2WR8A

Structure of pyrococcus horikoshii sam hydroxide adenosyltransferase in complex with sah
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
259
structure length
258
Chain Sequence
GSHMITLTTDFGLKGPYVGEMKVAMLRINPNAKIVDVTHSVTRHSILEGSFVMEQVVKYSPKGTVHVGVIDPGVGERRAIVIEGDQYLVVPDNGLATLPLKHIKVKSVYEIIPDKIRKFTGWEISSTFHGRDIFGPAGALIEKGIHPEEFGREIPVDSIVKLNVEPRKEGDVWILKVIYIDDFGNVILNLENYEKPRTVELLDFNLRLPYLETYGLVEKGEMLALPGSHDYLEIAVNMGSAAERLNVKVGDELRVRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Insights Into Water Activation in Sam Hydroxide Adenosyltransferase (Duf-62).
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN PH0463
total genus 77
structure length 258
sequence length 259
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2wr8A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2wr8A01
2F4NA 2Q6KA 4CQJA 2C5HA 5FIUA 1RQPA 2V7VA 2C4UA 2Q6OA 2CBXA 2V7TA 2V7UA 2Q6LA 2Q6IA 2WR8A 5B6IA 2V7XA 2ZBUA 2CC2A 2ZBVA 2CW5A 1RQRA 2C4TA 1WU8A 2C5BA 2C2WA 5LMZA 2V7WA
chains in the Genus database with same CATH superfamily
4H7KA 3ZBQA 2BFWA 2XWJI 5K0NA 2FN7A 4IIJB 3DPIA 3FWZA 1THGA 1ULAA 1SU4A 2DWPA 2GARA 4DNTB 2XB9A 3QG1A 4AQDA 4AZTA 3L0ZA 1IDOA 1YR6A 2HT1A 4C0AC 4WBXC 3A8KA 3A2KA 1L7XA 5KQRA 4WK4B 1PR0A 3ZVMA 2WUVA 2AZ4A 4H59A 1T3ZA 2PKCA 2ZYWX 4LPSA 2Q9UA 1YCDA 4MVJH 1KZLA 4B43A 2F7SA 3IP3A 3OD5A 4N3BA 3VZRA 3W9YA 5IG2A 3RADC 3ND8A 2BF4A 4JLBA 1WBDA 3SC2A 4JX8A 4NDNE 3PA1A 1WABA 1FFCA 3RVQA 4MUNA 1GRCA 3BQJA 1CV2A 4FHZA 3PC6A 5C1IA 1XZHA 3LWNA 1Y5MA 1E8DA 2YJ4A 4JYBA 2ZB3A 4GX1A 4HFNA 5LPNA 4EEXA 1SJ9A 4CTJA 5FAKA 3C5VA 4QRDA 4M89A 4IIXA 2RHWA 1SHJA 2B36A 3H2HA 1N6RA 5BV7A 1DAPA 4IGFA 1SUBA 4G1UC 1A4UA 4A0GA 4CR6A 4EHNA 4R3NA 2VK2A 4KYUA 4DBLE 3GEPA 2QVGA 1V1MA 1K73D 2AA3A 1UP6A 4IIJF 1V26A 4R40A 3NCTA 3OZTA 3TINA 1SRQA 1JLLB 2P77A 2ISQA 1H0RA 2W2PA 4GZ3A 3TQOA 3CNNA 3VC3A 1OASA 4TV9F 2KB0A 2UXBB 2F8LA 3SKBA 3F67A 3QIVA 4FLMA 4NCHA 1Y9DA 2ATEA 3AQ4A 3FAZA 4RF5A 3IEUA 2ZRPA 1R6XA 2XA2A 5TC4A 4RETA 2VPQA 4QDXA 1N5DA 4C9BA 2MIIA 3EMDA 2ZRMA 2B1QA 1A8UA 1N77A 4EI8A 1NPDA 1CQJB 2C7QA 3Q0IA 4QTXA 1R0XA 2KLBA 2VK4A 4AWXA 1BKSB 1VQLB 4UEKA 3KSAC 1AF4A 1B0PA 1MV5A 1P62B 1VRWA 3KFLA 3SYKA 2NSJA 5A6VA 4LF9B 2CN1A 2P4EA 3QITA 3FMFA 3H1EA 4BWVA 6NULA 3LT0A 4Q82A 2I3AA 1M67A 5B1HA 4WOJA 3CW9A 3MIIA 3OP4A 1GVHA 3GI1A 4L02A 3WGQA 1C1HA 2BI4A 4L8VA 2ZXIA 1YAHA 3HJFA 2H51A 3WSTA 3PVZA 4HL6A 1WVIA 3GPCA 3AEZA 3HR4A 4P98A 1N7JA 4Q4JA 4RF4A 1H22A 2BFPA 4KNVA 3FVWA 1LS1A 3NUGA 5K1ZA 3TVTA 4DSTA 1SVUA 2WUWE 4XLZA 3CWZA 3GZ4A 4JY7A 2BHRA 2GO7A 4HLQB 3PC3A 3I2FA 1RZRD 2O8CA 4CLOA 4XKWA 5I48A 1OAOA 3K8ZA 4K9MA 4YIKA 2W70A 3B89A 2ARKA 2C4UA 4CMCA 1ANKA 2VJQA 4H7JA 4YCSA 1WP6A 4IZIA 1E59A 4TZ0A 1CU1A 4Y8VA 4DQLA 4H4EA 4NY1A 4R0VA 4R8SA 5T41A 4MVJE 3U44B 2VYQA 1IN5A 4QYXA 2VT2A 4Q9HA 1W0KD 3IPRA 3HBMA 5EQDA 1B6SA 1T5TA 4YLYA 2IFTA 1D6JA 2P7HA 1WG8A 4NJMA 4QPDA 3C41J 4PGGA 4ZD6A 3SPXA 2WZCA 2ZSKA 3UK1A 4ZYYA 1W9XA 2IHKA 4CUZA 4IEFB 4CQMB 4TYMA 3KVVA 4ETMA 1KJWA 1GV1A 4FEEA 2XRYA 3VYVA 1RZ3A 1ZO8A 1KH2A 1HL3A 2ZRJA 1TT5A 4GE3A 4HKTA 4U2EA 5F5XA 2BISA 3BTVA 3CCUB 4HFMA 4WV3A 2IZ5A 4CKEB 3IC5A 3T9CA 2WEKA 2XQGA 2HSEA 4OXYA 2LIVA 1WVGA 5BN3A 4M76B 3D4PA 4FXUA 1PSZA 2WJVA 3VYSB 2E1RA 2NUTB 2YMQA 3AHCA 4C4XA 3HU1A 1QFXA 3HFGA 3FI9A 5CYFA 3ZK9A 4OYLA 1BRTA 2QYTA 1GUDA 3TW0A 4ZC1A 3D2CA 5JTTA 5BN3B 3U3MA 1E6KA 2JJQA 3LS2A 1ZA1A 2EKLA 1SU8A 4BJHB 4WKBA 1T2FA 4AKHA 3TW6A 2OV6A 4MWOA 4JHXA 3FJYA 4M55A 2QRHA 3AKCA 1IEXA 2AQIA 4TT3A 2GEKA 3CLTD 4OQNA 2W7TA 2Q7OE 5AK6A 1U9YA 5IFKA 4DLZA 5K8UA 4ZO4A 1V1JA 5H5JA 1H3EA 4PRLA 3BE4A 3COWA 3R3XA 3B6IA 2BZSA 3W7BA 3KJZA 1K7YA 2ZI3A 3ZLTA 4Z3KA 2GM9A 5JS7A 1VHTA 2OP0A 1X1AA 1PVVA 2MT9A 1FRFS 1QK3A 1T4CB 2GVDC 2Q99A 4G3XA 4PFQA 4LHEA 4M0UA 2OMEA 3UA3A 1MG5A 2FSVA 2KLHA 2VJAA 2ZETA 4R01A 4OK6A 3H0CA 3AM5A 3L0DA 2BEUA 4Q1CA 1YOBA 1RHKA 4AJ9A 2B83A 3ZHUA 2VHJA 4ZFNA 4KQ1A 5K0ZA 1CRLA 2AC4A 1SBTA 2HDNB 3KTFA 4OUDA 4R5HA 4H1TA 3VO1A 2IIVA 3F7TA 4NC9A 4UUQA 5T3YA 3ZPXA 2VXYA 5I7RA 5IC4A 3Q0EA 4UEWA 1C7IA 4Q7QA 4M7OA 4TLBA 2AUMA 5E9AA 4GOXA 5LQMA 1LKZA 3N0TA 2NP7A 4D9NA 2ZAOA 2VDQB 2CNDA 1CIVA 4I1YA 4RLSA 3ZDFA 4C3UA 3LT4A 2Q3FA 2W6QA 1P6XA 4X7BA 1RYEA 5JDIC 1AXGA 1K68A 3N2KB 1C9MA 1JXMA 4I50B 3ORFA 4MMYB 4JLNA 4MZXA 2A5YB 1ORIA 4BFXA 4MW0A 4EHBA 1QC5A 4EPXA 4LV6A 1WSVA 1HRKA 3HUTA 3BT7A 1UD8A 3BOSA 4OATA 1EDDA 3EC2A 3TOSA 4KLZA 1C3VA 4JJKA 4A16A 1WW8A 2J9XB 3BHMA 3NIBA 3T7KA 3RT7A 1G2QA 4CM9A 2WM3A 4LXIA 5JADA 1N2CA 3EXG2 4EO7A 3RVPA 3RYFA 1TVEA 3F90A 1JEOA 5E6RB 5HS4A 4BO4A 1EDBA 1TM2A 1GTL1 1KDVA 2EG5A 5TF4A 1IBLB 4JLMA 2ES4A 4GWGA 4DWWA 1R1DA 3ZKWB 4D9BA 1MEEA 4FYVA 3THWB 3AY7A 4G97A 4WX2B 1VJ0A 4YN3A 2O20A 4IGAA 4GHWA 4EKIA 3RSFA 2NWQA 2CHUA 5J4YA 1JDBB 3CCEB 1FTYA 1YGYA 1GCAA 2OBMA 1U4OA 1C30B 3HCCA 1WDKA 1T34A 4MVJP 3CVUA 1VPDA 1WXFA 1YL7A 2FDXA 3KXDA 3Q3GE 3OZRA 3R5SA 1DIOB 1D2AA 4QLOA 1O2DA 3FLMA 3JQBA 3HJAA 1G0NA 1GQOA 3P9RA 3W6UA 1GFIA 3G9ZA 3RVJA 4ONEA 2BP7B 2PD4A 4XOUA 4KNWA 2B5OA 3EXAA 4UHCA 2YOHA 1A5ZA 1WULS 1Y4UA 2YDYA 1XCBA 3D2BA 3M3HA 5T64A 2Q4TA 