2DERA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
364
structure length
348
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 90
structure length 348
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2derA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2derA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2derA01
1JA0A 1QUEA 1PFYA 1EP2B 1K4MA 1H3EA 2VNHA 1EFPA 4ZT2A 3W5VA 4ZCQA 3LOQA 1H3FA 1TUIA 5HG0A 4MYUA 1VQPB 2QUKA 3KT3A 4ZCLA 4PBTA 1Q81D 1NZJA 4YAFA 2E18A 2JAXA 3QTTA 4MW1A 1QVFB 5FO1A 3AVYA 1MB2A 3WBKA 1EJ2A 2B7LA 3V76A 3HFJA 3TZLA 1ELOA 1FDRA 4CQNA 4FZJA 1OWNA 1I7PA 3IDFA 1F7UA 5LFAA 2IJGX 1YJNB 3FY4A 4TS1A 2OQ2A 1MAUA 1NUTA 1YIAA 1KTVA 1NUSA 1EFUA 2V0GA 5GV8A 1TYBE 1ILEA 3AGQA 1N2BA 1H85A 1EE1A 4DQKA 1JIKA 1QGYA 3VNVA 2J07A 5EKDA 2AKEA 2C77A 3U6KA 3CPWB 3FOCA 1JNYA 5AHWA 3INNA 4PC3A 1QU2A 4PC6A 1Q86D 4FN5A 3H99A 5JBQA 1OWOA 4KR9A 4P3YA 2EFGA 3FG9A 3CVUA 4ZGQB 3PNVA 1VQLB 3OJXA 1K97A 4ARCA 2DPLA 3UC5A 5HXBA 4EG5A 4YMIA 3OZWA 1M1KD 4M0LA 2NZ2A 3N8HA 1KKUA 1W2BB 1VQ9B 3AVUA 3IMEA 4MQ6A 3SEQA 3W5UA 1SM4A 4QHYA 3NBKA 1AIPA 1O97C 3RFFA 1F7VA 2QA4B 1JIIA 1XNJA 1YIDA 1IRXA 3RK1A 1M1ZA 1BJKA 4A91A 1VQMB 4C0SA 3H9CA 4MYTA 1NJID 3LVBA 3CLRC 1FNMA 1EFPB 1QJCA 3U2QA 3CCQB 4RD0A 5KHAA 2VTBA 1WDTA 4PGOA 3SZ3A 4YAOA 2PFSA 1TYDE 2DY1A 1NURA 4OUDA 1SKQA 1ZM9A 3CVVA 5GV7A 1BS2A 2J7KA 4F7DA 1QUFA 2E1RA 2B7BA 3ES9A 4HE5A 4M2LA 4RD1A 1K73D 2XNCA 3QE2A 1P7PA 1T9GR 4TN1A 3CCVB 4MVCA 1GJRA 2BM1A 3JQPA 4P2BA 4GU5A 1G7SA 1R6TA 3GMIA 1QNFA 4MUGA 1R5NA 3ZIUA 1YUMA 2J5BA 2BV3A 1WQ4A 5KCMA 1JEEA 1T6YA 2J4DA 2I1LA 2CYCA 4MUHA 4MW2A 3KT8A 1WXEA 1W87A 1YHQB 4EFKA 4UAJA 1PFWA 2V0CA 1BX0A 1XNGA 3FWKA 1TYAE 4DDHA 1OB5A 3A4IA 1FRNA 4EG8A 1VBNA 4EG6A 1WQ3A 4DQLA 1JA1A 1TQ8A 4R2MA 2BMWA 1IQ0A 3CVXA 1IQUA 3N9IA 3SDBA 1KQPA 2Z08A 4L2IA 3CC2B 3X1MA 4ZCMA 1VQKB 4EF6A 3B8HA 2VZLA 1N2JA 4MUIA 3QTBA 3CCEB 3CCJB 1PFVA 1N0UA 1WJGA 2WSIA 3FH0A 4CT0A 1O96B 1N8RD 3ZXSA 3TQOA 1GAQA 4WQMA 5TS2A 3SYTA 4I6JA 2IP1A 4B3XA 1J9ZA 3CVWA 3CD6B 4HJXA 4PC2A 1JJ2B 2X3FA 1N78A 2R5WA 4EG3A 4NBSA 4YALA 1JZSA 1Q15A 3PNYA 4KPUB 3IVGA 3AVXA 2QN6A 1EUYA 4MW4A 4NAUA 3H9BA 1J1UA 3MLAA 2BVNA 1KQSB 1JGTA 2GM3A 2PZBA 3HV0A 4RCYA 1CNFA 1YIJB 3CC4B 1I2DA 3K9WA 1TTTA 1DNPA 3ZUGA 1V47A 3H05A 4NAHA 4B4DA 4QRDA 1BX1A 1KH3A 3AG5A 3CLTC 4GRIA 3A04A 1KQNA 1F4LA 2EIXA 5H5JA 2EJCA 3E27A 1O0CA 1E62A 1OWPA 2BSAA 4RD4A 1WKBA 4P6VF 4WNYA 4Y9UA 3UOWA 4MVWA 1EFTA 1KAQA 4DJAA 2A1UB 1EXMA 1X8XA 3H97A 4H9GA 3P27A 2NSYA 2QTNA 2BPOA 4PY2A 3VO1A 1N1DA 2QTRA 2PZ8A 1EWYA 2ZUEA 3AVWA 3IOBA 3RK0A 2RE8A 2E89A 2NPFA 2AHOA 2A86A 2PZAA 4NATA 2A4MA 1VQ8B 1KH2A 4OJMX 1IHOA 3CC7B 4XFJA 1EP1B 4G5FA 2WQ6A 1KAMA 3WNCA 3WBJA 1J70A 4PC7A 5DSZA 1G7TA 3VNUA 1M8KA 3AG6A 3PXUA 3MCAA 4MWBA 2QDXA 4TMZA 4MAFA 4ZT3A 4BWVA 2D5BA 3VGJA 3E20A 1QGAA 1F20A 1DDIA 3FJOA 3CLRD 3FNRA 1NDHA 4EG4A 1OGJA 1XB2A 1HA3A 3CMAB 4LBZA 4EG1A 2HGZA 4Q93A 4RPIA 1ZH6A 3IUEA 2PMDA 1R5BA 1GPMA 1MBZA 3SJZA 1JHDA 1U3DA 2Z09A 3IODA 3OP1A 4YP7A 2DEUA 4F3RA 3CRZA 4N3GA 4MUEA 3FETA 4WSOA 1PFUA 4MW7A 4DNXA 4R71A 3IOCA 4ZT7A 2PIAA 1AMOA 2A88A 5HUHA 2ZUFA 2CV2A 1U3CA 1LI5A 1FNDA 1QX4A 1FNBA 2D74A 5TR9A 3ELBA 3IOEA 4MWDA 1TEZA 3WYAA 4YAWA 1D2RA 1QQTA 1QGZA 2E0IA 4B48A 3G5AA 1TFUA 3X1JA 1EFVA 1M8FA 2IELA 4MULA 4LC0A 2CRVA 2OTLB 2TS1A 3ZJUA 3LE8A 1WY5A 1K8AD 1KORA 2HCJB 4X0EA 4RD6A 1DG1G 1GZUA 4AC9A 2EL7A 1FYDA 4RJLA 1NUQA 4QBTA 4R2LA 4ZCSA 1ZJWA 1G7CA 2JANA 3JQRA 1J20A 1PG2A 4TMWA 1Q82D 1TYCA 3AFHA 3COVA 4EH1A 3HZRA 3IMGA 3W5HA 2DERA 4K03A 5J5AA 4E1AA 1GVHA 4M4SA 2YWEA 5KSWB 2YWHA 4FK8A 4IW3B 1QTQA 5EMNA 1VQ4B 4G5GA 1O94C 4PBRA 1G7RA 1O0BA 2BTEA 3G4SB 3QSYA 3ZXIA 4JXZA 2CYAA 1K9MD 4G6ZA 3AKZA 2C5SA 3IMCA 1MOPA 5TGTA 2BN4A 4MUFA 5TV2A 1G59A 3DO8A 2QTLA 1Q11A 1MRZA 1NI5A 1NSYA 3P52A 1VBMA 3JXEA 2XEXA 3TS1A 3TNJA 1ZUNA 1M8GA 3ND7A 3I05A 4M1KA 1Q19A 2A1TS 2YWBA 2GKSA 2HMAA 1H3NA 4F4HA 2CV1A 4ZGNB 1FNCA 2BF4A 4LBVA 1YI8A 1N2OA 3U1VA 1JZQA 1K4KA 4TMVA 3CCMB 4DE5A 2J09A 1U7XA 3N05A 3QFCA 1KD1D 3I1FA 2BYTA 3Q4GA 4MWEA 5FNZA 3J81k 3GUZA 3FDXA 3CCSB 4RD2A 3X1KA 4EG7A 4JFAA 1G8GA 2J08A 3W2HA 3CVYA 1YJWB 3B82A 1D8TA 2QTZA 2X3UA 3OW2B 1VQNB 1PG0A 1EXDA 1A8PA 3JQQA 3DV2A 1OGIA 1H42A 1NUPA 3AL0C 4YAUA 1T6XA 4MW6A 1COZA 2PXHA 4UZEA 4ND6A 2XRYA 1NUUA 2QUIA 1K92A 5LLTA 1WXFA 3FIUA 4AS1A 4BPRA 1WXIA 4ZT4A 3RJZA 3QE4A 2CUZA 4ACAA 4Y9RA 1KK1A 4KPUA 4MWCA 1VLHA 1OBCA 3ILVA 4MUNA 4NDAA 1KJZA 3IVXA 3N2YA 1OB2A 4B43A 1ZM3A 2QUHA 1G8HA 3SEZA 2CFOA 4TMTA 3PNBA 3G6KA 5TEWA 1GTRA 1R5OA 4MW9A 5DEOA 1T6ZA 1IH8A 3CLSC 2DLCX 3OZVA 3IH5A 1KK2A 1M83A 4KR7A 4OUDB 1YITB 4HPWA 3P0HA 3OJWA 1Q77A 1N2EA 2XNJA 3CLSD 1XJQA 4YP5A 4JXXA 1FRQA 1M8JA 1ULHA 1ZM2A 2H29A 3VRHA 1N3LA 1VL2A 1MAWA 2DCUA 5H59A 1S4MA 1O6BA 1SURA 3AGPA 2AG6A 4G1BA 1DDGA 3ZBUA 1J21A 1N77A 5LM3A 2HDNB 2CSXA 3PENA 3CCLB 2FX3A 3LO8A 1O94D 2BM0A 2QUJA 4MUKA 3HMQA 1O95C 5DB4A 3COWA 4NCNA 4DLPA 1M8PA 1YULA 4HK4A 1OWLA 1U2RA 1VBKA 5BNZA 2B5OA 2AZXA 2BGJA 1E63A 1N0VC 3COYA 4PBSA 2X1MA 4M53A 4YP6A 1DARA 