2DERA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
364
structure length
348
Chain Sequence
b'AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
molecule tags Transferase/rna
source organism Escherichia coli
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
total genus 90
structure length 348
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2derA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2derA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2derA01
3G4SB 1VQOB 3TNJA 4ARCA 3KT6A 1M1KD 1DDIA 1GZUA 2AZXA 5DEOA 3G71B 1NYLA 1OWNA 3SDBA 4MAFA 1GLNA 3N2YA 2OTJB 2CYBA 1PFYA 1CNFA 3CRZA 1J70A 4DQLA 3CPWB 1NUTA 2E21A 4M1KA 2DPLA 2BVNA 1M8KA 1OB2A 4QHYA 3VNVA 2VTBA 1J09A 2CV2A 4MW5A 3MCAA 1H3NA 4OJMX 3X1KA 3KFLA 2EL7A 1N75A 4TMWA 3CW2A 4TMVA 2A1UB 4NDAA 4CT0A 2HMAA 3RHSA 3TQOA 1AMOA 2YWEA 3CXCB 1NUUA 1EXMA 1EXDA 5GV7A 5JBQA 1QNFA 4HE6A 2WB2A 3AG6A 1N3LA 4ZT4A 1FFYA 5KWVA 1H3EA 1D2RA 3PNYA 3SP1A 4G1VA 3FI0A 1GO2A 1O96B 3FG9A 4MUGA 1GR1A 4ZCRA 4CQNA 1EFCA 1K4KA 1NI5A 4EGAA 4MWBA 2PXHA 3QFCA 4IW3B 1I6LA 1KH3A 3ZJUA 1F60A 4DDKA 4J0QA 4YAFA 1NUSA 2CYCA 4KR7A 2BPOA 2D54A 1XB2A 4Y9UA 1YITB 1IRXA 5TS2A 3WNBA 1S4MA 4MWDA 1QVFB 3W2FA 1NDHA 1IB0A 1FRQA 4RUKA 4EG3A 3P0JA 4P2BA 3IOEA 4EF6A 1KP2A 3AVYA 1KQOA 1AIPA 1Q19A 4OUDB 3IDFA 5H7XA 1I6KA 4RD4A 4AC9A 1FNBA 1KP3A 3SEQA 4A91A 4JXZA 2QMUA 3AFHA 1QX4A 2WQ7A 1N2IA 2CSXA 2AG6A 4XFDA 4RD3A 4YMIA 1U2RA 3X1MA 4L2IB 4P3YA 3F3MA 1ZM3A 3KT0A 1N2GA 1YUNA 1X6VA 1CT9A 3W2EA 1N2HA 1PG0A 3AGPA 3WNDA 3MMXA 1TEZA 1JJ2B 4UZEA 4N3NA 3AVTA 3FJOA 1JHDA 1V47A 2GKSA 4MUKA 2BGIA 1TUIA 3W2GA 3DLAA 1N78A 1H3FA 5TY0A 4GU5A 2A86A 1DNPA 5TEVA 3QE2A 4LBWA 2OQ2A 1GN8A 2PG3A 4Q16A 3CCRB 3AVXA 1QU3A 4MYUA 1KAMA 1VQ6B 4MUHA 4KR9A 5HUHA 5IHXA 1QQTA 4J75A 3QTTA 1KK1A 1ULHA 1KTVA 5DB4A 1QFZA 2CV0A 1JIIA 4ZCIA 1GTRA 3CC4B 2RC6A 5KSWB 2HZ7A 2CT8A 1XE1A 2BV3A 4I6JA 1YI2B 2CFOA 2EJCA 3IH5A 2PMDA 2YY5A 2A88A 1MRZA 2A1UA 5BNZA 3ZBUA 5IJXA 3RK1A 3LE8A 3K9WA 1D2EA 1R5OA 2VNHA 1TYDE 1TYCA 4HPWA 4MW4A 1EE1A 3AVVA 1MC1A 2DY1A 1KK3A 1F9AA 1QUEA 1YI8A 2QTNA 4C0SA 1NP7A 5JBNA 4KR6A 1XJQA 2A7XA 3IOBA 4G6ZA 4R71A 4TMZA 3H9CA 1EFVA 4E1AA 2VXOA 2HGZA 2G36A 4ZGNB 3U6BA 1WOYA 2J5BA 4TMTA 4NAHA 2GPJA 2OK8A 4PC1A 1EP2B 1N2EA 4EG5A 1WXHA 2HCJB 1M8GA 3FETA 3CVUA 1K4MA 4YP6A 1G8FA 4YHBA 1KQNA 1O0BA 4F7DA 2QUHA 5F23A 2IP1A 2YWBA 4DJAA 3OW2B 3IVXA 2VZLA 1EFVB 2DR2A 4TN1A 3HFJA 3OTWA 1J1ZA 2CNDA 3LO8A 3HZRA 1M8JA 1QGAA 1S0UA 4RD6A 4HJRA 1R6UA 1GAXA 4M0LA 2QA4B 2NSYA 1GJRA 1GTSA 1BX0A 5HXBA 1VQLB 4AQ7A 2E1RA 1VQ8B 1KH2A 1PFVA 2QJFA 4ZT2A 1OWPA 2C78A 5LM3A 2BF4A 3RJZA 1F20A 2BTEA 2PZAA 1VQPB 1MOPA 1MAUA 3ZZ0A 4PGOA 4EG7A 1EP1B 2DETA 1O95D 3FDXA 4EG8A 2JANA 2RE8A 1E64A 3W5HA 4YAWA 2QEXB 3BL5A 3U2QA 2CUZA 1O97C 4KKVA 2AKEA 3H05A 2QDXA 1RQGA 1VL2A 3QSYA 1KORA 1W87A 4ZT3A 1QG0A 3VNUA 1IQRA 2YWFA 1R6TA 3PRHA 4ARIA 4MLPA 1WXGA 1JIKA 2DERA 2J08A 4JXXA 1XNJA 3CMEB 2WSIA 1O0CA 2CYAA 4ZGQB 1UMKA 3U6KA 4MW6A 2RC5A 2QUJA 1YUMA 3PXUA 2VNJA 1TVCA 3WBJA 3UC5A 1W34A 2GOYA 1ZM4A 4ZCMA 3CCUB 2PZBA 3IVCA 1KD1D 1NZJA 2H2AA 1Q11A 2PIDA 2XRYA 4UAJA 1OWLA 2E18A 4MVYA 4MW2A 4ZT5A 3K32A 2ZITA 3IOCA 3UY4A 2XNJA 4AF7A 3IMGA 3CD6B 1JGTA 3HMQA 4MW7A 1N0VC 3JQQA 1EFUA 3SYTA 1EFTA 3CLSC 3FH0A 2WQ6A 4YALA 3A2KA 1VBMA 3OJXA 1R5NA 3IMCA 4JFAA 3FPKA 1QH0A 2O5RA 4X0EA 2BGJA 1YJ9B 1Q81D 2FX3A 1KH1A 1OBHA 1GPMA 1QU2A 1G7RA 3CCVB 1VQ9B 2B7LA 2VTBB 4K03A 2QUIA 3MUEA 4B48A 3LCJA 1WJGA 4R0NA 4I6EA 4FN5A 4QFMA 1O5TA 4HJXA 4DE5A 3CLRC 2C5SA 4BPRA 4MUFA 1QVGB 1KAQA 2X3FA 2CRVA 2YWHA 3AG5A 3IUBA 3L93A 1OGIA 2BYTA 4EG4A 4G1BA 1CNEA 1N2BA 3COWA 4MUNA 5LLTA 1B23P 1WDTA 1O94C 1W2BB 4U8HA 4DDHA 3A05A 4RCZA 3W5VA 1IHOA 4EG6A 2IELA 1Q15A 1QTQA 1Q82D 3H9BA 3ND5A 3TS1A 4MVWA 1R6XA 2PIAA 4MW1A 4ZT7A 5J59A 4BWVA 2ZUFA 4ZCTA 4G5FA 4PBSA 3WXMA 1Q77A 1LI5A 2ZUEA 2H29A 1GAQA 2J7KA 2QTLA 1YJNB 3ELBA 1VLHA 3N8HA 1Q7YD 1B2RA 1U3DA 2QTZA 3W2HA 4J76A 4EFKA 1W35A 3NV7A 3U1VA 1VQ4B 1B6TA 1JECA 5K0TA 2XNCA 2YXNA 1J21A 2EFGA 1KRHA 4NZPA 1F4LA 1T9GR 1WKBA 1PFWA 1O6BA 4MULA 3UOWA 3H97A 3IUEA 1EFPB 2Z08A 4K0RA 2DLCX 3CLUC 1COZA 4MUEA 2Z09A 4F3RA 5KHAA 3FWKA 1TFUA 3ES9A 4DQKA 1KKUA 1H1TA 1JZQA 5FO1A 5KCMA 3B8HA 2X0KA 3ILVA 3PENA 1EUQA 1S72B 3IMEA 4U7JA 1WY5A 1V8FA 4B4DA 1YIJB 1ZUNA 3P0IA 4EG1A 5H16A 3HL4A 5TEWA 3CR8A 3JQPA 4ACAA 2D74A 1JMVA 2PZ8A 1XNGA 4LC0A 1KQPA 3CC2B 4XSVA 1DDGA 3ISJA 3LOQA 1BX1A 4MWEA 1QUFA 5LFAA 4WQMA 3AL0C 3CCJB 1IH8A 1LW7A 1GVHA 3CCSB 3KT8A 2DUMA 4I6GA 1OGJA 3VO2A 4MUIA 3MXTA 1I6MA 3ZGZA 3ZJVA 1PG2A 5EMNA 4YBRA 3M5WA 2BM1A 1WXFA 1MB9A 3J81k 4B43A 3A4IA 1N0UA 3I1FA 3E1YE 4QREA 3ZZTA 1LI7A 3X1JA 1Y42X 4JZYA 4WSOA 1EP3B 3WNCA 3ZBTA 1D8TA 2VYQA 3I56B 3G6EB 3RFFA 1ZJWA 1OD6A 4TS1A 3W2IA 2BN4A 4FK8A 4B3XA 1D1NA 1SURA 1IQUA 4ND6A 1F7UA 1M8FA 1WQ4A 5TV2A 1KQSB 3WBKA 1MB2A 1YIDA 4LBVA 2B7CA 3AVUA 1M83A 2QTMA 5J5AA 1G7SA 4RJLA 1JEEA 1I2DA 2NPFA 1M1ZA 2PLFA 1MJHA 3MLBA 3Q12A 4DNXA 3CCLB 1BS2A 1JILA 1IJFA 4DDMA 5HG0A 2BSAA 1SKQA 3DV2A 3CVWA 4DLPA 4Q7JB 3CVVA 1OBCA 4NBSA 2PFSA 3W5UA 