2DERA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
364
structure length
348
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 90
structure length 348
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2derA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2derA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2derA01
3CR8A 2OK7A 1TYCA 2ZUEA 3FWKA 3OJWA 3SEZA 2AKEA 3A05A 4NATA 1IVSA 1G8FA 1RQGA 5TY0A 4UZFA 4RD3A 1CT9A 1W87A 2PZAA 1EJ2A 1KH2A 4MUJA 3MMPA 1SKQA 4OUDB 1IHOA 3COWA 1Q11A 1PG0A 2Z08A 2V0CA 5J5AA 1NUSA 4NDAA 3SZGA 3MHPA 4BPRA 4M53A 1K97A 4B48A 5K0TA 1ZJWA 2V0GA 2CV2A 2D54A 3Q4GA 3W2IA 1ULHA 5DSZA 1H42A 1N1DA 1KQNA 1OD6A 3WYAA 3QTBA 3CA8A 4YBRA 5IJXA 4CQNA 2D13A 2NPFA 4L2IA 1VQ7B 5H16A 1ILEA 2DERA 3PRHA 2PIAA 3CC4B 1NUPA 3AIIA 3ISJA 3CCRB 4P3YA 1GN8A 3INNA 5TEVA 1QRTA 1KJZA 1QFYA 1R6XA 1VQMB 4PBRA 1MBZA 2PMDA 1N2HA 1QRUA 3SDBA 1JB9A 1WZ2A 3OZUA 1H3NA 1QUEA 1E62A 1TUIA 4MUKA 2XNJA 1F20A 1FDRA 4C43A 1JA0A 3Q10A 4MW1A 2DR2A 2PLFA 3J81k 3OZVA 1NI5A 3FJOA 3AFHA 2RE8A 2QJOA 1O97D 2CUZA 3H9CA 4MW5A 3COVA 3PNBA 1FNDA 1G59A 4R0NA 1O6BA 1E63A 1YJ9B 2HGZA 1Y42X 3B8HA 3COYA 1D8TA 1NDHA 2BM0A 4K0RA 5KSWB 1G8HA 3A4IA 3I05A 1T9GR 3ZZ0A 4J76A 1N77A 1J1UA 4XFDA 3ZXIA 1EFPA 1QFZA 1K4MA 1ELOA 1OGJA 3WY9A 1U7DA 1K9MD 3ZIUA 3CD6B 2X3UA 1H3EA 1KP3A 4PC6A 1BS2A 3IVCA 2CYAA 4TN1A 4WQMA 3FNRA 4YP6A 4PC7A 4RPIA 3ZZUA 4S1OA 4TMXA 1MOPA 3G71B 3UMVA 3BL5A 2BGJA 1S72B 3CC2B 3KT8A 1M90D 2R5WA 3L92A 3P26A 1M83A 4NCNA 1U3CA 4DJAA 1R5NA 2B7CA 2BM1A 2VNHA 3AVUA 1QRSA 4J75A 3GMIA 1GAWA 4CDNA 1FRQA 5H7XA 4B43A 1KC8D 3MMXA 2BSAA 2OTJB 3RK0A 3LO8A 3K32A 4MVCA 4PBTA 4MUNA 4EG7A 4AC9A 3IOCA 2H29A 1E64A 2HCJB 1Q86D 3U6KA 3CCQB 1K8AD 4H3SA 2GPJA 4AF6A 4ZV4A 3IUBA 4FN5A 3SJZA 4OJMX 4HPWA 1JNYA 1R5BA 3CLTC 2CT8A 2YWBA 3PNYA 2CV1A 5BNZA 4LBVA 4MWBA 3JQQA 5H5JA 3ILVA 4HE5A 5THXA 1O5TA 4GRIA 2PZ8A 3UOWA 4CDMA 4TS1A 1U7XA 1W2BB 2WQ6A 3GLVA 3JQRA 1KQOA 1F60A 2C77A 3ND6A 2WB2A 4TMTA 1J9ZA 3PENA 4PC1A 2QUIA 4E1AA 3S3TA 2YWFA 3SZ3A 4YALA 4G6ZA 3CVVA 1QUFA 2DY1A 1K73D 1QX4A 3AG5A 2BTEA 2DLCX 3U1VA 3WXMA 3CCSB 1Q82D 1I2DA 1QG0A 1ZM9A 3VO2A 1WXFA 2GOYA 5K0SA 2QMUA 3LE8A 1YHQB 1M8FA 4DDMA 3OTWA 1IQRA 4M4SA 3I1FA 2XRYA 3CCUB 1N2GA 3E27A 3ND5A 4U63A 1OWNA 4G1VA 1VQLB 2DUMA 4KR9A 4ZCSA 2J5BA 1QQTA 3QE2A 3QFTA 1MAWA 3FPKA 1ZM4A 3TQIA 4N3NA 1QJCA 3FH0A 4B44A 1JECA 3L93A 4ZGQB 2EL7A 1JIIA 1VLHA 2O8VA 1BQEA 2E1RA 4EG1A 3DPIA 4DLPA 3G4SB 2J09A 1R5OA 1VQNB 1VBNA 5HG0A 3CVWA 4L2IB 4PC2A 4XFJA 4F3RA 1FRNA 1WXHA 3WNCA 1JZSA 1ZUNA 4JZYA 1TLLA 4I6EA 2AZXA 2GQFA 3CLRD 1XNGA 1DARA 1VBKA 1O0CA 2CYCA 3KT6A 4CT0A 3CCLB 5DB4A 2VTBB 3CCEB 4M2LA 1OWOA 4DQKA 2GKSA 2BYTA 1I6KA 4MUIA 3M5WA 1FNBA 3VMFA 1X8XA 2PFSA 3CVXA 3CW2A 1JEDA 3RJZA 1YIJB 3P0HA 4PGOA 4Q16A 4R2LA 1QU2A 1IB0A 2EFGA 1FNMA 1D2RA 4ZT4A 1U2RA 1QGZA 1D1NA 3TNJA 3FY4A 3CB4A 2QTZA 2BN4A 3MLAA 1S4MA 4DDHA 3AVXA 3U6BA 2ZITA 1DG1G 3P0IA 2AHOA 4ARCA 1TFUA 3H99A 1O94D 1EFUA 2CNDA 3COZA 5TS2A 2CV0A 3AL0C 3IMCA 5GV7A 4U9UA 1V47A 1KKUA 4YP5A 4ND6A 3WNDA 1BJKA 1F9AA 1WY5A 1KP2A 3ELBA 3ND7A 4YAWA 1G8GA 1GZUA 4MULA 2E21A 4ZCMA 4G5YA 1KK1A 3AGPA 1NUUA 4LBYA 2OV4A 3HMQA 3IVXA 2X3FA 1PFUA 3IMGA 1WXIA 2NSYA 2CRVA 3D6VA 4AF7A 1I7PA 5DK4A 4PBSA 1QU3A 1EUYA 4B47A 2XEXA 3QTTA 4N3GA 1XB2A 1X6VA 2G36A 1O0BA 1O96B 4EG4A 3UK2A 2QJFA 1N2JA 1PG2A 2A1TS 2YWCA 1MJHA 1LI5A 5DASA 3H9BA 2QEXB 2PZBA 4EG5A 1M8JA 2X0KA 1AMOA 4YAFA 1EXMA 5FO1A 5AHWA 3W2EA 4YMIA 2R6HA 4HJXA 4YP7A 4M1KA 2CSXA 5HXBA 4Y9UA 2PIDA 1GVHA 1G7TA 1UMKA 1VQ6B 4DNXA 1A8PA 4MQ6A 5TGTA 4QHYA 1EE1A 1ZH6A 1N8RD 3CLSC 2BGIA 1M1KD 4JXZA 2QUJA 4X0EA 1HA3A 1KD1D 2H2AA 3ZC3A 5KHAA 4A91A 2QTNA 4BWVA 3CLUD 1TVCA 1TYAE 2E0IA 1QTQA 4RD4A 1VQ4B 1WDTA 1WXEA 4K1XA 3W5UA 1ZM2A 3OW2B 1JA1A 1EP3B 4ACAA 1LW7A 3LOQA 1OWPA 4U7JA 4JXXA 3ZJTA 1KORA 3G6KA 2IP1A 4DE5A 1EWYA 2HMAA 4Q7JB 5TR9A 2QA4B 1T9GS 3IH5A 4QRDA 4RD0A 3AVYA 1CQXA 3LVBA 1J70A 3SEQA 1TTTA 3HZRA 1I6MA 4XSVA 4NX2A 5KWVA 2QDXA 4NZPA 5J59A 3RFFA 3ZXSA 1J1ZA 2WQ7A 1QGAA 1MB2A 3SYTA 4UAJA 4FZJA 1O95D 2CFOA 4MWDA 1EP1B 2VNIA 3E20A 1OB5A 1O96A 4MYTA 1PFVA 3AVWA 1W35A 1MB9A 1XE1A 3W5VA 4JFAA 2IELA 1EFCA 3G5AA 3ZGZA 1GTRA 3NBKA 2E89A 3FHJA 3GUZA 3VNVA 2VZLA 1N2BA 3CVUA 1W34A 4B4DA 1N2EA 5HUHA 3RK1A 2EIXA 4MUHA 3AG6A 2E18A 4ZCPA 2YWEA 4J0QA 4MYUA 2QTRA 4ARIA 3TZLA 1YIAA 3AVVA 1TYDE 1GLNA 1G7CA 2BVNA 3B78A 4G5GA 1JZQA 1KH1A 1H3FA 3HV0A 1CNFA 1JILA 1GR1A 4RJLA 1KR2A 4MVXA 5FNZA 4ZCTA 1YULA 3OP1A 3CLTD 4MW2A 3AKZA 1KAMA 3E1YE 4TMVA 3P27A 4TMZA 1QVFB 1JIKA 3G59A 3KT3A 3PXUA 4KKVA 4OUDA 1JJ2B 3TZEA 1T6ZA 4EGAA 1Q19A 3H05A 2NZ2A 4ZT6A 3F3MA 5AN9A 1SM4A 3RBAA 3DO8A 1YITB 1GJRA 4RD1A 4LC0A 1ZH0A 1GPMA 1NJID 4MWCA 2D74A 1EFVA 4WNYA 1WOYA 2A7XA 1R6UA 2C78A 2J08A 2A1TR 3NBAA 4B3XA 4Y7CA 1ZM3A 2J7KA 1WQ4A 4HJRA 2BMWA 3CXCB 3CC7B 3CMAB 1V8FA 1QFJA 1K4KA 3IOBA 4LBWA 3KT0A 1T6XA 1B2RA 2QN6A 4TMWA 1NSYA 4DQLA 1U0BB 3AGQA 3OJXA 4ZT5A 1Q15A 2QUHA 1N78A 1B6TA 3H97A 3IMEA 2QJTA 1NP7A 1XNHA 3ZUGA 4EG3A 1EXDA 3W2HA 2JAXA 3X1JA 2DCUA 2D5BA 