2DERA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
364
structure length
348
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 348
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2derA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2derA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2derA01
2BM1A 4RPIA 2DR2A 1KK1A 3CB4A 4J76A 4Q93A 2XNJA 4M53A 1R6TA 5KWVA 1KR2A 4BWVA 3D6VA 3S3TA 4M4SA 5JBNA 3ZZUA 3SZ3A 1KK0A 1G7CA 1VQKB 2DUMA 2J4DA 5FO1A 4EGAA 4NBSA 4MW6A 4R71A 5K0TA 4IW3B 1MB2A 1KK3A 3DPIA 5TEVA 1SM4A 3N05A 1GAXA 3MMPA 2QTZA 5GV7A 2D54A 5FA6A 2CSXA 2YXNA 4NATA 3CVUA 1TYBE 4RD3A 1MAWA 1VBNA 2GKSA 4TS1A 3H9BA 1NP7A 3FNRA 1M8KA 1Q82D 1N2BA 3SEZA 2H29A 1EP3B 1O6BA 2QTMA 1KP3A 2XNCA 3DLAA 3HMQA 4TMTA 3INNA 1KQPA 4MW5A 3H97A 1N2HA 1V47A 1VLHA 2CV0A 1DG1G 4TN1A 4ZCLA 3MHPA 1M1ZA 1G8GA 1NUSA 1K4MA 1M8PA 1WQ3A 3KT0A 1Q11A 2WQ6A 1IQ0A 4XFJA 4ZT7A 1J9ZA 1YJWB 1WZ2A 3ZBTA 4B48A 1LI7A 1EFTA 3ND6A 4DNXA 4UAJA 5J5AA 1QTQA 4B4DA 1J1ZA 4Y9UA 1VQ6B 3ZGZA 1KQNA 3IMCA 3ZJVA 3E1YE 2NZ2A 2D74A 1O94C 1PG2A 4QHYA 1YIAA 1U3CA 4R0NA 3SEQA 2BYTA 3JQRA 3CMEB 3ZZ0A 1G59A 1OGIA 1GVHA 4B43A 3LE8A 1JZSA 1XNHA 4J0QA 1VQLB 1WXIA 3QSYA 3OJXA 5JBQA 1CT9A 3PENA 3K9WA 4ZGQB 1W87A 3ZZTA 4ND7A 1ZUNB 1SKQA 1OWOA 2QUIA 2QUJA 4AQ7A 3LCJA 2AZXA 1ILEA 5EMNA 1GPMA 2YWGA 3IVXA 1MJHA 3L92A 3GLVA 3HFJA 3P26A 1KTVA 1WXGA 3N9IA 4MW2A 2O5RA 1W2BB 4MUNA 4RD1A 4FWTA 2DCUA 1JECA 3OW2B 2PZ8A 4HE6A 1EJ2A 4JXXA 3H99A 4L2IB 4HPWA 2VNIA 2Z09A 3TQIA 3QTBA 4MWDA 4WQMA 3DV2A 1O96B 1T6ZA 1QG0A 2PIAA 1NI5A 5J58A 1EP1B 2QMUA 3CW2A 1F4LA 2YWCA 3COVA 4KR7A 4HE5A 1MOPA 4MYUA 1N2IA 1PG0A 2C5SA 1YJ9B 3RK0A 3MCAA 1ZUNA 3SYTA 3ISJA 1IJFA 1Q7YD 2TS1A 3NBKA 3CCRB 1JGTA 1DNPA 4GU5A 1DARA 1F20A 2HZ7A 3ND7A 1E63A 2QA4B 2CYAA 1IB0A 4ZT2A 3FETA 1M8JA 5AN9A 1KAMA 3KT8A 3P0HA 1J09A 1EFVB 2NSYA 3ILVA 5J59A 2C78A 3U2QA 1VQ4B 1QJCA 1ULHA 4MWBA 1JHDA 2J09A 4MUIA 1TYCA 3ZJTA 1KQSB 4L2IA 1X6VA 5H16A 5KCMA 1AMOA 2OTLB 1M8GA 4FN5A 3AVXA 1QRSA 1O96A 2VXOA 3QTTA 3IUBA 1JMVA 1KH1A 1T9GS 2B7LA 2A88A 1D2EA 4UZFA 1IVSA 2EL7A 1I6LA 3FIUA 2Z3VA 3A4IA 2ZUFA 5H5JA 1W35A 5TY0A 3WNCA 3WY9A 3G6KA 4YALA 2VNKA 1KP2A 2A7XA 3C8ZA 4ZCTA 1E64A 5LM3A 3A05A 1VQPB 4XSVA 4K1XA 1J1UA 2J5BA 2X1LA 4X0EA 3IOEA 5DASA 5HG0A 1YIJB 1JA1A 2EJCA 1JB9A 3CVYA 2DY1A 2CYCA 1TYAE 2XRZA 1FDRA 1EFVA 4QBTA 4RCZA 3WYAA 1YHQB 3AKZA 3NV7A 1H42A 1TEZA 1KH2A 3IOCA 2OQ2A 3FHJA 2QTLA 4G5FA 1D2RA 3CLTD 3ZBUA 1WXEA 2QJTA 1O5TA 3MUEA 4M2LA 5F23A 1H3EA 2DPLA 1NUTA 1QVGB 3TZLA 3PNBA 4MAFA 1R6UA 3X1MA 1EXMA 3WNBA 1EFCA 1WXFA 3IOBA 4CQNA 3CCEB 2WQ7A 1F7UA 4I6GA 4K0RA 1QGYA 3Q12A 2CRVA 2JANA 4F7DA 3FJOA 1PFWA 2VNJA 3A04A 4JZYA 1N3LA 4RCYA 3AVTA 4I6JA 4MLPA 1FNCA 2OK8A 4G6ZA 4MVWA 2GPJA 4M0LA 4MUKA 4PC3A 4DDMA 4EG5A 2V0CA 3A2KA 3V76A 2E1RA 4G5GA 1NDHA 2JAXA 2AHOA 3B78A 1PFVA 1VBMA 3MMXA 1I2DA 3JQPA 1NYLA 2YWEA 5TGTA 1ZJWA 3Q10A 4E1AA 3QFRA 3VO2A 4RJLA 3QE4A 3RHSA 4JXZA 2QDXA 1QH0A 4RD4A 1FYDA 5BNZA 3CC4B 3PNYA 3H05A 1DDIA 2BM0A 1XJQA 1OWPA 3CRZA 3IDFA 3QE2A 1O0BA 2YWHA 4MUJA 4ZT6A 3RBAA 2RD2A 1FRNA 1O97C 3I56B 1WQ4A 4PC7A 4MW0A 1WXHA 1VQ5B 1MRZA 1XNJA 4MW7A 5TV2A 1ZM4A 1S72B 4U7JA 3CVXA 3FDXA 3LVBA 3FPKA 4B47A 1RQGA 1KQOA 4YAOA 1GTRA 4QRDA 4AF6A 2E89A 3AG5A 2J08A 1M83A 1FFYA 1A8PA 1OB5A 3P27A 1J20A 1B6TA 3FH0A 3HL4A 4YP6A 2OTJB 3TNJA 1YJNB 1LI5A 1CQXA 1FRQA 3OZUA 4EF6A 1JILA 5HXBA 1Q19A 2ZUEA 1LW7A 4MVXA 2DXIA 3VRHA 4OJMX 1O94D 4UZEA 2C77A 1T6XA 2WB2A 3P52A 3CCJB 3SDBA 2DLCX 1K8AD 4EFKA 3OZWA 3COWA 4DE5A 3CCMB 1NJID 4U8HA 1OB2A 1I7PA 1KD1D 1B23P 1IHOA 1KKUA 4ZT3A 4EH1A 1K4KA 3CR8A 1G8HA 1VQOB 1QFJA 3HV0A 4I6EA 3X1JA 3IH5A 4ZCMA 4PGOA 4DJAA 1N1DA 2E0IA 1GTSA 3DO8A 2BF4A 2HMAA 1U3DA 1IJEA 2QEXB 3UC5A 3B82A 3UY4A 2O8VA 1BS2A 2QUKA 4DQLA 4GRIA 1N2OA 1G8FA 2BV3A 3RJZA 2QN6A 4YHBA 3COZA 4ZGNB 2IP1A 2PZAA 2BVNA 1YI2B 3KT3A 5FNZA 1BQEA 2YWFA 1I6MA 4LBWA 1XB2A 1GJRA 2CFOA 4EG8A 3RFFA 4JYZA 3FY4A 2HCJB 3B8HA 1UFVA 2BPOA 1QFYA 3W2FA 3KFLA 3AVYA 2BTEA 1I6KA 2CNDA 1N2GA 3IVCA 4PC1A 1H3FA 4PBTA 4BPRA 1HYBA 5KSWB 2CYBA 4PC6A 3CVWA 1JEDA 3FWKA 4MUHA 1OWMA 3PNVA 3CD6B 4PY2A 2VZLA 3TQOA 3ZXSA 4KR6A 3AG6A 3U1VA 4FK8A 3P0IA 5TEWA 5HUJA 1JIKA 1JIIA 1TQ8A 2CV1A 2DEUA 1B2RA 2V0GA 4R2LA 1OGJA 3CC2B 1JZQA 4EG3A 4EG7A 1R5OA 2CUZA 2QTNA 2IJGX 4DDHA 4MYTA 4P2BA 4LBVA 3CPWB 4M1KA 4TMZA 1JNYA 2GOYA 4R2MA 5THXA 1U7XA 4ARCA 1GAQA 1FNDA 4MWEA 1Y42X 1K97A 1ZM2A 4JFAA 1TFUA 1WKBA 1QFZA 2PXHA 2WSIA 4HJXA 1VQMB 1EUQA 2J07A 2CV2A 3CLRC 1NUPA 4Y7CA 3CLUD 2BN4A 3L93A 1M1KD 2G36A 2X3FA 1OWNA 3VNUA 3CLSC 1CNFA 1H3NA 3CLUC 4CDNA 4RD2A 3AVWA 3AGPA 1JJ2B 1IQRA 4YP7A 4G5YA 3W5UA 1TLLA 3X1KA 1N75A 1OBCA 4RD6A 3CCVB 4KPUB 3VMFA 1WDTA 2OV4A 2X1MA 3VNVA 2A1TS 3E20A 4ZT5A 3W2IA 2DETA 4MW1A 4G1BA 4U9UA 3VU8A 3AVUA 1K9MD 5IHXA 1N0UA 2DERA 3OP1A 1ZM3A 5LFAA 2HDNB 2GQFA 2PIDA 4CT0A 4B3XA 1N8RD 1QNFA 1EFUA 4MUFA 3IODA 4RUKA 4ACBA 2AKEA 4TMXA 2D13A 3QFCA 5LLTA 1FNBA 1AIPA 2PMDA 1ZM9A 2J7KA 1BJKA 1JA0A 1FNMA 1GAWA 1GO2A 1KJZA 3Q4GA 1N78A 3WNDA 1ZH0A 4EG1A 1R6XA 4KPUA 