2C77A 4RD2A 1A8PA 1K8AD 3E20A 1BQEA 1WXEA 2ZP1A 4WNYA 1J20A 3FNRA 2V0GA 4NX2A 4ZCPA 2JAXA 1U0BB 2V0CA 4M2LA 2QUKA 2O8VA 4MWCA 3COYA 3COVA 1VQ7B 1P7PA 4PBTA 1NUPA 3AVWA 1FNMA 4ACBA 3N9IA 4YAOA 4S1OA 4ZCLA 1O95C 1GAWA 1QRTA 2NZ2A 4F4HA 1A8HA 3I55B 3CLTD 1JA1A 4K1XA 1BJKA 1KK0A 4LBZA 1FDRA 3B78A 3UK2A 1IVSA 1F7VA 3JQRA 3ZJTA 3HV0A 1ZH6A 4ZCSA 3SJZA 1O94D 3P0HA 2E89A 2A1TR 3FY4A 5EKDA 1ZUNB 4RD1A 3G59A 2TS1A 2J4DA 3GLVA 3INNA 1H85A 1TYBE 5DASA 3KT3A 1K97A 5TGTA 4H3SA 1E63A 3RK0A 5DK4A 1N8RD 1N1DA 1O96A 4PC7A 2GM3A 3ND7A 5K0SA 3Q10A 4JYZA 2B5OA 4AS1A 4HK4A 1JNYA 2CV1A 4MYTA 2A1TS 4KPUB 3OZVA 3CCQB 2HDNB 3SEZA 3I05A 1TQ8A 1X8XA 1NUQA 1ZH0A 1I7PA 3VMFA 1OB5A 1VQMB 1OWMA 2X1MA 1QFYA 1DARA 2YWCA 4L2IA 3OJWA 1DG1G 2I1LA 2J09A 4MUJA 4B47A 3CMAB 4LBYA 4Y9RA 3V76A 1VQKB 1JEDA 3NBKA 4OUDA 3MHPA 5GV8A 4Q93A 3GUZA 5H59A 1KR2A 2R5WA 1VQNB 4FZJA 4ZT6A 4P6VF 3CCEB 1NJID 3LVBA 1EWYA 1N2JA 1VBNA 3IVGA 5TR9A 1N77A 3QFSA 3ZXSA 2DCUA 1JZSA 1K9MD 1G8GA 4PC2A 3E27A 1E62A 3MMPA 3RBAA 1FYDA 3QTBA 1CQXA 3PNVA 4U9UA 4MQ6A 2X3UA 1TLLA 2VNIA 1N2OA 2IJGX 3CB4A 3CLSD 4R2MA 3N05A 4HE5A 3MLAA 5FNZA 1YULA 1TTTA 3CVXA 4NCNA 2VNKA 3QFRA 3OZUA 1XNHA 3FHJA 3IODA 1G7CA 1UFVA 1VQ5B 2D5BA 2DEUA 4YAUA 1IJEA 1T6ZA 1FNCA 2A4MA 4U63A 1QRUA 3TQIA 2JA2A 3AGQA 4ND7A 4XFJA 1MBZA 1WQ3A 1O97D 3Q4GA 2QTRA 2Z3VA 3JXEA 4PY2A 1SM4A 3ZXIA 4R2LA 1HA3A 1R5BA 1K73D 3TZLA 2D13A 5THXA 3A04A 2EIXA 3VU8A 3P27A 1KJZA 1ELOA 1T9GS 4MVCA 4B44A 2GQFA 4EH1A 1JIJA 3WYAA 4M4SA 1J9ZA 2AHOA 2XEXA 1TYAE 3AIIA 3FOCA 4PBRA 4YP7A 3SZ3A 5J58A 2X1LA 1JB9A 3QFTA 4CDMA 3B82A 4ZV4A 1T6YA 1YIAA 2E0IA 2DXIA 4PC6A 5H5JA 1WXIA 2QJTA 3VRHA 1OWOA 3WY9A 3P26A 2BMWA 3G5AA 2J07A 3CA8A 3D6VA 3ZZUA 1U3CA 1FNDA 2XRZA 1G59A 5AN9A 1QRSA 1ZM2A 1VBKA 2QJOA 4QRDA 4UZFA 3DPIA 4KPUA 3HGMA 2RD2A 2B7BA 1NSYA 1QGYA 3OP1A 1QFJA 1HYBA 4G5GA 1U7XA 4NATA 5AHWA 3TZEA 3C8ZA 1ZM9A 1H42A 3GMIA 1YJWB 3ND6A 3CLRD 1IFXA 4Y7CA 4PC3A 4H9GA 4AF6A 5FO0A 1FRNA 3G6KA 1Q86D 4RCYA 3L92A 1KC8D 4M53A 2A84A 1G7TA 1M8PA 4N3GA 2OV4A 4MVXA 3ZUGA 3S3TA 4TMXA 4NAUA 3DO8A 3VGJA 3PNBA 2YWGA 1ILEA 1G8HA 4FWTA 3CC7B 5DSZA 1EUYA 3ZC3A 4QBTA 4YP5A 3AKZA 4C43A 1QGZA 3CVYA 4CDNA 5FA6A 3CCMB 3CLUD 2BM0A 3FIUA 4RPIA 3SZGA 3UMVA 4ZCQA 3ZIUA 4MW9A 1T6XA 3VO1A 3D6UA 3QE4A 3OZWA 2QN6A 1EJ2A 1MAWA 2R6HA 1NURA 1QJCA 4GRIA 1EFPA 1YHQB 5HUJA 4RD0A 1IQ0A 1J1UA 1M90D 2OK7A 4G5YA 1WZ2A 1JA0A 1K92A 3NBAA 2OTLB 3COZA 3P52A 1PFUA 3H99A 3CLTC 4MW0A 1U7DA 1KK2A
chains in the Genus database with same CATH superfamily
4WE3A 2KQUA 5BP7A 3KT6A 1EZ1A 4IV0A 4R84A 5H68A 3AHUA 3H04A 3R74A 1OWNA 2AZXA 3F7NA 1GLNA 2V54A 4X7RA 5FYDA 4B87A 1MC4A 3ND9A 2PKCA 4R41A 4PJLA 4C4AA 3MUNA 3KZNA 1J70A 1KOFA 1ZSZB 3QOWA 4UTNA 1NW3A 1BGVA 2WMYA 5BR8B 2IHTA 1XVLA 2PBFA 4W5RA 4JY7A 1J09A 3GLGE 4UU0A 3C3AA 4MW5A 3BS4A 3ECCA 3FZQA 4XNFA 1I1OA 3SHTA 3WRYC 4YS6A 2AJTA 4LZPA 5E8RA 3I52A 2QD3A 1U2SA 1KHHA 3R9XB 1JU5C 1EXDA 1VMIA 2C5HA 3GT7A 1A5ZA 4XEHA 1E6HA 3ET4A 1AZWA 1TQHA 1J1IA 1Q0ZA 2MU1A 1XL0A 2EGHA 1Y4ZA 3S1AA 4QLAA 2LTAA 5KNBA 2ODBA 4DLAA 3Q38A 5DYWA 2C7OA 2ZUCA 2ZPTX 3OO1A 3RASA 2R5AA 4C08A 4CT4B 4EGAA 5EIEA 5LIRA 3BUSA 1CP2A 2QLLA 3FDZA 4OFZA 5B1SA 3ZE2B 1USUA 1XN4A 1IGQA 2GTJA 2IUYA 4Z4VA 1S1CA 3EEYA 2Z8XA 4MO2A 5DO9A 3RYFA 3CF4A 4RS3A 4OMNA 1YITB 1TM5E 5M34A 1DKMA 3LWHA 3LYLA 4EELA 3W2FA 4YAJA 4GG1A 3HCRA 5KNDA 5GZ1A 4AECA 1T1RA 3THKA 4UMFA 1XROA 4M9CA 4DC9A 3QSGA 1V43A 2I67A 1VUBA 1FFXB 1QF9A 3A4TA 3K71B 1NW6A 3DGEC 4K9KA 3JPWA 1XGKA 1Z6TA 1VOMA 2PUKB 3M54A 2GYVA 3AP2A 2XD0A 1AUPA 2HJSA 2PAFA 3DONA 4L4RA 3Q6IA 4Q9DA 4QU9A 3AFHA 1BFUA 4KYTA 4RE6A 2RK3A 3L8GA 5FYQA 1UZUA 1J0EA 2GEDA 2VASA 1QP2A 3BJZA 1ZL0A 2GZSA 1GZDA 3A2NA 5IK2A 3JARA 4OAQA 3X2EA 1BDIA 3ZHRA 2EQIA 1XXHE 4PJOB 2IS2A 3N86A 4LDRA 3BAZA 5DNVA 3AGPA 2QVLA 3B70A 3ASYA 3ONYA 1XAHA 4N5LA 3ZI0A 2PKRA 4FB4A 2IUUA 4AJNA 5GAJA 5FLEX 4OB0B 4LFBB 1NVWQ 1IZ6A 3CIFA 5BMOA 2FPXA 1TZBA 2AD1A 3I4LA 4L85A 1WZCA 4M98A 4Q7EA 4G7XA 2QPOA 3EEQA 4DWWA 4YT2A 5CVDA 1AWJA 1KAMA 4OY3A 5FOXA 2JZ2A 1DC7A 2FLWA 2WW8A 1WSRA 3QE0A 4I9GA 4RZXA 1Y0MA 2CV0A 1N06A 5ALUA 3R9XA 4GQNA 1NJ2A 1TUBB 3QPHA 5KSWB 1KVRA 2V9ZA 1FP4A 2SKCA 1BI3A 4CKBB 4EYGA 1WHKA 1WPQA 5CFZA 2A1UA 2DSTA 3ENVA 2R0QC 1W5AA 4OREX 3OEEA 4UCWA 2Q2VA 1DWUA 3ZDFA 4W5OA 3TL2A 2NSLA 2FCRA 1Y8CA 4WH0A 4CM3A 2E49A 1M72A 3T7JA 3M5CA 4OYLA 1IN8A 3E9CA 4BNDB 5ESXA 3O2SB 4DOMA 1ULSA 1WYXA 4TMTA 2XUOA 4NAHA 1O9BA 1BBZA 1EP2B 3RM3A 5IDXA 4N65A 3WBBA 4PJOF 4MZTA 1TT5A 3DEKA 4BNYA 4DPLA 4RTOA 2AC2A 2AV6A 1DLIA 5CM2Z 4KE8A 5J26A 3HQ4O 1B4DA 2RO0A 1U8YA 2Z5LA 2GGSA 5TQJA 4CC4B 4TXLA 1QKWA 3HAGA 1QF7A 1WO8A 3MJHA 4RTMA 4ZEOA 2HTFA 3RTDA 3HZRA 3L4BC 2JBWA 4C5IA 1TMYA 4M0LA 5IYRA 4ZHSA 4WADA 5HXBA 3CCUA 3OOJA 1PFVA 2C20A 4WUTA 2ZSIA 5H80A 1G17A 4C5HA 4E15A 3RJZA 3NV9A 2FW9A 2MIIA 5KQGA 4GKKB 3A1WA 1AJEA 5DGHA 4URXR 3PUJA 3E3LA 2BZSA 3ED5A 3A9VA 1HYQA 1R8SA 5JPCA 2LW7A 4Y30A 3Q7TA 1XMJA 1PW5A 1UADA 4UTZA 3IB3A 4ZVLA 3I56Q 3WISA 1A9XA 4L6AA 5KSZA 2ONCA 1Z56C 3QY0A 4L3OA 3H5VA 4GKVA 2J32A 5BSFA 4R55A 4ROXA 1WXGA 