2DERA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
364
structure length
348
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 90
structure length 348
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2derA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2derA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2derA01
3AIIA 1LW7A 3CMEB 3CCQB 3MUEA 3ZZTA 2AKEA 3QSYA 1KP2A 1R6TA 1YITB 4RD0A 1OGJA 1JA1A 4F7DA 1KQOA 3CCRB 1I6LA 5DB4A 2I1LA 5TEVA 2XEXA 1GO2A 3U2QA 1A8PA 2JANA 1QRSA 4P6VF 4EG3A 4J75A 1QG0A 3J81k 4MVYA 1JMVA 4FN5A 4TMXA 1TYBE 1MAWA 3CB4A 4PC2A 4U9UA 1JJ2B 1N3LA 3OW2B 1TLLA 4G5GA 3ZUGA 2B5OA 3P0IA 1F7UA 4YAUA 3P0HA 3A04A 3FPKA 1G7RA 4P3YA 4DQLA 1VQMB 2IP1A 3LO8A 2YWGA 3ND5A 1JZQA 2C77A 4M1KA 3AVTA 3A2KA 1QUEA 2HDNB 2J07A 4MWEA 4N3GA 1VLHA 4NAHA 4EF6A 1VQ9B 3FWKA 1KQNA 2NPFA 3I05A 3WNBA 1ZUNA 3VO2A 1QUFA 1YJ9B 2DPLA 4PGOA 4MUKA 3W2FA 4ZCQA 1SM4A 2OK7A 3TQIA 1YULA 1EFPA 3CD6B 1XB2A 4HE6A 4RCZA 2DY1A 1XE1A 4ACBA 1N2JA 3H97A 4YBRA 4CQNA 3MMPA 2VNHA 2FX3A 4PBSA 4IW3B 4YP7A 1DNPA 3CLTC 1JIIA 4RD2A 2ZITA 4LBYA 1EJ2A 5JBNA 2GOYA 3COVA 2BYTA 1M8JA 1ILEA 1OWPA 4PC6A 5HG0A 4ZGNB 1U3CA 1P7PA 2CSXA 4DLPA 1K4KA 1K8AD 2DUMA 1NYLA 2QUJA 1SURA 5H5JA 4PBTA 3H9CA 4AS1A 4XFJA 3OP1A 1NP7A 1PFUA 1K92A 1YI8A 2OV4A 4MUGA 3SEQA 4EFKA 3AVVA 2CYBA 4R2LA 3LE8A 4CDMA 1KQSB 3RK0A 3GMIA 1JECA 2J4DA 1D1NA 3AVYA 4KR6A 4JFAA 1KORA 3FDXA 2VNIA 4M0LA 1PG2A 3IH5A 2D74A 4WQMA 1FFYA 1YHQB 3HV0A 2HCJB 1QGYA 3LVBA 1EP1B 1ZM3A 3CC7B 1N1DA 4JXZA 1DDIA 1E63A 3G6EB 1YUMA 2NZ2A 3PRHA 4E1AA 1O94C 3KT6A 3TQOA 1D2RA 3Q10A 2JA2A 1QFYA 3KT8A 4QFMA 2D13A 4MW2A 5H16A 3MXTA 1SKQA 4F4HA 1U2RA 3W5UA 2YWFA 1IB0A 2CFOA 3B78A 3G71B 4P2BA 1N0UA 2A1UA 4B48A 1AIPA 3W2IA 3ZBTA 4HE5A 2WQ6A 1TEZA 4MUIA 1I2DA 3H9BA 2XRYA 2DXIA 3ZIUA 1FNBA 1YJWB 4BWVA 3JQQA 3HL4A 3ZJUA 2BVNA 4UAJA 5DASA 1Y42X 2EL7A 2QJTA 4YP6A 3PNYA 2E0IA 2E89A 4R71A 3WNDA 3VMFA 1R6XA 1T6YA 1TQ8A 3NBKA 4ZCMA 3CVWA 4PC3A 3WBKA 3MHPA 2D5BA 4J0QA 3I56B 3P52A 4TS1A 5BNZA 4ZT2A 2RD2A 1BX1A 3CCVB 1H3NA 2DR2A 1VQLB 1N2EA 1Q77A 4MUNA 2WB2A 2CV2A 1W35A 1R6UA 3E1YE 1TYCA 2O8VA 1IJFA 5IJXA 5LFAA 1OWOA 4R2MA 3FH0A 1IQRA 3CLUC 3FY4A 3Q4GA 3WNCA 1MAUA 2BF4A 3VNUA 1J21A 2QJFA 2XNJA 1UFVA 3LCJA 1G7SA 1VQKB 2BM0A 2PLFA 1QGZA 4FK8A 2PZBA 1IVSA 4OUDB 1CQXA 5AN9A 4I6JA 1EWYA 1OBCA 3CCUB 3OJWA 2Z3VA 4QREA 2QEXB 4K1XA 1JHDA 2EFGA 3OTWA 1QH0A 4ZGQB 2Z09A 4NAUA 1WXGA 4G5FA 3KT0A 4NZPA 4EG7A 1H85A 1IJEA 1QNFA 3QTBA 5TGTA 2A88A 3RBAA 1EFUA 4BPRA 1K97A 3IUBA 4UZEA 1K73D 4G1VA 3COWA 3CCSB 3UMVA 4CDNA 1IFXA 1U0BB 3PXUA 1X6VA 2YXNA 1ZUNB 1O5TA 1FNCA 3A4IA 2PZ8A 3MLBA 4NX2A 4UZFA 1G59A 3AVUA 1EFPB 4M53A 5J59A 2R6HA 2EJCA 2CT8A 3CXCB 2JAXA 3SZGA 3DLAA 3W5VA 1EFVA 3ZC3A 3FETA 3K32A 5DSZA 4YHBA 3CLUD 1W2BB 4Y9RA 4EG4A 1R5BA 4RJLA 2Z08A 3E27A 2VNKA 4N3NA 1PG0A 4L2IB 1ELOA 4XFDA 4DNXA 1VQ7B 4RD1A 1H1TA 5EKDA 4QHYA 2QJOA 2PMDA 3IMCA 1GZUA 1GTRA 3RJZA 1VQ6B 3CLSD 4K0RA 1GN8A 1NUQA 3HZRA 4MWCA 1CNFA 4R0NA 4WSOA 1XNJA 1O95C 2BSAA 2DETA 4OJMX 5AHWA 3TS1A 1X8XA 1T6ZA 1T9GS 1OBHA 2GKSA 4TMVA 1LI7A 2QUKA 3ZXSA 2O5RA 3PENA 1VQPB 1M8FA 4PC1A 4RD6A 3CCLB 3CVYA 4HJXA 1NDHA 4TMTA 1J1ZA 1KR2A 1J09A 3NV7A 1IRXA 1FNDA 3N05A 1KK1A 1KD1D 1GPMA 1WQ4A 1MBZA 1YIAA 4MLPA 1E62A 1WY5A 2VXOA 2VZLA 4MYTA 3CA8A 3KFLA 2RC5A 1Q81D 4PY2A 3F3MA 3I1FA 1DG1G 1ZM4A 1KAMA 4EG8A 1COZA 1QGAA 1I6KA 3D6VA 2X1LA 3E20A 4ZV4A 3COZA 1WXEA 3G5AA 1QJCA 1J20A 1KKUA 2ZP1A 1KJZA 1V8FA 1W34A 3CCEB 3QFRA 2CUZA 3RK1A 1N2HA 1O96A 1JZSA 3HFJA 5J58A 4RCYA 4MULA 4MVWA 1KAQA 1EE1A 4B43A 4YAWA 1QVGB 1N75A 3QTTA 4MW7A 3C8ZA 1KP3A 4MUHA 4DQKA 1EFVB 1QFZA 3K9WA 2OTJB 3MMXA 4I6GA 3ND7A 2E1RA 3I55B 1KK3A 1NZJA 4TMZA 1CNEA 1VQOB 4PC7A 3CLTD 3GUZA 2XNCA 5HXBA 1Q19A 1IQ0A 4MUFA 3CR8A 4MW4A 1D2EA 3IOEA 1N2GA 1NUTA 1TFUA 1BQEA 4G6ZA 2QTNA 2V0CA 1ZH0A 1JNYA 3ISJA 2CYCA 4MW5A 5GV8A 4G1BA 1EFCA 2QDXA 3KT3A 1F60A 4NDAA 4ZT6A 3V76A 1VQ8B 1O0BA 4ZT4A 4LBVA 4RD4A 5KHAA 2E21A 4B3XA 1WXFA 1PFVA 2BTEA 2QUHA 4J76A 2RC6A 3H05A 3IVCA 4EG6A 4KR9A 1H3EA 2XRZA 2OK8A 3OJXA 1KQPA 1BS2A 4ZT7A 4ZT3A 2VTBB 2A86A 1N77A 5GV7A 1JEDA 1JIKA 1TUIA 1O94D 3OZVA 4YALA 4ZCIA 1G8FA 1O97C 3IUEA 4EG1A 2QUIA 3CVUA 3W2HA 1K9MD 4AF7A 1U7XA 1VBKA 3L93A 4MW1A 5DEOA 1HYBA 3ELBA 5DK4A 5IHXA 2CYAA 1KH1A 1NI5A 1JEEA 1QVFB 1B23P 1OD6A 4H9GA 1ZH6A 1E64A 3P0JA 3UC5A 2PIDA 1OGIA 3WBJA 1M90D 1AMOA 1I6MA 4AQ7A 3CVVA 2X3FA 2H2AA 3VU8A 4JXXA 3CPWB 1YIJB 1CT9A 1M83A 5HUHA 2NSYA 3QFSA 4MQ6A 2D54A 3L92A 3M5WA 3N2YA 4DDKA 1O0CA 1GR1A 4YAOA 3AVXA 1YUNA 2DERA 3OZWA 3DPIA 4Y7CA 3U1VA 1QU3A 1J1UA 3OZUA 3SDBA 3IVGA 3S3TA 1JILA 3ZGZA 3N9IA 4ZCLA 3D6UA 4Y9UA 1FRQA 3CCMB 3TZEA 3U6BA 1S72B 1Q86D 1RQGA 2B7LA 4U7JA 3RFFA 2C5SA 2QTMA 5KWVA 5KSWB 1XNGA 5LM3A 4EH1A 1WZ2A 1D8TA 4H3SA 2AZXA 1NUPA 1WOYA 1O6BA 3B82A 1WKBA 3AG6A 4OUDA 3SEZA 2CV1A 2YWEA 1FDRA 2YWHA 2J08A 1ZJWA 5FNZA 4ARCA 2J7KA 1UMKA 3AG5A 3FJOA 2X3UA 1R5OA 3ILVA 4ND6A 1BJKA 1YI2B 4KR7A 1ZM9A 2QA4B 1MB2A 2J09A 3FHJA 1XNHA 4MW0A 1NSYA 3IMEA 2YY5A 2PZAA 4AF6A 2VNJA 5FA6A 1EUYA 