1IQUA 1T9GR 2BGIA 3MLAA 2ZITA 3J81k 2RC5A 4U63A 4XFDA 1YUMA 5K0SA 1KRHA 2D5BA 1WY5A 1EP2B 1O97D 1VQ9B 1J21A 4C0SA 1VBKA 1YI8A 4PBSA 5DK4A 4MUGA 4DDKA 4ZT4A 5HUHA 1GR1A 1KH3A 1NUQA 1U7DA 3G4SB 2A86A 3N8HA 3CLTC 3COYA 3OTWA 3CCSB 4FZJA 4DQKA 4HJRA 1R5NA 4ZCRA 4NDAA 3U6KA 2A4MA 4QFMA 3I05A 4P3YA 1D8TA 1S4MA 4LC0A 1XNGA 3D6UA 2A1TR 1QUFA 3LOQA 2B7CA 2ZP1A 3ZIUA 1QU3A 1NURA 2AG6A 1QVFB 4G1VA 4N3GA 4WNYA 4B44A 1UMKA 3GMIA 4ZCIA 1OWLA 3W5VA 1Q81D 1H85A 1BX1A 1V8FA 2E18A 2B7BA 4NZPA 1QUEA 5AHWA 1KAQA 4RD0A 4MWCA 5H7XA 1YIDA 4Q16A 3SP1A 1G7RA 2QUHA 3PXUA 4N3NA 1K92A 3FG9A 4KKVA 4MVYA 1QGZA 3I1FA 2XRYA 4YMIA 3LO8A 2BGJA 3ES9A 2EFGA 5TS2A 3N2YA 4H3SA 3MLBA 1T6YA 3MXTA 1S0UA 3W2EA 4MQ6A 3CCLB 2PZBA 4ZCPA 3ZXIA 4ND6A 1GZUA 1GN8A 1VQ7B 1KK2A 4YAWA 2OK7A 4NCNA 1KORA 1N0VC 1VQNB 1H1TA 1Q77A 4Q7JB 2HGZA 3NBAA 4AS1A 4ARIA 1G7TA 2VTBB 4EG4A 1U0BB 4J75A 1MBZA 5EKDA 4LBYA 1QU2A 3U6BA 3JQQA 3FI0A 4AC9A 1QX4A 4ACAA 4C43A 1Q15A 3H9CA 4MULA 1E62A 4H9GA 3CVVA 1TUIA 2YWBA 1ZH6A 1TVCA 1X8XA 3OZVA 1MAUA 1DDGA 3OJWA 4YP5A 3AVVA 5GV8A 3F3MA 1EWYA 2QTRA 1EUYA 4Y9RA 5H59A 1PFYA 3G59A 1QRTA 3W2GA 3AIIA 3K32A 4P6VF 1XE1A 1NZJA 4ZV4A 3UMVA 1IRXA 1VL2A 2RE8A 1YULA 3ZJUA 1NSYA 1R5BA 3IVGA 4ZCQA 2VYQA 4TMVA 3I55B 4OUDB 1M8FA 2VTBA 2XEXA 3W5HA 2JA2A 3PRHA 1ELOA 3G6EB 3GUZA 1YITB 3CC7B 1A8HA 4MW4A 1F7VA 4LBZA 3IMEA 3IUEA 1BX0A 1COZA 1P7PA 3ND5A 4K03A 3VGJA 4A91A 3BL5A 3IMGA 2BMWA 4MUEA 3ELBA 3CCUB 1JIJA 2A84A 2E21A 3WBKA 5DB4A 3CLRD 3CMAB 3AFHA 4AF7A 3QFSA 2QJFA 3M5WA 2PFSA 1KC8D 1N77A 3CLSD 1G7SA 1N2JA 2X3UA 3CA8A 3KT6A 3G5AA 2R6HA 3HZRA 1PFUA 4HK4A 2BSAA 1TYDE 5KHAA 1MB9A 4TMWA 4PC2A 1CNEA 2A1UB 2Z08A 4MVCA 4OUDA 5IJXA 1OBHA 1IFXA 4EG6A 2YY5A 3WBJA 4NAHA 3P0JA 4CDMA 4YAUA 2QJOA 1YUNA 1GLNA 4F3RA 1O95D 1MC1A 1WOYA 4DLPA 1O0CA 3G71B 2I1LA 1Q86D 4NX2A 3UOWA 1U2RA 3AGQA 1TTTA 1O95C 2CT8A 1M90D 1NUUA 3ZC3A 3SJZA 3SZGA 1HA3A 3CXCB 1EFPB 1QRUA 1D1NA 4NAUA 1SURA 3TS1A 2PLFA 5TR9A 4KR9A 1N2EA 2R5WA 4WSOA 1F60A 2NPFA 4S1OA 3CCQB 2FX3A 1WJGA 1EE1A 2RC6A 4YAFA 4F4HA 2X0KA 1QQTA 5DEOA 1IH8A 1W34A 3AL0C 1JEEA 3QFTA 3W2HA 4YBRA 2A1UA 3FOCA 2B5OA 2GM3A 2IELA 4MW9A 3TZEA 4PBRA 1QGAA 3E27A 4ZCSA 1F9AA 2H2AA 1OD6A 4QREA 3UK2A 3WXMA 5DSZA 3JXEA 3HGMA 3RK1A 1EXDA 2VNHA 3ZUGA 1K73D 1VQ8B 1EFPA 3VO1A 2EIXA 5FO0A 1J70A 2PG3A
chains in the Genus database with same CATH superfamily
1FX0A 4RVDA 4WTOA 4UBKA 1Z3IX 4YTEA 4XDZA 1ISPA 2I54A 2QD3A 3HCBA 3TIVA 4M0MA 4ZDJA 5KVVA 4I2NA 4UD2A 3SR0A 1Z6ZA 4XVCA 4B87A 1U8CB 4ZDWA 2OCDA 3UJPA 4K86A 5D2CA 4IO0A 2RHGB 1X6OA 1ESNA 3AM3A 2AQKA 3E8MA 2Q0XA 3GVKA 2OV2A 3EBLA 2Z9CA 4JR1A 4UQOA 1QCFA 3TNFA 1VIAA 1NYFA 2PDAA 4FSSA 5AOVA 1CEEA 3ZNNA 1QJ4A 3PEWA 2CHEA 5KQSA 3PQDA 3IIEA 5LZ2A 1QF9A 3PEEA 4MCAA 4IH9A 3D7NA 5DS0A 4A9AA 1ZIXA 3S0JA 1MH1A 1H05A 2QXYA 1L7OA 1UP6A 1EM6A 3OD5A 2CSUA 2ZFUA 4YCDA 3GFOA 2EBPA 1LA2A 1VLVA 4BRUA 3WSTA 4E4YA 1E3MA 5TVGA 3LT2A 4FN5A 1I51A 4UKDA 4FDVA 5I5EA 4HDRB 5HM6A 3ZGOA 5ICCA 3HRUA 3CVYA 1OZ3A 5D6XA 2AF3C 4WASA 3FCAA 2GYUA 2V6IA 3YASA 4HPJB 4NBUA 1X42A 2RJOA 4XM3A 1S89A 1NUTA 4ZXPA 1T3HA 4KOAA 2R9VA 1RM5A 4ZVKA 5A9SA 2YTZA 1JKJB 1ZSVA 5DTMA 1PYGA 1N8RC 3UMJA 3HXLA 4G5HA 3EEFA 4LW8A 4EG5A 5IAOA 3H11B 1OHHD 5B6JA 2QTBA 1FW6A 5I9IA 4UHEA 2DD5A 5DZSA 2ODTX 3KPJA 3CWCA 4QAJA 2MCFA 1N2ZA 4U7PB 4DUGA 4XWAA 3PVSA 4A0QA 3H13A 1C7QA 3D8TA 4H7KA 4O33A 1FMLA 3UMMA 4G09A 2OO7A 4L6CA 3G88A 1MIOA 5B58T 4KZKA 3CC2Q 1QZUA 4M77E 1EMDA 3ROZA 1WUTA 3WQRA 2O5EA 3V1KA 3H0EA 2IIVA 1I7QB 2WP8J 4RZUA 1OWMA 3TTXA 1AEYA 5KJ1A 3T1VA 2V0GA 4Z89A 1ECBA 2JLBA 5CFNA 4Z4FA 3QLEA 1W1WA 4EEZA 3EA4A 4N9WA 2Y0BA 4V2UA 1FXUA 5DGCA 2V7PA 4CQMD 4B45A 1U8YA 3BH0A 3H04A 2DOGA 1E5XA 3NTKA 5EQDA 5MN6A 4IUPA 2WF7A 4M77B 3VR5D 2VQ3A 5IHXA 3IDQA 5TT0A 4IJQA 1GO2A 3QIAA 2MSCB 4AYTA 3BH4A 3EF0A 4GLOA 3VSAA 5AXCA 4D42A 2MAMA 5E7IA 5JCPA 5CDSA 1EBBA 4YV2A 3A28A 1SQSA 221PA 1P31A 4N47A 1J0XO 1E3TA 2XWQA 4Q3DA 1N8RR 1THTA 3NNSA 2PU5A 2WKRA 2HSPA 1YA8A 2C59A 2FW6A 4AZ0B 5HRCA 4UVEA 3ACDA 3KSMA 1JRLA 4E5DA 4XKJA 2ZM5A 4E13A 1BW9A 4XU3A 5EWJA 4L07A 4KYIB 2H1RA 1VRWA 1RACB 4RA9B 3IPCA 4CLRB 1Q20A 3D3JA 4IHJA 1NVWQ 2XMFA 2BUAA 3IPXA 2B1JA 3GEEA 4U6NA 5DBHX 2DZ9A 3KU1A 1FFBA 5E6RA 2COKA 3VR1A 3Q3AA 2Z08A 4W1RA 2HLHA 3ZWYA 1B8NA 3W7AA 4REQB 3B7GA 4RIGA 2QBYB 4AD8A 2WAYA 3DB4A 3NYQA 3W2HA 1HYGA 2PBLA 2Z2XA 2VN8A 3EPRA 2C96A 3HKSA 5LMUB 2W8BB 3HA2A 4FS8A 3MWEA 3WXMA 4C8QA 4C5CA 3UIEA 1L5ZA 3FUUA 3ZCRA 2PG3A 4Q1CA 1PJ5A 2X6XA 4XDHA 1OV4A 4Y9DA 3ONEA 4CN8A 4P0TA 4EPRA 5AJWA 2GN2A 1LSJA 1EK6A 4LGVA 1OKKD 1RWVA 2GD1O 1D3AA 3H97A 3PR3A 4LDUA 5AVQA 1UDXA 3UH1A 4K87A 3FYUB 4O0MA 3ZWPA 2Z95A 1I2CA 1EFTA 1Z08A 4B4DA 2PR7A 4U5XA 2BL4A 1MO2A 3EFOB 5T3UA 3V2IA 2FX5A 3LC2O 5JAOA 3GJ3A 2DOKA 3D3EA 3LQ6A 4L8YA 4UJ3A 2C4HA 1XLTC 4GFDA 3NTHA 1A82A 4Y2QA 1VQ6A 1Q6ZA 3U26A 5AKXA 2KVQG 3MMZA 2OMEA 1XCPA 4JX9A 4DV1B 3L7MA 4ZPXA 1AKWA 2DQSA 4UREA 1N2IA 5LL6S 3T94A 1JJVA 2J7PD 3A5ZB 3TE7A 4EUEA 1R3UA 3SF8A 5JQGA 4U7TB 3DB2A 1G2IA 5H16A 1PO7A 2LD4A 3DLBA 4M8SA 1GQSA 2X4DA 4IIOA 