3ZBTA 1XJQA 2OQ2A 2Z3VA 3K9WA 4MAFA 5EKDA 4AS1A 1AIPA 2O5RA 4NAHA 3VU8A 1A8HA 4F4HA 2C5SA 3CCJB 3HGMA 1O94C 4FK8A 4RCYA 3IODA 2EJCA 5JBQA 1SURA 4LBZA 2VNJA 2B7LA 1M8PA 2PG3A 1N2IA 4P2BA 4HK4A 1IFXA 2PXHA 3MUEA 1QGYA 4YHBA 4ACBA 3IVGA 3OZWA 5H59A 1OGIA 4MUEA 4ZCQA 3CMEB 4YAUA 1DNPA 3QFRA 1KK0A 1N3LA 2A1UB 3P52A 1VL2A 4MVWA 1R6TA 3VGJA 2J4DA 3QSYA 1M1ZA 4RD2A 4MLPA 4PY2A 3I55B 4EG8A 1WXGA 4ZGNB 3C8ZA 1J20A 5J58A 1EUQA 1XNJA 1KK3A 3FDXA 4R2MA 5GV8A 4P6VF 3G6EB 4JYZA 2VYQA 4RD6A 1KQPA 1IQ0A 1NUQA 1YUMA 2OTLB 1UFVA 5IHXA 1COZA 3MCAA 5FO0A 1HYBA 1J09A 4ND7A 3V76A 2JA2A 3UY4A 4NBSA 1FFYA 1KQSB 3CCMB 4M0LA 1YIDA 1M8GA 2JANA 2B5OA 4HE6A 3I56B 5TEWA 1N0UA 1H1TA 4GU5A 3DV2A 4ZCIA 1IRXA 3X1KA 3HFJA 5JBNA 4KPUA 2A4MA 2DPLA 2GM3A 1Q77A 4EFKA 4ZT3A 4QREA 3CLRC 3X1MA 3U2QA 2J07A 2BPOA 1KH3A 1S0UA 3N2YA 4MVYA 2HDNB 2A84A 2VTBA 1F7VA 2DETA 3W2FA 1OWLA 1QNFA 1VQPB 1BX0A 3IDFA 4G5FA 4UZEA 2Z09A 1QH0A 2YWHA 1F4LA 2IJGX 3NV7A 1JHDA 3W5HA 3IOEA 3N8HA 3D6UA 3FOCA 1G7RA 1FYDA 4KR7A 4NAUA 1IQUA 2QTLA 3QFSA 4K03A 4QFMA 1D2EA 1WKBA 5EMNA 4MW6A 4ZCRA 1IJFA 4KR6A 4KPUB 3VRHA 2DEUA 1CNEA 1KAQA 1G7SA 2DXIA 2ZP1A 1MAUA 1GAXA 1VQ9B 1GAQA 4F7DA 3CCVB 2RD2A 3IUEA 3UC5A 5LFAA 5HUJA 5LM3A 3JQPA 4I6JA 2ZUFA 2XRZA 1WQ3A 3WNBA 4EH1A 4RCZA 3ZZTA 3JXEA 1NUTA 2YXNA 1N75A 2B7BA 2VNKA 1JMVA 4PC3A 2YY5A 1P7PA 1O97C 3LCJA 1U3DA 4FWTA 5KCMA 3MXTA 2RC5A 5DEOA 1JGTA 4QBTA 4H9GA 4MUGA 3TS1A 4Y9RA 2HZ7A 1DDIA 1K92A 3QE4A 2XNCA 1VQ5B 1T6YA 1BX1A 1YJWB 1PFWA 1H85A 3CLUC 3VNUA 2YWGA 3QFCA 1OB2A 1EFVB 1EFTA 1YUNA 2A86A 3PNVA 4MWEA 3W2GA 4EF6A 1Q81D 1B23P 4U8HA 4DDKA 1TYBE 1IJEA 1N2OA 1WJGA 1KTVA 2QTMA 3A04A 4MW0A 3SP1A 4MW4A 1KK2A 2BF4A 4ZT2A 3ZJVA 2CYBA 4IW3B 1M8KA 1YI8A 1J21A 1NYLA 3FI0A 1OBHA 1ZUNB 3TQOA 4EG6A 1O95C 4C0SA 1JIJA 1NURA 1VQKB 3CLSD 1LI7A 3FETA 3ES9A 1FNCA 4R71A 2VXOA 3MLBA 5LLTA 3CPWB 4I6GA 1TEZA 1KRHA 1GTSA 4G1BA 1JEEA 4AQ7A 1EP2B 5TV2A 3B82A 1MC1A 3P0JA 1DDGA 1IH8A 1I6LA 4MUFA 1TQ8A 4ZCLA 1PFYA 3CVYA 1Q7YD 1VQ8B 3RHSA 3Q12A 3AVTA 1VBMA 3FIUA 1OBCA 1VQOB 5FA6A 3KFLA 1F7UA 4MW7A 3CRZA 4Q93A 5F23A 2AG6A 2OK8A 4YAOA 1N0VC 4MW9A 4ZT7A 3N9IA 2X1LA 3HL4A 1GO2A 2A1UA 2TS1A 2QUKA 1QVGB 1NZJA 1OWMA 2X1MA 3WBJA 2I1LA 3FG9A 2BV3A 4RUKA 4WSOA 2RC6A 1EFPB 2A88A 3ZJUA 3N05A 2WSIA 2FX3A 3A2KA 1MRZA 3ZBUA 1YJNB 3VO1A 3DLAA 1YI2B 3WBKA
chains in the Genus database with same CATH superfamily
1GGNA 1JHPA 1KMIY 3UIEA 2I3BA 4XGNA 4V1CI 3OA0A 3AFGA 3DOFA 2GH1A 5A05A 4LMPA 1XEWX 5JCJD 2PZAA 1K63A 2NO1A 4TUYA 3TD6A 4AKTA 5KREA 3PC7A 1MG0A 3UCEA 2G80A 2JFGA 1Z6QA 1UP6A 4LJ6A 1A5BB 3Q0TA 1VRVA 4BNHA 3DBRB 3ZI4A 4JLDA 4C08A 4TM8A 1PEDA 2OXEA 4Z4ZA 3F8WA 2V7BA 3AY6A 1CUVA 1KE2A 3W9BA 2D54A 3Q4GA 2EP7A 2UUCB 3SNKA 2O2IA 5DN6D 3WK9A 4PX2A 4CQNA 2VRBA 4TQ9A 1CC1S 1VMKA 2DERA 4LA4A 2UZ1A 4M60A 2E4VA 4YP1A 5AVKA 4AROA 5DY9A 2BCEA 1YVEI 3RSLA 4ZHQF 3TW8A 5HRAA 2WJPA 3FR7A 2XUHA 4ZOLA 2FG5A 3SNHA 5L4SA 2FOXA 3IURA 3FOEC 5A7GA 1IWBB 4R51A 1EFRA 1IY0A 3PVSA 1FDRA 3GP5A 1Z3IX 3NWBA 1GL6A 3IQEA 221PA 3M3PA 2A36A 3E3MA 4AU1A 5A9SA 3R9XA 1CDOA 2QJOA 4FMPA 2CUZA 2YCLA 1NN1A 3E7DA 3R0IA 5GMOA 5GVSA 3JYNA 2DJIA 3LDAA 4NLLA 5EIBD 1ESEA 4KX5A 1PS8A 1D8TA 4YBZA 2DOKA 2BDEA 4ZYLA 4Z3OA 1BMFD 1TTHB 5LSAA 2PFGA 3IYLW 3I3OA 1CY2A 3HN6A 1NFQA 1EX6A 1NMYA 1EP9A 4PLZA 4J9IA 4UVGA 4Y7DA 3WLTA 5JNRA 4OXNA 1Z73A 2FZ5A 3TZCA 5HK0A 3IVCA 3L46A 4DSAA 1GRCA 4PC7A 1EFNA 1LF5A 1TQDA 4MRMB 1LSUA 3HJTA 2AA3A 3KJGA 4GZMA 4L8WB 4PLVA 3QZ9B 4U7TB 4Y2VA 3WK4A 5J2UF 1BQ3A 1ZOPA 1QHFA 1X3SA 5EUCA 2WUWE 3H8JA 1E2EA 1I4LD 1V11B 2XKAA 2P3LA 3DJFA 3AF2A 3ITEA 3LC7O 1PQ4A 5CB8A 5IULC 4FOSA 1R50A 1Y57A 3ZW8A 1J90A 4TYYA 3KUKA 3O1IC 2VWQA 1LCKA 3LA6A 3OPOA 5IT9A 2F4VB 3GI1A 4BC1A 1H0SA 1OAAA 3JCMf 2QI9F 3CW8X 3M9LA 4CM8A 5TB5A 5A02A 1WLSA 1D5CA 1NN5A 2H1SA 4TLBA 5CNJA 2DPHA 3CCJT 2M32A 2M0YA 1UBOS 2RJOA 3NTKA 2OB1A 3K94A 1E61A 2SECE 3UWDA 1GPWB 1R9JA 3D2LA 2HCJB 5J39A 4J9CA 3JARB 4WUVA 1AK2A 2C2ZA 5H70A 3E7WA 4WL0A 4B3JA 1BU1A 2JBHA 2ZT8A 4HBGA 4I1VA 1NBHA 3T54A 2Z1NA 4JC0A 4NKRA 3WIOA 2FRXA 3H1GA 1C9KA 3UW3A 4PYJA 1Z5WA 5KB3A 3JCMd 4FMDF 2RQWA 1BHQ1 5THXA 1O5TA 2LKCA 2ZS7A 5LQJA 1Z5PA 3SI7A 3MINB 2B92A 4LZLA 3I9OA 4C0FA 1FP7A 2DKGA 2V6FA 2ZWVA 2G6FX 1K75A 2WB2A 4MLCA 1F06A 1ZEMA 3LY8A 4KV7A 4EY3A 2XOEA 3G71T 1F6WA 2Q7DA 1QV7A 4BQFA 1TCUA 4OHWA 3VVLA 3MJRA 1UKEA 3PNQA 1VOTA 4FEGA 3TAXA 1UZAA 4I14A 4U39A 5BSXA 3HJGA 1Y5IA 2V7VA 4FYPA 1R9GA 4ZK2A 4EB0A 4KYTA 4B46A 3LBAA 2ZK7A 1RQ2A 4AKSA 3RMSA 1Z0IA 2JIRA 3FAZA 3LE8A 5DOZA 3E8XA 4DS3A 2V5AA 2XLCA 3JAWA 4ZEMA 2QAJA 3CEPB 3CXRA 3E27A 2N9UA 1RM0A 1S2IA 2JCGA 4NU5A 1A2QA 1H0RA 1TXQA 1KMQA 2GAOA 3H16A 2EL9A 2XITA 1RQXA 4JB8A 1L7OA 3JZMA 1HE3A 3DLLA 4IUUA 2EL7A 2YICA 1NB0A 4PXSA 3NH6A 4UEJA 3V34A 1GRNA 1PKTA 1ST2A 2RARA 5JC1A 1BGWA 2H1CA 1WPYA 3U80A 3NDIA 3WGHA 1WSVA 2G4CA 2NUBA 5CXXA 4EG1A 2ZPAA 1J56A 2HD0A 2VSXA 2ZZQA 1SUWA 3IB6A 2H65A 1UKZA 4GXTA 1JP7A 3H9NA 2PGLA 4LYJA 4E7SA 3LUBA 4MRSA 2R97A 3IE2A 3M81A 1IHUA 5IXFA 5LJLA 1Y1RA 3ICVA 4PNHA 3QKRB 1TLLA 3CEJA 4OQNA 