V;  4FF1 A;  2Y0S B;  1I4G A;  3MXU A;  1HZE A;  5C0X G;  5CDF A;  1CT1 D;  3MXN A;  5NUC A;  2WZP P;  1Q3L A;  2F0D A;  4KN4 C;  4OIK A;  1E1R A;  1J9O A;  4FVM A;  3TP7 A;  5FOB B;  2YU9 B;  4PMW A;  1OXX K;  2SDF A;  1VJS A;  1C8C A;  4ABN A;  4RGO S;  1PKV A;  1SE2 A;  4ILW A;  3HZX A;  5EPJ A;  4G7W A;  2QIL A;  3NBI A;  2Z8L A;  4IN3 A;  1O80 A;  2QCP X;  5KNL A;  1SMY D;  1I3Q B;  4XQJ A;  1H9K A;  3BDL A;  2X6G A;  2KVM A;  1STY A;  4C3H G;  4FF2 A;  3R3O A;  3ND9 A;  5M3F B;  3T13 A;  4AVZ A;  1EEF D;  1TS2 A;  4KY6 A;  4XN3 A;  2F3V A;  1PLF A;  3QOL A;  2A6H C;  4BA1 I;  1WTO A;  3BCD A;  4A3D B;  2K03 A;  1I4X A;  3NWT A;  3RMH A;  3OWF A;  2WAC A;  4F8M A;  2LKV A;  2HLD A;  1ROD A;  2TMP A;  4RGM A;  2V31 A;  1BNZ A;  4KHV A;  4QF4 A;  3HOX B;  1F2Z A;  2NYZ D;  4XXE A;  2J7Z A;  1BUV T;  1FD7 D;  1UEA B;  1YNN D;  2AUJ D;  5J1Z A;  3SDZ A;  4X3U A;  5KYL A;  2I46 A;  2PZW A;  1COW A;  2K05 A;  2JA8 B;  1M8A A;  2ZXO A;  1FGB D;  1NRK A;  3I91 A;  2XND A;  3PUV A;  5COY A;  1D5M C;  4ZQ3 A;  2XRQ D;  2D3L A;  1UAP A;  1EIH A;  3VYT A;  3MTS A;  2GJP A;  3H3V C;  4Z9C B;  3SXH A;  4FXU A;  1KLG D;  5HUR A;  1UD8 A;  1JQY D;  3DEO A;  4QB4 A;  3DWQ A;  4IZ8 A;  3NBH A;  1I4R A;  3BVM A;  1STE A;  2XSC A;  4ID6 A;  1EFI D;  3HS0 C;  4KJO A;  1GUS A;  3V2T A;  4ZKB B;  1TQO A;  4IFD J;  1O7Z A;  3VR6 A;  1SYC A;  1WD1 A;  2MHV A;  3S16 B;  2D9U A;  5I4D A;  1NBM A;  3MXG A;  5CV7 A;  2XIW A;  1S5E D;  3R8B A;  1FNW A;  4XT1 B;  1JWS D;  3K57 A;  3T56 B;  1X3Q A;  3VR2 A;  1G91 A;  5LL6 X;  3QWN A;  1PTO F;  2F0Q A;  5IGF A;  2GK6 A;  2JA5 B;  2F0L A;  5DM6 3;  4OIJ A;  5M3M B;  4C2M B;  2LFN A;  1PZJ D;  1TKW B;  4L8J A;  4UZU A;  1B4O A;  4NKL A;  1DON A;  3S17 B;  3J7A F;  3MEH A;  3I70 A;  1H8H A;  3HRZ C;  3N52 A;  4NNJ A;  2G9H D;  1CTM A;  4ZYS A;  3TP6 A;  5M5X B;  2IWH A;  2EZV A;  3AU7 A;  4ODG A;  1EIG A;  4FNF A;  3W2D A;  1A3T A;  3OMG A;  5KND A;  1W0K A;  4PV1 C;  4AYB B;  3A7L A;  2RQX A;  3S1M B;  5BN5 A;  2ZXR A;  4RKL A;  1MAB A;  1BXT A;  3S1Q B;  4DK0 A;  2EYO A;  3ERQ A;  1FX0 A;  2VJI A;  1T5X D;  2L55 A;  2SEB D;  4BY7 B;  4KV6 A;  5IT9 L;  1HRJ A;  3R93 A;  2KCC A;  5IGE A;  4DN4 M;  4BA2 