1YGPA 3Q9LA 5LM3A 4GX0A 1VQPB 8GPBA 1NUHA 2XZLA 4N01A 3QVLA 2ZRGA 3KV1A 3OHPA 1ACMB 1QQBA 2IG0A 5T4HA 2O4XA 3C15C 1Z9QA 4RF2A 2ACWA 2F17A 5AK5A 2O06A 4R9SA 5JDIA 4PFPA 1ZJWA 4RFSB 2FPSA 2F4NA 3X25B 2IY9A 3CRZA 3K96A 5DF1A 2HREA 4DV0B 3FCUB 3U13A 3AIMA 4UTXA 1SOVA 1PHTA 2QRMA 3BEDA 3AM1A 2H92A 4RPDA 1BK2A 4EJSB 5NULA 4A16A 2M9UA 1XDZA 4AJEA 1GL5A 1B3BA 3DO8A 2BF4A 3JQ7A 3Q7RA 4P7BA 4GC5A 2A8YA 3RJZA 5A9TA 3CCJA 1AHIA 4BZXA 3M4NA 1X7ZA 4CR6A 1QB7A 1I6KA 1NYTA 5F2KA 1V4VA 4D0NA 3HKEB 3WKBA 1A4RA 3V4RA 3RMQA 4RE5A 3NYWA 1OW3B 3FKQA 1ODJA 3KSRA 4LDYA 1WDXA 2V6GA 1PJ6A 4TYQA 4KGDA 5IKXA 2P4RA 3IAS1 1B14A 3PNSA 1Q0SA 1II8B 1WPYA 1O89A 5BQOA 1WKBA 2HF2A 2GMWA 4CKZA 1GQFA 3NHYA 4FQ7A 3CF0A 2EVRA 1BXRB 5IXSA 4RD2A 4JT2A 4V39A 4YCBA 2C92A 2AFHA 4QO7A 3ZIAA 2ZSFA 1A9XA 4XWYA 1ZISA 4P1ZA 1PUJA 2K5FA 1E32A 1TI7A 2B8NA 2PMDA 2PYIA 3LPLA 2I4OA 1QHFA 3A9UA 1I3LA 1M2FA 3IIKA 1L3BA 1I4K1 4EHBA 4GX1A 3JWEA 3LOQA 4PE5B 4D3XA 4IYJA 1T4DA 3PRJA 4OJKA 4C2BA 1XXHA 3CCSA 4EGFA 2ZUDA 2RHUA 3KQHA 3L6RA 3L0IB 2FPDA 1BHQ1 3BWDD 2Y4YA 1EFDN 3P94A 3HN2A 1RAAB 1EJ6A 8MHTA 1RP7A 3JQQA 5KJCA 3EWAA 3I55Q 3BK1A 1DDGA 5K2OA 3L43A 3KFXA 1GDTA 4V02A 4K11A 5DM0A 3IDAA 4ZN1A 3IMEA 5GQSA 1TLFA 3IO3A 1PKXA 1SBQA 2F59A 1G16A 4ZHSA 4LRUA 3D1LA 3JASB 4ZV7A 3V6LA 1YQQA 4HCJA 1GPBA 1W85A 4Y6GB 2RKBA 2PL5A 2YY6A 1AQIA 5BSWA 2QQFA 9ABPA 4K9QA 4C0QC 4Q4HA 1LBIA 4XARA 1XVIA 2L3QA 3UXYA 4ADSG 4D74A 4GLLA 2GO7A 3Q3HA 3L1AA 5F52A 1JBEA 1DJOA 1Z0IA 3GLIE 1HLFA 1P44A 5TQVA 5JH7B 4FFBA 4UM9B 1TM5E 5C8VA 4IMIB 1I32A 1Y4UA 2JI4A 4E12A 3IOYA 5ITWA 1M0SA 2C84A 2PWZA 1XMIA 3HMKA 1I3KA 4OV6B 5F7OA 4NYJR 4HVUA 2VP4A 3WKCA 5JZVA 1H94A 4G56A 3DFIA 5FWXB 1G8GA 1DAPA 1A8UA 2O2YA 2WJ6A 2EW1A 5AVSA 4BWYA 2QEXQ 2C00A 2I6QA 4M75E 1GUZA 4VUBA 5CFPA 4OATA 3FVVA 1TUDA 1C7FA 4LDJA 2SKEA 1DKMA 4PRLA 3AHHA 1X13A 3LPDA 3CMCO 4QODA 2ZR0A 2OYRA 2QE7A 1NN0A 1HNWB 3META 4IKPA 3RKRA 1K3TA 3UPTA 3A8GB 3TPZA 2C03A 3FB9A 3H2IA 3U7RA 2Y6UA 1Y33E 3WLLA 2J30A 3TW6A 5IKEA 1YJ9A 4KXYA 4A4KA 2PM8A 4JRPA 3DKIA 4TVOA 2Q8QA 3PJFA 1ZA1B 3CCCA 1P62B 4ZQBA 4XOPA 4I1VA 3AH8A 1Z06A 4NBTA 4PNOA 4P7JA 4R8MA 2QZ9A 4JZYA 1GPH1 2RHTA 3JD4A 1NJ6A 1E3WA 1P77A 2CMDA 3MJCA 4ZVVA 2PUEA 4KHPB 2BF7A 2B4RO 3HB5X 3MPUA 1NXWA 3OSSC 4EYKA 1GFCA 1KU6A 1KO8A 3QE2A 5DCWA 1ZSYA 3C16C 4DLUA 2YWXA 1O9HA 3BXOA 1UEJA 1CEXA 2C2XA 2OCYC 1GQOA 4WLNA 3R8XA 3ER9A 1YE5A 1L7DA 2RGEA 2OC4A 3V00A 1SG6A 1P3Y1 2UXDB 1SVKA 3R9KA 4LXTA 3RUHA 4MZMA 2F9LA 1ZD9A 2J9RA 4PYRA 2VAPA 4PYJA 4E94A 3B1VA 4CEHB 3W6NA 1XWWA 4GYKA 2JGKA 2HQ1A 5LNK1 4TZKA 1BC5A 3GWGA 3GFVA 3EG3A 4PBTA 1DE0A 4MV4A 2Z6AA 4XAQA 4BFTA 4LE9A 4F71A 4BLUA 5LBTA 1YI2A 3A35A 1ZOLA 4L74A 1JDBB 3HN6A 4NFLA 3ZLJA 4EGSA 1CY2A 4PHHA 1R1DA 4OI1A 4EATA 4PJOD 4QELA 1NL3A 3AUYA 1FTNA 2WY2D 1DUSA 3DDNA 4W8OA 4ALIA 3C85A 2OTCA 3IO5A 3B1ZA 3DFFA 2F3PA 1UD4A 2PQMA 5K0SA 1GNTA 1XLVA 4KULA 1EP2B 4ZOLA 4PBSA 1E69A 2CDTA 1JDPA 4CMJA 1W6RA 3U6KA 2PXAA 1SVOA 4CIDA 1NF3A 1V9SA 4LV8B 2O2GA 5E1DA 1EUDB 4NJMB 1UKAA 1YR8A 3R0IA 3H9UA 1T13A 4N7MA 2X6WA 1T1EA 3DTVA 2QQ9A 3G4SA 1LSOA 1K92A 2IEIA 1UAYA 4FMPA 1PR5A 5HK0A 1ZSGA 1W52X 3FR7A 1DSSG 2J6CA 3G68A 4H7PA 4EG4A 1TM3E 3H2JA 1JU4A 2Y0PA 2QAGB 4B5LA 4JNKA 1U3VA 4UU7A 3PF9A 1DP4A 4JMPA 3U48A 4Y30A 4A0GA 1XNQB 3NPAA 4ZICA 1WNFA 2VYQA 1Y0YA 2NQ2C 4EGQA 3EVNA 3OF5A 3FJ1A 1KR5A 3G02A 4U7HA 1YE8A 2HQRA 1ZDMA 4QOIA 1LNQA 4PNZA 4HDSA 4KIWA 4LPKA 3PSHA 3L4JA 2V65A 1GLNA 1LRLA 4DLPA 2WSEE 3E5MA 1U2RA 1TTTA 4D98A 2GHRA 2XB4A 5SZHB 1POXA 4GOKA 1NKVA 4EUFA 1I1OA 4S1OA 4PRZA 4CT5A 5H70A 1DAFA 4HRAA 3V1YA 3T1TA 4RF4A 2A1UA 3PGA1 2G17A 4PG5A 3BGDA 4I4TA 4KV9A 3K1ZA 3OPVA 2HXSA 4LV5B 3EVDA 2H1IA 4P82A 3Q9UA 4IFTA 4I1OA 1D04A 9LDBA 3B5EA 1QYCA 4WGGA 3LQ2A 2O2JA 1MAWA 1EESA 4UUBA 2CXHA 5MDHA 5AUOB 1DG1G 6GPBA 3GPIA 4U2GA 1PKEA 5JBIA 3OP4A 1NHWA 2ADFA 2IOQA 4UTRA 2ZSKA 2QL5A 2XUKA 4JUDX 4Z0PA 3E1YE 2D74A 3ANNA 3D4PA 2G9QA 5A5FA 4NNJA 3JCMV 1CRZA 4B7XA 3LKDA 3DQQA 3MPOA 4KXVA 5LJ5f 4E7ZA 4MROA 3DMGA 3KLPX 4GD3Q 2YWCA 1KZ6A 2FDXA 4ARUA 1I7SB 3AOEC 1ZUNA 2TMKA 1BDHA 5LDHA 3FIFA 1JB1A 2Q5LA 2VKQA 4ZU3A 2VHVA 3ND7A 5FV4A 1UBCA 3SSOA 3D31A 1I5EA 2NWQA 3ZU3A 1C0MA 3JCMQ 3D6NB 5TY0A 4LTMA 4CKEB 3JW8A 2J3HA 2ZJ8A 1UPAA 1YIJB 2R68A 3SDSA 5TT1A 3UUGA 1AHJB 1P39A 1U6KA 4XASA 2BBSA 4GMGA 3H86A 1PJ8A 3WICA 4ESHA 4XQ0A 4DR6B 4PM4A 4GOXA 2PLWA 4UZSA 2WJWA 3ZGYA 4WESA 5KNCA 2VYNA 2Z56A 3JR7A 2O14A 3S8EA 4HX9A 3L02A 1OX5A 4B33A 4NC9A 1C9JA 2FE4A 1T1GA 3SLRA 1FX7A 4R31A 1OXSC 4KSCA 2GFAA 3ZGVA 1SKYE 5IAGA 1HT3A 2FUKA 3FSEA 4G4SP 2OECA 4UUNA 4LRQA 1U3DA 4EA8A 2G28A 5L4SA 4MV0A 1RXWA 1VA5A 2BZ0A 1K1EA 4FGLA 4MDEA 5JQGB 2JVVA 1I5LA 4DXDA 3AVYA 2NO9A 1NXVA 4N4HA 4DCUA 3IIIA 5BYBA 4R1MA 1Z0KA 1YJXA 1SKYB 5HUJA 4H77A 1MX1A 2PRSA 3RS2A 2DQKA 1BH6A 3L0BA 2DP4E 2R1VA 3Q6QA 2P40A 2F48A 4P3XA 3ZDEA 5KQGA 2FJPA 2LP4Y 4CUZA 1SCIA 2B3TA 3VISA 1LWNA 1KIKA 1WIEA 1O6GA 1Q0ZA 4CBVA 3QOXA 1ZJZA 3PI6A 1F12A 1R16A 2QLTA 2RAVA 4ZIRB 5EXTA 2QGFA 4RGBA 4QGFA 1LBHA 4OHYA 4NYMQ 5FW9A 3RUXA 4J90A 3QFCA 2E49A 