4JMLA 4JLSA 2G0NA 2XCSB 3Q9SA 1C8LA 3SX0A 3U1VA 4M1MA 3U80A 2H7YA 5B6JA 3LK6A 5TF0A 1E1CB 1JHUA 1WZCA 2FG7C 5DISB 3THYA 2YXPX 2IODA 3IUPA 3WL5A 4OCZA 4CEHB 1XG5A 2DH5A 3OTIA 5F5NA 4UEJA 3X1YA 4K6CA 3ESYA 3EOZA 1MJNA 2I4OA 4GWKA 1FFGA 3RV3A 4BFVA 1IUOA 1UBSB 1V7CA 3CC8A 4UU7A 2UU9B 1RACA 2QYOA 3ESBA 4FILA 3ZHCA 1BZYA 3O38A 1I7NA 2IQ5A 4BWGA 4XPIB 3HXMA 5I4IA 2RHTA 1TO6A 3IDFA 2Z8YA 1UWCA 4DLUA 4B9EA 3PF9A 4HXEB 1KI8A 4ARAA 2CXPA 5M2QA 4JC8A 5LZ2A 1VL0A 3CMMA 3OQHA 5EFZA 5K2MA 4RDXA 2O3QA 4OOVA 4R1MA 1HDOA 1IUNA 1XKTA 3NX4A 2VHVA 4FS3A 4IS2A 1T91A 1DVRA 3X3HA 3ROGA 1YI2B 2WJAA 3Q3IA 3HVKA 5IBQA 4CL2A 2B4TO 1QU2A 2NVUB 4WLFA 1UZAA 3D6TB 1YS1X 4E1AA 3DBLB 3ETDA 3R0ZA 3C1AA 1BA2A 2QY9A 4Q7KA 3K53A 4Y2SA 1NBEA 2KYRA 3FHLA 3AIIA 2XKJE 3C1OA 5F1KA 1JNXX 1U9JA 2Y0PA 3COPA 3EZ6A 1QRTA 1CQIB 4RIGA 1P77A 2F3QA 1AB6A 3UATA 5KTTA 1D7OA 3KKLA 4PWZA 3G0HA 5D8DA 2NAPA 1MUUA 3OECA 1THTA 1QORA 2ERYA 2O8VA 3M34A 2YS7A 4S2EA 3RBZA 1OX6A 3W7VA 1J5XA 4ECEA 2JD0A 2VRBA 4RPHA 2WZNA 2ZOSA 1WKCA 3PWSA 4F1WA 3KSDO 4DK1A 3UJHA 1H9BA 2GZ2A 5ESRA 1K8ZB 1W5SA 4OMDA 2E9SA 1IZ0A 3MJRA 4KIFA 4R1SA 3V8QA 3ZDQA 1R27A 4QTYA 5DLDA 1PVOA 3ITKA 4KW7A 1I7QB 1GXSB 3ES9A 5J23A 1G5PA 4RW0A 3EF0A 3OQ1A 1XTJA 3EOAI 3UT6A 2GKGA 3TYXA 1K7XB 4EGFA 1Z68A 3CCVB 1UMDA 1ESNA 1XK7A 2A30A 2FFJA 3AEKB 5EWJA 5BOSA 4GSKA 4EP1A 3A3OA 1R88A 3L8GA 3I64A 1CY6A 1SUWA 2EBFX 1JR2A 2CDBA 2WUEA 1IH8A 3CX8A 3KXKA 3ZI4A 1DZIA 2C1XA 4B6QA 5FUMA 2GEVA 4X65B 4QOGA 2WVGA 4FFMA 3M1YA 3ABQB 2GN6A 1RXWA 1V8BA 1Y0BA 2HA5A 1Q17A 1ZQ1A 3W6OA 1KKLA 3DPUA 2C5LA 4B6OA 4ES6A 1M6WA 4JS0A 1P6UA 2QMUA 1XDZA 3PK0A 3H3XA 4ZREA 4GX5A 1A88A 1PJ6A 3CC2B 2X8JA 3KL4A 4XZ3A 3UMRA 2GRAA 2H54A 5D51S 3VOAA 5KOJB 4HUQA 1NY6A 1DO0A 3B2NA 2PUGA 4JYPA 2CHEA 2IP2A 2FPIB 2JGJA 4IQ4A 3QRWA 4M3NA 1IN4A 3H8WA 4TT3D 2YFQA 2ZATA 4L0DA 4X1YB 3E3NA 1H1DA 2HF2A 5DYYA 4BIMA 5BV0A 2HRDA 1YQGA 3IVRA 4B2YA 1B8OA 1YJBA 2D8AA 2PZMA 3D4LA 4ABYA 2JH8A 1N7GA 1L7EA 2CLOB 2ZI6A 3E58A 5FOVA 1ZMRA 4UTVA 5JSZB 1V35A 4JCOA 4JR0A 4NYJR 2GH1A 1Q0LA 3N2KA 5L8VA 3UN1A 5AM1A 1PWEA 1T36A 3PB3A 4BLSA 4IEIA 5K0GA 4RCZA 2X6WA 1PHRA 2WQZA 1GRVA 3NHUA 4NENB 1M2VA 1PJ3A 1MA3A 1IOVA 3VNQA 3W9UA 4QLBA 3AYXB 4XWOA 4W9RA 5FPKA 2QE6A 2I87A 4MW2A 3I9LA 1D5WA 4HS9A 1A5BB 2P9FA 3B5EA 2XD9A 3V1UA 4K9PA 1YKGA 1TKCA 3OEWA 3T3GA 3R44A 3W3AA 1AHNA 1NN5A 2GETA 3BMQA 3N6RA 1X2EA 1WCYA 2BVNA 2JGIA 2P1ZA 1EX1A 1W96A 3K8OE 3OBIA 1ONNA 1UOPA 1SN7A 1WWKA 2F1OA 3FDZA 3Q7EA 4N40A 3HU3A 4R41A 4KFRA 3M6FA 2B8WA 5EHIA 1VMIA 5BUSA 4V1CA 5ITSA 2VDLB 4CT4B 3ZCQA 2C4HA 2B78A 4ITUA 4KOAA 5JPDA 1YJWB 1Y7LA 4MV3A 1TT5B 1AG9A 2H0QA 5DJ5A 1IAVA 2WG1A 3IJPA 4QHSA 2I7DA 2O2CA 4P2NA 3RWMB 3FJ1A 4Q6WA 2FSSA 1SXJC 4DEVA 1E63A 5LQCA 1Z7BA 2FQWA 1QS0B 5CA0F 3KFXA 3W5IA 3RFVA 3Q98A 1UP4A 3TQCA 1YI0A 3PNSA 4DA0A 3CF2A 1LF0A 5TDHA 4Y2TA 5H68A 4RBNA 2I1VB 2MHCA 1E20A 3JCZA 2Z98A 3QXGA 1AGPA 5TS3A 3RT9A 2QP3A 3OTWA 4DABA 3GFPA 1Y34E 3NT5A 2CLEB 2Y6VA 3BGSA 3N2GB 3W79A 4N0DA 1X3SA 2PSHA 2PTHA 1C3EA 1NBOA 4U2GA 2J4CA 1C1XB 3SYMA 2I71A 3WYAA 1NX6A 1MZPA 1CR4A 1FS6A 1XQ9A 2WF7A 4N6OA 4AS1A 3TOZA 2LVBA 1O6FA 3QLJA 1FFAA 3KJHA 2HSDA 4JT8A 4LJ6A 2PBZA 1KEUA 2HU2A 2PX0A 3LXMA 3KR2A 5AJXA 1VBNA 2X7XA 3NOVA 1SXJD 1G59A 1JHVA 4Y2JA 3UW3A 1U98A 2PFKA 4X05A 4LSMA 1T8SA 1OIXA 5A1JA 2CJWB 4TLMB 1L5HA 5U9CA 5K51A 1RU3A 4YRLA 3ZIDA 1TCCA 2XQIA 3T99A 4K46A 3CWQA 4TUYF 5ER6A 1VJCA 3L7AA 4D41A 2AN1A 2JHAA 2FI1A 3SLDA 3S99A 4ZOQI 5HNKA 3ER9A 1FJ2A 3RT1A 1GDTA 1U7XA 4JDUA 1KRWA 3GCWA 3BMCA 3L1HA 5KQGA 1EG2A 1KP9A 4YYEA 2X9QA 1XRRA 1PJ4A 2GFQA 4KK3A 4RF3A 3NVAA 5C3MA 3OAAD 3WNDA 3F4KA 2BE7A 3IQXA 3EIQA 3FWNA 4RHCA 3HACA 4ZCSA 5BYKA 2NT4A 1L7VC 3FTPA 1GGVA 1VLHA 1YB5A 2G5PA 2P5YA 1HUQA 3OLXA 3RW9A 2CV0A 2P5TB 2VT7A 5AVQA 3V1TC 2OBFA 3RTBA 4D7AA 1MG0A 5E6TA 1C81A 1LSUA 1V45E 3CT4A 4JJGA 1GFWA 1TW3A 3ESQA 3O0DA 1UFOA 1YK0A 1YQ9A 1LI5A 4MYCA 4I46A 4S35A 3H1PA 4WNAB 1PR3A 2ZYGA 1RAFA 2QTAA 1JMVA 2ZYAA 2RGNA 2IEIA 2E5FA 2XVMA 2XUGA 3QPCA 1JHDA 3MJCA 3PGA1 5DS0A 3D3WB 4HRVA 4BX2A 3UXEA 1JJ7A 4IJWA 4QG7A 4ZVOA 3DR3A 3G17A 5K4GA 4P1VA 1N8RD 3R6KA 3Q15C 3GT4A 4H6PA 5EZ6B 3HEMA 2D59A 3OE7A 2XY4A 3JWEA 3UOGA 3ISTA 3RVMA 3O83A 3AR8A 3U6BA 1N5OX 1ZLXA 3GLTA 2XBUA 4RXUA 1H2RS 3RODA 1PEAA 4WN3A 1M3SA 2GBIA 4QDUA 3TLBA 1ARZA 4D8TA 1CFJA 4YCCA 2H1FA 2C2ZA 1P74A 5IXJA 2F8TA 2AK3A 4HHEA 2UYCA 1J0AA 1DJPA 4Q7LA 3FF1A 1FBTA 2V6GA 5FJIA 3E18A 5FJJA 4UTRA 2IYZA 2RAPA 3IT3A 2N47A 1MBZA 1MC5A 1FTQA 3QI2A 3DDHA 3E8MA 1NC1A 4E5YA 4JJEA 5FL7A 1A9SA 4TTVA 1GADO 3TMYA 4A1OA 4TWRA 3FPAA 1C4WA 1JAYA 1NRWA 3DFMA 4TMTA 1W2HA 2H1WA 3KZOA 3MUOA 4PHTA 4EF4A 2PJRA 3C48A 3ZV6A 5AM3A 1L5OA 3F3YA 3UB2A 4Q3OA 1NVUQ 1FFXA 1I3KA 2J5QA 4P0PB 4UOQA 1CQWA 2O5RA 1H94A 5AHXA 4OJTA 5CX1B 1TB4A 2VHCA 4ZGBA 4RKQA 3NYWA 4CJXA 4DLNA 2DFDA 1RE0A 2AV6A 2JJ2D 3ZZ0A 2P9GA 4GP7A 3WKBA 3T94A 1B76A 2ERCA 1N4AA 3IVAA 2WD8A 3ODGA 4FUQA 4HYYA 4KJZA 4AWBA 1KZ6A 3ZLVA 1KWKA 5IARA 2VJNA 4UDNA 4AB1A 4QIHA 2EYQA 3KSRA 4NQZA 4XIIA 3CVVA 2Y3IA 4LJ5A 4JVNA 4N5LA 1XVIA 1YASA 2FRDA 1YF3A 4CM4B 2FK8A 4KMRA 5EWLB 1KJJA 2IZ6A 3T1QA 3CINA 1KEZA 