2DERA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
364
structure length
348
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 90
structure length 348
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2derA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2derA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2derA01
2B5OA 3ZJVA 3GLVA 2DR2A 2QUIA 1H3EA 2FX3A 1O96A 1PG0A 1JIKA 2OQ2A 3AIIA 3JQRA 2QEXB 1EFUA 1U7DA 3CLTD 1VL2A 1F4LA 2EJCA 1QX4A 3S3TA 3SYTA 4HE5A 1KTVA 3DO8A 4XSVA 4CDNA 3COWA 3JXEA 2BYTA 1WZ2A 4ACAA 1NZJA 3IH5A 3MLBA 1JMVA 3FIUA 3IUBA 3E1YE 3RK1A 4ZT6A 3SDBA 4P2BA 4EG4A 3I55B 1Q77A 3JQPA 2ZP1A 4MW2A 4ZCRA 1QFYA 4CT0A 4HE6A 5TV2A 5FO0A 4QRDA 4YAWA 1O97C 1BJKA 4DE5A 1TVCA 4Q7JB 1GJRA 5IHXA 1OGJA 2O8VA 3CVUA 3LVBA 1YI2B 5HUJA 2D74A 4AF7A 2VTBB 2B7BA 4G5GA 1I6KA 2XNCA 1KH1A 3ZIUA 4KR7A 4YAFA 2NSYA 1N2GA 5EMNA 5HXBA 4RUKA 1N77A 4TMZA 1Q15A 1M8KA 2R6HA 3I1FA 1OWLA 2ZUFA 5GV8A 2YWCA 3G6KA 3KT8A 4DDHA 2H2AA 3X1KA 1T6XA 1KQPA 4MW4A 2A1UB 1K8AD 1FNCA 1XJQA 4QBTA 4B43A 1ZH0A 3IVXA 3FY4A 3CCQB 4E1AA 1M90D 5H16A 3NBAA 1F9AA 1E62A 3IVGA 1WXEA 2QTLA 3IDFA 3CPWB 4L2IB 1E64A 1OBHA 3QFCA 1KQSB 1FFYA 1H3FA 1O94C 1UFVA 1Q11A 1KK1A 1R6UA 2HCJB 3NBKA 4AF6A 1N2BA 3L93A 5H59A 4TMTA 2QUJA 2OV4A 1XNJA 3PNBA 3X1MA 2AZXA 2Z08A 1M83A 4RD4A 2JANA 2PIDA 1IRXA 3G59A 3SP1A 2QUHA 3PXUA 2WQ6A 4Y7CA 2V0GA 2BGIA 1KP3A 3ZGZA 3TZEA 1KRHA 4ZT7A 1JEDA 4NZPA 2J09A 1F7VA 1QU2A 5JBNA 3ZJUA 1GAQA 1PFVA 2IP1A 4YP5A 4F4HA 4LBZA 4NDAA 5FNZA 2PIAA 5TY0A 3FG9A 3Q12A 4NX2A 1QQTA 1FRNA 3MUEA 2VNIA 2G36A 3UOWA 4TMVA 1PFYA 2O5RA 1GTSA 5KSWB 5HUHA 4WSOA 2A7XA 2VTBA 3CW2A 4RD1A 4MVCA 3SZGA 4YMIA 2VNHA 1YIJB 1NUPA 1TFUA 3VGJA 1DG1G 2QJFA 3CCMB 1NJID 2X1MA 1J20A 1MOPA 1IH8A 3CVXA 2BSAA 4FN5A 1VQ4B 2WSIA 2GM3A 1B6TA 2HMAA 4NAHA 1OGIA 3OZUA 1KAMA 1N0UA 1DDIA 2RC6A 2I1LA 1G8HA 2A88A 3CRZA 2A84A 3U2QA 4MUJA 2A1UA 1KC8D 1WXIA 3DV2A 5DK4A 1W35A 1N3LA 1F60A 4RCZA 1VBMA 3FH0A 3INNA 3KT6A 4FZJA 1JIJA 1ZJWA 3FNRA 1IVSA 4NBSA 2BV3A 3MXTA 1EFVA 1P7PA 4L2IA 1N75A 3CLRD 3ZXSA 4EFKA 1KQNA 1OWNA 2AHOA 4U8HA 2QMUA 3WBJA 3QTBA 2BN4A 4N3GA 1S0UA 1QUFA 1H42A 3COYA 3ZZUA 3CLUD 3CB4A 4R2LA 1Q19A 2DY1A 2BF4A 3AG6A 4RD3A 4MWCA 4S1OA 4EH1A 1JGTA 3COVA 2EFGA 2XEXA 2JA2A 4RCYA 3CCSB 1N2EA 3MLAA 1G7SA 1D8TA 1EXDA 4MW9A 2DETA 1EP1B 4LC0A 2D5BA 1ILEA 1H3NA 2QTRA 2GKSA 1F20A 3CVVA 3QE2A 3QFTA 3CR8A 3D6VA 3PRHA 2H29A 4ZT4A 1A8HA 2DERA 1HA3A 1MC1A 2JAXA 4MW6A 4YAOA 1B23P 2QJTA 4MUFA 4JXZA 4ND7A 1W2BB 1XNGA 3CCLB 4I6GA 1GVHA 4G1VA 4UAJA 1N8RD 3UY4A 2VYQA 1KAQA 4KR9A 5TEVA 1N0VC 1QH0A 3H05A 4EGAA 1YUMA 1EXMA 4YAUA 1X8XA 3QSYA 3A4IA 4YALA 2J5BA 2A1TS 1KP2A 3TQIA 1J21A 1UMKA 1IQRA 1YJNB 3VRHA 2J7KA 1PFWA 1G7CA 4YHBA 3HL4A 1KK0A 1U2RA 1NYLA 4MVYA 3LO8A 3WY9A 4JYZA 1N2IA 5J5AA 1WJGA 2QTZA 1ZH6A 3CLSC 3U6KA 3IODA 5DEOA 4LBVA 4AQ7A 3RBAA 3WNDA 2QUKA 3DLAA 3ILVA 4GRIA 5LLTA 1JA0A 3QTTA 3G71B 1K9MD 1WXHA 5KWVA 1S72B 1NSYA 5DASA 1TUIA 2CUZA 1QJCA 1R5BA 1A8PA 2PLFA 1JZSA 3FWKA 1R5NA 3W2GA 3AFHA 2CNDA 4OJMX 1TYCA 2RE8A 3QFSA 1IQUA 3FETA 3ZXIA 3B8HA 4WNYA 2DXIA 2ZUEA 1VQNB 4Y9RA 1VBNA 4EG7A 3CLTC 4ZV4A 2DUMA 1QRSA 4MUNA 1ZUNA 4JXXA 3E20A 1GAWA 1M8GA 1WDTA 4I6JA 2AG6A 4DQLA 1QGZA 1Y42X 1J9ZA 3CD6B 3QFRA 4KPUB 1MRZA 1NURA 3IUEA 4M4SA 5FO1A 2X1LA 1I7PA 1NI5A 3P0JA 3FJOA 2B7LA 1BX0A 2YWBA 2OTJB 2YWGA 5DB4A 3B78A 2RD2A 4K1XA 2A4MA 1O0BA 1WQ4A 4ZGQB 2DLCX 3VO2A 3ISJA 1T9GS 1V8FA 1FNMA 3RK0A 1MB2A 2RC5A 3I56B 2YWFA 2YWEA 1MBZA 3FI0A 4MUGA 4DDMA 2AKEA 3ELBA 2CT8A 3GUZA 4MAFA 1M8FA 1O6BA 4ZCIA 3CCVB 2PXHA 1VBKA 2TS1A 3TQOA 4DLPA 3IOCA 2CYAA 3TZLA 4B44A 1O95D 5THXA 4H3SA 5AHWA 4PC7A 3COZA 5TGTA 5AN9A 4J0QA 3ES9A 3LE8A 3AVTA 3IOBA 1W87A 3VO1A 2QTNA 3DPIA 3CVYA 1G59A 4F7DA 2A1TR 1KH2A 1MJHA 1J1ZA 2CFOA 2EL7A 4FK8A 3WYAA 3W5VA 2BPOA 3OTWA 4MWDA 4Y9UA 1TYBE 1QG0A 3OZVA 1JB9A 4ZCMA 1KK2A 4R71A 3TS1A 1RQGA 4C43A 1FRQA 4MW7A 1Q86D 1GAXA 2DPLA 4K03A 4UZFA 1QFZA 3PENA 4QFMA 2A86A 4R2MA 2PZ8A 1IJEA 1PG2A 1J09A 3K9WA 3ND5A 3W2EA 1DNPA 3UC5A 2WB2A 2BTEA 2DEUA 1JEEA 1U3CA 4MLPA 3SEZA 4ZCQA 3TNJA 1M1KD 3AVWA 2E21A 4MUEA 4AS1A 4C0SA 4HK4A 4NAUA 2QTMA 3K32A 1VQPB 4KPUA 4ND6A 1QVGB 1K73D 1YUNA 4MYUA 1N2JA 3WBKA 1S4MA 4H9GA 1EFPB 4M1KA 1HYBA 4PC2A 5FA6A 4B47A 1EWYA 3G4SB 1EUYA 1YIAA 1COZA 4QHYA 4J76A 3KT3A 1CNEA 1EP2B 2OK8A 4BPRA 1R5OA 1EE1A 3GMIA 4EG3A 1G8FA 2BGJA 3ND7A 5H7XA 3A04A 3Q4GA 1GR1A 1G8GA 4G6ZA 2CRVA 1O5TA 3HFJA 5BNZA 1NP7A 4EG8A 1JIIA 1GZUA 2NZ2A 2GQFA 3IMCA 2X3FA 5JBQA 1E63A 1K97A 4RD0A 2Z3VA 3I05A 1F7UA 3P0IA 3OZWA 4G1BA 3WNCA 2VXOA 2CYCA 1JECA 1KKUA 1WOYA 4MUIA 4DNXA 4K0RA 2ZITA 5TEWA 4DJAA 4MW0A 3VU8A 2IJGX 4XFJA 1GN8A 2D13A 2PG3A 2QN6A 4IW3B 1T9GR 3IMGA 4EG5A 1OD6A 3IMEA 4ZCTA 3VMFA 3CMEB 1SURA 5K0TA 1AIPA 1PFUA 4MUHA 1QTQA 1WKBA 1K4KA 3CLRC 2C5SA 3LOQA 1MB9A 1U0BB 1GTRA 1OBCA 4MYTA 2QJOA 4U9UA 1OB5A 3A05A 5DSZA 1B2RA 3CLUC 4TMXA 3CC4B 1VLHA 4MW1A 3UMVA 1TYAE 2BM1A 1J70A 2CSXA 2CV0A 1O97D 3U1VA 2J4DA 3H9BA 4B4DA 3MCAA 3CA8A 2PZBA 1R6TA 3N05A 2R5WA 2BM0A 2QA4B 1K92A 3OP1A 2J07A 