4ZANA 3SJUA 4A8JC 2XUDA 1EZ4A 1E0DA 1M5UA 1YMUA 1ZH4A 4H35A 1T1EA 1EFHA 2ZVPX 5E1DA 3DLPX 1BRTA 2Q3MA 1H2BA 1VBKA 4W5OA 4G85A 4EP1A 1E92A 4M9CA 4RXTA 1X77A 1E1QD 3OZBA 2I4OA 5FOSA 3SF8A 2O4CA 4PR0A 2GKSA 4HNHA 4ROSA 4L7QA 4TQAA 3GLFB 2DP4E 1BKBA 2L82A 1RWVA 1JRIA 3WXMB 2Q2WA 1UBEA 1W1WA 4BUGA 3V1LA 4D6XA 3EEYA 5FADA 2ZZMA 3O4GA 4MGEA 5U4QA 1SOVA 3B12A 4W1QA 5JU6A 5GADl 1E8NA 4OLAA 5A9TA 3S7ZA 4RPDA 1MMNA 4LQ4A 1X9IA 4HLCA 1SQFA 4AZ3B 3B6JA 3CCVQ 1HEUA 1YJQA 2X7JA 3KM0A 4RXMA 2OYCA 3V48A 3QLVA 3THKA 3GUUA 3KLBA 5A3SA 3VR3A 3WLQA 5K8TA 4FR2A 3QGMA 4RPGA 5TS2A 1BHJA 1M90C 2RGUA 5LOVB 4L6IA 3ROMA 5GV7A 1XTUA 3AJAA 3CR3C 4AP9A 1H23A 2VAPA 3G13A 1VQ6T 1JKFA 2HA7A 2JT4A 1JWAB 3LLUA 1G0NA 3MPOA 2I4IA 4IWYA 4RENA 4AG6A 4EGFA 2EQIA 2Q6VA 2E21A 3TB4A 2LX9A 2E5QA 1WXBA 5DI3B 2CMHA 3P97A 3VH3A 2NSYA 4MH0R 4O33A 4AF7A 2F59A 3FJ5A 2Z58A 1C9NA 4PONA 2VATA 4C0AC 4UDOA 1NJ5A 3OP4A 4XD2A 1LF0A 1M6WA 1K0SA 2C98A 1XAJA 3GLGA 3DBRA 1W7AA 1XRMA 3EODA 3IXQA 1WW8A 4KAFA 4R9UC 3AO0B 2AD1A 4JR0A 3H2KA 2WYVA 4BMYA 2MYPA 3M6UA 2FSUA 3EVEA 3A6FA 2YVAA 2VCHA 3P45A 4U7GA 5DASA 2WFMA 4ZVVA 4DILA 2B3DA 4RL4A 4O25A 5JALA 2QR3A 1LLQA 1SN7A 3MWDB 1R4MA 3KQSA 4JP3A 4EY8A 3TUJC 1WD7A 4A2WA 2CVHA 3UWPA 1F51E 3OD5A 4CG3A 2RJDA 5TGTA 3LQ4A 4UNIA 3JU4A 3LXMA 4HGQA 1L1RA 4BWGA 4D8UA 4D9HA 5DE3A 1R9NA 3GT0A 1KWGA 1UJ0A 1E7YA 5AMXA 4CUJA 1TVCA 2BFCB 2EYQA 1VMIA 3HUUA 1KOJA 5CA0B 4R16A 4K1XA 1N1MA 1M30A 5HWSA 1A0OA 1Z15A 2VP2A 2TECE 1RXIA 2WIBA 4M75B 2XJ9A 3BN3A 4PYIA 2IYLD 4TUYF 5FI3A 4EF4A 3JQ8B 3HV2A 4ALIA 3BXGA 1N2SA 1CQXA 1AGRA 5EXXA 4EY7A 3COJA 1EXWA 1R27A 2JD0A 4QD3A 3SJBA 5C4IA 4II3A 1DIAA 2ZBQA 4RJJA 4BUZA 1FS4A 2HM7A 3KAKA 4L5GA 1QGAA 3GXOA 3LXRA 1Q86R 3ZLTA 1OLXB 2VWGA 4TT8A 1P60A 2D4HA 2CFOA 5EKSA 2BTQB 4PNEA 3EGCA 2JFZA 3L7NA 4WLVA 2PX8A 4CGYA 4EKDA 4TVBA 1JU5C 3W5VA 1UAGA 5BURA 5ECAA 4P2GA 1RMYA 4KKXB 1P4AA 1VPTA 1Z0KA 2W2LA 1YOVB 5AH0A 4PHFA 4A8HA 4CKBA 5JQGB 1DOHA 3QLVC 2RBEA 3UZUA 4BMVA 5ELLA 4CTMA 1W34A 2FTKE 2JMCA 2LZ0A 1K5HA 3IPYA 2XMGA 3ONWA 1IZ0A 2FWBA 5J23A 2JI7A 2W2KB 4GBGA 4M0EA 3USZA 3YASA 2CLKB 4F9TA 3UGKA 1UGSB 2Q49A 3HEMA 4DG8A 2A30A 2W43A 1PRYA 2X2PA 3PP8A 5FL7D 3SYRA 2JAQA 4BVFA 1NC1A 4DR1B 2V8IA 2IHVA 4RAQA 1EZ1A 5E6UB 5FNZA 2IE8A 2NQTA 1QQAA 3NALA 3VOAA 2A94A 2G07A 4PCAA 4L5BA 4TMZA 2EGUA 2Q4DA 2XGJA 2P5UA 3FSRA 1CY7A 1JJ2B 4ZV7A 1T6ZA 3PGJA 4GNRA 1LA2A 1J0EA 2NVBA 4Z0NA 3STYA 3ZDEA 2CWWA 5TQ0A 4LFCB 4OQDA 1X2BA 1FOEB 1MZVA 4J9UE 1BYIA 5E2BA 4TKVB 3LY9A 4ZQCB 1S7CA 1YS7A 1ZHIA 1PX0A 3A6LA 3TL2A 1UGVA 2BIVA 4OHKA 3K70D 1UFKA 2CFSA 4BIMA 4CIAA 4WLNA 4IIBA 4XOIA 2JKZA 3IKJA 2QGNA 4FYYB 1YR3A 2PQ6A 3H6KA 3W5AA 2PZLA 3A11A 1W75A 4NV0A 1KD1R 4QATA 2DG2A 4CMIA 4QNNA 5IDWA 5IDQA 2QORA 5CYPA 1NP7A 2HGSA 3T1HB 2D2FA 2WNHA 1T8WA 3L2RA 2BWJA 4QXQA 3TIFA 4CFZA 1Y0MA 3TD9A 1ND5A 3VFDA 3ZBTA 1MTOA 4R1MA 1ZW1A 4DA6A 5KQGA 2EKLA 4RULA 1LB1B 1T8SA 4LQDA 3IEMA 2FEAA 4K9KA 3SEMA 4B83A 3CF4A 2QLTA 4DABA 1N2IA 4B4VA 1RYNA 4RZ2A 2PXHA 3VBCA 1U3VA 1ZNQO 4XWOA 1ZA2B 5KJFA 2VEOA 3IUNA 4WECA 3E9GA 1NXQA 3A32A 1ESMA 1X7GA 1Y1QA 2B1IA 4MUEA 4EA9A 3FDJA 2QE6A 3DW3X 2BKEA 2WUFA 5EXDA 4LWPA 3A98A 3GD7A 3WTCA 3MAJA 3WQBA 2HBZA 2AN1A 1Z4OA 3P4UA 4DARA 1F4PA 5EJ7A 2HXYA 2WYWA 4ZD6A 4LECA 1YDFA 1Z12A 3G6EB 4NZYA 4UBNA 5AVXA 3MJHA 2CK3D 3KYCB 4BE0A 4LV8B 1W9XA 1LGYA 4QYIB 4QELA 5JS2A 2QXTA 4OPSA 3HO8A 1E6MA 3JU3A 4LNHA 5EXTA 1J09A 2GXQA 3KUFA 2MR6A 4DLVA 4IR7A 1IN1A 2ZAEA 3BGSA 1NWHA 4OHPA 5G1OA 4U8GA 3FBTA 4QJ4A 3WKCA 1L4GA 1SVWA 2PS0A 4YP9A 4BFCA 3I56B 4RHFA 3ZCPA 4ZZ0A 5AKGA 1XTPA 1ZHFA 3DV2A 4B82A 3JPWA 3SLKA 1NAIA 3H0HA 1KY5A 2ABWA 1D7AA 2DUNA 4D4IA 1JPJA 2BUDA 5C6SA 3L2UA 1TJ4A 1R3UA 3NHPA 3NYIA 4PLWA 4TV8F 1KQSP 1G6Q1 3P96A 1VQKA 5DIZA 1VQ4Q 4Q3DA 3ZGYA 3TE6A 1FZQA 4J7UA 1Y7TA 2Q5HA 4ZK6A 3EHDA 4LF8B 3NTIA 1XLTC 4LN1A 3RG8A 1FNNA 1HVXA 3FRJA 4HAIA 1EGMB 3FOCA 3QXXA 4U6SA 1O6FA 1AN9A 1WM1A 1W4BA 2ZIGA 4WN9A 1PD0A 3CN7A 3CCRT 4WZLA 2FPRA 2H16A 3DHVA 3EN0A 3KZVA 4Q9DA 1DZIA 4PSAA 5KDLA 4KR7A 1DXOA 1PDOA 3CN9A 4QFMA 1KR5A 1MXFA 5EMNA 3IDAA 1UM9A 4FJ0A 4M1TA 3X44A 4D3FA 4FLFA 2DR2A 3M4NA 4NZMA 2RCYA 2OMKA 3MCUA 2J05A 2MF2A 3V97A 1PWHA 1C1HA 4JLVA 5IT9E 2Y77A 4D96A 2PD6A 1A9QA 2AIRB 4RCZA 4S2EA 3LZCA 2PTGA 4JKOA 4MV0A 2VNKA 1WJRA 2DQZA 3T3OA 3W2TA 1DT3A 3LW7A 4EITA 2HMWA 5AW6A 1X2EA 2C8LA 4N76A 1NNEA 1H8HA 4H9GA 1XLVA 4IUCS 5F51A 4J9FA 1KC8U 4YIHA 1HT3A 4FT4A 1ESDA 1GPUA 1ZGHA 1GL7A 1ODJA 3HB9A 4TL9A 1QVGA 5FF9A 3S55A 3U0BA 2FPGA 1YJWB 3BK1A 3MUFA 4ARAA 2O1EA 5HJ7A 1EUCA 4PAWA 3TU4K 3PPXA 3MCZA 5JYBA 2FGJA 2QD1A 4IIJF 4X0CA 1KYYA 3FZYA 2ASVA 1WV0A 2R5FA 3OCJA 3WGGA 3UTCA 2VHXA 4CIVA 1U2PA 4Z4UA 4DGQA 2XSZD 3AF6A 5M7EA 1L8OA 2QTMA 4LJKA 4MW0A 2MSNA 1YZ3A 1KK2A 1E8DA 3OIFA 3ORSA 1PFQA 3N07A 2SRCA 3ANXA 5K0ZA 4MVJD 1LQUA 4OPVA 4FI3F 2BEJA 2AE2A 4GUDA 1ZSVA 4LYDA 1BD3A 2DWOA 3P9QA 1KSJA 3R7BA 5KPDA 2X8LA 5DYGA 2XD4A 3UXMA 3L4JA 1XTRA 4A0SA 1LI7A 1NJGA 3F0TA 5INTA 5K8JB 4EMKC 2ODNA 4ARVA 3CPWB 1ZH8A 3OQBA 4K2AA 1Z4QA 4Y2JA 1IYZA 1EK0A 2YUIA 1DMRA 5JSKA 