1X94A 3TVYA 3LMKA 5ALHA 1X7GA 2F43A 2W43A 3TLGA 2NV0A 3PA8A 3PXEA 4RMIA 5WRFA 4I19A 2QTLA 1KERA 2Z56A 3OD1A 4E5DA 4P6VF 1MOZA 3GDHA 4I6JA 4GLFA 4JB0A 4P5PA 1JDPA 1ONOA 5J40A 3EG9A 1XTVA 4NKRA 4W63A 1BHQ1 4UXHA 2C8JA 5COBA 5J2UF 1OPXA 2BUBA 8ATCA 1PBTA 4F5DA 4XL9A 1JMYA 4LBWA 4CHTA 3KJIA 3EN0A 3QVKA 4LXXA 3ILVA 4M0CA 5G53C 3WWPA 4BVJA 3DMRA 1JIXA 1KAOA 3KU4A 4ZK2A 3FTDA 4JUBA 2OHFA 2OYNA 3M9LA 1AKUA 2GAOA 2W93A 1LQTA 3BK2A 3N2GA 3PLNA 3TB4A 4LDJA 3WIEA 1KEKA 4QPZA 1P73A 1LF5A 1EUZA 4LNUA 4BVLA 5C8ZA 1SH7A 2FPSA 3N6VA 3RF7A 4JNKA 3HA7A 1LPBB 2P6PA 1NE7A 4MULA 3KEWA 3QFCA 3EVZA 8LDHA 5FPYA 3KZMA 3SQOA 1O6GA 2H8KA 2WE8A 2A2ZA 1A2QA 1TZMA 1N6NA 2Q41A 4C4AA 5G1OA 2W71A 5I4BA 5EYPA 5CT9A 2X4GA 2ZRAA 3HUDA 1KC1A 3VYWA 3MRVA 1M83A 2ZDGA 4YO7A 3TAHA 4YRMA 5C2JB 4A2QA 4FMBB 2VC2B 1XZIA 4L07A 1C50A 1XJCA 3B9PA 4ARVA 4AYTA 3ZQJA 2XUIA 5K8IA 1OW3B 4M0EA 1IK6A 3EODA 3N5CA 4URYR 4AUEA 3EXIB 4DSZA 4W5NA 1AKYA 4HXGA 2ZJ4A 3EPLA 1P4MA 1E1NA 4FYMA 1NSYA 4FM9A 5H9WA 4KAJA 3RAEC 1KYTA 1U5AA 4TV9B 1DAFA 2AXNA 3MJHA 4LJKA 2VXCA 4RACA 4OB7A 2ZTGA 4QVJA 1PIWA 1Y4SA 2XYRA 1POWA 2WV7A 3ESDA 2ZT5A 1QYRA 2XMSA 1JWLA 4ZYTA 4PZZA 4RVSA 1O9HA 2EBHX 2NM0A 4DFDA 3R0QA 2UZ1B 4DE5A 4K26A 4ZHQA 1J2JA 4KQFA 5D5QA 2GCOA 2Z4RA 3KT3A 3A4LA 2O2GA 4NCAA 1Z4QA 1I2BA 1WB5A 2Q5HA 2C9DA 2WT8A 2JFNA 4NFLA 4XDHA 4P3YA 5EJGA 1JDZA 1FYXA 4MUYA 3UT5A 4ZIRB 1J5PA 4BKUA 5I9IA 4ZK6A 5LFAA 3UYLA 2BBOA 4Q0MA 1SVMA 5IBPA 2YIVX 5LN1A 4DQUA 4TVSA 3A3NA 1C9DB 4FJ1A 4CUJA 2P9QA 2OTJB 1C2YA 4KLRA 3AIMA 1Z2AA 2AW3A 2IKSA 2ZI9A 3PC2A 1T8RA 1G20B 5FOQA 4GZMA 1SUDA 2FF5A 1R0LA 2Y1KA 3D3JA 3K9CA 4IRMA 3V97A 5LQRA 3EWAA 2DFPA 2ALJA 2EVWX 5TRTA 3LXRA 1V1MB 1ISHA 3QKRA 4NU0A 1FS5A 3A4MA 1XZBA 4L5BA 2Q0SA 2V3VA 3NRJA 1L5MA 1OGYA 1UZLA 4LAFA 4XTCS 4PYRA 3NEYA 4YNBA 3DO6A 1XE3A 5A7HA 5ALFA 3W1EA 4UCFA 3OJ0A 5IXYA 2BFFA 3BIOA 2IEDA 4M88A 4ZVLA 5KTNA 3SP1A 4MVJM 3I53A 3KJGA 1MGPA 2JNWA 1TA4A 1Z0FA 4EL5A 2VJLA 1FP1D 1OIVA 1TU4A 4C0LA 2ID7A 5FL3A 1P0MA 4ZJYA 4KE9A 4BWYA 5JCXA 1Y8QB 2B34A 3DW1X 1E6CA 1XYGA 3IAM1 1SCIA 4XD7A 3W5AA 2YBEA 3EZYA 1YZVA 5FNVB 4Z4IA 2OCYC 2FRDC 3L6UA 9ATCA 5IP5A 1Z6GA 4YJ2F 3EIXA 4V0QA 3TJMA 4R2IA 3EJ6A 1NDQA 4F56A 4C6TA 3VNVA 2E2WA 3LA6A 4H6XA 1UIMA 4CIBA 3RB8A 4HEHA 2ZBRA 5LMCA 3FHOA 1W36B 4XYEA 1UPCA 1QG6A 3GRCA 1SHUX 3NM6B 4QOSA 3ZIAD 1QRUA 3HP4A 3HGTA 3IXMA 4IHJB 5JJ5A 1P7WA 3NHAA 2X86A 4K9SA 2WJYA 2CUTA 4Q34A 4KN9S 3ETGA 1AK9A 1JHAA 1P9OA 2G5GX 2GVZC 3VPAA 5DX8A 4A0RA 1Y6JA 2EFCB 1L9KA 1DC7A 3B1JA 3N8DA 3NBZC 3VX3A 1ZNQO 5KWVA 1XTUA 2PXXA 3BEDA 2VBTA 1H8ED 4BB0A 4FJ0A 5DK6A 4JUFA 4KHZA 1OI4A 2WMNB 2I7VA 4O5OA 3K70D 1MVLA 1NWHA 3AB8A 4NF2A 4WZZA 2D5IA 2ICAA 3CCBA 3IAEA 4O2AA 1QLHA 1WXDA 4MW6A 5L7YA 4J9VA 1JEJA 2CHGA 1VL2A 3QVXA 4K6HA 5IT4A 5AOCA 2DLCX 2MSCB 2DPGA 3PUYA 4I5IA 4CL8A 4W1RA 5HRAA 4P54A 3PNBA 5KTYA 3IEXA 1XPUA 3MLEA 3VHXA 3E9ZA 3ELYA 2HV8A 3BHIA 1GAQA 2ZS8A 3KTDA 2B35A 3KDPA 1E6LA 3SVZA 3L6BA 1PWYE 1F2UB 4A03A 4F4DA 5JEEA 3L9WA 4GEGA 4YRCA 3I4CA 4JLJA 3R7SA 5F23A 3DXXA 4WXPA 4UAJA 3AP2A 4IG9A 5SZKB 2EQBA 1ZUHA 2AD5A 2GAJA 2QPLA 3DFUA 3MTGA 1Z6QA 2VRCA 4MB0A 1CUCA 3EXHB 1EMDA 3U3RA 2FOXA 5BNTA 3KYCA 3I23A 1OXVA 4Q9AA 3AU9A 5GWXA 4BZXA 1EFRD 2QHXA 2Y1DA 4ENTA 4UBIA 3PFFA 5ABPA 5A9SB 2G08A 2PJDA 4G1MB 3QTLA 2FEXA 5H81A 1JDBC 4WWHA 2BP7A 4DLSA 2GZSA 1VLLA 4KI0A 1SULA 1OBOA 4FFWA 4MUKA 1G5RA 5HFJA 4F97A 3SGLA 4AKIA 2HIAA 4IIHA 4OMFG 1F8YA 2W2TA 2VAVA 3M4NA 3O2JA 3ZVLA 3CEPB 6AT1A 4I9GA 2R1UA 1U7ZA 2HLDD 3FBWA 1E96A 3K6RA 4K9KA 4O4HB 1XFAA 2ZE6A 3KXLA 3URKA 2AJ8A 2OCGA 5LB2A 2WMOB 4EG1A 3UAVA 1NXSA 2J0VA 1CHNA 2WYVA 221PA 1RHJA 3QMMA 4DN6A 1KBZA 5EJ9A 3O2SB 5L3SA 1WM1A 1IULA 4XQ9A 1MT0A 1TRKA 2ZJBA 3JAWB 4PHHA 2WM8A 3FSGD 4DT1A 5CH5A 1PEDA 2W6PA 4ANFA 4HB0A 1GRRA 3VI4B 1YB1A 4WECA 2IYPA 3CCRB 4RUKA 2P4HX 3RYIA 2Q29A 2QUZA 1HQDA 1ODJA 3TI7A 4HZUB 3VFDA 3U7QB 1A7AA 3I9MA 3IPLA 4DSNA 4HEA6 4J75A 4QVGA 2PZKA 1YJQA 2R87A 3KPWA 3GVIA 4Z4ZA 4LCJA 4RAQA 2HPVA 1E2QA 3A0RB 5D7BA 4YJGA 2BKXA 1N1DA 2A6PA 2OCPA 2BR3A 3LP6A 1CUYA 5AHRA 4DLTA 1CUAA 3FIJA 2GLUA 5FPTA 1OILA 4CEIB 5SV2A 1P9LA 1WD5A 3P2MA 1ZU4A 4A8PA 2WJGA 1E5DA 2JCSA 2EAUA 3DV2A 3KJQA 2WFLA 2PRIA 3BSSA 1BQ3A 1KI3A 4J03A 3ENKA 3IKLA 4AX4A 4F3NA 1HM5A 1NRXA 5EWMB 2XD4A 5I01A 2BJHA 2AG6A 2J3KA 3D7LA 3M89A 4KL8S 4KI7A 1HA3A 4J1TC 1KAGA 4L5JA 3M5WA 3CZ5A 4RH1A 4HWKA 3BA1A 4BPRA 4B85A 5HZAA 5DNUA 4IQFA 5K7SA 4EFNA 2RAVA 3D02A 3NYRA 3VR4A 3GEBA 4UVGA 3AW9A 1A5SB 1RBZA 1UADA 3PJDA 3QHAA 1XHFA 4RZXA 3VJMA 3LGAA 2XYGA 4GQBA 3WGUA 4RPBA 3N8GA 2DE0X 4TKLA 4HJXA 2YWDA 2LNDA 1SQFA 4LIPD 4CG2A 4X84A 4CM7A 4CLDA 5ISMA 4DKJA 1N2BA 3TPFA 3KYDA 5BVGB 2E4AA 4LHYA 5MGNA 2JD1A 2C7RA 4E7OA 2R4TA 1KZ4A 2W48A 2E82A 1R0ZA 3KLPX 3ZWQA 1N4DA 4LWQA 2Q62A 4KDCA 4KO4S 2TS1A 3VH2A 1OTXA 3L8HA 2GQ0A 1L1QA 4TZKA 1L5KA 3ZDZB 4AMGA 4L72A 4QGFA 4CMGA 3P9QA 2CYAA 821PA 3QVJA 4E0BA 1F6WA 4ECAA 3PUKA 2Y71A 1GTSA 1NF2A 3C7TA 1Q3KA 4B44A 4GUDA 3AR5A 5JQGF 3UBTA 3GP3A 2WZBA 4DUZB 1EU1A 1XYYA 4KWTA 4E7PA 1Z22A 1M34A 3JARA 1JFVA 1M2EA 1AQJA 2NXJA 3L4JA 3HTXA 1BS2A 5K3FA 4Z4FA 4BNVA 2B30A 4G09A 