2GQFA 1GN8A 1YUNA 2YWCA 3OTWA 4MVYA 2CT8A 4G1VA 4ZV4A 3LCJA 2PIDA 4J0QA 2YY5A 3ISJA 3ZGZA 3P0IA 2A1TR 2DR2A 3ZJTA 1GLNA 1RQGA 5DK4A 1N75A 1NYLA 1B6TA 1EP3B 2YWGA 2QJFA 3M5WA 3QFSA 3NBAA 5J58A 2O5RA 3G6EB 1IB0A 2DETA 3CCUB 3P0JA 2ZITA 3P26A 1I6KA 2H2AA 3HGMA 4MLPA 1N2GA 1O97D 4DDKA 1XE1A 3WNBA 1O96A 3AVVA 1MC1A 5HUJA 1H1TA 3AVTA 3IVCA 1QFYA 3ND6A 4I6GA 1QG0A 3E1YE 4XSVA 2VNKA 1MB9A 1KK0A 4B47A 4AF6A 3B78A 3W2FA 2JA2A 3ND5A 4Q7JB 2D54A 3Q12A 4J75A 1VQ6B 5K0SA 1GTSA 4H3SA 1WZ2A 1MJHA 1D2EA 3ZZ0A 3FI0A 5TEVA 4U63A 3CW2A 2OK8A 5KWVA 1QRUA 1Q7YD 4J76A 1FFYA 2VTBB 1R6UA 4RCZA 2VNIA 3ZBTA 1X6VA 3WNDA 1IQRA 3A2KA 1JB9A 1IFXA 1JIJA 2DUMA 1ZM4A 1I6MA 4HE6A 2Z3VA 1QH0A 3DPIA 1B2RA 1TLLA 2YWFA 3COZA 4G5YA 5H7XA 1KC8D 1OWMA 1GAWA 3I56B 1EFCA 2RD2A 4Y7CA 1OBHA 2QJOA 3W2GA 3AIIA 2QMUA 1JECA 3U6BA 2QTMA 4RUKA 4U7JA 5H16A 4N3NA 2X0KA 1KP3A 3KFLA 4ZCPA 4QFMA 1V8FA 4MVXA 1I6LA 4MUJA 1G8FA 3IUBA 3QFTA 4EGAA 4AF7A 2ZP1A 3F3MA 4NX2A 1S72B 2OTJB 1WOYA 2CYBA 3TQIA 1EFVB 4ZT5A 4CDNA 1UMKA 3K32A 1CNEA 4ZCRA 1EUQA 5J59A 2D13A 5JBNA 1QFJA 1LW7A 1YJ9B 1LI7A 3UMVA 3CXCB 1ZH0A 4TMXA 4B44A 3FHJA 1VQOB 2QJTA 2A1UA 4Q16A 5DASA 1KQOA 2GOYA 3SZGA 4K1XA 4UZFA 1BQEA 1YI2B 3HL4A 3CMEB 3CLTD 1IVSA 1JEDA 2QEXB 4AQ7A 2YXNA 1VQ5B 1B23P 1QU3A 3ZJVA 2BGIA 2PLFA 1N2IA 3MXTA 3CLUC 3VO2A 3I55B 4U8HA 3UK2A 3TZEA 3OZUA 1O5TA 1JILA 4U9UA 4ZT6A 3FPKA 2C78A 2G36A 4MW0A 3S3TA 1QRSA 2RC5A 5K0TA 3WXMA 4CDMA 4L2IB 3VMFA 3W2EA 1KR2A 4K0RA 4QREA 3CCRB 3MMPA 1QVGB 1O95D 1UFVA 3PRHA 2E21A 1GAXA 4S1OA 3MHPA 1M90D 3G59A 1ZUNB 5TY0A 1A8HA 2HZ7A 3L92A 1XNHA 5THXA 2VXOA 4PC1A 1CQXA 4ZCTA 1NP7A 3D6UA 2B7CA 1J09A 2WQ7A 1U0BB 3MLBA 1D1NA 2OK7A 1WXGA 3BL5A 3VU8A 4LBWA 3CR8A 1S0UA 3DLAA 4ACBA 3Q10A 1R6XA 2PG3A 4MW5A 1F60A 3KT6A 4RD3A 1IJFA 3WY9A 2CV0A 2R6HA 5AN9A 1KRHA 5F23A 4YHBA 1VQ7B 4ARIA 1GO2A 1QFZA 1KP2A 3NV7A 4XFDA 3KT0A 1W35A 5FA6A 4KR6A 1HYBA 3CA8A 2O8VA 3A05A 4R0NA 1T9GS 4NZPA 2VYQA 1N2HA 1KH1A 3MUEA 5FO0A 5IJXA 4ND7A 1OD6A 2CNDA 4YBRA 2GPJA 3W2IA 4HJRA 4JYZA 1TVCA 3UY4A 2RC6A 1E64A 1CT9A 1Y42X 3C8ZA 3L93A 4KKVA 1JMVA 1IJEA 2X1LA 4DDMA 2DXIA 1QRTA 1J1ZA 3GLVA 3MMXA 1WXHA 3CLUD 3ZZUA 1KK3A 4ZCIA 4FWTA 3D6VA 4JZYA 3SP1A 4LBYA 3QFRA 2A84A 1GR1A 3CB4A 1U7DA 1F9AA 2VNJA 2WB2A 2OV4A 4I6EA 3RHSA 2A7XA 2XRZA 1W34A 5IHXA 4C43A 3G71B 3ZZTA 3ZC3A 3RBAA
chains in the Genus database with same CATH superfamily
3NRJA 1U9ZA 2WTEA 4IGAA 1H3EA 4LWQA 1X94A 4IXNA 5CA1B 4WKOA 4GECA 1CVLA 2OVFA 1HD3A 2OV1A 1B00A 3ABSB 5CKEA 1T5IA 3GT7A 1L4FA 2W2VA 1GTL1 3GLHA 3IXLA 4Q12A 4XUDA 3HCPA 3VKFA 2A36A 4X7BA 4FU6A 1Q0PA 1PS9A 1M5UA 2JJYA 1Q81D 3QELB 2VH5R 1V41E 2P9EA 3CSDA 5IFLA 1KEEA 3LWZA 3TZCA 1GFZA 4Y9SA 2BGWA 1GZ6A 1NPDA 1WU7A 1B7TA 1ZBJA 1D5CA 2J7PA 3A3YA 4G81A 5IH3A 5JDCC 5EAIA 4DWOA 4KREA 3TZLA 1WHJA 1PJRA 1ELOA 3CE9A 3QWFA 4OOXA 2PX8A 5G1PA 4YR9A 1A9RA 3H83A 1I7PA 2HTFA 4RM2A 3B3FA 2G9UA 3HEMA 1CUBA 3M5DA 5K8VA 2Z8YM 1F7UA 4HNUA 1Y5LA 3DV9A 3LMKA 4QXPA 4B5LA 1W2HA 1XAJA 1Z4PX 3GAAA 1LEHA 1EFUA 5GV8A 5LMCA 1UIRA 3SFZA 3UXEA 3WK8A 4O4IF 4CNQA 3U6KA 3ZCRA 3O84A 3VNRA 1CZKA 5HHTA 2QAGC 4ZRDA 1OEBA 1XDUA 3KHKA 2CNNA 3QEMA 5CT5A 3ZZ1A 3G0HA 3H99A 4BWFB 4B6FA 4M8SA 1MIHA 4P3YA 5CITA 2BZ0A 2OV6A 3NJRA 2OZEA 4EJSB 5BY2A 3Q8WA 3RFVA 1VQLA 5CDHA 3VYHB 2PD6A 5FYDA 2CF4A 1Y6GA 2IYLD 3CIFA 5EKXA 3QXJA 3EG2A 2JFVA 2HBQA 3SHVA 4F6CA 2XNDA 3TECE 5E3HA 2WTNA 4X85A 4XOUA 4RFLA 5A71A 3TNFA 2H4XA 3A1PA 1JIIA 1YIDA 1Z4KA 2AK3A 2M1ZA 3KOMA 1XLVA 4BAZA 4RJKA 4POOA 2H3EB 5AI0A 1VQNQ 5KTPA 1VHJA 4E46A 2IS1A 4A91A 5BUZA 3AEKB 1DDOA 2ECQA 1XZ8A 3WDKA 3IKTA 4AG5A 1ABFA 1BH2A 3RVNA 1FUKA 1BS9A 1GA4A 3LXXA 3TSCA 2IXAA 4TXLA 3FMFA 2VTBA 2QP9X 5DKFA 5JXJA 3PTLA 3JX9A 1F0KA 3ADBA 1L6IA 4TGLA 4N5MA 2FPWA 4DUPA 2RCYA 5GV7A 1K08A 3FTPA 4NYIR 4MTCA 4Z86A 1QUFA 4PPNA 2E10A 4HHEA 3OEYA 2EJVA 3ZIDA 4IH9A 1QYDA 4WBNA 2IT1A 1Z4JA 2Q4BA 2JB9A 3EB9A 1PYGA 4WKBA 4KVAA 4UARA 5M9OA 4GI7A 4O2AA 3H5RA 1DBPA 1JE1A 2G08A 2JFOA 3ZCTA 4BCBA 1JIUA 1KYVA 2PO7A 5E4JA 2XMCA 2E64A 3EFRA 1BX0A 2G67A 4EY7A 5EA2A 2X9HA 2Y8EA 5EN4A 3QOXA 1KO4A 1VC2A 2D7CA 5TT0A 1OAOA 4NPCA 4DQLA 1TQ8A 2OL4A 2P90A 1IQ0A 3H5TA 1JPUA 3I01A 1P2SA 3QM1A 4GLFA 4ITVA 4TROA 1SBNE 4YV1A 5K1ZA 2Z08A 5FOWA 1NU6A 5SZKB 1I36A 4DLKA 2KM1A 3T15A 5AVSA 1QZXA 2DBQA 4UU7A 4M7DB 3BHMA 2I4TA 3CCEB 2QEXT 2XB8A 4MQEB 1V5GA 3LUHA 5K0GA 1PZHA 1EDDA 2XDBA 5CFMA 5I7EA 4ZN1A 2OTLA 2VUTA 1E1LA 3R6KA 4K9QA 2IP1A 2Z1NA 3QYHB 3L02A 4QYTA 3ABZA 1PK9A 4HJXA 5EIBD 3AUFA 3CMCO 4YASA 2GTJA 4KO8A 1PE0A 1A8IA 2ZTGA 3TBHA 1QFMA 2P75A 3K8OE 1JDJA 2BEUA 4G8DA 3S8MA 2O4XA 2QGFB 3C98A 4EY8A 1GL6A 2BELA 3IP9A 4X7PA 2CSIA 4CNBA 3H5AA 1LTKA 4D3XA 4JXKA 3K9HA 4JB0A 2BUAA 4X9XA 1POXA 3WI7A 4AY4A 3AILA 3EMVA 3THWB 1I1NA 2EKPA 3DQQA 3Q5GA 4D9FA 4Q66C 2GGRA 3VSEA 1XQ6A 1XHLA 1QV6A 2DKNA 2FSSA 3ZUGA 3S55A 3GA5A 4KR0A 2RH2A 4O4JF 2GN6A 5HOQA 4LF8B 1XL0A 1QIGA 4NBVA 4GIBA 4KH0B 2WACA 2VP6A 2ZSHA 2CNWD 2LRHA 1QAQA 4N0MA 3A1CA 4I36A 3LH0A 1X3SA 3RWMB 5JQGF 1O8CA 1P4AA 1I9GA 1HY3A 4LF4B 5ELXA 3URGA 2ZCFB 3M0QA 