I;  2EVB A;  2F0E A;  1KDC A;  1G2S A;  2ZZF A;  2GA4 B;  5KYI A;  3U9S A;  5C0X J;  1DZ1 A;  5IGD A;  4V19 0;  3DDY A;  4TT3 A;  1BCP F;  3DEP A;  3CU7 A;  3IKJ A;  1EU3 A;  3OOC A;  1B44 D;  1SNM A;  3PUX A;  2ZZG A;  3S14 B;  1RTN A;  2RKS A;  2PZU A;  5FLX L;  1E1Q A;  1VDZ A;  1L0X B;  2JJ1 A;  3GV3 A;  1KNE A;  4M8A A;  4DXF A;  4XLE A;  5DN6 A;  2E2J B;  3C1E A;  1T5E A;  2KA7 A;  2F0F A;  5J39 A;  3MVV A;  1TS3 A;  3C1F A;  3GTJ B;  5ISR A;  2ZZQ A;  2ICE C;  4JBW A;  3FVQ A;  3WQZ A;  2VJJ A;  3MXP A;  1PMR A;  5M5W B;  5JOB A;  3V96 A;  2F0S A;  4IAL A;  3HGB A;  1TU2 B;  2B2T A;  1J8I A;  3O13 A;  1GUW A;  1I6V C;  2PMZ B;  4DXG A;  4J1M A;  4IQZ A;  4N9P A;  3VR3 A;  2A73 B;  3GQB A;  1MGS A;  3NQI A;  4XON A;  2L9H A;  2HUG A;  2NVY B;  5A2Q E;  1BDO A;  2K28 A;  1SNC A;  2PCF B;  1AW7 A;  5C3W A;  3FPP A;  1KMH A;  4KY7 A;  1Q8I A;  2ZTN A;  2E2I B;  2QE7 A;  3FKI B;  1Q1E A;  3GTG B;  1XXG A;  1WTW A;  4MIU A;  2KQ3 A;  1TY0 A;  1UD6 A;  3GTM B;  4ZUJ A;  1CFM A;  3P20 A;  1DOL A;  1QB5 D;  1ESR A;  1PRT C;  4DAV A;  1DM0 B;  1K83 B;  3M4Y A;  1Y8N B;  4XKW A;  2L5T A;  1EFR A;  2FFK B;  4BWG B;  1UD5 A;  3A35 A;  4XN0 A;  3CKI B;  4K2K A;  2KJX A;  1KZL A;  3TN2 A;  3PIP 3;  3FPU B;  5CV8 A;  3EA6 A;  1ENA A;  3NTK A;  2XNA C;  1TWC B;  4HCS A;  2HDL A;  3A54 A;  1SYF A;  2NTT A;  3KF8 A;  4DF7 A;  1VCI A;  3HP3 A;  3K7A B;  1A3V A;  4IUP A;  3OE7 A;  3HG9 A;  1A2U A;  1EEI D;  5E4X A;  4UAI A;  1PTO C;  5EBC A;  2VNU D;  3KK7 A;  2NZ1 D;  2X6X A;  2X53 S;  4K5V A;  1VF5 C;  1R4P B;  3OEE A;  3MA2 B;  3M3Y B;  3RUZ A;  2JSO A;  3D31 A;  2EE1 A;  2WAQ B;  3KUP A;  5JPM C;  1X32 A;  4GZY C;  4RA8 A;  4WOR A;  2D3N A;  1MSH A;  4RGN A;  3DHQ A;  2ICI A;  1LTB D;  1F2L A;  2CHB D;  3C3L A;  2GJR A;  3BG3 A;  1SNP A;  1I4H A;  3DXJ C;  4JK1 C;  1NSN S;  2OF1 A;  1CM9 A;  1SFO B;  1AZP A;  3NTI A;  5FKA C;  3S2D B;  2BE5 D;  1QWY A;  1TII D;  2PZT A;  3SK8 A;  1TWH B;  2PQE A;  3GTO B;  3FDT A;  2NN6 G;  5FO7 B;  1BOS A;  3J81 L;  3Q24 A;  4TSS A;  1SND A;  4IFD G;  3K5M A;  4OO1 I;  2R61 A;  1RJT A;  1KDA A;  2O5I C;  1W9X A;  1WTX A;  1BBX C;  2ZXH A;  3IFT A;  2F0K A;  1LT4 D;  1CQF A;  1BCP C;  2IX0 A;  4PQX