4K28A 1I3MA 4F84A 2Q0XA 4CLEA 4TWIA 4MXDA 1OBCA 4J0IA 2YHIB 3D7MA 1PUJA 4Y0VA 1PYGA 1XQ1A 2QUBA 1SC9A 4RD3A 1U0BB 1DXOA 1PFKA 3HB4X 1P4GA 3RBVA 3ELUA 1QH1B 4GKVA 4HAVA 4JVSB 3SE7A 1CUGA 2OBNA 2Y1XA 3GRZA 2QY6A 3X1ZA 1ZMXA 1N9KA 3OEYA 2QZPA 1TMKA 3FNEA 1LNQA 1XDDA 2YXEA 2IWRA 1Y9AA 1KAHA 4BGVA 4CM1A 3D3EA 3U4MA 2CFCA 3PFIA 4GYJA 2VQ3A 4PQGA 4DC1A 3PHJA 3TQSA 2C0PA 4F04A 3NAMA 3RK0A 4JZKA 4JBGA 3Q8MA 3BJRA 5DEOA 1Z83A 3E9EA 3DZDA 3GFFA 3NHBA 4WCFB 4PYIA 3O8NA 1SUCA 4RVFA 2ILVA 3KSUA 3TBHA 1Z73A 1X7HA 1GGFA 3ZE2B 1BN7A 5TPWA 3MMZA 2I3BA 4HH0A 1R64A 521PA 2OHXA 2GQFA 2VPZA 1SU7A 5TLSA 1RWBA 1ZXBA 3NGLA 3CUEF 3DC2A 3RRBA 2QTVB 4NBWA 5AHWA 5D6OA 4R1UA 2AF3C 3BFXA 2WHQA 3HLTA 3ZNOA 3DD5A 3B1KA 4I5GA 1G1AA 3AFNA 3H2KA 3KBOA 2IU0A 1LDYA 4I66A 5J4HA 3FFBA 4LF5B 2FE4A 2WYIA 3VKGA 1JB9A 4KLNA 5G0UA 1HZZC 4Y6LA 4CTNA 1XRLA 2O4UX 2J9ZB 4PZAA 4EMTA 3Q12A 5AIBA 1EINA 1PW7A 3JD0A 1I4EB 3PNKA 5GZ1A 2ZZQA 1M73E 1W88B 2HU5A 4GOND 1O54A 3OOYA 3S1LA 5IJ0A 3DMTC 4U7GA 2OXTA 3QE9Y 1MKYA 2HN9A 3OKFA 1H2AS 4FWTA 4JJ6A 5H0IA 3F5FA 5BV2P 5D1NA 5CD9A 4AJKA 2DWQA 1DIRA 2IXBA 1EXMA 1X7WB 1HYQA 4YAGA 3ZJTA 2QE7D 2IF0A 3QLVA 3O1JC 5HTKA 4M7WA 3DZCA 3GOQA 3C3PA 4Q21A 4EHKA 2R66A 3AP1A 5G02A 4BP1A 1WXHA 2ECPA 3LBHA 2V7UA 1JVSA 2CJFA 2E6UX 4AY5A 4DVJA 2PRJA 2J3LA 2WTXA 3E70C 1NE2A 2YV3A 4RIEA 4XCVA 3DYBA 3TNDA 2B0CA 1RRFA 1YAJA 3NTXA 2V7QA 2Z2XA 3T9AA 5GPBA 2JEZA 3CLRD 4XA8A 5D3QA 4BVGA 2QOEA 1FFXB 2G9VA 2O2HA 2QG4A 2RGYA 4BMCA 5I5EA 1LX7A 1Q2XA 3R6GA 4KO8A 1QLJA 1U7UA 2X0EA 2HY7A 3I6MA 2ZPTX 3FCOA 3K15A 3P7MA 5AJZA 4XLTA 2FFAA 3F9CA 5J1TB 3B3QA 3WLSA 3O03A 1OZ0A 4MS4B 4EHJA 3QA9A 5TE9A 1Y8RB 4MUHA 5F64A 4B75A 4MV7A 3N3AC 1XMOB 3VTFA 2A88A 1S2OA 8ABPA 1ZCJA 2HXGA 2NGRA 4BNHA 2A9FA 4CCYB 3ZNQA 1I5EA 1OMOA 2B8EA 3IP8A 3I9JA 2YZMA 1KO1A 3G59A 4YONB 3T5GA 2AFIB 4A92A 4YR9A 3DMFA 1E69A 1RI2A 1AT1A 4CMAA 3I2IA 3CN9A 4IHQA 3PBKA 4FUTA 4NXNB 1R3UA 1XVAA 2QLJA 2ZW9A 3LHFA 3GLHA 2XHZA 3DWEX 1C5KA 1RZUA 1E18A 1YCFA 3KS9A 3CRQA 3IMKA 3NKLA 2XRZA 3HXPA 1WZ2A 4ZQCB 3COVA 1Q0QA 5F4ZA 5JBIA 1SFRA 3K9GA 1IXRC 1D1QA 1I80A 2GBLC 3VX4A 3AUUA 2IY9A 3CZPA 4FBGA 4LGCA 4Z0TA 4AX8A 1WO8A 4OSEA 5BNZA 4LF8B 1Z08A 3LHKA 4U0KA 2G06A 2MR5A 2PU7A 3GMSA 3CUVA 1YFZA 2PO5A 3CRVA 3A14A 3EY9A 3FYTA 4NS1A 5JSKA 4LBYA 3WMFA 2ZUUA 3KIPA 3VSEA 3H5NA 2XVZA 3I3SR 3IUNA 2EP8A 4TRRA 1OFIA 3C3MA 5IBCA 5DSTA 3QFSA 2AJTA 2ENWA 2K2QB 1JXQA 2CF4A 2C42A 3HZOA 5CM8B 3TAXA 1QH9A 5LC1A 4BMNA 2POQX 1E3DA 2XQFA 5ELMA 1H4TA 3FCYA 3V46A 3ICVA 1WPGA 5CXUA 1JWAB 1NT2A 2JFQA 2FUCA 1NUPA 4JA2A 1XQ6A 4PGHA 3IEVA 2IYVA 4WGFA 2WUGA 4DJTA 1H1LA 3K0BA 2VZ0A 3IDSA 4PX9A 4KR6A 2P11A 5DLEA 1KS2A 2QAGC 4UHHA 1T4BA 1ENOA 3ICPA 2BFBA 1MW9X 1XV5A 3NHKA 3W3AD 1RD4A 4XLEA 5A2QA 4GX2A 2ORED 4FR2A 3O9MA 1PJ7A 3ELDA 3OJCA 4OFZA 4RXMA 5JMTA 2ECFA 4WY2A 4BZZA 4OXQA 3VKFA 1XDWA 1VPEA 1TZCA 5FBLB 2BGJA 2JAQA 1IC6A 5G40A 5KTKA 3B5IA 5I9TA 3L8ZA 4XX0A 1DCKA 2OBXA 1UMDB 2P3MA 1IPEA 1G5TA 4EGJA 1I8DA 5KOHA 3C0KA 4P83A 3GGPA 1S2IA 1ZM3A 1EWTA 3M6AA 3UANA 3WIOA 1HLGA 2QRJA 1IWOA 1XFDA 5ALNA 3ZHYA 3H2BA 5JFTA 1QYVA 2CNOA 3LQ6A 3B48A 2BDEA 4WOPA 3KPYA 5ALMA 4LDQA 3T7IA 2Z6VA 3JXEA 2UYHA 2XZTA 3GQVA 5EE3A 1F1BA 2FEMA 5FUBA 5C8XA 4DEYA 2MOKA 3C3KA 2OCDA 4DRXB 1FTWA 3AETA 1OKKD 3LJKA 4GW3A 2A0YA 2CVQA 5KYXB 2OGTA 3VSCA 1SQSA 3AR3A 3EZFA 4LJSA 4Q16A 3KAQA 5JYBA 2GBPA 1DJNA 3IT1A 4LRSB 3P8ZA 3HY6A 5MN4A 1JEEA 4I2VA 4XYGA 3GZNA 2CRVA 3ANXA 5SY4A 3I8SA 1K06A 3AV0B 1CY1A 3UV6A 5ADHA 4W5OA 1YDGA 5BO5A 5EE1A 1WEKA 3TGWA 1R4AA 2B7LA 2FWNA 4CMIB 4JELA 3KT6A 3STXA 4YP5A 3UAZA 1XO1A 3PPYA 2ATCA 4QVIA 2WKRA 3F3SA 1WUJS 4I50F 5F9HA 2B7BA 1VJRA 1FQOA 1ZL2A 2FQQA 3CSUA 3IILA 2P1DA 4YJGB 4F5ZA 1DDIA 4JC4A 1DO8A 3ANSA 4KK4A 1P45A 5CDFE 5HIMA 1ODFA 2XUAA 4AJ4A 4LQ4A 3HK2A 4UKDA 3I2KA 1TNDA 5LKRA 3ZHZA 3CNEA 4ERXA 1Q7CA 4V0MA 1WDMA 3M0EA 3SJBA 4MKHA 2FY8A 2CJYA 1UH5A 4P22A 2I33A 2JLAA 2ZSBA 1C9EA 1MIOB 3QE3A 3UMYA 3WGOA 2ZTMA 3VPSA 2RFLA 1WMBA 4E0FA 1KMHA 3PUZA 2XXAA 4UNIA 3KM0A 3V4PB 1Z6TA 1URPA 1T6XA 4TMZA 3JSAA 4HWSA 3R5HA 3VR4D 2CXXA 2IXDA 2F48A 1U2PA 4LHWA 5LLTA 1O4VA 3K94A 3OLZA 1C7ZA 1CRQA 4QXAA 4ZYUA 1A1SA 1PR9A 4DLBA 5IYZB 4MHSA 5BWNA 3B3JA 2NADA 2HEIA 3F49S 1PFUA 1BKDR 1EM8A 1YQTA 3IDQA 3OZXA 3DLPX 4I99A 4MQMA 4NSNA 4TPKA 5FNVA 4TN1A 1BX3A 1J8VA 1W29A 4P3PA 4HDSB 4KRXA 4JFAA 2QGFA 3Q10A 3SDBA 4CMHA 4EOGA 4AWAA 5BPFA 4C4SA 4FJ2A 3FA2A 4TM8A 4EJSC 2PAFA 2PKEA 3OW7A 2AJBA 3CSSA 3HJHA 1G20E 3T95A 1GKKA 4XRGA 5HPYB 3N8KA 3TNYA 5A4KA 1XWIA 2Z8XA 4OHUA 4RJLA 1KZ1A 4GMHA 4QLAA 2YV4A 1XPRA 3R3JA 4K9NA 4KXXA 3ZWBA 4DC9A 4FWBA 2DUJA 1J2EA 5CU7A 3SR4A 3SIRA 4WZTA 1NI3A 1UOQA 2VP9A 2X2EA 3QTBA 1W1WA 4UHKA 3O4VA 1GIAA 2GLXA 2W42A 4WZBB 1N3LA 4AXBA 1Y5RA 1YOVB 4HDAA 2ZQ5A 2X76A 4N9QA 2RGBA 4NZYA 4RV5A 4X1IB 4ER3A 3GQBA 4Z0PA 3VR3A 2IYQA 3RUAA 5CHEA 3A0UA 3ABOB 3FF4A 1V16B 2PMKA 2D5CA 3ZWCA 3B3GA 2QUJA 4BRZA 3VO8A 1X1DA 1E2UA 2XBLA 1ODSA 4Z7NB 1LY1A 2GCPA 2YY6A 2WWRA 3BXGA 2HBYA 3WLIA 2J5KA 2FOLA 3QI7A 3QF7A 4BTLA 1GV0A 3D7KA 2G80A 3O3NB 2EL9A 2A9QA 1TKBA 3MTAA 5FO0A 4RLQA 2JGDB 4GBJA 5KYKA 1V5FA 1GYPA 1TLFA 2KWIA 