2FN3A 2VJKA 4EFMA 1QB7A 5ALXA 2QYTA 4ARBA 4EZBA 5J47A 3SQWA 1EBBA 1VE9A 4MWTA 5AVUA 2DH6A 3BD9A 3B6IA 2AZSA 3DAOA 3VX3A 1HDZA 2I34A 1LFAA 2YXYA 1HMYA 2K5UA 3PA6A 4PPFA 4M36A 5EJFA 5F12A 4CCYA 4ZYVA 4FYVB 4RVUA 1BDIA 1E2BA 4M0PA 3PNBA 3RU7A 4PRYA 2IIVA 3IBSA 3HB0A 4QNRA 2AKAB 3SE0A 4BNZA 2XDDA 3WBJA 4KMSA 4WZKA 1URPA 2H17A 2Y0CA 4ECEA 2QUBA 3ZWMA 3GZ4A 4KLNA 2O3UA 3DJYA 1SIBE 2GUWA 4YCCA 2ABLA 5ALVA 4HMOA 4BO7A 4RY8A 1YJNB 2PRJA 3UNXA 8ATCA 1EX9A 1KHTA 1TIKA 2DWUA 3EQ8A 1OJLA 4XOUA 4I1OA 1TYCA 1P1CA 3R3WA 1WS6A 4R2WA 2XMPA 2XDAA 1DO2A 3MWJA 3V7NA 1QS0B 1E9DA 2PVCA 1G8FA 3KL4A 4DPMA 4PJOD 2CE2X 4RTOA 4CGZA 1AQUA 1VDZA 1SU7A 1FXXA 3ZNNA 1T36B 3H41A 1IHOA 1X87A 3OX2A 2COYA 1AKEA 1VQMQ 4I5GA 3NT4A 5I8PA 5HZAA 3L2ZA 2DD4A 4BPRA 2AG1A 5FBZA 4AWBA 1Y7XA 1GAEO 2PANA 3USES 5D1HA 1T4MA 4P5NA 5JZVA 2R8BA 2V0GA 3DHYA 1UD6A 3LGAA 5GAOr 1Q57A 3LT0A 4D7AA 3KHUA 5E38A 3EQ7A 3DKKA 4Q03A 3CTMA 3LPDA 4RA9A 2P0YA 5EZ6B 4AMVA 3HSKA 1MD9A 2ZPIB 2WFLA 4B74A 1DIRA 4MHSA 3GZTB 3I64A 3LVFO 4FIDA 4YB8A 1K89A 3G8YA 1RXVA 1GN8A 1ZN7A 3GDHA 3VV0A 3P4XA 3QHAA 3RQIA 5ICSA 1ZBJA 3IA2A 3M55A 4QOEA 3FFTA 1AGYA 4OU5A 4K81B 5FLYA 3LT4A 2KBTA 1CB0A 1KQSS 1E62A 2Q6TA 3OOJA 1U2ZA 1NMZA 3KSMA 3PSHA 5CPBA 3UT5B 5GAMj 3LQFA 1HDGO 3Q7QA 4A16A 3AHCA 4R83A 2YXDA 4AUMA 1P3JA 3PLRA 2O8CA 2G28A 2ESWA 4P8RA 5TSDA 3LP5A 3W7AA 2Y0BA 2YHIA 2FPSA 1YDWA 1NDHA 2XEDA 4Q4JA 4BAGA 1XQVA 3A4IA 3R77A 4UZSA 4UPEA 1C8BA 1Q1GA 2DFDA 3WI7A 1XELA 4DKXA 1A7AA 2FPIA 3L8EA 4QGAA 5BQ5A 3WGZA 3TN7A 1WXXA 3BWYA 3KKKA 1RWBA 1RYEA 1XCPA 2X3UA 1RRKA 4YEDA 1S96A 2OENG 3CTPA 4Q4AA 2VYNA 3UWSA 1ECCA 1GAJA 3T7EA 2JVKA 2IKSA 2ZLBA 5D3KA 1RFGE 3DOIA 4S1OA 1MOPA 5L7YA 3S27A 4CMEC 4BO3A 5JYCA 2R5WA 1V5EA 2X85A 5EPEA 3L92A 3P26A 2CLDX 2QRHA 4ARSA 3DEHA 3SQOA 4CLOB 3VPGA 3OLCX 3C41J 4DJAA 1JJVA 1MZPA 3T7CA 3JQBC 3KJEA 5AJZA 1DAEA 2X0NA 2GVZC 2QD2A 3PKIA 2B21A 3F3SA 3ASSA 4GE3A 2RHRA 2F5TX 2Z8YM 3KVYA 1K9AA 4GPBA 4EJ6A 4AURA 1T1JA 3PG5A 3NMUF 3BJZA 5DNCA 3CX4A 3N86A 3AM4A 3ETLA 2X5OA 4FOOA 4J1QA 1AQ6A 4LNUB 1EZZB 3GFQA 2NSJA 3TSZA 2BR4A 2WHXA 1A9TA 3HCDA 3MRVA 2FPEA 2P6NA 4M7WA 5TMDA 5U1PA 2I67A 2Q5CA 3PQEA 2BMJA 2ID7A 2V5UA 2M51A 5JNSA 2XBMA 4TKMA 3LRXA 4C7OA 4OGCA 2XCIA 4FDMA 1IMJA 2AEJA 4N5LA 4YR9A 2EF0A 3UOWA 2QTGA 2IWRA 4HE5A 5JZ9A 1AKRA 1C3EA 4I4IA 2JCVA 4GVLA 5TPZD 1UJ6A 3FUWA 4Q1DA 4XXHA 2ZRPA 2NT4A 4NYMQ 5LA6A 3SFTA 5BWBA 1OFVA 4RESA 3H1BA 4WKBA 4X8MA 1N1EA 1KRXA 4TMTA 2QYHA 4F96A 3IKVA 1RR6A 4FOLA 1M7GA 2DCMA 2Q8NA 2WSLA 3FCSB 3OE4A 3GL9A 3OO0A 3QXSA 3TGWA 4FDUA 4R5HA 1QUFA 2X9NA 4GL2A 5FTLA 1NZFA 1ZIXA 1EHCA 2G09A 2J3LA 2VUSA 3BREA 3IQWA 1K73C 2Y76A 3ETJA 3LUFA 4MP6A 1UWVA 3VH4A 3WGUA 1DC5A 1X8JA 2QA4T 1QG0A 5HVNA 4W5NA 4S1NA 5FUWA 1WBBA 2P1RA 4X66B 2QMUA 3REQA 5CDYA 3CISA 2HCFA 1UAAA 1XDZA 2GPSA 5IYZF 2VHWA 3I1FA 4AVYA 2OUIA 1DBVO 1JDVA 1FSSA 3AUSA 3DW1X 4QASA 3BWEA 1E1DA 4HYEA 4IDPA 2CSUA 4FFPA 1E8MA 3T7KA 2XDPA 3UUFA 3FPKA 1QXSA 4CU5A 4BJ1A 3FTFA 3QWHA 4PO3X 4D0RA 2QBYB 2OXCA 3QVVA 1OXUA 5T5QA 3AWIA 2IYOA 1KC3A 4W7HA 2PSEA 4KQXA 1BCRA 4D3DA 2B6NA 4OQFA 5IDXA 2Z5VA 1QIMA 3CCUT 3EHQA 2JN0A 3FPJA 3V33A 2BFFA 4P7KA 1Q1AA 2PWPA 4QSMA 4MINA 3SZMA 2CNWA 4F9GA 1OVMA 3EAEA 4PC2A 1G3QA 2ZRGA 2GB4A 1Z2NX 3C7CB 4Y3UA 2FFRA 3IRUA 4F3RA 5A2QA 4BP3A 3WNCA 2RH2A 3U3DA 1U94A 4PJOC 1RW4A 4PW0A 4HLQB 4OGEA 1LPOA 3GRFA 2IZ0A 3OUTA 5J1SB 1K08A 3WC4A 4DV3B 3DB3A 2L0AA 4NFLA 5D3QA 3UMGA 1XT6A 5FXMA 4Q9AA 3GNGA 1Z26A 2HA2A 1QMCA 1W5BA 4HXEB 4OQPA 5BSKA 3DZBA 5FRNA 2D8AA 2BAGA 2XVXA 4RHTA 2P7IA 2VRCA 3I35A 4JAVC 3CH5A 1OFUA 2O5VA 3O91A 1L5SA 2GSDA 1E1NA 2Q2QA 5L8VA 1U5BA 1RI0A 2XYGA 2CB0A 1E9VA 2F3PA 3H5AA 5BN1A 5H3HA 3KPUA 4C22A 4PGOA 3CCRQ 5D6XA 5GANd 1UPFA 2A78A 1QVGP 1L1QA 2WA2A 2ZE8A 3HABA 3LHSA 2JNWA 3O8NA 2F3QA 3CSDA 1V48A 1ZGBA 3EIEA 1YACA 1IRIA 3EMBA 1QGZA 3F9RA 1P3Y1 4ISBA 1ODTC 1AKYA 3E9DA 3CB4A 5DBHX 2X6WA 2WJ3A 4A6XA 1MVNA 4DL9A 2MYUA 5AJWA 5IMBA 1SC4A 3RYCB 3SVTA 1JI3A 1NOIA 4ZTZB 1E9BA 3OOHA 1LBSA 2R85A 3DV0A 4JDPA 2Q5OA 3DDNA 4RKRA 3HWX1 5LWHA 5GANf 5LDGA 2VH1A 4W99A 5IARA 1N92A 4ETMA 1NQXA 2HMSA 5A06A 1V1RB 5AW8A 1LRKA 3N5CA 5F98A 1VZ3A 3EBOA 1YR9A 5TC4A 2X3FA 4NBVA 1CQZA 4BNJA 3BQJA 1WTHD 1MB3A 1Y48E 3C6KA 2EJFA 4FFSA 4XWKA 1VYVA 1I7PA 3ADDA 2VG8A 4MYRA 5D5PA 5AJVB 2DZCA 2PBRA 2C54A 3QBVA 4DJDC 5GZ6A 2XEXA 3TFOA 1O0BA 3BTOA 1OC4A 2C2BA 2JIOA 3IUJA 2BBOA 3KXIA 4KGVA 4O2AF 4A23A 1E6WA 2YQ4A 3B3GA 4HRYA 3G0OA 4N01A 2BLLA 4HWPA 4QLBA 1BB9A 2KQUA 2ZSUA 1UJ2A 2QEXB 2W93A 4JVNA 4YNBA 1Y0BA 3RR6A 1S3IA 4AECA 1SHUX 1X7ZA 2A9VA 2IZ7A 1HDRA 5BV1A 5I11A 5FWXA 3ENVA 5CXUA 1OX9A 1PWTA 4R1LA 2JVJA 4CEJB 1KRWA 2WE8A 1E2KA 2ZVJA 3O94A 2FPGB 4MQ6A 1BYUA 3CCFA 2YXBA 1N5LA 3CHYA 1TAGA 5ALFA 3MEQA 4U7FA 3MAAC 4TS9A 3ZC3A 4OAPA 2F3RA 4IXTA 4F4CA 4J07A 2VA8A 2YIJA 4RD4A 4V02A 3G7NA 3QWYA 3G1JA 1UDWA 5A3RA 2I1VB 5C4MA 1TEVA 2ZWMA 3I30X 4LNPA 1TMKA 1VHJA 4IQ8A 1BWSA 3E1SA 2X4GA 4QRDA 4WA7A 2OBNA 1PTJA 4MGZR 1R37A 3FX2A 4MUBA 4WCDA 1CUHA 1J8VA 1GG2A 3A58B 4NX2A 4YS6A 2YV1A 2WM3A 2XB6A 4TV8A 1GA6A 