2WR8A

Structure of pyrococcus horikoshii sam hydroxide adenosyltransferase in complex with sah
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
259
structure length
258
Chain Sequence
b'GSHMITLTTDFGLKGPYVGEMKVAMLRINPNAKIVDVTHSVTRHSILEGSFVMEQVVKYSPKGTVHVGVIDPGVGERRAIVIEGDQYLVVPDNGLATLPLKHIKVKSVYEIIPDKIRKFTGWEISSTFHGRDIFGPAGALIEKGIHPEEFGREIPVDSIVKLNVEPRKEGDVWILKVIYIDDFGNVILNLENYEKPRTVELLDFNLRLPYLETYGLVEKGEMLALPGSHDYLEIAVNMGSAAERLNVKVGDELRVRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN PH0463
publication title Mechanistic Insights Into Water Activation in Sam Hydroxide Adenosyltransferase (Duf-62).
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 77
structure length 258
sequence length 259
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2wr8A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2wr8A01
1RQPA 5FIUA 2Q6OA 2CBXA 2V7XA 2F4NA 2C4TA 2WR8A 2Q6LA 2C2WA 4CQJA 2V7TA 2V7WA 2Q6KA 2C5HA 5LMZA 2CW5A 2ZBUA 2Q6IA 2ZBVA 2C5BA 1WU8A 2V7VA 2V7UA 1RQRA 2C4UA 2CC2A 5B6IA
chains in the Genus database with same CATH superfamily
1E20A 1EBFA 5FPTA 1XOIA 5FB3A 4H59A 621PA 1AV6A 3TNYA 1Q0UA 3C45A 1N2SA 5JWHA 2F00A 2PMKA 1M10A 1SC4A 2X5XA 3I04A 2TMGA 2YZNA 4FD2A 4E5YA 5G4KB 3Q7IA 2RB5A 2FZEA 4OJQA 1KIMA 1XMVA 3I9V6 4TQ9A 5JIBA 1XI2A 5JHGB 1SHZA 3E7DA 3Q7RA 3CC4B 1V39A 3H4VA 2FE4A 2GKSA 4NCBA 1LD3A 1G8FA 1NV9A 3OF3A 1QVRA 1BA2A 3PENA 4UBNA 2QTVA 1Y9EA 5I7WA 3VR4D 3Q3IA 4X1OA 3N87A 3TOVA 4DJDC 5HDBB 4RFLA 5FPHA 2BD0A 4ZVMA 2B1RA 1TJYA 5KYYB 4HRXA 4FB5A 1MIOB 4OYRA 3GMDA 1XHFA 4DDUA 1OX5A 1XRPA 2J9FB 5HJ7A 1L1QA 1Z33A 1II0A 2LDBA 4Y2GA 1HBJA 2ZSIA 2F43A 4GQBA 4G0VA 3VZRA 4WFJA 1Z12A 1KWKA 4LXQA 4DWVA 3AO0B 1A9XB 1P7VA 2L2QA 4GMHA 3VJRA 3HEMA 4CL2A 3EC1A 4LWPA 1C1XB 1JIXA 4A03A 1LI5A 4BHTA 1GTRA 2GQ0A 2HXGA 2AQ8A 4MRVA 4N4AA 5ALGA 3MMSA 3S6JA 3AIMA 2ZWOA 3SZLA 3ZKWB 2MOKA 2CL7X 4HYQA 4X7DA 1JP7A 