1SHJA 1JSLA 1UOQA 2WSSA 3JAKA 5L46A 4OATA 1V5VA 1ZIPA 2QW8A 1Y5RA 3OPNA 3QBJA 4WDQA 4HGPA 2FLVA 2QTNA 3W3ZB 3WXBA 3SEFA 1RSZA 5B57C 2G3YA 4RJTA 5JI2E 1W73A 3HYNA 1VM6A 5JH7B 3GRFA 1N4DA 4OM8A 1TAGA 3QHAA 5K05A 4LF9B 1FPQA 2CD9A 3ROGA 5B64A 4XYEA 1OXSC 2X0IA 3LA8A 1YJ9Q 3GIRA 1EX6A 3VAZA 5C7OO 4DNPA 1R0KA 1PT7A 1I0CA 1VQ4Q 1M1XB 1WTAA 1YOVA 1VKHA 4TWJA 2NU6B 1R15A 3WE7A 2IPOB 2F8TA 4C88A 4ND2A 1WSDA 4RTNA 3I6YA 3VNUA 4Y1RA 5SZIA 3THWA 4Y6SA 3BWYA 4BUZA 4DNRB 1L7DA 1G3SA 1I07A 1QQ6A 2G6BA 3FUTA 4Q9LA 3E1KA 3FNRA 1N27A 2W4QA 5HW0A 3CMAB 1LLDA 2IF2A 2QP3A 4BV9A 1WXQA 1E92A 1ECJA 1SHLA 1TUDA 4IVNA 5TPWA 3RH0A 1JWLA 3C6YA 2H18A 3LAWA 4IIJA 1R0WA 4LHWA 3ZU3A 3NBYC 3E70C 5F98A 3R23A 1I7DA 1EXWA 3ASTA 3HU5A 1Z39A 4XPZA 3BE4A 4H6PA 4V39A 2G8NA 2W8BA 2WAOA 1KIFA 5JCOC 1OX9A 2B1GA 2BMEA 2IL1A 1C3JA 2CZGA 1TUGB 4HLQB 4MIKA 2AMLA 2GYUA 3RMQA 2FPXA 3DGEC 3INGA 5FWBA 1NE7A 1NF8A 3LY9A 1D4OA 2DE0X 3CMET 2VXCA 1ZEMA 3DE5X 3H2GA 4FQ8A 4H59A 5IVHA 1R16A 3CMMA 5DGHA 3U3KA 3ZI4A 4HDNB 2QN8A 3KD2A 4AUEA 1QRRA 2BUBA 4PYJA 1ZUUA 1N5LA 2BC9A 3VR6H 4OL0A 5K4AA 5LU8A 5M2QA 3EGXB 3G7UA 4YWJA 3KPUA 1R0BG 3FWPA 1Q1BA 1XQ1A 2CUKA 2ZI6A 3JQ9A 1C6VX 4Q9KA 1X87A 4D98A 3OCCA 2PX0A 3AR6A 1Y63A 3OWXA 4N12A 4WGFA 3VOBA 1ML3A 2IIBA 3GIDA 4ER0A 3PUZA 1GVHA 1WUYA 2HFKA 3IOYA 4UVDA 5DM2A 2CLFB 3ZCUA 2JIZD 1Q81R 2ADMA 5HS6A 1OBFO 4U2EA 5FNVF 1ZNYA 3MP8A 2REXB 5B3JA 3MW8A 2GD1O 4PYMA 3B1ZA 4O2LA 2GK4A 3C1AA 2A9FA 2EGUA 3OQVA 3P8DA 1VG8A 5EWMB 1IATA 1N07A 3WYGA 3CC7Q 1KO5A 3OPOA 1AKEA 3ASSA 2A5DA 1LBSA 2B92A 4QOIA 1LH0A 1LUAA 3ABQB 4X34A 1PTJA 3LDAA 4UULA 3MTGA 4ZEXA 4F7WA 1KSWA 1U7XA 4C8QF 1M1FA 3AF1A 4CL3A 1N7GA 3I1FA 2ODNA 4Z8XA 5I8PA 4YCDA 2MIIA 3AT1B 3CEYA 3CESA 1KFCB 4HCZA 3JSXA 4KXYA 4PZUA 3K15A 4ZP1A 3RE1A 4FYVA 3U4AA 2MSKA 4M76B 5LYYA 3ZWDA 3V9AA 3ZXXA 3RC2A 5J3JA 2GZDA 3CRVA 4OA5A 1OGIA 4YGYA 4LHZA 1NR1A 1COZA 2AWOA 2QX7A 1F2TA 2NXEA 1FX0A 3KR2A 3VUFA 1INLA 5LJ5g 1WXIA 4EZEA 3SC6A 1BD4A 3PS9A 4KPUA 1Y9ZA 2GRAA 3OLWA 3SIPA 1QP0A 4DSNA 2QYSA 4BDTA 3GFSA 4I5GA 4ZZ2A 1RAHB 3TSWA 1DBRA 1SG9A 1YBVA 2DKFA 1JHXA 2WIJA 2XI4A 3HU1A 5AI4A 3SJ7A 4ZVSA 3VDNB 4DNQA 4ZQGA 1SRQA 2PMEA 4B4WA 4YXFA 4ZKDA 3IH5A 1O89A 4B75A 4KR7A 1H5UA 1QRDA 3A10A 1BZYA 4CC2A 5LD2B 4DB2A 3EXIA 1UZUA 5K45A 1AVZC 2ZJOA 5G4LA 1VSVA 2YDXA 1A0NB 4X61A 3SS8A 1GUDA 1N5OX 5DLQE 5CD9A 2ZUUA 2BEVA 4LGVA 4UFOA 5IAKA 1G2PA 3JQGB 3TOSA 1Q7GA 3D4NA 4LMRA 4ESEA 4K9OA 1M72A 3T9EA 2DVJA 5FPSA 2B8AA 3SIXA 3UMGA 3W5CA 2HBPA 2AG6A 1ZHHA 5DNYB 1TCVA 1N77A 1RADB 3KCQA 2W9XA 5L51A 4UEOA 3EQ2A 2H57A 3Q38A 2CXQA 2GF9A 3KQHA 3LUKA 1XJ5A 5JAIA 2DPMA 4MLZA 3LHIA 1SVMA 3A6DA 1XDSA 1AUQA 2A9QA 2Y0BA 2PXXA 4RACA 3TE7A 1RWOA 4NZ9A 1W2GA 3BE6A 4B4UA 2CP7A 5BQFA 1F12A 4LPSA 1J97A 3NNNA 4B09A 3A3BA 2OCYC 3CNQS 3L5OA 1YUNA 4LZJA 4OB8A 2EQKA 3HBAA 1IZ0A 3AJAA 4Q5IA 3RRJA 3GJTA 3FXAA 2PX5A 5IC6A 3BE3A 1C9NA 1FOEB 1LLQA 1Q3TA 4EJMA 3FPHA 4BNYA 3HKDB 3MINB 4YAEA 2UDPA 1W8IA 1GTZA 2GESA 1J56A 2EWMA 5AICA 4LXUA 1SVIA 1SZCA 1GRVA 1TUBB 1A2QA 1WZIA 1EP3B 2FZWA 3A14A 3IMFA 3LX5A 2QM8A 2EP7A 2MOKA 2VO1A 4FHFA 2NZUG 1CVIA 1ONOA 4N76A 3JAWB 3BCSA 5AM4A 1XO1A 3B3GA 2ONCA 4QXOA 2GDZA 2IKQA 3FYDA 4IIJF 4DA0A 2YJGA 4IJVA 3D3NA 5I45A 4M7DA 3HSBA 2QNBA 4QWMA 1RI0A 4KGZB 1PLLA 3E3LA 3KYDB 3W2TA 2VNKA 3CVVA 1KYQA 1UINA 1TPZA 5LYJB 3N7TA 5IDVA 2FF5A 4CV2A 1M2OB 2XHZA 2ST1A 4RKUE 4G63A 4B74A 3LPAA 4ETWA 1Y3BE 4LZZA 4RMNA 3HBLA 1UE9A 5FUBA 1NT2A 1NW9B 2GA9A 1YE5A 3EY4A 5HCNA 3WP1B 4FB5A 2I76A 1JB9A 4NOMA 2HRBA 1P9OA 4PZPA 1G8SA 2ODAA 5IPFA 1VGVA 3LQYA 3VXKA 2JGNA 3G89A 3QUBA 2JBAA 4BJ3A 4OHWA 1I4EB 4Q0MA 2GZ1A 5EE3A 3G71Q 2P4RA 2A0WA 5JEDA 3P9YA 1TIKA 4QSMA 1GAWA 1YZHA 2NADA 4J4TA 4ND5A 3K5WA 5TX7A 2V31A 3RDPA 1H0RA 2ZRNA 3QEBZ 2X7HA 1OV4A 4HB2A 3LGLA 4ZDIA 4A26A 4KIFA 1KP3A 2OM2A 4F6RA 3MP6A 4P12A 1HK7A 1OVGA 4H7IA 4LMAA 4YX9A 3NTXA 5KHLB 4ZU3A 1HEUA 3FROA 1QXSA 4BCDA 3TOVA 2ZP1A 1WOYA 1IMJA 4S04A 4NV1A 1Q1QA 4J1TC 5KNDH 1T9ZA 3KSAC 4WWVA 1K88A 4RF4A 1NLYA 1ZH0A 4LXGA 5DLPA 2X4YA 5SYAA 2IYAA 4BGVA 5TMEA 3Q3CA 4ZTUB 5DASA 1QVGA 3BFVA 3NHFA 1HG1A 1RRFA 1WY7A 4JGBA 4JLSA 2RHZA 2PKQP 4A4HA 2D8HA 3VR6A 2TYSB 1OXTA 1YR3A 1GU1A 3QWXX 1WU8A 3AHGA 3QLVA 3DCYA 1T1SA 3PUJA 7AT1B 2GJSA 4BVGA 3QIVA 3CTMA 1O5TA 4HMOA 4Y1GA 3SVTA 5DYIA 3O75A 5BR7A 1U9CA 3TREA 4QDJA 3H3XA 1Z8NA 2C8JA 1P80A 3GXBA 2X1HA 5K0TA 3PGLA 3D2CA 3L43A 1XMJA 3W2EA 1I1JA 1KR2A 1TDJA 2PUWA 4WA7A 3BB1A 4JJZA 3AOEC 3MHPA 1T4BA 4S1OA 4WZAA 2CFRA 3D6AA 4Q7LA 3A58B 4JBWA 1W70A 2B20A 4AFSC 3MWFA 3PX3A 4UW9A 2J3MA 4ZARA 3RCBA 5JLJA 4KBMB 4C8QE 1T5SA 4N82A 2VF2A 2CT3A 2HEQA 3A98A 2B8EA 2PZFA 4WFJA 2DTOA 1YJNQ 3VU8A 2XMSA 3UA7A 5TQ2A 1UP4A 3AF5A 3CR3C 3NHBA 5K2OA 5LD2C 1DCTA 5LUAA 1K6EA 2BCEA 3AR9A 2K2QB 1I13A 4K3UA 3LKBA 4J0FA 1TT5A 5D5HA 5HRUA 3TR5A 4D80A 1HLFA 1R12A 3I45A 1PWHA 3SJUA 5AUOB 1RI9A 2PZ1A 2ZXFA 1VJCA 4KSBA 3X1ZA 5M29A 4ZVRA 1CY6A 1UBNA 3PFIA 4EF4A 4M0DA 3GQBA 2IFTA 4BMVA 2PKCA 3JD2A 2K6DA 1NYGA 1S4QA 4MKHA 3WJ7A 3QFFA 2GEBA 1JG6A 1KKMA 3AKDA 1QZUA 3NI2A 3ITDA 4R8MA 