A;  3RZO B;  3OMC A;  4DU9 A;  3OIP A;  3A56 A;  1ENF A;  4FXD A;  2HCI A;  3A8I E;  4XNF A;  4RCN A;  3TME A;  2F0U A;  4CJ0 B;  2F0W A;  1HQM C;  3H0G B;  3Q6S A;  1FNV A;  1GUN A;  1I4Q A;  5EPK A;  3T51 B;  2Q8I B;  1ZEQ X;  1B9M A;  1SBB B;  1EZ6 A;  2JEA I;  3C46 A;  3TP8 A;  1ZYR D;  3VYU A;  3IL8 A;  2B63 B;  1STH A;  3AB9 A;  5I2Y A;  4DNT B;  4KK7 A;  4H13 C;  4RHS A;  2RDF A;  1ILQ A;  5KEE A;  1HA6 A;  5J22 A;  1II3 A;  1GJX A;  4O42 A;  2EPB A;  1UD2 A;  1STN A;  3T4A C;  1V1O A;  2CW0 C;  3HKZ B;  4BY1 B;  2K7V A;  1HVX A;  5KGU A;  2BCO A;  4S3S A;  1B3A A;  3NK9 A;  3Q0A A;  2H4O A;  3NHH A;  1O7Y A;  4E6I A;  1R9T B;  4XTC S;  5EKL A;  4PMC A;  1W6K A;  3ERO A;  4R9W A;  4TQU S;  2MPM A;  1S5D D;  4B9X A;  5JPN C;  4OGQ C;  2TSS A;  3K5N A;  3BDC A;  4A3K B;  1EL0 A;  2KHS A;  1SYD A;  3HOY B;  3Q22 A;  2DN8 A;  4MN3 A;  1HA5 A;  3J80 E;  4IUU A;  3M4O B;  1UUP A;  3X3N A;  5AFW A;  5EKK A;  2A68 C;  2F43 A;  1AFP A;  1DCZ A;  3QB3 A;  3SVM A;  3CP8 A;  4YIJ A;  2KUM A;  1F77 A;  2FIN B;  4WFN 3;  3G05 A;  1ET9 A;  2F0P A;  1HFG A;  3T16 A;  2EYP A;  3CRL C;  1LAB A;  2G9D A;  2A74 C;  4CJ2 C;  2A6H D;  3KEW A;  1LTR D;  2HCC A;  5M5Y B;  2DY8 A;  3DWP A;  3J7Y W;  4ZK9 B;  1EWC A;  4O1N A;  2IT1 A;  4X3T A;  3VR4 A;  1HTP A;  1LAC A;  5HKK A;  4WJW A;  5G3L F;  3K58 A;  4A93 B;  1QE6 A;  1SJH D;  1UD4 A;  3BH4 A;  1CA6 A;  1BQQ T;  4L63 B;  1Q90 A;  2Q8T A;  2CVR A;  1ZKO A;  1D6E C;  2ZXI A;  1GOZ A;  4H0L C;  1CHP D;  3NQT A;  5A35 A;  1K8M A;  3SK6 A;  1VMP A;  3NSW A;  3PUY A;  4OO1 G;  2M5S A;  3OIQ A;  1PFN A;  1CZG A;  4EQO A;  4U68 A;  2RDG A;  2F4I A;  2L12 A;  1SAP A;  2M2L A;  2NN6 H;  4NMZ A;  1OXV A;  2F0O A;  2F03 A;  5F2D A;  4RAU C;  1W6J A;  2KVO A;  1JCK B;  1E2Z A;  1F9P A;  5D14 A;  1E43 A;  4B3G A;  1PRT F;  4IFD H;  2DIE A;  3BVG A;  1YNN C;  1EYC A;  4CGY B;  1GUO A;  4BS9 A;  4ZRZ A;  1H9M A;  2YYZ A;  1QJO A;  3PV0 A;  4KKS A;  3D8G A;  3D4D A;  1A3U A;  1GUT A;  2EJG C;  2NTS A;  2X6Y A;  1STG A;  4HSV A;  3MHB A;  1PZI D;  3TBI B;  2IW3 A;  4Q5V A;  3D4R A;  4RH6 A;  3D4W A;  1SYG A;  2X85 A;  1Y8P B;  4K8J A;  3VA5 A;  1RHP A;  2E76 C;  1LT5 D;  3P75 A;  3TZD A;  2AWN A;  4II2 