5HF5A 1KA9H 2IUYA 4KOEC 2AMVA 2Q27A 4LI3X 5JD3A 2HYDA 4EO9A 1DOZA 3DXFA 2IYRA 3M5PA 4L73A 4I9HA 2EV9A 5CDHA 2PJUA 2PE5A 1C7IA 1HZZC 1LPAB 5TRDA 1X2EA 2F4NA 2QS9A 1WAMA 2ZI9A 4TVBA 5JPIA 5F7JA 1ES9A 5L3ZA 3ZZMA 1KZ9A 3N9IA 2Q6VA 3HSYA 3QU9A 4NDAA 4FHGA 3CP2A 1VPTA 4M0CA 4XZ3A 2Y1LA 4FE7A 3TOCA 3IHLA 4ZMRA 3ZE8A 1AUVA 1TM5E 4YS6A 4B76A 4J4BA 3AP2A 1P3Y1 5E7IA 4NJEB 1EHYA 3UJDA 3D9QX 3FZEA 1GCIA 2ECFA 1JFFA 2PUVA 2DBZA 1I01A 2JANA 3EZ7A 3NUZA 3S2EA 1JEYA 3CLUD 4OHCA 1XP8A 3JVVA 3OX1A 4R1NA 4PC7A 3DG9A 2FMKA 3NBXX 1INLA 4BLSA 1G16A 2ZRDA 5G1OA 1EZZA 5TRTA 2RAFA 1VIYA 3QWIA 1VG1A 1YB1A 2COEA 2IIVA 3A9WA 1QYVA 3GVIA 1MOPA 3AEUA 5JARA 2OD7A 4HDKB 4LJ4A 2DWUA 2WHEA 2ZVDA 5A7HA 3MAGA 4BWYA 2AVNA 1JHXA 3LUDA 4NYJR 3ELYA 4CL3A 4L8YA 1DMSA 2ZW9A 3P20A 3P9NA 5HKLA 5DN6A 4TXMA 3JASB 2R84A 2E48A 1ISPA 3AF6A 1WNFA 4C6HA 2PZGA 4EEXA 2XF8A 4CW7A 3OF5A 5BSYA 3H2BA 3COPA 3FDJA 3I30X 5FNVF 4X63A 3T4UA 4F6LA 4L5YA 4O3MA 1KH1A 1LK7A 3CLRD 3B78A 1D2HA 3AUJB 3G9ZA 4IIXA 4N7JA 4YO7A 2Q0HA 3WISA 2YIDA 4JUDX 1C4OA 2ZIAA 3ZHVA 4QDUA 2QWXA 3OE4A 3OLZA 3EDMA 3ZEAA 4EJSC 4K2HA 4LBWA 5K3EA 1JS1X 1A2QA 2ZSBA 3WLKX 4H6XA 2AR9A 1KDPA 4DTCA 2IUFA 1OYVA 4FW9A 3JD4A 1C8BA 2ETVA 6NULA 4EMUA 1IY8A 4HHEA 1CR4A 3TD9A 2PR7A 4TMXA 4KUHA 4UOQA 1O9HA 5AW6A 4UXJA 4LYGA 4XNFA 4LF8B 2ACWA 4F7DA 3G8BA 3K1TA 4PTYA 5FBHA 1TKAA 3ZLVA 4C30A 4XFKA 1GKKA 1U7PA 4P35A 5EP2A 5F3DA 4A92A 1P39A 3BJEA 4MULA 1DDIA 3QSGA 1GEGA 1XTBA 1HE1C 4N40A 4EHNA 4F85A 1S4QA 4RLQA 1LQTA 4B7UA 1VGVA 3DOEA 2Q4TA 2VH5R 5IT5A 5H8WA 3C14C 1P2BA 3C4VA 2B21A 4TTQA 5CYGA 3O4RA 1P0CA 2Q99A 3AUFA 4UDOA 3FI0A 1Z0KA 5LBUA 1X38A 2PVPA 2BH2A 3WNQA 3P0IA 1UMCB 5FOSA 1CXZA 4KGDA 5C1IA 1A9RA 4UEQA 2WF8A 3WDLA 2GM9A 4XLZA 2WMDA 3DFUA 4OHOA 3T7AA 4AZTA 2PZLA 3U7JA 2WSYB 1DINA 4I19A 4E07A 2HHJA 5FULA 1ZMRA 2PUWA 2QRNA 2X5NA 1F1BA 3ASSA 5AW1A 4R2JA 3RO7A 3V8NA 3JVIA 4GPIB 2P41A 4YJFA 3LK7A 1WPGA 