1XA3A 5LYJA 5JCOC 1M5UA 4QXRA 1G9TA 1AUVA 4BV2A 1X8LA 4BMVA 3UWOA 3K1YA 2B86A 4DTIA 4WA8A 4TS9A 5HZAA 4ZQHA 4PLWA 3MWDB 1Y6RA 3EUAA 3V4PB 4YASA 5KNBA 5C0MA 3NJ4A 4MA0A 5KJ6A 4Z5XA 4ME6A 2B0JA 1KNQA 3ZX5A 2HU7A 3FZEA 2GHIA 2BFBA 1GFZA 1C0PA 3E23A 3TD2A 3EDOA 3LBIA 3LOPA 3B60A 2P3OA 2F3TA 4LYYA 4BBZA 5JALA 2G1PA 5D84A 3PFIA 4RF5A 5FOTA 3OZVA 1UF9A 3SE0A 1EWYA 2X1VA 2VKNA 2CMHA 4FQ5A 2OOKA 4MP3A 3QYFA 2CKKA 1C41A 1E59A 2JARA 2H1VA 5EVCA 4HS4A 3LVRE 1PLJA 3V8JA 1YZHA 3VOAA 3SHWA 1HYEA 4FDLA 5FFFA 2V6JA 1MNDA 3DZBA 3KKOA 2QX6A 4M1ZA 4EO9A 3DDWA 4AFSC 3FFWA 3OEEA 1H0RA 5ALFA 3PMTA 5D1NA 5I7VA 2QD4A 5CT4A 2EJVA 4JODA 5EXXA 2O1XA 1LNXA 4EZIA 4PSDA 1IPFA 3IQGX 4DQUA 3EPLA 3RERA 1W0JD 4PR0A 3JCMJ 1ABEA 5SV2A 3KSUA 1RCFA 3PGLA 4PG4A 4QLOA 1I4OA 4AMUA 3BCUA 2HLDD 3R3YA 3WZLA 2GGRA 3T9NA 3DQPA 1O9SA 3ADPA 2XJ9A 3DAFA 1SHZA 3ILHA 2GHTA 2AKAB 1P7CA 2R0QC 1KQ1A 3VU3C 2E5QA 721PA 4HUTA 2JGEA 1NVKA 1VDZA 5CLGA 5GOZA 5C1IA 2J06A 3I2YX 3CMEA 3COVA 1BEEA 3LHIA 3LUGA 1PCXA 4L3OA 1KG1A 2DHRA 2W2KA 4BLVA 2AT1B 1NP3A 1KKMA 1YFZA 1U1EA 2LZ6B 1AMOA 2B7LA 5C8YA 2QKYA 4JP8A 1L3CA 2NSDA 3SWNB 1JYSA 3R5JA 5C7IO 1GZ7A 4ZYVA 3VUZA 1QCNA 1TEZA 1PNVA 3OYEA 1A9PA 4WKCA 2GN6A 2I87A 1XQYA 1E0SA 1Z2EA 4F38A 3E7FA 5FOSA 1OI7A 1W4SA 4C4XA 4LF7B 1D09B 1C80A 1IPEA 1ULUA 3WA7A 4AG2C 2WLSA 2F1OA 1M6HA 3WL6A 2FG5A 3WAGA 3QVXA 1KQSP 1DKUA 4HQKA 3I5MA 5BQFA 5TV2A 4W99A 3HRIA 4LKRA 2Y71A 6REQA 4QRDA 3OT4A 3BEOA 1DBPA 3LS2A 3K2BA 1ECLA 3KV3O 2QU8A 4ZHQB 4C5GA 2VJNA 1IHUA 2J33A 4FFOA 3KYDA 4C8QG 2O8FA 3MS4A 3RRFA 1L4HA 4IDQA 3IBCA 1DHTA 3ZEAA 4R7ZA 1TVMA 3GA5A 1UPUA 1LY1A 2Q99A 4BEWA 3A6ZA 3ZTTA 3H3XA 2Y1DA 3U81A 3W34A 2CZ1B 3HRTA 4LC1A 4YT2A 4HRYA 3RS7A 3BW1A 1W5EA 5CT6A 4GDFA 2V59A 1OXBB 1VMDA 5FAKA 1A95A 3E9YA 2E87A 4DCJA 2AOXA 3KBBA 5AVWA 4R2LA 3CUEF 3QP9A 4DF3A 5A0LA 2H7CA 5BV2P 2QK4A 3LRTA 4M9XA 3NPMA 4HTFB 2ZWVA 1ST3A 5JXJA 3P45A 1N9RA 3LW5E 1SXGA 3L6EA 2ILVA 1NJ1A 5DH9A 4GM4A 3FYCA 3TU4K 1E3WB 2JHGA 1D9XA 2INGX 1LB1B 5IT0A 1FXWA 4PO1A 1XG5A 4LCJA 3WRWA 2B83A 1OFUX 3DOFA 3QEMB 3R0ZA 2AKEA 3D7MA 4YVFA 2NZXA 3AETB 4U2EA 2AKLA 2KMLA 1ZH0A 4F4CA 1JT9A 1JEAA 1T9GR 2MIIA 1WABA 1P1HA 5TMPA 4WLOA 2O8BB 3EWNA 3SVTA 5P8WA 2FG6C 5DLOA 1EIZA 1UBUS 3BD9A 1CIVA 1M0EA 1CF9A 2P3MA 3TQHA 3PUKA 3M1LA 2ZIUB 1NVDA 2L2QA 2PKCA 5B4UA 3GPCA 1B93A 5A06A 4TLBA 5IYZA 1QC5A 3KCNA 4I1IA 2ZRCA 5IVKA 2P6RA 1GG8A 1UZUA 3BAZA 5HS6A 3D4LA 1ODIA 3R3SA 3CVVA 3U3OA 2OZKA 4LHEA 3LQYA 1R4NA 3AUTA 3F97A 3MWGA 1N8SA 3VRZA 2AMVA 4AULA 3EMKA 4DLXA 3AY0A 4WIAA 3CCMT 3VPHA 1W1IA 2Y68A 4JOQA 4RZHA 4TQ9A 1II9A 1U9JA 3K4HA 1XALA 1XTUA 4ESVA 3I64A 4KQFA 4X1KB 4W7SA 4PZYA 2YYAA 2I6XA 1Y8CA 5AIBA 4I1UA 4HR7A 1JDZA 3VTFA 5K6RA 1XOVA 4F3NA 5A05A 3RVMA 4BNXA 1QRUA 4FT4A 3KLMX 1YX2A 1HO3A 1FEZA 2WR8A 3QW4B 3QFTA 5TQ2A 1I4DD 2ORIA 4TTVA 2A08A 4RTVA 2GD2A 4B3RB 1E2LA 4K88A 4X61A 1EK1A 5IVIA 5I6DA 1KK0A 5MFZA 5K0LA 4YRGA 4F2HA 2XVZA 1RDFA 4C5AA 4UOEA 5KWEA 4ZAFA 5TNXA 1Q1QA 3JQCA 4BI4A 4TN1A 4RZQA 1M8PA 2BKLA 1Q11A 1UDWA 3S3NA 4O2RA 1DB3A 2GZRA 4OPSA 1SCKA 3D43A 1YQXA 1G20E 5EIHA 1HE1C 1TGVA 1KD1C 3D6FA 2CC2A 4NBNA 3JYQA 1E0AA 1GGJA 4JLKA 2FSIA 3KOXA 2H2GA 1VG9B 1JAXA 1JECA 4M78F 3RQIA 2TS1A 3NBKA 2PH1A 4YXFA 1G20B 1QIEA 1AH2A 3F5QA 1VCMA 4P38A 2RK6A 4ENSA 2QQ5A 1H4TA 5CAEA 4A8JB 2H2FA 2PL1A 2C99A 4P1VA 4JLOA 2Z3VA 3CEYA 1NJIU 1G83A 2B9EA 7ADHA 8AT1B 1ARKA 4HL6A 5HKCA 1CJCA 3SLGA 3CC7T 1NQ5A 3C3PA 1I2MA 3ZKAA 1N34B 4PYMA 1ICIA 3N74A 4EP1A 2VWFA 2QW8A 3OZAA 4PN3A 4UBLA 3HRHA 2O0LA 1L4BA 3DFZA 3H2YA 4DSOA 1BROA 4N6GA 2IV2X 2R3SA 1ZCFA 4FSDA 2JF0A 4UNNA 4KLAA 6YASA 5REQA 3B9PA 3O4JA 3MINB 1Z2DA 1DEXA 1LI5A 1FRQA 1SB8A 1Y6QA 4IIFA 3Q1LA 1UBTS 2LCFA 2Z1NA 4EFKA 3QPWA 4PYLA 2OFWA 5HJ7A 5C0OE 4QBFA 3ZS9A 5A6SB 3AIOA 4AI6A 1MDBA 3W4KA 1FFCA 1UK7A 3OJOA 2F2XA 2JA1A 4NU6A 2HIAA 3KT3A 1SWVA 4KO1S 3HL8A 3NIFB 2WMNB 4HYTA 4LJSA 3IP7A 3VYRB 1Z8NA 5DHAA 3OJFA 2GRUA 1KD1R 1J42A 4KFRA 1ENOA 2PUHA 4Y6OA 3IUQA 2O9JA 5IT9A 5CBKA 1N5IA 4L6V5 1SHLA 1C8BA 2I7VA 1SVSA 1SKUA 4MWEA 2KW5A 1PNTA 2D0OB 1JRIA 4LOAA 3GC6A 1OWNA 3AVWA 1U9IC 4BNGA 1B76A 3V4ZA 1ZXXA 1W36C 1TM4E 2ENUA 2CGHA 2O19A 1TD9A 4I8XA 2EGHA 3LGFA 1UMDB 3CZCA 3ZHOA 3DV0A 2YS6A 1XNRB 5AUQA 2G0NA 4GWLA 1D6MA 2ZITA 5AVOA 1KOGA 1WXBA 1UDBA 1II0A 4V0SA 1AX9A 1M6NA 4U8GA 1NLMA 3DAGA 5J26A 2PS1A 2QD5A 3HTXA 2PE3A 3CLHA 4B3DA 1YJWQ 5AVVA 4KLNA 1OIXA 2HL6A 4X93A 1OAKA 3EHRA 5AK4A 1P4JA 3O2QB 4BV8A 4I9FA 1GT91 2RHLA 3DMHA 1I3MA 4N0PA 3P8HA 3ZE7A 3A3NA 4MCIA 4N1AA 3WL3A 3KKLA 4ACAA 4WNCA 5CK5A 2PGJA 3PQ2A 3NRJA 4YMTA 2AN4A 3G49A 5L3QA 1YRYE 4NBRA 4D81A 1ND6A 2BGTA 1CUEA 4S12A 4EHJA 4DG9A 1KYVA 3AXSA 5IW8A 1P18A 4P5EA 2OBXA 2WWGA 2IH5A 4R54A 5DRYA 5K0JA 2WSFE 3LY8A 3EXHC 4TTPA 5ICMA 5KX5F 1MJGA 2DSNA 1AHNA 4E2YA 1PBTA 1G8YA 1KJIA 4Q9DA 5LYJB 4PO9A 4F0JA 4X7RA 5KW9A 2YNMC 2H4JA 1E2PA 2A94A 1QE3A 2AWOA 2XB6A 4UQLA 2UYYA 4ZXFA 4QDUA 1SCNE 3DB1A 4OXQA 3WLRA 2YVKA 1U0SY 5J3JA 1JEEA 4AB1A 3ZV4A 1R0BA 3UHAA 4DCMA 1VJ0A 5AM5A 4OEHA 1VQ8B 3NHBA 3PUNA 2ZYRA 1KK1A 3DJYA 4F93B 