2CE7A 4BLQA 1UMDA 2HV9A 1H0HA 4ZMBA 1JEYB 4E03A 5IJXA 1P4MA 4Y9TA 2VSYA 1WXXA 1F2UA 4UTVA 4ZN6A 3TRKA 1L7AA 4HQNA 1N0IA 3C8ZA 4JROA 3LQ2A 1G8XA 2H1VA 2JGMA 1J0BA 1JMVA 2LDXA 3DKKA 3DOEA 1S72Q 1N8RC 1EFLA 1QKJA 1R37A 2X1LA 4RPDA 3GFOA 3HDHA 2F6RA 2XCLA 1AOXA 2O14A 4JQYA 4ZOLA 4LTNA 4CVNA 3QWHA 4L5AA 1C9YA 1VJ0A 3FFWA 4HWKA 3AU8A 2OI3A 1KIKA 1QVAA 4I6EA 5C5IA 1BFDA 3BHIA 5HNKA 1HK9A 1RKXA 4LRUA 5DYNA 2V8BA 4J6YA 5EMMA 1UB4A 5FI3A 3I56Q 5FTWA 3RJTA 4CLOA 1LV8A 3HXLA 1CR2A 2X9QA 1K8QA 3REAB 1YSCA 3K6JA 3EA0A 3DF9A 4A63B 1E58A 4JXJA 2MU1A 2P2YA 1T0PA 3KWJA 2AG1A 2VUUA 3TGPA 3CR7A 4J43A 3OU6A 3ZGOA 1NT4A 1BFKA 3CCJA 1IHDA 1JQBA 1R0CA 4GKAA 1RXYA 3A6JA 3PFKA 5FLKA 2WZQA 4WLOA 5C0OE 4I50A 1BVRA 2LIVA 3SQOA 4LQCA 2JA1A 4MUMA 1YZVA 3VS6A 3MJDA 2XE6A 4YQFA 3DFMA 2HPVA 3HA3A 1XI2A 4PCLA 4AB1A 2ZZMA 4X7RA 5B1DA 4BQPA 2L3PA 1KDTA 5KINB 1CZOA 3SKBA 4QPDA 2EKBA 2V74B 3QG5A 3MSXA 4YRAA 4OO3A 2RHBA 1VI2A 1JFLA 3OG9A 2INGX 4WW0A 1N6NA 1GEGA 2I1WA 3ZW8A 2ZM6B 3VMMA 1BGWA 4F9TA 2VP0A 2F43A 1YJNB 1VE9A 2Q8QA 2BONA 1YR6A 4ALMA 4F21A 1BCSB 4ILKA 1OI4A 3KX2A 3VV2A 4PTYA 4INOA 3SXUB 1RWBA 2QGFA 2Y4OA 3FHOA 2XUQA 5AK4A 4AYTA 4OQXA 4X90A 3UMCA 4DIBA 5F9FA 3I9V6 3PDCA 4EFNA 3HKSA 1OFHA 2X5OA 3BIWA 2C0QA 3IIIA 3CG4A 3AXTA 2G9QA 2YYAA 3MNFA 2WM3A 3MTEA 3CCST 1XMSA 2EKLA 2GB4A 2IVZA 1HDOA 2Z4RA 3K0EA 4RK6A 5F73A 3UVEA 2A0FA 2E87A 4QTTB 1WPGA 2B4QA 1SVKA 4LHSA 4G5XA 3A7EA 3KB2A 3C5EA 3RBVA 5AOAA 4P34A 3FAKA 2IOFK 3SEQA 5A2QE 1RBZA 1I3CA 1O97C 4CKEA 1QLJA 1NR5A 3AUAA 3DMRA 2OZLA 4IS3A 1AKWA 4N3CA 2Z0WA 3F97A 4PPYA 4UEJA 3HJCA 4PU0A 2BOVA 1UD8A 3B2QA 2Y2VA 2MK5A 4YYZA 2G0TA 5KOHA 2F2VA 1PUJA 5HGXA 1FNMA 1EFPB 3MO8A 3IQFA 3KE9A 2EFIA 4HB0A 2GZRA 1OX5A 1OH8A 1IY9A 2FEXA 1B8VA 5KHAA 2DFUA 1R2QA 2Q1UA 1EXVA 3VPAA 5IK2D 3DBHB 3THRA 4HXYA 3S2ZA 3JQEA 3ROEA 4QUEA 2J6KA 3GQBB 4JL6A 1OC2A 3LUDA 4IRUB 1K5GA 3CKLA 1I4LD 2FV8A 3C14C 3CUWA 2GREA 1M0SA 4IYJA 1UP7A 3P2IA 4L07A 4X1KA 2PDAA 3G1WA 2L8DA 1DIBA 4MK4A 2JJ1D 2ZYTX 1RRPA 4Q4DA 5JVDF 2KROA 3RUXA 1PSDA 4PYQA 1Y9JA 1H2XA 1P19A 3BWMA 4HGNA 5B1EA 1XYVA 1E9FA 2EFJA 2R6CA 4H4DA 5ITZB 4G84A 2XQJA 3QYJA 1R5NA 5FPKA 2I7VA 2CLEB 4JJEA 1WLPB 4D8DA 4Q5WA 2J5BA 2JFWA 2WJ4A 2ZYSA 3IKVA 2QLBA 1N6AA 3FZGA 4LJLA 3V42A 4BNKA 5KTSA 4Z4VA 1E1YA 3F74A 3QI7A 2UZ3A 2ZYGA 1GRRA 4J16A 3TPZA 4AWXA 4EPXA 3A4NA 3I01M 2P41A 3UNXA 1WHGA 2KB0A 3GARA 2C4WA 1Q7YR 1I8DA 4QOGA 1DIOB 3QG1A 3OYYA 5E95A 3S2UA 4M1OA 1Z4IA 2RN8A 4GEGA 2WM2A 4JGGA 1G6KA 2O48X 2DK3A 4L8LA 4LCEA 3UHAA 3D4OA 2FW1A 3DJYA 1CJCA 3LPCA 3JRWA 4MUIA 2WPDA 3T3GA 4XXHA 1N0UA 1WOOA 3T9AA 1YJBA 1TB4A 4JDPA 3TQQA 2CHQA 3QYFA 1O96B 1T3LA 2EZ4A 3OYAA 2GARA 2L3SA 2IYPA 3RIXA 4BO9A 2NNWB 5JZBA 2HZBA 1GGJA 1B0UA 1NV9A 1SQ0A 3DNMA 3KQMA 3P2YA 3CCET 1N78A 1Y3FE 4P08A 2DL8A 3ITNA 1SBHA 3QA3E 3MT0A 1OH5A 4BLVA 1ZUIA 3O03A 1XD9A 4AMUA 3IVGA 4IKPA 3IFSA 2XUJA 4EI9A 3LQFA 4WJZA 1GZDA 5B7GA 3CH4B 2FMTA 4B7UA 1SAYA 2AZMA 2BJHA 2J32A 4OXQA 4M7DC 4DG5A 5ES4B 1JGTA 4I1OA 1B8OA 3HV0A 1YS4A 2QVCA 2VJYA 1B41A 1UH5A 3AKYA 5A3SA 4BS9A 4G0MA 3EJ6A 5H82A 1B0ZA 2DFDA 1NP6A 2PH7A 4HWOA 4UAUA 4F9EA 1SUEA 2HDWA 5BSFA 1V47A 4NOYA 3LYLA 3PEFA 3BORA 2K5IA 1E5LA 3L0IB 4P8RA 1DRVA 3O8RA 4Q18A 2W6PA 4RC9A 2UYQA 1DPFA 2VDKB 4AI6A 1F4LA 3RKWA 5LJ5h 4XONA 1RFGE 1U0JA 1KC8R 4RE5A 4UUMA 1O0CA 3I0NA 2NVWA 4P6VF 1DAKA 4Q00A 4PZ0A 4TTAA 2G04A 1JI0A 4PXAA 4W6QA 2PUFA 3DC7A 3K30A 1G21A 5GAMf 3C3XA 3DOIA 3QJYA 3L82B 3Q0IA 4G0QA 1ISJA 4U7PB 2Z58A 5K03A 2O8BB 2OHIA 4KJXA 4GY5A 2CKDA 3HKCA 3BMNA 3GRZA 1AURA 3PE4A 4OREX 2YV1A 4DHWA 1EWYA 1YF3A 3IJPA 2E55A 4EI8A 3FYHA 4LQLA 1OCEA 2E89A 4XIIA 4GAEA 4ER5A 4ZOEA 3TKYA 2EKDA 4LEIA 3ZQUA 1RHUA 4IEFB 4L51A 4Q3CA 3CCEQ 3OYBA 2YRXA 2MCFA 2PH3A 4KH0A 3RG2A 3HKEB 1AQIA 4MRMA 1Z4NA 4X3OA 1F8FA 4CM8B 1OLXA 3T51B 4V1CI 1XK7A 1AQLA 4LDRA 3W8DA 1L6RA 3O0TA 1G7TA 1CB7A 1XN4A 3D8RA 4LRTB 5ESWA 5SY6A 2Q2QA 5FXMA 3UENA 3MWEA 2Y67A 3UH1A 3QX3A 2BGTA 3EDYA 5DH9A 4IVPA 4L4ZA 3THXA 5JC1A 1NPRA 1EDOA 3OOWA 1A1SA 5EI5A 3U80A 3OY2A 1QGAA 2PJZA 4QGBA 4BX9A 2HF7A 2RJNA 4WFIA 3MA0A 5CA1A 1VQ7T 1OGJA 4QV2A 4EYGA 2CWWA 3D81A 2FDRA 5AM3A 2X6WA 5JI3E 5IVKA 3UA6A 1QORA 2J3IA 3U39A 5I7RA 3RK4A 1C7ZA 4DMHA 3Q6QA 1JHDA 4G5HA 3OP1A 2DD5A 5JPCA 3WAKA 1DIRA 3BWDD 4BE2A 1LOJA 2O5CA 3MTDA 5LYJA 4P9SA 1U8FO 1PFUA 3PC6A 4C0BA 2EX4A 3BW1A 3T1TA 2C59A 3OIFA 4U0JA 5CFRA 1SZJG 1KR5A 5D7NA 4P4TA 4P25A 3FN4A 3JCMJ 2C94A 5AKYA 3EX7C 4AZTA 2GD6A 3SXUA 2AZXA 2R00C 1IPFA 2BP7B 2VEOA 2LPMA 2RGAA 3K2IA 1OGYA 3OECA 4R6WA 2OUIA 3VDQA 5I47A 1QRUA 2GFIA 2OFXA 2E6ZA 3ANMA 2GTHA 3G5AA 4XGRA 1T3GA 3TX2A 2IUFA 3INRA 2HZYA 1Q1ZA 3WWEA 1OU4A 3HWSA 1IGQA 4B32A 4LDWA 1IEQA 1UXKA 4TT8A 1A9XA 1KO7A 1DP4A 3ONFA 1Z5PA 5TIIA 3RDVA 4X0EA 1CDEA 5FBWB 4M89A 4QVIA 1DADA 2EL7A 2D2FA 4KKXB 4Q1FA 3WOHA 3I2IA 4R2LA 3QYGB 4BKRA 2VJIA 2I3GA 3IMGA 1VPWA 1KMIY 1ORTA 2CXPA 3KYCB 3ZPNA 4RZSA 5CHYA 3NH9A 1NHGA 3RVDA 3ZDFA 4RTRA 1ISHA 3SF8A 3TL3A 3ZVRA 2H2IA 2JLBA 5DNCA 3RYTC 2H1OA 1NR7A 5IN5A 2VC8A 4KVFA 3A9SA 4BO0A 4DYVA 4YMWA 3WVEB 5GADl 