4U63A 1XJQA 1Q7YD 4DDMA 1GJRA 2QMUA 5TS2A 1J70A 1T9GR 1GAWA 3X1KA 2BV3A 1B2RA 2E18A 4FZJA 4YAFA 1KC8D 1TTTA 2DCUA 1S0UA 2PFSA 4DJAA 3ZZUA 1N78A 1BX0A 1WXHA 3AFHA 1ZM2A 4Q7JB 3VO1A 1G7CA 3SZ3A 1FNMA 4GU5A 2A1UB 5TY0A 5H59A 3QE4A 2PIAA 4LC0A 2HZ7A 4X0EA 4NCNA 3G4SB 2R5WA 3IOBA 5K0TA 2GQFA 2QTZA 2C78A 2V0GA 1PFWA 1O97D 5TR9A 1OWMA 3ND6A 2A7XA 5FO0A 1KTVA 2AG6A 1F4LA 1VL2A 1MB9A 4RD3A 2WSIA 3X1MA 5FO1A 1TYDE 3ZZ0A 1M1ZA 3IMGA 5THXA 4RPIA 3GLVA 4G5YA 3AKZA 3CC4B 4MYUA 1N2BA 5TV2A 2ZUFA 1KH2A 3G59A 3CLRD 4GRIA 1DDGA 2BN4A 4ARIA 4YP5A 3ZBUA 2BGIA 1A8HA 4JZYA 1JGTA 4ZCSA 2BPOA 1O95D 1Q11A 4C43A 2IJGX 1GVHA 4WNYA 1DARA 2DEUA 4QBTA 1OWLA 1H3FA 4MVCA 1LI5A 1H42A 4ZT5A 2B7BA 4LBWA 1EFTA 4I6EA 2QTLA 3CCJB 3FI0A 3AGPA 2VTBA 3AVWA 4MW9A 4MWBA 3G6KA 3P26A 3CMAB 2OTLB 1MJHA 2X1MA 4LBZA 1QRTA 3QE2A 2HGZA 3CVXA 1VBNA 4EG5A 2AHOA 1Q15A 2PG3A 3DV2A 4AC9A 1G7TA 2VYQA 3ES9A 4B44A 2GPJA 3FG9A 2YWCA 3JQRA 1QRUA 3IDFA 3UK2A 4MUJA 1IH8A 1G8GA 2TS1A 4KKVA 1U7DA 4NATA 1M8PA 5HUJA 2GM3A 2CV0A 1O96B 1M1KD 3B8HA 1YIDA 1N2IA 2A84A 3N8HA 3CW2A 2ZUEA 1GAQA 4MWDA 1FYDA 4TMWA 3CLRC 4MAFA 3RHSA 4U8HA 1VQNB 1NUUA 4EGAA 5K0SA 5H7XA 3SJZA 3Q12A 4DDHA 1GAXA 1IQUA 1MRZA 3FIUA 1QTQA 2OQ2A 3QFTA 1OWNA 3QFCA 1FRNA 1M8KA 2A4MA 5JBQA 4Q93A 3HMQA 1T6XA 1VBMA 2PXHA 4L2IA 4Q16A 1KRHA 4KPUB 4YMIA 1W87A 1M8GA 4F3RA 3ZJTA 2J5BA 3HGMA 4NBSA 4B47A 3MCAA 1ULHA 1EUQA 3LOQA 1KK0A 1NJID 1VQ5B 2X0KA 1OB5A 1NURA 1R5NA 1B6TA 1JIJA 4HJRA 5TEWA 2CNDA 1N2OA 4DE5A 1OB2A 4QRDA 1WXIA 3WYAA 2IELA 4K03A 1G8HA 4ZCPA 1NUSA 2QTRA 3VRHA 1K4MA 3MLAA 1WQ3A 4MVXA 2RE8A 3VGJA 3VNVA 1N8RD 2CRVA 3ZJVA 5F23A 1PFYA 1EP3B 4ACAA 5LLTA 3PNBA 5J5AA 1F7VA 3H99A 1QQTA 1GLNA 3ZXIA 1N0VC 1WJGA 3CLSC 3COYA 1HA3A 3CRZA 1MOPA 3SP1A 1V47A 2BMWA 3X1JA 4JYZA 4PBRA 1KK2A 3IODA 4M2LA 4ND7A 3U6KA 3AL0C 2G36A 3FOCA 1GTSA 1WDTA 3TZLA 4B4DA 2A1TS 2YWBA 3DO8A 3SYTA 1QFJA 3W2GA 1F9AA 3NBAA 1IHOA 3IVXA 1YJNB 1KH3A 3AGQA 3IOCA 3W5HA 2QN6A 2H29A 1QU2A 3JQPA 3WXMA 4HPWA 5KCMA 1I7PA 3P27A 1MC1A 1JA0A 4A91A 1J9ZA 2BGJA 1EXDA 4CT0A 2DLCX 1EXMA 3WY9A 3UOWA 3TNJA 4ZCTA 2EIXA 3A05A 3JXEA 4S1OA 3CC2B 1JB9A 3W2EA 4TN1A 2A1TR 3BL5A 2HMAA 3FNRA 4C0SA 1S4MA 1QX4A 2B7CA 2BM1A 5EMNA 1U3DA 3INNA 4MW6A 4RUKA 3PNVA 4FWTA 1EP2B 4HK4A 4XSVA 1Q82D 4MUEA 2WQ7A 3UY4A 4M4SA 4KPUA 4ZCRA 1F20A 1TYAE 1VQ4B 1TVCA
chains in the Genus database with same CATH superfamily
4Q9AA 1I5LA 3IAEA 1CYDA 4LHZA 2H1HA 4MLDA 3TAXA 2VDLB 2ZDHA 4GSKA 3WZ2A 4OI2A 3ZZTA 3QSYA 4X7DA 5AJUA 4JLIA 4YJ3B 2KVOA 1UK6A 2PU7A 4MDWA 3BKWA 1E7WA 3WHIA 4M7DE 5AW3A 2V6MA 3CCRB 3LXXA 3AEZA 1QAMA 4ZI7A 2GK6A 1MMAA 3QHSA 1M6NA 4B3BA 1G8YA 1Z0UA 1S9HA 3CO0S 2OC4A 4MVYA 4CL2A 1EFRD 1HUQA 2YLCA 1R0YA 3TRHA 4LN2A 3H13A 4KIWA 5IC5A 4C6SA 1APBA 2VJCA 3PMIA 1M8MA 4U9UA 1OHHD 2F59A 5FI1B 4G5GA 2C5GA 2VDWB 4NPAA 2HLDA 4P93A 4B6MA 5AVSA 3THXB 2VDVE 3C3XA 1KD1U 4JUDX 3SB2A 1CE8B 4BGEA 4KO8A 3V4OA 2A5DA 2AD5A 2COZA 4ZGBA 2UVQA 1Q17A 4AT1B 3L7LA 1FTYA 3QX7A 1CZRA 3F8WA 4Q4JA 3I05A 5DHPA 4D4HA 2XHCA 4RCCA 1ORTA 1L3IA 1W59A 3IBYA 1M1XB 2ZJ7A 3MT0A 1TAUA 5K1ZA 5L8RE 4GPAA 3GSIA 2DECA 1XEXA 1QOQB 4WY2A 4Y6LA 5AJYA 4BLVA 5IDXA 4OKSA 4AKGA 2YZMA 4F5YA 1ZUHA 1RCFA 1BMTA 4YR9A 3CIOA 3OTOB 5EP4A 3PPXA 1YZQA 1WR8A 2BZGA 4WHMA 2PS0A 2QHXA 1SY7A 4BIIA 1JIIA 4EBFA 5HQTA 1VJ0A 2C9OA 1FXUA 3OM1A 4CF5A 4JUAA 3SHVA 1CD5A 4M7AG 3M4XA 4FMBB 1YJNT 1U3CA 4QULA 1LX6A 1PT9A 2NV6A 2I2AA 2DC1A 3VC3A 2JM9A 1ZH4A 1DGQA 4M77G 4OGGA 4XR4A 3IBTA 4Z99A 4XFJA 2H2FA 3TSAA 4AY5A 4JBLA 1K92A 2LTAA 4EFKA 5C5EA 4DTIA 4K28A 2V5AA 3KL4A 1JBKA 3LT2A 2Y05A 4FDUA 1BS1A 3EXHC 5ALWA 3MRXA 2EARA 4KR6A 2WF6A 4GI7A 3ETCA 1AK1A 1W73A 2R44A 3AEQA 3ZHBA 2GTPA 1K5GA 1OE0A 3IA7A 2XZLA 5ALLA 3TRJA 1N8RU 3Q2KA 2HR1A 1D0SA 1ST2A 1J00A 4KGZA 3GFRA 1XN1A 3FTDA 1MN6A 3I01A 2YZKA 4W9MC 1RZUA 3OE5A 2Q50A 1D2RA 1RXUA 4LXXA 4XM1A 5D01A 1U65A 1YBHA 2B82A 3EIUA 3PQ8A 2VNAA 3AKDA 3P9RA 4QFMA 4M36A 2OHIA 4Q3EA 4X61A 1SUAA 5H16A 4Z5XA 4K6MA 1ZJ5A 3Q8WA 4XONA 2BELA 3SZMA 2P77A 2PJDA 1Y8AA 3GUUA 1K9MU 1NJFA 3DNPA 3ZH9B 3EG9B 1R4MB 2FSUA 5DLOA 1AIPA 3CF4G 3K94A 4A6XA 4I19A 2YJZA 2GK4A 4JBGA 5SYAA 4A36A 2UXCB 1BWSA 1YFNA 2EJVA 2WUWE 4H1HA 1GL3A 1NW3A 4EDFA 4IDEA 1LI4A 5EE5B 1YB5A 4NYIQ 2FPWA 1EJ6A 3SC2B 4MDFA 3L0OA 1QPGA 3PC3A 4XM3A 4OJYA 1Y6QA 3MINB 1EK5A 1XYGA 2YZ2A 5E4FA 1ZA2A 3NU1A 4YP6A 4R71A 1YU9A 2HNBA 1R50A 1QMCA 1R6XA 4OLHA 3O2NA 3SWWA 2WINI 2RONA 4LMAA 4WH0A 2V7QA 2Z58A 1WZNA 4WDRA 3RRBA 4BFYA 3E22A 3IPLA 3LCUA 3ZGLA 4LD9K 3CY6A 2CV2A 1AUOA 5CEEA 3TLGA 1ODTC 3EZ7A 2P11A 4D4LA 4RTPA 4JOCA 3M83A 4ZEVA 4ILKA 4YMHA 2UU9B 1T0BA 1ENYA 1QANA 5DP2A 5CA0A 3FY4A 1TD1A 4U2BA 1WHMA 2E6ZA 5GMOA 3IEUA 4AXXA 2G8NA 4QUJA 4XGIA 1K0SA 4JJ8A 1M0SA 1ZMTA 2PSJA 5JAQA 1JG6A 3KQYA 1E2MA 3GRYA 4C88A 4DCNA 1CQXA 1AY0A 2FDRA 3L7DA 4FCTA 1YVPA 2JJ8A 1MDBA 2JVIA 4XU3A 1ICIA 3DA8A 1AKVA 4FLEA 2EFGA 3OTWA 3I9LA 5AIBA 1QH0A 3BS4A 5I4BA 4G5FA 3O5ZA 2WWXA 1VE6A 1UJ5A 2Q07A 1RXVA 3ANMA 1ENOA 4HAWA 4K6HA 5CBPA 4DB4A 2BP7A 4C7KA 1K73D 1A7JA 1E2IA 4ER5A 3OZ7A 3IEVA 2TSYB 