4U7JA 3ZJTA 2OK7A 3AVXA 3C8ZA 4ZCLA 4X0EA 4B48A 4HJRA 3VNUA 1JHDA 4RD2A 4CDMA 3L92A 3KFLA 2CYBA 3M5WA 1T6YA 4P6VF 3JQQA 3J81k 3MMXA 3RFFA 2E0IA 1ZM9A 3CCUB 4RD6A 4ARCA 2CV2A 4CQNA 4N3NA 3U6BA 2YXNA 5TS2A 3RJZA 4PC6A 5IJXA 1SM4A 1NUSA 4MVXA 4PGOA 3N2YA 3F3MA 2D54A 3BL5A 1K4MA 3CCEB 1KH3A 4RPIA 3ZZ0A 4TS1A 1TEZA 1NUQA 1Q82D 1EP3B 4G5YA 1VQMB 1FDRA 1N78A 1D2RA 3HGMA 4JFAA 3AL0C 4PBTA 1MAUA 1IHOA 3ZZTA 1ULHA 1V47A 3VNVA 1VQ9B 1GPMA 4F3RA 1O94D 4KR6A 1QFJA 4NATA 4OUDB 1QVFB 1Q7YD 3ND6A 4EG1A 4EF6A 1KQOA 4I6EA 4Q16A 3A2KA 1XE1A 3HMQA 1T6ZA 1R6XA 4MWBA 4UZEA 1VQ5B 1JZQA 1J1UA 3P27A 1N2OA 3QE4A 1WXFA 4LBYA 3G6EB 3RHSA 1VQKB 2BMWA 1JJ2B 1KJZA 3SJZA 1OWPA 1G7TA 3HZRA 3P52A 1YIDA 4MQ6A 2XRYA 5H5JA 3FHJA 2X3UA 3FPKA 1YITB 5KHAA 3MHPA 1FNBA 5GV7A 1YJ9B 1FYDA 1LI7A 2NPFA 2XRZA 1O0CA 4XFDA 1D1NA 3OJWA 3Q10A 2PFSA 1LI5A 3LCJA 1KR2A 2PMDA 1BQEA 4WQMA 3WXMA 3OJXA 3H9CA 1NDHA 4PC1A 3W5UA 3N8HA 3V76A 1D2EA 1U7XA 1GO2A 5HG0A 1JILA 1YHQB 3FOCA 2DCUA 1JNYA 4A91A 2WQ7A 1KK3A 3CCRB 1EFVB 1X6VA 1VQOB 1BX1A 4YBRA 4DDKA 2CV1A 4KKVA 4PBRA 3AKZA 1I2DA 1EFPA 4YP7A 4J75A 1WXGA 2YY5A 3ZUGA 3KT0A 5LM3A 4HPWA 3AGQA 1ZM2A 1EJ2A 1CNFA 3AG5A 3IVCA 1NUUA 1N2HA 3UK2A 1CT9A 3G5AA 4ZT5A 3ZC3A 4QREA 4TMWA 1OWOA 1FNDA 2HGZA 4MULA 3ZBUA 1W34A 1VQLB 2Z09A 2VNKA 2E1RA 2C78A 1QGYA 3PNVA 1H1TA 1LW7A 2EIXA 1TLLA 2VZLA 3IOEA 3P26A 1I6LA 3CVWA 1VQ7B 3E27A 1KD1D 4OUDA 2OTLB 1MAWA 4R0NA 3B82A 1U3DA 4M0LA 4B3XA 3CCJB 1QU3A 5LFAA 1O95C 4NCNA 4AC9A 1ZM4A 2XNJA 3AVUA 1EFCA 1QUEA 4ZGNB 4MUKA 5KCMA 1O96B 1XB2A 3W2HA 1DARA 4RJLA 4FWTA 4U63A 5F23A 4HJXA 4LBWA 3WNBA 1QNFA 1KORA 4PBSA 2HDNB 4ZCSA 1IB0A 2B7CA 3P0HA 1I6MA 1Q81D 2GOYA 1AMOA 1NUTA 3AVYA 3W2FA 1VQ6B 3SEQA 3CC7B 1M8PA 3X1JA 1N1DA 3CXCB 4EG6A 3N9IA 1YJWB 4M2LA 2PZAA 1QRTA 1DDGA 1CQXA 1SKQA 4TN1A 1TYDE 4GU5A 1IFXA 2HZ7A 4ZT2A 4BWVA 1ZM3A 1OWMA 1ELOA 2J08A 5EKDA 4ACBA 1TQ8A 1WY5A 3AVVA 3D6UA 1H85A 1XNHA 3H99A 1JA1A 1GLNA 2QDXA 3SZ3A 4MVWA 4Q93A 3FDXA 1IJFA 5TR9A 3CMAB 4G5FA 5J59A 3AGPA 4PY2A 1OB2A 1YI8A 2VNJA 4ZT3A 2X0KA 2C77A 1BS2A 2GPJA 1EFTA 4M53A 4MW5A 1EUQA 1M1ZA 3CC2B 2V0CA 1IQ0A 3W5HA 3CLSD 4JZYA 3H97A 1ZUNB 1WQ3A 4MWEA 3HV0A 3OW2B 3PNYA 4ZCPA 1G7RA 5J58A 3MMPA 1M8JA 2BVNA 3W2IA 3NV7A 2IELA 2YWHA 2E18A 4PC3A 1VQ8B 4DQKA 1YULA 1TTTA 4P3YA 2E89A 4ARIA 1QGAA 4YP6A 1QRUA 3ZBTA 5K0SA
chains in the Genus database with same CATH superfamily
3K6KA 2C0PA 3F2VA 3KUFA 2GTPA 5ECDA 2GJ4A 3JXEA 4WNIA 3MJTA 1P4GA 3DB1A 5FORA 2WBLC 2B94A 3DFIA 1BJKA 5IHXA 4P54A 2JM9A 5DMHA 2UYYA 1QCCA 5JCXA 3AEZA 1M8KA 2FNAA 3O1IC 1VZ3A 3UUGA 4QU0A 3CJRA 2Y1LA 5G4LA 4E4YA 1IHXA 3P8HA 3ZCTA 2VYCA 2JLZA 2QAGC 3TU4K 1MO2A 4KN6A 4MAAA 4YDQA 1KYQA 3T8YA 2O8BB 3QF4A 3SP1A 3LUKA 2GK3A 4J8OA 1RJEA 1F2UA 4Z4RA 2A5DA 4NARA 4M7DG 1SZDA 4DQ2A 3ASQA 2GTHA 1JPNA 3NT2A 1GRCA 1S2OA 2WSIA 1L7PA 3QMMA 4B40A 2LDMA 3BILA 2DH6A 1T5IA 4RDJA 4LY6A 2PWYA 1BO6A 3BDAA 5LJ3h 1I7QB 16PKA 1PR5A 2JA2A 3WKBA 1OH7A 4XLZA 5FR1A 4DLBA 4OCZA 4WESB 1HA3A 3GIBA 1W2BB 1LH0A 4MQUA 3K9HA 4IDHA 4BN5A 3MTIA 3I9QA 4FR5A 4G1EB 3MWLA 1EYZA 4PICA 4AICA 1MH1A 1YJNB 4HPJB 4XA8A 1YJ9Q 3C94A 4K9QA 3HA7A 4XKWA 4JB2A 2EC5A 5EY5B 2AFHE 1NQWA 2PWBA 4IIUA 4LXUA 4TZKA 4GRIA 1Q0PA 1KFKB 3C1UA 1UXIA 5EWLA 3R0ZA 4BTEA 3EBOA 5K6AA 5CTJA 1GQFA 3OT5A 1DJ7B 3E20A 3E8SA 4UTOA 1MMAA 1CULC 1T24A 3A4NA 5AJHA 4LNUA 3M4YA 5TX7A 1T9GS 1V8FA 1KVUA 4ZGEB 2WWXA 4CLDA 1T36B 5AUOB 2UVPB 1Q6YA 2EKPA 1J25A 1CUFA 1KEZA 4ZOLA 1IZ0A 1KH2A 1S9HA 2C7OA 1NOKA 5BWMA 4RESA 3TS1A 1MOZA 1MFPA 2H8KA 3VR3A 2AZMA 1YS2X 3SLRA 5CH3A 1U3CA 3ENZA 3GLXA 4IIOA 4AKHA 4AN1A 1KZ7B 3AF0A 5JNTA 2JGDA 3VV3A 2IU0A 4R2WA 2HR1A 3UHFA 4JZ4A 1O1YA 4K9MA 3HBNA 3MYRA 2JASA 3N2GA 3R4CA 3ZTYA 1GLGA 1CJVC 2QS9A 1XBTA 3CUVA 2TSYB 1XLTA 3EDYA 1V76A 2WPNA 5CNMA 1ORTA 3PXXA 1KAGA 3SOZA 1E0SA 1AKYA 1J2EA 1F9EA 1ACLA 4BE1A 5CJPA 3M4XA 1N8RU 2WG0A 2YXYA 5L8VA 1BA2A 3HCPA 5HUQA 4BV3A 4KQJA 2AMJA 3HI6A 4X92A 1VGRA 1EB8A 5DNDA 5J2UF 2X5KO 1FDTA 5BUQA 3SAJA 3NHYA 3IVRA 4XYMA 2AIRA 1XU9A 2XB2A 1OIXA 5EUBA 2XOKA 1ZITA 4BNXA 2CK3D 4KNYA 2GEBA 1QORA 3I55T 2XRFA 1DWUA 1JDVA 2LW7A 1YI2T 2HSEB 4HPWA 1V37A 1WRBA 1XFOA 1GNRA 3VR2A 1TI7A 4BIMA 2OWDA 5FP0A 3TEJA 4ZZ3A 3OIWA 2XD9A 3BWMA 1G8PA 1TCUA 3CVWA 2C1XA 4HSEA 1EDEA 4N3AA 4PF1A 4D80A 4R8RA 3GJ7A 2GJPA 2VZ0A 3H2ZA 2ORYA 1XTZA 2RH5A 3BIJA 4KJZA 4G41A 4ARBA 1KEEB 4S05A 2DPYA 5KJEA 2KSQA 2IHUA 4XIYA 1CUUA 1H9BA 2WG1A 3C7TA 3Q38A 4CPDA 1NB9A 1LK0A 4PLCA 2HH9A 2A08A 4M77C 3AGPA 1EXVA 2ZTNA 5DHPA 3MUOA 4E3ZA 1QGOA 1L5KA 1U5SA 4FCTA 4CUJA 5KEIA 2C29D 2JS2A 2V74B 3T9AA 2ZJ5A 3HJBA 1KJJA 3FCSB 1O2DA 4ACAA 3NDBB 2DZDA 4WA7A 3TQRA 4E70A 2FLKA 4FI3C 2HDWA 4DIOA 3ZU5A 3HWX1 4EDFA 4M1ZA 1PK9A 3LVBA 1Z4KA 1ZD4A 3ROFA 3DW3X 5EMNA 1KS2A 1PCXA 4BLRA 1WORA 4O63O 1U81A 1ZH0A 2BFBB 2JG3A 3A6EA 4N03A 3ECCA 1OYWA 1Q11A 3FOEC 1A4IA 4C0WA 1WZOA 3ANXA 1EB9A 2EJFA 1X43A 3AT1B 4V1CI 3T99A 1F8FA 1YMVA 3VJPA 2BEWB 3UOWA 2VBCA 4JXJA 4U2CA 3CNBA 1MENA 4RW0A 4HLDA 1OB0A 1GGJA 1JTEA 5DW3A 3LDUA 2R11A 4RHXA 821PA 1MD9A 5IHNA 3LZDA 5LP6C 