1XLTC 2QX4A 3HDVA 2X42A 3MCUA 3VJMA 2YT6A 2Z8ZA 3PYMA 2OG1A 1AWOA 1VQ4A 2FG6C 5A05A 3RS4A 4QVIA 4NFLA 2GBQA 2GN1A 3O8QA 4P5EA 4GMFA 4B34A 4C8QD 1TJ5A 4B6FA 1HI9A 1NAHA 4M7PA 4AUMA 2BMVA 4M1OA 3K2EA 4R1UA 4JGBA 1O89A 1N4DA 3PVQA 1Q11A 1Y3FE 2B34A 1UUEA 4CNQA 3P7MA 3TQRA 5MFPA 3PEFA 4OL9A 2XNJA 2V8IA 1G8XA 1AA6A 1KK7A 5EIBC 1FJXA 1E2HA 1ZHIA 3M0EA 2DLPA 5HK9A 2IH4A 3JCMd 1M0TA 1T1SA 3NYWA 3QITA 2VXFA 1A9QA 3CCJT 1I33A 3IXQA 4KL8S 4AURA 5BV7A 5G40A 3FLMA 3PNOA 4JODA 1X80B 4JFAA 5IAKA 1G64A 1V48A 3A4LA 2AX4A 2Y0DA 2MINA 2G0AA 4QGHA 3QLJA 3K5WA 4D25A 1Z7BA 2XNHA 1RLPC 4V0RA 5EXPA 5JHHB 3SVTA 1J0CA 4K03A 5ESWA 3JQGA 3GLGA 2QAGA 1KDRA 4JT4A 2NU7B 4HS9A 4HL6A 4WBNA 3EF0A 1L3BA 1YOVB 5CNKA 3BXFA 3KD3A 4HJXA 3BE5A 3TBFA 1QFSA 3K2BA 1TUCA 2JW4A 3MK31 3V4LA 1QV9A 2XCLA 5FOQA 3I30X 2FHDA 1IAQA 1YJNQ 3IIKA 3NHBA 1DOHA 3CRVA 4F1KA 3E7DA 4J8OA 3O8VA 5E1MA 1VPVA 2E4ZA 2OMKA 2ZWAA 1PX0A 4XK8E 1D1PA 1VQ4T 2WAXA 4JBIA 1R9GA 4ZOAA 3HSKA 1B74A 3QBEA 5JH7B 4S1PA 2A0FA 1RLQC 4CKWB 1UANA 3NEYA 4D41A 4R2IA 1TPYA 5A1JA 4YCMA 4G56A 4Q4JA 2EQBA 3KSMA 1ORVA 2RGNA 5BQPA 3I0MA 4CLOB 3ZE9A 4PBSA 4EPWA 2NUPA 3R1IA 1FTQA 2P3MA 2BGRA 3L5OA 3EJ6A 1KS2A 3LQ6A 1R0YA 2QJRA 1CTQA 1JI3A 3I6IA 3ZW9A 3U13A 1P7YA 3OJLA 1JP7A 3ONVA 2AZVA 1U3DA 2YV3A 5CQXA 4KI7A 4YJ2A 2VYCA 3BH6A 2PGLA 7GPBA 3CH6A 3PICA 5EYPA 4G09A 4TTSA 1FXSA 1X9HA 3IPLA 3JVEA 4Z4QA 4OKSA 3HXLA 2CUNA 5DULA 3B2QA 3T3MB 2RI1A 4L75A 5B2EA 2V55B 4Q7QA 5JD5A 3CZPA 1K6JA 1JKIA 5CB4A 3RV4A 1QPGA 4AFNA 1TO1E 2KE9A 2HQEA 3QM1A 3QKUA 1E2DA 1UXKA 4NWIA 4B0OA 2OZLA 3ZCPA 4E5KA 4ENRA 4QGSA 2JH9A 1COZA 2GAIA 4QYXA 3UPTA 2CB0A 2OFOA 3FWKA 3ZU6A 4Q39A 2I9PA 3CE6A 1E2EA 3GP3A 3N53A 4K9NA 4E4RA 1J9GA 3SJCA 1ABQA 3NC4A 4YJHA 1MFPA 4BJ6A 4EDHA 2ZYUX 5FTNA 4X20B 4UNIA 4LF8B 1PJBA 4ACAA 4FCCA 4KMSA 1JE0A 1XNGA 4P4SA 4AYTA 1II8A 2CE2X 2PQMA 4IGIA 4ESOA 2P2ZA 1XHFA 5LFAA 5CH3A 5KI6A 1LI4A 1TA9A 2OORC 4OCZA 4FI3F 4GP9A 3HCWA 4OO3A 4BC0A 1G41A 2R7MA 2XMBA 3HB1A 4I6GA 3VX4A 1OGJA 1NJFA 3QQPA 4W7HA 4YGXB 3Q3AA 1TJ3A 3B6JA 4N40A 1FMCA 4R8KA 5IM4A 4J9CA 4J7CA 3GIWA 1MB9A 2VBTA 4Z99A 5AQ1A 3FPEA 3VR6A 5KNDH 4AXBA 1W2BP 3ESAA 4FYYA 3VPXA 3BHJA 2LQWA 5DNCA 4PZ0A 5F3RA 4LF9B 1NNSA 2A6PA 1CDDA 2AC7A 3DEZA 4RCVA 3M57A 1N5JA 1YZ3A 4TV8B 4WZBB 1JR4A 5HOEA 5I5EA 5ILOA 4LE9A 1HLGA 2IY7A 2IFTA 3FCSB 4R1SA 4ND6A 4AS2A 4HYYA 4MA5A 4RHTA 1DKOA 1E5QA 3DB2A 2XNDA 3U37A 1KQSB 3N2KA 1Y48E 1XVAA 4FVTA 4NZZA 5DLQE 3ACBA 3WSVA 4B6SA 3TW4A 2JJ9A 4UE2A 4EB6A 4YCAA 1JEEA 1P5RA 2NPFA 1T5TA 3FFTA 1ADGA 3L0YA 1I8DA 3NETA 3HVHA 3NWBA 3C94A 4JOQA 3TW6A 5K4AA 2YZ7A 3WQHA 2VXEA 1H23A 1DQRA 4ENVA 1JDNA 1M1KR 1UJNA 3O03A 2F1MA 4D80A 3K1JA 3GYGA 3O94A 4ITUA 3TI7A 4AJOA 1E1CB 5ALEA 5JR3A 4M6WB 2EKZA 3C0CA 3FYUB 1UWVA 3IMKA 1NQXA 1F8FA 5K8TA 3HYLA 3KX2A 5TC4A 4MRPA 4DR7B 1ZK1A 2W2MA 3X2SA 5IAAA 3L8FA 2HKIA 4GD3Q 3ZGNA 3VAYA 4X6LA 3ZQUA 4PIPA 221PA 2H31A 3IUYA 2V7UA 1O77A 1Z39A 2P2SA 1EM8A 3LT2A 1W4AA 1PJQA 2H1LA 1YDFA 2WD8A 3Q9SA 1FNMA 1LNSA 2V3VA 3BAFA 4X9DA 4C0GA 3GJYA 2YVUA 3IT0A 3KKEA 3PNLA 3RY8A 3ZKWA 3N75A 5DLEA 3HYSA 5BUQA 2ZSUA 5TLSA 3OWHA 1A7KA 3VS3A 4BKQA 5HCUA 3HCFA 3TMYA 3GRRA 3IHLA 4BACA 3JQBA 3BA6A 3BXZA 4P25A 3QXHA 4KXNA 4RIGA 1KGSA 4DBRA 2ORIA 4FU0A 3KV3O 4EITA 1W88B 4WBNF 1ZHFA 2H9YA 4TKUA 2DY0A 1HR0B 2XTAA 2DM1A 3ZLJA 3TVTA 4IKFA 1DXOA 2RB5A 2VA8A 2A9OA 4X7BA 3RK0A 1P3JA 3PE4A 4J6FA 6AT1A 3HFSA 1DTSA 1E9BA 4GRAA 3RREA 3RVQA 4JMLA 1E1DA 1G3YA 1O57A 5JCJA 3WMXA 4B75A 2FDRA 4IFBA 4DCSA 4EVIA 4V0ME 4EA8A 1OA1A 4JLIA 5D6YA 4FCWA 2AUNA 2CV1A 2HMVA 1FXUA 1YR1A 1TW3A 5IT9E 2NV0A 2WG2A 3I05A 1E0JA 1QM5A 1TVMA 4UCFA 2OVFA 3GCDA 1Z4KA 4E0BA 2VZ9A 5FH9A 4L2IA 2Q3HA 1PWYE 4ALLA 3LQRA 4NZ9A 1CR4A 1HE5A 2D5AA 2PU9B 3CMAB 4YRKA 4IFEA 4YMLA 2D6FA 3UKJA 3PX3A 3VS5A 1ODKA 3MHPA 1QVVA 4QOJA 4PYQA 2AK2A 1K8AR 2CH4A 2J7IA 5E8JA 2W10A 1C1DA 3UAXA 1N5RA 3HHTB 3ETEA 2ZXEA 4TXMA 1L4FA 5ERYA 2JAUA 4JEIA 2XVXA 1EDOA 5CPFA 3E05A 3GEBA 2WQZA 4U9UA 1YR7A 2X3UA 2VNIA 3EMVA 2J3IA 3EUFA 1VYUA 3MVEA 2IA5A 3N05A 3KKKA 3L4SO 4KQ1A 2VN8A 3ZY6A 2BH9A 1R0CB 4BBZA 1V2HE 4BLRA 1F4VA 2BW0A 5EEHA 5B37A 4R8RA 3W2TA 4EUNA 3CVXA 4XU3A 2X0NA 1C30A 2NYUA 4P81A 3KWMA 1Q91A 4X63A 3BJRA 3GLSA 3K9NA 4UU8A 3PPVA 4ENWA 3BSYA 4QOHA 4XFJA 1VHEA 1RLOA 1ZN9A 2XVZA 3OTIA 3RRZA 1UC8A 3T8YA 4P84A 3VS6A 4ZYTA 3RNLA 2ZFUA 5CLQA 2PRIA 3GLGB 2HW8A 2YRWA 1X7WA 3RKUA 5THXA 2DPPB 1JEJA 2PGDA 1R8YA 2IYQA 2XUIA 3ONFA 4PO9A 4JYMA 3OPQA 3EH2A 3K9FC 2RQTA 5AW1A 5J35A 1Y80A 1D07A 3QRWA 4AYXA 2AHOA 2PGNA 4Q4AB 1G19A 2OC4A 1YLOA 3SZ3A 1TSFA 4X24A 3VC1A 3BT7A 3EUEA 3GA0A 2I91A 3NYQA 5J5VA 4FCYA 3LFUA 1WD5A 4GRDA 4WXYB 4Y1RB 3UWSA 1P1BA 1ZC4A 1AF7A 2FN9A 2HIAA 3AY0A 1YS2X 3KB6A 3NASA 5H5JA 2VF4X 4YJ3F 2HL5C 4G0QA 4J1QA 4P4UA 2BMWA 1CUVA 3GARA 3KEQA 5FFFA 5KTKA 4J9IA 3DXYA 2GXQA 3DDOA 5CIWA 5HJ5A 3ZDAA 3V7CA 1NW5A 1Q20A 2JW5A 4HDMB 5KU7A 3HL8A 3ZD7A 2DTEA 1GZVA 3DPIA 3DXFA 4KPUA 2B7BA 4CPDA 4ZN6A 2FW7A 2G09A 2IEZA 2PEYA 4FLMA 4AW9A 4ECEA 1J2RA 1VHLA 4H7EA 2I7VA 1GFDA 2W8ZA 3HUFA 1LF5A 5D6WA 1I3LA 1K7EB 1XTUA 4C0FA 