A;  1EWH A;  2K32 A;  4FF3 A;  5DM7 3;  3FKS A;  1HCZ A;  2WSS A;  3AMU A;  4IUR A;  5JEA J;  3CHB D;  5K36 G;  1H8E A;  2FHT A;  2K5Q A;  4XLH A;  1HXY D;  4P2C B;  4G4K A;  1UD3 A;  3QOJ A;  1JC7 A;  2MGS A;  3TSS A;  4G7X A;  5CBA E;  4XYQ A;  2B2U C;  1WPC A;  3DM1 A;  2F0V A;  4RGT A;  4WRD A;  1O7L A;  1A2T A;  2LMC B;  1BF4 A;  3SK4 A;  3I8Z A;  4NW2 A;  1MSG A;  4G6I A;  4B9W A;  1SNO A;  1Y8O B;  1BLI A;  5C0X H;  1D2B A;  1WTP A;  3DMU A;  1XX8 A;  2V4D A;  1L0Y B;  2DNC A;  5T1I A;  2B2V C;  1EQV A;  1E79 A;  1OXS C;  3PO3 B;  3IAY A;  1SDF A;  2KCN A;  2NVQ B;  5I9O A;  5BN3 A;  4M1U B;  1I4P A;  3NE5 B;  1ET6 A;  2EY2 A;  4K8I A;  2PW5 A;  3I4M B;  4KI0 A;  2HQE A;  2RVL A;  1RDP D;  1LO5 D;  3DUZ A;  1HPC A;  4G57 A;  1MI2 A;  2K5D A;  2A6E D;  3S1N B;  2PNR C;  1V0F A;  4E0F A;  2WP8 J;  5C4Z A;  2MJ8 A;  1IYV A;  2EY6 A;  1JOR A;  3I90 A;  4XOP A;  5CYU A;  3KBX A;  4CHT B;  4KKT A;  1NR4 A;  1B53 A;  1G8Z D;  1I6H B;  5ELB A;  2NB0 A;  1D1I A;  2F1M A;  1KLU D;  2E2D C;  2W6J A;  2KEC A;  2D5D A;  3CP2 A;  4ME5 A;  1H9S A;  1TR5 A;  1JWU D;  4YEJ A;  1BR9 A;  4KJN A;  3BC9 A;  1RCV D;  2L0C A;  3JAM E;  1O78 A;  3VR5 A;  1STB A;  5C4J B;  5I9P A;  3EVQ A;  4QUC A;  4K5X A;  4X3S A;  3UI2 A;  3LWE A;  3NTH A;  5EPL A;  1ENC A;  1BMF A;  1SNQ A;  2EYM A;  1S5B D;  4UDU C;  5JJZ A;  2R92 B;  3L3O C;  3G7L A;  2B39 A;  4KD3 A;  2MP1 A;  1IW7 C;  1EQT A;  1QNU A;  1E0B A;  3SK5 A;  1IKL A;  2SNS A;  1S5C D;  4XOT A;  1AEX A;  3PUZ A;  2IX3 A;  1ONL A;  3ZYY X;  3LWU A;  5D3I B;  1IKM A;  3T53 B;  1SEB D;  3A3G A;  2WJY A;  1GHK A;  1H9J A;  1KDB A;  3OHX C;  4HMJ A;  2EOT A;  1PYW D;  2OEO A;  2N88 A;  4J8Q A;  1IL8 A;  4G7Z C;  3H6M A;  3OEH A;  3RD4 A;  2XN9 C;  3E6Z X;  5COR A;  1SYB A;  1SE3 A;  3L9A X;  1TWF B;  5FO8 B;  4P22 A;  4XT3 B;  4EQP A;  4LK1 C;  5IOC A;  1A6X A;  4JMQ A;  2EXZ A;  4C3I G;  3MFY A;  2PPB C;  3ZPN A;  2O2L D;  1I18 A;  3PO2 B;  4K5W A;  1WP6 A;  4B08 A;  3CQZ B;  3I72 A;  4XOR A;  5C0X I;  2W6I A;  3KLS A;  4IUT A;  4KD4 A;  5CV9 A;  1U4M A;  2F0J A;  4HAE A;  4CKB A;  4FF4 A;  3HAG A;  1PRT B;  4R8N A;  4IUV A;  1F9Q A;  5IIF A;  1OHH A;  1QOH A;  2QF7 A;  2GK7 A;  5CGK A;  4YEL