3IEIA 3T4EA 4AP6A 4OMMA 5B12A 3I4LA 3NI2A 1L7EA 5E2IA 4A8JB 1FVFA 2GHRA 2VZ8A 4KULA 1SCUB 3A6GA 2FG0A 4TZTA 1AQJA 1GADO 2DR3A 5I9IA 4DQDA 2UYHA 4RH3A 3CF6R 5EIEA 5GANf 3ZVMA 5JPCA 4EVIA 2XQIA 1J21A 5I5EA 4OOFA 4QLAA 1ZD1A 3ZE1B 3CPSA 3GN2A 4C8QF 3BIXA 3U6KA 5D7BA 5KSOA 1K9MD 1K5DA 1RQXA 3V8JA 1GAEO 1P9NA 1TDJA 3HU5A 3S3MA 1U2ZA 4RLSA 2AT1A 3VVCA 1MAHA 4QNMA 4AG3A 2ZR9A 4XR6A 3TKYA 4FYYB 1X94A 4X54A 5ENVA 4AT1B 1RWKA 4BBZA 1N0IA 4P53A 1GV1A 1XZIA 3S81A 1JPUA 1ZKDA 1RRMA 4GMGA 2XTNA 1X69A 3WK4A 1E3IA 3RAFC 3U7QB 3CSDA 5EZQA 1LS1A 4PJOD 2OXEA 5K2OA 1LBHA 5CB0A 2O2YA 3S5UA 2NZWA 1HDRA 4PLVA 4R9RA 1VQPB 3BX1A 2LCSA 4BUCA 5KWIA 4X7FA 3W9SA 4L85A 1S4QA 2RGEA 4GYWA 3K0EA 4NJEB 3GFTA 1NEGA 4PPYA 2GD0A 2UV8A 5FOTA 1IG3A 4O4HA 4X71A 1EZ1A 1Y1KE 4RD0A 2R8OA 2TRSB 2ZRGA 3INTA 3SWWA 3GF4A 4A63B 1ONOA 1QIIA 3NE5B 2B2XA 2N75A 1UHFA 3B6IA 2XKJE 2E4VA 5I9LA 2ATCA 2XRMA 1K73R 3ZI7A 3WXMB 2PZBA 2QN1A 1Z26A 1BGWA 3NVMB 3E19A 1WW8A 1P7ZA 2VXBA 2GUWA 3Q2OA 2W8BB 5JNRA 1XD2A 3AHHA 1OGYA 1T4CB 1XJWB 3JPYA 4F3RA 1QFJA 1A7UA 1X9HA 4JU8A 1TQHA 4Q16A 1B26A 3EAGA 3AEQA 1X14A 3USCS 1TEVA 2GNAA 4IYJA 1T8WA 4RKWA 1ZIOA 2Z56A 4KQFA 4B3TB 4F12A 3QYHB 1OVMA 3M8KA 1E1YA 2LGJA 5IDQA 3WWEA 2FVGA 1XLVA 2JJ9A 4CIXA 2BZ8A 1R18A 2EYQA 3ADOA 1BLIA 2G1KA 3HUDA 1WL8A 3TRJA 3R6OA 2M6RA 4RKEA 4P0QB 4QC2A 3W05A 2AFIA 1BXRA 2H1FA 4IG9A 3ZBQA 1E7YA 4DJ5X 2I6UA 2PZMA 1W4BA 1H8HA 5BSTA 2GBLA 4KN8A 3AB8A 2ZSKA 3FWPA 4MR9A 1XDWA 5F23A 2HDNB 4R41A 5I8PA 1Q1AA 3AVYA 2QMYA 3A26A 1U2GA 3A3PA 2F4NA 1C1HA 3KOXA 2XZOA 3M0QA 2ZWVA 3CLVA 4HXYA 4AP9A 4YACA 1EUCB 4GLOA 1R8OB 4Q01A 1ZSZC 1ABEA 4CF4A 2YICA 3PWKA 5CAEA 1AGPA 3SKXA 3W8FA 2YFKA 1VQ5Q 2A30A 1QAMA 2QEXB 4ZDJA 4HVUA 4L6IA 5I7HA 5IANA 4ZOLF 3NOXA 1EZ4A 3B12A 1V0EA 4ISCA 4GBMA 4A6XA 2NZ8A 4RAQA 2XZDA 1NVKA 1OZAA 2Q21A 3PKIA 2VDQB 2V7PA 2OV6A 4Q4HA 3T5GA 4GRAA 5JRDS 2BD0A 1YWPA 3KTOA 1TKAA 4FWBA 2FO0A 4BP1A 2HPHA 3DOUA 1JLSA 1GM5A 1IRXA 2C0IA 4IQ8A 3TSOA 3VYTB 4D9NA 2O8NA 1UM8A 5DFAA 1V5WA 3Q8WA 2QL5A 4ESEA 4JSRA 4C5AA 4JT9A 5KOHB 5JZMA 5DHQA 3IP3A 4KO1S 5KYVA 5CW2A 4JR1A 2CZ6B 5G0SA 2BJVA 2M6SA 4I5GA 1ENZA 5IYWA 2L19A 4FGZA 3G9ZA 2AMVA 2IXTA 5I9BA 4M7OA 4CLEA 3W5CA 1O9SA 3T3GA 1P1JA 1K4YA 4LTMA 4N5NA 1EBFA 1EP1B 1HNZB 2G5GX 4P7KA 1VLOA 4NJMB 3ZDXB 3F5SA 3HRUA 2VQFB 2ZAGA 1UM9B 2J9FB 2WWRA 2B1IA 1Q22A 5EE1A 1GCIA 2NUZA 1VQ6T 4HDKB 3CZCA 2TMYA 2AFHB 3V7RA 1BTOA 3NYRA 1AN9A 5IMSA 3VSCA 4CU5A 4DOWA 3UC9A 8OHMA 3DZDA 5AM0A 1Y57A 1FU8A 3QVGA 1JKIA 3HMKA 3SYKA 1J9ZA 3CD6B 4ECAA 4TL7A 3UGKA 5A88A 5FFMA 1OI1A 4IEFB 2NTVA 2VP6A 4J9BA 1JSCA 2R4TA 2VLBA 4NULA 4Q03A 3EXG2 1FF9A 4HR7A 3ZKAA 1DS6A 4X1YA 2WF8A 4BZWA 3CW9A 1IBLB 2R7NA 4FUTA 4DCUA 1RKUA 3H7IA 3EXHB 3QVSA 1GV0A 3QPAA 2E6UX 1Z18A 1U0GA 1WV0A 4S24A 1QFZA 3IAXA 1RUWA 1ZQ9A 3EIEA 1T1GA 1M2VB 3I5UA 3RT7A 4QATA 3K8ZA 4DVGA 4PZ0A 2EQKA 3NTRA 1SOUA 2VRWA 4AO7A 1CNEA 3RSQA 4FP9A 3OYIA 2CRVA 4FD2A 5C1DA 4PPQA 2VBGA 1BWPA 3IMCA 1FP4A 3H1EA 2XCOA 1KC8U 1IATA 1NBIA 4K0RA 2QGFA 2RAPA 2X9GA 4KQIA 2Q7DA 3UW3A 3IIIA 3QPWA 1P81A 3KQWA 4H1HA 3CLUC 4TMXA 4LCJA 2CJWA 3SF8A 1PL7A 4F3YA 3SEFA 4G0YA 1VPLA 5IAYA 1KI1A 4QUDA 3D6HA 5B55A 2I1QA 4DC0A 1US8B 3DF7A 5BURA 4DARA 3N2YA 5AXBA 4EY4A 1TB4A 1KRWA 5EGSA 1N6HA 2PGXA 4OFWA 4AZTA 3F3SA 2C7RA 4JVSB 3L2OB 4C6TA 3RS7A 2ZCUA 3LXUX 2C2KA 1DCFA 5FYDA 5T3YA 2JFBA 3FYHA 2AI3A 4ENTA 2Y0DA 4WFKA 1MGOA 4CMBA 2CD9A 1J0BA 2DO3A 3II6X 2J3LA 3IDAA 2F9FA 1XLUA 3ER6A 2PM8A 3KD3A 3JQ6A 2V1XA 1M2FA 1ZUIA 1Q7YC 2FYKA 4DWVA 2AN1A 3AU9A 3HJCA 1T0JB 5TJ9A 2WHPB 3VS3A 3V8BA 4JYAB 3C3AA 1JI3A 4Z7QB 4N0EA 1VQ5A 1FWZA 4CQLA 1CZOA 1Z0FA 4MUKA 2VJDA 3ETLA 1HLGA 4Q9KA 4B4WA 4J0CA 3MRSA 1VQ6B 2X22A 5ED4A 4C8QC 2XT6A 1H8KA 4NIMA 5KSPA 4XQ3A 3RKYA 2CMGA 2Q6OA 3EGVA 3DZFA 5EZYF 2X9VA 5JZ9A 4EJMA 1BOOA 2PBFA 2WYRA 4YLGA 2CE2X 5JR3A 3EHRA 4RKFA 3NTLA 4Z8AA 2RKWA 2RGNA 1DGQA 1X86B 3B5IA 2C7GA 4P08A 2W6MA 3KYDA 3WMXA 1I2BA 2ZXIA 2CHFA 5AK3A 4CT0A 3EA0A 5A03A 1H2YA 2P4EA 2IYWA 4J49A 4XZ3A 4Z9BA 3QBYA 4LDYA 3G2MA 4OVKA 5AW7A 2AOTB 4QE3A 3QKJA 4M9SA 3GEIA 2DLPA 4I2VA 1M75A 2WHEA 1HURA 1UBLS 2ZYUX 3VGPA 3NALA 2L5QA 4O4HF 5EMJA 4Z2AA 1BCRB 5IJAA 1U8EA 5HCKA 2AOVA 1KARA 3BMNA 4FQ7A 3OQMA 5BPHA 1YV9A 4MV5A 1FDWA 4KXFB 3CXRA 1QXSA 3HUUA 3QPBA 2PDAA 5AESA 2GXAA 4AVZA 2VZEA 4HBZA 5CDHA 3JU3A 1ODTC 3FCEA 2Q5JA 1DLJA 4EA6A 1HNWB 4M98A 5DRTA 1Y98A 4FVTA 4HNHA 3UH0A 2BF4A 5IS2A 3WGNA 1B1CA 4BFTA 4TROA 1TAUA 1MFZA 3BFJA 1GFCA 5L51A 4KX5A 4LZJA 2XE4A 2VYQA 5CIQA 4YCAA 3B6JA 4TX1A 3U48A 4UE3S 4G24A 1O4WA 3KHUA 4QPDA 3LCUA 4UHEA 1NMZA 2OXFA 4HNSA 3UHAA 1QIEA 4OPOA 4LECA 2FJUA 2QLMA 2DKFA 1U9ZA 3F5DA 1XQYA 2ZJ1A 4CMKA 3MWEB 2SRCA 1M1NB 4EUFA 2B8TA 3H2HA 3U4QA 2W8ZA 1OH6A 1TCCA 1C81A 2GKGA 1J56A 2YWGA 2QMZA 2R1VA 2A4MA 2KHZA 3LLMA 3QE3A 4MUGA 1V6AA 2WWHA 4MJ3A 2O5EA 5ECAA 5JSFA 4A53A 1KWKA 4IFTA 5LJLA 4E5VA 3KDPA 3IPYA 2C96A 2X5JO 4OHVA 2WF5A 4XDYA 2V5UA 1AJEA 1P1KA 4DR3B 4AKGA 2YUTA 5K6AC 4PINA 1IRIA 1AZLA 4EI2A 2HZYA 5JFTA 4OB2B 3THXA 3LQFA 1LLQA 3BY1A 3TNJA 3X24B 5GMKh 1KZ6A 2VHCA 3NPMA 