3C2QA 4AF6A 2AN5A 4QDKA 2WG0A 2ORED 2OBSA 3OMCA 3NQ41 1VQMA 4MHOA 3T5CA 4EF5A 3U60B 1U7HA 2HL6A 1YRAA 3HC7A 3P2KA 4DUYB 1V1RA 1YBYA 3AR9A 2E9SA 2RQRA 3PEUA 1T8PA 1O6FA 2GYWA 2QB5A 3PYLA 3R6TA 1SUEA 5C7IO 5H8WA 3G4ST 3A0UA 1KMCA 3I8XA 3JQCA 3WHIA 3S6WA 3INRA 2EEZA 4WLEA 3UT0A 3V8JA 1Y33E 4LEIA 2IKSA 1Z15A 1M90U 2AG8A 3LIPA 1JKXA 4CV1A 1MMGA 4XSGA 1NOJA 4G5HA 2DRIA 4BMPB 3CVYA 2PUDA 2O8DB 3UJDA 2YL2A 4XLFA 3JYNA 3MINA 5CH8A 2RPNA 5FP0A 2MR5A 3D6UA 2LRHA 2R6HA 3L6EA 5HUJA 1Y57A 4ZOBA 4P4SB 3SFMA 5L7YA 4AN0A 4D7AA 4DUGA 3FOFC 3NBAA 2O1WA 1Q17A 1ODIA 2G07A 4IYJA 4JHLA 2HLNA 4GEGA 2D7JA 3KXTA 3DVLA 3RVJA 3KETA 2YYZA 1EGQA 2IHNA 1VQOB 2QZ4A 4JPBW 2JFYA 2Y27A 3QKRA 1RM0A 3D31A 5K8JB 4MB6A 3SDBA 2WAOA 4FDAA 4B40A 3MOSA 1HM5A 3V34A 2FV8A 3DDNA 2H17A 4KH0B 2JJ8A 3T7CA 3QF4B 4LN2A 4IDBA 5JWOA 2GCXA 3KWFA 4FKMA 4HX5A 1QZZA 5LWHA 3HBLA 3NHRA 1VLJA 4PCLA 4IUPA 3VYVA 1WTHD 1MEJA 4FYPA 1R12A 2OXCA 4WEQA 2F1LA 2EL7A 4K9QA 4U3JB 3R3HA 1I13A 3SR0A 4CN8A 1PJSA 3JWPA 4LOIA 3QJGA 5KOHA 3MTEA 1OLUA 4KSYA 3PHHA 3GUHA 3NX4A 3RAGA 2NT4A 1QNFA 1JL3A 4OIFA 1AF4A 4BWGA 1G8JA 2QVZX 3O3NB 4RS4A 2X6WA 2WJPA 4IVRA 5EG2A 5CLHA 1ZJ4A 3LQEA 2H0AA 2V0NA 4LRYA 5FKJA 1GCPA 5B53A 1XZPA 5MHTA 2XH8A 4OSOA 3VR1A 4KXUA 5FCDA 1Y3CE 2PXHA 5JV5A 1G8YA 1ZOOA 2Q1XA 1XF9A 4OBEA 1F60A 1XJCA 4IFIA 4HNAA 1JEOA 3LYHA 4QUIA 3OX1A 4PU0A 3LA8A 4CJXA 3NATA 4NNPA 4PCAA 2AOWA 1N5OX 1G3RA 3RF6A 1IG3A 3BICA 1HFJA 4JC0A 3R20A 3OBIA 1XZDA 1USVA 4X20A 3CBQA 2CKMA 4HQ6A 3TX6A 4JLJA 4DY6A 5K0EA 3JCMc 3ASPA 1NIJA 1RYFA 4P2BA 4R2WA 2QV0A 3ZWMA 2X5NA 3ABSB 2V7BA 1SZCA 1VSTA 1L4NA 2XMQA 3H5IA 4FOPA 1IHXA 1V8OA 1KQOA 4I3FA 3UXYA 2K6GA 5LQNA 1S9HA 3U5TA 1NMSA 1E9AA 4FMBB 4JNKA 3HP4A 4YT5A 5AJUA 1PJAA 2Q07A 5M04A 3KQUA 4RHEA 3PEYA 2QENA 3K15A 3STTA 4JD5A 4L2IB 1QIHA 5HPYB 5J23A 4JBXA 4HF7A 4PLWA 1N2GA 2VRCA 1YI2T 1UBKS 2CCKA 3OESA 4EBFA 2B8WA 4UZEA 4D45A 1EDZA 1WTCA 1TPZA 2RH4A 3H75A 3GIBA 4CM8A 3ZD6A 5IKXA 3OY9A 2FEXA 2I7TA 2O3QA 2BGIA 4RK7A 3W9YA 1C3OA 1KYZA 1F0YA 2QL5A 4IPTA 1X7GA 3O7WA 4XR6A 5CVUA 3FCEA 1MN6A 1YAJA 1ZWLA 4JU9A 1QCDA 2FG7C 4XTZA 4Q37A 2BWJA 3JZMA 3Q15C 3R8XA 3U16A 2R1TB 2W2NA 4TV8F 3FLBA 2EX1A 1QC5B 2G80A 2QYHA 4JMQA 3AVPA 3QTTA 3WMFA 2EBHX 3K0EA 3W8DA 2CJXA 1QVFA 3HDGA 1YS4A 2JCBA 2PT5A 1TT5B 3GD7A 3UJ8A 4B45A 3C6ZA 3Q8MA 4NV0A 3ET5A 2DX7A 2FJ0A 4Y92A 1T5OA 1TB4A 3CRW1 3F46A 2A88A 4XM2A 5EZYB 3L8ZA 2F59A 1YQDA 1BQ4A 3RK1A 2H7XA 2ST1A 5G0VA 5F7OA 1T4BA 4EHNA 2FKAA 1EGVB 2BUCA 1L7XA 3Q41A 4FW1A 1VQKT 1KFBB 1RACA 2RH2A 2AB0A 2G70A 3M3HA 3OIUA 1YJ9Q 3QVUA 4N0MA 5BSEA 5LIPA 2OT3B 4RJ2A 4M0KA 2W6MA 3MT7A 3UJPA 2UZ0A 2GPJA 4PC1A 1GCAA 5AYVA 1NXXA 3BH4A 1Z0JA 3REOA 1IN1A 5EIHA 3KUXA 3RWOA 1H65A 3KZXA 3FETA 4MKHA 3SB2A 4Y2XA 3K0FA 4YP6A 4EARA 5K0FA 3PE6A 1R0RE 2P4UA 1DAIA 3QQ5A 4OQEA 4QICA 1KI3A 2D2VA 1A4UA 2QU8A 3JQDA 4LQLA 4CRIA 2YWBA 1JG3A 4MGEA 3TLGA 1F2VA 2W90A 4K0KB 1SHUX 3KYCA 3QUSA 1Z2CA 5EAIA 1N6KA 2O07A 3K70C 2W42A 1OFUA 3JCMJ 1DQYA 3STHA 4V1CB 3HFJA 4LHVA 3ASKA 1NP6A 2ZYVX 5F77A 3IAS1 2I87A 4RTZA 4UHEA 2ODPA 2O3JA 5I8ZA 4D9GA 1CQIB 4RVDA 3B1KA 4OHZA 1WOMA 4GICA 3BJIC 4BFUA 1OWPA 3PC4A 4DHEA 1J0BA 5JROA 3PQ7A 2B6NA 3V97A 3JD1A 4K6FA 5CA0A 2OO5A 2GZ1A 4R0KA 1WV0A 4GGMX 4PGOA 4X5OA 3DFUA 4E3ZA 1PKXA 4EG8A 3UTDA 2VWHA 4G81A 4I46A 3AW8A 3PGVA 4KQJA 4OOXA 1CUBA 1C9DB 3BJMA 1MOQA 3A6GA 4QUHA 4YC7A 2AKEA 2I71A 1DOZA 3VPGA 4YT4A 1VE5A 3Q2KA 3MM4A 2PD6A 1BROA 1I5RA 3UENA 2D7CA 1FFXA 1VPLA 3DKMA 4A82A 3LVQE 4M1EA 4BB7A 1TQDA 2A30A 4LZLA 4MQ4A 5SY6A 5AO9A 4E5VA 1M54A 4EABA 2Q6TA 2H2WA 3WMGA 3DPUA 4R51A 2NYVA 3PTAA 1XMXA 2AG0A 4BLWA 1G0NA 2VO1A 3LHFA 4I4CA 1WXBA 4OMMA 1RWXA 4GLLA 4Y0NA 1KDVA 3QTLA 4B2PA 3SIXA 2OHOA 3DQZA 3H11B 4P83A 4X54A 3URKA 1NX6A 1Y8RA 4EUSA 2JS7A 3OQ1A 2PXXA 7ABPA 1ZISA 3ADCA 5C4MA 3KYBA 4A8JC 4AAYA 1IG0A 1MOZA 1SBCA 2WJJA 3O8NA 1D1AA 1VLYA 1P2UA 4PQGA 4OB7A 3R3JA 4DLVA 5FDFA 1FVFA 2ZL6A 1QHYA 1C2YA 3OEYA 4UVIA 3I1IA 2TSYB 4RZIA 4RIFA 4ZN1A 1GOTA 1Z7YA 2WIAA 3T1NA 2Z9CA 3FUTA 1PYOA 3FPKA 4NL4H 3C1TA 3SOZA 4GPEA 1V6AA 1SIUA 2E3JA 4Y2JA 2GXAA 3TLXA 2L8DA 1ISSA 3NXSA 3GVIA 2VTBB 4UUNA 1RXYA 1MNEA 4YPFA 1NU8A 4ME7A 4QWWA 2I78A 4R0NA 5FRDA 5JNWA 1NL3A 3WYBA 2C5SA 3RR6A 3R3UA 4WW0A 5NULA 1ST3A 3OMGA 5H81A 4PCVA 3M9XA 1GCIA 1NC1A 2YMPA 1E2NA 2I99A 3P4XA 1LFDB 5KO2A 4G1BA 5AW9A 5DRTA 1AU9A 3EHQA 5LQMA 3KU4A 3N8DA 2AYXA 1ZPDA 4NYIQ 1XXHB 2QQGA 1U8UA 3H8JA 4U8HA 2PD3A 5T4HA 1SU4A 3A05A 4C8QE 2R68A 1RI4A 2CMDA 4G36A 2JN9A 3AEKB 3IURA 3NHFA 4FSSA 2L0AA 5J59A 3KTFA 1AK2A 4WASA 3IHKA 1UK8A 2KHZA 3AF5A 3R5XA 4FHZA 5DHUA 4ALIA 5E7IA 1LI5A 4P3IA 1WA7A 1VQPT 4HNVA 2AI3A 5HZBA 2K5FA 3RE1A 2HNIA 3G6WA 3HPWA 2HF8A 2CSQA 3SAJA 3SXJA 4MTCA 5BMVB 5HZAA 2A37A 2FMUA 4IIHA 1L2TA 1OT5A 5JS8A 2ZUSA 3ZZ1A 1IZ9A 2PQ2A 3MSXA 3NV7A 4XDYA 1HEIA 3VHXB 2JAQA 5A0DA 1WFWA 2PA3A 4MIEA 4DREA 1Z5ZA 3CUUA 5DEIA 3TK1A 3NWEA 4OHVA 1B0UA 1ZU4A 1UECA 3GRPA 3PFFA 2QAIA 2XKJE 3FOBA 1GTJ1 2W0MA 3MWJA 4HZGA 4Q9KA 5DGXA 3VS0A 1RADA 2C07A 3MJCA 3NTVA 1DWOA 3OO0A 4LSWA 5AXAA 4UREA 1M1NB 3HYTA 2DL7A 4QO7A 4EY6A 