4EO7A 3C5WP 1W88A 2VK2A 4RTJA 1YDGA 1W30A 4MW6A 3AUFA 1HM5A 5GMKl 4HFJA 3QMVA 3UHJA 2N1BA 3CCVT 3EDMA 4C5EA 3GL9A 3T7EA 1X70A 2LR0A 4LJLA 4XYGA 5IJ9B 4H3KB 1ESEA 2WFZA 2V9CA 1WJRA 2I4NA 4OQMA 3IKTA 2QN3A 3L1JA 3ECCA 2RKOA 4DMRA 3H19A 3PXXA 1UIMA 4AJIA 1GWNA 1J0BA 5GAMh 3C5EA 2KI7A 3OX1A 1FSZA 4W5QA 3T9FA 4R55A 5NLLA 2OJ2A 4QDXA 4Q4LA 2PLAA 1U7UA 5FEMA 3UGTA 4J91A 1T4GA 4S2UA 5KSOA 1JTVA 1A9RA 3MF4A 4WAUA 3LKBA 4TL9A 3QQPA 5C1PA 4R2WA 4GPIB 4Z4RA 5ESRA 1UZLA 4PPNA 4RTKA 3P0HA 1A9QA 3FF1A 3SLDA 5KYWA 1Q3KA 3X20B 3SQNA 3TVTA 2GFIA 4JU9A 4ZMBA 1XTSA 2VUBA 1WHKA 4PYOA 3NDRA 4HB4A 1D03A 2BMVA 4FBMA 4L16A 2NV6A 2HYDA 2D4HA 2P62A 2HH9A 3ESRA 2PRZA 4L75A 5KEIA 4B85A 3FTNA 1T5HX 4OHFA 4DWWA 3AJAA 1PG5B 4HGNA 3IDSA 4BO2A 4MDFA 1EYZA 1XJQA 4DGSA 1FDOA 2JBHA 3OTIA 1HZZA 1CUIA 1Y98A 1CQXA 2P30A 3GT0A 4L76A 5DNDA 4WERA 1K8YB 1FTYA 4U8HA 1ATIA 4HCCA 3WLSA 3SEJA 1IPHA 3ZLBA 4Q5WA 1QE0A 2Z0WA 5ICGA 4NMWA 4E14A 4TKLA 1JAZA 2I8CA 4TM8A 3O8BA 1ULZA 1MAAA 4OYRA 3ZNQA 2C5GA 4A2WA 1XBTA 2HA0A 4TV8F 3R44A 1KJNA 3QU5A 2KYRA 2DUNA 4E30A 4JQSA 4DN6A 3KZCA 2HWYA 2CFSA 3SYRA 3TRFA 4RVNA 1JJ2S 4N82A 3WOVA 4OSOA 1DTSA 4Q1BA 1AT1B 1NW9B 3K9QO 3JCMb 3TW0A 3VR3A 1MMFB 2FHSA 1PKVA 3UK7A 4I4CA 2NU7B 3OYLA 6Q21A 3ASQA 1SIOA 1UAAA 3ENVA 3P4YA 4L6AA 2XCOA 1XC7A 2VVTA 3UJHA 3I23A 2JCVA 1BFKA 2GJ4A 4HUQB 2P1ZA 4JGGA 3Q8XB 1JFRA 1A71A 1BG6A 1M9NA 4KN5A 3BDAA 4MUBA 3NASA 1W76A 2K3XA 2DBVO 4AJHA 1V8PA 3G8BA 4XVHA 5EE5B 2Z5FA 3S55A 2BZSA 5CVVA 3L7LA 3ETJA 1RZRA 5LIPA 2LZ0A 2RHMA 2GCOA 3O8QA 1ZGHA 1E4VA 4PL6A 4OMQA 1RPZA 1EAYA 2NT3A 3F3YA 1QM5A 3GFBA 5K8VA 1KZ9A 3MIZA 3I6BA 4HVCA 4G8CA 2E65A 4O3FA 2P65A 3K0AB 3STHA 4Y1FA 2EFIA 3DFKA 1WUYA 4J1TA 4KYVA 4M7PA 3N5BB 3DOUA 1V5FA 1SD5A 3LH0A 3ZJUA 3GBSA 1IUNA 2CLOB 4HZUB 4FDAA 5EJIA 5L23A 1GNLA 5CKHA 3QI7A 3QHAA 4D4HA 2QPAA 2BFNA 4BX2A 1C5KA 3QHQA 2BONA 4I14A 2O2HA 3ILYA 5CLLA 4XOUA 5JCJD 3UHPA 2ZWAA 5AOBA 2CFRA 2WUWE 1N08A 3F67A 2R25B 1YHQQ 2OD7A 3NAMA 2FU5C 3PWSA 3V8MA 2OVFA 4GGMX 4KIJA 3R0XA 2DR3A 1YN8A 1QGDA 3ZQKA 4ZVRA 3MEQA 1SZDA 2Z3ZA 1GCUA 1SVLA 5HILA 1MR3F 5SYNA 2JKVA 3OLQA 1DRJA 4ZEVA 1GXIE 3WYNA 3BK2A 3CLVA 1NSFA 3RQSA 3ZWNA 4ANFA 4DWVA 3KUKA 2BFOA 1P7YA 4F2WA 1JG7A 1XZGA 2YXNA 1TYBE 5L7WA 5EJFA 2WMOB 3QJ5A 4P3PA 4MTLA 4BB6A 3MTJA 3FVQA 3KEQA 2V31A 4O4LA 5GPBA 1LQ2A 1C9EA 1U1GA 2YW2A 1U6IA 4KAFA 2AEEA 1NOKA 3CRW1 1CUAA 3ZZ0A 2F1JA 1K5GA 3GIWA 1G3UA 2CH4A 1ILEA 5G0UA 2PYDA 3IVMA 1J8QA 2P2DA 1I7NA 2IHBA 3ZK8A 3RVDA 2YRXA 1UOEA 2OAQ1 1FYFA 2Z4TA 2KLHA 4C0BA 1CUJA 4PJNA 2B92A 5JVDA 2AG5A 1ZA2A 4CM8B 4HVTA 2WYIA 2ZI7A 3HI4A 2XWSA 1X7WB 4ZT2A 1RLTA 1LDNA 5CKDA 5TQ2B 2Y27A 3CG0A 4ZVLA 1IK4A 2UZ4A 3KRTA 1OLOA 5DHTA 1JWLA 2NV0A 2V1RA 4YYZA 4FEAA 3BSWA 1B6SA 1FRFS 2ZLBA 3OOEA 4XTYA 3JV7A 3O8NA 2J5BA 1KSGA 2A37A 1VLZA 1ZGBA 3CISA 3HDVA 3X2SA 1KQSA 1AY0A 5CITA 4RM3A 4CI0B 1U1IA 3T4UA 3PIIA 3Q0TA 1JX6A 1FVHA 1IIRA 2Q5IA 3IE1A 5D6OA 2V0CA 1CZKA 4RTSA 4G5GA 1CRQA 4ENVA 5CH3A 3UJBA 2GPYA 2ED1A 3OCCA 2PMCA 2X7HA 4AP5A 1GADO 3MJSA 5AVYA 1SB9A 4BFLA 1H2FA 4V0KA 4E6RA 2O0MA 4QJBA 3PDJA 3OPYA 2IKSA 2EFDB 2ZSHA 1GTSA 4Y2HA 3B82A 1VBFA 4H7HA 3HKBA 1DV1A 4JCOA 3EFEA 2YWFA 2G88A 4GGOA 3S2ZA 4J8PA 2Z5GA 1KI1A 1DCMA 4AQYB 1CS4C 3CVWA 2QEXA 3SJAA 2IIBA 4I3FA 1X1SA 3ZLVA 1LV8A 2DC1A 3D0OA 4NI5A 5DNVA 4AMBA 1JKXA 2NTJA 1Y4DE 1ECPA 5EI5A 1YQDA 4BMNA 3NH9A 3V8EA 3AESB 5B3LA 4C4RA 4GGPA 1C7RA 3A6PC 3HZOA 5ITSA 5BYJA 1N75A 3A3BA 5B64A 2A1TS 4MW1A 1SUEA 2JLSA 3RG8A 1L7AA 2DMRA 3R9WA 1MHNA 3UICA 3SF0A 1RRMA 2O31A 4FBLA 4IQ0A 5HKOA 4MUFA 4ROXA 1G2OA 3FNGA 2W2LA 2IRWA 1KOFA 3ZY5A 2PH3A 1ZOPA 1LZKA 2OENG 1YIOA 1CY7A 1UBJS 4JL8A 3P0RA 2GN9A 2GBPA 5FUVA 3IEKA 3R23A 4RDLA 2VSFA 4MWTA 3EVTA 4OGWA 2FZKA 1W1FA 1S4QA 1Q82C 4WFJA 4YH1A 4K6FA 4KBGA 1UD3A 2JZCA 2D00A 5A0DA 1YFLA 4C92D 3EDRA 1QYIA 4X7BA 2PGDA 3GCGA 1X15A 4R1QA 1G8XA 3UMVA 4RHFA 4NU8X 1YJNT 1OBFO 5IBRA 1FB5A 1L7RA 3I1YA 3CCRQ 3PNMA 4Q9NA 1XL0A 3ZDYB 3DSRA 2EP7A 4NMLA 1V7QA 3UKOA 1H8HD 4GM0A 1WLSA 1RQPA 1IO6A 3AFHA 3VYGA 3CO0S 2F8TA 5CDUA 1YZTA 3GVCA 1Z2AA 1TUGB 4N4GA 4NK4A 3SBXA 3EZNA 5JSQA 1XU7A 1VSVA 2PLFA 1CBUA 4GUAA 2QP9X 3T53B 5AFSA 2OORA 4EPCA 2KX7A 4W63A 1A69A 5CCDA 4QGGA 3WRYC 3UK2A 2WWWA 2C88A 2HA4A 1KIFA 1TU0B 1XX6A 5CKBA 3IURA 3KWFA 3ZZUA 2WIDA 1L5SA 4YDSA 4Q00A 1XTJA 1S72Q 4AN4A 4QQRA 4YRSA 2ZYAA 2PZLA 4JAVC 2JBAB 1DIAA 5KYUB 4MKHA 2CZ7B 2WQ6A 4MRPA 5L3QB 1WS6A 4R51A 2ZBEA 1QTQA 3U80A 3UOAB 3AK4A 2XQJA 3K0CA 3IEVA 4CF7A 2VP2A 3E9ZA 5IJWA 4ZTUB 1FIUA 4WEQA 2PUOB 1NBWB 1Q82R 3CNNA 3S27A 3MXOA 1SBNE 3QXCA 2ETVA 1Z7GA 4N41A 2ASEA 1WSAA 3G8CA 1VL8A 4H3VA 2X0RA 5AQEA 4G85A 3ZJ4A 1YQ9A 1DEOA 2PIAA 2HHHB 2OHIA 3RSLA 2O2OA 4HNUA 4ZAGA 1YQWA 3ZVRA 3N8IA 2JTFA 4C4OA 5J59A 1W48A 5CA0B 4E51A 3JQ9A 4YCAA 2AYZA 3KAJA 3WRVA 3ZDZB 2HL5C 3CFYA 1XQHA 2NO0A 4N12A 1JU3A 4KLRA 1J2TA 4B09A 2FPLA 2DY1A 4HWSA 2AFIE 4XJVA 3NE5B 3I0ZA 4DNTB 4D3FA 2GZ3A 1JTFA 5B7QA 1X75C 1EFCA 4I55A 2O9SA 5CW2A 5B5SA 2GTIA 2UAGA 2K5IA 2CXPA 4XIJA 3W4JA 1RPNA 2Z58A 4WZZA 2FUEA 2DFNA 3WJ7A 4AT1A 2IYRA 