2VOJA 4C05A 3OT1A 5EHGA 4XB1A 1RHRA 4I50A 3S2EA 2IP4A 5GOZA 4L9SA 2RK4A 3BH6A 3CY6A 4PRYA 1TYAE 4BQQA 4BXOB 1C41A 1SOWA 2IW1A 2RCNA 3H5WA 3IDAA 2N9UA 3IQEA 3K5HA 2FPXA 3ANTA 3DNMA 4INAA 4J1SA 3VR2A 3MMSA 1YXMA 2E3JA 2FW7A 3CZQA 3NPAA 3OZSA 3UPDA 2G17A 2A14A 1A0OA 2YV2A 3LT1A 3LUAA 1SVSA 3R9XB 4ROSA 4EBFA 1XK6A 3VR5H 1GSIA 3AHGA 1V9CA 2UAGA 2ZSDA 1YS2X 1G6OA 1M34E 4N5NA 5EZ5A 5KYVA 4RZQA 5ALOA 2W6OA 4LMBA 3V4SA 1AKWA 3M2PA 4ENWA 5JWOA 3RANA 2SECE 3WJ7A 2WOOA 4NU8X 3V00A 1XRNA 3WIDA 4EITA 3HKEA 2BAGA 1DRJA 3KJNA 3CIFA 1P2VA 1LVGA 4W1QA 3TLJA 1AQUA 1DHTA 3IJ5A 3G68A 1P9NA 1RRVA 2P91A 1E6MA 2OYRA 1RZRA 5AYVA 3H2GA 3SZOA 1W49A 3KU1A 2H1LA 2B6HA 1KY4A 2C07A 3PF8A 5JDCA 2FW8A 1F2TA 9GPBA 1TF5A 3KQLA 2FZGA 3KUXA 1UC4B 3GPDG 4F3KA 1I2MA 3PVSA 4P8RA 4OI1A 3TTYA 2QN8A 4CODB 4JLPA 1KJYA 4MJLA 3FE2A 2B20A 1Z2NX 4R0NA 3S55A 5JFOA 1UOEA 1WW2A 4XVHA 2P1RA 2GHTA 3GUHA 3DVQX 1WMAA 3MGBA 3NS7A 2XEXA 2XMCA 1U8CB 1XELA 3STTA 4F9EA 3EASA 3UTDA 3OQBA 5CXXA 4DMFA 2I4MA 3R75A 4MVJA 1A95A 4GBED 4RJTA 3O4JA 1KKUA 4DBVO 5JSHA 2QQFA 1OYYA 2ZVPX 2JIZA 1YB7A 2DY0A 1A9RA 1K5PA 3DAOA 4QYMA 3VZCA 3FBGA 4G0XA 4GVLA 4KQ2A 4R2XA 1QVGB 4TLLB 5JAIA 2F1RA 2UVQA 5JFGA 4N3GA 1W6UA 2I2FA 3G89A 5GV7A 3T1TA 1DZ3A 5DHAA 3OTQA 2HOQA 3UK6A 3DKPA 2XSZD 4L22A 4NJOA 1J90A 5HFNA 2X6XA 2JVKA 3GGJA 4GR5A 3WZMA 3ENNA 2GB4A 3WI7A 3ZGXA 5CLJA 3FYDA 4JZYA 4HN2A 1HDCA 5I7EA 4E70A 2FMTA 3J7TA 4DMUB 4LOHA 4US2R 1IZYA 1P5RA 1T1IA 4LQLA 4AZ0B 5LU9A 4INZA 1PNTA 4JGBA 4N65A 5JNRA 2OWDA 3FR7A 4WEOA 2JD2A 2R5WA 3M6IA 1HVXA 5LVAA 1VIVA 1T6YA 3AR4A 4AMUA 4NOMA 1UXGA 4RE5A 3FFXA 3OU2A 1MXHA 4C0JA 3MLBA 3T9DA 3ZVKA 5HM6A 3WQQA 2ASVA 4KG7A 2LZJA 3BDAA 2WWWA 5EE5B 2WMDA 2CLIB 3QY9A 1SUFA 1TDJA 3V80A 4J3FA 2BGIA 3O8DA 2JKZA 1X1CA 3I2YX 3MJ4A 2MSNA 2Z0MA 4IDBA 2GJKA 4B3GA 1Z25A 4KBFA 5GINE 1OXXK 2FSHA 1ZEJA 5JAMA 3CJTA 4GM4A 1IRXA 5K05A 2Z4TA 2ZROA 3BG5A 3N2EA 5ER9A 3JAMA 4KR0A 5EKUA 3DYIA 2V58A 1WUHS 4BC0A 2HGSA 1A5AB 2A1IA 3KXIA 1VI6A 3LTEA 1X9GA 3KUUA 1DUSA 1MTOA 5EIAA 3RRZA 4DIOA 1A7KA 2WD7B 1AURA 3GRVA 3JATB 1SQGA 3E9CA 1MRNA 4NH4A 4Q9NA 1G7RA 4W5HA 2PFGA 3HGMA 4Z7JA 1AD2A 3OZUA 3QMPA 1Z0DA 4IOJA 2A9PA 1UD5A 2JW5A 1LNZA 3OF3A 4TYPA 3CBGA 5JZBA 3A26A 2C3YA 2DPXA 3WLTA 5KJFA 2ZJ5A 1L5HB 5I51A 1Y6GA 2RHLA 3GNSA 4FOOA 4P2BA 2ZCJA 1PUIA 3IQHX 1NBME 4IHJA 3L7NA 3RIXA 3TG8A 2F1KA 2RC5A 1TJ5A 3M1AA 4EY4A 3C4JA 1CY8A 1DFHA 1U3WA 2DKNA 2XIQA 4OIFA 2AL7A 3D4NA 3GXBA 1XVUA 4EFDA 6PFKA 2IPNA 2D1SA 1WY5A 2E89A 1XCPA 4YRJA 5EJ2A 4XB6B 2BIFA 2X19A 4ASUD 5LNK1 3SZUA 3BC1A 4PS1A 3TPCA 2Z1DA 2ZB7A 2F3RA 1MEJA 3LZCA 1L5YA 3IPCA 3ND9A 3OAAA 5HJEA 5K6AC 5AXCA 2CFSA 5KBYA 1XUOA 3BAZA 1BWSA 4QQ8A 3DOIA 1T9KA 2BEWA 4L7QA 1D8TA 4CQJA 1O94D 2ZJ2A 1M5UA 4M7RA 4Y9UA 4WINA 3G7NA 5AW3A 3MCTA 1HRDA 3H2ZA 4JBWA 1N57A 1X86B 1YZLA 2UZ1A 3GFRA 3ZDEA 2QDXA 3HL0A 1S96A 4FLFA 2OZVA 1A4XA 2VBFA 4BRSA 3CT6A 3GP5A 2Q07A 1IXSB 1SURA 3EPJA 2JGKA 3RSLA 4J91A 1P19A 2ZL5A 4LY3A 3TBFA 3WK8A 4DAEA 1DSSG 2HZ7A 4AURA 2GJAA 4G6ZA 1E0SA 1NZJA 2YV5A 4B74A 1P0QA 5G3YA 4R4JA 3UEOA 4F8YA 4IVRA 4KBYA 1YRQA 1L7QA 3QWBA 4KQ6A 4A0HA 2G1KA 4A8JC 2I91A 3RC2A 4WCDA 1YR1A 1U0LA 2HIGA 4JA0A 1XA4A 2P3SA 3INRA 2J5RA 1NBAA 4JI1B 1P39A 3HBAA 2GZMA 4IXTA 3WL8A 4DXAA 1R6AA 4Q66C 1US8A 4W5JA 4JYAB 4BJ5A 2C9MA 5JNWA 1GSHA 3WK4A 3FB4A 3ENWA 3C3DA 3GEHA 3I9V6 4UNNA 1ECGA 1R4ZA 3M6MD 1MC1A 2WJPA 3I61A 5T5QA 4C7VA 1AXRA 1J8QA 4NENA 4DLPA 2ZSHA 3LFUA 3O9VA 3A6PC 1JR6A 3U1BA 1KK3A 1DJLA 2CEAA 5JYEA 3BWMA 4WOCA 3BY1A 4N8SA 1N0IA 1WRBA 2OGUA 2GKSA 3KSMA 3V3KA 4CV3A 1NVTA 2EIXA 1AKVA 3DOJA 4NCIA 4CM9D 4EPYA 1NVDA 2B4KA 2L82A 2XTJA 3O4GA 4GXQA 4F1JA 4KJXA 4XFKA 3JX9A 4D0GA 5C37A 2V4DA 3MELA 4G5XA 3NJRA 4I1IA 5GZ3A 3MWJA 4ESHA 1NB9A 3N07A 3UXMA 3TKAA 1LPSA 2WBLC 3TLMA 2XNCA 1HT0A 4MR8B 1UL1X 2GBFA 3PIDA 2X4IA 4BYGA 3LPNA 621PA 2K2WA 4U9HS 4URVR 1GKIA 1E2IA 5CA1B 1QFSA 3PDJA 2QN2A 3DLTA 2B37A 4URFA 1K98A 2PK3A 4GI2A 3IEKA 4JJ4A 2IU6A 1XZGA 5AR1A 3VR3D 1NVVR 5LDGA 3UB3A 2PS3A 5GJCA 4TZ6A 5CA0A 4CM4A 1W9HA 3H9JA 1AJEA 1RPNA 3FSJX 3HA2A 2I4TA 1NYRA 3NHRA 1KXZA 2R6FA 1J7JA 3TJRA 1XWFA 1E0JA 1W87A 4PYKA 1NASA 5CW1A 5I5GA 2Y2VA 1ZJ5A 2QVLA 1JIUA 3ID6C 4RZ3A 4ZCQA 5J63A 4YUAA 3CX3A 2CLLB 1NKVA 3K0HA 2RKOA 2OORA 2XT6A 1TC2A 4EHDA 1EGMB 1Y48E 1JJFA 1OI2A 4F2PA 1KOGA 4LJ7A 1HYGA 3QH4A 1ECLA 3PGKA 4NRDA 1SC6A 1VHQA 3C7KA 4YCNA 1Z5VA 1CUIA 2ORIA 4Q3EA 2RGGA 5IVPA 2OBTA 1X1SA 4FHCA 5CNJA 4AMBA 4R2LA 1W1IA 3LNNA 4EB8A 4JROA 1P61B 5FP0A 3MEQA 1OCEA 4ER0A 4BO7A 3TRDA 3CCSB 1P1KA 2ZULA 3RUIA 3LIPA 1QH0A 5K2OA 1R12A 3CMEB 1LPAB 2CJXA 1E3TA 3ACDA 1Y37A 5H02A 3ZE9A 3E9NA 3JVDA 3DP9A 4OI2A 3R9IA 1QCYA 4J0QA 1G3QA 2VDUE 4C7XA 1EBFA 2CEKA 2MSEB 2C2XA 4YRKA 2RHMA 3M6UA 1XZJA 4JVLA 3RGGA 5GADl 2ZB8A 1SXJE 3HKDA 4FFSA 3RUCA 4KMSA 5C7YA 3HY4A 2QPOA 4MRPA 1JFTA 1XDSA 2NG1A 1TIPA 1KKMA 1XSEA 2ZUDA 1PHPA 3MM4A 4G67A 5JISA 1OGJA 1XKXA 3SEZA 2MYPA 1PL6A 3NEAA 2PRKA 1UD6A 1LNSA 1ULZA 3A4TA 1JALA 2O57A 2O52A 1BDBA 2PZFA 4YTEA 3TRFA 3GHHA 4PR3A 4XDZA 2NNWB 3QUBA 3LX4A 4LTNA 4M9XA 1QO0A 4IO1A 4JSYA 3SQLA 5A5VA 5FTLA 2ERXA 3HDGA 1QK4A 4RHFA 1KO5A 