1VQOT 4ZHQA 1PEKE 1KI1A 1X7DA 2XUJA 3GB9A 1M5RA 3OKXA 2PZ8A 3C70A 1LBQA 1MZVA 3PIPA 2FU5C 3NT2A 4ZEXA 1GTG1 4G0XA 5HK8A 2HBRA 3X1ZA 4R2IA 1JG7A 4EGFA 1WB5A 1G19A 1TF2A 5AR1A 4PEVA 2RK2A 3EAEA 1V4NA 2I4TA 3QY9A 4IV5A 4RIIA 1VZ2A 4D0LB 5KYUA 2O5VA 4EG4A 4Z2AA 3S2ZA 5EHXA 2G1JA 3Q0IA 1R8YA 3DEAA 1Y63A 1ACMB 1AWOA 2X0RA 3GPIA 4KLCA 3TSYA 3A31A 2F5TX 1HYEA 4EMKB 3JWEA 3FYDA 3KM0A 5ALFA 3TCXB 4RD1A 2PGLA 3NTHA 3CX6A 3OPXA 1GSIA 4Q9LA 3SHOA 2XQFA 4EEKA 2JHGA 1HDXA 4K6FA 4OLBA 4PYKA 1Z8FA 3BDVA 4Z0PA 1PGJA 2EU8A 5EINA 1S2GA 3TINA 3ZHTA 2GD2A 4JLUA 1PF7E 4Q7KA 4MWCA 5K9ZA 3X28B 1BE6A 4R7GA 2C0QA 4CMJA 7REQA 1BVRA 4ZICA 2H4ZA 3UO8B 3ZN2A 1RYZA 3PWKA 4TL9A 1TRKA 4E5YA 4E51A 2FPMA 2VDPB 5H9WA 3I5UA 2JVVA 1K8AR 3HCEA 3R5HA 4OP2A 3TD2A 2GDZA 3BERA 1U0FA 3KAKA 4G5QA 1A8IA 3QXCA 3QPAA 4L57A 3HJTA 2IYNA 4C14A 5LP6C 1J1ZA 4YWJA 1QH1A 2QVLA 4MO9A 3E4DA 1PWTA 2PZ1A 1EX7A 4IIJF 3TX2A 1UMCB 1AQIA 1ZZGA 4EB6B 5AW5A 1W47A 1XTQA 1Y7HA 3SCZA 1VLJA 1E62A 2BE9A 4LZAA 3EXG2 4OXRA 5I9BA 3SU8A 1VCHA 4ZHQB 3RJTA 2I6QA 3M5CA 1D0XA 1G5IA 1YR8A 4KGDA 1IZ8A 3AEKB 4M46A 1YFLA 2MWMA 3KYDA 3DBLA 1I4K1 4LHYA 4MCAA 2X1LA 1OIVA 2IEYA 4HXJA 3G5AA 2P6RA 2AFVA 2F67A 3A6GA 2HWKA 2A7QA 4OHFA 4C30A 5M34A 5IKXA 1AKQA 1KJZA 5FWXB 3CCEB 2CUZA 2ERYA 2QL7A 4JC0A 1QHYA 2ZSJA 3CZPA 2ZM5A 5K4GA 2RGGA 4RCYA 4YDSA 4XU0A 2FPOA 3MYRA 2HWXA 1OZ3A 3KKLA 4X3PA 2XDWA 2Q6KA 1F8XA 2N9UA 2ZSIA 4MEBA 3BH4A 2OAUA 4URXR 2H2HA 2XDBA 3CXCS 1WDWB 3ZHUA 2HYIC 1RYYA 5B4VA 3DFUA 1F0KA 4D9MA 3HXOA 4YJ2F 4FFDA 4JJZA 1Z7BA 2V4ZA 1BA3A 3H1BA 3IX7A 4NJOA 4FYHA 1BQ3A 1WUYA 4QG3A 1TAQA 2HL5C 3M2PA 1WCIB 3LWIA 3JAMA 2Q6LA 1NUTA 5JSKA 1C1HA 1G8PA 1P4JA 3ENVA 3RKRA 3RV3A 2MSDB 4DMKA 4L8YA 2Y1DA 1UUFA 4MW5A 2VEDA 2IUTA 1YONA 1PWZA 4Z4RA 1XZMA 4ZT4A 3ICPA 4R8VA 3MUOA 1E7MA 3IQWA 5DTIA 4RF3A 1KMHB 3JX9A 2FXVA 1EFLA 5JYEA 3MG9A 1H3EA 3BAFA 1B15A 2CJYA 3CCQT 3OJXA 3DNMA 3TLJA 2Y4YA 3K70C 4BD3A 3SC3A 1DFGA 3OF2A 1DTSA 4ZCIA 5KX5B 4K3UA 5GOTA 4D80A 1UDRA 3A4MA 4RMJA 3U7GA 2GHRA 2WNSA 4XYBA 4MW1A 1C30A 1VBKA 1QHHA 3KXLA 3OT1A 3VRYA 2E3IA 4XQ9A 1VJRA 5KNCD 5IN4A 5L7YA 3T1HB 1O94A 5AXAA 3U39A 3U16A 2NZUG 4IQ8A 5AHKA 1NE7A 4YA6A 1ZMXA 5IJ0A 2I54A 2LGJA 2JIZA 3CVVA 2WJJA 2GARA 3F9IA 2D0IA 1HBJA 2C4WA 3JAKB 4R1QA 1Y48E 2B9VA 5FPHA 3UW3A 2JBAB 2AXPA 3TBFA 2DYIA 4LKOA 1UWVA 3TUZC 1UBFA 2KQUA 3IVGA 2DHQA 4EY4A 1WU7A 5EFOA 4ZCLA 4QNMA 4EAAA 3OYAA 1W2BP 1XT6A 4K9RA 5DGDA 5F98A 1YF3A 1H2RS 1XAHA 2IYOA 1Z56C 3EAGA 4U7JA 1B1CA 1SKAA 1JDBC 4MQEA 3UWOA 1D7OA 2Y76A 4MQFB 3VR6D 1E20A 4C0HA 5H8WA 1DINA 1QCYA 5F5LA 5EHQA 2O57A 3T7KA 4QQFA 1WYXA 4UOQA 5AKKA 2WD9A 3B60A 3DZFA 5IZCA 4LPKA 2BZ1A 2ATIA 3OM0A 4JDPA 4KDFA 3NVMB 4OOXA 2RFLA 5D87A 1DKMA 4R54A 5AKIA 1BYIA 1BXKA 3VZSA 1ORIA 2PKRA 4YB8A 5D3KA 3RSOA 2YHAA 2JJ1A 1C9YA 2FX5A 2Y9MB 3BL6A 1I4WA 1UKYA 2WIDA 3VNAA 1LLUA 1AGRA 3MTGA 1VQMQ 2VNJA 4Z8YA 3ZOKA 2ZS7A 3G8YA 2EFIA 1FUYB 3FDJA 1NN3A 2E18A 4YRLA 2BFEA 5FOTA 5AW2A 4ZEWA 4S0XA 5L7WA 2QX4A 2C2KA 2C2BA 2QT9A 1RDFA 5CXQA 1ZM2A 4QDXA 3KYDB 1YAHA 3ZDQA 4DLRA 3L84A 3A4YA 2C31A 4BBAA 2B30A 3TJRA 3WIOA 2GUWA 4F2GA 3OWXA 1T34A 4X6YA 3W7VA 1TZ2A 5AUNB 3ZVMA 4BNXA 3UG6A 5I7VA 3EG0A 2EKOA 1ZJYA 3NC0C 3V3KA 2LDBA 1CY2A 4W9NA 1ZD4A 3S6WA 4B09A 2W48A 2XNDA 1N8KA 1KTVA 1GZ4A 4B3FX 1FFXB 1VL2A 2X41A 3GWZA 3T9EA 3A1PA 2LP4Y 2C5AA 5E6UB 1TYDE 4ZVKA 2F3TA 5ILGA 1SUEA 4ZAXA 5THXA 1UBGA 1AXEA 1B6RA 1Y1RA 1WPCA 2QYOA 3OCUA 4LISA 3WJ7A 1YS2X 2I2DA 3E9NA 2C94A 2ZSFA 4HH3C 4BVBA 1ZM7A 1RLTA 4GI5A 1V2HE 4EJSB 1SHKA 1DAFA 1W2WB 4B45A 4IS3A 9ATCB 1C7RA 1FB5A 1P17A 1RRGA 3P2JA 3LDFA 3WLSA 1AKEA 2BPOA 3OF3A 2KSSA 3HKEB 1MZPA 2XRFA 1VQ5A 1Z3IX 1YHQQ 5A04A 5K4HA 1NY5A 2A14A 5ADUS 1QZUA 1UDWA 1DFHA 5B3AA 1NT2A 1J2EA 3THRA 4N82A 4TXJA 521PA 3S2IA 2XODA 3F5MA 3WJ1A 2HAEA 3VH4A 1E8NA 4KV9A 3FI0A 3QBDA 1ML4A 3BWVA 4L8VA 3UJ7A 4RMGA 1EWVA 5GQSA 2DTEA 4CHTA 4YRGA 2R5AA 1TZMA 2NV2B 1XZQA 5F51A 3CZMA 1YZHA 3B2EA 3PJGA 3ZE2B 1NF3A 3OQPA 4L4RA 4MYHA 3ROQA 1NASA 4G2TA 4J94A 1L7DA 2QGNA 3SFVA 3JCMP 5CTAA 3UK2A 3M55A 4KNYA 1G8GA 4HWKA 3QWIA 1P74A 1JV2B 2X85A 2QRZA 2QYHA 4HGQA 1UM9A 3OCVA 5DT2A 4RTVA 1O96B 1UBJS 1B00A 2PH7A 3OG9A 2ZUEA 4Y6PA 3U4DA 3NHKA 1SVIA 4NYJR 5GJVC 3WYDA 4XPIB 4E5PA 3WLKX 1N1MA 3NV9A 4M1YA 2X0EA 2ADOA 4XZ3A 5KX5F 4AWXA 1NQTA 3MQFA 1K2VN 4YFVA 2QQRA 4QYMA 1Y8QA 2C96A 4A10A 1LCKA 3K2IA 5LQCA 4CFYA 1YRLA 2II6A 2GX6A 3MRVA 4FHZA 4PX2A 4TKZA 2QG9B 3I6ZA 3TRDA 3U3OA 4C08A 1VQ5Q 4BYGA 2C7VA 4M77E 1VTKA 1LSJA 2KAFA 2OTJT 1Y4UA 1BMFD 3HGMA 3JQ9C 1I2BA 1VKZA 2CY0A 1EGHA 2ILTA 4RADA 3RVQA 4DNQA 4F6RA 4RGYA 3LQ4A 1ESZA 2VRNA 1JIJA 3D1JA 4MVJE 5TEWA 1TIKA 2P6NA 3I09A 4IDPA 3LLRA 4LYDA 1Z0DA 2QK0A 5I8WA 2G9VA 4RVUA 4ZAWA 1TA4A 5M3BA 4LRQA 4L4SA 4QO7A 2M5SA 4A23A 5L3SA 1JAZA 2KBEA 1I3LA 1K4MA 2WT4A 3IT0A 5E3HA 3H18A 5FFFA 2X2FA 4XA8A 3ULKA 4E2WA 3D3KA 1R8SA 3M0EA 5H83A 3L2RA 1LEHA 3NMZC 1H0RA 2M1HA 1NRKA 4MGEA 3TYXA 3ZGYA 4L72A 3PNBA 2LTOA 4XI9A 2AIRA 2ZJ1A 3ZY6A 1L5KA 2QW8A 2QDLA 3RRJA 4ZYXA 1SWWA 3WL4A 6REQA 3I32A 4G3XA 4X6LA 4GMKA 3DV0B 2R00A 