2AX3A 5FJJA 4PZEA 3DEFA 3RSZA 1BE1A 2RH5A 3LDUA 4DMLA 4ED9A 2QUBA 1V3UA 2AFIB 5JD4A 4TTRA 1BQ4A 1THGA 3DE6X 3T5GA 4LGCA 2I99A 2Z83A 4OJMX 1WD7A 3VZCA 4ETWA 1MUZA 1X7YA 3NXSA 3QVTA 4IFEA 2VYTA 2RNAA 3W3AA 4FWIB 4F91B 4RNDB 3I6ZA 3JD1A 5E6UA 1K4YA 3DL7A 3Q3EA 3R09A 2MOXA 5DSTA 2FJUA 3ZNOA 4YDHB 3CNLA 5LU9A 4QGHA 2A4KA 2RAFA 3CCUQ 1E2DA 5FLXE 2DEUA 1C29B 8ATCA 3DAHA 4M78D 3NTIA 4WN9B 1KPGA 2BCEA 3T06B 2VHYA 2J6FA 2VSYA 4EGJA 4Z4IA 1M1KD 2P9GA 1SWWA 3HZZA 4CLXA 5EQJB 3M0EA 5K8CA 3HHTB 4GKBA 4ZVUA 3ZY2A 4CM7A 4QFDA 4J29A 2Y1LA 5ALJA 2C07A 1CVLA 1WXTA 4H1HA 2FLVA 3UEOA 1U1SA 4KPUA 4EX6A 4FDTA 2AKKA 3AEUA 2FE1A 1NQWA 4FZ3A 2Y99A 4LA4A 4C7XA 1PC0A 2EFHB 4QNNA 1TF2A 3W8FA 3GDOA 2ZBGA 4HSGA 5K0FA 1NV9A 5FU6C 2BMJA 4B44A 3O4RA 3RVOA 2AG8A 2VAMA 4TL7A 3AHGA 4OBBA 1TIBA 2CD9A 1A5BB 5LQSA 1TCCA 4RIIA 3IAHA 2HWUA 2PKQP 4C43A 1K2WA 4Q47A 1P9NA 4IPTA 1H2RS 2KK4A 3FCSB 3GJSA 2YMMA 3I1JA 3L8EA 5KWSA 2UUBB 1JH8A 4OOEA 1P2BA 1HNZB 3OLXA 5CJPA 2GNAA 2QSUA 3H2KA 2A5LA 1YUBA 1PI3A 5CBPA 1P7PA 3GX1A 3OSUA 3B5JA 2B61A 3AP3A 5A9RA 1BCOA 4JBGA 4LD9K 1OPKA 5B1EA 4S1VA 1KMIY 4J43A 3RIYA 1PFUA 3LBHA 3F0TA 4ZVOA 3NTVA 1B3QA 3UPUA 2A5YB 2KEAA 5JZSA 3OSZA 1YUNA 4V0LA 4H0NA 2YDXA 3HYSA 1XP8A 1RJ9A 4O6VA 3CH5A 1FX0B 4WTOB 2XZOA 3ELYA 5DU2A 2KRMA 1S2OA 4GXQA 1OCEA 3I37X 5E7JA 4F2DA 4P5NA 3KUDA 2QMHA 1I8DA 2IZ0A 1WU8A 3T4EA 4M4SA 3TR6A 2O2SA 2R97A 2ZTMA 1B0ZA 5ULLA 1P81A 1T8PA 2P2NA 1DC8A 3CEMA 3CCQT 4IIUA 4D6XA 2GDJA 2VJOA 1V5WA 2Z6UA 1Y7IA 4CKBA 1IQ0A 2WSSD 4OMDA 4UNPA 5HKLA 4CU2A 4KSYA 1PWYE 4DOVA 1DKNA 4AVYA 2LMJA 4HSEA 2HNAA 1T1SA 5I9BA 5EMNA 3OYBA 4MHTA 2SNIE 1K9AA 3TLMA 1CS0A 3RC8A 5AO9A 2PBZA 4MI3A 5FPSA 3LWBA 2G1AA 1ZVMA 4XJSA 4UEQA 3BVPA 4XYMA 4A82A 4UQPA 3ZGNA 3ILVA 2RIRA 1U3GA 3JQ8A 4EY3A 1Q1NA 1X6VA 1SXHA 3GJ7A 2GI4A 3D0QA 1UP4A 5A9SB 2YRFA 2IV7A 2PXCA 5ALZA 2I6FA 5HG0A 1U2QA 1JA1A 4ARSA 4AFZC 5IAAA 2REOA 3D5QA 2VPIA 1Q3TA 1D2RA 1MO5A 5DSXA 2OO5A 1KEZA 1B07A 4MDWA 5M29A 3K9NA 1VF7A 4LYGA 3GROA 5L53A 3NCTA 1RJWA 2NU9A 4CQLA 1LTQA 2IS2A 1WW3A 5BWLA 3NWJA 4NWIA 4PANA 5GJVB 3K1TA 4JYAB 4BE4A 1KQ3A 3V8KA 5CD9A 4IG4A 3TSOA 3UT5A 1Y6JA 3CNEA 2Y77A 5LA6F 5HJ5A 1ZM4A 4DPKA 5JANA 2RAUA 3DVRX 3SPXA 2IYVA 5I7EA 4BU0A 4N0QA 1SBYA 5ESWA 1DBSA 3I62A 2FPOA 4NL3A 2P77A 3PT9A 1D0XA 1S1CA 3LVQE 1VQNQ 5I8ZA 1R0BG 3DC2A 4A36A 3QEKA 1MIOB 4JB8A 1IHPA 3EDQA 5JVDB 5EMLA 4BL5A 5HZKA 3RGWS 4WK6A 4ZJUA 2AOVA 4TKVA 3GLHA 4ZEMA 4A4EA 1YB1A 4RVFA 2HSGA 3ROQA 2CFOA 2E4YA 3KLNA 1ZLYA 1EFKA 4MYCA 3VR0A 5BR4A 2CNDA 1CU1A 1GA1A 1XKXA 4GQBA 5A1JA 3ZYZA 1RRKA 3U23A 1I18A 4AMCA 5FULA 2R6ZA 2GNOA 3HY6A 3OC6A 1AD5A 4HGOA 2OGZA 1NC1A 1XA0A 3OOYA 3A98A 5BWBA 1QIDA 5ALHA 3MA0A 1M1NA 1OZFA 4G24A 4PJOC 2NP7A 1CFZA 5KB3A 4DMHA 4QPNA 3AKEA 4DCPA 3MKDA 2QN8A 3QNUA 3R2JA 2PJDA 4BC0A 4MNTA 2WSLA 3LGXA 4FB5A 5AKEA 1WU7A 1UTIA 7YASA 3G7ZA 1EB9A 3OPYB 3N7TA 1VQMT 3KS9A 1DTWA 3T7TA 1QR6A 3T4PA 2J0QA 3PC6A 4RPKA 3ZIUA 1BW9B 2QAJA 1M75A 4WWHA 5EWJB 4F1JA 3B9RA 1VRCA 1T34A 3RJTA 1C50A 1WO8A 3WISA 3DZHA 2EWNA 3IKJA 5ALKA 4IHJB 4G5OA 3MLBA 1WF3A 1CRWG 2CKDA 3MT9A 3B9QA 2Q2WA 2VHCA 2NSLA 1WUIS 3BXXA 3H9CA 4Y0NA 1K2VN 3N0RA 3R3XA 2OKGA 4C8QE 3VTAA 5E6RB 1YE3A 3LIPA 2L3SA 1ZAKA 2JA2A 2ZE7A 3HVRA 2Q27A 4NMHA 4GXTA 2Q4OA 3E3NA 3PS9A 5EGSA 1IEVA 4HK4A 3QWFA 4PC2A 4WNAA 4WXMA 5IDQA 3WGUA 5CXUA 3MWEB 3WXMB 4C8QB 4DIBA 3M6LA 3FEOA 5LJ3g 1UODA 4B34A 1ZHHA 4KIFA 4GI2A 1R0CA 2IELA 4OXNA 4Q9HA 1MTOA 2F1RA 4V24A 2YUPA 1RWKA 3M57A 3P8DA 2VSXA 3ZUGA 3MJEA 2FZKB 3CLTD 1UFQA 4X8HA 1SXJC 2OGSA 1G2BA 5TGZA 3BCRA 3VR4A 4EQZA 4XGIA 2AJLI 2HMVA 2B5VA 1OYVA 3GD5A 3BG5A 4OXRA 1H6BA 2WVJA 1ORIA 3UWSA 2N9UA 1K3FA 1AGXA 1INLA 4GYWA 4FGJA 1VQ6B 2MI6A 3ZY6A 1ONNA 4OMMA 3SN6A 4O4IA 4TYYA 2Y1GA 2AZXA 4P9SA 4GPD1 5JD3A 2PVGB 4ZI7F 5DT9A 1W4LA 3SF8B 4JJ7A 2P4TA 4WLFA 1SRRA 2O0JA 1J06A 5GMKm 1NXOA 4KPEC 3IT3A 1P2SA 4W9NA 1QYDA 4Q1VA 2IS1A 3GQBA 3K9CA 1V11A 1DRKA 2O4XB 3O3MB 2C5EA 3W8DA 2UKDA 3HSSA 2H4WA 1SBCA 4P4NA 2GKGA 4X7EA 5GINE 2DXCA 2HJHA 1Z5WA 4OHWA 2H2HA 2P4QA 4FFMA 2B78A 2QNRA 3NTRA 2QSZA 1YU9A 3FJOA 1I1JA 1T9CA 2XD0A 4OLBA 2OEPA 2XHEA 2RGNA 4WHMA 1VBMA 3SCZA 4C7OA 3UN1A 5DT2A 4XIFA 3IBTA 3CCEA 1O0BA 3DMPA 1W0KA 3THRA 4JOCA 3JQ7B 2QL9A 3TAUA 3CCJB 1PX2A 3NHJA 3GLXA 2OAGA 3EZ2A 1X7ZB 3ZU2A 1O4WA 3PGVA 1W9XA 3TPCA 2GTHA 1E9FA 3M0RA 3I61A 4XU1A 3VFDA 5F76A 2ZZDA 2BV3A 1F2UA 2JOYA 3E58A 3OE1A 2GEUA 3IEMA 2OZLA 4HADA 3WBBA 1X01A 3ZNPA 3X2EA 5G1NA 2LX9A 3PKZA 1QCYA 1BNCA 2PWAA 1Z88A 2IPXA 4QZVA 5LOVA 2CUZA 5KHLB 1OXVA 2AFHB 4F2PA 1A9XB 4LHVA 1OILA 2WHQA 3GFRA 4H7EA 3GFTA 3MT0A 1XXHE 3X1WA 2GNCA 3NC4A 4R69A 2H5EA 1OBCA 3UH0A 1KI6A 5GANh 3ASTA 4BDZA 4P7GA 3L7BA 2XA1A 1XP5A 1VI5A 4C0JA 4PKCC 2OQVA 1U2ZA 3KE8A 5J1SB 2D8MA 3DPUA 4CZ2A 2AQIA 1WBJB 3JB9J 3HABA 1SUAA 1TTQB 1G4AE 1PNQA 5IFKA 1JP7A 5I7OA 1YI8A 1KJWA 1XXHB 4GWKA 4AS3A 1X7YB 3MEWA 3CCSB 4PZUA 3BCDA 4UD6A 4O2BA 3LUPA 3Q88A 1SUIA 1M27C 5GAMf 3ZVLA 5DVZA 3DHNA 1GEEA 3BPSA 4BNZA 4EHLA 4CIAA 4N3NA 1J39A 4D9FA 2FSVA 3LVFO 2UZ1A 4NBKA 2RQRA 2OK7A 2G63A 4MJ3A 