A;  1WTR A;  3NP8 A;  1JOK A;  1RKN A;  3OSO A;  4RKB A;  5DNF A;  3BVZ A;  4II3 A;  4HCE A;  1HUN A;  1EY9 A;  2EY1 A;  1HFN A;  3KLS X;  1FYC A;  4XD7 A;  3A3B A;  3CMM A;  3GTL B;  4XQF A;  4U67 3;  2FMM A;  2RSO A;  1PFB A;  1XWE A;  3OAA A;  5A2Q L;  1BPL A;  1H9S B;  2NBF A;  2C5C A;  4IUN A;  1E3Z A;  2A69 D;  2E75 C;  3NPP A;  3H94 A;  1PTO B;  2PW7 A;  1Z7T A;  3GVJ A;  2K33 A;  3JU4 A;  2WIN B;  4TKO B;  3D6W A;  1HUM A;  2BE5 C;  4ZLT F;  1DD2 A;  3WDN A;  2WB1 B;  1U4R A;  2M00 A;  2NUC A;  1GHJ A;  2OT2 A;  2JA7 B;  4K6L A;  1F9R A;  1DOK A;  1TWG B;  2B8F A;  1RTO A;  2PO4 A;  2LZJ A;  1PDQ A;  3S2H B;  4RFB A;  5JEA G;  5LHY 1;  2BA0 A;  1V0E A;  3SR1 A;  3BYT B;  2O5J C;  4C3I B;  4F88 A;  5D3D A;  2BDO A;  3HOV B;  1F2Y A;  2F0T A;  2WKD A;  5FL7 A;  2X69 A;  5E1F A;  4FO2 A;  1E3X A;  1FR3 A;  1GUG A;  2CW0 D;  2ZXP A;  2ID0 A;  4H7B A;  4B3F X;  3K5L A;  2A5H A;  5KIX A;  4EQN A;  3MAQ A;  4F7X A;  2K1B A;  3S15 B;  2K5W A;  1K28 D;  2R6G A;  4DAY A;  1B9N A;  1YNJ C;  5CV5 A;  1BCP B;  4XR6 A;  2WJV A;  4J6H A;  1ZXT A;  1MBY A;  3I3C A;  2B8G A;  3BYY B;  4FP5 D;  4A3G B;  4CKE A;  1SXT A;  4RWS C;  1GXD C;  1DXM A;  1Z47 A;  2X6L A;  5I6W A;  3LNN A;  1CQV A;  3M7G A;  2XWJ B;  2SOB A;  1DJR D;  4A3M B;  4LJZ C;  2SNM A;  5FK9 C;  5DEH A;  4I7Z C;  3QG1 A;  2A68 D;  3PUW A;  4YXW A;  4DGZ A;  1V1P B;  1XTC D;  5JVG 3;  4HIZ A;  1EY0 A;  4HR7 B;  4DK1 A;  2B2W C;  5LL6 S;  3S1R B;  3FEW X;  1A15 A;  2E74 C;  5KRU A;  4ZUI A;  3CRK C;  4FXG C;  5C4H A;  1G6Z A;  2VXW A;  2AQ2 B;  1LTG D;  1B50 A;  1EY8 A;  1WTH D;  2B2Y C;  1SJE D;  4BBS B;  2R9V A;  2F3W A;  2XZL A;  3SHL A;  4A3F B;  1EOT A;  4A3I B;  1SE4 A;  4ZKC B;  3MC0 B;  2BOS A;  1SSO A;  5KNB A;  2VB2 X;  4XLA A;  2AUK A;  2NVT B;  1HQR D;  1CZW A;  1XYI A;  3GO5 A;  3NWS A;  1V8Q A;  2X6W A;  3EQL C;  4FYD A;  3A8K E;  2K04 A;  1DYQ A;  4KY5 A;  1SYE A;  2IX1 A;  2XZP A;  1SMY C;  4XQQ A;  2WPD A;  4G7O C;  3OW7 A;  2VUM B;  2R7Z B;  1QIL A;  3W3A A;  5DAU A;  2JEB I;  2PYK A;  3QO2 A;  4XLF A;  3F2U A;  1QG7 A;  5BN4 A;  1TWA B;  2B2U A;  2M9V A;  5CBE E;  1CI3 M;  4F87 A;  1I8D A;  1H9R A;  4KTA A;  4XYO A;  2EYJ A;  4Q0F A;  2I07 B;  5IT9 