1Z0SA 4GG1A 2I9KA 2EC5A 2MYUA 3U4IA 1XP8A 1SUSA 1U2SA 3M3PA 3AF4A 2F48A 4JBHA 4OHBA 5GAMe 2P67A 1EXVA 3U7RA 2PUBA 1N32B 3LYHA 1II9A 5LZ7A 3U81A 4TTQA 3R5JA 3RT1A 4G37A 1YVEI 2RAFA 3FYTA 2LCCA 1Z4KA 1T9CA 1UZMA 2ZSHA 3QVLA 3U3KA 4EHBA 5LNK6 4CG2A 3AGQA 5FOUA 4M99A 1A27A 3QENA 2PWBA 4HPWA 3KSBC 2IYUA 3L7MA 1BX3A 2G5PA 3B85A 1QWSA 2G1UA 3MPUB 1MC1A 1JEYB 1POXA 4F4FA 1UP4A 1PLLA 3M4NA 5I22A 4BY9E 1MO2A 4G6IA 1DAHA 1E99A 1R37A 1PL7A 4DC0A 4LJ5A 3VV0A 2CD7A 4ZZ0A 1DZIA 1JB9A 2HK7A 2OTJA 3JZFA 2IPLA 2Q3DA 5I8ZA 4RTMA 2HMAA 1FFEA 1S4MA 1PO7A 5E1BA 1Q1GA 4KU4A 4LJ9A 2JD2A 2P9BA 4HK4A 1PSZA 1CJTC 4ZDJA 5K0ZA 2H5JA 2WQ7A 3GDFA 2HQXA 1Z2OX 2JCYA 1S8OA 1UXJA 2WJZB 5ISMA 1ZQ1A 4JB0A 4AWAA 2LIPA 2LW7A 3HI4A 4NCXA 5TX7A 5A7FA 5FUQA 4CM9D 1UBCA 4XDYA 3KQMA 1N5KA 4DMMA 3IAS1 3U61B 3KXPA 4GAEA 3FOWA 3VHXB 5A62A 1AXGA 1FFCA 1YS9A 4QICA 4P22A 4PJOF 2C42A 4J75A 4PJJA 4XU1A 4HNSA 1U2GC 3UHJA 4KLAA 2WYRA 3AC0A 3LKZA 4OB7A 4WTOA 3RDPA 2ZYUX 3USES 5HJEA 2MI6A 4IJVA 2VWFA 4FGSA 3BH6A 5FQNA 2B5OA 2VBUA 1GPLA 2EERA 1HI9A 2IZ7A 4IH9A 4JT2A 4OXKA 4Q3KA 4QSMA 3T9BA 1W0CA 1Y82A 1SUPA 2FK7A 2NU7A 4QVZA 1K0UA 1PUIA 2GUGA 1U1IA 4UBNA 1ODCA 3H5VA 4D0SA 4F97A 3ISXA 4NAHA 4EF6A 4E07A 4N5IX 3ZDBA 2CHFA 5JVDF 3I83A 4BRWA 4JI5B 3IE1A 3WNBA 4Y2RA 3ZW9A 4RK1A 3TLCA 4TXMA 4KBMB 1SM4A 4QX6A 2W0SA 3MD0A 2DMRA 3JATB 3MGKA 5LXTA 1PT6A 3A4TA 4O29A 1ZMBA 1P5RA 4W7IA 3EUEA 3H97A 4IZ6A 3VO8A 3G0HA 2IS2A 3EBOA 1SC6A 1XTZA 3RBZA 3MAGA 1MB4A 4FWBA 3GD5A 2HBQA 3QKUA 3S8YA 4DOWA 4FFSA 4NFYA 1QIFA 2CF5A 1QE0A 3IE0A 4OKNA 2XKJE 5EJ8A 2CP2A 1YDHA 1C0LA 2FSVA 4B79A 4D4KA 5EPUA 2PKWA 3IKTA 1GU0A 1OFHA 2C99A 4MKHA 4PBTA 3W2TA 3ZPXA 1PZXA 4IG4A 4UC0A 5FNVB 3WNVA 1TEXA 2GM5A 1BS9A 2JZOA 3DAYA 4UDXX 2RI0A 1AOJA 1HL7A 2QB5A 4RHUA 4FN4A 4B35A 4BX3A 5B53A 1A76A 1OX5A 3VS0A 2RI5A 2IV7A 5E3JA 2EAUA 2MT9A 3M70A 1ESEA 4RPJA 2W90A 3T35A 2H8KA 3W90A 1RQ7A 1DX6A 2WABA 3K1TA 3OMXA 4EO4A 1BDJA 4RS3A 1OUMA 2JH8A 4HWRA 2BFOA 4TVOA 2ANBA 3K8QA 3QBJA 3TFQA 3QKJA 3G6EB 1YUMA 4CL8A 3OX1A 4N0DA 3OOSA 2EJ9A 2GN0A 2O05A 3UA4A 3MS7A 4ESOA 1ABQA 4IIJB 3EG5A 4D9CA 1KEVA 4KQ9A 2XWBF 1VQNA 1DJOA 1WHLA 2G76A 1WGSA 3LX6A 3W8RA 2UYCA 2N0SA 5L7TA 1BQ4A 4DC9A 2VHTA 4R68A 3KHUA 4E2FB 1N08A 1O87A 1CJKC 2C8JA 3LYAA 5LP6B 4M0DA 2R5NA 3DXZA 4O0MA 3OT1B 1J8DA 2IYWA 5DHAA 4FSXA 3KOUA 3SLRA 2QAGB 2VBVA 2JHPA 1COWD 2RCNA 3DZDA 5K2OA 1T8YA 1ANKA 1GNRA 3BSYA 1FUEA 2QORA 5JSQA 1N36B 3G7UA 3JCMQ 5EJ6A 4MVJP 1TB4A 3UKJA 1DRKA 2FN9A 4JHXA 3I0MA 1LTHR 5D1NA 4Z7NB 3LQ6A 3NGMA 5TF4A 4CM4B 2FN3A 4NRDA 5FA5A 3VMFA 3RSSA 1MLDA 3OKPA 1P2UA 5BR1A 3LQRA 4J0QA 1WY7A 2P2NA 3VOTA 4ZT2A 1K6MA 1TZCA 3WNQA 4KO1S 3ZWNA 4IIUA 4TWRA 4DV3B 1Q77A 1FZTA 5A0FA 3RSQA 1XUOA 2QJWA 3U4AA 3AHIA 4A26A 4F4CA 4E7IA 3HB1A 5GAMf 3HDGA 4LDNA 3HRKA 2JIRA 3Q9LA 3UMCA 1T8UA 3BX1A 4FW8A 3PL1A 5MHTA 5A1JA 2QA4Q 1CS4C 3FW1A 1WBJB 3DZ8A 1JYFA 3A11A 3NALA 1LUAA 3N0VA 4AM8A 1M2WA 2H1WA 3T5PA 1JDJA 1OAOA 1W85B 3OJWA 2G0TA 3TLXA 1LJLA 2ILVA 4UCXA 3ZFJA 2F17A 4DR7B 5JAHA 2Q46A 2JMAA 4IZIA 2ZDQA 3FROA 4HX2A 1PRLC 2MHCA 1MDFA 3REGA 3SXUB 1SULA 3V4PB 1CB0A 3CNQS 3SS9X 1LLDA 1SMKA 3GJ0A 5TGTA 4ZJYA 1NBMD 3H6HA 1MEOA 4MGKR 1SB9A 3IUBA 1IJBA 1TZJA 2GZAA 2HO5A 2KPOA 4RHCA 3WLMA 4EBBA 2JLUA 2PUFA 3CCSB 1TZKA 1YBYA 4ZVOA 7ADHA 2CSIA 4QUHA 3A4IA 1CQIB 2C2XA 1PR9A 4J6FA 3T15A 3V8RA 4BNTA 2BZYA 1U1TA 1CRZA 3D7NA 4H0CA 3QJGA 2HADA 3RW9A 4BB6A 3W4IA 1P4RA 4EUNA 1Q0RA 2JAOA 4EA7A 4N47A 6Q21A 1DC5A 2CT8A 1V16A 4LKRA 3OYHA 1QV9A 2DZDA 5BY2A 2E4YA 4YLEA 1XDZA 1IB6A 1SRMA 3QVJA 4GMHA 3T3DA 2PTHA 1Y5IA 3MTJA 2Q7OE 4ELYC 1WCWA 2C3UA 4JKYA 3KFXA 1PG0A 2RMKA 5ELMA 4YJ2A 5AFSA 4XFDA 2GN4A 2WWHA 1T1RA 4PHFA 3E9MA 3QKWA 1SVMA 3AUYA 1Z2CA 3AZOA 1AKWA 4LSGA 5U9CA 4FKMA 2H6EA 2X35A 1D2NA 3HKBB 4CN8A 1R0LA 1P62B 4NMHA 5DTJA 1YWOA 2PMKA 1E1KA 3LX8A 4DIKA 1TLFA 1ONBA 5EPOA 1FK8A 1WF3A 3SIRA 1X8XA 1W6XA 2WR8A 1OBHA 1DQZA 3N2GA 1SD1A 2HK9A 3QEMA 3PHHA 1JFSA 1NP3A 2ZREA 1N9RA 4D46A 3QYHB 4RWZA 3MJFA 4FZ5A 4C1NA 1ZCAA 3AHFA 2VGMA 2AJ8A 1F4VA 4QJBA 3UKDA 3DJYA 2P2YA 4FU6A 4ROXA 3K0FA 1MNQA 4WXRA 1X6GA 2F9FA 3SS7X 3NV7A 1NKVA 2B35A 1N8TA 3PFFA 1B8UA 2Q9BA 4IIJA 4L8WB 4UUQA 3R7WB 3HHTB 1USIA 1IHWA 3BA6A 5CAEB 3RR2A 4RDXA 1NEBA 5FV7A 2M51A 3KFLA 2J5RA 3JAKA 2TYSB 3T06B 2QN7A 2CZ1B 4GP7A 3WKDA 5AW1A 3BWCA 4ZGJB 2C2HA 3D1VA 3Q8XB 3JCMV 1KHHA 4MLZA 2IW3A 1ZSVA 4MQ5A 4DKJA 1I6KA 1UEJA 3EFOB 3KUXA 5CT8A 1MC4A 3DDZX 3Q3VA 4L0CA 4XLTA 2EATA 3DE2X 4XWOA 1JHQA 1V8FA 4DNFA 3RIHA 1QH9A 2HN9A 3G23A 2PXXA 1NVVQ 1SU8A 2NQTA 1LPOA 1N4DA 2NXWA 3OYLA 3KB1A 3WRVA 1M54A 2QRQA 1P72A 4K1LA 3PYMA 5B7PA 2L42A 4YAWA 2FXIA 2QPAA 3ZK8A 3PF9A 1LOJA 3BB4A 5FWCA 1AOXA 4QT4A 1VHJA 3CC8A 4IYJA 2IYEA 3GEIA 4A91A 4TWIA 4CT0A 5KDDA 2ZIEA 1AMUA 3UB3A 3C3PA 3RAEC 4ZQHA 4JBXA 3N39C 1XXLA 3RYHA 4AO7A 4B82A 5K99A 3IOEA 4NOLA 3KKNA 2ECOA 4X41A 1FYXA 3WGYA 5LZ9A 2QTNA 3U49A 1U5AA 4BMYA 1ZH0A 2D1TA 1ODKA 3A8JA 4EYEA 5GV8A 5EZYF 2V3VA 4ZHQF 4EVRA 3ND9A 5J39A 1Z5WA 3H1AA 3LTEA 1LBIA 2Y0BA 4LBVA 4RD4A 1OYWA 2DHRA 1DV2A 3ANLA 3FM9A 