2VJNA 3UJAA 3U3XA 3VKUA 3IPCA 5BMOA 4EYQA 3IBFA 3ASZA 1Y9JA 2H11A 2FH5B 1NJIU 3NS7A 4GKJB 3E3AA 3OUTA 2VP3A 3SVLA 2AG0A 4R1TA 2XGOA 1JSRA 3ZWWA 4CTOA 1I2ZA 2WJ3A 1C3OA 4XLAA 4IVRA 1Z6GA 5F76A 4U4AA 2FQXA 1LF5A 4WZAB 2DNUA 2DB3A 5BO5A 2WIFA 2VPQA 2Q07A 3FYTA 3AUXA 4XVHA 3HM9A 2GLXA 2A1IA 1P29A 3GJ6A 1UBTS 1N6PA 3ZHCA 2FGKA 4PN7A 3VC7A 3FGPA 5ALXA 4U2EA 1XLTC 4TTQA 4HVLA 2OHVA 2GBPA 3JYPA 5GAMh 1W2HA 9ATCB 1CVRA 3QVOA 1IG0A 1QE3A 2NPFA 2YCBA 4HB0A 2VK4A 2PFGA 3REGA 3D59A 3OJXA 2IOYA 4B4KA 1IK6A 1U1EA 1JX6A 4QBGB 1SULA 2EKHA 4MQ4A 4HRVA 1DDOA 2KRSA 2WR8A 2D1RA 3CHYA 5LJ3d 1XTTA 3KSBC 5CG1A 2HGZA 1SKAA 1Z7BA 1Y96A 4RO0A 1JEJA 4QL3A 1UD4A 5BQFA 2NO0A 1MNAA 4LRQA 4H0FA 1UZAA 3EIWA 5L23A 1XRQA 2DBKA 1YJNQ 3A3BA 2ZJ0A 3KPUA 3QLJA 2O52A 1RLQC 3R09A 1JA1A 4NNJA 3GAZA 4K9NA 4X91A 1XQBA 1LFAA 1RAAA 4NEHB 4DNTB 1KSGA 1XCLA 4MYCA 2DXUA 1V71A 1K8XB 4RKYA 4ZCPA 1Q3TA 3UV6A 5L3QA 4GL4A 1U1TA 4IIJB 3K8OE 4YJDA 1JVBA 3R6KA 4RSGA 2C9MA 4N39A 3OFNA 2EQBA 3GRFA 3H5AA 3JQRA 4KWEA 3CEHA 3LCCA 5E4FA 2FW8A 5HQ3B 4MGHA 1G6OA 1AGNA 2C9CA 3SE7A 4UNPA 5AVQA 3JCMh 3NYWA 4P3IA 3RAPR 2K3YA 2ZWPA 2BAGA 4C04A 4MVJA 2GA8A 1JG4A 4IUDS 3VU9B 4IGKA 3S2GA 1FRFS 5DCYA 8ADHA 3GRUA 5BN3B 1VJ0A 4YMLA 3DLMA 1KIFA 5DJ5A 3WLRA 4HTAA 4PIMA 3KIPA 4QOJA 1KK1A 3DKRA 3PC7A 2EIHA 2HYIC 1NSFA 2PTKA 4Y7CA 4TUYA 1EK6A 1XJ0A 1KS9A 3U7JA 3FPJA 2FSFA 2D3WA 1E4EA 4YMTA 2XVXA 5KSWB 2G0NA 2GYWA 4RF5A 3VR4H 4MQMA 1MQ8B 1VECA 1XZKA 3P96A 1VQ4B 4M1SA 4RU1A 3MO8A 2E5KA 3GJXC 3MJHA 5DYNA 1BKDR 3T53B 4RDKA 1KZ9A 1F60A 3PA6A 5JDCA 3DDUA 4U8HA 4EB0A 4MS4B 3ZK7A 1E0KA 2W5UA 4UMEA 4K8OA 4MWCA 3UWMA 2EXXA 4K5QA 1XO1A 4JROA 3SHFA 2FRYA 3QENA 5FKJA 1WV1A 4YAOA 2K4MA 4OB1B 4GGMX 3W77A 2A0WA 5AVVA 1XA3A 5GANd 1FX0B 4ZQCB 2C3OA 4II7A 2QD3A 3A4VA 1N1EA 4GI2A 4DLZA 3WHKA 4NDZA 4G8DA 1IQRA 1FBNA 1KDPA 4L5JA 2Z5FA 3PRKE 2J7KA 5AXAA 2C2HA 2PANA 3C4VA 1NBHA 2B9EA 1I3CA 1IXKA 1WHLA 4NPAA 3D5QA 1LJOA 4O1HA 1CP3A 2JFXA 4DDTA 2COKA 4L76A 3MELA 3QOFA 3RKSA 5JBIA 3U23A 3MRTA 4P3XA 2IYOA 4YI3A 3ZDEA 4LJYA 3OZBA 1MC4A 3NX4A 4GNRA 2ZB2A 3ZS8A 1I32A 4B83A 5E0OA 1I33A 3NDIA 1JAXA 1WIWA 1LCKA 5CT8A 4XGRA 4FYXB 2XB6A 1SHFA 3VO1A 5KDDA 1M90C 4WZBE 4HN4B 2C5AA 3H86A 3QA3E 1H4VB 2FXIA 2VPWA 2LX7A 4YJ3B 1Q44A 3EB9A 1K8YB 3SFMA 1G17A 2NVOA 4LEIA 5CIUA 1ZN2A 2E4AA 5JWHA 3DDCA 3E9YA 5HIMA 4AN0A 5JLAA 1IHPA 3HO6A 2QQSA 3NXSA 3WJAA 1MEEA 1WKCA 4EJ2A 4ZICA 3WGLA 1XTDA 3BCUA 2BMEA 1RLTA 4KBFA 4QOGA 1UBSB 5GAOm 1X1DA 2V8BA 2VWPA 4JBLA 4FC6A 3CCMT 2QOEA 4QGGA 5E9JA 3PFGA 5EP3A 1GYRA 2EW2A 2CSXA 4YTEA 4X85A 2CP5A 4V0QA 5SZJA 1J33A 3WQHA 4X66B 3TF5A 1VSUA 4WASA 2G0TA 5AQEA 3REQA 3HNOA 2OGUA 2VB6A 1RXIA 2HLDD 4HLNA 4RD6A 5F52A 4JC5A 3PDCA 2JFQA 2JT4A 3S8YA 4RCBA 3M82A 4IHAA 3T35A 2I6QA 5KCZA 3T9EA 3CMMA 1L1QA 4XD7A 3TL6A 1A7JA 1SQ0A 2BMWA 3NDRA 5C5IA 4MQ6A 4ENPA 1CJMA 4TRRA 4RPGA 1Q0ZA 2FUKA 4R1QA 4HNVA 1KAOA 4D8XA 2NU7B 2CSQA 1YHQB 1ZJ5A 4OHXA 5ERYA 1SIWA 4GR4A 1J5PA 1R15A 3WOHA 3ASKA 5IHIA 3SJCA 4IFEA 1JLLB 2MWMA 4MIYA 4GG1A 3VNQA 4ZI5A 4ZVSA 5EMLA 5IHPA 2NQTA 3PXCX 1ECCA 3BG5A 1EJBA 2X15A 1UJMA 4RTRA 1XOVA 3LUHA 1EHYA 4WXPA 1EE9A 3OJCA 4NV0A 2XNJA 2Q7XA 1T0UA 1P2TA 4MX8A 2QZPA 4MDHA 1IBRA 1N3BA 2HRQA 1RFLA 1QV9A 4A0QA 1RMYA 1NVEA 4JJAA 3GQVA 4JKIA 3DEJA 4OQ4A 1CR1A 1UJ5A 4CEHA 2CL7X 3PNQA 1OQKA 3REFA 4R6WA 2GFQA 3KJIA 1HTWA 1CUYA 1Z28A 1L4LA 1IEXA 2QQAA 5J3OA 3UH1A 2I8AA 1G1MA 3PC6A 5JSZB 2D9RA 3UKDA 4CKWA 2GBLC 5GY7A 1E1RD 2WD8A 4PG7A 4CV0A 1FE8A 1IN7A 2IYRA 3M4ZA 1U2GC 1UADA 3K2EA 3EWIA 4AKSA 3EIOA 1LZLA 2R85A 5F4BA 1O94A 4KE6A 3IULA 2OOSA 3H5RA 3DVAB 4YRPA 1PKVA 2JFNA 3IUYA 4AF7A 4JB8A 1SUWA 3P2OA 3PFKA 3M54A 1U65A 1OYYA 1T4BA 3PQEA 2CL5A 2ZUFA 1RACB 2Q8NA 2WICA 3R3YA 5GJWC 3OFJA 3K9GA 4B82A 4ZV7A 5KQLA 3BGOS 2O14A 2ZVDA 3M6LA 1SPXA 4QTUB 4HEA1 2CH4W 4BAUA 2QF7A 5A5FA 4JP3A 4E12A 2FPRA 3H42B 4RMOA 4U6NA 3S2IA 4TMVA 1XTKA 2GF0A 2DL5A 3CCMB 2NO1A 4IWNA 5JRJA 1XZNA 1YJAA 2XKAA 1NVDA 4JHLA 3DEFA 1N75A 3E23A 2YDLA 3COYA 4H4DA 1RFGE 3L02A 1Z6YA 4NBNA 1TS9A 3GHHA 3ZDFA 2XMGA 2GKSA 1QH1B 4MGYR 1WCIA 4BV8A 1AK9A 2E1BA 4UAJA 2ATEA 4IP0A 1O8BA 3HRHA 4HEA6 4JJ7A 5K8JB 2QLFA 2AJLI 1KEEA 3PDIB 1TUGA 3GZTB 4NMHA 1QK3A 2C8KA 2DFDA 1KDZA 1FFXA 3V00A 5EWMA 1OIVA 1DSSG 5F2KA 5T3UA 4NY1A 2BBSA 2O3QA 1L8AA 1VCMA 1M0TA 4CVNA 5H80A 1DO0A 2F67A 3M1LA 1NW4A 3AF4A 2ORIA 5JXIA 4JJEA 4C5CA 1R37A 2H7VA 3BD7A 1MF7A 5K7SA 1YIJQ 5HGJA 3OCJA 4FFBA 2RJ3A 2PBZA 3KYJB 5BYBA 3A31A 3ASTA 3C4QA 4W8OA 2PMKA 3AF6A 3QZUA 2I54A 1O89A 2WHXA 2VYTA 3TZBA 1C50A 3DDOA 3FNGA 1FTQA 1D1CA 1D7OA 4C43A 1V3TA 5FEUA 4M0DA 1CJCA 4HWRA 3P5SA 7REQA 3LWNA 3OFSA 3QM1A 1SUCA 3RVKA 3NW9A 2X86A 4A4GA 3GT4A 3N87A 2OXTA 2ZT5A 3ENQA 3RBBB 2G4VA 3TTVA 3IAEA 1Z5NA 4CETA 5CK5A 4G5HA 3RVDA 4QTXA 1I24A 3BDUA 2HL3A 2ZUUA 4DSNA 5JBQA 2AEJA 4LZPA 4NZZA 4C5HA 4MVJF 4DJTA 2QN6A 2BEWA 1TUCA 1U6JA 3RJMA 4D82A 1VHDA 1P3Y1 1JR3A 2HF8A 4EHAA 5HY6A 3RIMA 1Y7PA 4Z4CA 5IP5A 3RY8A 2MOXA 1CUEA 4CM1A 4WF2A 1VIEA 3DAFA 4NZYA 1JDNA 1JIUA 2UKDA 2AEMA 4TUYF 3OYGA 5CU7A 1W4ZA 1LS6A 4NICA 