5FRDA 1IXYA 4R1OA 3PT5A 1QU2A 4KO2S 2A59A 4EFLA 1TPZA 3QLJA 2WJYA 4C5IA 1ZJ6A 1Y7LA 1UBEA 2XCIA 1KRXA 1UFRA 3DT8A 2H2IA 3FLEA 1W85B 1KY2A 1J2JA 4DV6B 2CVQA 2TRSB 2A84A 4RHEA 1IZZA 3O21A 2FB7A 4Q4HB 3PDHA 1ZXLA 3HZRA 4EG6A 4CDMA 1CTQA 1DL5A 3VHRA 1U7PA 2ILTA 2A5DA 3KL2A 1NQUA 1X6GA 3OQ1A 4FFBB 3KB8A 4DJ5X 1WPCA 4X8LA 5EHZA 3FDZA 1MDFA 5CEEA 2CNWD 3ENQA 4EKEA 3ZBDA 4XR9A 5HK3A 4X1VA 1SULA 2WUGA 4MQEA 2R00C 1JW9B 4I8IA 2ACEA 4TTQA 4M8IA 5CX1A 2RK2A 3P19A 4UM5A 1WDWB 1FBTA 4RMNA 4CIXA 3NBZC 1YA6A 4Q0MA 4QPJC 2F2TA 1PRMC 3E9GA 2FAXA 5AW7A 4TN5A 1M3AA 2CZ0B 3FM9A 2V7XA 3N5KA 3IE2A 2IXEA 1LI7A 3OIGA 5BSGA 2ORYA 3WHIA 4UFOA 4C92F 3SM3A 4BO8A 1YVDA 3L41A 2ZZEA 5CX4A 3LT0A 1AKTA 1YJWA 5HF8A 4WXRA 4MI1A 4DOMA 4U9HS 1CYDA 3IIMA 3BXEA 3ESBA 1ZP6A 4GMFA 1Q6YA 4YFYA 1RLUA 1YJ9B 2KY9A 3U5TA 1AZSC 1DJQA 3MLEA 4K28A 2JEOA 4V2IA 1TYCA 1YU6A 4BFSA 5I9NA 1XXLA 5BXQC 3AVXA 1ZCBA 3IEPA 3FPSA 4XSHA 3TPFA 1QIHA 2ZL7A 4L6IA 3SWWA 1YZVA 3WL5A 2FMKA 3O3NB 2XJ4A 3MPUB 1SK8A 3W0LB 4BGDA 1Y3IA 3X1MA 2X7JA 5UKDA 3KOZA 5IT5A 1V16A 3GVHA 3VKFA 1RMQA 3ENNA 1FNCA 5LJ5e 2LRQA 1AZGB 2D5IA 4Y1EA 4D8XA 3G0BA 2WSCE 4BDSA 4OU4A 5E0KB 4U0JA 4B7UA 2I33A 3RV3A 3RBAA 4EPYA 2H7VA 1LKZA 4BBPA 1G17A 1KIMA 1QPBA 1QWOA 5HY6A 3AF6A 4C7MA 1GPKA 4N39A 3G6WA 3EY4A 3V7YA 3UY4A 4FSXA 1G8FA 4ABYA 5GWXA 1DV2A 4KKTA 1YI2B 4IJKA 2XCLA 1JUDA 1L5FA 3PA6A 1HFEL 3CPWS 3QKIA 4PHTA 4MICA 2Y92A 3B6KA 1V6AA 1HYBA 2GAIA 2XODA 4HQ6A 4QVAA 3CRNA 4J9EA 2BGNA 1VPLA 3H5VA 1JE0A 3A8HB 1QRAA 3M0TA 5FXMA 2IYZA 3PC8C 1VQLT 1K89A 2LXNA 1CY1A 1XKQA 2FFRA 3W5UA 2IF0A 4QL3A 2M32A 1G8SA 4JI7B 1V26A 4ZOLB 3AW9A 4P22A 3DE4X 2C7OA 1QCCA 6CHYA 4LGMA 3AFGA 4O59O 2ZWOA 3L8ZA 3R1IA 3KYCA 1XRPA 2QN7A 2W2TA 2ZBDA 4ON9A 3RIHA 2K7AA 4NEHB 3SZUA 3WQSB 2GJRA 1ZKDA 1R0YA 5GJWB 1USGA 2CXSA 4L9WA 2IYNA 4F2GA 1VA7A 3DTVB 4MLZA 3G4SB 2I6TA 2CREA 5BQ5A 4AMZA 4BO1A 1SZJG 4C03A 2Q5OA 4EAQA 3OZGA 5EXPA 3EVBA 4WD3A 2WBLC 2FN8A 3Q39A 4TKVB 3QXXA 3GLHB 4WNYA 3GJTA 4AECA 2ZSJA 2H0QA 4LE1A 2V6FA 2IS6A 5AOAA 3GRFA 2DFDA 1P9OA 1WE2A 1MD9A 4I08A 1PV4A 3C39A 2IBSA 3QGMA 1ZI6A 2VSQA 1OTXA 3F78A 2C4VA 4S04A 3UJCA 4LQCA 4WT7A 3FMPB 1Q77A 2OWEA 4JZ4A 3M5DA 4RESA 4HAIA 3H41A 4O02B 1TMGE 4F85A 2JIZD 1H5UA 3HB7A 2KR3A 4WWVA 1TL7C 2YWBA 4JUAA 3F47A 4G86A 1ACLA 1V5IA 2ZPAA 5LQCA 3C5CA 4HDSB 1XQ1A 2GZMA 1NQOA 2P41A 4LOIA 2JLCA 3WGTA 1NBIA 2W4QA 2O5VA 3IMGA 4M77D 2HKIA 3ELBA 4B3MB 4D4IA 2VAXA 4E4RA 5JOQA 3NBQA 3DMFA 4BQNA 1G7SA 1TKCA 3CEAA 3WK6A 5I2SA 1SOAA 2A1UB 3WIBA 3WBJA 4BX3A 1HA3A 4I4TB 3PUIA 3THWA 2E2WA 5JC1A 2ZULA 1IHXA 5ES3A 5GAJA 3L1KA 2RH9B 3V7WA 1XZFA 2FQ1A 4G26A 3AEXA 3TZKA 3KOUA 1XFOA 5BV8A 4FYHA 3HCDA 1K8QA 4M8KA 1UGVA 1U7WA 5K0ZA 1JIQA 1ZSZC 1EINA 4GSKA 5BO5A 2XDBA 1SM4A 4BO3A 3HCCA 3DO6A 1HH4A 2E5WA 2VP0A 2RFLA 3E18A 1UD6A 3JQEA 4M7DA 3K73O 2IHYA 4W6QA 3U7IA 4ZPJA 1RWBA 2HRQA 2WRZA 3IKVA 4X24A 2XKJE 2WWTA 1G59A 5LD2C 4IGEA 1ZUNB 5IKMA 5AM4A 4HX5A 1L4NA 3HFJA 2H0RA 4MLCA 1YCGA 5BUQA 2PPLA 1E7QA 3II6X 1QH1A 5BY2A 4M22A 1SJ9A 3M82A 1TQ6A 4YPVA 5JDCC 4M0CA 3UXEA 3IJEB 4B6FA 1TZCA 4DAEA 4V1CI 5JE8A 3M2TA 5GAMe 1EWKA 4K9RA 2WM8A 5DXFA 3GMDA 1W581 4DV2B 1XZAA 5JXGA 3OPOA 3HCOA 4K6CA 1GARA 3FTEA 3T1HB 4OGLA 1WZIA 4WESB 1B8VA 1C0KA 5FOXA 3HHPA 4MJXA 4UFNA 4MCHA 4DDMA 1NQTA 4NBLA 3BBPA 1XD9A 4Q6BA 4OGCA 3UA6A 2ZRLA 1L1QA 2FUG1 1CE8A 3QVMA 5IS2A 4N5MA 1NBHA 1W44A 3PD7A 4YDRA 4S24A 1CQWA 3GDGA 2GD0A 1XDGA 1ZRHA 3JCMP 1VOMA 1QYWA 1F1JA 2XF8A 1BS9A 3IUYA 2G4VA 3ZV5A 5BPHA 2GHQA 4Y9SA 1NU6A 1HE8B 3PQFA 5KJFA 3U4MA 1VQKT 4CEIA 4L85A 1FNNA 4X06A 5KNLA 2C3UA 1G8AA 2R1VB 1F9EA 4FU0A 3A9WA 5E8RA 4WXPA 2DQ4A 2ZVPX 4H27A 2FPPA 1T9KA 3EGOA 4ND2A 3BERA 3EUFA 2AHRA 4MVJA 1S1MA 4FMCB 4RHCA 3RI3A 2O54A 4OMUA 1N5JA 1JEJA 2QGFB 1CHDA 1FP6A 3ZV6A 3FWYA 3T56B 4HBZA 4UVIA 4ZOEA 4EJMA 1R15A 2B8WA 3FCEA 1RZ3A 4G5YA 3CC2A 4B2LA 5FU7C 1VI6A 3B85A 3GOQA 1BS1A 1JHYA 4AY4A 1NY5A 4RUKA 4YT8A 1XRLA 2C0PA 5FI3A 4B73A 4BNKA 4AG5A 3PYMA 4JLNA 1LVGA 4LF8B 4W7HA 4B3SB 4FZJA 1JQ5A 3R6KA 2BFBB 3VR2D 4PZCA 5LQUA 1XRQA 2A58A 4AUEA 4QUJA 5CR9A 3CM0A 1F2UB 1BX1A 1V8FA 1T0BA 4EENA 3UWNA 5H7XA 1TJPB 4GX5A 1G7RA 1Y7TA 1BKYA 5EHNA 2H4ZA 4EYOA 1GFDA 2XRYA 1M90U 1Y48E 3G2PA 1I3CA 2E7ZA 2PS9A 3AR7A 3B12A 2QAZA 2GAJA 3U31A 3OQVA 2YLBA 4YRKA 4R9RA 2OTJT 4H15A 2O1EA 1IN7A 1W96A 5LVAA 3OZXA 2XT0A 3FX2A 3VYUB 1Y3HA 1QORA 1IZ7A 1NLPC 2C8LA 2DFLA 1OV3A 3WKDA 4DIOA 4BFZA 4XB6B 3VXKA 5CYGA 2XF2A 5FPQA 2CBZA 4X5OA 2V7QA 2OHOA 4C04A 3R75A 2WILA 3OECA 4I0WB 1UPFA 4L15A 3CX6A 4IIXA 1NT4A 3ZD6A 1QQTA 5HF6A 3AL0C 2M0OA 1GKUB 3EA5A 1U3FA 4CL0A 2G8NA 1RBZA 4P5DA 1UECA 1BYMA 1XMJA 3MJHA 2YDYA 3M4XA 1QV6A 5LMCA 3P0EA 1H69A 2ANCA 2VYVD 2FVYA 5BNFA 2DEQA 1KDTA 3H84A 1LRKA 1SOUA 3OE5A 1MEOA 2QTZA 3EZ9A 3SEAA 4P54A 2FPUA 4WA7A 3DLAA 1J25A 3USZA 1VJ5A 5FPYA 5K8UA 3SIRA 3F70A 1Z37A 3WJ2A 4HQRA 5IKOA 2ZATA 5FORA 4KQWA 5KC9A 4HB2A 3CMEB 4QOGA 4NMXB 3RC2A 3TFQA 4IDHA 4YN3A 2ZPUA 1W73A 3KXLA 3O1HB 4OF4A 4YMGA 4IP0A 1ZK2A 4QBIA 5ISMA 3NU1A 2W2KB 1W19A 3R6JA 2ZPFB 2I78A 5C8YB 2O3RA 1PG0A 