3HYCA 3MVEA 4MOWA 2VK4A 4GBQA 4Z9XA 2PO7A 5A6SA 1OBOA 2MINA 1W6UA 3BMXA 5IDWA 4DRZA 4CV1A 4N7BA 1RC8A 2HCRA 3QWHA 5AT1A 4E0BA 4R1OA 4JVMA 4H27A 3ICEA 4G1EB 3F3SA 3F8SA 4FMDB 2QTBA 3IVAA 3I8SA 3CVJA 3D6JA 3K9BA 3IA2A 3RRMA 4R8KA 3BK1A 2FEPA 3OPOA 3ACDA 2FRXA 3SYNA 3EFOA 1OX6A 1ZICA 2QAGC 1C4WA 2OO3A 2XHEA 1PL0A 1K9MC 3CNLA 3IV6A 4FMDF 2QW0X 4Z86A 3ASVA 5GJWC 1O57A 4BNDB 4ENTA 1P1RA 4LXUA 1CUXA 2ZUUA 4KB5A 4TZ0A 3OKCA 2PTGA 2XGGA 1AVZC 2KGTA 1BCRA 1BVYF 1I6MA 4JJ6A 4UVGA 1CPYA 5ALGA 3VH2A 4MAAA 2XMDA 1DMSA 4P1ZA 3VU8A 3ZZ1A 6GPBA 4JXXA 4BGUA 2FDXA 4CV2A 2HW8A 3TVTA 4JL6A 3RWMB 1WHJA 2ZAMA 1AQ6A 1IC6A 3HU1A 5DHUA 1F3LA 5EUQB 1W9XA 4DJDC 4JT8A 3UJ9A 1K73R 1JEQA 4OA5A 1V3TA 4A5OA 4Y7CA 4CMCA 1NLYA 4AO8A 4ITRC 2ZULA 5CDFE 4I3FA 1P0CA 3MLEA 3LX7A 1DRVA 3CRNA 3DTNA 4L4XA 1R0WA 1KOGA 3R0QA 1CFJA 4OFBA 5J43A 4C0KA 3HFRA 3QMWA 3CCMQ 5CFQA 2OXTA 4ZYLA 5CEFA 2ZTNA 4MCIA 4X93A 4CL3A 1P77A 1NVVR 2ESWA 3GVHA 3LC7O 4LDPA 3VJMA 3F46A 3CC4A 1HQDA 3JAWB 5FU7C 1Q0SA 1WKBA 2C9MA 3IP6A 1Z4IA 3D4IA 3NGXA 3PUJA 2EQ5A 3PQ4A 3BGIA 4TLBA 2CV1A 2YWHA 1HMYA 1KOLA 2JAPA 1A9XA 1MX1A 1ZRHA 3NATA 3H0IA 2PV7A 2ZVPX 1JRLA 1RJ9B 3MB8A 3IQXA 1GZ7A 3P4UA 3HA5A 4LJSA 1CUFA 5B6IA 4HN4B 4NESA 5F9MA 4EI9A 3IKLA 1XTPA 4RY2A 1ZEJA 1XNHA 1UD3A 1G6OA 2C98A 2DBVO 4M6WB 5TS3A 2F1IA 4DAEA 1KRXA 3ODPA 2A28A 3J81E 5DBOA 2ZKLA 4UM9D 1P4SA 4CIWA 4Y30A 2JAWA 3NPMA 1GAWA 1LBHA 4FFVA 4IGIA 4PAQA 1J99A 3KV3O 4FZJA 3G71Q 5CNIA 3RG2A 3RYIB 4WLUA 2DFUA 1Z2PX 3P8DA 3SN6A 3G6EA 4ZFNA 2Q99A 3DOIA 3SFZA 2ORWA 5LJ3g 4BFLA 2WU3A 7AT1B 3CQTA 4CI0C 4JXKA 1XVLA 3J7AC 3D4PA 3HJCA 5LZ4A 1MCZA 1UKZA 5BYJA 1EVZA 2RHIA 4NF2A 3CJTA 4JROA 5C7YA 1JAHA 2FWBA 4XGQA 3FFTA 4LVOA 1O97D 1HMPA 3H5NA 4IVNA 1S72A 1Q7TA 5J2UF 4RQTA 2YY7A 5K0CA 5JXWA 1RAAB 5FR2A 2A0WA 4C20A 4RZSA 1EXWA 3NHNA 1N3BA 1OGYA 4RORA 4Y9SA 4RJJA 1T4MA 2F1MA 1YCYA 3IMGA 3LX5A 4UDYX 1GYQA 3U3DA 3ZNPA 1TZBA 3E84A 3H8VA 1S1CA 3MJEA 4L6CA 3TN7A 1MB0A 2HF7A 3G9XA 3WIBA 3TOSA 3T1TA 3JQBC 2ZUFA 4RA9A 1I13A 3GJYA 3C5WP 4RZXA 1RWQA 4GX2A 3QEAZ 1BI1A 5I7EA 3I9QA 3HU2A 5AKLA 4BKMA 1IXDA 3WLHA 3FF4A 2Z5VA 4XM0A 3THSA 4M21A 1AO0A 1H8KA 1QKWA 4HB2A 4KH1A 1JU5C 3U3ZA 1P7VA 1M67A 4AJJA 1T1IA 1V7QA 1TQ4A 1JSZA 4MRRA 2PFKA 3INRA 1I80A 1NHWA 4KHZA 2XOKA 3RNLA 4ENRA 3QF4B 4LBWA 3AJEA 3RSFA 3NHFA 4AKHA 4U00A 1F6WA 1MV3A 1KMHA 2C61A 3I1YA 2QAZA 4CCYA 3SIXA 3KUFA 2HGZA 4M75B 4JLWA 1DEHA 3NUZA 4LWOA 2CJFA 5EYPA 5KQGA 4D25A 2DHDA 2DL4A 1W4CA 3PF8A 4TSRA 4M77F 3WRWA 4DCCA 2WJAA 1N5OX 2VEOA 2ZKIA 5GMKm 3TVYA 1H8ED 4G4IA 1QH1B 3D43A 1HV8A 1PKSA 1FYFA 2NQ8A 4JSRA 2FLWA 1JFRA 2I4NA 4YUVA 1KIKA 3H5OA 4JVLA 4YV0A 5JY6A 1H4SA 5GVRA 1RMQA 2A78A 2I4MA 3T61A 2ZQ5A 4MWDA 1JR3A 4MAFA 2DILA 1BXRB 3PV0A 4HHEA 3UJBA 1OQKA 1GRCA 3VSBA 4AJIA 4WBXC 4C7OA 3REBB 1SQ5A 1KU6A 3HKDA 1X2BA 4FJ0A 1FQJA 2MMPA 1ZX6A 4OQXA 4Q3CA 4TL8A 4WZBB 4X45A 1V16B 2FUNB 2PGDA 5K0TA 4Q93A 1L4HA 3FDFA 3JZIA 2NU6B 1O95A 3TQ7P 3RUCA 4R4JA 1K7XB 3R5FA 3EXIA 3O1HB 2DF8A 2PNIA 3FC3A 2C1ZA 2K2QB 3AUSA 2NXCA 2OP1A 1T43A 1OB5A 1XDUA 2XXJA 3L6EA 1E9BA 3R41A 4LZNA 1EAYA 2B1IA 5CLGA 2IXBA 1U0EA 2QTHA 4Y2HA 4Y2SA 1EQAA 3IJPA 4BVLA 1SQSA 4D8YA 3L5KA 4EHNA 4BNMA 5LJ5d 4PWYA 2ZBVA 2WPDA 3CCJA 1I1QB 1EK2A 1PV4A 3QWYA 1XTVA 1RKBA 2WHPB 2ZTUA 4IHAA 2WM3A 3UANA 1QIIA 1ZGGA 4L9WA 4DY4A 4GM1A 3A1CA 1OX4B 3HKCB 2A5GA 3C8MA 4HAYA 1PGOA 4TTSA 1ZX1A 1PFYA 3ZHQA 4JRPA 1EP3B 1Y7PA 3RVDA 1F7VA 5TVGA 4LECA 3H99A 3SOPA 4I1UA 1WA5A 5C8YB 1WJGA 5EUCA 4PKCC 2ID9A 4K86A 1TU0B 5CVTA 1Y3BE 1KK2A 2VTEA 4ND7A 1E6HA 4CMBA 2QR2A 2J0EA 1X43A 1OPLA 1H5UA 1MV0B 4J0IA 4DIDA 4DY6A 1EQUA 5I7AA 5A9SA 1I10A 2I2BA 4XX1A 1N2XA 3T9CA 1SUDA 1NB9A 3KAQA 2QN6A 1Y7TA 2JFHA 4RVOA 1QU2A 2QSZA 2IPMA 5IUKC 2YVQA 4XEHA 5KCMA 4BO9A 2IH5A 4CKBA 1A5ZA 4V2SA 1KSFX 3EDCA 1OR8A 1VQ9A 2LR0A 1NXWA 2B1GA 5DM4A 2VTKA 4C5CA 2I6UA 4QU5A 3WLPA 3HFNA 5TLSA 3HGTA 4MPTA 1HDRA 4DXAA 3RJ5A 2A1TR 1PW7A 3CC4T 4C0SA 1P0MA 1GQ2A 1GZ5A 1E0DA 3I0ZA 3IQHX 5CNJA 1NJIR 1HFEL 5JD3A 4E5KA 2OGUA 1QVRA 2M32A 3AR6A 3CG4A 3JQGA 4KNWA 3RUFA 3SNKA 4ZOLB 3DYVA 1NZFA 1TL7C 3B1XA 3H1PA 3NFRA 2Y1FA 4HY3A 4NBLA 4UVDA 4Q12A 4X64B 3OYYA 3AIIA 1LW7A 4ZVLA 3EH1A 5HMLA 2D5CA 4EUFA 1PR0A 2ACWA 4M7PA 1BHQ1 2MSKA 3W3AD 4JX8A 4FDMA 1G5QA 1BROA 4WLNA 2K57A 5GTDA 2O8EB 4XQGA 3CKKA 5KYWB 2XMQA 1DT3A 4AZWA 4YPVA 4BFUA 4C8QA 3FDZB 4CCSA 2JT4A 2XEDA 2XUQA 3E2IA 3H7IA 4IDAA 3ROKA 1LV7A 1YI2Q 1YS7A 3QKSA 4JVNA 5KDOA 1QRSA 1PRYA 1R16A 2FVXA 2P6UA 3LQEA 1FOEB 2HEGA 3NTQA 1BE8A 3S40A 1Y6FA 5DRYA 2ET6A 3S1LA 5IJZA 4RLHA 3CF2A 4JHLA 4KAFA 3W3AH 4BNGA 5L51A 4YLGA 1SKUB 2XDAA 3AP3A 3MS4A 4HWTA 4NECA 4Z9AA 1DZ3A 1Q3TA 4GWLA 4LE9A 3KHTA 2IDMA 4YCSA 2BBOA 3PJFA 2G0AA 4BNDA 2I2WA 3TKLA 3S2YA 4DQ0A 2FPXA 2ZXFA 4DM3A 5H02A 2Y68A 3W2FA 1P2VA 1QHNA 2OK7A 2C58A 1BI2A 1YULA 2FEMA 1N25A 1ZSNA 2ORED 1LKZA 1XB2A 3ENKA 1YGYA 4XKVA 3CKMA 2BMFA 1GPBA 1PLKA 3R3WA 4TKVB 5AK3A 5EEHA 1I7QB 4ACBA 5LJ3e 1XCGB 1PV1A 5EJ2A 5HZGA 2RKWA 2FX3A 3EC2A 4JEHA 4J9GA 5GAN3 5M2QA 2C8KA 2JTFA 2DBYA 4E5UA 1E2BA 2FPIA 2EGEA 2OO5A 3NBYC 