3A3NA 3OIUA 4P3PA 4JGGA 3F4BA 2GEKA 2YOHA 1S8NA 1JHZA 5F4BA 2R0QC 1E7MA 2NO6A 1FTYA 1EAMA 2PKEA 1Y5NA 1SC3A 1HR0B 2I7TA 2OM2A 2PUDA 4ZJUA 1PFVA 4C92A 2EWWA 4KKTA 7ABPA 5EPOA 5LXTA 2PT9A 1W2HA 1JEAA 5E9WA 1C50A 4I9GA 1O87A 2IELA 4CIYA 4INOA 5EIEA 2V3CC 2QTXA 4JZKA 4RK5A 1ID1A 5HUHA 5D2CA 3ID6C 3RK1A 3RTDA 3Q98A 4WX2B 2UXCB 4DUPA 2XWJI 2PAFA 2X2FA 3OT1A 2YRFA 4XQFA 1WTCA 3VJMA 1E6CA 2XXJA 3GMSA 3GOXA 1SZPA 1G63A 3A0UA 1G8JA 2QN9A 5CK5A 3VC1A 1JAIA 3BRWA 1TM3E 4NOLA 3A8TA 1T3LA 2ZT5A 2FUG6 4U7WA 3HU1A 1JILA 5JE8A 1UINA 4ZOCA 3KQNA 3CNLA 1R66A 2AFHB 2D1SA 2F5KA 4M77D 2G06A 3ZHVA 2HEQA 5FRMA 1PLLA 1QS0A 1VQ8T 2G7MC 4K6KA 4BX8A 3HVHA 4H6WA 5ITVA 2L2QA 4PCUA 3Q2OA 2DB3A 3H05A 2NVUA 2FPFA 5CFRA 4PFSA 4XTVA 2OKCA 2Q21A 4M78G 3GEEA 3SHVA 4F8EA 1TAUA 1YL7A 2WSYB 5D5QA 2X4XA 1IXZA 1EFVA 3L77A 4PX3A 2DL8A 1VQ4A 4IXMA 1FMKA 3ASTA 1VHTA 1AUOA 1XA0A 2PGNA 3AM3A 3EEQA 4N54A 4QECA 4ZIRB 2JHCA 4D8KA 5CD9A 4EPCA 3WGMA 2E6ZA 3HI6A 3WLKX 4M7DG 2X8WA 2MCNA 3WRYA 2AOUA 1Z8DA 3K9QO 2F1JA 5D6WA 3PVDA 3O4HA 4TTPA 1UT6A 3FPSA 4Z7OB 2ZYRA 3C7TA 3W9YA 4Q15A 2NYUA 4FXPA 1IL0A 3VO9A 3D4PA 2X19A 4M7AA 3U48A 3ULKA 3ZD7A 4JXJA 2P0KA 1B6TA 3PDIB 4WFKA 3T3IA 3U3JA 1DKNA 3PQFA 3V8VA 4EKEA 5G0VA 2ZIEA 1WG8A 3K9WA 4N0AA 3RBBB 2NXJA 1XF1A 5KKAA 1BXRB 3DEKA 4YRPA 1L5FA 2D4AA 3LP6A 4RTUA 4K9SA 1MDFA 2X3WD 1RPNA 2D1RA 1KDYA 3NNDA 1SURA 4LF7B 4JQYA 2B7LA 1HDXA 4QYIA 4R1UA 1R5JA 4AK9A 3ABZA 5A4AA 3K2QA 3QLUA 1ESNA 1Z16A 1MQ9A 2Z9DA 3MOSA 3C2QA 1ESZA 4ALKA 1U99A 1L7VC 4UNNA 1NTOA 4J2HA 3LZDA 3OC0A 3TZKA 2J4DA 4EI9A 2AG0A 3SB2A 2HL6A 3EDQA 3K72B 2O3JA 1I4TD 3KZ1E 4ZQEA 5ITSA 5JQWA 2VBFA 3AF4A 3MMNA 3RGGA 4DSNA 1CR4A 4IYRA 4GICA 3S2IA 2QV7A 4YMTA 2GKOA 4JYBA 4AN4A 4JKYA 2XZTA 5HKBA 3LECA 3CCEA 5K6AA 4NJEA 1Z5OA 1D4OA 4ZYWA 5K6AC 1TMOA 4R1PA 5E3JA 3K6RA 3TLEA 1FFYA 2PSSA 1LLFA 3IPXA 1C3VA 3MTGA 3N8DA 4QQRA 3DMHA 3O93A 4D4HA 3BGWA 2XDWA 4Q18A 3X1KA 4PZLA 5CKDA 4QXAA 4RFSB 4XPIA 4C0HA 2Z2IA 2A92A 4ZT3A 4QREA 5THKA 1UJ4A 3VA7A 1WUTA 1J33A 2GCXA 3G7UA 3V6MA 1DWPA 4ZNXA 4DIMA 4XKVA 2ZYTX 4D92A 2RGBA 1QK3A 2E85A 2DETA 3N2KA 4XWAA 1KD1U 1D07A 3VS3A 3A9UA 3IDFA 3DBLA 2QXYA 3TZBA 1M2EA 4JUAA 4U2EA 4JU8A 4QDXA 3P9PA 3ASPA 4NEHB 3BC9A 5CURA 1UGRB 4JQZA 2WVJA 3RIXA 5ARCA 2BF7A 2IITA 2QMOA 5KHLB 3HUTA 4YDHB 5LQSA 1JEYA 1G3YA 1IZZA 1G1MA 4P58A 3D7RA 4R3NA 2IZOA 4OOEA 4A1FA 5EERA 5DM70 3VKHA 5BNTA 5E7IA 3A8IA 5AOBA 3GUCA 1NE7A 4A63B 3G9TA 1WEHA 3R44A 3W4IA 1HG0A 1J24A 4MRVA 4ZCRA 5IZCA 4KR6A 3TM4A 1MAUA 3ET4A 1U6IA 2FSGA 1V43A 4P6YA 1EUCB 1VGQA 4Q4LA 2RD2A 1Q95A 2BE9A 3VJLA 4Z4GA 5HUJA 4XAQA 4NEQA 2DBRA 5BN4B 4KQ1A 3EG0A 4DMKA 4X71A 4KNYA 5L51A 3OB9A 1IOZA 4MQ4A 2ZM5A 3ZZTA 5A88A 1E3WB 4YDSA 5IWCA 5JD5A 2DX1A 4WZBA 3GV0A 1XFAA 1I5RA 3DLHA 2R6R1 2H18A 3EG9A 2JGKA 3L9WA 4TXJA 4GWLA 1UZLA 2DFNA 4B87A 1GLVA 1DDIA 3FSJX 5I3ZA 3DE7X 2DHDA 4CEJA 1VQ5B 2LQ8A 1GARA 4WT7A 4URXR 2XMFA 3QVUA 1HRDA 2LDXA 4JJKA 1DQPA 4HLDA 1MX3A 4PRZA 2VRCD 4S05A 4B17A 1RMTA 4G0PA 4UKDA 2QROA 4IIYA 3CCEQ 3I8OA 2NV6A 4GIBA 4BE7B 4AKGA 4IM7A 3A04A 3EG2A 1SCJA 2B1JA 2G71A 5GMKl 3BCRA 2YS6A 4Y2UA 1BAPA 4JROA 3U40A 1Z9QA 5GONA 1V9LA 4DUGD 1P2SA 2RHUA 4IW3B 3V2GA 5B2EA 1OBHA 3T7SA 5C37A 1N8RC 2P0AA 4M89A 3L0IB 3PE4A 4R71A 4I6GA 1JFFB 3HJAA 3LJKA 1VQMA 5HF8A 2NUTA 1IWPB 1WP9A 1JB0E 1RXEA 3KWJA 5IBQA 3DR5A 4JJFA 4A0GA 3VSEA 3ZHQA 1ML3A 1EVKA 4QVDA 5CX1A 3HTXA 1ZNWA 3LUKA 3I9V1 2GCIA 2FF5A 4ZCLA 4M1YA 2J0UA 3ZIAA 3QUSA 1Q7YD 3OAAD 1CKBA 1ABBA 1NQWA 3F5FA 2ZZFA 1M1UA 1JLKA 3D0QA 4HDQB 2QN7A 1WVGA 2IC5A 3PL1A 4WXEA 4AN0A 5L3QA 3KALA 5J2UB 3RS0A 2RHWA 3A1NA 4G9EA 2AW5A 4LYGA 1GO2A 3BJEA 4G84A 3L8DA 2X0DA 4DCNA 5AK4A 4ZXPA 4EVIA 4RUKA 4H7IA 2XU8A 1A69A 3TOCA 3ZHUA 2ID4A 1ZAYA 1L5HA 1E3TA 1N8TA 1WUKS 1G6OA 2QMHA 2PAAA 1M76A 1G8KA 5C8YF 3VO1A 4FFNA 3EWAA 3CC4T 1W46A 1M0WA 1KC8R 1E99A 1O94A 3FWKA 3M56A 3EG5A 3CKLA 3OIDA 2X2EA 1P3DA 4IDFA 4IVQA 5TVKA 2O2HA 1NW4A 3ER0A 1CJVC 1Z88A 3GFVA 3RS9A 2B8AA 5GIPE 4RD3A 3MG9A 1AOXA 3CCBA 5C8ZA 1AKQA 2MMCA 4D0GA 1NVXQ 1E20A 1YGYA 1V0EA 4DYVA 1BE8A 1PG0A 3QI2A 5J5AA 5BSUA 1PJ5A 1YK0A 1GSOA 4I5EA 4NDAA 8GPBA 4YXWD 4FGKA 2Z43A 1BFKA 2N0SA 3ZXXA 4KQFA 3WISA 2UUPA 1H2FA 1ZJWA 3R5XA 3GIBA 3FNGA 2OTJA 1XRNA 2FWRA 4BY9E 3L7KA 3E7PA 1KQNA 3GA0A 5TPWB 3GIWA 2YOFA 2Y4OA 5T41A 3ZLJA 2XGOA 2G5TA 4UOZA 2AE1A 2YHUA 5BR1A 2VJMA 3ISJA 3CCRB 1Z2EA 3IVRA 3LG2A 1JLLB 4XW2A 4B7CA 5JTTA 1JDTA 1KPHA 4EUSA 4G37A 3B1ZA 3K4HA 4EYKA 4QXMA 5LQDA 3CONA 2WZCA 3O92A 1ACMA 1NHWA 2FRVA 2PE5A 5K4AA 1IIBA 2YASA 4AZTA 3DFMA 4NCXA 3L5OA 2BY4A 2HWUA 2ID9A 4B7AA 2YMPA 4CQMD 2EGGA 1XVUA 3EISA 3N2ZB 4IV8A 4ZAWA 5BQXA 3OZVA 2YWDA 3KWFA 1EYZA 2IHZA 3EGEA 4OCZA 5KIAA 1DC4A 1NNSA 2QX4A 1C3LA 2XKOC 2IOYA 1RD4A 5L3ZA 4DBRA 1P5ZB 3CZ9A 1FP4A 1PJBA 1Q2UA 2BM0A 2FETA 1X13A 4K0RA 3TXYA 3PVLA 1USKA 1FFWA 3ILYA 4RACA 4JI2B 2WJAA 5LIRA 3RTBA 3R6LA 3CD6B 2ENWA 1ONPA 1T5OA 3F7MA 2CJFA 3ZWDA 2WU3A 4PC6A 1IB6A 4KQWA 4P86A 4PLTA 1EIWA 5GJWB 4QDZA 4MZMA 2OGTA 1AA9A 4ITRC 4YAGA 3U4QB 5CB6A 2O5CA 5KU1A 3H9GA 2E6NA 3I2JA 4X7PA 1NW8A 