4GOLD 4JEHA 2QR2A 2WHRA 2VBVA 4KUDK 2WKWA 5TPZD 4QGAA 2YFHA 4I4NA 4OOVA 3N3BC 1IY1A 1CB0A 3DM9B 2P0KA 4ZU6X 4LWPA 4X63A 2CXUA 4RWEA 3CCRA 4YGXB 2B8JA 1F2DA 3A1WA 2GS9A 4QT0A 1S3IA 4UM9D 4UMVA 3W78A 4NIMA 2GNPA 1XEWX 2L19A 2F7SA 4M0UA 3GRUA 4AG3A 5JEEA 4B2PA 3R6DA 2K7FA 3LLVA 6REQB 4DBLE 1NW8A 3RLFA 5KCZA 2BE7D 1XNJA 3CXUA 5KINB 3KYDB 4TV9A 1P1KA 2O8FB 1RQGA 1T5IA 3KYIB 1C0IA 3WJAA 4NCJA 1VLQA 4ZARA 3AHJA 5FOVA 3UNXA 2IE0A 5C2JB 3O2JA 2G1JA 1CDDA 5A62A 1NLYA 1S72A 1D1PA 2H59A 1RZUA 2DZDA 3WO0A 3LQRA 5BSTA 3M9LA 3BILA 1SQ0A 2C3MA 1N9GA 2M0YA 2PZAA 3TTVA 5EG5A 4EPXA 3AHCA 4M75D 5CFOA 1GJRA 4EGCB 2EDCA 2R2GA 4RH1A 5FYDA 2RHHA 3HJHA 1YWOA 4PYQA 3LDAA 3KUXA 4H60A 4Q82A 4CUJA 3PDUA 3GBVA 4L9AA 3V1LA 5DXJA 3WIEA 1K5DA 3QHPA 4KAAA 1JL3A 3GZ4A 4M1KA 1QGUA 4PPYA 4UVDA 2WIAA 2VIIA 3IERA 2PX2A 2H6EA 4Y2UA 4N5LA 4RZ3A 3Q6IA 1ONSA 2E10A 1D8AA 3VVMA 4O08A 5HCUA 3FVTA 2W83A 2FVGA 1D1QA 2QA4T 2OMKA 2AVNA 3LI2A 2XMCA 2NUPA 1AF4A 4MPDA 5BSXA 1LPNA 3VHQA 4Z0NA 2W0MA 1RWPA 4AO6A 5GAN5 4Q39A 3TLGA 5IYZB 2VPWA 4PLTA 5YASA 4E1VA 1QC5B 1V1MA 4ENPA 3K8OE 4DDWA 3MB8A 5FQOA 1NURA 2BMEA 4F7UA 1OH5A 1MEJA 3F7NA 5DM60 2BRUA 2V3WA 2PKEA 2D1SA 2D5AA 3EDYA 1HYOA 3KVVA 1R4NB 3PJEA 1FP2A 1DJMA 4FZVA 2NTEA 4UE2A 2C20A 4J9FA 1H8KA 3AB7A 1XR3A 1WBDA 4CETA 1VKNA 4UCQA 2KMTA 1IBSA 3I56T 4MSUA 3RNJA 3VU9A 4ZO9A 5A1TA 3GUUA 4OPMA 1XE1A 4RQTA 2ODAA 2FWIA 5D5QA 2YJ6A 1Y4AE 3OYHA 1FJXA 3W5HA 2NYAA 2A92A 3VRYA 1JR3A 3UGJA 4UASA 4Q18A 4AF7A 3ISXA 2VPPA 1UJ5A 2G0AA 2C0OA 3I55A 1OBHA 3L7YA 3PC3A 1UADA 1E3SA 2JN0A 4X91A 1WQWA 3TOCA 3CCUA 2X8LA 2XLBA 1IH8A 1XAJA 1Z2CA 9MHTA 5HQJA 4JBHA 2H1OA 3DJFA 3UAZA 3C7TA 3RK1A 1JVBA 3RRXA 1UFOA 4XLFA 4JD5A 4HCZA 3GELA 4Q93A 1RJEA 2G9RA 1CJKC 3PXDA 2PEZA 3G23A 1S2GA 1JI3A 5J2UF 1X87A 3W9BA 1UAGA 4LXIA 3ACBA 3DKMA 2K2WA 2QASA 2X7XA 1UWVA 5L4LA 3BTSA 1Z0ZA 4PXYA 1UBHS 2ZRQA 5AUPB 4REMA 3PWZA 4RKWA 3BH7A 4I5IA 5E9WA 1WHGA 1GZDA 4JSTA 3JZFA 1ZD2P 2X6RA 3MRVA 3WRXC 4QRIA 4AJPA 5EKUA 3ZW8A 1Z4JA 1XEXA 3V7SA 4FBGA 3MFYA 4FWTA 2I8AA 2GETA 5CAEB 3A25A 2XE8A 1F4LA 1U0JA 1MV0B 2ROQA 3MCAA 1JSLA 3R3HA 4WDQA 4ZANA 4KCGA 4KTVE 1EUZA 1D0IA 1SKBA 2X5XA 4G0OA 2ZBPA 5AJUA 3Q7TA 4RKRA 5KYNA 5T8KA 2V9ZA 5MFPA 5GJBA 3AO0B 4V2SA 4HH3C 4I9HA 4Q7MB 2VP5A 2I7TA 4HAVA 3F2VA 4OP7A 2QPTA 3EXFA 1DT5A 4IKFA 2K2VA 3ZBUA 3THOA 2GWHA 4FJ0A 3O8DA 5EHGA 2YXPX 2ZREA 3LAWA 1E9RA 4C7BA 1FX1A 1X2KA 3TDMA 5REQB 1MOSA 3A2KA 3ZI0A 1YL6A 1NFQA 4Y1GA 3UAWA 4A6EA 2A9QA 4IUBS 3K0HA 4PLZA 2XIDA 5IT9E 3HNRA 2EBUA 4ZRNA 4U9IS 3KOWA 1OX8A 4YP6A 4ZMRA 4OO3A 1ZWKA 2VDVE 1OA1A 4U7WA 1SPXA 4D79A 1HORA 6AT1A 2WACA 5DDIP 5C80A 3N0TA 2B4QA 5TB5A 1U99A 3X1JA 4M0FA 1JFLA 2FN9A 4IUYA 1IJEA 2QN9A 4HXFB 2NVUA 4LJ8A 2IYAA 3A8KA 2NG1A 1AS0A 1MMDA 4KREA 1SKUB 4XGQA 4W1PA 2I2DA 4PC6A 2HJVA 1XCLA 1HXHA 4DDTA 1VCHA 2IWHA 3ASYA 3LFTA 4CTKA 3F98A 4G3XA 4ZI2A 4OG2A 1O08A 3MTEA 4LVOA 2P90A 4I4LA 3DV0B 3UC9A 2L0XA 2QW0X 4EMBA 2IGTA 1ISMA 1XKTA 2DETA 4LZAA 3REQA 1I6WA 3I4LA 2NO6A 1K9MD 2FKNA 4H7DA 3FYHA 3UANA 1G5RA 1TCVA 3MTGA 2E4XA 3IJ5A 1XF1A 2BKDN 1GM5A 4N5NA 1EAMA 2PQ0A 1FYXA 4DQDA 1VJCA 1J56A 3T1YB 3KVNA 3UGKA 3CEHA 4F5WA 2FPEA 4A54A 4ONEA 1N5MA 1GCIA 1AB6A 2ZIFA 4U2DA 2H1FA 2F5KA 1TQ2A 3JQDA 4W9RA 4IF4A 5AHWA 2LKDA 3TEFA 1EVJA 1IOZA 2YV4A 1S0UA 3NDJA 1JIVA 5IN4A 1ZX6A 4FM4B 4GW3A 3UKJA 4NJEA 4D0GA 5LJIA 3OU6A 1Q15A 1YDWA 1KDVA 4HDKA 5CPFA 1J6UA 3LO5A 3V9AA 1XHFA 2J67A 3TTTA 2QU7A 4JFRA 2Z6QA 1H2YA 1Q1BA 5CG2A 4J0FA 4OLHA 1VQNA 3WV5A 4PLPA 1KJQA 2Q62A 2IDJA 3JAME 4XM1A 3OESA 4NR0A 2RBEA 1L5GB 4YJ2F 3GGCA 1VQ4Q 1MB3A 1HL3A 2IEYA 4WZBA 3SDZA 3OU2A 3K35A 4DBZA 1QG4A 1VHQA 4KXMA 2FCRA 2AH5A 2WZQA 4P86A 5I01A 1O95D 2J6BA 1Q86D 1TQ4A 4YB8A 3G1WA 1NF2A 2EDAA 2JAUA 3U9SA 3MRSA 1OH8A 4DG5A 1CUWA 3U39A 3RTGA 1W88B 4YJKA 5G4KA 2HY7A 2V7WA 4G0QA 3ZTYA 3IR7A 1OYWA 5AXDA 1UQRA 4FNAA 3AVPA 4ELZC 4PLVA 3C3KA 1BKBA 4I9GA 2O59A 4JASB 3OVMA 4F17A 1QCDA 4N40A 3M6UA 4URVR 4HGZA 1P5JA 2JLUA 1AQUA 4TZ6A 1H1LA 1S2IA 2YVUA 4LXHA 3ZOKA 4CW7A 1T8WA 1IVYA 3VH4A 5K01A 2BLLA 4UAUA 5LP6A 3LNNA 1IY2A 2PVOB 3VH2A 3W2TA 2HHAA 1NA5A 4K26A 2PN1A 5GGYA 4NONA 2RK4A 2LC4A 3LC0A 3S29A 4JC5A 3RIRA 2WNSA 1TX4B 1Z17A 4LDPA 3WC4A 1SC4A 3INGA 5KYWB 1BD4A 4E0FA 2YN4A 4M77F 3DC7A 2V58A 4JRIA 2GCXA 1CC1S 3HXTA 2H1CA 1OMOA 2OTLQ 621PA 3ZLTA 3GARA 3AR4A 4AUNA 5GMKj 5JAHA 5GANf 1BD3A 3P96A 4L2IA 4DIFA 1JDVA 1K88A 1CZUA 1AHPA 5IC6A 5F77A 1W35A 2M6RA 2XSZA 5IASA 1JDJA 3OAAD 2QOEA 3GIDA 3BTVA 1BI3A 1P1BA 2DXBA 4B4OA 2CL0X 3V97A 2ODWA 5I3CA 3N5CA 2BFAA 1Z6QA 1VQ9Q 1PU2A 1FYEA 4C4TA 3PFHA 5AI0A 2ES4A 4PC3A 5BORA 3QKWA 1HYQA 4EJ0A 2YWEA 4E1AA 1NG9A 5JRJA 4KFCA 1T8YA 4PAWA 3VZDA 2YWHA 4Z0TA 3EXG2 3L8MA 5AI5A 1OB5A 3P27A 4UXJA 2F9MA 4MA4A 2BP7A 1LJ8A 4JP3A 2PZGA 2QG4A 5I8PA 1JLSA 3PQ3A 4EHAA 2GEVA 3I2FA 2IIPA 1R7RA 4HQOA 2VH1A 4XEHA 3K15A 1N8RU 3UBTA 1LGYA 1BAPA 3HLYA 1C3OA 4S0XA 5BWOA 2NX2A 1JG4A 4NS1A 3FYDA 1KHHA 3EEQA 3LTEA 4M7DG 1ZGGA 4MGKR 3SU8A 4II1A 1DFIA 1FLNA 4CMBA 4M78C 3K31A 2G9VA 1HUQA 3ESQA 2XKAA 2KT8A 2GVNA 2HQHA 4P53A