3CC2Q 1SVKA 5BV2P 4GKKB 1KO5A 1C7FA 1XF9A 1KVUA 5HG0A 2XLBA 2FQWA 1EM6A 2FSVC 1NBIA 4GO1A 2ZRIA 4IQ0A 4MUYA 1KMQA 1E3MA 1U04A 4X85A 2QTGA 1FFBA 3IMFA 4I50A 3VNSA 2VP6A 2JAHA 2E4UA 2ZUWA 4RTJA 3FYUC 1B26A 1TF7A 3OZRA 5FB3A 4JJFA 4DR5B 2WG2A 1GNLA 3FPEA 2O01E 4CRIA 1RRPA 1NF8A 4RS4A 4YPFA 4M87A 3WC4A 2C7PA 2RHGB 3GV0A 3A3YA 1RL2A 1Z06A 4ZYWA 3BF7A 1CHNA 2B98A 3X2EA 2RJOA 3ETHA 5F1OA 3C97A 2EZ8A 2G83A 2OLEA 2FDCA 3MFYA 3UAGA 2FG5A 3O75A 2J6OA 3P8ZA 2R87A 3D3WB 3VZDA 2H4YA 4DBLE 2N46A 5IVKA 1GCIA 1KI9A 1HSQA 2L2PA 3W5DA 1DRWA 1ORWA 1Y3AA 3KJHA 4R9VA 3GLFA 3P4YA 1YKSA 3E81A 5F4MA 3MEWA 3HCRA 3ILHA 3FGOA 1SKQA 1M5Q1 4V3CA 2PFGA 3G8DA 4ODIA 5B7QA 3W6UA 5ADVA 3G2KA 5MGNA 4D41A 2GZ2A 1Q0ZA 4LOHA 5JZOA 4B48A 3ZBTA 2K87A 4HE5A 2X13A 3O95A 4MGYR 2V6BA 1PJQA 3P9NA 3OKFA 3V34A 2JBHA 3HYTA 5EEGA 3V6MA 3ZIUA 2CSQA 3M1YA 1Q81R 2Y71A 4A1OA 1ZINA 3UJ6A 2WFZA 1J24A 3SBXA 5KNBH 3QPCA 1YRBA 5DM7R 3F74A 3AW9A 3CCRT 3HCDA 3UF0A 4Q15A 4RVCA 2R6GA 3BMNA 3OFJA 1XK6A 4JQCA 2ZB7A 2UZ1A 5IZCC 1P73A 1E43A 1DJQA 2AZMA 4JPBW 5A5VA 1BX1A 4BCCA 3TGLA 4MUNA 4UFPA 1UR5A 2Y4OA 2O8VA 1CY7A 1ZOIA 3TREA 2VHEA 2CS7A 4P7BA 4R6XA 3G7SA 2FQQA 1NFFA 2IEAA 2BF4A 1U02A 1JXAA 3FVTA 3HUDA 1EM8A 1ESMA 2OGTA 2Z8YM 4I5DA 4TKMA 2R8EA 2VT6A 4YRSA 4C29A 1SKYB 1IVSA 1JDVA 1TGYA 3I04M 4TKLA 1I0LA 3MIIA 4HDQB 2W6NA 4NNJA 1LC0A 3IUNA 5MFZA 2LJ0A 1LQTA 4K1XA 1JI0A 1PU2A 1GQQA 3CP2A 1U9IA 1W1UA 2EKQA 4HRAA 4MR7B 3DOOA 4OQYA 5D6XA 2FQXA 2WTXA 3FSEA 2C2YA 5G2OA 2Q9AA 1X2KA 3NDBB 3ZCUA 1I7DA 1IJEA 2HRBA 2WU8A 3G8AA 2X5XA 2XYQA 2HDWA 4KITB 1T8RA 5L3QB 3DL7A 2O8FA 2KJQA 2BM9A 1LQ2A 3F1KA 3GXOA 3Q3IA 4FM9A 3ORFA 2A67A 4L22A 4G1VA 1Z8HA 4KFRA 3GBVA 4CDNA 2QNBA 4JJAA 2YXNA 5DYGA 2VYTA 1O5TA 5JTTA 2RI3A 1NLFA 1M2VB 1WZUA 3WGKA 5A4JA 1C0MA 1Q1NA 2FZKA 3GZNB 3TSOA 1YQUA 3C4SA 3K9CA 4XASA 3EPKA 2PT9A 2FP3A 2YJ5A 1T10A 1PHPA 2J85A 1DAPA 2CDTA 4D8KA 2EJBA 3BHNA 1CUAA 1E2GA 4GWGA 1BHJA 1OYXA 1XEWY 1FXSA 3DLAA 2XBLA 3I9V6 4HX5A 4EYGA 2AMJA 4YUXA 3NH9A 1L3BA 4P3PA 2Q5EA 3EA4A 3OE7D 2ODEA 2X4IA 2HJ9A 4Z3KA 5C32A 4J16C 4C2AA 1CY4A 1VQ8Q 4N3NA 4F9TA 1JQBA 3UMYA 3PUHA 2JTMA 2AUNA 4KLRA 4K40A 4LJRA 1X3SA 1TPYA 1HLGA 1Q14A 3KKMA 4EJFA 1YQQA 3IC5A 3PUWA 3ER0A 2BMAA 1ZOOA 3PCXA 4AG2C 1GZUA 2L3RA 1CNFA 1P6QA 5D5QA 5HW0A 5CB0A 1Z73A 4CQJA 1E0JA 3KZXA 4MS3A 3ZK9A 3T94A 2EW1A 1OW3B 3KZMA 4G36A 4GOXA 4TMVA 1NXQA 1SBTA 3GD7A 2OCAA 3VPFA 2O5RA 1JR6A 1KZYC 3ROPA 1C80A 3INTA 1HLPA 4JLMA 1V41E 5L3QA 1NDHA 5GMKe 4TMTA 1SUCA 3DP7A 4ECAA 3IIKA 3LWNA 2ZRLA 4NBTA 4PINA 4FLMA 5IH7A 1WQ4A 3GRAA 4M9XA 2JN9A 1CRQA 1ODJA 3ID6C 4GYKA 3F97A 3A8KA 4KXLA 4BKPA 1A8QA 4PABA 2PX3A 3NYIA 1UGQB 2VZLA 4IDGA 1TU0A 3DR5A 4EYKA 4KQJA 3V1MA 3T4EA 4DEYA 1DG1G 3F5SA 3NNDA 4UHEA 3VBCA 4LNHA 5D51S 4F2DA 4A2WA 4YV7A 4Q4AA 3CNHA 4RCBA 4M9RA 4FILA 1COZA 4J6EA 5IBRA 2BGKA 1QE3A 4OPVA 4DDVA 1H6CA 1LJOA 2NZVG 3I9JA 2UUOA 4H08A 2BGGA 4ZQGA 3C7KA 3T7IA 821PA 2RHXA 4EY5A 1EX1A 2V7EA 5CYOA 3HFJA 2GK7A 3BXHA 4FDVA 4W7HA 4AKEA 1AQUA 1LZKA 2AZSA 4C04A 2Q6TA 4FQ5A 4DSZA 1NP6A 4J0DA 2IU3A 2Z30A 4C92F 4DA4A 4N03A 1Y1KE 2GT1A 3NASA 2G9RA 3NP7A 2ZJBA 2I99A 1K9SA 2UZ1B 4FGKA 4B74A 1XMSA 4E0FA 1BH2A 1ZBJA 4G1FA 1Y3CE 4M7DF 2WU4A 1NTRA 3I55B 2MOXA 1TIBA 2QROA 4QGGA 4WZ6A 1A9XB 2ZYIA 3CSDA 2IV3A 4US2R 4JBIA 2V03A 4X6XA 4MV4A 3RLIA 2IEGA 3AOEC 2EYZA 2RGNC 3K2BA 1HFWA 1X1EA 3UA6A 3PG5A 4RPGA 4LFCB 1BMDA 1Q7CA 2A0UA 4DA6A 3T53B 2QDXA 4F91B 2ZJ8A 3OP4A 5HVNA 2CNNA 1NRWA 3N7UA 1NC3A 4XJTA 2C92A 3DGEC 4AYXA 2WKSA 5KHAA 3SQDA 5JAOA 1FE8A 1QHFA 2P4EA 1N3YA 2GD0A 2R7MA 3R5SA 2ATVA 1HJDA 3HO8A 3J80A 1M5TA 2B1RA 3TGPA 3ZR4B 3DLTA 5U4XA 4RJTA 3WWOA 4M0UA 2X77A 4PU0A 3AERA 1W46A 2OCPA 3AI3A 2ZT7A 1OSNA 3D3EA 3UM9A 3SQWA 2E5LB 1HSZA 1RP7A 1DUIA 1GR0A 1GM5A 2W4QA 1KFEB 4KBGA 1SCDA 5AJXA 1Q86U 1J90A 3KUDA 1JJ2A 1QVFA 1SCNE 1T9HA 2QXUA 3F6RA 4FOSA 2Y3IA 2NUPB 1J0DA 3ST7A 4F2WA 1US8B 2CYAA 5IVPA 1F06A 2O2DA 3RLFA 4I46A 1Y0MA 4Z3OA 4JLKA 2GCGA 1VXOA 3WV5A 1CDZA 3GRKA 4QOSA 3RYCA 3IQZA 4NEQA 2ZWOA 3GIDA 2DUJA 4TXNA 4L0QA 4HCKA 4XXHA 3D02A 3SLKA 3EF1A 2VKTA 3LCCA 1PR1A 5CVVA 2OP0A 3HUTA 3ONUA 4K9NA 3GUHA 1VQNQ 1X75C 2DERA 1M1NB 3HCBA 3LYLA 4Y0AA 4CV0A 5LP1A 1UC5B 4L5AA 3BC9A 2H0QA 2UKDA 2CXRA 3PC7A 2QX8A 3DP9A 1CEYA 3I9FA 1YS1X 2XVZA 4UTRA 3H75A 2CNLA 1RQGA 3F4BA 1CJBA 3RFFA 4LUEA 2LDMA 1SA0B 5KSWB 1BCSB 2SHKA 1QVFS 3L4BA 5AI4A 5H1YA 3N2EA 3ZZMA 1K66A 1XRNA 4H3SA 5E3IA 3Q3JB 3PSHA 2PE3A 2HEIA 5HE9A 4E14A 1XU9A 2VBGA 2P3MA 1XSEA 3OEHD 4R8RA 2JLBA 4F72A 1IOWA 3OU7A 4O59O 3V5NA 1KC8U 1RAIB 4ZU6X 1BN6A 1E5TA 4PSAA 3BMQA 5E6SB 2BW0A 3AR7A 3LP6A 2ZPHB 2KRSA 1L4LA 3ILVA 4HMOA 2OBMA 3UWKA 3EEFA 1YI2B 2ENUA 2V4DA 1QH8A 2NNWB 3H2SA 2ZSKA 4HN9A 3V33A 2FETA 3FX2A 2F8TA 3FFWA 3SE0A 1HGXA 2NW6A 2RK6A 4U63A 1U28C 2ACVA 4F5DA 5JMTA 4JT9A 4D57A 1KPHA 3H1FA 1O75A 2HMWA 3OBWA 2FMTA 4DWWA 5JS7A 1K73C 3F98A 2HRQA 3GUCA 4F9EA 2AOUB 2VBCA 1WHKA 2F64A 3DM5A 1YE5A 3QA9A 4MRMB 3TXYA 4J1NA 2D62A 4TT3A 1ZJJA 4OXXA 4YCAA 4ZO6A 5B7NA 4HXGA 3PTZA 5IVDA 1SKUA 1XVAA 4QQRA 1SRQA 2FPGA 2HEQA 3CMET 