2RK1A 1NR1A 3KKNA 1SO8A 4P7GA 3AX6A 3PR2B 5F1OA 1C4WA 2R8OA 4F38A 1N92A 5FOSA 5A0FA 1N6HA 4M0DA 3UOAB 4AMGA 4HG2A 1T15A 2YHTA 5LDDC 2VL7A 3LIIA 1U8CB 4B4DA 3PDIA 4EG1A 3R3YA 2PX8A 4KZKA 3TDMA 3IEVA 3CS3A 4J7UA 3JSCA 3T52A 1JMVA 5E0OA 3ZLUA 1KJIA 3WYEA 2OLEA 2CJYA 2YJ6A 3CC2B 4WMLA 4BGDA 1SVSA 1ZX1A 1U9ZA 2AFHE 1BX1A 3B3JA 4WECA 2Z6UA 1V16A 2Y2UA 3I23A 3L7JA 4KX3A 1LSSA 1LW7A 2GA8A 3GJ5A 1Z6ZA 3KEGA 4GI2A 5P8WA 3VV3A 1YSCA 4UPVA 3S1LA 2GZAA 3O8RA 3F71A 2QPLA 2I4MA 4AKEA 5ENVA 1OLSA 4ZREA 1KEVA 3KLMX 1C6VX 3QVJA 1W6RA 2G04A 4KV9A 4RCBA 1V4BA 4XWOA 1UAAA 1QYXA 1N0UA 1RAEB 3S3OA 5GANj 1J39A 3L0DA 4O2LA 4PPNA 4XWAA 4QDTA 5I7OA 1A7UA 1WOPA 2GS9A 4MCHA 1EEHA 4RJJA 9ATCB 4U2KA 1FTNA 8AT1A 5AUNB 4K3VA 2IP2A 4O4LB 1D8TA 1KMHA 2HJHA 3SS9X 4M78C 4OXYA 1B8PA 1AZLA 5EP1A 2NXNA 4PNZA 1DKUA 4JHXA 3P0RA 2BN4A 3WAKA 1V1MB 1F7UA 2GILA 2VJCA 1OYXA 4X1VA 1MB2A 2C2KA 2XHEA 2B7CA 3NVMB 4WINA 5LBIA 5LU9A 1VQ7T 4N0PA 1ODFA 5AM2A 5HP4A 1MJHA 1OASA 3GEGA 4DSZA 3CCLB 2N1MA 3EGIA 1J8FA 1SKQA 2OCPA 3Q3CA 3KZOA 4Q3AA 1YRBA 2AXNA 3TSWA 1JAXA 2GF2A 3CESA 2PS9A 3N70A 4LXYA 5KNDD 3GEPA 4HRVA 2B8EA 1J20A 1GQ2A 1UKCA 3FNRA 3L4EA 3L7KA 5MN6A 1WCV1 4Y6GB 5BYBA 3TD6A 1L3IA 5DM7R 5DTEA 4RSRA 1QVGS 4P08A 2ERYA 1WSVA 3UPUA 3FTNA 4UFOA 4AB1A 1X15A 1YRLA 3FFAA 4XQGA 4CN9A 2WJGA 4LYAA 5C3UA 1VQKQ 1IXKA 1IM5A 2O7SA 3GGJA 2XWPA 1Q0SA 5HDQA 2YXEA 4DLSA 3COJA 4MDFA 4C7VA 2IYPA 1Z9ZA 2ZIGA 1RYEA 3PHBE 1RI3A 4QSMA 3ROTA 5I51A 3WLLA 4GL2A 3QEJA 1LD3A 2R00C 2EQMA 1ISIA 1N6IA 1KK0A 1UMDA 3OFVA 4HNSA 5F35A 3UK2A 4Y1GA 3RROA 5B5SA 1N2CB 4MQUA 3R6NA 3MPOA 3P0HA 4L51A 5F78A 5FULA 2XQIA 5JDIC 1X77A 1FJHA 3KJZA 4AFQC 1ZN7A 3O93A 3GLFA 1EVEA 2Q8NA 1W2BS 2BISA 5TVKA 2YFKA 3JB9J 1S2NA 1K4US 5FUBA 1BW9A 4C06A 4E07A 3N6VA 1J0DA 4PYKA 1OULA 2ZT7A 1V4VA 2FMHA 3ND7A 3FNEA 1CC1S 5KWSA 2B1RA 5C35A 4IP0A 5DRYA 3OHSX 1F2DA 3OPYB 1T4CB 4C4OA 1TUGB 3C3JA 2OBBA 1DCTA 5JCJD 4JXKA 1K86A 1SG5A 1Y4UA 4FUTA 1D7OA 5KJEA 1LJOA 4Y2PA 5IKMA 5KWIA 1V25A 3I92A 4S05A 5I4IA 5LQRA 3F1KA 3V2UA 1Q44A 3S3NA 3JQ7A 4JK3A 1V0JA 1KQSP 1QX3A 4WI1A 1L5GB 2DG2A 4RM2A 3NTUA 1H6CA 3L7CA 2NZWA 1DG1G 2NTEA 2GREA 1UQUA 1US8B 3KUUA 1RDFA 2BBTA 4K11A 1BE0A 3V8KA 4G25A 4AG1C 5J5CA 4XH9B 5F4MA 1JF8A 1NLUA 1OCEA 3GUZA 3U4CA 2C5BA 4D9HA 2AQIA 1U8RA 1EWYA 2FEIA 3MWEA 3UV3A 1JHQA 1GQYA 3INTA 5LJ3g 2H9IA 2I9KA 3I9V1 3A6FA 1S2LA 5K3OA 2VDNB 3CCQT 1ZJJA 3DNPA 1QYCA 1CQXA 1UMBA 3RVPA 4RY9A 1SOWA 2A7YA 1OOEA 2CFRA 2IJGX 5BW5A 1BI1A 2YXBA 3FAZA 5B4VA 3OW2P 2H4WA 4OB6A 4HLUC 1KI9A 4ND8B 1N27A 4TS4A 3HH8A 1KE2A 1KC1A 3E0QA 4OHWA 3V1MA 4A5SA 1IJEA 3AFOA 1FNCA 2FOIA 3PD7A 3R5KA 3PTZA 3OHPA 4RHXA 4NC9A 3I55Q 5KYVA 4DIMA 2LDXA 3DT6A 2CP7A 3ECAA 3SHOA 1MGPA 3KJFA 3QE3A 1PRLC 2YBEA 3GZJA 2VWFA 3ZNQA 3L5KA 3NUZA 4JJ7A 5KX5B 5A3JA 1KQGA 1YRYE 4CL0A 3DZFA 1A2QA 1HV8A 2R6GA 3QKSA 2ZREA 1T5DX 2VYND 4TWAA 1XRJA 4M7DF 1D1CA 2I4OA 4KFTA 3QJYA 5FBWB 4BFXA 2XGOA 1EFLA 1XRQA 2E2WA 3AYZB 3PIRA 3PMTA 1TU0B 1NE2A 4KMMA 3SWWA 1Y7IA 3QG1A 2J0UB 3R5SA 3LBIA 2CFSA 2V1QA 3BMNA 3VU9B 3VNQA 4ZV4A 3QF4A 2C0IA 1I14A 1BA3A 3UWNA 1OJ7A 2DTXA 2P6RA 1VM6A 5AHRA 2BJWA 1Y96A 2CLHB 2J07A 2OORA 3CA8A 3LQYA 2K87A 2F1IA 2Z3WA 1JXQA 1ZOPA 4DYHA 3OY7A 1TAHA 2EAUA 4JJKA 1G59A 3PUHA 4GNRA 1SA0B 3GLIB 1U80A 4M7AE 4Y9DA 5JARA 2MCNA 3TCKA 3EJWA 3QXEB 1ZM7A 1LSUA 4KGXA 4Z8XA 3EG9B 3AQIA 2Q29A 1R64A 3V42A 3VR3A 3DEIA 1GNQA 3K9LA 4OGLA 1J6UA 1I4DD 3CBOA 3TEFA 3WC4A 1IHMA 2WPDD 5DYGA 5GINE 2DBYA 3UK1A 2XAAA 1Q84A 1L4EA 2I54A 3AI3A 3T7DA 4RVSA 2ZTHA 2DWCA 3TTTA 1YBVA 4AFSC 5BSMA 3EFBA 2WV7A 3VRYA 4ITVA 4WVLA 2G1JA 4S1NA 5F2KA 5CB4F 1OT3A 1QG2A 2Q5IA 1JU9A 4FUQA 1Q2UA 4MMLA 1E3ZA 4G26A 1M6VA 2C54A 2X85A 1T24A 4Q3LA 4FIDA 1JN0A 1SG0A 4XOUA 2BBSA 4AJLA 4IDCA 1L5MA 4IHKA 1RFLA 1ZMXA 2OAGA 2CP6A 3L7OA 3NCHA 3PVSA 1V9SA 1MO3A 4KQWA 3B9QA 2D5IA 1JPNA 1IY8A 1RKUA 4P98A 3TAHA 3BE4A 2BSQA 3VDRA 1LQUA 1RC8A 1QIMA 3GGGA 2HC9A 3ABZA 4JT8A 4QEDA 4GGOA 4DTCA 2Y0CA 5CCAA 3QKSB 1FX0A 2B99A 1YQQA 2ZRPA 4EW6A 3Q8LA 4BFTA 2GZDA 3P52A 1WHSA 2JIQA 1SULA 3AIKA 3GCWA 3TTWA 1OH8A 3JAMA 1CKEA 1MVOA 4M37A 2L82A 4DIUA 2WYWA 1HOTA 4RA6B 4ZO4A 4QTYA 3GGOA 1PVVA 4TVRA 4WKOA 3TQ7P 1G5QA 4ASUA 3HFGA 3QVMA 1WJQA 2YSQA 3KOMA 3N2YA 2JCGA 4ZOLA 4IIJB 3OA6A 1PL8A 4NPAA 4J9FA 4AMZA 5LJIA 2JLWA 3DMNA 3CCMT 1DT3A 4MVJH 2X5OA 3SIPA 3FW1A 2B2XA 1WL8A 4F91B 5KS2A 4W82A 5JSZB 4C2UA 1QZUA 3A3OA 3E22A 1EP9A 1QVGP 3RIGA 3IALA 2QIPA 1HJDA 3CBMA 4G1FA 1MJNA 4DBVO 4CRWB 4ARVA 5A4DA 1QZXA 4Z1MD 4NDAA 3BGSA 3SLNA 3A8MB 3TRIA 4F5YA 3LK6A 4N0QA 2QQ0A 1FSPA 2NSHA 1W6XA 4R9RA 4ZT4A 1RWBA 3LQFA 2RHMA 4QAJA 1P4AA 3GG2A 5HF9A 3HRUA 1Q86C 4RBNA 2BHSA 3C98A 3RFTA 4BGIA 4D4GA 1GO2A 4NV3A 4QUEA 4KDCA 3NDBB 5FBLB 1K4KA 1GN9A 2ZR0A 1SY7A 1ONNA 3GVLA 1VLVA 3V7YA 3A7EA 3BDAA 1H9CA 2FGJA 2P9BA 3UAVA 2CFTA 2HA7A 4M77D 2W4IA 3RU3A 1BE8A 1YD7A 2XCOA 2CDCA 3TREA 1E7QA 2OE2A 3UAOA 3TZQA 1NQ5A 4GI7A 3GQBA 1ZONA 1JA9A 1UXHA 1YONA 3K6JA 1Q12A 1Y1TA 2F8TA 2IK8A 3HNOA 4CKYA 3MD9A 3R5FA 4GWLA 1T0HA 4F4UA 4B4VA 1S1NA 2KY9A 2Q6LA 3A8JA 4XONA 1N2SA 2PEZA 3EWSA 