1PYGA 2G08A 5GJCA 1DADA 1ZXLA 4HLNA 2GBCA 4RYDA 3UFXA 2R00A 5B3KA 3QUCA 1G9TA 3AVYA 1I4EB 4G4IA 4FWTA 1K89A 4HJRA 1PWZA 1W2HA 4GKAA 4ZXFA 5ES4B 5FWAA 2OXTA 3OZEA 4MJXA 1RKBA 2VYQA 2CY0A 3UKDA 1ZNWA 4PSDA 5IG2A 3FE2A 1LSJA 3IQZA 1K7EB 4Y7DA 1RPAA 4XH9B 2JHCA 1QIGA 3H05A 3HPRA 2PRYA 1Q7GA 1W1IA 3MUEA 4U2CA 5FPPA 3UUFA 1XRLA 2BI7A 1MXHA 2EKPA 2GERA 3EWIA 1NV8A 1RHJA 1DXHA 3LWNA 3G2NA 2WKWA 4JKIA 1EAMA 4PLGA 4V2UA 5BWMA 1DAIA 2J87A 3OJWA 1XZJA 1H66A 3CG0A 4LVOA 4Y1GA 2RHOA 3WL3A 1HA3A 2LKCA 1QQ5A 3IALA 2CHQA 2FOIA 2CE2X 2D0IA 2I7DA 4BZZA 4YJ3F 4L1KA 4XQEA 1GUBA 2J67A 2EEPA 2TMKA 4KTVE 3PWTA 1NHWA 3UH0A 2Q3HA 2RI0A 5JWRA 2GM5A 4BO1A 1TZCA 1RXVA 4BFUA 5AI8A 4QPJC 3ZXXA 4QULA 2PO5A 3L1IA 1V7QA 4KV9A 1N2IA 4CM6A 1JA9A 3IUSA 3HM9A 1B16A 1GFWA 1F4PA 5THXA 1HYHA 3BILA 3DSRA 1Z26A 3PLRA 4KPFC 4E5VA 4EX7A 2B2NA 4EJ6A 3DZCA 2BM8A 4OL9A 5KJ6A 2CK3A 3VZCA 1C0EA 2I80A 4DK0A 1PQYA 2MR6A 3G49A 3H6HA 4IJMA 1KPGA 2JKYA 3BJIC 3E3AA 3IUJA 1ABEA 4I14A 3NS7A 4MO2A 5FNVA 5DN6D 2A9KA 7ABPA 4G3XA 1NI4A 2Q9AA 3UCXA 5GVSA 4ADSG 4RDKA 3O31A 3K8ZA 5ALEA 3UJ9A 1UH5A 3INTA 4XM2A 5JUWA 2QRJA 1TAHA 1UD5A 1KKMA 2P0YA 5CA1B 5H5JA 1V3TA 3D6HA 2XWSA 3LBAA 4O4JF 1XEFA 2C2OA 1I7LA 4NMXB 2GM4A 3KVOA 2X4GA 3I72A 3DBLB 3I39X 3WJ7A 2GYVA 4URWR 3O9ZA 3EXEB 3I3OA 3GJZA 2R1UA 2EYUA 2NZ2A 3D6JA 4RTLA 4LC0A 5J2UA 4B6JA 5IJ0B 2X77A 1DP4A 4U1RA 4ARBA 3NRJA 3ASRA 2WVJA 3B1ZA 1S72B 4EGFA 1DIBA 3SE7A 2V7BA 2BGJA 3CX4A 4DIBA 3FPCA 5EJ5A 1P1RA 5JASA 4MIYA 1ESZA 4LHXA 1Z15A 2B4RO 2II6A 4MW7A 5K03A 5C37A 3EN0A 1Q2UA 3KRTA 4I9GA 4WQMA 1IQ0A 2CEKA 4K9LA 4S2EA 3AF5A 3FBTA 3ES9A 3LRTA 5HQJA 2WZPP 5HXBA 3LBHA 4RF4A 4ZOAA 2J3MA 4LG1A 3HSKA 4X1IA 5K3SA 2HWUA 3H9UA 4UE6A 1FQWA 2GXSA 4NDNE 2H17A 1DLIA 3T35A 4L28A 1P1IA 1RJ9B 1KDRA 4ECAA 2H92A 1OU0A 3ED5A 5BV0A 1P45A 2REQB 3K8QA 5CEFA 4P3OA 2G7MC 2ZIFA 2H11A 5MHTA 3G7NA 1NKTA 4MVYA 1V1JA 1AKVA 2L69A 3HBMA 3ZWWA 5IW8A 