4C07A 1RI9A 1S7CA 4S1WA 2HV8A 4ZANA 4CM3A 2YZ7A 5FO0A 1BVHA 4CQMB 4WOCA 5LVAA 3GPCA 3VVCA 1HE3A 4P4NA 5GAMj 5IAGA 5C1BA 1U11A 1G66A 1ZY2A 4MS1A 4S2UA 1ADBA 3ORRA 5EJ9A 3L8EA 5C18A 4KPEC 4P8RA 4B73A 1KOJA 2DG2A 3W3AA 2XMGA 3HB5X 3TQFA 2IIQA 5TV2A 3Q7RA 4FHDA 5BO5A 2DD4A 5IM4A 6LDHA 5GZ1A 1A0OA 2EGHA 4XIIA 1KSHA 2HZBA 2X3WD 3OMGA 2Y4XA 3K6SB 1RZRD 3LF2A 2BN4A 3OZEA 3GPLA 1OT5A 4N40A 4DCGA 3T9AA 4YIKA 3Q38A 2D0DA 3DT8A 4I4LA 5CPFA 4UDNA 2DLDA 2AYXA 2BC9A 2ZPTX 4B3IA 5KIAA 2YDLA 1WUIS 1D6NA 1EBBA 4R2KA 3TEJA 4AJEA 1QRRA 1H3FA 3GP5A 2P1RA 1N6PA 2WAMA 1E3SA 3GK3A 2VYVA 4MMKA 1OU4A 4HQ0A 1E6UA 1IN5A 4F4JA 4H17A 5HX7A 3PZRA 3U48A 3BTSA 2WJ4A 1CSEE 2J4CA 3CQ9A 4UXHA 2N1MA 1IHUA 3HRSA 3IESA 3VUBA 2MTBA 2EX1A 2IOFA 4C5GA 1MJHA 2LIVA 3LBFA 3LQ2A 2NO6A 5CB6A 2PNFA 3W5BA 1AUQA 2HAXA 1Y0YA 4DSNA 1LPLA 4HTFA 1F3OA 3AFNA 1GT91 2ZZDA 2NSJA 3KOMA 3L04A 4XNFA 1V37A 4WVFA 5BVHB 4GUAA 1QRUA 4LVNA 4HGRA 1E2HA 5BQFA 4OTZA 1G83A 1G5PA 1OTXA 3WVEB 2ZYRA 3DWIA 3GGGA 2VJLA 2VYCA 2XGMA 3GRPA 3NHJA 1G60A 1X7XA 5GMKj 3P2OA 4NATA 4YRFA 2PZEA 3ROEA 1N8SA 1L4KA 3B8HA 2QPOA 3KOYA 1WMSA 3P2KA 2G28A 1JQAA 3CLKA 4H4CA 5IKOA 3TSZA 1Z36A 1M72A 3SC2A 2XVMA 1Q44A 3EIHA 3LXRA 5FJJA 4MYDA 2PWPA 4DSAA 5DOZA 3CC2A 2A92A 3MN1A 3NCTA 3TQCA 5K0SA 4D42A 2DXTA 1GAXA 3DW1X 5JQGF 3CC7T 2HTFA 4MHOA 4RTYA 1Q82U 1Q83A 1CETA 1QLHA 3KPWA 4YELA 3V32A 5MDHA 2GHIA 3C74A 1H641 1Y8QB 4XGRA 4DANA 4F3RA 1RI2A 2I2LA 4JDUA 2AK5A 2OPBA 4J49A 1KXJA 1JG3A 1LLFA 3JB9G 1W96A 3KTFA 1NE8A 2Z8XA 3PL5A 4NFHA 5IT9A 1XPOA 2RKBA 3AOEA 3EUFA 4RFLA 1XDGA 2XMZA 1CLUA 1FNSA 1R6VA 2DWUA 2XTZA 2BY4A 3DF9A 4KOEC 3RHFA 1AD5A 2XCOA 1I18A 5IYZA 4KDCA 4X20A 4QRDA 4BRSA 3VR4H 1ZU4A 3KXDA 4RSMA 5EVJA 4E7JA 4FC6A 2OX7A 1RM4A 1QPBA 4P31A 1BJTA 2RGYA 1NUSA 1DKLA 2OKCA 2QTRA 2F62A 1KK7A 1HKHA 1WB6A 3FPJA 1Q3KA 4JLNA 3TLZA 3HBJA 1H1LA 1IY1A 1VQPA 1KZ6A 1JEJA 3N53A 4H6XA 5B1YA 3C3JA 4W99A 4RFSB 3UJAA 3O1IC 4FYWB 1Z4OA 3HV2A 3K70D 2QTWB 3D7LA 3C6MA 2WSSD 3ZTTA 1X0VA 4ARVA 5CU7A 3ROGA 1A97A 2Z9BA 1E1DA 3O31A 2SECE 2F1KA 3F6YA 3Q7SA 3U62A 3X43A 2DPMA 4F11A 1HA3A 4DBFA 3C5HA 3GLXA 1T9BA 4OAQA 4PAWA 4AY3A 4DADA 4EARA 4HNVA 2IXDA 2O6HA 3GLFE 2ZR9A 4CEHA 3E9QA 4YJGA 2EW2A 5IYQA 2K2WA 1PG5B 2J6HA 3Q41A 1BG6A 2Q2OA 4GOOD 2Z56A 2NU8B 1OLUA 4YMTA 2A1TS 5BNFA 3AINA 3GLIB 3L0SA 1D0YA 5AW7A 2JDID 3ANSA 3K0KA 3MWJA 1GFIA 3L2UA 1J25A 2WAYA 3W5HA 2DR3A 3X3HA 1WKVA 3JSAA 4DNPA 2B4KA 4ZTFA 4TV8F 4FCVA 2FRWA 5COAA 1UDXA 3C16C 2OQRA 4EMBA 4J1TA 2JW4A 1TK9A 2CFRA 2PBRA 4ER6A 1EXMA 4E12A 2GNCA 4UMFA 2YS7A 3ZLJA 4D7AA 1C8VB 4GC9A 5DGCA 3EFRA 4J0KA 3KQPA 2H1OA 2H5EA 3W2EA 2BFDA 5IYZB 5L4SA 2FYTA 1LS6A 5BN4A 1WHTB 4AUEA 4RUKA 1HRDA 1QK5A 2R1TB 1Q86C 3MRSA 4YJFB 3ITDA 2FKAA 1RKUA 4L95C 3USCS 2CFSA 2H1VA 2BONA 4BATA 1DSSG 2X76A 4MIYA 5K6RA 1ZSZA 3QKTA 3QUSA 2ZRDA 5CW1A 4RH1A 4I1RA 2DL7A 3KSMA 1K08A 3LBNA 3MJHA 4XIGS 4HDCA 2HCTA 1K7EB 3MHTA 1P0FA 4AK9A 1OILA 3WAKA 3ZU3A 4LC9A 3MJCA 1JA1A 2QMYA 3G6ET 5EQDA 2FG6C 2ZQYA 2GFAA 3SC6A 4FZ3A 4EB3A 4Q1CA 4Q4HB 5EKXA 4DTCA 5JMOA 3HZOA 1TUBA 2JFVA 5J2TF 3B6KA 3F3YA 3T5CA 1NU6A 4RSHA 1VQ5T 1ADJA 2C4KA 4COOA 3QF7A 3HDYA 4DRXA 4EGCB 4ETWA 4DMLA 2Y93A 1IULA 1CVRA 3DZCA 2PV0A 3J7TA 3UV6A 1GV0A 1QYCA 2H7VA 2OZVA 1F2TA 1J6UA 3FB9A 2I1QA 5F3RA 4QDTA 4ESVA 3QHQA 3P94A 2KROA 3WFZA 1T0HA 4OHZA 2D9TA 1WP4A 4MRNA 4VUBA 1VE3A 1H05A 2RH9B 1WOSA 1TVEA 2I2FA 2P27A 1BWQA 2QG6A 3NYWA 1U9IC 3VO2A 1QUFA 2P1DA 2YHSA 3DQQA 3FPSA 2ASVA 2DT8A 2WB4A 3Q7TA 3GYBA 2UV8A 3CPSA 4TYPA 4J4BA 4YONB 3H2YA 5HRUA 5GJBA 4KN5A 1WIEA 5CO7A 1B8NA 1WEKA 1WHTA 4HDMB 2DY1A 1D09B 1V71A 2HD0A 3BGOS 1V9CA 2ZSEA 3GUVA 2OB1A 3E1KA 5B37A 1ISPA 2AWOA 3D8NA 4GPBA 2W70A 2HSEA 4C6RA 4CN9A 3PX7A 1SU7A 3BMOB 2ZYGA 1VL5A 3N1UA 5AW6A 4BNYA 3BCUA 2ZITA 2ZZFA 1N8NA 1JQQA 6AT1A 2JZNA 5IC6A 3N0XA 1M8JA 4PGFA 3NKVA 1EYZA 2FN8A 5EQJB 3M3HA 4ILEA 3T3HA 2RPNA 3OFKA 4TKUA 3SHTA 2JIZD 2OY0A 3FB4A 3V8PA 2F3RA 1AHIA 2FJUA 2H85A 5T8KC 3P5SA 2Z5FA 3QPVA 2E4WA 2GZRA 4QYIA 5KYGA 6YASA 3VPSA 5KX5A 1M2JA 2O1WA 1LF0A 2Q5OA 3JSXA 1LU9A 1OX4A 4H6PA 3WE7A 1HKUA 3ZBDA 4WUTA 5JEDA 5CX1B 3JCMd 1OVMA 2F9LA 2B8WA 1UMCA 4KRYA 4ALKA 5JYCA 5BSXA 3O0DA 2QLJA 5GADl 2BHSA 1E63A 4JASB 3TLBA 4O3MA 3ZLVA 3ZY4A 3G2JA 2HWWA 2PH3A 3HXLA 1GQFA 3ZIAA 1M10A 2JAQA 3B6EA 4E5VA 1UJMA 1X2QA 2F1HA 2OBXA 2D13A 3MTDA 2F3SA 2J3HA 2JBAA 3P45A 4QVGA 2Z3WA 2I1VB 5L6LB 1BU1A 1G5HA 4Q47A 3V8LA 4BO8A 3GLHA 4MV3A 1CDDA 2E87A 4QLAA 4F56A 3KS9A 3MKDA 3PHBE 2FA9A 2PS9A 3A2NA 4Z8XA 3DMRA 5FPKA 5JSHA 1G6HA 3FRIA 1FLAA 2DULA 1XTRA 2RB5A 4EMHA 4WCFB 2H9IA 5CCDA 1V6AA 1YKGA 3EMDA 1T5DX 8ATCB 2VO1A 5JVDA 2XXAB 2GF7A 3DBHB 5F7ZA 3VS2A 5KOYA 3Q5GA 4PVCA 5CK5A 4ZQCB 3Q5DA 4H2DA 1J06A 2BFNA 1V3QE 2QTCA 2ZBEA 1KPIA 3LMKA 3R0ZA 4HYEA 4ZIRA 2YV1A 1R18A 2VZ0A 1QHXA 4ZCMA 2HT1A 5KE3A 4PJOA 1JFFB 4P58A 4CM4A 4HNQA 4TZKA 4CR6A 3JQ8B 3H0HA 4QYWA 2H3JA 5K0JA 4O1HA 1VIAA 4B2YA 1VQLB 1SHUX 1ZL2A 1CR6A 3H9UA 4L7VA 4YACA 4MUAA 1E98A 4BX9A 1HT2E 2IS1A 4ZYYA 2GTJA 3ZDYB 4DUGA 2HRRA 3ETDA 1MAUA 2EL9A 3E7PA 4J9UE 4LXTA 