3AKCA 2R6AA 2XUDA 3JAWA 4KPGA 3BKWA 4QHTA 4QO7A 4TLLB 3ZLTA 4AJPA 1L7NA 3T1YB 4QODA 5I7VA 2NTVA 3C8UA 3I0ZA 1B3BA 2QQFA 3QXHA 3UJNA 3CPFA 2IYVA 4L7VA 1WBDA 1J2RA 1GNQA 2HL3A 1M8GA 3L5KA 3CFYA 3RLFA 3P5BA 4FIBA 3P9CA 3O74A 4CTMA 4XE5A 5D01A 3WYCA 1J0DA 1AQYA 1YI0A 4H2DA 4S0ZA 3AOGA 1DBVO 3HFNA 3EHQA 1ISGA 3OYGA 2F1HA 2WIAA 4A0QA 1CRPA 4TSFA 3QFCA 1BC5A 1PRMC 1MV8A 1UADA 1XZPA 4YLYA 3FHCB 1ND6A 5JD6A 3G1JA 3O8VA 4B4VA 2YH2A 1G8GA 5EQJB 2PQ0A 4MUXA 4K1LA 1YJWB 1QO7A 4Z88A 5BWBA 4N4IA 1XAGA 2HQSA 2LCCA 4BE0A 4GOKA 1PW5A 2IXGA 1T6XA 4WCVA 2PS9A 5AI8A 3VPDA 4RJJA 5JMPA 3RTBA 1HGXA 1MQAA 4V24A 4BVHA 1A98A 1JWBB 2Y0CA 3OCYA 4GE3A 2BEJA 3L4BA 3OJEA 3DVLA 5THQA 3ZWNA 4DMKA 1PVDA 2BBTA 1CUUA 2CDNA 1H9CA 3E3NA 2FPUA 2JFPA 4IXTA 3VJKA 5LMNB 1K27A 3PNBA 4EKIA 5KWJA 1IOZA 3ZFJA 2EZ9A 1ZD4A 1GOTA 5GPBA 3WADA 1GPH1 1R4MA 3UCEA 4F6RB 2W10A 1XZCA 2WT8A 2F3SA 3SFMA 4BNGA 2H1RA 1Y3IA 2D9TA 3WZLA 2EJFA 3ZZNA 1U0GA 1HETA 2AX4A 4JAVC 4B46A 1ZZGA 1HYQA 4AS2A 3ZI7A 3VSBA 4JXXA 1S6YA 1ZVVA 4KQMA 4U7DA 1KERA 1GU0A 1NVDA 3F1KA 5H59A 3REGA 4FYWB 1E1CB 2I2FA 4CMCA 5CAIA 4BVKA 1TMGE 4FFOA 1XMIA 2P79A 3BQJA 5LM3A 2PEZA 1FZTA 1IHPA 2X6YA 2VHTA 5AVYA 5CPFA 2C5GA 4OQEA 2F3UA 4Z51A 4G6IA 1QBGA 2H8KA 4FGWA 2J5QA 3D4LA 3DUWA 4FMDB 4HNVA 3I4LA 3AK4A 3ENVA 4M7WA 3DXYA 1L5HB 2CLDX 2X23A 4QDOA 1U2RA 4UATA 4EW2A 2QBYB 5GAMe 4PNPA 1HUQA 4NCBA 4JKOA 5GANe 5KKCA 4CMEA 4Q7QA 4DANA 4MIEA 4MZXA 2Z5LA 2AI1A 4GYWA 1GFWA 4D6YA 4KC0A 3NM5A 4J0QA 3MXOA 1LJUA 2OP0A 2WE8A 4HPXB 3ZDEA 4ZZIA 2XT0A 5BNIA 4CLRA 3W6OA 3ZJTA 4RAOA 3LBHA 2RQVA 4TL8A 4ZQEA 1V7PC 1VOTA 3SPXA 4O4HF 1MAVA 4COOA 3B13B 1K7CA 5H8WA 1FFCA 3DKMA 1HE3A 1ZVMA 2XK0A 1ZK4A 3N2GA 4KQ2A 1ZCAA 4D0RA 1Z6XA 1O96A 3MYYA 1WEHA 4YT5A 3ZE9A 2RHGB 3LPNA 1C2TA 2QTHA 3QENA 5HUJA 4G4SO 2DM1A 1O57A 2AC4A 3NG1A 4W9MC 5IKXA 4JQCA 1UR5A 3QXCA 3KJEA 4Q82A 4ATOA 4BFVA 3JVDA 4UUPA 3IHKA 4ED9A 4HAXA 5GAMg 3HR7A 3M6FA 1WI7A 5ECDA 1YOVB 5K3SA 3GIWA 4B7AA 4E88A 4GPEA 3QVLA 1GARA 3JZMA 4M9RA 4TYMA 4BO3A 2YRFA 1NG2A 2X4DA 4GGMX 2QYZA 1SQGA 1G3IA 5L53A 4F91B 2K2MA 1TX4B 1F17A 3A1WA 4OBXA 4FGJA 4MQ4A 4AMYA 4O4JA 3A2KA 1IQRA 5FYQA 3M9QA 3L8GA 4K6MA 2R4UA 5FTKA 4L8WB 4PQGA 3LECA 1I6MA 5C8DA 1KMQA 5DNAA 2FR1A 4E7ZA 4EKEA 2A0UA 2DSTA 2V45A 1RRKA 5DWVA 1MXHA 4E4RA 3N76A 1EFCA 1RFLA 4Y7CA 2EX1A 2JIPA 1VDZA 3QIAA 1FB5A 2C06A 1HT3A 4RO0A 3ZWXA 3WKCA 4UOQA 4EMKA 4JRPA 4N3NA 1GQ2A 1ZD9A 2DQSA 1DAMA 2I2XB 2YRWA 2DHEA 1QTRA 3FFTA 3FRJA 4CU5A 1PX0A 1I81A 3M70A 2PE5A 1PR6A 4OMLA 1I6LA 3B38A 3P0EA 1KC1A 4UVHA 1YC5A 2WAXA 4ARZB 3O4JA 3ONWA 4LE2A 4EGAA 3GLIA 3NCTA 4JUAA 4OFBA 5HDQA 3TUIC 1AGPA 1EFVB 3RF7A 2P6OA 2EBWA 3ND9A 4Z9BA 4F9FA 3X25B 4PVCA 5EXSA 4MQUA 1BD3A 4G56A 4DV2B 4JR0A 1K06A 5A1JA 1XMPA 2QGNA 3WTBA 1FTGA 2QN2A 2JGFA 2JBHA 3HY6A 4MPJA 4RHCA 3MTQA 2I2BA 1CUCA 3D6FA 4KPFC 3TIVA 2GBPA 2JCBA 1B6GA 1V5EA 4L9AA 1JEDA 1BA2A 3JWIA 3IC5A 3LUPA 4W1SA 2XIDA 3E9GA 4WTOB 4BEWA 1MQ8B 3SKXA 2V7GA 2X51A 3JV7A 5PNTA 4HX2A 3B9PA 4G7XA 1PL7A 3G2LA 4RLFA 4L6AA 2Q7DA 3UK2A 2C0CA 3UG6A 3UW1A 1PL8A 1SUFA 1VQ5A 2G36A 4IDAA 2H2HA 1LXCA 3L49A 3ZHCA 4CDMA 4XIYA 1UOPA 2D2IA 5HFAA 3SC2B 3PHHA 3RBXA 4RABA 1G3UA 2FEMA 4U6NA 1YB6A 3M6UA 1DLJA 4PC1A 5HFJA 2O7RA 4F1JA 5TQ0B 4F8EA 4OCZA 4RL6A 3L8CA 5FJJA 2LTAA 2VUSA 3V1YA 3C1OA 1L7RA 3EG9B 2DWCA 4IXDA 1HL7A 3S29A 1U8YA 2VHXA 1WXWA 2E4YA 2YASA 4KLCA 1J39A 5JUWA 1AQJA 1L5KA 2EFCB 5LJ3g 2RHTA 2OORA 1EXNA 4A6XA 3DLAA 1U06A 2R62A 4JLDA 5G2OA 4P26A 2PR2A 3MQ2A 1NYQA 1JL3A 2PG3A 1YKGA 2RJ3A 1XCBA 2O2HA 2JKYA 1ULZA 1FL9A 3IEPA 3X1WA 1ZYUA 4OLJA 5I7WA 1AGRA 2CZCA 3PD7A 2C31A 1X7XB 1GO2A 1D09A 1DEAA 3NV7A 4A7PA 5JAZA 4F17A 5FA6A 4B6OA 1MMAA 3LGSA 2B8NA 4DLWA 5JZSA 2O8VA 2GEFA 1I9CA 3I5MA 2WHXA 1D03A 1SHZA 4BKPA 3JTEA 2B86A 1VLQA 3LWIA 4RK4A 4MQFB 1V0JA 2CHEA 4Z54A 4RTXA 4ZGDB 2X58A 4ND7A 4RGVA 1RJDA 2Y1DA 3DQPA 4W1PA 1I0ZA 5D86A 5LBTA 3W78A 3WK7A 1LPLA 2HWKA 1V8PA 1KY5A 4IIEA 3ONEA 2KE5A 5HFNA 1O58A 5BOVA 3VTKA 2RG1A 5BSGA 1E1KA 3TCJA 2O2GA 3MQ4A 5IJAA 1EFKA 1QP2A 2AF4C 2IHTA 3D64A 2X8KA 4JEIA 1ZA1A 4XFKA 3AEUB 4WZ6A 1ORVA 3UATA 8ATCB 1G55A 1LRLA 1SC4A 2EKQA 2FYTA 4WBNF 2GNOA 1SCJA 4QPZA 2ATCB 4BCCA 1OXVA 3DYBA 3R3JA 4D9HA 5GAMh 2IP4A 5AHKA 1G83A 1W34A 1P4GA 2NPIA 1K7EB 4PXSA 2GJ9A 3DLTA 1G3YA 1YA6A 5CG1A 1K8ZB 3TPFA 2PSHA 2RBGA 3G0CA 3M6XA 4H4CA 4N5IX 4ETNA 2VNHA 2ISSD 2C2MA 1WUJS 4CDGA 4B3HA 3O2JA 4BAGA 4MYUA 2E1BA 1PBTA 2G17A 3A9WA 1DC3A 5EZQA 4F16A 5F4MA 4ZCLA 2AXNA 3PF9A 4PBTA 2ZYAA 3REOA 2ZBUA 1PNRA 1JVNA 2WDZA 2AT1B 4GMHA 1Y0YA 4WXYB 4Z8YA 2D3WA 3UMFA 2VDJA 3BSWA 3PFHA 5ALOA 5I7UA 5C18A 1AWXA 3R1IA 3WBKA 1QVGP 3DD5A 1AMNA 5ERYA 4YUWA 1U5CA 4FE3A 4W7IA 1Z45A 4XLAA 5DBOA 4MR8B 4IHKA 3GA0A 2QSZA 3VZBA 1RWWA 3M82A 4BX8A 5JS2A 3KQQA 1WPXA 2PV0A 3AR5A 2ZXUA 2NO5A 3KZNA 4OXXA 1YJCA 3UTCA 3VOSA 2GVZC 1DRWA 2MYUA 1EE9A 1FUUA 5BP7A 2GFHA 1VTKA 4PGGA 1Q7YC 3FKSD 1FWZA 3NAZA 5CU7A 3CPWB 3GPCA 1NEGA 4L1KA 3TZQA 4Y1EA 1Z6AA 2WFLA 4JLAA 4RSRA 1KBZA 2R96A 4PFKA 5ES3A 3W5SA 3VS7A 2P9ZA 4M7DF 4FXPA 3T5TA 5BN5A 2EFGA 3OUZA 3LY7A 