E;  4C3J G;  5C44 B;  1TT2 A;  1PZK D;  1ESF A;  2Q8R E;  5JVH 3;  4QIW B;  4MHE A;  1PXU A;  1BO0 A;  4K6D A;  3H91 A;  5ELE A;  3PMF A;  4QMG A;  1LTI D;  2B2V A;  1PFM A;  1KAB A;  2IJ0 A;  3N6R A;  1JOQ A;  2QKI C;  3S9W A;  2JA6 B;  3QJY A;  5CV6 A;  3H09 A;  1RD9 D;  5FLX E;  4R8I A;  1R4Q B;  4KHZ A;  2WKC A;  1G29 1;  3IFD A;  5JEA H;  4RHR A;  3NUC A;  3GVL A;  1MD2 D;  1KAA A;  3J80 L;  3VYR A;  5E4W C;  2LS0 1;  1TVX A;  3OFN A;  2EYL A;  3EFX D;  2JP1 A;  2XZO A;  2KOL A;  5EJW A;  3L7Z C;  3ND8 A;  4HN7 A;  2DY7 A;  3C2P A;  1VF7 A;  2JDI A;  4XDX A;  4XKV A;  1OO9 B;  2J4X A;  1WTQ A;  1CA5 A;  4CKC A;  2XOK A;  3BS1 A;  1LT3 D;  4FXK C;  1ICW A;  4C3H B;  1NUC A;  4ZAI A;  5IK2 A;  2N55 A;  1RF2 D;  2K6A A;  2RBM A;  3ONA B;  4H44 C;  1EY6 A;  3WOF A;  3I73 A;  4C1N K;  3X3M A;  3K59 A;  3GTK B;  4XQN A;  2ENB A;  2RSN A;  3WOE A;  2D62 A;  3I4N B;  5IOD A;  4G7H C;  1TS5 A;  1Z6H A;  4C3J B;  5EGT A;  1Y1V B;  1LT6 D;  1EY4 A;  5E3F A;  1OXT A;  3MFG A;  2RDH A;  3KLR A;  2F0M A;  4XLC A;  1JB3 A;  1V43 A;  1HHV A;  3SEB A;  3GP7 A;  1EYD A;  2Z1C A;  4C1N I;  2X8K A;  3K6O A;  5CC4 A;  2O4X A;  2GJK A;  2Z4I A;  3QIA A;  2QDB A;  1WVL A;  4OL7 A;  4EVO A;  1JOO A;  3R2T A;  2VB3 X;  1QCB D;  1U4L A;  1EYA A;  1CK1 A;  3KBG A;  2FJ2 A;  4C56 C;  2EJM A;  2EJF C;  2V7Q A;  2ZT9 C;  5FO9 B;  4BBR B;  4LMQ D;  1E2W A;  3DWA A;  2NN6 I;  1Q1B A;  4PMB A;  5C3X A;  5G3L D;  2JYO A;  1WCM B;  2A6E C;  2JJ2 A;  4N9T A;  3BCF A;  4IFD I;  4HTH A;  3M7N A;  4A3B B;  3V05 A;  2FMC A;  2H1E A;  3TP5 A;  2JIZ A;  1KNA A;  3EJI A;  3HOZ B;  1B2T A;  5JAV A;  4KKU A;  3E0J A;  4OO1 H;  2AWO A;  4HMI A;  2Z6B D;  5CV4 A;  1LTS D;  2L4N A;  3D3R A;  1JE4 A;  1IW7 D;  3MWY W;  1I50 B;  4ASU A;  1Y69 U;  1AZQ A;  2R3Z A;  1Q12 A;  1TY2 A;  3GTP B;  1K8O A;  2BDN A;  5ELC A;  1PRT D;  4HED A;  3HEJ A;  1EZ8 A;  1NAP A;  3M85 A;  2XRS D;  1W0J A;  3CES A;  4PNY A;  3J81 E;  1UNS A;  4DAP A;  4Y7N B;  2ZZE A;  2D2C C;  2AQ3 B;  3VA7 A;  1VMC A;  4NDX A;  3R2I A;  2NWG A;  4OHJ A;  5ELD A;  5ELF A;  5T1G A;  1OXU A;  2L1B A;  1B1Z A;  2JE6 I;  2EDG A;  2F0I A;  1U4P A;  3E5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...