2CB9A 1H2HA 5KB3A 1RI1A 4JDUA 4HNHA 1VQLB 4RGVA 3Q8MA 4DUGA 2BLLA 5DMHA 3OU2A 4PQYA 4B35A 3UTDA 2EFHB 2JVIA 3ZJYA 4B7CA 1JFRA 4DLLA 3HXQA 2ZIXB 3RVKA 1PT9A 2ZPTX 2B8JA 2CNWA 4J07A 4PZEA 1UANA 2ZDQA 4CL0A 1U28C 4UMEA 3FF1A 3M6MD 3ESAA 4RWZA 1GPAA 1P4AA 3TS1A 2OV1A 2CSUA 4PX9A 1G3MA 4P3XA 4XR6A 4XRRA 3STYA 4DB2A 2G9RA 3IP7A 3A7DA 3W5AA 1M2HA 3KSMA 3VPHA 3ISXA 1FQJA 4O08A 4D41A 4NEHB 3VNBA 5HIKA 3R5XA 1FSGA 4CZ2A 1C7ZA 4Y1EA 3NJRA 3LY7A 1J1IA 3H83A 3GH1A 4RTSA 3URKA 2VNIA 1F6BA 3PUWA 5IM5A 5AW5A 1PFYA 2ZJ7A 5L53A 1UD8A 1NXSA 4HDAA 3BWVA 4LMBA 1P9WA 1P61B 4ITVA 2D8AA 3GT3A 3COWA 4YJ3A 1ZA2A 3RVSA 3QMPA 2VO1A 4R51A 3Q2OA 3ZH2A 2XUHA 1P5JA 2VJYA 4X7EA 4NARA 2WB2A 4A15A 1SVOA 1X3SA 5DXJA 3GIDA 3UV3A 5SZKB 1WMEA 4ZV4A 2EJVA 3QJGA 2QDXA 2P62A 4Z4FA 2AXNA 2P9ZA 3NWJA 2AR0A 2QHXA 2W7TA 4M9XA 2ZYDA 2V7TA 1GGJA 1SXGA 2PWYA 3QVGB 3K3PA 4FGKA 4UUMA 2FK8A 4TXHA 5TSDA 3G71B 3QP9A 4ZOEA 4UE2A 5CG2A 3NRBA 4PANA 3B1FA 2XRYA 2YXNA 7MDHA 1A04A 4LGVA 4C03A 1V5GA 4DDVA 1T9KA 3DHEA 4KN6A 4K9PA 5F3WB 2VXOA 2CK3D 4RQUA 5BSEA 1DIAA 3G5UA 3LVQE 4TTRA 4U6NA 1XPUA 1MABB 1XF1A 2R4QA 1UXHA 3RF7A 5A3RA 3R20A 1Q1ZA 1SCDA 4IYJA 1SBIA 4RACA 4L0QA 1R0WA 4O4JA 1J0CA 4YP0A 1Z18A 1ZAKA 2HREA 4HN2A 4OPVA 1N6IA 2V5VA 3RHSA 1GL6A 1Z0UA 4WJLA 4DV0B 1SUSA 1WP4A 3AEXA 3FGNA 4HLUA 3KWMA 4DG5A 1JQAA 1KEWA 2H31A 2A9QA 4QFBA 3UJPA 2W0MA 4EENA 3EW7A 1TU3A 2M1ZA 2PWPA 5BN5B 3TTTA 2W6PA 4H3HB 3IH5A 1P1CA 1NVWQ 1VDMA 4KG7A 3ZGZA 3R9XB 3G7SA 4OQYA 5AHKA 5A4IS 1C4KA 1ODIA 4P92A 2Q0XA 3M4NA 4UMFA 2FUG1 1C7EA 3GVJA 3FWZA 3WGMA 1PLJA 1L4GA 3A4MA 3DO8A 4PZCA 4EGCB 3Q9NA 3MIZA 2JI8A 1AN0A 2ZYHA 3JVDA 1M75A 1ZITA 1SD1A 2BMFA 2JI6A 3JZDA 1XZIA 4ZO9A 3WRWA 1V9LA 5HOQA 3W90A 1TZBA 4JBYA 2A1TR 1LY1A 4PX2A 4E4YA 3BD6A 2AFVA 2IVFA 3GWZA 3NO4A 2A1UB 2ZRBA 3E18A 4R2MA 1OT3A 5D00A 5KVQA 3TJZA 4QTYA 1SOUA 1CDOA 2QMYA 4ZEVA 1ZSVA 3M82A 3PDWA 1YKFA 1WV0A 4A10A 1KO4A 4KRXA 