1UFVA 2DLNA 2FSIA 2ZBQA 3NAMA 5EWMA 1YP5A 1U7HA 1GNPA 1KU0A 2HLPA 1UC4B 4M75G 2Z5GA 4HO1X 1O54A 2XE4A 4KXQA 4RZIA 2IYFA 5E4YA 4Z51A 2HH9A 5JASA 1NQVA 4FU0A 1DC4A 1E96A 1RHJA 5ANRB 2O2ZA 4HF7A 2P9JA 4B3JA 3O3NB 1PSWA 2RGBA 3IKVA 4HVAA 4ZGQB 3O1JC 4YP9A 5KWSA 2NO7A 1YL6A 4Y6SA 1H85A 3DDCA 3OIVA 1W88B 2REBA 1TMOA 2FVYA 2V55B 4E1BA 4M7AF 3IHTA 3BRWD 1RI1A 4FUTA 2GEFA 5HKCA 1HFJA 1W4RA 2PUKB 2HJGA 4JJ7A 4Y1RA 3QBYA 2X8AA 4CG1A 5CIYA 5IMBA 1NG2A 2PRSA 1MTOA 2YWDA 4BO4A 1CRLA 3BOSA 1I1HA 1T5BA 5ER6A 3O83A 4X8HA 2H4WA 2BZ0A 2KLBA 3LL7A 4KBYA 4R05A 5DYTA 1UBMS 3A3GA 5K3OA 5A0TA 1T3TA 4LVUA 2XKOC 3EG9A 3CLUD 4RX1A 2X0DA 2WRZA 3QIAA 4ESEA 2B4TO 1G3UA 2V7GA 3VC7A 1GNQA 5B4UA 4A82A 1XAGA 2DRIA 4Q34A 1U4SA 1XKLA 2XV1A 5T8KA 1GCQA 1YS4A 1W76A 2AXEA 1RWNA 2Y1CA 2OBTA 1IMOA 1G3MA 2A59A 3O9MA 1GCUA 2YVUA 4XUEA 3ZTWA 3N8DA 3BY7A 3M6WA 2SKCA 3RIYA 1QVZA 3A35A 3GAAA 2FR8A 1VQ6B 4H60A 4R0NA 1KO1A 2NO9A 4QASA 5BUQA 3HP9A 3NUQA 1AZLA 3O4GA 3AV0B 3MQ4A 5BYKA 2YV3A 3JQDA 1NKTA 4CQMA 1KI7A 3T7DA 3QEKA 3UJHA 5ADWA 3WRXC 3HCNA 3QVOA 4FEGA 4TLMB 1NTOA 3AHUA 1J2YA 4H77A 3THWA 2Y1EA 3OW2S 4EENA 3I2HA 2BHLA 4I9GA 1BGXT 1THZA 2JS7A 1RZRA 3IJRA 3OQHA 2XB9A 4X1OA 3U7EB 4C89A 5AVYA 1YDMA 4FHFA 4FSSA 5KH6A 4JV5B 1EGMB 4D6XA 1D2MA 2FF7A 2G5GX 5GAN6 2FFBA 5IFLA 4Z0NA 2A3RA 4IKPA 5L3RA 1JA9A 3E9GA 4E7KA 1CKBA 4MYTA 2ZWMA 2IBTA 2MYTA 2LNHB 3FGZA 2I03A 3NGLA 3B7PA 3I1FA 3DEKA 4D9NA 1I2CA 4AG5A 5JECA 1GZ3A 2P0EA 2AC2A 2B0JA 2QLTA 4LRTB 3DDUA 3UAWA 4EPYA 3ELUA 3IAAA 3Q7QA 4UAVA 1QC5A 3HDJA 2X5NA 3X24B 4JC8A 2JJ1D 3NC1C 2YFKA 3R3JA 4TT3D 5AJTA 4IGAA 5EZ5A 2IDKA 1SA0A 3KKPA 3SWNC 2V1RA 4MVJM 4UBLA 1XZGA 5HEKA 3BG5A 5HIKA 3U4CA 1FDTA 1VJDA 2NG1A 4HNAA 2X6RA 3U19A 2DPPB 3DOHA 1EHCA 3OVMA 1VHOA 4J9FA 4WMLA 4YDRA 1YVRA 3BQ9A 5DE3A 5K09A 2W6QA 5BN5B 4QBFA 1O6GA 1WXTA 2FZCA 2O8CB 4PC7A 2QF7A 3ZWXA 1KBZA 3N8NA 3ITEA 2UUCB 3CR8A 2ZZQA 1SOWA 3R23A 3REOA 1CJVC 3HA3A 3AHCA 1LDNA 1AV7A 2PCJA 3K1YA 3LY9A 4OREX 4ETNA 1RR6A 2FOIA 1MVNA 2PRKA 1NYGA 1IAVA 3DFMA 1R0SA 2XK0A 4KZPA 5EG5A 3W1EA 1EIWA 2CH4A 3AQIA 4TRNA 5LC1A 4I55A 1UDLA 3CCRA 4MMXB 4ZI7B 2C8VA 4X7BA 1XI2A 1GUYA 1WXFA 5EG2A 3V4SA 5LWHA 1TW2A 5LXTB 4J1TC 3H05A 2ZRAA 3C7TA 1FLDA 4L76A 1YSCA 1Z8DA 3CEPB 4OGFA 1CF2O 5CD1A 2C4NA 1B8VA 1TW3A 3UICA 1C8KA 3LM8A 5K3EA 2ZJ2A 1O94D 3OZVA 3O8OA 1MTZA 2R8BA 4XWKA 2CWWA 4DRXB 3OYJA 1X87A 3QVKA 4C4TA 1RE1A 3UDCA 3TLMA 4U7TB 3M8KA 4ZPXA 2IY8A 3JARB 4PYLA 4F1JA 3I62A 2IHBA 5HF8A 1G3WA 3I8OA 4MX8A 5K8VA 2ZAOA 3BICA 1M90D 4OGKA 3P9KA 1Y3HA 3J80E 3K5IA 5BN3A 4V02A 5JNTA 3NW9A 1A1VA 5IXYA 1I0ZA 4IEFB 4ER0A 5KNBA 3N2YA 1X7GA 1SBIA 4BUCA 4QPNA 2LZ0A 3O4FA 4XIFA 5HILA 1LBEA 4TYNA 1QG6A 3LWBA 1WVGA 1ZSGA 4LY3A 4ZEOA 1NVBA 3AX6A 4KDEA 4BHTA 5FCDA 5HIIA 3K8OE 3U6BA 2A4KA 2Y1GA 3TBHA 4V0NA 4JWKA 4QELA 3GRVA 4F8YA 2CT4A 1MVOA 1YGPA 4HAIA 4IOLA 5EXTA 3TWOA 3L2ZA 2X6TA 5GVSA 6AT1B 2CDRA 2XADA 2VL7A 1GUZA 2YBDA 4Y0NA 1NATA 4Q7MB 5I7RA 2IPXA 3CCVQ 4C2TA 4OUDA 1KQSA 5EJFA 3WGLA 2HU7A 1I9GA 3A8MB 4OMOA 2D06A 4D5EA 1Y4AE 3OS0A 1M7HA 3ILXA 3S7TA 3GIWA 3ZS8A 3R0VA 5CPBA 1ZHIA 3EFEA 3KETA 1HDZA 1ZHFA 3D8UA 4KR7A 1FMVA 4WNAA 2CP7A 2AN1A 1V0JA 4XEUA 3RKSA 2Z57A 2ZZNA 1RI3A 2Q5JA 4LQDA 4O4JB 1N3IA 4XOTA 2CLIB 3OQ6A 1ZK2A 5DU2A 5BWNA 2H5IA 2WLTA 2Q62A 1R0XA 2AOVA 1DCKA 4YAGA 1VGQA 4CKCA 4Z3DA 5BR7A 4P3OA 3FBGA 4YECA 4RTUA 5K8TA 1Z38A 4RBNA 4XQEA 1V45E 4BMPB 1X9IA 4B4OA 5JO0A 4HUQA 3V48A 1L5QA 4N76A 1G7CA 2HCFA 2JCSA 5H68A 2V9CA 2YYZA 5AVWA 4N4HA 1U0RA 2QD4A 1ZI6A 4GR4A 4DR4B 3H84A 5FOVA 4LDRA 4OCZA 1G5FA 3BCSA 2X86A 3UVEA 1V1RA 5HY6A 3E9EA 2IHJA 2YT6A 3KYJB 2I4RA 3LCRA 3VR2D 3UJ3X 1SQGA 1VKHA 3QRWA 3IQLA 2A7XA 4LWZA 5CLJA 1Q0PA 4Q1VA 2HUPA 2JGJA 4FE3A 4RLFA 2XUGA 3L8FA 5CLLA 2Y1WA 1EVJA 4JN6B 2IYPA 5LYYA 5JDCC 1II8A 1BAPA 2PXAA 3I76A 1PDWA 4MYUA 2IP2A 4TYYA 4WKNA 1N2BA 2NXJA 2XKBA 5C1DA 1K7SN 4GRIA 3UJPA 1YASA 3E15A 3HTXA 1L4GA 1AKYA 2VIIA 3NTIA 2OCDA 5JD6A 3LLSA 4P6YA 4HH1A 4RDHA 1HNWB 1FYWA 1KQ2A 3E70C 3IJ5A 3DGFC 2JNGA 4BB5A 4WNYA 2OTLT 3ISTA 1UBTS 2XAUA 5F52A 1WP9A 2NYRA 2OBLA 2V6FA 3JYPA 4LYJA 3W8NA 2P5UA 1G20B 1H42A 3GRUA 4KRGA 3OURA 1ZUKA 1UDAA 3QELA 5A88A 1XDDA 4DUZB 3MILA 2BE9B 4QUDA 1I3KA 2JUFA 2RQTA 4XR6A 2GM9A 4TZTA 3ZKAA 4TRJA 2YUIA 2IH4A 3DV2A 2VSOA 3NBXX 1O5OA 4B5KA 3OYIA 1YB2A 4O1MA 1YCHA 3EFHA 3OQBA 3JARA 2Q4OA 4XW2A 2F8SA 2IPNA 1HE4A 2R7AA 2XR1A 3HU3A 3ZHXA 3JSCA 4IQGA 1E66A 3LHDA 3MSCA 4MUJA 4C8QF 5LJ5e 1PSFA 2QV7A 2VVKA 4PE5B 3NVDA 4BJ6A 1XXHB 1M73E 5EHNA 3I2IA 4EA8A 1ZG3A 2ECKA 1GAQA 2PT6A 3GCGA 2E9SA 1H1DA 1JFLA 2IU6A 2MU1A 4KRTA 3G9UA 1RWMA 2VCYA 4OO3A 3CCET 1NUUA 4B4KA 1TC1A 4X66B 3KZCA 3SVLA 3I3SR 1A9TA 4DDHA 5GGXA 1KJJA 1FX0A 3CV3A 2EQKA 1QTQA 1FMJA 2VGNA 1AT1B 1L5OA 1ZKMA 2WWWA 3PD7A 2B4YA 4P7KA 2D2VA 2K7AA 1T6XA 2HKQB 2PXHA 3G6WA 5DWDA 4KPUB 4PRLA 4D3ZA 3DXFA 2GCPA 1I5OB 4N48A 3OIUA 3OTGA 4FD3A 3CCMA 3MCAA 1Q3HA 4UULA 3BWEA 3K4PA 5DCWA 4CU2A 4N3BA 2H31A 2RK3A 2DKFA 3IQIX 2RHCA 4K2HA 5HM6A 3TU4K 2JJ9A 5IZ4A 3D0QA 5KQPA 1KJ8A 4DLWA 1Z5UA 3C0CA 2C2WA 1PJCA 5GMKh 3WYAA