1FX1A 2BSQA 2PUFA 1KH1A 1VL5A 5CPBA 1M1YB 4WZLA 2Y66A 3E1SA 1T2NA 1E89A 2NYRA 2AOTB 1U2GC 1PKXA 4NMHA 4L0MA 6GPBA 5SYNA 4G8DA 1OTHA 1LJUA 3O82A 3F4LA 3MPUA 1D9ZA 1HLFA 1KJ9A 3CO5A 4PLVA 5A9RA 2GPYA 2PMCA 3UGTA 2C7OA 2YWHA 2PJUA 3WNCA 2G71A 3UNXA 1FRZA 3IOEA 3A9VA 3VBEA 3QEAZ 1YQWA 2XOEA 1Y1PA 2DTEA 2VYVD 1E3XA 3SF8A 3TZEA 4MI1A 5IU6A 2ZYVX 3EQZA 2ZJ7A 3JAWA 4LOIA 4DTCA 4CKZA 2XJ4A 1W4ZA 1JEDA 2Q5OA 1VOTA 4E5VA 3K92A 3CWCA 3WLLA 3K0CA 4EF6A 5L3SB 1K8QA 2CGEA 4FZ5A 5HDBB 1DOHA 4V1CB 1E3ZA 1FYEA 4FDTA 4ZVNA 1PNVA 1QIMA 3VSAA 1J25A 1DAOA 2J31A 1VDMA 2P40A 3BRQA 3ZZUA 3HCNA 5FFMA 4NR0A 3SJZA 2X6TA 3I09A 4YUWA 1LX6A 2WU0A 2VTVA 2AZDA 3DDUA 4P3XA 1JDUA 1UKYA 2AXQA 1GZSA 2RI1A 3PR1A 1OZGA 3EVNA 4JP1A 2G70A 4KVGA 3OA2A 4BBJA 2FW6A 2PLWA 1JEQA 1TU3A 5BQPA 5IULC 5KHLB 3F46A 4E5NA 3RAFC 1G9TA 1EWYA 2FQ1A 4JL5A 1Z5NA 3OJXA 1RJ9A 1NX9A 2Y4OA 4G4IA 1O4WA 2ONCA 2XF8A 1YWGO 1IONA 4JR2A 2E1BA 4UHBA 2O2EA 2W8BB 2X9NA 2HD4A 2YRXA 5DIZA 1JEAA 1ZMTA 2Y1EA 4N39A 4ALKA 4E03A 4ZV4A 4F4CA 2JC3A 3UUFA 2I6TA 3NDRA 1JLHA 2BGRA 3A9SA 4YWJA 2P68A 3EEFA 3RSHA 3N6XA 4HDNB 2O2DA 2R65A 1ID1A 5PNTA 2ZTHA 3R6WA 4UTZA 2A3RA 5CR9A 2QT0A 3V4FA 5EJ6A 3U0BA 1BC5A 4YC7A 3KJEA 2O8BB 4EMUA 5L9AA 3ACCA 1O0BA 2B3TA 3T3DA 2QENA 4IDDA 3SQNA 3UCXA 2JKVA 2JIRA 4LEIA 5KVAA 5LQSA 3DQPA 2RKWA 3B82A 2DX7A 3DXYA 4H3VA 1OYWA 2NUAB 5EN4A 2GCIA 1U3FA 4C01A 1A9QA 1SXJA 2ZU0C 2B2NA 3F8SA 4GQAA 1KYYA 4H9GA 4MWSA 1RTKA 1BXKA 3ERCA 3RHFA 1W4RA 1UOOA 2WRZA 4Q47A 3JD3A 2VH2A 2GREA 1ZBQA 1NR1A 2JRLA 2NZVG 3OLVA 1Z74A 2WP8J 4JN6B 3REGA 4OXXA 2PS0A 2DHRA 3S29A 1SXJB 3L01A 4X91A 2QXYA 4B2PA 2JZCA 4XQFA 3ZQ6A 1KC8D 1WNFA 3L79A 3TLZA 3NQ41 1C3OA 3RFCA 4NNOA 3ZU3A 3WGVA 4OHZA 2WWXA 1P1FA 3N9IA 1GT91 3CM0A 1RYMA 3E9DA 4WKNA 3O7WA 3CBQA 2PKQP 3GLIB 3AHFA 2BEUB 1I6WA 2I54A 2IV2X 1U90A 3FYHA 1QQBA 3KB1A 2HBQA 3BWYA 5B12A 13PKA 1SO8A 2WF9A 4DMKA 3QE2A 3H2YA 1E6UA 3QKTA 5IJ0B 2WIFA 4MGEA 3QUCA 1R0BA 5KSWB 5JU6A 1KC3A 3L18A 3SSNA 1UK7A 3K2IA 4CM5A 3FPGA 2CWDA 3PC8C 4I4CA 1S4QA 2CHFA 5E6UB 4IF6A 1IZZA 4OXIA 4W8HA 1FX0B 4GZLA 4H7DA 3BL6A 1R37A 2PGDA 4BJ1A 4YPOA 1YUNA 4Z4YA 1L4KA 1M6VA 1BHO1 1U1DA 3ACBA 3D3QA 4W6ZA 3U4DA 1JKIA 1U0OC 2CL5A 4M0PA 5F4BA 1SCAA 3LUKA 1M72A 2XZPA 3B20A 3PEUA 3C3XA 4LWZA 4X6UA 1PRYA 1OQAA 3BXEA 1ILWA 2REQB 3RSSA 2XGSA 3ZOZA 1MT3A 5JMPA 4XM1A 1Z9BA 1PT8A 1XYVA 1YJ8A 1C3LA 5DHTA 1C29B 2XZDA 4JJFA 2V7BA 2O06A 4FB4A 2O7RA 3PKZA 5FT9A 1D0SA 1GTMA 3NI2A 3QPDA 1KR2A 1CUDA 1Z0IA 3F3KA 4QUJA 4UPVA 3WLFA 3CONA 1KOFA 4D8VA 6REQA 3I1JA 4WESB 4HN4B 4X6LA 5FBKA 1G4HA 1J56A 1RQ7A 2XUHA 3ZWMA 1MHTA 3JQ9A 1JJAA 1FMLA 3OVMA 4MQFA 4OU5A 4CCAA 2XCRB 1NBWB 3WJAA 5HBGA 4BCCA 1U2DA 4FCCA 3A3BA 5AI0A 1KEPA 1BCSA 4LECA 2FSFA 3VR6H 3ZI7A 2DHQA 1HOTA 1S3SA 2BOVA 2XMQA 4PFJA 2J1LA 3SY8A 3UAOA 3W9SA 2FPKA 2REQA 5H3CA 1HTBA 4CUKA 1N3IA 4OYRA 4DV1B 1RE1A 2DT5A 1CDEA 3ER6A 4HQKA 3AB3A 3W5VA 4O0MA 4UDXX 4ZTUB 3QX3A 3A4IA 1INLA 3HGQA 1DBRA 1CJSA 3BWCA 3H83A 2DWUA 5THQA 4EGSA 4C7OA 3GGGA 4V0ME 3K32A 4DIMA 1ML3A 3LDAA 2BMEA 4EUFA 4X3CA 3DF9A 3UJ8A 2FFHA 4YP9A 1IWPB 5EQJB 1VECA 3F5MA 3PQFA 1A8QA 2ORYA 2WD9A 3K4HA 4X61A 5FOSA 2OUKA 3AFHA 5IJXA 1PR1A 1OB0A 2D1FA 1YRWA 2Q45A 3W5HA 3MS7A 3NP7A 4ZO7A 2GD0A 1N08A 2N42A 2GK6A 4L50A 1FRQA 1K4YA 2EZ8A 4CVNA 4DG9A 3LUBA 4PG7A 4GR9A 1DAKA 3UA4A 1AA9A 2VH5R 2NU8A 4DCCA 2ZBEA 4ZKDA 5L4SA 5KNDA 5DVZA 2RHOA 3JQDA 2XB8A 3JS5A 1FP2A 2J0SA 4CV1A 3GELA 3NNSA 1T5IA 1UCFA 2QLMA 1D2GA 3E81A 2A1TS 4MGHA 3SFZA 5BUCA 4LC0A 2AJLI 3V4RA 1UDBA 2FUNB 2WFMA 1IN7A 1RRMA 3KTOA 4ME6A 2D7DA 1NJFA 4Q1DA 2CMDA 1VGQA 2IOHA 2CKDA 4JB8A 4LZOA 2LBPA 3BD7A 3AFGA 3BZWA 3FG9A 2ONYA 5HVNA 2MYUA 2JBHA 3U48A 3PFGA 2YJTD 2PNFA 4ZYLA 4XLHA 2EGHA 1IDN1 1KARA 5TPZA 1FFEA 1P0FA 2C7GA 3K0SA 3TFOA 4XM3A 1WPQA 2IF2A 2NVUA 2Q4DA 2OAQ1 1YUBA 1ESCA 2GI4A 3LD9A 2JIOA 1E5LA 4HGPA 1EA7A 1MA0A 1TM5E 4JQZA 3ZNPA 1ACLA 1H5QA 5A4MS 5AFSA 5HOQA 1ODTC 3BIXA 4DAOA 1GPNA 3DL0A 1OXUA 2PT7A 5JBQA 2P62A 1DPGA 2WKQA 5AKLA 1RYDA 3A31A 5JD4A 3U37A 2HSZA 1J22A 1EVYA 5E7MA 5LCXA 1SCQA 5ALIA 1NIJA 3T5AA 1O57A 1JAZA 3NXKA 2PR2A 4J49A 4ZP1A 3PSHA 5IYZA 1XZPA 1J2TA 3BBPA 2P2ZA 4FW8A 4DARA 5G4KB 3L93A 1L1FA 3D7SA 2H59A 3ZQKA 1ESMA 4ZCPA 1KL7A 4OH1A 5A7GA 4HX5A 3VJLA 3RM3A 5CDHA 5LU8A 2IS6A 2ATIA 4NZ9A 5KINB 4RHUA 3CPSA 4UUMA 3TBKA 4GFDA 1ZD8A 1K9MD 4QXMA 3UK0A 1KYIA 1IVYA 1CUXA 3IOBA 2JANA 2C98A 3E7FA 3DVAA 4GQNA 4DNRB 2HK9A 4YLGA 5JMWA 2GK4A 5ESWA 1IBCA 3ZGNA 3STHA 3SICE 2XT0A 1SEPA 3JQAA 3TXXA 4JBYA 5GONF 4IYRA 4BCBA 4ZQHA 3H1AA 1GJRA 7MHTA 2AG8A 4ZVPA 3H9GA 3NC4A 1XF9A 4XKJA 3QLTA 4YECA 1AX9A 5CAEA 1OLUB 1TKAA 1J0XO 3QVGB 2OFXA 5DNCA 4O1IA 2W90A 4C7BA 5I8PA 1Z16A 4JQCA 1ZVJA 3QKSB 3OF2A 1Y8CA 3JQAB 5LJIA 4NCXA 1YKSA 2PWAA 3G2NA 2GWRA 2XTMA 3PXAA 1LS6A 2D5BA 4HZUA 3KOMA 1UKVY 1KMMA 3CUKA 5COAA 1T1RA 2ZBVA 2VN8A 4PSVA 5J35A 1N9GB 2QMZA 2Q6VA 2QRNA 1A9XB 2VTKA 4XX0B 3DNFA 5FR1A 1KA9H 1WL8A 2JFWA 4X1YA 3RYFB 3WLHA 4BN5A 3B6KA 1GPMA 3E7WA 4UCWA 4ZYZA 4GOLD 3MMXA 3U19A 4RSMA 2BDUA 3WV5A 1T3TA 3P0JA 4FGUA 5F9MA 3S1SA 4B32A 3PNMA 4QBIA 3CRMA 1ZM2A 3A58B 1DQPA 3BM5A 3DZHA 1Q1BA 3UJDA 3R40A 