1GYQA 1IDOA 3R6NA 1JVSA 1LK5A 4QUDA 5D8DA 5IC5A 1NXSA 2I22A 1HY3A 3DDUA 4ER6A 1WUHS 3CJRA 3HZZA 1K76A 3N58A 1E3IA 4P3XA 4Y0VA 2ZL6A 3LQQA 4JS4A 4O2AB 3N3AC 3RK0A 1GFIA 5KNBD 5JVDB 2VYND 4ENPA 2X6QA 3ASYA 3QWBA 5SYMA 1M9SA 1HNZB 4AC9A 1SUSA 2HW8A 4C4OA 3UPDA 1WYXA 2JUFA 4FXUA 5I7HA 1K8AD 4J9GA 3IUBA 1WGSA 4WPGA 3C6BA 4YJ3F 1FU4A 4HPWA 4W5QA 3PRKE 2OQVA 1A3CA 4CE6A 1GA1A 4OQYA 4IFBA 3FSGD 4MAMA 5JI2E 3JQQA 3OBBA 3P71T 1SKUB 1Z4KA 4XM3A 4AY6A 2RAVA 1XHLA 4A6DA 1AV6A 3GLVA 2X5XA 5DKFA 3JQRA 3G79A 2GO7A 3T0IA 2EG5A 2NUAA 2IWHA 4RU1A 1IK4A 1P4GA 5CVCA 5ES4B 3PIOA 1JSZA 1U1IA 3NI2A 1P77A 2AJTA 3I1YA 3P2OA 4YMLA 4QYSA 4UHKA 5CFPA 1T5DX 3RUCA 1VPLA 2GFQA 1M1KU 2GTHA 1J0CA 3OBYA 3MYRA 4LGCA 10MHA 4YJHB 3WXMA 1XZQA 2OZPA 4FILA 3TXAA 3QYFA 3I4FA 1X1AA 2AVDA 2R2GA 2AMYA 2ZAOA 4P4LA 4NAVA 2YV3A 2ZBPA 1XUOA 1FFHA 3W34A 4TWBA 3A8JA 3UAVA 2WB4A 5ALHA 1RYDA 4FYXB 2PKWA 1ZK0A 4YFYA 4BC0A 4ZGWA 4R9SA 1UBJS 5BOVA 1B0AA 3U37A 3I55A 2C2KA 4Z54A 1ECGA 3OOEA 4OKSA 3KL2A 3L93A 1EWRA 1ZWKA 4LZJA 4B9EA 1N5ZA 1AKWA 3HQ4O 2E1RA 4CQMA 2IYAA 5CA0F 4NJMA 2XB4A 3BX1A 1CV2A 1ES9A 1JG1A 1PHRA 1VCNA 2P1DA 2WK1A 3H8SA 3JD1A 3NJ8A 3IR5A 4E2XA 4PJOA 1GL5A 3L7BA 1BJRE 2BCJQ 4KXLA 5SYAA 1DC6A 1Y37A 4Y9TA 5DI3A 4BMNA 1GNTA 3REFA 2KRSA 2X3XD 2RIRA 1P9NA 1CQPA 1J1IA 2AEEA 4EUKA 1AZWA 1Z8FA 1VQ5Q 2DAQA 4UD2A 5CA1A 1EU1A 3LLMA 2H11A 1MEEA 5K3SA 3VKGA 1A4RA 5TARA 4C92F 2DKFA 3N7UA 5HQJA 3RYCA 4QDJA 3MCAB 1VIDA 4MLDA 4OAOA 5GJBA 2O14A 2ZBVA 4DR5B 3IPCA 2A5GA 1BNCA 3ELYA 3EQ2A 1XPOA 3EXIA 3VNSA 3EZ2A 2HMVA 5EZSA 1LCIA 4RZUA 4M1SA 3RU9A 2YXEA 3V8EA 5EJ9A 1YIJB 1ST3A 5E3HA 3WDMA 2LC4A 4XX1A 2M2IA 3PR2B 4J94A 4LG1A 1RLPC 2OBSA 5KBYA 3BWCA 3EPHA 2FPKA 4PZYA 2VVTA 3C4VA 3H5WA 2FFHA 4XR6A 1E6GA 3FGNA 4IIUA 3N75A 4H4CA 4S1VA 4AMYA 1S9HA 1H2AS 4C2UA 3ZE6A 2HKQB 2BLNA 4J0KA 3HO1A 3NHAA 2SCUB 4KDFA 1U7PA 1QVPA 1DBWA 2FPMA 2UUOA 1JHRA 1SCNE 3C5HA 1OFIA 3LPLA 3SVZA 3DS8A 3VVCA 2GFHA 5I45A 1PR2A 4CLEA 4QT0A 2A59A 2WVAA 1BJKA 2WJVA 1PR1A 2HA6A 4PYQA 4V1CB 1ZUKA 1RPJA 1ZA2A 2CMKA 3IEIA 2DFPA 1CUWA 4LBYA 2QLLA 1WMBA 3BZBA 2FPPB 1OULA 3MB5A 2P8SA 4GGPA 4I81A 3M0EA 1QHEA 3RKSA 1JW9B 2LBPA 1WB4A 3D6VA 4ANFA 4CRWB 2PRZA 1ADGA 1Q0RA 4AM8A 2CHGA 1XN1A 4ZZIA 4RM2A 3DMDA 2YV2A 3HA2A 4QTZA 4LZWA 4KSCA 3EGWA 2V6MA 3OESA 4YV1A 4I19A 3WK6A 1FTGA 3X26B 5AUPB 4GR4A 1HDIA 3LTEA 3A2NA 1PSDA 2HX1A 4H59A 3EWIA 1MB0A 1Z4PX 3H87A 4MYDA 3RIHA 3FA2A 1ZJZA 4BKPA 1QVRA 3HTRA 3BIJA 3H9BA 3TF5A 4U5QA 4DR6B 4HNSA 4QUEA 3SWNA 5EIAA 3V2HA 3CC8A 2AQIA 1XQYA 3X20B 3WE7A 4EZEA 1K4US 2DA9A 1F48A 2C04A 3CUSA 4XYGA 4GG1A 5GMKh 1U8FO 2RF0A 3AETA 4YMIA 4YP7A 5HPYB 4CEHA 1PJ2A 3Q5DA 2W5UA 3WIUA 1DO8A 4B6MA 4ZN3A 5M9OA 1VQ5A 1JG7A 2E1PA 2VAWA 1KI8A 4IGFA 2G9NA 1ZH6A 4KDEA 2P0QA 2W2OA 2BGIA 4LJ7A 1XTJA 2C3YA 5DSXA 1HT2E 4RTPA 3K0SA 2C07A 2C4KA 2JLCA 3BKWA 3OLXA 3C7AA 3W5JA 5AM0A 1YR2A 5LPNA 1QTQA 4OYLA 2WZBA 2WA1A 3ITKA 1Q3TA 4MB0A 4P7FA 2VK4A 1PG5A 3VDQA 3V4RA 1AGXA 4NI5A 4JXXA 4FE7A 4JJ4A 4ADSG 4LF4B 2W2VA 2RNAA 5KW9A 2IP1A 1VCOA 2QA4B 1ZXXA 3DLIA 1P2BA 4E22A 1JNXX 3I61A 4XD7D 5IT0A 5ECGC 4DT1A 5EXSA 1TD9A 2QDXA 1O77A 2XWSA 1P0PA 4MWGA 1L5RA 1SD1A 1FVOA 1SXJA 3GHYA 1XZPA 3KR2A 5IHNA 3G9QA 4IDBA 4MYCA 4NP6A 3VR5D 2IW1A 4YCBA 2BMVA 3GX1A 4FZJA 4M75C 2GVNA 4ELZC 1ZONA 3CNHA 3HP7A 4QQKA 5LD2C 1O96A 4MDYA 1WMFA 4QG7A 1B6RA 4B9WA 3PA8A 2K87A 5AOAA 4FIZA 3M6IA 5GONF 1EFCA 1NW6A 2FSHA 1BFUA 3DONA 3NAQA 2V6IA 3FOAA 1P6UA 2E89A 4FJ1A 4MV8A 1JJFA 1JHYA 2NSLA 4MUMA 3I52A 2H1HA 4C29A 4PYOA 4Z4FA 4MR8B 2B1QA 3MJDA 1FMFA 2YH2A 4R1OA 5BSFA 4HFMA 2OV1A 2XF2A 1KEEA 2MTBA 3AB7A 4QUJA 4OB7A 4BNNA 1T25A 1XZGA 3TZLA 1L5HB 3RWBA 3SU8A 2IVFA 5K05A 4Y2SA 3CUEF 3KR1A 3ADCA 1TLFA 3DZCA 3FFAA 2P11A 4G8DA 4N0EA 4OTZA 5B30A 3HXQA 2HT1A 1W9MA 1NU6A 1JHMA 1HL7A 3GJYA 1Y6ZA 1JIKA 2IDMA 1UPAA 4IY1A 3JD2A 3VJKA 3LKZA 3QJ5A 1Q19A 4I46A 1ARKA 1TT7A 3NPMA 3RHZA 2FMIA 1NQTA 3LXUX 2I5PO 3WVDB 2MSEB 3EUAA 3BK2A 1LBHA 4Q9IA 3SC3A 3TJZA 5MN5A 2RGXA 2ZETA 3JQEA 4LW8A 4R40A 3OWOA 1Q1NA 2Y68A 4XIGS 3UOGA 1BDBA 1CDDA 1J9EA 4PN3A 4QXPA 1A9XA 1GPLA 1FMLA 3VRYA 3GXBA 1SCQA 3BHMA 4Y7CA 1KVRA 3HVKA 1LX6A 1F0NA 3THRA 2I7XA 3JQDA 1V4NA 2AC4A 2OAGA 4HTAA 5BSRA 1V8FA 2FSSA 1JQLB 1UJBA 1MPXA 2NTJA 2X7HA 1F8YA 1K4KA 5KYUA 1F38A 2CNLA 2ZRMA 3PIDA 1OU8A 2B86A 3CC4A 1CWUA 2Q0SA 1QVFA 1T6XA 4YMVA 5K6TA 3IESA 3CUWA 2YKGA 2D8MA 5AUQA 3RH0A 1KG1A 2GJ4A 2GRJA 4B3TB 1V7PC 1GPDG 1MCZA 2FDRA 1IBLB 1NASA 3DTYA 1ABFA 1B3RA 4IDDA 1GUBA 4OJKA 5MGNA 1N78A 2O8FB 3G2IA 3PT9A 2D5BA 3RPEA 1PJ4A 2RKOA 3D6JA 4CIXA 4ZI7F 4RA6B 2QTWB 4V0QA 2SKCA 2EWNA 1AHHA 1BI0A 3CCJB 3MEUA 1CZUA 2ZSIA 3V7YA 5KQLA 2RN8A 5JBQA 3GEDA 1BSVA 2ZUWA 4RIGA 1KI6A 5KYGA 3KZXA 3OETA 4LRQA 4A4DA 3F8TA 1IFXA 4OVAA 2HB6A 3L6BA 3GRRA 1PE0A 1T3GA 3K0BA 3RWOA 5JPDA 3BMNB 5DPMA 3UF0A 1N33B 3CLVA 2VAMA 2OOKA 1NM7A 4DV1B 3DP7A 3FPPA 4QLAA 4RE6A 2IXGA 2PXCA 1VL2A 1Z0SA 4DYHA 1R6TA 4QVGA 5TQ0B 2M6LA 3VGJA 1W4ZA 3WHIA 3QVGA 2NX2A 3CPEA 4G36A 4EG8A 4QG3A 4KK4A 4UPDA 3U5TA 1J20A 4MARA 3T5PA 4TX1A 3RKWA 3TLXA 5ULLA 3VU3A 