1H3HA 4AZ0A 1Q0UA 4HDAA 4V2SA 1FA9A 4KDCA 4U1RA 3H4VA 2PY6A 2DTDA 2YJNA 4W99A 1XAIA 1SM4A 1AIPA 3HJHA 3QELA 3VC1A 2DOKA 2OCIA 2ZSIA 4HATA 4L5YA 5E6TA 1Z4QA 3VGPA 4OAQA 1HFEL 3RK1A 1HE2A 1X7WB 2XWSA 1V7CA 3PD1A 4HB3A 5ITSA 3A1TA 3ZDBA 5KYXB 5AKLA 1WE2A 2PUJA 1QJCA 1ZSZA 1NJ6A 3GGDA 4ZGEB 3EQ7A 3IIMA 3KKLA 4KGDA 5K8TA 4C2UA 4WEQA 4IJMA 1NXSA 1VIMA 1ZSVA 1NJ1A 2GTIA 3RRZA 5IT5A 2GZ2A 5DM7R 3VUEA 2VBVA 4YRIA 1SZPA 4HN4B 2ASVA 3TO5A 4FMCB 1DCMA 2VUHB 2ZTSA 1J23A 3UDCA 4EG4A 1S3IA 4FX2A 2E41A 4C87A 1V4NA 4MVCA 4B83A 3EFHA 2BM1A 4NHEA 2Q3MA 3CNNA 4GU5A 1E2NA 1K63A 1R6TA 4PSAA 4W5RA 2ED0A 3AQ4A 1N5KA 4MUGA 4NZOA 3UICA 1EE2A 4MV4A 1B6RA 3A8HB 4RHYA 1TW3A 2HPZA 1FRFS 1T36B 2FZ4A 3BS4A 4ICIA 2ZBPA 2BW0A 4I1YA 4WHMA 2I1LA 4B71A 3IX7A 4JLUA 3U7IA 5EJIA 1J1IA 4DUYB 2AFIE 3KRTA 3MPUA 3OQJA 4EPTA 3HL8A 3RU3A 1TYAE 2QXUA 3M8KA 3MELA 3WK5A 4YJGA 5ILGA 4P84A 1JA1A 5JMTA 1NWCA 2LQKA 2M1HA 4MQEA 5CVTA 3GZ4A 4MYRA 3A8JA 4MS3A 2FDCA 5FBRB 4Y2TA 3RU2A 1OE0A 1BPLA 3IS3A 4UDYX 3PA1A 1HV8A 2FPKA 3TQSA 3B8HA 4CM9D 1JB0E 2JGDA 4Z4ZA 3I4FA 1UZAA 4JB2A 3SAJA 4HVLA 4HSGA 5E7JA 1JJ2P 1GPKA 1IZ7A 4UREA 5JDCA 1UEXC 5J2TA 3KZOA 2XLBA 1L3IA 2O3JA 5JAQA 3OA2A 3Q7IA 4U2DA 2O4XB 1HRKA 4WQMA 1SHKA 2OV3A 2X22A 1UDXA 4EELA 3E2PA 3ZE8A 1EBUA 1I8FA 1JJ2B 4HCBA 1GGKA 2XWQA 4KAXA 3W8NA 2FWRA 4R8VA 4OFWA 5B3KA 3GDOA 1Q50A 1MH1A 1P7ZA 1FXUA 3OZBA 1REQA 3ROMA 3JQGA 3S81A 1J1UA 2IKSA 1KQSB 3CD6T 1X92A 3NFRA 4PYNA 1R8OB 1FSPA 1UM9A 1X8KA 1TZJA 3G7ZA 4G5OA 5LQSA 3X2FA 5M04A 4M77C 4B4DA 1FFGA 1KYTA 1TT5B 1OFTA 1U8EA 1WABA 5FL7A 2W43A 2Z3ZA 4ZI5A 5BURA 5KTKA 2A94A 1PD0A 1VI5A 1E62A 3C6BA 2NAFA 2UKDA 3EVEA 2X3WD 4LUDA 3BWBA 2G0AA 3OX3A 1BU8A 2C95A 1L8QA 2RAPA 2P67A 3F96A 3K09C 3SSAA 4AP6A 2WWYA 3AV3A 4FZRA 1A97A 2PK3A 3ELUA 1EA7A 5CIUA 3Q3HA 4N0QA 3TCXB 4YRPA 1RAIB 1CBUA 2XUOA 2I2DA 1J8QA 2IUSA 4CEHA 3PKZA 5CIYA 1UZNA 5K0BA 1Y0BA 1U0NA 4RPGA 1WDWB 2NXWA 1JX6A 2IYQA 3Q3VA 5T4BA 4UQPA 1IVNA 3AHFA 5ICMA 4DMLA 4JLKA 4M1MA 5KVSA 2PUCA 1MO2A 2N0SA 2ATCA 2GNPA 4M0FA 2OCDA 1UECA 1UGRB 4HS4A 2PRJA 3FDIA 2PKQO 3QMMA 1KAMA 1RYBA 2Q5JA 3LNCA 2VK4A 2IYYA 1WHTA 2ZROA 3PWZA 4KLNA 1EZZA 1JXAA 3GLGE 3OS5A 4XU2A 1GA6A 1YCHA 5CH3A 2QTXA 2P2LA 5DSXA 5J5VA 4OLAA 4D8YA 3PJEA 4YRFA 4Q3BA 4XYGA 3MCWA 2GFUA 2C92A 3FJPA 1ZOIA 2EQUA 2XQFA 3F2IA 3Q6NA 3RIMA 1RYMA 3AJEA 1JAHA 3HG7A 4EG1A 1X42A 1DJNA 3HYTA 4MQBA 3GVLA 2CWDA 4Q93A 1MC4A 3OHMA 4ISCA 4K6OA 1QJ4A 1SCIA 3WGLA 2EIHA 2Y99A 1PD1A 1YDFA 1D09B 2XUGA 4K2HA 1TZ2A 5EY5B 1V16A 3BFJA 3CPWP 5F4ZA 2IP2A 5JDIC 4IDBA 3PFBA 2V58A 3A1DA 3KUXA 1PK7A 1OAAA 2BISA 4X62B 1Y98A 2ZQZA 2YV4A 5L95A 1ONPA 3CMEA 4RCVA 3RASA 1PYDA 3AM5A 2CREA 1E61A 3BYZA 3WGKA 5FU7B 4G0YA 1A9OA 3FJ1A 1ZGAA 2CF6A 2PIAA 5DTRA 1U2DA 1VQPA 3A9CA 2DQ4A 4PWZA 1WM1A 4MWDA 2EAYA 1SRLA 1NF2A 1Y81A 2D7JA 3JYNA 1IQPA 2ZB8A 4WVLA 5SYNA 3X44A 1X1QA 1QQBA 2H4YA 2ASEA 1C3OA 1EGQA 2Y0DA 1CIPA 1A77A 3P9NA 1TQ6A 2VH2A 4GBQA 5EINA 2H63A 2JJ1A 2HADA 2SECE 4X00A 3OQMA 4DG9A 3REFA 3D3KA 3P8BB 2CLHB 5GVRA 4D4HA 3THYB 2HNAA 2EW3A 3ZHTA 1MX3A 2R7NA 1KDZA 4ZAGA 4YCCA 1G7CA 1VJSA 5I9BA 1GKYA 4BFZA 1YI1A 1QWFA 2EU8A 2H16A 4RZ3A 4F84A 1M5RA 5T7BA 2H2WA 2FFAA 3C8HA 5ARBA 4YJ2F 4TYYA 2EZ8A 5EJGA 5EMNA 3WP0A 4YRMA 2LZJA 2HA7A 2ZSAA 1EINA 1AK9A 1NMYA 1T25A 1K0UA 1UOOA 2HHCA 2O2DA 1SOMA 1ZNWA 4PSKA 1E4YA 4GPIB 2F2TA 3TAXA 1HZZA 2J9XB 2HYDA 2Z98A 3DTVA 2FPPA 4HZUB 5GIOE 3NAQA 5A5EA 1CV2A 1PSZA 4I19A 1K5DA 3ZNOA 4MVJD 3VBEA 2DXUA 1Z2EA 2XQVA 1UKCA 3K8YA 2KR3A 4YNBA 4EHHA 3BH0A 4JWKA 3ZLBA 1VFPA 2P40A 3O95A 4QUKA 4TT3A 3PPXA 4YJ3F 1DFGA 1KBOA 4JN6B 2P4EA 4LGMA 1RHQA 4QYIB 1MJGA 4LBVA 3WLRA 4V1CB 4JBNA 1K4KA 4V0OA 4FW1A 3CCMB 4DBRA 2PX3A 1QAOA 3G13A 4OX9Y 1JLRA 2WJZB 3UC9A 2JH9A 3KLPX 3NWPA 3RTDA 5F33A 4NS4A 4RFSA 1NASA 1Y0RA 4OA8A 5KYYB 1ZUYA 3O8DA 1Z68A 3JQQA 1M0WA 5DX1A 4FILA 5TQ0A 4TKVB 4WKCA 4YO8A 2RAUA 3UOAB 4ASUA 1JG3A 1M2HA 1RAEA 1T8WA 3NBXX 4PQFA 5AP9A 3STYA 1SOAA 3VU9B 3QE4A 2O1EA 2FPMA 5H1YA 3E4DA 4QFCA 1D2AA 3RR6A 1MABA 4IGIA 3LFUA 3RT1A 4NZMA 4B43A 5AW7A 4CJXA 4Q6BA 4DJEC 5HK0A 2YV5A 1NLOC 2C42A 2IY8A 1R5OA 4GS5A 5FI5A 5TEWA 3V7NA 1TO1E 3VO9A 3N2LA 4YT8A 4X7EA 4Z02A 4B3FX 2EP8A 3GA7A 2B83A 1KK2A 2IXBA 3MS2A 1GNVA 4KO2S 1H8HA 3HA7A 3SWNA 1W1IA 1L3CA 3Q40A 5EFOA 5HQ3B 4M99A 4RNCA 4GWGA 4ZTZB 2YUNA 2DR3A 4KG7A 2PVPA 4A03A 2A57A 2WC1A 1OI1A 3SLRA 4XSGA 1UD5A 2AC7A 3M57A 3CCLQ 2E5KA 2FR8A 3I6BA 3RC1A 2L3RA 5GIPE 5CAEA 1PWZA 3OZCA 1D4ZA 4E2XA 2O8EA 2YT6A 2YIDA 3DVRX 2KE9A 4G1BA 2QUAA 4RW0A 5IN1A 1VZ2A 4HVWA 2HDNB 1KAEA 1MJGM 2BFOA 4CM1A 3UWPA 2XXJA 3V7UA 1SCUB 4XLLA 4EABA 1HT2E 4G07A 4F4DA 2AZ4A 2P9JA 4B6EA 2IU0A 3OZFA 3IJ5A 2VRWA 4QBFA 1D07A 4CMKA 2CLLB 5CB4A 4BP1A 1ZP6A 4UD2A 5GAOm 1G2OA 4OOSA 1YCSB 1E3XA 1Q1AA 4GLKA 1S2LA 2EVWX 2PZJA 3FVQA 4P4UA 2DOGA 5JZMA 2V26A 2CXUA 1KBQA 4RWEA 5F1YA 3VHLB 4JI8B 3LHSA 4DSUA 2Y1CA 4ENRA 4H3HB 4QECA 3QU7A 2WJVA 1SKUA 3JPWA 2ZWMA 1LWOA 2NU8B 1DS6A 3OX4A 1UDRA 1Z0JA 2MI6A 1Y1QA 2QJFA 3JS5A 1XTSA 1Z33A 3KJIA 3L7OA 3I09A 3N2ZB 1GPJA 4B6SA 2CFSA 3G6EB 1M1UA 1X7ZA 