4X8IA 4NZ9A 2B8NA 3BWXA 4N76A 3HXLA 4I6EA 1SCDA 4JVLA 3KKZA 4ZU1X 2Z6VA 4JY7A 1J9EA 5GJVB 4XDHA 2E4UA 3FW1A 1H8ED 5JO9A 5CM9C 2R8EA 1RAGB 3A1UA 1IY1A 2RONA 4WQMA 1N6RA 4Q4LA 2CFSA 1FZTA 2WQ7A 3B51X 3MF4A 4ABTA 1IB6A 3NCHA 3CCUA 2OD7A 4E1BA 1N1MA 1WYXA 1ODJA 1VQLB 3LBIA 4QULA 3H5VA 1LQ2A 1ZJ4A 4KUDK 2FK8A 3A1SA 1W5FA 1E8DA 1XN1A 1P2FA 5A71A 2IX3A 1VYTA 2A9QA 1PWZA 4AI6A 4LNPA 3U7QA 3E81A 2ZUTA 3V2GA 3OPMA 1PDWA 1RMTA 1H2FA 5L8RE 1LPOA 3H41A 2ZBDA 1BHJA 4ZT3A 1MZPA 4BAGA 2QR5A 1QRAA 5IC5A 2VQSA 3HA5A 3BC1A 4NABA 3USZA 3OH8A 4LHSA 2EZUA 3JVEA 5AH0A 3UAXA 1MXHA 3WYDA 4RZUA 3TREA 1W0JA 1RWXA 4ZYUA 2NZVG 4V1CB 3GT7A 2IZOA 4I9FA 3RTCA 4ZIRA 4NJEA 2HV9A 5U1PA 4FJ1A 3A6JA 4TLCA 1S01A 2IKQA 4NHOA 3GLTA 1MMGA 1L8OA 4TWRA 3DO6A 2O8VA 2G5PA 3JWIA 3N8DA 4RTWA 2XUOA 1Y0YA 3AUYA 4J0DA 4W5HA 3FZYA 3HBJA 2NG1A 2RGNC 3I01A 5HKBA 2V7EA 1BG6A 3QFCA 3KZXA 2DYBA 3UT0A 4GXTA 3HRKA 3H19A 3TCKA 3O38A 3X1MA 3WK5A 2BGIA 4BO2A 3CQ9A 2XUFA 3RB8A 4BFLA 1T4CA 3OYAA 3RLFA 1BXGB 4KSBA 8LDHA 3TBFA 1IIRA 3L0SA 3L7BA 2OUKA 3T15A 3HYTA 2MTBA 3N7TA 1V8OA 3O7WA 2D0QB 2A0FB 5IWAB 1UD5A 3RRZA 4MUJA 2VA8A 2FG5A 1Y4AE 3VZQA 4FZJA 3ZIDA 2V65A 1V9SA 3QK7A 4PPFA 4OMPA 3RS2A 2XMZA 1PUJA 4JOCA 2VXFA 4QV2A 1ADBA 2BRUA 1RXVA 4ZAYA 3AYZB 3QIVA 1H3NA 1SB8A 1A8HA 5FADA 3HYNA 5AKJA 4Q1AA 4DLTA 2QTCA 2Q27A 2WA2A 2CBGA 2XUIA 2HBWA 3N6VA 1SVWA 1YIJA 2I3GA 3CZPA 1Q16A 2GCGA 1ZA2B 1MABA 3DL4A 3VRHA 5FWXB 5ENDA 5A02A 1ML3A 5IJZA 3M0EA 3VUFA 2Y1DA 5LQCA 2YFHA 3DULA 3R7SA 3AZOA 3FTCA 1NSYA 1ZZGA 3ZHBA 4UASA 5HZBA 4IDEA 4ZYVA 4HUQB 1ENPA 2I0FA 3WFJA 3ZE8A 1TEXA 2MSKA 2YW2A 4C30A 1JLHA 4PTZA 1SKBA 4OQNA 3MJCA 4ZAGA 1JG2A 2FKAA 1UJ0A 4XM2A 4JI2B 3TOSA 4WXYB 3ZK8A 4Q7KA 5SYAA 2PXHA 3HTXA 2OGZA 3EHQA 5ISMA 5LQUA 2YYAA 4NCIA 3RUCA 5H3HA 3E9CA 4WZBB 3W5VA 4GOOD 3QEMB 3T1QA 4B73A 3C3JA 1QTNA 4P4SB 2HWUA 1DG9A 2FK7A 5LWQA 1U02A 1XZ8A 4A2CA 3CN9A 4ZEMA 1E94E 2JGLA 2LT1A 3R23A 2LRQA 5FA6A 1EK2A 2JIPA 4EG3A 3VRZA 3PUJA 2WYOA 4A6DA 3B3FA 5EE9A 1LQUA 2RH4A 1PK8A 2QXTA 4N1AA 3GVXA 4DNXA 4YCNA 3VU8A 4MB6A 1MRNA 3GP5A 2QX6A 5CQXA 5DXFA 1B34B 1ZH8A 2I87A 3RESA 4HDNB 3EE6A 3RF6A 3KQKA 4US2R 5KOHA 1I10A 1X3LA 1VHJA 4U6SA 2CW5A 4KIFA 2OP0A 3UCXA 3PVDA 1OXTA 5C8YB 1NT2A 2PO5A 1NULA 5G3YA 5EI5A 3ICQB 3THWA 3TZCA 3RBZA 4C5BA 2DIQA 3I56Q 3M6AA 3OOCA 5P21A 4PZZA 5G2OA 1FB5A 1GQ2A 2Q3HA 4M83A 3K6JA 1FDRA 3I04M 3PXDA 3NO4A 3ZQJA 4O6JA 4RQAA 4BL5A 3A2KA 1NTRA 3QFHA 1K9MU 3N0TA 2J9FA 3VPAA 3N6XA 2Q0XA 3SQDA 2PTGA 4II2A 4GD3Q 5ILOA 4PC1A 2O2IA 4NMLA 1D2EA 3MQ2A 2HFJA 3FIFA 4L78A 2ONCA 3TR6A 4B85A 1ZSGA 3X1XA 3R0IA 3F5MA 2PRYA 2NWMA 2ACEA 1X74A 5EIHA 4UBMA 3NP7A 1ISMA 5CLFA 4MUMA 2A7QA 2NU6A 2A5YB 4ZFNA 4OYYA 3AKCA 1VLQA 2AJBA 3A4TA 4XOUA 1YDHA 1I3KA 4DV2B 2CVOA 2JFVA 3O4RA 3VHXB 1KRXA 3B1JA 1FMTA 2QN7A 1M1KC 1Z0KA 3FOBA 3AUTA 1Z16A 2XBMA 5J59A 5B5SA 1VJGA 1QYRA 2YN0A 4NV1A 2ECQA 4ELYC 3GMSA 1LBTA 3PGA1 1BPLA 2CFCA 5I4KA 4ZC1A 2C7VA 4CXMA 1LDMA 4DY4A 5KI6A 2BKAA 4QLBA 4OM7A 2W2MA 3RI3A 4QM7A 2G25A 4FHGA 4HT8A 1GLVA 1F12A 4LMPA 3E58A 3C41J 3OKXA 2I6SA 4L0QA 3E2PA 4MW2A 3RC9A 2FX2A 2CZ1B 2ZS9A 3U4IA 3L2WA 4Q6BA 1WB5A 3ESBA 2OPBA 3QI2A 5TF0A 4X61A 3O1JC 5ITVA 1N77A 4A1FA 3P2KA 3PEFA 3G6KA 3UA7A 2ZJZA 4XJTA 2HRZA 2F3RA 3B36A 9GPBA 1TECE 2B3TA 4DKJA 3RODA 1TZKA 2PV7A 2OZKA 2H5EA 1MQSA 4UREA 2XUJA 2Q6TA 4MS1B 3P9ZA 4L57A 2VTBA 4TSFD 4PXSA 2GCNA 2B20A 1DKQA 3GX1A 3E0XA 3GVCA 4O2RA 1VC2A 2YUNA 3K20A 4W8HA 2IQ5A 4OK6A 3ROGA 4Y3UA 4GZLA 1F17A 5JAPA 4XB1A 3ZXXA 1JGTA 1T0JA 4WEQA 3X28B 1NFQA 4IZOA 5CFNA 4PJOG 5CK4A 2XWSA 2VTEA 5CVUA 5JNWA 3BJMA 1J7JA 4IHQA 5F64A 4CI9A 1R0LA 3OM1A 1G6Q1 4FNGA 1RJWA 1PHRA 1EXMA 3WWOA 2H7YA 1E4OA 3UW1A 3OPQA 1B3QA 5JDCC 4QARA 3L1KA 2K57A 1M2OA 4YHBA 4PLGA 1YJWT 2IK8A 2GK7A 2ZRLA 1U1IA 1THGA 4LOJA 1XI2A 1Y9EA 3CURA 3IBYA 3GLIB 4LG1A 2ZUEA 5DBHX 2DH5A 1OHHA 3I5AA 1A98A 4Y6OA 3REBB 4KPUB 1HMYA 1DJPA 4D0LB 2G09A 4IY1A 2HOQA 4W82A 3OEED 4JI8B 4JUIA 4NU5A 3GVPA 3TW8A 1OYVA 3RFTA 3CCET 3C85A 3IOCA 2Z9BA 5J1TB 2E6KA 3T3MB 3I8SA 2ZCFB 3BXHA 4UVGA 1Q7GA 1JQLB 2VSYA 3D8TA 4ZTUB 2DPLA 5LJ3f 2SHKA 1IHVA 3BXEA 3W2EA 3H5NA 4U7DA 5A4IS 1G8JA 1WZIA 4AJPA 4AS1A 3K32A 4DV1B 3IIJA 1AT1B 1GZVA 1OFGA 2KBEA 3LK6A 5HZKA 2IW3A 4WGFA 3JASA 2YJ6A 3I56A 1WD7A 2GLTA 4G6ZA 1BCRA 4AG1C 2NLOA 1KDYA 2HA5A 1XDZA 2VHXA 2W70A 2Y27A 2Q6KA 4N4HA 1A8QA 1KDOA 3NTHA 1RYMA 2ZPHB 3CF0A 3LHIA 1J0EA 4S0ZA 3ZHOA 5IBRA 2PLRA 1Z38A 4GX2A 4UVEA 5COAA 4WXRA 3EWAA 3CCVQ 4LYHA 3SR0A 1VCIA 2WU0A 1WQ1R 3GFFA 5AW2A 4MR7A 4E15A 1ONNA 3WKAA 3CTAA 2X19A 4XQCA 3A4LA 4GOXA 3R3VA 3HUEA 2VDPB 1NW3A 1VQ4Q 2ZXFA 4N0PA 4DUGD 4BLWA 1F38A 4HGPA 4G85A 3NBUA 1KY3A 4B3JA 4KMSA 2ONYA 4B74A 5EUQB 4MZDA 1SWVA 1C8LA 2FMIA 2P9FA 2K3BA 3ESDA 4QG3A 5FRNA 3BBLA 1RWVA 2E1RA 1YR3A 1M1NA 5HRAA 3K0CA 1THZA 1Z4JA 5CNIA 1Z56C 3PNSA 3KOOA 3PX7A 4ZTJA 3OAAD 1YJ9A 1PX0A 1R8SA 4PFZA 5F3WB 3DBRB 2WF9A 1YJWB 4M2LA 1B6SA 5EJ2A 5A6SA 1YRQA 2AZDA 3P9XA 3L8HA 1GLNA 2J59A 4BU1A 1CKEA 3FYDA 1YBMA 4W5QA 4ZI7A 2GTOA 5TPZA 4BFUA 4P36A 3RR2A 2AN9A 4QDOA 1JHQA 3H6HA 3JZFA 