2ZPUA 1SBYA 2YT6A 3L7LA 3SLGA 5AJHA 5HKCA 4PE5B 4M7AC 3E4DA 1P2FA 1T1GA 4ZVNA 4PG8A 5KJ1A 5L3VA 3BE8A 1PSFA 3WL7A 2P5TB 2PSFA 3FOZA 2VNAA 3AIKA 3S5UA 1WDLA 1ZL0A 3CPSA 3I01A 4R3WA 8MHTA 2WZNA 1R0YA 2NNWB 1GRRA 2QSJA 1R18A 4LRSB 4XUDA 4BU1A 2I6TA 2ANCA 2H85A 4GI1A 2LCSA 1W73A 2Q99A 4FUQA 4MHOA 2A0KA 4Q01A 3AINA 1W0JD 2P9BA 3QOFA 4HDMA 2ZYWX 4OYHA 4RMNA 4Y6LA 5G3YA 3SICE 2JB9A 4W7SA 1F8UA 1TUBB 2WD7A 2XE6A 4RUGA 2CF5A 1GITA 3GAFA 3K8ZA 1WVIA 5IJ9A 1QO7A 5L53A 1E0SA 1YGPA 2VPYA 5L9AA 5BORA 1UUFA 3ZUPA 1EIFA 3OMLA 2JA1A 2PH7A 2Z98A 1ZRNA 5FPHA 3VUFA 1SCBA 4IUPA 2BGWA 2ZI3A 3EDRA 4REQA 2X4LA 2Z30A 3G1TA 16PKA 3E2MA 1HEYA 2WT4A 4I1SA 2ZSJA 1QH0A 4K9NA 2OV6A 3K30A 3A1CA 3N8HA 4PICA 1Z0UA 3M89A 3EFBA 2VDPB 4YLYA 4M77B 3OYHA 3DVLA 5KQSA 1L2TA 3GIDA 3IBCA 4NAUA 1J97A 3U3KA 4IIJB 1JVNA 4M77F 3TZHA 3KVNA 1JT2A 1ZGAA 4WXYB 3SBEA 1KAQA 1JR3A 4YQYA 2DUUA 3VRHA 4A8JA 4ZI2A 2R6ZA 4W5WA 1XRQA 3OFJA 4BE2A 3UAOA 3VKFA 1PJLA 2D1FA 1HQYE 3SR0A 4GMKA 3U7FB 4I55B 2VBVA 3G6EA 4JDSA 1YU9A 4J3JA 4TGLA 2ZB2A 3JRWA 4OHMA 2JS0A 5A3VA 3TSWA 1I4WA 3G8DA 3T1QA 1UXKA 4GMHA 4MI3A 3T61A 4M7RA 3IHKA 4XUCA 5DLYA 2WU4A 4OB3B 2QMQA 5DEOA 1MRNA 2LUOA 3WTBA 2QV0A 4BNIA 5HHTA 3Q8KA 4ID3A 1MP0A 2VVKA 3SJCA 3UMRA 1ADCA 3B13B 3EC2A 4QGGA 3RKXA 5FIUA 3CESA 2ZQZA 2E70A 3I2YX 4FDAA 1W76A 4PEVA 2IU3A 3MPUB 2PEYA 2ESRA 4Z53A 3QE0A 5E4JA 5EKXA 3NVKI 4A36A 1YUNA 3B3FA 3DG9A 4XJVA 4EYOA 1K6XA 2O7VA 4CC4B 1V8DA 2Q46A 2ZTUA 4O1MA 4A8TA 3F1KA 4ENQA 1HLGA 5CM9C 3I1IA 3LY7A 1N2OA 4W5TA 1PZXA 4E2ZA 2KQWA 2PKCA 1V8PA 4IQGA 4JLBA 1RRPA 4F60A 1B8OA 4YJFA 2EF1A 3OMGA 1HH4A 1L4HA 3M5DA 5L23A 1TJ3A 2OO5C 2ZG6A 3QW4B 5BMVB 1MMDA 5EYPB 3JQ9A 2VHTA 2OR3A 4MKHA 3N0RA 1B7GO 2NYRA 4FFWA 1XZMA 3BDVA 1N07A 2B98A 3FOBA 3K05A 4J4BA 4B7XA 3FETA 7YASA 3ZDZB 4DBLC 3FTEA 3WGTA 5LJ3h 3L1JA 4Z0HO 3M1LA 1V35A 1LV8A 3L8FA 2Y0PA 1YI2A 3FHCB 5A62A 1CP3A 3CC2Q 1L4KA 4OATA 1PFYA 5A2QE 3D3WB 4TWIA 4CM9D 3HL0A 3ORFA 4F2GA 2QN2A 4X7BA 3H65A 1SRRA 1N4DA 4WNAB 2OB2A 3VTZA 4DMGA 4IEIA 3VR2D 4Q5WA 2R00A 2Q1YA 2FSIA 1JU9A 4NCHA 4KAJA 3HCCA 4FZ3A 3VPFA 4B40A 1UFFA 1KEUA 4PJOE 1QVGB 2AEFA 2WKWA 2GJKA 1XZFA 1R10A 3MD9A 3Q3CA 5GAN2 2B9VA 4WLEA 4WNIA 3TCJA 5SY9A 4HP8A 3UWNA 2JIDA 1VM6A 4Z49A 1N25A 1T0JA 4HGYA 1DHRA 1HOTA 1H641 1WP6A 1Z2DA 3MGBA 3CR8A 1BC5A 2DEQA 3HPQA 5CT4A 2BHTA 3RKYA 3IT1A 3SEZA 3P0RA 4AF8A 1IJKA 3GK3A 3GT4A 2DTXA 3HCOA 3HNOA 3WDLA 4BTLA 1CFZA 1XMSA 3PLAE 2CLHB 1J0BA 4Q7KA 1O95A 4EHHA 5KX5F 5KWSA 1A95A 3J7AC 4L73A 1SKYE 3LWBA 3MEVA 2HDOA 2JLZA 3CUYA 3PWKA 2AUMA 4QUGA 3G0HA 3NBZC 4YCNA 4XTZA 3O2QB 4KPYA 3HUDA 3O1HB 1YWGO 1KC8C 3TAUA 4HC4A 4MYSA 4WFJA 1ZSGA 1WU8A 2P79A 2VP5A 2AQHA 1B0ZA 5ELMA 4J0HA 1JQBA 1ZYUA 2J9ZB 2V8OA 4A26A 3K70B 4CLRA 1Z38A 2FJPA 5BR4A 3CA8A 1T8PA 2VHUA 3DMGA 3QA9A 5AICA 1XAIA 3GGCA 2HPZA 3NC4A 3LTNC 1V5VA 4ZGGA 3R3JA 3GO4A 3TSAA 5FHQA 3FJPA 3N0WA 5D51S 4LVCA 4YC7A 1V9CA 2WF9A 4O6JA 2BT4A 1QFYA 2EBUA 1PT6A 4G1MB 5CIUA 1GCIA 5C3UA 4MVJE 3R40A 3IE0A 2VAVA 4PFQA 4DT1B 2MJLA 2R6DA 4JVLA 5EWLB 5AKZA 3SDBA 4LC1A 1QUEA 2GREA 2XNJA 1I7NA 4DCTA 3KP1A 3HFRA 3AHHA 2FQWA 4EB6A 1K3FA 2W83A 4ZVTA 4GBED 3W8NA 8ATCB 3G71Q 1YJNA 1XBTA 2BFEB 2A5YB 3FYDA 1ZUD1 3HGQA 3HXLA 2GWRA 3CVOA 4HAVA 4N39A 1ZVMA 4BJ6A 1VE3A 1DBPA 2LDBA 3B8HA 3O4RA 1H6AA 1JJ7A 1UFOA 4XJXA 1N77A 1G8HA 1XNQB 3QX3A 1T9GR 2B5WA 2JRCA 3G1WA 3PUJA 1AKMA 4XFDA 4BEWA 4J16A 4M55A 3VDRA 3CMMA 5E6RB 3T99A 4PO1A 4G8CA 1CR0A 1I0LA 3GVKA 5F2KA 1TA4A 4N0MA 1H6DA 2W2NA 5JMOA 4XN3A 3JARA 1XTSA 3JSXA 3N87A 3OZSA 4YTEA 2UXDB 5A9SB 3LDGA 2RHDA 4JLWA 3GA5A 1WFWA 2JJ1A 3TIVA 2GN8A 4NCNA 5I9LA 3C8DA 1O5IA 2DLPA 2B7CA 2C7GA 1EJBA 3JRXA 5GJVC 5KYYA 4YV7A 1E6HA 1ENOA 2I4MA 4MSUA 2EKQA 2VHZA 1MMFB 2YINC 4HWOA 3QIAA 4D3ZA 5GAOm 2YMMA 3EBPA 4E5VA 2I3AA 1JJIA 2PVPA 3UJHA 4RWEA 4WBSA 3KWLA 5IEBA 1G2BA 3AR7A 3TLBA 4U0KA 4PBTA 2JEZA 1Z2AA 4EG7A 3ZU5A 4C5CA 3DPUA 4UVDA 5FOUA 2BH9A 3OKFA 3UT0A 1C0PA 5T8KA 2IYWA 3KLPX 4UNQA 3RY8A 4REQB 3W3AH 1V11A 2XVAA 2X35A 5FWCA 2F62A 4EPWA 2G1UA 1KBOA 2YWBA 2HF7A 3H7IA 1RLIA 3PGA1 3RRJA 4MZTA 1VHWA 3JAWB 1YHQQ 3MT8A 3OLWA 5L4NA 5I8ZA 5IHIA 2R2AA 2BFPA 2EYYA 2XR1A 1NPDA 3OOYA 4BKQA 3D4IA 3CMET 2FE4A 1J9ZA 2E4UA 3AY0A 3IAS6 1SMKA 2QYOA 4DXHA 2QSZA 3S3TA 3SZ3A 2ATXA 2CDBA 2RGGA 3HLTA 5BVHA 3SXJA 1K73D 1QYWA 5FPQA 1RL2A 3LI2A 3RVQA 2B37A 3MOGA 3TLGA 3UENA 3VSBA 1YR6A 4FLMA 3WK7A 4A10A 1W59A 4HVCA 2I2DA 3AB8A 2P9FA 2CHUA 3AR8A 5CDFA 3DWEX 4M8SA 2VQ3A 4NTZA 3IQIX 3TTYA 5IAAA 1VQNT 4UEQA 4Z89A 4ZTUB 4DDMA 1LNZA 2IQIA 3ND5A 3RVNA 4EM6A 3HCWA 4O2RA 4TMKA 5KNLA 3DDOA 2ZJ3A 4ZFNA 4QQDA 1DADA 3GT7A 1Z0JA 2AWNA 1BE6A 1G8PA 1YJCA 4LNUA 1H3HA 1GLGA 2G17A 2NAFA 1A4UA 1KZ4A 3EDOA 4WY2A 4ZQHA 3FSEA 3T9NA 1BQEA 4BX2A 1LRJA 4JMQA 1NW5A 3DPIA 2XGMA 2O1WA 4C3VA 1DJMA 5EE3A 3G4SB 1CZOA 4LEIA 5AI5A 2RDMA 1JR3E 1VBNA 3SC6A 2BTTA 4Z9YA 4OM7A 5F7OA 1ZK3A 1WQ1R 3WS7A 4RWZA 5FDFA 2PUBA 2VWPA 2ZPEB 3JV7A 3BB1A 3WLEA 1KEZA 4D9BA 5BY2A 1RZVA 1T5IA 3CSSA 3DE5X 3H0FA 4CC3A 3BGVA 4I6EA 3EAGA 1Q17A 2I8CA 4TKUB 2XA9A 4QPZA 5CDUA 4MVJI 