2QNRA 1MN6A 2W6ID 2QUBA 2VGNA 3PUXA 4KQEA 5GAOn 2YS6A 2VPXA 2ZUCA 2BDEA 3N8IA 4DB4A 1SK9A 1O97D 2VZ9A 4KKUA 5G1NA 1RRVA 3K2EA 2Y77A 3MFQA 4HRXA 1T9CA 1GPAA 1Z5UA 4U9HS 3RS8A 5AW6A 1ACJA 2GEKA 3CZ5A 3TWOA 3WMEA 2E3IA 2CEAA 5BYAA 1CEQA 4AX8A 2WHRA 2X0EA 4EUKA 1R4AA 2O5VA 4QC2A 2FCAA 5F5LA 4J0HA 5FBZA 2G1PA 1Q20A 1PFQA 4ON9A 3WAGA 4BMOB 1T2UA 1W2BP 5DM0A 3TMKA 2JBWA 4IDHA 1HKHA 3MVEA 2VNIA 3NFCA 1AGNA 1IN8A 1XALA 2B8WA 3PGMA 4KO1S 3H75A 1ZGGA 2EEPA 2GQ0A 4FYIA 3REQB 3HO8A 2ZB3A 2GZMA 1SUIA 5AHRA 1AHIA 1M1YA 4F6LA 1TTPB 5JARA 2Z3VA 4Z4IA 1LD3A 5L3RA 4REQB 1B2RA 4TV8F 4D56A 1KVQA 4G5YA 1U11A 4EHIA 1R0SA 8ATCA 2NP7A 3T6KA 3E48A 3A28A 3HCNA 4X1YA 5DW3A 1TM3E 4O8ZA 2W6CX 3W2GA 1HDXA 5KI6A 1D0YA 2QMUA 3CUTA 4IGFA 1OZGA 1XQBA 2Z8XA 3B5IA 3D6NB 5HIKA 5IDXA 5HKBA 1SXPA 2E4WA 2PO5A 3L07A 3RIEA 2VP2A 4QFMA 1DWQA 2M98A 2CK3A 3HXMA 1T0JA 4KZPA 1A5BB 4KXMA 4YRDA 3PXGA 3RJ5A 3QFTA 4KOAA 1JBKA 2G71A 2OAQ1 2VT7A 2JH3A 2OTJB 2OGSA 4HG2A 4KXFB 4XR4A 4D41A 1CNEA 3EIEA 2IHYA 3RHZA 2FPSA 1KJNA 2LZ6B 1RWVA 1S8OA 3SNKA 1APBA 4IP0A 1PR4A 3PDUA 2GEJA 1V45E 3VHRA 5ITZA 3H2KA 2ORYA 4Q4AB 4UBLA 1W4BA 2YXLA 1SVNA 2FUKA 3CLTD 2QEXB 2R7KA 3WWOA 1B23P 3MG9A 2CDTA 1V8BA 3ZVKA 4HDMA 4UMVA 3U4HA 4GI5A 4KAAA 4U8HA 4HOYA 1A5AB 1SC1A 4OSEA 1XDWA 4EVRA 3U7FB 3KYCA 3ZHSA 7GPBA 3M5PA 2XUZA 4MMKA 1NQAO 3RSZA 3I9QA 5C8ZA 1O95D 1C0IA 1TMYA 1C0PA 3W8FA 1JU4A 2ZAMA 3G59A 5BNFA 1N36B 1A8HA 4LWOA 3JCMW 2CHUA 5TXGA 3BB4A 1YV9A 2AHRA 3KJQA 1SD5A 2FUNB 4H1VA 4J2OA 5JRJA 1UDCA 2JFBA 3OCXA 1LBHA 1SUBA 1XRRA 2EBFX 4LZNA 4DM3A 1GQRA 3P2EA 2OZPA 3AUJB 1C9MA 2R8RA 4QUJA 3TTVA 3NVDA 4CM9A 4DA7A 5CM8B 2Q1SA 1VQ4A 1SKUB 4ACBA 1UL1X 1VL0A 4PLPA 3EGOA 4I0WB 4H6VA 4P33A 3JCMh 4CIVA 3FRNA 5BSWA 2GN0A 4KIJA 5JSFA 2PUVA 3L0SA 5ALRA 2ZRJA 5ALYA 3VC2A 3VFDA 2RD1A 1R8QA 1RPJA 4RD3A 1Y4SA 1YBAA 1NM5A 2BZSA 1H5NA 1IB6A 2GSDA 3C5CA 1KRWA 4NXMB 2DC1A 2IX9A 3WB2A 3YASA 4N39A 5K8UA 1AS3A 5AVUA 3RAEC 1V2GA 4M0CA 4QT7A 3DCIA 3H2HA 4XGNA 1Y34E 5ADHA 3KQKA 3GYBA 3WWCA 3TEJA 1VXOA 5A0VA 4WN9B 4G9BA 1VYTA 4NZPA 2B36A 2WWFA 5ILQA 1Z56C 3UCFA 4CQLA 3EODA 5IT4A 1SUPA 1J90A 3FF4A 5KCZA 5LLDA 3FOFC 1AO3A 4KI7A 4Z3DA 1G5VA 1D5WA 4J29A 1D0SA 4JLBA 2W5UA 9ABPA 3LT0A 4CODB 3R6TA 4NONA 1K4US 2P4HX 3BDVA 5KMGB 1M2OA 3KQLA 1YHQT 3R5HA 5CYOA 1IJEA 4EUNA 1VL6A 1QRTA 3LW5E 5FNVB 1JDPA 2JHCA 3ZZUA 1MP0A 2O1WA 2Q99A 4BATA 4OIMA 4IYRA 3SP1A 2FZGB 4R7TA 4A6DA 4AWBA 4N5HX 2OOKA 1SHUX 2OCBA 1M3AA 5M3BA 1VLVA 3ZBPA 4P2NA 2MWMA 3BGOS 5K09A 1RAGB 1VL1A 4IIXA 5CVDA 2IA5A 4FFVA 4E14A 3M59A 2POQX 2P0KA 2XOKA 3LNTA 5H9VA 4EYEA 3PEUA 4HQKA 3LWBA 3HE3A 4RDCA 4DBHA 2XDAA 1Y82A 3HUTA 4UPVA 3I32A 5E6SA 1FRVA 3F78A 4F2PA 5BSVA 5JXIA 5ED0A 1XZLA 3MJRA 1K75A 1DWPA 2BLNA 4UNPA 4ZQIA 1MIOB 3SBOA 1M0EA 5IEJA 2E18A 2Y05A 3A70A 1KU0A 3G2JA 5YASA 2I3ZA 3AVYA 1Q7TA 1NXQA 2OZKA 3VPHA 1YITA 1EUDB 3FLMA 5ALQA 5EPOA 2B7LA 3PI7A 4HEQA 3TL6A 1QW1A 3KQOA 2B8JA 4NBLA 1JH9A 2DPPB 3E58A 1L5HA 2YN2A 4RQBA 5JROA 3TLXA 3AIOA 3IDFA 3AF2A 2D1TA 1YL5A 2WWHA 4M0EA 2GBCA 1TZKA 3CRQA 3M3DA 1CRLA 2ZUWA 1C0MA 3ON5A 1EVEA 2HLPA 2OEPA 2OQ2A 3KKOA 3KOYA 4ZI7F 4V38A 2RB5A 1JR4A 3H4IA 2JUFA 3WGZA 2V0GA 3IVRA 4HAWA 2W2KB 3N5CA 2NUPB 4GZ3A 1URPA 1E2FA 2ID9A 1EWKA 2C77A 2D1QA 2P6UA 4FR5A 4IHQA 4ES6A 2MF2A 2YMQA 2K4YA 3CISA 3OOHA 4Z8AA 4WINA 1JU9A 1UFFA 2DSNA 5LDDC 3K8ZA 4CV1A 4JYPA 3AT1A 1ADFA 4KI0A 4RL4A 5AVRA 3JVEA 4UC0A 4MHOA 4XGKA 3GROA 3T8YA 2QTVB 2IZOA 3OZWA 2EF0A 1L4EA 4UM9D 3DBOB 1RYEA 4IDFA 4YMIA 4BX3A 1AKTA 4MHSA 1ZUKA 1NKVA 2GASA 5EP2A 1L7QA 4YRRA 2CSQA 4PLTA 3CO0S 4IUPA 1IRXA 1K8YB 3DBIA 3O8LA 4RGBA 3ZKAA 3VH3A 3UK7A 1BRMA 1QZZA 3G2IA 4MR7B 1BJKA 3IR6A 1LPMA 1P1CA 3UB2A 3UT5B 2CFTA 1PAUA 3B52X 1GFSA 2Q6OA 1P1JA 1PZMA 3E5HA 2QROA 3EDCA 3U2QA 3QF7A 1W48A 4FQ5A 3TL2A 2FFRA 2R25B 1KFJB 3IELA 2P27A 1JXOA 3OQ5A 2VAMA 3OLQA 5GM1A 2WYIA 1DMSA 5KCOA 2EW8A 1VE5A 2E6KA 1L4MA 4WJLA 2B9EA 4F7DA 3FIFA 3JVVA 5JZOA 2K3XA 3CCVA 4YCLA 2J0UB 1NMZA 3GDHA 4AFQC 2FP4B 2DQKA 2WT9A 2PL5A 3SFVA 2FW8A 4PIPA 5D8DA 4H7HA 1VQ8T 1KY3A 2DRMA 2V7QA 4L72A 1Y6JA 1L5YA 5KB3A 1SG5A 2FG0A 1RHJA 3FHTA 4O29A 4RE6A 4Y2YA 3BA1A 3A1UA 4LXTA 3NTRA 2K3YA 4RTWA 4QNMA 2QWXA 5KOJA 4B17A 2NQTA 3EGVA 5REQA 3K20A 2NACA 3Q2IA 3KZVA 3LYHA 1PFWA 4RVUA 4W5OA 1F38A 4DDHA 2HQHA 1DU4A 2OG2A 4A8JC 3BK7A 1VBNA 2JFYA 3C48A 1WQ3A 3AZOA 3G49A 3MLEA 5C8YF 1GGEA 2BMWA 3GVKA 1Q16A 3L40A 5AKZA 1DAHA 4DLAA 5EGNA 2WSBA 2PGOA 3OCZA 3USES 4KE6A 5ED4A 1G3TA 4CI0B 5FU7C 2W22A 5EHQA 3LY5A 2PBLA 3IR7A 3OKAA 1PFVA 1WJGA 2XDQB 5BN4A 3TXAA 2FSFA 4EB3A 4V02A 1G3QA 3IAEA 1SXIA 1IU9A 2KMLA 3HFGA 2PTKA 2ZTLA 5LBIA 2WSYB 2EBHX 1RJEA 1JDVA 4N18A 2O0MA 4B7CA 5JH7A 4JRIA 5C53B 1PBNA 3HHTB 1VQOA 4C2AA 2ZE8A 1N92A 3FGPA 3I2JA 2I8AA 2UYHA 2CMFA 4YBZA 1IAVA 1OF1A 4M22A 3WIOA 5A9SA 1DKOA 3L6BA 3C3DA 3K8QA 2F3QA 4Q1AA 2ODTX 3WXMB 1L4HA 3KSUA 3KAKA 4TTPA 3L2ZA 1BSVA 2GCEA 2I34A 2XKJE 4M60A 1W5SA 4JHLA 1EH5A 5HQ3A 1ZMBA 3CNLA 1JH8A 2WTAA 3PI6A 5GGXA 3ZE2B 4GRIA 3NHAA 4LVOA 4R54A 4J7FA 5DHTA 2ATEA 1KC3A 2EIXA 2EJCA 2V5UA 5LJ3f 