4GKAA 4X3OA 3QUQA 2UVDA 4JMPA 3F3MA 5EIEA 4UMVA 1JEYA 3IL2A 2GNPA 4FGLA 4BO3A 5L3RA 3MA0A 4E3WA 3LBYA 3S5UA 4A0FA 4DA8A 4F85A 3THXB 2ZUSA 2WFLB 2YWFA 4LZWA 4X97A 5KHOC 2JH3A 1KVTA 3CTPA 2LW7A 3TR6A 1II0A 2QN1A 5F4MA 4KVFA 4DF3A 1GTG1 2VHXA 2FZ4A 3VKWA 5E38A 4HLUA 1KVQA 3VUFA 2QJFA 3A3PA 2DC1A 1TGVA 1E9FA 3ZZMA 2Q27A 1ZGJA 2W2NA 2PGIA 1CJVC 2C8LA 3HRHA 2I7CA 4TXJA 5P21A 1ZP6A 1ZM9A 3AB7A 4CHGA 4L85A 4BNKA 5HM8A 1SC4A 1II8A 3TK1A 1DNPA 2R2AA 4DV4B 2O8CB 1V1RB 3COSA 1NIPA 1I5RA 3RFTA 1U8FO 1ZUNA 5GGYA 1OXKB 3U4IA 1SG0A 1V16A 3QV1A 1TTQB 3HO6A 1FLVA 3HWRA 3PI7A 1I51A 3ND5A 1YMVA 1MRSA 4MO2A 4JOQA 1EK1A 3CEMA 2C61A 4S04A 3O4IA 3NT2A 4JOSA 4MVJF 1L7MA 4BEWA 2JAOA 1FDSA 3AESB 4L3VA 5EAIA 1XRQA 1YBFA 5F35A 3RVOA 4B81A 3RS4A 5LZ9A 5B7PA 3LRTA 4CNQA 4PAQA 3HNPA 1C1DB 2ZT6A 2V9ZA 4KFSA 3FPCA 4QGHA 3FRIA 4YV2A 3PENA 5EHXA 2CDRA 1FNSA 2XWBF 4XE5A 1C9NA 1CX9B 2CLHB 5FA6A 3ORQA 4FCTA 5CMLA 3S2YA 5CITA 3F6SA 3PEEA 1SHTX 1NJ2A 1YO6A 1WBJB 4ILEA 1AA6A 1E4VA 1K3FA 2OB1A 3FYUC 4G5GA 1ZD3A 2W98A 3DBIA 4M60A 1I2DA 1EUYA 1ZVMA 3HBJA 3K16A 5TJHA 3GLRA 2B9VA 4I1VA 1USKA 4Z4SA 4B73A 4WEQA 3IHTA 3PQ4A 1HEIA 3F6YA 5KB3A 4P7FA 4YMLA 4GBGA 2C54A 4L8YA 4P33A 1Q7TA 4J1TA 1HNZB 2YOFA 4L28A 4OL9A 5IYNA 3ETCA 4WLEA 3O1HB 4AUMA 1GSOA 2P27A 3HFRA 3IQFA 5G1PA 4LN1A 1KZ7B 3CH6A 1AS0A 4PGMA 5ICGA 4BFZA 4A36A 3JY6A 1CETA 1B3RA 1QE0A 3A35A 1CY4A 4GMGA 2AH5A 4RD1A 1FSZA 1Z4JA 5A4JA 4U2BA 1KEEB 3AZOA 2JZNA 4Q4CA 3MGKA 2WAMA 3DZJA 4XD7D 1I5OA 4UQLA 1NOIA 3CNHA 1QP8A 5JH7B 3SZRA 4P36A 1YRBA 3LVFO 3A6JA 4GNKA 1W8IA 3BB1A 1Z4LA 4MRRA 4D3FA 5BWOA 3GDWA 4F2WA 1D4ZA 3U7RA 3QOWA 4FOLA 4DV6B 4D4JA 3U61B 4M1WA 2YVQA 4BKOA 3IQIX 4QBFA 4DWJA 5EP3A 4EVIA 3CC7B 3BERA 1QIEA 3OOWA 2GNOA 5CDYA 3GDGA 2JAWA 3WKDA 1NWCA 3KRTA 1CD5A 3N7AA 3IUJA 4FDUA 4WNAA 3LQ4A 3ME5A 3L8EA 1L4YA 4CGZA 5JEDA 3E27A 2QG9A 3GRPA 4DVGA 4B40A 1R6BX 3I6IA 3I8XA 3JQGB 4OJMX 3OEED 5D01A 2PX4A 5KREA 1UFQA 2GAAA 4MGKR 3VR4H 3PUJA 4JNCA 3AJDA 3WLRA 2IYSA 5TGTA 3ABRB 4HB3A 1CF2O 2I2BA 2PX3A 3DNPA 3ZV4A 1M1XB 4MUIA 3BB4A 1EUCB 1DP4A 2QG6A 3DKRA 3IMEA 1T8PA 1VE1A 1Z6AA 2VAPA 4FFBB 2XBMA 1OBVA 2YXBA 3OZWA 4G84A 4MI6A 4DLAA 5LKAA 2Q46A 3BL5A 1N36B 5ITZB 1Q3HA 2JDID 4HQLA 3U31A 3G1UA 3U7QA 4BGDA 3EDRA 3A1SA 3UGQA 4MUFA 2GMWA 2QYHA 1O94C 2YWJA 3ZS9A 5KYYB 1KNQA 2PUHA 4EW3A 3CESA 1SOUA 4LYGA 2X7JA 3ADDA 4P7KA 1B74A 1NDHA 1M6YA 4OG2A 5DP2A 2AG5A 1G64A 2VDJA 3IDZA 4IP0A 3SMVA 3UMFA 2I9KA 5DLYA 2Y9PB 1C2TA 2H7VA 2VCEA 2XMGA 3BORA 3E8XA 3EXFA 4LXTA 4XARA 3UWOA 2NZJA 1PW5A 1QR6A 2GHQA 1PS8A 2GXAA 4N54A 1UDAA 5EXXA 3L07A 3IHWA 2VJCA 1FSGA 5B3AA 5J4VA 4LTDA 4KP7A 4DS3A 2QN3A 5BSRA 3T52A 4FD3A 4DYVA 5T4BA 3EMKA 4D3ZA 1BS1A 5KOJA 5B7NA 4BQIA 2XCTB 4NPHA 3O92A 2FA9A 4ZVRA 1A4RA 1RQPA 5AKZA 5EP2A 1U1EA 3M5DA 2R1TA 2ZYDA 4YEJA 4KXMA 2QEXB 4BEBA 3KOZA 4YV0A 4D9FA 4MEAA 1B0UA 2IL1A 2W8BA 3HDQA 1NAIA 4PS0A 4LRWA 1DCTA 3P5SA 1ACJA 3H75A 1TMYA 2NUBA 3E5MA 3NM5A 1E2DA 3K09A 5BR1A 3S7TA 2PUAA 2FAXA 1ZONA 1J0BA 4MB2A 3I62A 1E1QA 1X92A 4AG6A 2X1HA 1ORRA 4H1VA 1NXTA 4X1OA 5E1MA 4TYYA 1SD1A 1P7CA 3K9WA 3TGLA 3GEIA 2OFOA 5B30A 2ZTSA 3GROA 2XT9A 2PGOA 2WSMA 3BF7A 3FYUA 4A6DA 2D74A 3CPEA 4B80A 4QODA 1S8AA 3JWJA 4JT2A 1AS3A 3VMFA 2CNNA 3TZCA 4BNDA 4PZ0A 4IY1A 2GESA 2I1QA 2WUFA 3A4VA 1SZDA 3LVQE 3GLGE 5ELXA 5SZHB 3NXSA 4WH0A 3LG2A 4FHGA 4G5YA 5DW3A 3HEBA 3LFTA 3OPYB 4OBEA 4TM7A 5GM1A 2NUTA 3NLLA 4WUTA 4PN7A 1X8LA 2YN4A 3O95A 3MT7A 5K0FA 4CQNA 1MZVA 4YLEA 3OM0A 4EKDA 2Z57A 4P86A 4Q7JB 2OWEA 3ROZA 3TQTA 5JZMA 4U7TB 2I65A 2QN9A 3OCYA 4D4KA 2C4NA 2I66A 3ILXA 1C8KA 2DIEA 3R7WB 3OJFA 4OJYA 1VYTA 3A28A 5KOHB 4F5YA 2ZE5A 4QBHA 1T9BA 3UM9A 1OH8A 3FOCA 4ON9A 2OSVA 2WFZA 2ZUWA 4XUDA 4E1VA 3ONUA 1T4MA 3AUTA 5GJWC 3OKPA 4XMYA 2AN4A 2WLTA 3F4BA 4YMUA 4X7DA 2XXJA 4KFCA 5KMGA 1F3LA 3C7DB 4MWEA 5IZCA 1GZHB 2VP3A 3LNCA 3K0EA 3K96A 3TTXA 5TEWA 2D9RA 1EM8B 3AETB 2OPBA 2VHUA 3ORRA 3WKCA 4B0PA 5KYXA 4D6YA 3BCDA 4HN9A 1UPBA 4JCCA 1G7TA 5DYWA 5LOVA 2MSLA 1BGWA 4GO1A 3W8NA 5C8YB 2YNMC 4BO1A 2A35A 4NZPA 4RWEA 1RR6A 3SXUB 2Z5VA 3LYHA 3WX0A 4R7GA 1AUOA 5F4OA 2A9RA 4K1XA 4TYWA 3WQZA 1C3XA 2G7MC 3C4QA 1ZC3A 3FN4A 4P4GA 1PT6A 3T9EA 1P7YA 1EVEA 2PSDA 3CG0A 3UQYS 1LZLA 1D1SA 2PQ6A 4L7VA 1W4CA 1DBQA 3S1AA 3BWBA 3QZUA 4HDRA 5AKHA 4X93A 3DFFA 5HZGA 3R4VA 2IKQA 1LDEA 2B5WA 3RABA 3U5TA 1CR1A 4H27A 1NULA 2WNIA 2PT6A 4HBGA 3RWBA 3SJ7A 3NHFA 1IMJA 1EK0A 2QGGA 4YAFA 1QIJA 2JI7A 1F8GA 2YY7A 3BSFA 5M34A 2QSYA 2QTVA 1AF7A 3IPXA 3U6KA 1YONA 3SEAA 3HHPA 3V5NA 3QG5A 4ZZ0A 5ICSA 4LA4A 2O7VA 3VGJA 1XNQB 1Y4ZA 7MDHA 1SXHA 5DBFA 3MJTA 5A89A 2O8EA 2OZEA 1MVOA 1RRPA 1Q57A 2NU9B 2BSAA 4XIJA 3K6JA 1TQ8A 5LXTA 6YASA 2ZWIA 3DJYA 1I2ZA 3H18A 4K88A 1NFRA 3UMGA 3A9UA 3V4LA 4MK4A 1A2KC 1ZH4A 3DW3X 3ELBA 4BO5A 4J16A 4KAFA 2H63A 2VTBA 2XDWA 2I3ZA 4YRSA 5BP7A 1ZR2A 2HMAA 1J07A 3VPXA 2CXNA 1M8GA 4PG5A 3ZY4A 1O7JA 5ERXA 4YAOA 3SHOA 7YASA 4D3SA 4OPOA 3REFA 2F67A 5TQJA 4OLFA 3I0NA 5EINA 5DF1A 2Y27A 2YQ4A 3FM9A 2XHEA 4NXMB 4MWGA 2WM9B 1T25A 1YCHA 2M6RA 1HDXA 2WLSA 3AESA 4Z51A 2HR1A 2YC4C 2O1SA 2XITA 1AHHA 1V8DA 3TQFA 3UOWA 3SCZA 2AZXA 1XDUA 4OSPA 1JLMA 