5KMGA 2FVYA 1VGVA 5AIAA 5B6PA 4RQBA 4H4DA 4TKZA 5EG2A 3CMAQ 4BXOB 4E21A 1B3QA 1QWOA 2YWRA 1SU4A 4IRXA 1IVYA 4J03A 1QONA 4JV5B 1L5MA 4V2IA 5KQPA 1ND6A 2JARA 2PFSA 2WAYA 1L4LA 4QRHA 1TYZA 4U6QA 2DRIA 2WKSA 3TOXA 2LMJA 3P0HA 1IUNA 2FJUA 4Q16A 4CM1A 4IEFB 3JQ8A 4CRIA 2RHJA 4XLTA 3AERA 3I62A 4FFRA 4ZT4A 3FRHA 2IEYA 3S7TA 2O2JA 2XIJA 5EJIA 2DJZA 2X23A 3U6BA 1AY0A 3R7LA 2CC2A 3N53A 1TFUA 5CM8B 1U63A 4OMNA 1JDPA 1O94D 5EIHA 5CFOA 1BXRA 1MO5A 4HRVA 2Q8PA 2GZRA 1PRMC 3IA7A 2DSTA 3MM4A 5FCDA 4BE9A 4WFQA 4J8PA 3N2GB 2HK6A 2PL1A 4EPTA 3WNDA 2YBEA 1UADA 1NR7A 1O54A 2WF6A 4YAWA 4HAZA 4ZOBA 3FFXA 1U4OA 3IOMA 5KOHA 1P92A 1YIOA 1OC2A 2QQ5A 3PPYA 1A2BA 3EXEB 1GYRA 4O1IA 1MHTA 4JWTA 3KSUA 1QH8A 1H4VB 1JQJC 2JW5A 3B5JA 3BUSA 4AY2A 2QY9A 4WZZA 1BROA 1U1CA 2WY2D 3F97A 1DJLA 1EVIA 1XP5A 2J9XB 5IVPA 3F6YA 1QE0A 5TMBA 5LDHA 4DLLA 2YWCA 2GLXA 5TVGA 3H1TA 4FKBA 1DIGA 3STUA 3VHXA 1VKZA 5KS2A 4FW1A 1AE1A 1JU4A 2FW8A 3ZWNA 1EUDA 3T1OA 3TX2A 4F45A 4HN4B 1TU4A 1NI4B 3QXGA 4UUPA 4HJXA 3MVEA 3DCJA 4WD3A 1T13A 2WJ4A 2AFRA 4ZVSA 3RWMB 3V2UA 3PC4A 4MGHA 4C4ZA 1SXJB 5FBRB 3C1TA 3BIOA 3C3AA 1A82A 5CHEA 3QOXA 4YJ2F 3UATA 4MV4A 2LZJA 5AYFA 5T67A 3QYAA 4OQEA 2FR1A 2QTNA 1WUIS 3I6QA 2I0NA 1Y34E 5E9QA 3F6RA 4EUEA 2QRMA 2AFHA 3EUFA 5ALTA 1BMQA 2GETA 2Q3HA 3C4JA 4ZVRA 1ZD4A 1VCIA 2A9QA 1MQAA 2HMAA 2HU8A 2W9XA 4LYHA 4QAQA 1QWEA 2KRMA 5IN1A 1JEOA 1QK5A 1DRUA 1SBNE 1WNTA 2D7CA 2H1WA 4FONA 4UNPA 2YZNA 2AC7A 1DAIA 1DV2A 2WLTA 1NJIR 2ZTSA 3CX6A 3L9XA 1QLJA 1N2XA 2BZ8A 2WG1A 3E81A 1E1RD 5K0NA 1GQ2A 2BRUA 3QA3E 4JYPA 4N65A 1DP4A 3PA2A 1HQKA 4Q7EA 3SXUA 3HBAA 3R20A 2CKMA 1PVVA 2H5IA 1O8BA 1P5JA 1UIMA 4OHXA 2ZXEA 3DOHA 1JIXA 2C42A 1WR8A 1XE1A 2XF8A 3TOVA 3AF0A 2INGX 2PTHA 1VHLA 4GF5A 1HKHA 1K8YB 2BCGY 3GNTA 3OYCA 1BDJA 2HQXA 4DSTA 4ALMA 3OCVA 3I5SA 4QULA 2YLCA 1Y0YA 1QANA 1UXHA 3GQVA 3T8YA 3N8IA 3PLNA 4NE7A 4PINA 4DNPA 1V6AA 3TVTA 5JAZA 5C53B 3PXXA 3UV6A 2JM8A 5GMKm 2DIEA 3L0BA 4RPCA 4JJNK 2WU0A 2CB9A 3O8RA 2CXUA 1GLNA 2YJNA 3HCRA 4L8VA 4JU9A 2KXDA 5A71A 2R86A 3K20A 4O4HA 1KH1A 4P3IA 4PGAA 1CNFA 1L1EA 2V7QA 1X7DA 3P2EA 4LHSA 2ACKA 3QLJA 1Y4DE 4Y1GA 3U19A 1YULA 4OMQA 5HIIA 3WWOA 4F72A 3HDGA 1Z83A 2GILA 3P27A 2CUNA 1T9CA 1EK2A 1JQ3A 1SXHA 3LQ6A 2CUDA 1E2NA 2WR8A 1UC4B 3KT3A 1TRKA 2GZMA 3LA8A 2WHPA 2G9ZA 3MTJA 4IHJA 4WRRA 4QL3A 1CY4A 5LJ5g 1ZS9A 3PFBA 4Z8XA 1OH6A 3PQCA 3BQMB 4XB2A 4DM3A 3CRNA 4LC0A 3ED5A 5FHRA 4X07A 4W5RA 2C7PA 2FUCA 2HMYB 1L6RA 1B0UA 4U2KA 4D4LA 3K7EA 1JWBB 3ZQ6A 4B3XA 5C1PA 1NYGA 2EW3A 1RVV1 2GD2A 2CVQA 2P3SA 3BULA 1BCOA 3ESYA 3JQGA 4LWZA 4O4IA 4R9RA 1T4DA 2BMWA 3CXCB 1R8SA 3PICA 4KXQA 5E6UA 3TREA 3GNLA 4D5EA 4E14A 2GYYA 5J3BA 1QFJA 1NT4A 2SICE 5A6SB 4D45A 3K8QA 4E88A 4I50A 5FPYA 4LBWA 1KFJB 5I4BA 2IYEA 1HQCA 1MABB 2CVPA 1TS9A 1J6UA 4TMWA 2O3TA 2PUJA 2R7MA 3DWFA 4GZLA 4H16A 2O0HA 4GYWA 4QFCA 1QQ7A 4A53A 1DQRA 4UVIA 4D6WA 3W6UA 4UTVA 1Q3HA 3ZHZA 3H97A 2ZYGA 3HBNA 1PT9A 1V3VA 4MP8A 4RIIA 4CC2A 4GL4A 4L5JA 5KOYA 1M2VB 1DEXA 2EQBA 3AV0B 3OM8A 4G7WA 3QZUA 5KTTA 1FVHA 2B3TA 3FCEA 4X85A 2FAXA 3TQHA 4NAHA 5HOQA 1PK7A 5LJ3g 4E4TA 3A9RA 3KWMA 4FK8A 2MHCA 2A9KA 4CF7A 4Q9KA 5F4MA 1U0LA 3QFHA 5A0VA 3D8UA 1QGYA 2DULA 4HYYA 3IVGA 2QVXX 4QVZA 4RH0A 5MGBA 2FZKB 1PGPA 1NJ1A 1DC8A 1YIJT 1QH1A 2B0JA 3PUZA 4NICA 4JBXA 5FBHA 4O2BF 3VHLB 4YAUA 3W4KA 5A1JA 3HUFA 1C0IA 1FS5A 1JR3D 2E9SA 4M7AE 2V65A 4ZVPA 1M1ZA 5CAEB 1PV4A 2WJZB 1AJEA 4FCCA 4U3JB 3K35A 4F71A 3JX9A 2CHEA 4ZOQI 6REQA 5LYJB 3KKNA 5C8XA 1E9RA 3ER6A 3AF1A 2XZPA 1IG0A 3BTVA 1F1BA 2YDYA 4M9XA 1CYEA 4FFBB 1T3TA 2NO9A 1M6HA 5T8KC 2ZXUA 2BFCA 1DCMA 2Y1KA 2A1IA 2ZULA 3SYKA 4KQHA 2PMWB 4JCCA 2OHHA 1CLEA 2ZPBB 2D62A 4JX8A 2Y4YA 3VYGA 4R2KA 5BT9A 3CZMA 5M3BA 2QL9A 4X8HA 2W7TA 3WNZA 3FZEA 2B4KA 3ROZA 4IHKA 2WAOA 5TEWA 3CBPA 3AVOA 3S1SA 5KKNB 1FFXB 3HVRA 1F8FA 1D4AA 3E22A 1XJWA 3WIEA 4DZZA 2RGDA 3NPAA 3K5WA 4YRKA 2ZR0A 1W0JA 3INYA 4N4AA 4JRPA 5FBVB 2GF0A 3E9RA 2CNBA 4RLHA 1G3UA 5DWDA 2AJ8A 1KZGB 2ZJOA 2VJQA 2NNLD 3R5HA 4HR7A 2HYDA 3M6MD 3VPDA 1YRBA 1UC8A 3IV9A 3DC7A 4HS9A 4X54A 1Y7LA 4OMFG 2HWXA 4MI1A 1AVZC 5DW3A 3NWPA 3U7IA 1EI9A 3IOEA 4M7OA 4C7BA 4DUZB 1ZG3A 1ZWLA 2FHDA 2C31A 3MCTA 4HA8A 1ZSZC 5DWVA 5JLJA 5JSZB 3OQIB 5KX5B 2BSQA 3GGPA 3QEMA 5AWFC 3WBBA 4KXXA 1M2OB 3V42A 4ETNA 1KDTA 3OT4A 4CKEB 4QUZA 4DEXA 1CR6A 4L4XA 1O4WA 2IHKA 3ADPA 2Q9UA 3TR6A 3VR4H 1X7XB 5GOZA 4BZZA 4BLSA 4CM8B 3C3KA 3A1TA 1N6LA 1T4CB 1IOVA 2D2IA 1OYYA 1M4ZA 3W05A 2FUG1 1PZNA 3ZWAA 2NTYC 3EOBI 4NENA 1MDBA 2AF3C 1DKRA 2VZ8A 4UFPA 2CBGA 2ZGVA 3UAWA 2NU6A 1L7EA 4P3OA 2CLMB 5K8UA 2GN0A 2EARA 5IX8A 1U3DA 4BFXA 3KJXA 2K3XA 2RC5A 3ROTA 3RUPA 3ZEAA 3TR5A 3FMIA 1YQTA 3WLIA 4BEVA 2I2WA 5HXAA 4AO8A 2L3QA 3F98A 5C0OE 2G40A 2ZJ5A 3KE9A 2QLNA 1LBQA 3PNVA 2AXEA 1EFTA 4MWEA 1KOGA 1N06A 1P4SA 1F2TB 4RV9A 1Q81D 3NYRA 1HGXA 4Q3BA 2JCXA 4U8HA 3MNFA 1VP3A 2CFRA 3ZS8A 4RIFA 4BBJA 1Y96B 1IJEA 1PNOA 4E3ZA 3G4SA 1SVOA 3LWDA 4PAOA 4LKOA 4B8YA 3M5AA 2V9PA 5D87A 1OZGA 3GAAA 1FB5A 3JALB 3UAZA 2Q3CA 5HKKA 2H08A 3T3GA 4BPBA 1A0NB 4L6AA 4EYSA 1EX4A 3AKDA 4RIEA 4BN0A 4EB3A