4IDPA 3UEOA 1VCOA 4AQYB 1JKJB 4RD4A 3H1PA 4HAYA 4HB0A 4HB3A 4IY1A 3FYHA 4W8HA 3CCMA 5ENZA 5ELXA 1JB1A 1N2IA 3IEUA 1N2CA 1KAHA 2F3SA 4XFDA 5AP9A 3SWNB 2FRYA 4JB3A 2QL6A 3DKVA 3A8KA 1ZM3A 1V9CA 2WKQA 2ASVA 3KT0A 3IDOA 3LBNA 3MTDA 4F6CA 5CNJA 1D2MA 3OT1A 3PFKA 4P5PA 3RODA 2IOHA 3LOPA 5ALHA 3TTUA 1SD1A 5ALMA 4N3NA 3ZTWA 4PN7A 3ADBA 1RZVA 1AS2A 3C8HA 4OGKA 4EW2A 3NORA 2HD4A 2JJQA 3CMEA 1XPRA 5LJ3e 5A3RA 2QK0A 1TJPB 1IWBB 5E9AA 3HKSA 4BKUA 1R7RA 1U8FO 2AG5A 2FX2A 2X86A 5IHXA 3IA2A 3IB6A 2CZCA 1G4AE 4YAGA 4XYGA 1XRNA 2JHAA 4YAEA 3HY3A 4ZCIA 4M86A 1CR2A 4N0AA 2XEDA 1XTPA 3PQFA 4PG7A 2BV3A 1UKEA 4P38A 4ZXFA 2ZBUA 3TMAA 2DHCA 1V3UA 5BNZA 3Q1KA 2HA4A 5IJXA 1T8TA 1AKQA 5ARDA 5AM3A 5JVDF 2OAQ1 3EDQA 4XD7A 4HPWA 1NWCA 4CV0A 4Y67A 1M3BA 1F9AA 2AMYA 1ZKMA 3H2HA 1GL7A 2V7QA 3EGDB 1EMDA 1J2UA 3E03A 3N8NA 4KLAA 2PS3A 3RG2A 4C7JA 3QOFA 2MYSA 2G36A 3C74A 2BR5A 5FNVA 4I50A 3BMXA 5B1YA 5L6LB 4FFDA 3WO1A 2PH7A 2W83A 3H8SA 1I3OA 2I6XA 3A58B 3CISA 3ASQA 3LTEA 5EHIA 1GQFA 4LF6B 2M6LA 2QLTA 1GNLA 5D1NA 3V4PB 4YUAA 1YZNA 3GJ0A 3HM2A 3ZWQA 3H8VA 4BMCA 2K4YA 2WTEA 1KQNA 1M10A 4FLFA 3BTOA 3P4YA 5BQFA 1TLFA 1FOEB 5TRTA 5DCYA 3RF7A 1RTKA 4V3CA 1K6MA 5T4BA 1NPYA 2BM9A 3KBGA 4X9CA 2RGBA 3PR1A 2LX7A 1OMOA 1YGPA 4NKRA 5HTOA 2V7WA 2GPBA 3KTOA 4PFKA 3EXHA 1XRSB 4L0QA 1GJRA 1SFRA 4QRIA 1PSWA 1VQLB 2C96A 1VQ8B 3Q6QA 2YUPA 3T5GA 4YT8A 1NG9A 1Z22A 1DFIA 2BF4A 1HLFA 1L9KA 2FE4A 2PWZA 4KPGA 1XLTA 4M22A 3FYUC 3O92A 2GEKA 2KRNA 1VL8A 1GCGA 3BSSA 2LT1A 2XJ9A 5IYPA 4LECA 2LCSA 2VUSA 5JZSA 3TVDA 4BJ5A 1MX9A 1KRXA 5CYFA 1JLHA 2J4FA 1EHCA 3WB9A 1LY1A 3HVKA 2LQKA 3I5YA 3GJ3A 4ZI7B 2P3OA 5BV8A 4OX9Y 1K2VN 4MVJA 3LUAA 2Q3EA 1ULAA 3T5BA 3PUNA 4JP3A 1JFTA 5HVNA 1D2GA 1ZXBA 2PLWA 3RUDA 4DUGD 1N6RA 3M6AA 3ORFA 3SX4A 5C1OA 1GM5A 1FY2A 5AVVA 3QVSA 1SVWA 1Z4PX 4JKOA 1QQJA 1BCRB 1YDEA 2GZHA 4N82A 3VSDA 1APBA 1VQLT 3CZAA 3RI3A 1W9XA 2HLPA 2P9FA 2RMKA 5HZMA 3KSBC 1L7NA 2WSEE 3L4BA 5E1DA 1D09A 3M6FA 4HTFA 2J6CA 1C8VB 1KYQA 1N8NA 2Z8YM 1YQGA 1JPVA 1KD1D 2NLUA 2H2AA 2PVPA 2R8XA 2WYIA 1ISGA 5LZ8A 4MW2A 4MQFA 4OI2A 3SHWA 2D8JA 3O9VA 3QEKA 4RAOA 3N7AA 3VVCA 3KQQA 1JH9A 3UY4A 2ZE6A 2BMAA 5H4HA 4PVDA 5D6XA 3CD6B 3AUJB 2HZBA 5HRUA 3BEOA 3E2PA 2ZJOA 3H7AA 1VQNQ 1EFUA 3AM3A 1H93A 1X19A 4CM5A 1WXQA 3I35A 4N0DA 1XXHA 3HZHA 4KBGA 3WFJA 2G77B 2DT8A 3TF5A 4UEQA 2JIZA 1U0RA 3IVMA 4N39A 4YLGA 1U3GA 1HOXA 2QQFA 4MZPA 5B7QA 3FYUA 3ZTYA 4B3HA 4JUAA 2EKPA 3FWPA 1ZCFA 1XKXA 4QFDA 1V3TA 5A4MS 2VA9A 1SUPA 2FWBA 2YUNA 1J2JA 1QKKA 3DTVA 3GB9A 2DPMA 3CNHA 3JQ8B 3NHUA 4JMPA 4OMCA 1QHFA 3QKTA 1YITT 3VR4D 3CLRC 2FWPA 2F4VB 4AJHA 1Q95G 4ZVRA 1EM8B 1GCUA 3I56T 1EVKA 5CYGA 1B34A 3KFVA 3MYRA 4MLDA 1E8NA 3L93A 2C0PA 4EKNB 1FFSA 1GT6A 3VSCA 1O9SA 2WUWE 3PFIA 2ZB2A 2CZ1B 4R7TA 3TUIC 1DV1A 1JIUA 1W75A 3O4GA 3JQAB 2ZJ7A 1W2BB 5F7JA 3VNRA 4E11A 2V1XA 1UMBB 3E1GA 4XOTA 3GLIA 4IYRA 4LVNA 2E6NA 3ZDRA 5CCEA 2LZ6B 1YBFA 1TM2A 2G4LA 3EG5A 4RTVA 1LJUA 5A2QE 2QL9A 1DG3A 1ORIA 4KRYA 5IEBA 4BV3A 1SU7A 4YAKA 4AFUC 4EYKA 1VI6A 4R1TA 2FEAA 4NEQA 4C9BA 1QRAA 3HBNA 5KIAA 3R8CA 4MWZA 1O75A 4GZMA 4A0RA 1ZCAA 4Q48A 3R7SA 3EXAA 4HZIA 2OESA 2FZ4A 4E2YA 4X34A 3WYNA 1H3ZA 2QTZA 3W2HA 5ALRA 3UHPA 1GYPA 1WCWA 3O8LA 3JYPA 3ERCA 1GA1A 3FB4A 5LNK6 1I0ZA 1B42A 4W5QA 3FBGA 3F49S 3SWNA 1R4ZA 3R7BA 4TQAA 3DAHA 1QBKC 3T5AA 5CURA 4ZT5A 1S8AA 2WAAA 3DE5X 1ULUA 4PGHA 2R7KA 1EFPB 1M1UA 2IHUA 2Z08A 2KI5A 1G5IA 3QU4A 5BPHA 3LHIA 4TQUS 1ACJA 2HV8A 2HSGA 2PLNA 5FWXA 1MDBA 5L3RA 3I58A 2UVPB 5FJJA 1POWA 4IZHA 2CH4W 2SKEA 1QVAA 1LSJA 1XCOA 2XB8A 4X7MA 1PRMC 1K8AC 1S72B 3IMEA 1KNQA 3G05A 4WDQA 5DV9A 4BJ1A 3K1ZA 4TKMA 2I2LA 5LYYA 2EYXA 3N0VA 4G8BA 1OXSC 2H8KA 4OBWA 4DBFA 1HT0A 4S1TA 5FL7D 5C8VA 4ZRDA 4IILA 1R50A 4C0AC 4EATA 4FNAA 1RPAA 2FSIA 2WAMA 2ZDGA 3H86A 1A9OA 4NOKA 4V39A 3GZTB 2G9RA 2J0VA 2C92A 2PL9A 4QYIA 3RC7A 3TZ6A 4ED9A 2GMWA 5BVHA 1KERA 1GFSA 2XZLA 1QGOA 3KVVA 1A9TA 1BOOA 3OZSA 4DV4B 4A4GA 1JFVA 1W8DA 3ANTA 1LB1B 4QLOA 4AT1B 1WXDA 1Y8AA 3CC7Q 5G0SA 3ILHA 4GX5A 4M75E 1E5TA 5KYXB 1K8XB 1OE0A 2X8KA 1NJGA 5G1NA 1PJ4A 3GPDG 4H31A 1ZYUA 2F5TX 2V8KA 4UHKA 2IY9A 1ORDA 1Q7TA 3U1TA 1UBUS 3AVUA 1Z6XA 1HLDA 4XQFA 2PJZA 4I1YA 4UTVA 4OK3A 4A0GA 3RDVA 1J7KA 1J8MF 2BEUA 2H3EA 3FUCA 1AO0A 3WVDB 4P7FA 1U11A 2A9JA 1K0SA 5EI5A 4YRMA 3IS3A 3MGGA 4CMBA 3OQPA 5JADA 1XEWX 3RYCB 1KI6A 3CW8X 3QMMA 1XAJA 3M33A 1AVZC 1JQBA 3RRNA 5E3IA 1ARKA 2WJ3A 2A9PA 3WG9A 4BRSA 5CAIA 4G9BA 1UODA 2P78A 3GIRA 1X27A 3K30A 1AO3A 4GKJB 1L1QA 1MKYA 3AERA 5FNVB 4IJWA 2PUEA 4R1OA 2IS6A 1Z4OA 5JWRA 4O4IF 4WXPA 2WZCA 4ZXPA 1IONA 1QV7A 4MX8A 2HA3A 4XR4A 1NUPA 5L23A 5JTTA 5SZHB 1XZBA 1UC4B 2O2ZA 2FR0A 2WF8A 2Y0PA 3L2VA 3Q7EA 3N9IA 4IDGA 4M99A 5AKGA 4EPXA 2PUCA 2PK3A 3K5PA 4K2AA 5D01A 3AKDA 2AR7A 3UZUA 5ICGA 1MU0A 2BKLA 3MS7A 3S28A 4GE0A 1KG1A 1SXJA 3KYJB 1I7LA 1OZ3A 3R41A 4OFBA 3K6SA 2H7CA 1WCYA 1ZH6A 2ZYGA 4ZQIA 3RFCA 3KELA 4PQFA 1AMNA 3L0SA 1NPPA 4E32A 1C4KA 1AKRA 4HMPA 4J4HA 1QCOA 4LA4A 3WWCA 4NS5A 1T2VA 4A1OA 1SEMA 1K1ZA 4AO6A 1AQNA 4I1PA 5B12A 1H5QA 5GY7A 3GRAA 2PRSA 1FYWA 3OEED 1P1FA 3AM5A 4F92B 2M16A 