4WN9B 3IAAA 3W9UA 2GDZA 2P1RA 3DE5X 4KO4S 3IKJA 2V8IA 2XSZD 1A9SA 1LNQA 3JALB 3LY7A 3DBVO 1GG5A 2GKOA 1ZIXA 1TLFA 3I55B 3UK7A 2HQXA 5DN9A 4EMHA 5HE8A 1OILA 3CVUA 5KCOA 1R0CA 1YI2B 4EGFA 2Q4TA 1UBHS 2IXBA 3KB1A 1HD3A 2EJUA 2PA0A 1O5OA 4JSYA 5H02A 2IS4A 3V8PA 8MHTA 4WZAA 5EZYA 3EG2A 1UKCA 2F4VB 4KFUA 1TMGE 2ERXA 1H3HA 4IJQA 5HIJA 2PTHA 2R57A 1O94C 2BM8A 2Q28A 1BBZA 1U8AA 3P9KA 3U7HB 4HI0E 5I7EA 3G59A 2IBTA 3B6ZA 3MAGA 1CIJA 2FZLA 1GAQA 2QZZA 4Z9AA 3DYBA 1ZWKA 1O54A 1GQQA 3DQPA 3TXXA 4BMVA 3WLEA 4AP5A 1E3ZA 2QUBA 3A9UA 1CZKA 3N5BB 3NEYA 1WJRA 3A8LB 5DBOA 4Y2GA 5K51A 1VQOT 3V3KA 4NL2A 2W2LA 5F5XA 4J0KA 3BUSA 5IG2A 4C6HA 2X8KA 4ZMRA 3RRBA 1N2EA 3G0GA 3TRFA 1D8TA 1QK4A 1CS0B 1A1VA 1ILEA 5KHOC 3FMOB 2POCA 3PLRA 4DIMA 3KHTA 1W25A 5A4KA 3I09A 3K2IA 3V7WA 2WJIA 1ZR4A 2H8GA 2KMLA 5BR8B 2ID8A 2ZJBA 3D3JA 3HVUA 1G4UR 1IXYA 1U2RA 2E37A 1Z0DA 3SBDA 1YHQQ 1OZGA 3NAQA 3D8SA 3BZWA 4C5GA 5JAZA 3FWKA 3W2GA 3ST7A 1YZUA 3UJPA 5ECYA 2XH8A 3HNPA 1Y3IA 3EF0A 1WDTA 3QFRA 2PGLA 4MVJP 2NV2B 3P0JA 4IIJA 1W85B 1UMCB 2CXSA 1VLMA 1ZHOA 1CDEA 3KOYA 5HQ3A 3RQIA 5DULA 4LRWA 3PF9A 3LQ4A 3EULA 5M34A 4AJNA 4PSUA 1I5OA 4HWGA 4E03A 1ZGCA 3VDMA 1AE1A 2MPXC 5BMVB 1GCGA 3SS8A 5IYNA 5L46A 4JLIA 4YMGA 1QO9A 4LWQA 5E6UB 4GRDA 1U0TA 2JCYA 2PE5A 5GMKm 2IYEA 1L4UA 3IS3A 4Y30A 2MDTA 3GGCA 4IQGA 2FSIA 3GFGA 4E2WA 1COZA 2D2XA 1EH5A 2RGRA 3CCVA 3ZD6A 4W9RA 4YDHB 4NBUA 1ZN9A 4JASB 2GD2A 3WMGA 1PJ8A 2IXGA 1E2BA 5DTIA 1NR1A 3A8TA 2KI7A 4RJ2A 1Y63A 2CLEB 3H0EA 2VATA 2D1QA 5D6NA 3OQHA 2BI4A 3TZ6A 4GOMD 4EQZA 4Z9FA 1VQ4A 2OZEA 2UUAB 1YOBA 2WWWA 1ISFA 2JIDA 1ZJJA 4F6CA 4JLMA 4CG0A 5ALUA 1G2QA 2AK3A 4LF6B 5J3BA 4UPDA 3C7CB 1VKZA 3UGQA 1J22A 5J4HA 2RCYA 1UMBA 1UR5A 3V3TA 3ZZ0A 4G23A 5IBQA 1KO1A 5ESXA 3HCOA 3HP9A 2Y4XA 1QVFB 3ZU2A 1IO6A 3RFUA 3ZGYA 2O3JA 2Z0MA 4EPVA 4XWOA 2EHJA 4R31A 2PKXA 2VAPA 4LDPA 2XRZA 2EYZA 3CH5A 3BXFA 1D6NA 3TPZA 1E5LA 4LOKA 4M9XA 2O5CA 4F2DA 3S2EA 1VQOB 2OG1A 3WQSB 5EKSA 2V58A 3IERA 2QL6A 4KVAA 4HQ0A 2XKBA 1C7RA 2C4UA 1C9MA 2BFAA 1FW6A 4Q3LA 3PBKA 5IJWA 1K7XB 5JTTA 4NDNE 1OJ7A 3GFBA 4R0NA 2LC4A 3R0VA 4IDDA 2PGDA 3NIWA 1ZM4A 2H5JA 1DMRA 4NBRA 1SEVA 5JS1A 4KXLA 2EDAA 2X4XA 1JI0A 2EVRA 3JCMP 4U2KA 4PGFA 3LFTA 1EQAA 3G2OA 1P0MA 2NVUB 1IFXA 3UV7A 1VPDA 4XX0A 2OT3B 1NV8A 4ROSA 4F5WA 5JXGA 1PJAA 4MQEA 4UTRA 5CBPB 3NIDB 1U4OA 2I55A 4LE9A 1P2SA 4FC7A 1R0SA 4P38A 3BKWA 1P9RA 5K0SA 4EKIA 2QUIA 4P8RA 3H5TA 2WD9A 3TOZA 3MMNA 3L0IB 3NTVA 4CIAA 4HL6A 1LPMA 2Z3ZA 3CXCA 4EG4A 4C7VA 2REQB 3J81A 5TV2A 4HADA 4RF3A 2FN9A 1ADJA 5T57A 1VA5A 5DYYA 4XLLA 2WJVA 1DINA 2A9KA 3UWOA 1SCQA 4Y9SA 3GRRA 2VK1A 2VUIB 3FY4A 3U3OA 4HNTA 5J35A 1ISGA 3IHKA 1JG1A 3HEMA 5BORA 1H3FA 4BFVA 4EYEA 3GA7A 4YJFA 4UM9B 1M83A 4CC4B 2WUFA 1Y80A 1W4LA 4RIGA 1JEDA 3KOMA 3NWPA 4B46A 1K8AU 2B4TO 2D06A 2LTOA 3ZCSA 4U5QA 3DV0B 5CA1B 4QPPA 1XT6A 4DEVA 4MRVA 3D7NA 2W6JA 2IEBA 4UJ3A 1TJ3A 4UBLA 2RHRA 3V7NA 2ECKA 3M70A 2A1UA 2BP7A 2NU7A 3D0OA 1YHQA 4HNQA 3FNRA 2EW3A 3E22B 2I8CA 3U3DA 2VJKA 2ZUWA 5BSMA 2FN4A 3PJRA 4EI8A 1ZJ6A 2ZU0C 1VL8A 1JDUA 4ARSA 3JCMV 2LQWA 4C4PA 4UQPA 4HXGA 4KR9A 3EPJA 1ZYUA 3EIUA 5AKEA 4DS3A 3OYNA 5G0WA 4Q6WA 2PT6A 5E7IA 1NYLA 3V1NA 2AZSA 1Z39A 4R98A 4WW0A 1P6XA 3NQ41 1KGDA 2XNSA 3D4NA 2BRUC 5DP1A 5GZ3A 1DKMA 2R6CA 3KQPA 4WKOA 2XYPA 2AV6A 1FLDA 1VQLQ 4PR3A 1ZNWA 1D9ZA 2AG6A 4ES6A 3IUEA 2VRBA 3CP2A 2YBDA 3UAOA 2KMTA 2VV5A 5K8LA 2P78A 1DIGA 2XODA 1IN4A 3QKRB 3G13A 5LR6A 3PK0A 3QUTA 5DLPA 2I2CA 2OB2A 3ES9A 3HJAA 1W87A 4ZI7F 2XYQA 1G59A 1MJHA 2DHEA 2FVUA 2Z2ZA 3MTDA 1FS6A 4KVZA 5FU7C 3SDZA 1WHSB 2P6PA 4LW8A 3FPCA 3VTAA 1RACA 1Y71A 3KJEA 1BW9A 3WK7A 1BE1A 2ZDQA 3HB1A 1OAAA 1TK3A 2O0KA 4NS1A 4AUMA 3FMVA 5LDDC 1IHWA 5LA6B 3HFJA 4HN2A 5L53A 2P91A 2GQFA 4HAVA 5AD1A 2X9QA 1Y34E 4CGYA 6PFKA 1C9NA 1P5JA 3ITEA 2ZPEB 3ROXA 2IDKA 2MK5A 5IZCA 2XOEA 1ZCZA 5JTUA 1U8UA 5BWCA 2K5FA 3KC2A 1VLHA 2NX2A 4YJHB 4L5IA 3ZHTA 2Q1UA 1KHIA 2HRDA 4IHJA 2JZNA 3N28A 1UZUA 2HNAA 2V59A 1G8XA 1MO6A 5BW5A 1TEZA 4M7DA 3FYUB 5AOVA 1V96A 1EAYA 4PLZA 4YPOA 3ND6A 1OV6A 5JNUA 3QE4A 2GZDA 1VIFA 3B1ZA 4XASA 4L6AA 3JWGA 1AURA 3H9CA 1Q92A 3PDIA 1GO2A 5HG0A 1AKQA 2P2DA 5BUSA 4CTKA 2JLAA 4C0KA 5DM70 1PNOA 4I1UA 1PVOA 3OX4A 1Z4IA 3OHSX 3EG9A 3DR3A 3PHLA 4HQNA 4RY0A 3MOSA 1TGVA 1G21E 3K5WA 2HF9A 2A6PA 4HYQA 3D43A 1CDZA 2KRNA 5E2AA 2Z8YM 3BK7A 4MA4A 3IDQA 4QUHA 1Q9SA 1KNXA 1NAIA 3LF1A 3L49A 5IC4A 2NZYA 4UTXA 2C98A 1QDEA 4M7PA 1MEJA 4UXJA 4F46A 4MQLA 4YREA 1PJ5A 3ILXA 2AVNA 1QQ6A 2DPXA 1W48A 4I4CA 1D1AA 4UVIA 4IIJF 1YL6A 1ZU5A 5GONB 3NAGA 1WWKA 3UQYS 4OU4A 4LSZA 1X9IA 3G6EQ 5CW1A 2JHCA 2UZ3A 4XE5A 1IY2A 2IVZA 3HUFA 3RK1A 1CYEA 1IOZA 2B8WA 2WSYB 3IGFA 1QFXA 2HA3A 1EGVB 5F98A 4JLGA 5HM6A 3ZWCA 1QAOA 3S0JA 1KO8A 1AWWA 1EESA 2PKWA 1RQRA 2IHYA 4LRUA 5ALYA 1WFWA 1NZ9A 1Y6RA 3L82B 1L5SA 3OLYA 5JCJD 3EA5A 4B43A 4Q12A 1K6JA 2WZNA 2FMFA 4P4UA 3EXIA 3UANA 4G0NA 3M9LA 3W6PA 2XCIA 4RDHA 3E5RA 2PIDA 2J3HA 2V0GA 1DAHA 3DEAA 3OQIA 4J94A 4O3FA 4BKQA 3ZJUA 2M16A 2OYRA 1IC6A 4OBWA 4R16A 3OZEA 3RAEC 4NP6A 2M5SA 3QEBZ 4UU0A 3DG9A 4MVCA 1DKLA 