4CW7A 4G2TA 3SS9X 3JU3A 4BQSA 2P5SA 5AM0A 4DMGA 3A9RA 1BYIA 2IZOA 2Y76A 1KRXA 1BPLA 4IIJA 2OLKA 5HJ7A 1NVFA 3CKYA 1Z8DA 4ZA2A 1CQPA 2E87A 4X1IA 1GU7A 5DWQA 5AM4A 2G4LA 1UBEA 2QNIA 1OWOA 1E94E 1YE3A 2AZTA 2H2AA 3EPPA 4GOOD 2I99A 1KK0A 4DK0A 3E84A 2X53S 1NLUA 2RDMA 3EVTA 3IXLA 2VJBA 3EQ7A 5REQB 1MC8A 1T2EA 4IIVA 2GM3A 3PU6A 5CG1A 1L7DA 3VUEA 3HQ4O 1CR2A 5FFFA 3U4CA 4N49A 1YIAA 1FW8A 2WKPA 3QNMA 1HH4A 1BXZA 1H9AA 1V71A 2K5UA 3EW9A 3KKMA 3ZCXA 2IDJA 4BFCA 4L5YA 3ENQA 1VG8A 1JEQB 2FZKA 1R15A 3EEBA 3Q2KA 4NOKA 4R8MA 4GS5A 4QSHA 1N1GA 1TEHA 2IDZA 3GL9A 4HDSA 2BDTA 5KW9A 1B42A 4S0ZA 1O97D 5BOVA 1VIMA 2UUAB 1U2EA 1GKLA 3R5FA 3SVTA 5EMNA 1DKMA 1YV9A 5ALTA 1BXGB 4NG5A 2HT6A 4U6QA 5H3HA 4PSUA 3AUFA 4MV8A 4IGEA 1JXOA 3THSA 1UJMA 2Q8NA 4F7DA 3GNQA 5DNEA 3FCUB 2XADA 1OI3A 1IB6A 3R76A 5K0TA 1U2TA 5DX0A 1Y1SA 4B83A 1GITA 5A5EA 3FCAA 2FPLA 1QR2A 4HDNA 2G1UA 2XVAA 5AVWA 4NBKA 1XEXA 1IY9A 2C99A 2RGDA 1U8AA 5I4KA 2GNAA 4L08A 3X43A 2BGGA 1UJ6A 1CVLA 3AI1A 4QYSA 4ZI5A 3C8DA 5EHQA 2XNJA 4IFTA 5DHQA 3UO8B 4FYHA 2I6FA 2H2IA 3IMGA 4X94A 4Y9TA 5BURA 1P7PA 2Q2WA 4U7PB 1XTRA 4WIAA 2XCIA 1P2TA 4KNYA 3Q38A 1LC0A 3PC4A 3E2IA 4R51A 1ZL0A 2I29A 2J6IA 5G2OA 3RTAA 3TZ6A 4Z6KA 1A8HA 3CRW1 4P7BA 1H3FA 2D2VA 2FQYA 3B8EA 4BQNA 3EVEA 2Q5IA 3GVCA 4WVFA 3ASQA 3VVBA 1KIFA 1LJLA 2OESA 2C04A 3G6KA 4TWJA 3SHTA 4BV2A 3PX3A 1R8JA 2ZPUA 3O2QB 5CFLA 3CPJB 4V24A 4JSRA 1BWPA 1QV6A 2WPNA 2Z2IA 5HF6A 5IC6A 2ZXUA 1V4NA 2ZSIA 3G2LA 3OJEA 5E4YA 4B3HA 4N9WA 5LOVF 3AEKA 5EWJB 4F4UA 1E2FA 3JR7A 3I56B 3LA8A 2KJQA 4K1LA 1UEIA 2CF6A 4DG5A 3EF1A 3EVFA 3R4CA 3PHBE 3AOEC 3OLYA 3HHEA 3HEAA 1ZWLA 1N34B 3R09A 1P8JA 3HJCA 4I8DA 4JYCA 4LYDA 1NMZA 5DTJA 4YP0A 3ABZA 2V6MA 3NHYA 1NOKA 4FMDB 3MAJA 1Q82D 1VGVA 4E15A 3N7TA 1EEXB 3Q72A 2Y1OA 1NVVQ 1I4DD 2Q4EA 2RB5A 2QRMA 3V33A 1E0KA 3ZWKA 4F5WA 4AT1A 3HN7A 3WGTA 4HIZA 4TSFD 5BWBA 3J80A 1YCGA 1ZGHA 1T10A 3IR5A 1QO9A 3KV3O 5K09A 5HKKD 4BN4A 2J0UA 1XZ8A 4C4RA 1OT3A 5SICE 1XZFA 4HPXB 5TQVA 2JLCA 4X8LA 2GXUA 1IOLA 4H7HA 4QVKA 5IUNC 1CQJA 4AJLA 1JAHA 4B6PA 2WG2A 4KWIA 3UMVA 2I3GA 4IXNA 1IG0A 1KZ9A 2FSVC 3TL3A 1M2KA 2P9HA 2PQ2A 1BCRA 2PV7A 4XEHA 5FHRA 1NQWA 2C03A 2GS9A 2IITA 3KV1A 3D8BA 4FE7A 4XUEA 4Z99A 5DXFA 4PC3A 2GF9A 3VNRA 1AKRA 1DBVO 2WIAA 4UUPA 3C5WP 2O3SA 5K3SA 5EE0A 1C14A 4F96A 5IMBA 4ZHQB 3D31A 2QS9A 4JC0A 4JQOA 2Z6QA 2HA4A 2AFIE 3ZV5A 2PYZA 3JZIA 4JFRA 1EP1B 2YRWA 3HYCA 5HOEA 1JQKA 5AVYA 4B3BA 4A2WA 1LK5A 1OD6A 5KNLA 2XMRA 2Y0EA 3H16A 3ROQA 2XUQA 4AF6A 4EH1A 4OHCA 4IIBA 1S9HA 1ADCA 1QQ5A 3AW8A 2IUYA 4I9NA 1IFXA 3K35A 2D4AA 4G5HA 1GPYA 1I0ZA 3L0YA 1YVDA 3UAGA 4AS2A 4O2RA 5TGDA 3UK7A 2RH5A 3G05A 3NW9A 4G81A 4KMMA 2FKNA 5B5SA 4NHOA 2LV8A 4OV6B 4HH1A 3VR1A 3EARA 1GGEA 3FETA 5TX7A 3J81k 4WZEA 3SEJA 1E9VA 1Z4PX 2VJMB 5GM2A 2P4QA 4CQMA 1Y63A 2I4LA 3TN7A 4D8YA 2F1IA 3I39X 2OCBA 5LXTF 3IALA 3WBFA 3KT0A 2G5TA 3NNDA 4MS1A 1XCJA 4ZAGA 3MBOA 3OOHA 4D9JA 4DRZA 5L4LA 1VPWA 3QHQA 5K5EA 1EQ2A 1Q21A 3KEGA 4I08A 5KNBD 1NYTA 1QHNA 5BN4A 2W58A 4H6WA 4UAVA 3RVBA 3Q8KA 1V7PC 2WMYA 3IE0A 2OQVA 2GN2A 3TLCA 3USCS 1US8B 1N9ZA 5K0BA 2PT9A 1PX0A 2DFTA 4GKJB 2PH3A 1P2BA 4YPFA 4CIAA 2WDPA 3NCHA 4IG4A 3T35A 4D26A 3PPVA 2NT3A 5BSYA 3BF8A 2UYGA 4HTFA 3ZXXA 5FLEX 1E77A 3N0VA 4WBNB 4P31A 1EK5A 5B1EA 1MXFA 2AI1A 1P0PA 5BW6B 3GFOA 3H2SA 3WAJA 5FBVB 2PSEA 5BSMA 4OHRA 1DIBA 1X9HA 2R7KA 3B2QA 4HATA 2DYIA 1HT2E 4N7MA 3UFXA 5A88A 5FXMA 2Y1GA 1QP0A 2C83A 3M4ZA 4NE9A 1THZA 1PI3A 2CCJA 1QGZA 4G1BA 3DKIA 3SEQA 3HVJA 3HPRA 2ZRFA 1DX9A 1RT9A 3G7UA 3IIEA 3JVVA 3PHHA 4S24A 3DWFA 4XEUA 3HA5A 1G291 3EAQA 5K3DA 2M2IA 3OW2B 2ZSAA 3NHWA 5KQPA 2ZBUA 4O4JF 2UKDA 1VFPA 2H4HA 2QTMA 3D8TA 4LC1A 4WK2B 5DTRA 4HNTA 5LZ8A 4X7EA 4N18A 2P2GA 4CQMD 4D80A 4QVAA 4Y0AA 2PL5A 1OSNA 2C0QA 4GOJA 4O2AF 4JMQA 2I6SA 3WGYA 4GLOA 1Q84A 2VO1A 4KE8A 4PSKA 3AKEA 4TMYA 5E6UA 5DN6D 4BXOA 4PPGA 1Z2OX 3IV7A 1NUTA 1G41A 4PGFA 1R6DA 1TZ2A 4FFBA 5C4MA 2WNHA 4D2IA 4G25A 3UV7A 2GTIA 4PRKA 1NRIA 2I8CA 2G40A 3F47A 4CN9A 5JY6A 1W8DA 2GDJA 4HEJA 4MRMB 1VQ4B 2PAAA 4P25A 1CS4C 1RMQA 2Y0BA 3ISVA 4KRGA 3KR1A 3W34A 2Q49A 3F74A 4A82A 2PKRA 5AQEA 1NQTA 4F06A 1SBQA 1RFLA 5LNK6 1UJ5A 2X6QA 1W5BA 2C29D 3CF4G 2HSWA 4MVJD 4AJOA 4DUGD 2PCLA 3QPVA 3H7IA 5C81A 3B6ZA 1DL5A 1P3JA 4KC0A 4BRWA 5L6LB 3OQ6A 4YACA 3IDOA 1T5EA 4FC6A 3ADKA 4BS9A 2NACA 1HDGO 2Y1WA 2BHNA 5CX4A 4CEJA 1GUFA 2D0PB 1Q22A 4JD5A 4QO7A 3AZPA 1FVFA 4HB4A 1QX4A 2V3WA 1VBKA 3LVBA 1W4LA 4BAGA 1ISPA 1YTLA 3A1EA 4AJJA 1R3DA 1JIKA 4URXR 1OB2A 2VDRB 3EVBA 2WPDD 2IEAA 1SCDA 2VEOA 4MPDA 1G7CA 3R5KA 1JW9B 2VNIA 4U7JA 5C4GB 5C52B 2QBYA 1FFDA 2FV8A 4RCVA 1J5EB 2QUAA 1QE5A 4OHVA 1VHDA 1P1CA 2ZREA 1M2HA 4B7CA 2NXEA 1I94B 1W34A 2C9YA 5LUAA 4MARA 1L4UA 1AOXA 4GICA 2KQUA 4UE3S 5CTAA 1SBIA 4V0NA 3PFBA 2FN3A 3PA6A 4RPJA 2UZIR 3QX9A 3FPKA 5H4GA 4RSHA 2OORC 4MWDA 1M5RA 1PZGA 2RGUA 2DPMA 1RJ9B 3KLNA 4JOCA 4A6XA 2W11A 4IIUA 1UDRA 2Z95A 2DLDA 3CRZA 1PK7A 3FYUB 4ROTA 4ZVSA 4QM7A 4JT9A 3ZZ1A 1ZGAA 1H2XA 3NVKI 2X40A 4LVCA 1ZI8A 4AJIA 1O0SA 2FCRA 2ZU6A 1PNOA 3DQZA 3I32A 1C4KA 3S2UA 1U2ZA 2VL7A 5EZSA 4JI7B 3TS1A 4MGIR 3LX8A 3ROKA 3RAPR 1NQXA 4N76A 3TKLA 3KZKA