1E0DA 1T36B 2HUPA 5F51A 3ZV4A 5K6AC 5H82A 4N4GA 2C0QA 2PV0A 3C5HA 4PRKA 3SBXA 3UUGA 1VQNT 3L07A 4EJ6A 4PAMA 3Q10A 4O0MA 2POQX 2CXPA 2QLMA 3OD1A 4BGUA 1TD1A 3AT1A 2JHPA 4OI1A 2PL3A 2JAWA 1XMIA 3I04A 5IM4F 4M8KA 3VMMA 1XU7A 4NMHA 3NGPA 2IPNA 5DISB 5DTRA 3DL4A 4IICA 4B3BA 4AG6A 4FYJA 3VMFA 2D00A 4C0DB 1QBGA 3O8OA 4KUIA 3OJWA 1SCBA 3KJHA 4GP6A 5DHSA 4MUJA 4AS3A 4X1OA 3LNNA 1XTQA 2B86A 2HXGA 1Y5NA 4RTWA 1VQKB 1T5LA 2B1IA 4LV8B 1E2FA 5J2TF 5GV8A 5CB6A 2WZQA 3EDRA 3DUFA 1QG6A 4WKPA 5IRCD 1YH3A 5AOAA 4CW7A 3F0TA 2WKWA 5DGCA 1Z38A 2XMDA 1DEOA 1CZKA 2C94A 2FSGA 2HBRA 3D6NB 3DP7A 3G5UA 5LZ5A 3U4AA 1JZSA 2VDMB 1TK9A 1VLLA 4XARA 4PC2A 1F6DA 1T1EA 3IKVA 4XI9A 3GDWA 1RHJA 5CX4A 3T7IA 1Q81U 1PLKA 2VF8A 3B53X 3SEAA 1N2OA 4F71A 1MGQA 1U7WA 4M9XA 4C1NA 2LC4A 1IOWA 5HKCA 2JB9A 1YULA 3BL6A 3GJ8A 3KAQA 3H94A 4NCNA 1D6MA 1BW9B 1SU8A 4M7DE 3FHJA 3H6GA 3IODA 1NSFA 2P2DA 1UJBA 2GPSA 2RGXA 4YAUA 2WWIA 3JAWA 4NP6A 3A32A 5GANf 2H1HA 3HCPA 1K0FA 2AIRB 4JGGA 4PY2A 5C6SA 2QTRA 3GMSA 3KAPA 4BASA 5FLXA 4UTRA 2FLVA 4Q6WA 1OF1A 2MINB 4LNAA 3W8EA 1IGUA 1X86B 2AJ8A 2QYOA 4Q4LA 5AICA 4INPA 2HCKA 3STVA 3VU8A 2HY7A 4BTEA 1BN6A 4KSBA 1A69A 3DG9A 4MVCA 2RHCA 3BC1A 2FZLA 2GQFA 1S3IA 4EH1A 1JJVA 3GW8A 4ZOQI 1RAFB 1BKYA 4M4SA 4IM7A 3LC1O 6ABPA 4V2IA 1Q50A 5L4SA 2I3AA 4RWZA 1BKDR 1WB6A 2VKNA 1XQWA 1WXIA 3FSGA 2VOJA 4HWGA 5AJHA 3BXPA 2XZPA 1A9SA 1DQPA 1Z4LA 3D6AA 3G5AA 4IL5A 4R5MA 2Z0WA 1OZ2A 1U3CA 5A9SB 3GA7A 1CEYA 5A0LA 1CPYA 3KDPA 2FH5B 4E2FA 1OLXA 4UCXA 9GPBA 1DTWB 5J2UA 4QRDA 4QA9A 3PNKA 5G4KA 1NSYA 2QNBA 2UUBB 1HYBA 2PR7A 3LUHA 4MWSA 5AHWA 3SYRA 2Y05A 3GL9A 4TLCA 5FV7A 4EPRA 4CCSA 3TZEA 4RDIA 4HX9A 3R0ZA 4PWYA 4TQGA 1JEAA 5JO9A 3UHAA 2O5EA 4B3TB 2P35A 4DM4A 3AESB 4X92A 2I2DA 3DWGA 3E15A 4JELA 4HUQA 3M89A 2CJWA 3CG4A 3EOZA 4HT8A 2GQVA 1I1JA 2AEEA 4MIKA 3TQHA 4DNOA 2VJMB 3D3WB 3CEYA 1KQSS 4ER0A 3IVXA 1TM7E 2VDWA 4BY9E 4KRFA 2AFHB 1R4NB 2VXCA 2WIBA 4YJGB 1DV2A 1H641 1Q1GA 1UPAA 1RWVA 2IUEA 2JI9A 4PFSA 5DXFA 3S3TA 1KWGA 4C0ZA 3IUQA 3TL6A 3ETDA 2X6XA 2EQUA 1O0SA 1OI2A 2PKQP 2XV1A 3MELA 4G07A 3CC7B 3TH5A 1OKKA 3WVNA 1QMCA 4XUGB 1Z12A 1L7AA 4YRQA 3ZTTA 5C81A 4FZ5A 5CFRA 3RHZA 1MV5A 2QW0X 2R6ZA 3F4BA 3LLMA 5BRAA 2ZJ5A 4AP5A 4UVEA 3WAJA 3P45A 4E47A 4L0CA 4DA9A 3U4QA 4IIFA 4R9VA 5AKZA 4GOKA 2XODA 5IC4A 4C2BA 4JLGA 5DCLA 3H41A 1G18A 5JNLA 1H8ED 1YHQB 4TSFD 5L45A 4RD0A 1N57A 1TCCA 3OTGA 4JQSA 4RLQA 1SC3A 3C5WP 5KTYA 3QWHA 2J7PA 1I2AA 1JYFA 2TMGA 3BXHA 1NJ1A 1SUDA 4RGVA 3CXCA 5K5EA 2PRJA 1QO0D 2HX1A 5JWHA 4DTIA 5IXSA 3K0FB 1Y9ZA 4JEHA 1GGVA 1YRHA 4XIIA 3VU3A 2DHQA 3EAQA 4TLAA 3TLJA 5EHNA 1D6SA 2KYBA 1BCRA 1NZDA 2Q3JA 3KLPX 4R2JA 4DWVA 1X7ZA 3DOUA 3JQ9C 4UJ3A 4I9FA 5FI3A 2F67A 3OZCA 4JH0A 1R5JA 1OQAA 1N2ZA 3LM8A 3UG7A 1XDZA 3HCDA 3EGXA 3ZWPA 1ZVJA 4ZAXA 3RSLA 5TE9A 1IATA 4FPXA 1WVIA 2UZAA 4K81B 1DJPA 3OYKA 1BQ3A 2JCXA 2XB6A 4TSFA 3GR6A 3OF5A 1XQ6A 3MWFA 3DDYA 4B74A 1E7YA 1T5HX 2X8JB 4U9HS 5FAKA 4I2NA 1VCHA 4E46A 3ZHVA 1GWNA 3GVHA 2JFPA 2PLAA 2E87A 5C37A 5TJ9A 4YRIA 3MN1A 4E22A 1GFCA 2DK3A 3OOCA 5IUJC 4BLPA 5I3ZA 3RQIA 1JHXA 4BE4A 1AE1A 1XAGA 5LXTA 2FB7A 4Q7LA 1N33B 3FG9A 1WW8A 1LNXA 1QVRA 4PG5A 1MABA 4DY4A 1T3TA 1PEDA 1S9DA 4EJSC 4F04A 1KOGA 1F3LA 4LDUA 3AR2A 1WZNA 1ISRA 4L6V5 3FCAA 4EHFA 2DT5A 4PX5A 3NYRA 5HE9A 3T9AA 4YMTA 2UYYA 3D5EA 3VR2A 4FNGA 4JC8A 3I01M 3LP5A 3IAFA 5ALGA 4JP1A 1B6SA 4YVFA 2EFDB 1VKRA 1QIIA 4MEJA 1B8NA 4Z7QB 2IXBA 4BQQA 3M0SA 3V1TC 2OCAA 5EPEA 1UUFA 4XLEA 5EIBD 2FDCA 3O3MB 4QDXA 1U8EA 2IXGA 4XTYA 1S8OA 3PQ3A 5LDHA 3IP7A 1X92A 5JQGF 2Q5JA 4CM4B 3A8TA 2RCYA 1O9GA 1VTKA 3GFTA 3OM1A 1SOVA 5LCXA 4CF4A 1JWBB 2QR3A 5JZMA 2CSXA 5GJBA 3IPXA 4TYQA 5BSUA 2HK9A 3VBCA 1VPWA 2QBYB 4OXRA 4J5YA 5D3ZA 4HP8A 3D8BA 3E8SA 1Y8QA 2I1VB 1E1MA 3BHNA 3KUKA 5CVIA 1X6GA 4Z4SA 1WVGA 3HSBA 2XUAA 4I5IA 4JBWA 3RQSA 4EMTA 2J48A 3CX4A 4F5WA 2A1IA 2J05A 1DNPA 2SICE 4I3GA 2Q2OA 1U99A 4CLDA 3LY5A 2J67A 3RBVA 3P9NA 1BXGB 3KPVA 2BKUA 1QQTA 3NDJA 1B8UA 2FQQA 3LXMA 2BZGA 2H8HA 1W73A 4D9JA 1WMAA 1G1MA 5FRNA 2Q4BA 4US2R 1ECBA 1QZ3A 4OA8A 3CC4B 2WEKA 3MMNA 3ONEA 4YMGA 4MAAA 1RHMA 2KK4A 2YJGA 3IH5A 5TGZA 4ERXA 4RQBA 3VYSB 4CLRA 1P6QA 1O5OA 4QQ8A 1HE3A 4CI0B 2UAGA 2CP3A 2ZQZA 1YA6A 1MXHA 1CJBA 2CD9A 3AVOA 4LE0A 5LYJF 1DBPA 4F04B 1MABB 1ZH2A 3M0UA 2WUFA 1VKZA 1UR5A 1SH7A 2X9QA 1T3ZA 3OQHA 5EL0A 1KK3A 5IW8A 2ZJFA 2ZUTA 5IVIA 3VPSA 4P5DA 2X4XA 2MI6A 4C20A 5JBNA 1ULTA 2H06A 1KWKA 3ASRA 2J5KA 2P4EA 3HWRA 3JW8A 1RBQA 2CXQA 2ZJ4A 4E5YA 2V7QD 1KIFA 4P7KA 2NYAA 5B1IA 5IJ9B 3NLLA 1BMFD 1BYIA 1UKVY 3W6ZA 2QP4A 2VS1A 2ZYIA 2WIJA 3FJPA 2ZI9A 3F9IA 3QXSA 1T1IA 3OYEA 2P2CA 3AZOA 5GOZA 4IGKA 4C0HA 1O2DA 4OOVA 4FKZA 2YYAA 4I2VA 3SSOA 4LRQA 3ZWYA 2IP1A 2MIOA 1AXRA 2JH3A 3EWIA 2HDHA 1R77A 4AK9A 4Q5WA 1HXHA 2HRZA 3CCLA 1KZ6A 1JMKC 2IU4A 4O5VA 2WYOA 1L5ZA 2XDYA 3AO0B 3GLTA 4M78G 3LECA 4HXYA 4AQDA 1S2DA 1E60A 3OUUA 1LCIA 1TQ6A 2HPZA 2VEDA 1X7DA 1E8DA 2DXTA 2CUBA 5ENDA 2X76A 1ICIA 2Z6QA 3PUXA 2Z2YA 4KN5A 1NI3A 4TS3A 4ZZIA 4E70A 1M5RA 1GAXA 1UFFA 2RHUA 1ZEJA 3HABA 4HOYA 2HL3A 3O5ZA 2GVNA 4ZT2A 1BKSB 1FTYA 1WF3A 