2OBFA 1NQ5A 2GGRA 2V5AA 2NUBA 3H04A 4AQYB 3WYEA 2QAZA 2ZBPA 2QE7A 2EGEA 1JJ2P 1RXCA 4QYSA 1IOLA 3NFRA 4M8LA 5JT1A 3G5TA 1NVFA 4FMPA 1DTSA 1DI0A 2WU4A 3HDQA 1SQSA 3VNBA 2W90A 4WTOB 1ODFA 3A2MA 4K9KA 4ZZ0A 1EFNA 3IUMA 1I0CA 1K9AA 3V2UA 3LC7O 4EGAA 1Z0AA 5FPSA 3E35A 3I6MA 2HKNA 3I4CA 2ZXHA 2D5AA 3UBMA 1JYEA 4W5JA 3ZWMA 2K6GA 1HNXB 3E7XA 1UMKA 4N5MA 3ONWA 4E22A 3QVMA 5KOJB 2XXAB 2WF7A 4BB6A 3JQGB 4L3OA 3RUEA 2JUFA 3HZZA 1OAOA 2WTXA 4PJOE 2VXYA 1TU4A 3W5IA 5AKYA 4QSMA 4R3WA 1K6XA 1FNNA 1JHPA 1WTHD 1VE5A 1T6NA 4TMFA 5D6XA 2ZB4A 3PIIA 1NQAO 3L9XA 4JQCA 4XKVA 1AA6A 2B1GA 4WZ6A 1C3VA 3A9CA 5JI2E 4EW2A 2W7TA 3OUUA 5IT9E 4HH3C 1DC5A 1XUOA 5AW4A 4GP6A 2RB5A 2XCQA 3F8SA 2AHJB 3TGWA 3WISA 4RVUA 1V9CA 4BY6C 2NU9B 4YJ3F 3HGQA 5GWXA 1TM2A 2YXEA 3RVPA 4K6FA 1Z0UA 3OLWA 2X0IA 1RRVA 1ZMRA 3PXEA 4IPTA 4UPEA 2QL7A 1YTUA 2O2GA 2YXDA 2C8LA 3MKDA 1GYQA 3RKRA 2VXOA 1XGKA 5KTKA 1AV6A 5ES3A 1PFUA 1TEHA 1GCPA 2HXSA 3N1UA 4MRSA 5FBKA 4JBGA 221PA 4PZAA 2R5WA 3W7VA 4MMLA 3ILSA 4LXGA 3RFFA 1J0DA 3HEBA 3QMWA 5TVKA 1RWWA 3COSA 4I8XA 4PBTA 4KXVA 2WNSA 3OJ0A 1U8TA 1PJTA 3PD7A 5E7QA 1ZMTA 4CR7A 3TXAA 1MC8A 1Z74A 2NUTB 3Q10A 2ZSBA 2RHGB 1K7CA 1RE0A 3CUSA 1YU9A 5F78A 2HAEA 2XPCA 4EUHA 3ROMA 4S0XA 3MJSA 2RH2A 1RI4A 1B42A 4H4EA 2WT9A 2VLIA 3ONFA 4LDNA 3R3XA 4YRCA 3VS4A 1JDTA 4AC9A 4CFSA 3G6EA 4PW0A 2RGCA 2H07A 1YCDA 2B7CA 1EGHA 1GZ3A 4RMHA 1TSFA 2RJEA 4NI5A 5TVGA 1LU9A 4BWVA 2CEKA 5I51A 3JD1A 3AWDA 1AZSC 3GDFA 4IH1A 4F2WA 4N6GA 3OWXA 1QYWA 3GB9A 4F1JA 3IUNA 2C77A 2PZFA 5FBZA 4MW5A 2IXFA 3NHFA 4QNRA 2W4MA 3K0CC 4P4SA 4DMCA 2KM1A 4MWEA 1WSWA 4WBSA 4DILA 1NHWA 4GOKA 5LVAA 4G7WA 3JWEA 1FZQA 3M2PA 1WJSA 2RGGA 3EZLA 3GGDA 3PSHA 1T3SA 1C1AA 2REXB 2G9ZA 1V4VA 4KQ2A 4HMQA 3FIUA 3QBJA 4LDVA 4BASA 2IF2A 3IT3A 5B53A 4YAWA 1B34A 1RXUA 3VNSA 1H2EA 4G3XA 2OAUA 4BPBA 3P4XA 3HKBA 4DM4A 3PXGA 1YMQA 4RUKA 4G5SA 1TF5A 3M3DA 1VKOA 4Q9NA 1SRRA 4LOHA 2K7FA 5BY2A 4PYOA 3KV1A 4LDAA 1Z34A 4RNDB 5EIBD 3NIFB 3EZ6A 1D04A 4KNVA 1N5KA 3I8XA 4JNKA 1YBHA 4LCBA 2JTEA 2EGCA 4YECA 5F12A 1SXJD 1ZGBA 5JJIA 3BDLA 4GR9A 2PIAA 4CR6A 4XYBA 5FNVB 2IEIA 4Z0PA 1WHTB 2Z5LA 3MMSA 5E2BA 4P3PA 4IHJF 2P9QA 3O8LA 3AJEA 5LB2A 1M3AA 2DF8A 4ZJYA 3VQTA 4YQYA 1EVKA 4OGFA 4D42A 1XMQB 3M6MD 2P75A 1CJTC 2GI4A 1ETHA 2GHQA 4M7DF 2WD7B 2O8BA 3QDRB 3N0XA 4FR2A 3E84A 1JQQA 3QKSB 1YFLA 3ANTA 4FB4A 4Q3BA 3IFSA 2PSFA 5HJEA 3K4QA 2EW8A 2ZRBA 5C5CA 4S1VA 1ZVVA 3JCMf 3FCYA 4KQGA 2X8JB 2ZPIB 4IUPA 2DRIA 3OA6A 5JDIA 1U0SY 1ZD2P 2IOFK 4M99A 5EEHA 1KK0A 2HWYA 3EEQA 3C12A 3IODA 2ANCA 1RC1A 5LZ4A 3H8SA 5BT8A 4QUAA 2JHPA 1NP6A 4RENA 5FLYA 3L84A 2COZA 4B9AA 2ODTX 1VA7A 3JB9J 1XQHA 4WESA 4KN5A 1W2BA 3LFHA 2C2MA 4ML3A 3H18A 1O7JA 3B78A 2RD2A 3VDXA 2QVLA 5BQPA 3OY2A 5HF5A 1XCMA 2C97A 1YJNA 1ABOA 3LBYA 2H1IA 2R751 3QY9A 1P6UA 2PMEA 4J0QA 2PKQO 3BRCA 1Y1TA 2X1VA 5EXDA 3PNMA 4M1QA 3JAWB 2ZYRA 4ZVOA 1UB4A 4Q1VA 4X24A 3S68A 2ZRFA 1BCSB 4AYXA 2IKSA 3F4KA 4PS1A 4YFYA 4D4JA 1NW8A 2YWDA 3QV2A 1DHRA 4WUTA 4EEZA 1IDOA 1AS2A 4OQLA 2RJCA 3O9VA 1TGYA 5K0CA 1T36A 4KV7A 4Z53A 2YNMD 2WSEE 3DEKA 1O5TA 3GYGA 2UVPA 3NPAA 5HIIA 3BMCB 1SK8A 5A2QA 1XELA 5IDXA 3I55Q 3WLPA 3C6YA 1YSCA 4DUZB 1YI2Q 2OORA 1RJDA 4RMGA 3OQPA 2O8EB 2GYYA 4X3PA 3KL2A 2I3DA 1NG2A 5BUZA 1SVKA 2WIKA 5LJIA 1XPOA 4Z7JA 1JHDA 3E9QA 1NUHA 5CB6A 3VH4A 4EEKA 5ELXA 1DEOA 1SM4A 3Q7PA 2JRLA 2QRUA 1VHWA 1HTBA 1PJSA 3PB3A 4N7MA 1KXZA 4XTCS 2ACKA 5FT9A 1FQWA 2K7ZA 1AM4D 3IHTA 1A82A 3U3JA 5IJ9B 6YASA 4DADA 1K6MA 1SIOA 3DNFA 4MIOA 3NU1A 4R8VA 1VQPQ 4YRTA 5BSHA 4YP7A 1H2ZA 4G5QA 4LJRA 2DD5A 2QDLA 3WRYA 5LQDA 4BX3A 1Z83A 1G21B 2M1XA 2HGSA 1B3BA 4E6PA 2ZW9A 1J5EB 3GLIA 2X6RA 4LK3A 3LX5A 3V48A 3VR6D 3U3RA 2VGMA 5FAKA 5J5CA 5JAQA 3PFFA 3L7CA 1YQGA 4R68A 4IDNA 1K1ZA 2H16A 3W5BA 5HKKD 2Y1KA 3ELUA 2WVGA 5GANj 3T7AA 1Q81D 1KYTA 1L5NA 4GXQA 1Q86C 2OM6A 4KK4A 3H0IA 2EKDA 2IWRA 4CKEB 3RTEA 5I01A 2V8OA 1TO1E 2OGTA 3KQVA 1CR4A 2QGNA 4B6QA 5TQJA 2HSEA 2DBRA 3WP1B 1Q7EA 3A1TA 1Z08A 1GQSA 1KF0A 2ZYTX 2DUWA 2JVIA 2I6GA 4JZYA 4LYDA 1E9BA 4GOND 1WE2A 4LD9K 1LXCA 3VR4A 5IAAA 2F1IA 4FLEA 3OSUA 1X01A 5LQSA 3AIIA 2G82A 3DHEA 4TWJA 3CLTD 1KOLA 1EKXA 1J7KA 4V2UA 3HRSA 5FO0A 2GCIA 1N9ZA 3P2MA 1UWLA 4WH0A 1Z29A 3ZYCA 1G8YA 3N2LA 4CIVA 1PG5B 2PUEA 5H16A 4POAA 1PJQA 2D4AA 1ZX1A 3EFOB 1R6UA 4RJTA 1XNJA 2XT9A 2ED1A 4EYOA 1HR0B 3VH1A 2MYPA 1M3CA 2C7BA 4RDXA 1ECFA 5TY0A 1D0XA 5B1EA 1R9NA 2ANBA 2FPIB 3IAUA 3VHRA 4HDAA 2HNIA 3A1EA 2FLWA 1W36D 1WB4A 4J7UA 2B1RA 2AW3A 4HF7A 1N3LA 2KLHA 4RCZA 1U3FA 5CXSA 2BFBA 5KPJA 1YDWA 1UD2A 4CE6A 2BN4A 2M9MA 3DB2A 4R2LA 5AUPB 2QEXQ 4S1OA 3OIDA 5KJ6A 3AT1A 3WL4A 2OTCA 1FOEB 2CXNA 4NBLA 5JPDA 3BGSA 3NHMA 1B76A 1YIOA 5GADl 4B8YA 2QQGA 4CC2A 1RBQA 3FPSA 5CLQA 3T61A 1UPFA 4IO1A 2VP9A 5LJ5e 2O8DB 2XTAA 3R7FA 2QTWB 4BX2A 2LPMA 4PJOB 3MPUB 1NBMD 4GC5A 2Z57A 4ZVKA 3O8QB 3Q41A 1DCTA 4A8JA 1SCUA 1M9NA 3P2JA 2KGTA 1UKVY 4ZV4A 4JJ4A 2W6IA 3KKOA 5DKFA 4RVNA 2PRKA 1ZDMA 1L1FA 1NVTA 4MRMB 2INGX 1WAMA 3META 2RIPA 3LFUA 4YRBA 3UT6A 3ETCA 1B74A 2G9NA 5JYEA 3KJXA 4LNHA 5CVIA 1XOIA 4EMGA 3GCDA 3MAJA 4DW8A 