1G5HA 2W48A 2WINI 3CUKA 1OPLA 2B2CA 4QU9A 4RD4A 1H8HD 1XP5A 4WNYA 1EM8A 4XQCA 4MDEA 5IANA 1KAQA 2O52A 3G23A 3HYRA 4F2WA 3WHIA 2PEYA 1FVHA 3QMPA 1DWOA 3MMNA 2GDJA 2PX2A 2YXEA 4CMEC 4EA9A 3L8DA 4WASA 4BP8A 3KOXA 2GNCA 2Q4RA 1RAFA 2J7PD 2HRDA 2C4TA 3ETGA 1I3NA 4H1TA 2WZCA 4HN2A 5L6LB 4DZTA 2P7HA 2ZJ0A 1NXVA 2YBEA 4FC6A 4HGZA 4PX2A 3T38A 4BFWA 5L23A 2C3MA 2I66A 3IDOA 1CEYA 1FP6A 1I4DD 1WW2A 2R6ZA 3H84A 3RESA 3KWLA 1M76A 4EX6A 5C37A 2JM9A 4M75F 3R5XA 5CR9A 1XZJA 2IH4A 2D1XA 2M6RA 2VJQA 3AU9A 2PAAA 3B89A 3KTOA 3ZCPA 1KMHA 4OU5A 5A9SB 2DB3A 4O2BF 5EJEA 4REOA 3SMVA 2PQ6A 4E7HA 1M2JA 3H8JA 4CT4B 5IHKA 2ISQA 3RS5A 1DDIA 4RKFA 4YV0A 3PPYA 1XZFA 1IY8A 3CWQA 4TWIA 5HKKD 4RTTA 4E6EA 2W2NA 2OTJQ 3BBLA 3G0OA 2IS2A 2I4OA 4P6YA 5ARCA 3V8JA 2YHIA 3TQRA 3GY0A 4M7PA 2BBSA 4EUHA 2DWQA 1OUMA 1PZEA 3EULA 1R5BA 2O0HA 5LJ3d 3SJZA 3I3OA 2LV8A 3A2MA 3ECCA 2DEUA 1UJMA 1W88B 5CMLA 4JI5B 8LDHA 3BXOA 4QBGB 5FHQA 1ABQA 4JSTA 2CZ7B 1W4ZA 3PC4A 3ZD6A 1HE1C 2IEBA 3OOYA 4YP1A 1PP4A 1ESEA 2HJWA 2I62A 2HHHB 4RTZA 4KIUA 4KIGA 3KJGA 3IBCA 3V8PA 4K7JA 2H8GA 3OLVA 2Q5OA 1QQAA 5DK6A 4Q3EA 4JRQA 1VIDA 2HJVA 5AO9A 5B1IA 3V97A 1D2GA 1D2RA 2JK1A 2HEGA 3B6EA 3E23A 1A8UA 2VKNA 1EFVA 1H4TA 3FDZA 1M8FA 4FHCA 5C3UA 4DCUA 3L4JA 5LWQA 4UTXA 3KM0A 1UC5B 3PUKA 1JQKA 4QDKA 2PRYA 1PRLC 1KORA 3R6NA 1JFFA 1F8GA 3I9LA 3LP5A 4CL2A 1DG1G 3ZVNA 1GEEA 1RABA 3GZNB 3LK7A 1U8RA 2ZCVA 2C29D 3D8BA 5KO2A 1GG8A 3RUPA 2YJ6A 3QOYA 1LPBB 2DKOA 3SX2A 1JKFA 2QN1A 5J5AA 4DJFC 2WT4A 4K03A 4XUCA 5JYEA 1I7SB 2GJAA 1RCTE 3SKYA 4A0SA 4EB6B 2R8PA 4PBRA 1G7RA 3ISVA 2ZPHB 1LX7A 5E7MA 3U3ZA 2GK3A 4BNTA 4H31A 3M0TA 2DYKA 1EK5A 2Q8NA 1G4UR 3GJZA 3TLEA 3HPQA 2IK8A 4NMXB 2FLWA 2F4NA 1GKLA 1Q11A 2AG5A 2XB4A 3ACBA 4NL2A 4QVGA 3UA4A 3ZBQA 3JRZA 4IJQA 1E9AA 4IILA 3AETB 5A6SB 1ZUNA 3DLIA 3I05A 4IV8A 3GRRA 3NOQA 4C3VA 3I1YA 2YWBA 3BL8A 5FEMA 6ADHA 4MX8A 3H65A 1KK7A 3FUXA 1LU9A 1D6SA 2HLDA 3OY7A 4PF1A 4BMNA 3I5AA 4N49A 3R8FA 1SBTA 4OVKA 1AUVA 2XR1A 4IS2A 3BDUA 1PTKA 2WD9A 1OXKB 1U0HC 1UT5A 2XY4A 2VRNA 3O8QB 4TX1A 5JVDA 1FU7A 2B0CA 1K3FA 1C1HA 1NOKA 1QPGA 1VDMA 3D1JA 5H0IA 3UJ9A 4BTEA 2NTEA 3DZFA 3IP8A 3QVUA 4GKJB 1E3WB 2OOSA 3PPVA 1TM2A 3KZCA 3ZCXA 3GQVA 8MHTA 2FFHA 3DDHA 4GR4A 4UZEA 2HQBA 1MO5A 2YMLA 2VHZA 2CCKA 3L2WA 2OCLA 4Z6KA 4L7QA 2GZHA 5GAN2 1X7XA 4HGOA 3W7AA 3DLHA 3KVNA 5GAN3 1XP8A 3FMVA 4G0UA 2W0ZA 5HIIA 2P3SA 2XD0A 5LMUB 1XDGA 3RNOA 5FV4A 4D26A 4PKCC 4KQ1A 1MTZA 3WLPA 1ZL0A 4D9JA 1T8SA 1TVMA 2PWPA 5F5NA 4RJ2A 3GJ7A 3FGOA 5H68A 4C5EA 2OO7A 1Q77A 5K0CA 4IM7A 1XEXA 4EMTA 3WL3A 3A4MA 4FR2A 3GH1A 2XRFA 4NKRA 4XLFA 3G5LA 1T2FA 1F2VA 9ATCA 4AICA 3Q7EA 1D04A 1EVZA 2O2YA 3GYGA 4CIWA 4B6RA 1RLJA 2RIRA 3OTGA 4WZAE 2VJKA 1N3LA 5K8CA 3ZWQA 2A92A 4M9CA 4NESA 4MP6A 3FPPA 1AQUA 5GAOq 1FVOA 3BUSA 3C3YA 4ZK6A 3LGAA 5LP6B 4GH5A 5FQNA 2R3SA 2BHTA 4UDOA 1KFEB 1WDLA 3O4RA 4KN9S 2QYHA 4IDQA 2JCYA 3D31A 4GRDA 2OA0A 4XX1A 3KP1A 3THSA 4YCJA 1M6WA 3IVMA 4IHJF 1SOWA 1QIFA 3HACA 2R6R1 4D3ZA 2EJGA 1TK3A 3LGFA 4X06A 4KR3A 3KPYA 2EQBA 4BZQA 1TZMA 3DT6A 4FGKA 1U4NA 1WMFA 3E2MA 1UXIA 2C9CA 1Q9SA 1ADBA 1L7VC 1UJCA 1Z7WA 1RI4A 3UQZA 1XMOB 3Q3EA 3CCUQ 3E9EA 3PIPA 3IIKA 4AVYA 5JANA 2JZNA 4KUGA 5I7SA 4XD2A 3DE0X 4P83A 3ZKWA 1EUCB 3ZI0A 5KDLA 4YUYA 5LQJA 1H3ZA 3V8NA 2OCAA 4S3MA 2PM8A 3AWIA 5A0FA 3RC9A 1Y1PA 2D1RA 2PT9A 2P35A 2BZYA 2QW0X 2RJCA 4A10A 2ZITA 3KKPA 3O8OA 1MJFA 4C0DC 3IQXA 2H3JA 4N5NA 4TVKA 4EA8A 5JSQA 3ZBDA 5CD1A 3WJAA 4CYMA 4N65A 2RCNA 3AVTA 3IVCA 2ZZDA 4JJIA 4P58A 3PDJA 1ARZA 3ZU5A 1GZSA 2WJJA 1RWQA 3NWOA 4EHKA 4XEHA 3O82A 1T0HB 1LBQA 2V7VA 3Q0EA 4UTRA 121PA 1Y80A 3SS7X 1WTCA 3RAFC 1XFDA 1M73E 1ST3A 2B4TO 3C45A 3GWZA 2IYSA 4URUR 3FTNA 3P9PA 1L7XA 4LFCB 4DK1A 2XB6A 3WVNA 1EEHA 1YR8A 3WNDA 1ZISA 3AESA 2I91A 3SE7A 3Q8KA 5HJ5A 1TMOA 4E33A 3B2EA 5FHRA 2OT3B 3KUFA 5HIAA 3EEOA 2E4AA 2WLTA 4FSDA 1X7WA 5A3QA 1AHPA 2QXTA 1XPRA 5E8RA 4ID9A 4FWBA 1EX1A 5FULA 1X69A 4HFNA 1VQLQ 4MGHA 3CPEA 4U7JA 2QTMA 2QN9A 2KVOA 4BNVA 4UM9B 1FYWA 2FZKB 4HQOA 4FS3A 2V6IA 2X4GA 1V8FA 3DEYX 1QVVA 1OPRA 3Q3AA 2QX4A 3CKKA 1Q2UA 3O4FA 2XCIA 3GJRA 4E22A 1U2SA 1B0AA 3CC2T 1V1JA 1H0SA 5AUNB 3K32A 5AIBA 3VOAA 4X91A 2WD7A 2ZK7A 1TVKA 5FWXB 4FFRA 4YAJA 3BH7A 5KU1A 1EVQA 3MJCA 2FWNA 2W2XA 4QXMA 1V9SA 1SKMA 1XYYA 2BR5A 2WJHA 5C51B 1XMVA 3F6EX 3GLTA 3FPSA 3LDGA 3MAJA 4QPCA 3KQSA 4P38A 3R75A 2IZ5A 4JT8A 4P35A 4P3PA 1RJ9A 2X6RA 3U49A 1Z26A 1CDOA 3PRKE 3OW2P 3P9QA 2PLFA 2ORVA 3HM2A 4GW3A 4NICA 1E7QA 5G0UA 3IVAA 2FEWB 3WV4A 2XAUA 4RTPA 4DR3B 2XUFA 3CQ9A 4FYXB 3LJKA 1XV5A 3HDGA 5A4IS 1YZFA 3ACCA 4YP0A 4JNKA 2M2IA 4EBBA 5LOVA 3FVVA 4G2TA 4J6WA 2RPNA 5CXQA 4N41A 1QVFA 2CUNA 4HMPA 4TXNA 6NULA 2ZTHA 3QK7A 4L2IB 4PZ9A 4D3SA 5EJ6A 2VYNA 1QK4A 1CUSA 5B55A 5AVTA 1CUJA 2XMRA 4KQFA 4XNFA 3MUOA 3GZTB 3AETA 1PNQA 2AMYA 3HO1A 2VSQA 1C9KA 5T6BA 4ZCTA 4QUIA 1RAAA 4C3UA 1GZ3A 1WMBA 2RHRA 3EDOA 3OZSA 5FU6B 1UOEA 5KNCA 2OK7A 3KETA 1XCPA 1OJLA 2J5KA 3MJSA 5I2SA 1SD2A 3CR8A 1HDRA 3QXXA 3RS4A 1H2EA 4N03A 1DOHA 4DT1A 2YQ5A 1KAHA 3F9IA 4EEKA 2LP4Y 1G2BA 1SQFA 3PF8A 2RA2A 3GPDG 3DLMA