2HHCA 2ID4A 3UF0A 4KXWA 4B82A 2RKBA 2J0QA 3U44B 2PE3A 1KL7A 2VYFA 2KBEA 4R1QA 1NRWA 4AMUA 3PFSA 1YKSA 3G02A 1GQRA 2XZDA 2WJYA 3BL5A 3LKBA 4WNCA 3DOOA 4ZJZA 2V45A 3HJRA 5CAEA 4IURA 1W87A 1KY4A 4JGIA 1IQRA 3MP6A 5F21A 2RQWA 3EMDA 1QWSA 1GL9B 1RT9A 3KEOA 3CC7A 2LXNA 2RJ3A 3O91A 2CXNA 2ZQYA 2FQWA 1Z3IX 5G4KB 5I4KA 1RPZA 1BSVA 2BFEA 1KO5A 1OZFA 2OCGA 2CP5A 2QMHA 1E9FA 2WRZA 3IX7A 2ZIZA 4JBHA 4C0JA 2HU5A 3WBJA 3IE2A 7MHTA 1OZGA 1TRKA 3GOQA 3NHSA 5AXDA 3N5BB 2O3RA 5CP8A 1TTHB 1ZM4A 1E3QA 1MAAA 3H0KA 4QU5A 1UDXA 2AZMA 3KB8A 3SHQA 1BTOA 1I6WA 2ZUUA 3L7NA 4IWXA 4X0EA 2Q5HA 3PA6A 1HT3A 3D4OA 3WGYA 3P8DA 3L40A 4MO9A 3IOCA 2PVDB 2P5SA 4I55B 4FTWA 1DC6A 3DMFA 3PC3A 1N6PA 4ZQHA 1V26A 5EJEA 4BVJA 3E9EA 1P2TA 2EIFA 4DCJA 1NIPA 3RIYA 1WHTB 1ZD1A 3OKFA 2D59A 4Z9XA 4DGSA 2WQ6A 3HJTA 3OJXA 5EPUA 4CTJA 1YTLA 4J3JA 4I5GA 3CXRA 2YNMA 1PQPA 3MMSA 3PMIA 1B1AA 3K0HA 3UFXB 3UUEA 1RM4A 2YQ4A 3F2VA 4XCQA 4QYSA 1M34A 2PKYX 1H0HA 1ZCJA 5SV2A 2DWOA 2LIVA 3OX3A 1JWLA 1EWVA 1WJGA 4IIUA 3RTEA 3OCJA 1XJ0A 3Q5GA 2ZIUB 5AK3A 4UNRA 3I6ZA 1SBNE 2WA2A 1PS9A 1RQPA 2YWHA 3HU5A 3IGFA 1G3TA 5A5GA 4OH1A 3CC2A 1DHRA 4FE3A 1CNEA 1T26A 3U7FB 1NW7A 4V2UA 3SHFA 4CIWA 1FA9A 2X4WA 2I6FA 3HEAA 4ORZA 1O6CA 3G68A 3I6YA 3NBUA 2JIDA 4IH1A 1GR0A 4J0FA 3H18A 1WHSB 4NZOA 3GFGA 4U0KA 2WM3A 3I2HA 4DDHA 4PG6A 1BS1A 5HUQA 4Y0AA 1GEGA 2XE8A 4DLNA 1EX1A 2PH1A 4FE7A 3S7ZA 5L3QB 3IJPA 1U9IA 3QSUA 1ZLMA 3M56A 2JGJA 5KNBH 5JPIA 1HT2E 4HVAA 2ZL7A 3GUVA 3OIGA 3PC7A 4GBJA 5KOJA 4ZO7A 1OTHA 2BY4A 1X38A 4E51A 1CHDA 1Y3IA 2O8FA 1XU4A 2JLQA 4UEOA 5H1YA 5GAOn 3QEBZ 5G1PA 3OYFA 1FS5A 3N8HA 2PS1A 3OCZA 4FEGA 4LMAA 4Z1MA 1BD3A 3OYIA 3U1VA 3GRCA 1VQ4B 2FMKA 1GAJA 4QGAA 1E6GA 2GD1O 2R1VB 1ZU5A 4BVAA 1QANA 3N6RA 1YJWQ 1SD5A 3V9PA 3WL7A 3C16C 1F4LA 1N2CE 3SE0A 1EUZA 5ERXA 2V7PA 2JDIA 3VDMA 5LQCA 2DUNA 4D98A 1J22A 4N76A 4HDNA 2JEZA 3JD3A 5E9QA 2PLRA 5HQ3B 3LUCA 3U4QB 3H2ZA 5J9FA 2XADA 4M77A 4QG3A 1WB9A 1T8YA 2QSZA 1CFZA 5DNYB 4FM9A 2FPSA 1CF4A 2O9VA 3UHJA 5H16A 4QULA 2HMSA 5EUMA 3FKSA 5EJAA 5FOTA 2JIPA 2YQ5A 3VPCA 1V11A 1HURA 3F47A 4LF4B 3K8QA 1DDGA 5JH7F 3DCIA 3PV0A 2IIMA 2ZU0C 13PKA 5JCOA 3R24A 5MGNA 3H42B 2LJ1A 2LZJA 4DL9A 3DZ8A 2A92A 2OFWA 4E6PA 1NBAA 3FCCA 3ZJVA 4Q4AA 3M5WA 1NN1A 2WI8A 3W6OA 3RKYA 5BWNA 1XE3A 1L7RA 2IE0A 2QNRA 3QPCA 2NACA 5EUCA 3TRHA 3VX3A 1JDZA 3HL0A 1ZMRA 1WETA 3RC8A 2ZUEA 2D0QB 1H8HD 1CD5A 3A4NA 3OE1A 3TQCA 2HJGA 1WM1A 3JTEA 2WVGA 1KKMA 1ZJWA 1MTZA 3F6SA 4M6WA 4X8LA 2CLCX 1GPKA 2OM2A 1UGPB 3M3PA 8MHTA 4OGWA 3G0BA 1D1NA 2ADFA 1KOLA 4Q9NA 3RHTA 3K70B 2QTMA 1R00A 1Z5WA 3AJ9A 3O31A 2QN2A 4HAXA 1NYTA 1CULC 1I2DA 4TV9B 1GFWA 2FEKA 4HWSA 5DTIA 1VJCA 2CLLB 3INZA 2FJUA 2NOAA 2VKQA 2X22A 4Q4HA 3AJEA 2JPDA 2BFOA 1X39A 4RDKA 2ZK7A 4OXIA 4AICA 2GLXA 3P9SA 1T2AA 1Y9DA 4LDXA 2QTBA 5B3AA 1MB4A 3JCMf 3K1AB 4TKVB 4L1KA 2XW6A 3A06A 3ZX4A 3CC2Q 1RC1A 4RD2A 3TPFA 5LJLA 2P30A 4Y6SA 3QBJA 4LYEA 2CVFA 2B4AA 3X26B 3E7PA 1C4XA 4OP2A 2LP5A 1XZEA 2O7NA 4WZAA 4XD7D 5F1YA 3W04A 5E6SB 2ZXIA 2ZRNA 1K9MR 3L46A 3NS7A 4XVHA 3ZHSA 3E2IA 1D7AA 4H18A 3KC2A 2V7TA 4U8GA 4MWCA 3COYA 3KD2A 4EMKB 2ZVQX 1RACB 3OZAA 3QY9A 2HK6A 4ZYXA 4PBTA 4IIJA 5L51A 3LPMA 4EGJA 2JZNA 4QTUB 1GLGA 5ALVA 2Z2IA 4AUNA 1UBHS 4KN9S 4XKJA 2QTXA 1IY2A 4CU5A 2W2LA 5IZCC 4WACA 4R7GA 1Y3BE 4DANA 4RA9A 2XYHA 1U63A 2E5QA 4RMJA 4D4KA 3F4LA 2K3BA 1KFKB 5HIJA 3SBEA 2QX7A 5JIBA 4ZAYA 2Y99A 5K2OA 2HCTA 1B2LA 4XCXA 4B3MB 3KQOA 3P94A 4AI6A 1OX6A 5JFOA 3TECE 10MHA 4CEIB 3R4VA 3HR7A 3VPBA 1G291 1MMNA 3CMAT 1HVXA 2JBAB 2KBFA 4OJQA 5L8VA 1TU4A 1SZDA 4LJYA 1E63A 2NTJA 4QE3A 5EIFA 2RHHA 1V7ZA 2N47A 2WWVD 2OBFA 5EC7A 3H83A 3HY6A 3NJRA 3PB3A 4KAXA 2V74B 2XMRA 1PJ8A 4FFNA 4QGBA 4UM7A 4NQRA 3LXUX 3H2BA 5KMGB 2YZ2A 3PFHA 4Q4DA 4AKHA 1YQ9A 1DIBA 3KJEA 2QSUA 4J2HA 3FSJX 3HZZA 1DRWA 1EGAA 1Q16A 3P9QA 3OM0A 5E9JA 4IIXA 3P96A 2O06A 2X1MA 1OWMA 2LKCA 5BUZA 4XGKA 2QVXX 3H5AA 4HQKA 4JR2A 4ZTUB 2J09A 1EPUA 2VSNA 2YMQA 4H7KA 1CSKA 2AOTB 3SVZA 3LBFA 4PABA 5GAMh 4M1ZA 4Y0VA 1ZUWA 1D3BB 2H85A 3VO9A 4X1YB 3SZMA 1CJMA 3BXOA 3NP7A 4HQNA 4Q93A 4ETMA 1K3UB 1TZMA 3CCEB 2I5PO 1KEKA 2NQ2C 2YVKA 1MZVA 2NLOA 5L7TA 4J9VA 1E62A 3GJ6A 3CCMQ 4LI0A 2UYGA 5LP6B 4ZI2A 3FIFA 4YEJA 3HO6A 3TJRA 5BR1A 4EFDA 5MF6A 2WVAA 4DR1B 1SMKA 4JR0A 1Q1BA 5EJFA 2K4MA 3QWBA 1AHJB 3I0ZA 4XDHA 3UMRA 4TM7A 4LYJA 1XZFA 1N6OA 4RZHA 4QG7A 4PNHA 3KFXA 3QWIA 4L9AA 1Q7CA 3AP3A 3G2QA 4RM0A 3LCVB 5D7NA 4G8DA 1GGNA 2XTMA 3JD0A 4DPKA 1G5RA 4DEXA 3NHNA 1OVGA 2DULA 3JXEA 3MT0A 2RA2A 4L8VA 1BI0A 3FZGA 3AHHA 3V8BA 2EYWA 3ZZMA 1HA3A 2JIZD 4BATA 4F4DA 4J7FA 2Q7DA 2KQWA 4H0FA 1G60A 5ALWA 1CZUA 3DTYA 4YRJA 3WL3A 1DWQA 1MG0A 2ZXUA 1D4ZA 2VJNA 3C70A 3M9WA 2J3KA 4P53A 2X19A 1BA2A 1MIOA 2AKYA 4IEEA 4HXEB 2XUQA 3LDHA 4KVFA 3G7SA 1HYOA 1FK8A 4RXUA 2Y1XA 3R6LA 4OKIA 7YASA 3PTLA 3NEJA 1VHOA 4MYCA 3MPUB 2D8MA 1KDOA 5K3AA 2WWYA 5HKKA 4HAVA 1ZUUA 4P80A 2PKXA 5AKJA 3T38A 1YJQA 2RIPA 3HB9A 3VPHA 1EXNA 3VBEA 2P67A 2POCA 5GAN8 1G20A 3UANA 3UGQA 1IUKA 4PJOG 1UMCA 2GWRA 3DTTA 1V1RB 1Q82U 2NZVG 3RLIA 2AMLA 3RSQA 4XU1A 2LCIA 1OX9A 3ZE6A 1WU7A 4N0AC 4CM6A