4FYYA 4PFSA 4AT1A 3MT7A 4UZSA 2J46A 5JXWA 3QIAA 4P12A 5SZIA 3H2KA 3AERB 4ZA2A 4XLTA 2WKSA 4J0HA 3LBNA 4Y0AA 2RA2A 2EKOA 1H05A 1JAIA 2BISA 4FGJA 4MQBA 4AURA 3ASPA 3OLXA 4URWR 1JBMA 5CB4B 1OBVA 1PWHA 5WRFA 4R2XA 2RM4A 5ALVA 1XF1A 4A4FA 2MR6A 2GJAA 4DR4B 1BDIA 5GIPE 3CD6Q 1VQPA 3EWNA 3ONUA 1P1FA 1KVQA 1FNSA 2E0IA 2RQVA 1SQFA 4Q7MB 3STVA 3E3OA 1LEHA 2CSIA 3CC2T 1MKYA 4TLAA 2WINI 1I7DA 1PFKA 2RN8A 4JBWA 5IZCC 4H3VA 5J26A 4P5DA 3PEEA 5CIWA 1KAHA 1IEVA 3WK6A 3MHPA 5FFNA 2EKLA 1E7MA 3F96A 4QXQA 3WXMA 4YRLA 3QVKA 4M7AD 4MGEA 4W7SA 4M7DC 1OC2A 2YWJA 1IPHA 1WXDA 2W8BA 5B6PA 4CF6A 3I61A 1YDGA 3H6ZA 3IOEA 2EIXA 1XJWA 3IBSA 1KD1D 2ORWA 2XCSB 2RHLA 1HLPA 2EL9A 2J48A 2C3UA 1FMJA 1SU7A 2MIIA 3WADA 4EW1A 2O05A 4DJFC 1PN3A 4EKNB 4PYNA 2C99A 1VKNA 2J6OA 3DEYX 1U0NA 4RTSA 2AFRA 2H1HA 3RYHB 3VV0A 5CNJA 4C0FA 3PPIA 3JAME 4QQ6A 5E6UA 2VUBA 1P33A 4U9HS 1NPRA 5KW9A 4NPCA 3DWIA 4BTVA 5ADUS 1CNMA 3Q98A 1UK6A 2GF9A 4ND4A 4BIIA 4JAVC 1Y81A 2O1SA 2GA9A 4K6CA 4QLOA 4TKMA 3H8JA 2P9CA 3QDFA 5BSXA 4I08A 5D5QA 3P9PA 3FF4A 5HOQA 3FPEA 2GAIA 3DWGA 1DO8A 5FRMA 1FYWA 1EUCA 2QHXA 3W8NA 4POOA 3LD9A 3DLLA 4P7JA 2IA5A 1Q15A 1UANA 1XQXA 4TSRA 4PTYA 3LY8A 1P5FA 3G85A 4DCCA 3BH7A 3E5MA 2D7CA 2HMTA 3V4FA 5DU2A 3RFVA 3SC4A 4YP0A 2VDOB 3JRXA 3I72A 2Y0CA 4OHOA 1TXQA 3STHA 1QB8A 3ICPA 1TT7A 2QEXA 1T3TA 2H31A 1CS4C 1K63A 3O4GA 5K0JA 1VQ6Q 4ZT7A 4WFIA 4QVGA 3IAS1 1DE0A 4JDUA 1QVFA 1RKBA 4M78D 1C80A 2QYTA 4KREA 3ZH2A 1QHGA 4X6XA 4C0DC 2I1LA 3SXJA 4TLEA 3AJAA 1RKQA 5HK3A 4NBSA 4BKMA 4KQ6A 2YFQA 3GLFE 4JBXA 3D7RA 3U39A 3ZPNA 3S1AB 4EENA 4K9DA 4RTOA 2G0AA 4NE2A 4DMHA 1GVHA 4JK3A 4MMZB 3Q9UA 1B14A 3TZHA 3VHLB 1SXJE 3H2IA 3MFQA 3O7MA 3IAS6 4IX1A 2NVUA 2L0AA 4RM2A 1PR2A 1G38A 3BXXA 2H2HA 4LI0A 2A5LA 2CNBA 3I5RA 3CXCP 3VPFA 1OAKA 3MOGA 3QEAZ 4ZGJB 5CBPA 2MYTA 4BMSA 3BDVA 4BNFA 3O2SB 4E4RA 4NJMA 2PFKA 1UM9A 2FW6A 1FJXA 4Z3KA 1ONSA 1VOTA 2J5XA 3OYYA 4HDKA 1W93A 1DRWA 2NZXA 2V5VA 2AFHA 4B44A 1OAOC 2VS1A 2X1HA 4B6MA 1WZUA 4TTVA 2NP7A 2LR0A 3HJTA 3KVRA 2Q8PA 2DTXA 4QDTA 3P19A 4MW7A 3M5CA 3LQEA 3BE8A 1UFOA 1TZMA 1K6IA 1GTL1 1E9AA 4BB5A 4BZQA 3CD6A 4Q34A 5EUCA 1UFFA 4AO8A 3EZYA 2H9IA 1ZAKA 1QCFA 4BLQA 1TJ5A 2VAXA 1RRPA 5GVSA 5BRNA 3EXHA 2FPUA 3DV0A 3WICA 4PLTA 3CZ4A 2IDZA 1MB9A 1R9JA 4DLWA 3EMVA 1E5DA 4EABA 5C1IA 4PQYA 1DKPA 5CUQA 5EOVA 1M2VA 2ZOSA 3OIUA 1VE1A 1LNZA 2YZNA 1UD8A 3WMRA 1N8RC 1W47A 2AMLA 4J0FA 2IYXA 4FN4A 2ZR7A 1V8DA 2P9EA 5FPTA 3KYBA 3WB9A 3HCEA 3JTMA 3BMOB 1J1UA 5HW0A 3LI2A 2DFVA 5DN6D 5TS3A 1UAYA 2IDJA 1R0ZA 1GRQA 5GAOl 1IHDA 3DM9B 4WKBA 2UDPA 2O2EA 3W3AD 3V33A 3RIGA 1V39A 1NSTA 2H1RA 4NOMA 1TZ2A 3VAYA 4MTLA 4A4KA 1D6SA 1US8A 3UAWA 3LY5A 2IX9A 2D5IA 3EFHA 2WI8A 3GDGA 4ZQHA 1H4TA 5B7GA 4LDRA 3UFXB 3CCQT 1QU3A 2X0FA 3ITNA 3EMKA 5FL7A 4NOYA 2DC1A 3QNUA 3U9TA 3KAQA 2V6GA 3KWFA 4O2BB 1TU0B 3U7RA 3PYXA 2W6NA 3QKRA 4ZZIA 2F3TA 2HBPA 1OWMA 2YINC 3D4OA 1U3VA 1PZHA 1R9GA 4Z4QA 1CQIB 2NZJA 1EMDA 1KI3A 3AILA 4GECA 2YJ4A 1Q0HA 2Q4OA 1M1ZA 2KLBA 4PAQA 2WHQA 3MNFA 2Y68A 2WHPA 4PZDA 4BBJA 4INZA 1UWKA 5DM60 3E82A 1HBJA 1VG8A 1QOPB 5L4SA 3QHPA 4J07A 1EVEA 2NO9A 5GAMd 3FR8A 3EGUA 4EGSA 3MA0A 5FBVB 4AJOA 4EZBA 1F4LA 3T41A 1I3LA 3MP6A 2FFAA 2P6MA 3Q5DA 1VQ6A 3CX6A 1Y7TA 4X62B 5I9MA 3BM5A 5K0EA 2JLQA 1FDVA 1JXQA 4RTPA 5FBWB 5G0VA 4TLBA 2HF2A 1FUYB 4C4TA 2IHKA 2C57A 1VKRA 4ER3A 1HXHA 5GAN5 4TQUS 3I6ZA 4YJHA 1OTXA 2I6XA 2C3MA 5B7QA 5EQTA 4ZARA 3QBVA 1WABA 4D02A 5IYZB 3UJBA 2C3PA 2RHDA 2QIPA 5BWOA 3K05A 2DAQA 1QWEA 1QHEA 4OV6B 3T0FA 3FYUA 3LGAA 3QKWA 1W5TA 1WMEA 4G0UA 5SV2A 5JALA 2X42A 2YV4A 3GEPA 3V6MA 4PSVA 3OY9A 3ZX4A 2R79A 3DBHB 2AOTA 3TGPA 1ZJWA 3IHWA 5T7BA 2V4UA 3AM5A 2Z83A 1AD2A 4FYPA 1ZGGA 3IT1A 4GMHA 1C8KA 3P0RA 3QFTA 3AM1A 4ND5A 3H4VA 3WP0A 1Q0SA 3JCMd 1XMOB 5TIIA 4BDYA 4MS3B 5LL6S 2H92A 3USES 5TRTA 3VX3A 3ZY4A 3HZOA 5M29A 3E8MA 4NYMR 2Z2XA 2NXNA 3C3CA 4AY2A 2XXJA 1A5AB 4YY3B 3TJRA 2WFAA 3AY6A 3I0ZA 4GX0A 2FJPA 1VBNA 1B0UA 5I7OA 1VCOA 3CB2A 1P0FA 5JDIC 1DC8A 1XU7A 3VS0A 2MJLA 3R76A 4EHLA 4MDYA 3GUZA 3B48A 1Q0LA 1PR3A 2ZULA 1TC1A 2W6QA 1RZ3A 1GXSB 4CCAA 5BMVF 3AWIA 4KAJA 2E41A 4C4XA 3TLKA 2FW0A 2FEXA 4UBKA 1H0SA 3MWEA 3I9MA 1HPLA 3Q1LA 3T9BA 5ALNA 4G1CA 4URXR 1RSZA 3THRA 2GTJA 2C07A 5EP2A 1ENOA 4HNAB 3OQNA 2Z4TA 1SHJA 3K2BA 2D8JA 4LDJA 4OLFA 1A69A 3SCZA 2VPTA 3BC9A 1PTKA 3Q5GA 1TA0A 1YB5A 1DCKA 1S3GA 3OP1A 4BRZA 3GF5A 3QBDA 4JRPA 1YCHA 2V7QA 3SS7X 2XU8A 5F9HA 1BD3A 3CCEB 5C37A 1FXWF 3W2TA 3I52A 5E1OA 1CERA 4WKNA 2OORC 1TTQB 3AC0A 4DIKA 4HQOA 1ZO8A 1U8CB 4MPTA 3DF9A 4WOKA 4RPLA 2C58A 2J9GA 2QVGA 3EGOA 4F14A 1LBQA 1ZPDA 2JGAA 3ON5A 3DOIA 4L7QA 1I2DA 3UMGA 1NYGA 3FIJA 4CRWB 3AESB 4YR7A 1GHTA 1U0OC 1AUVA 2EYYA 3QY0A 5IT5A 2QLBA 3SJPA 4ARZB 2PMWB 3SI7A 1EFCA 5H9VA 5HM8A 3HL8A 4KTTE 1OXVA 2CVQA 9ATCA 1NVWQ 4XQ0A 5CXUA 5KJFA 1C9JA 4KFRA 4X94A 1T9AA 2VJLA 3ISTA 4DWJA 4BWFB 4P31A 4ID9A 2F3PA 3D6JA 3WRYC 1RPAA 1YUBA 1X1EA 1V11B 2VRNA 4Z3DA 3M81A 4EIWA 1MW8X 1QIHA 4EGJA 1H1LB 3W5HA 5DGDA 2A8YA 1UXOA 4TYYA 5CP8A 5C32A 4M7AE 4DBLE 3ZXYA 4NK5A 1C9DB 2XAAA 4BX9A 4KIWA 1T0HB 1