2ZCJA 2I99A 3T5GA 2QD4A 1PHRA 5ARBA 2G4CA 4YJHA 1YCGA 1OI4A 4JSRA 4MUIA 1JYFA 3ZY2A 2BJVA 1CEEA 3WKAA 2V7UA 1H2YA 3VNRA 2Z2KA 1W49A 4C1NA 3C74A 4UFOA 5E1OA 1BXZA 1QR6A 2PFKA 2IV7A 4DUGD 3TL3A 3L84A 1IG3A 4F9GA 4BY9E 3I9NA 1FNNA 1K68A 1O6FA 1UJ2A 3GGOA 5LQMA 4I50F 2J0UB 4DUYB 1IN4A 1LVUA 1K0FA 1H42A 2ID9A 2WFAA 1CSEE 3FTDA 2IYAA 4FDVA 2QA5A 1HDZA 2AIRA 3CEPB 2FSHA 1JR2A 1MO3A 2QW8A 1PS9A 1P3JA 2QJRA 4TRJA 4X7RA 4GR9A 4DWJA 5FO1A 2VNKA 2P2NA 3D7SA 1E94E 2BHTA 1DIGA 4WD3A 2DFKB 1Q84A 1VQ7B 3NW9A 2ZJ0A 1Z6AA 2Q3LA 2RHTA 3FD8A 1AMOA 1Y4AE 1SXJC 3G2KA 4RSHA 3IA7A 4TTJA 2QX4A 4LYDA 3W3ZB 1JHOA 4GG1A 4D8XA 4DC0A 5HKAA 1ZD2P 3GLTA 1JR4A 3REGA 2PFGA 1PJ5A 3LZDA 4L5BA 4NK4A 3STWA 5L46A 1JT2A 3E4DA 3QVTA 2PQ0A 1UK9A 1F2TA 1W94A 1YKSA 2LPMA 3GP5A 4NQZA 3PUMA 4B8YA 4DE5A 3UT6A 4LFBB 1M0SA 1WHSB 4MDYA 3KU1A 3N05A 3N8KA 5JD6A 4PNHA 3E70C 1F38A 2EG5A 1U1CA 1XTJA 1DBPA 1G5IA 2PHZA 2XXAA 1MJGA 3H1GA 2GWRA 3KOUA 3RSZA 1JLSA 3NVKI 5AVWA 3C85A 2NU7B 2QVGA 1YFKA 2XYHA 4YB8A 4M1KA 2IQIA 4HH4A 1QCYA 1ZMXA 2HFJA 5ED4A 2AF4C 4BVJA 2EBUA 4EY3A 4HFJA 4DR7B 3QMVA 4UPDA 2WJ6A 1QGDA 2C9BA 1IK6A 3AHIA 3K2QA 1FSSA 5JO9A 1L8OA 1HDIA 2WILA 4IVNA 4K26A 1ZPDA 2JFUA 4WIAA 4WN3A 5B3AA 5KCMA 5KNDH 4WZLA 3MGAA 4DVGA 1MB2A 1KO7A 2OB2A 4J16C 4OHKA 1AY0A 3VNUA 3KKKA 2VUSA 4XI9A 3QPAA 4E94A 3OZ7A 1JZQA 3MLBA 4CMHA 3ADKA 3E9EA 3ISVA 1ZHOA 3H19A 2QNBA 4P0QB 5IX8A 3A1FA 3K09A 3V1YA 3DQPA 2QTMA 3NKFA 4A0HA 1XDDA 4MUXA 3GZ4A 1CF9A 2QLNA 1AV7A 1W5SA 2HF2A 2X7JA 4RHXA 2O05A 2I1LA 4DM4A 1Z82A 3WYDA 1RZUA 5THKA 5LOVB 3KVRA 5CDSA 3ZV4A 1NNLA 5JCOC 1U2PA 1KO1A 3CS3A 4Z99A 4YRKA 1KFEB 4I1OA 4TV8B 2YH2A 3VC7A 2OM6A 4MS1B 2AQHA 2WJIA 4I4LA 1A7AA 1F0YA 1GPYA 2IHTA 3RUHA 1YRBA 3JD2A 4UU0A 3AVVA 4MW0A 5JG7A 3DAYA 3OETA 2OAEA 5EPOA 1FL9A 2C78A 1XVUA 3IVXA 2VC2B 1NXVA 3H2HA 3PIRA 2DXIA 4GLOA 4P98A 5B7GA 4M1TA 2ORIA 2V54A 5BV2P 2YFQA 4HFNA 1TEXA 5FWXA 4HQFA 2GAOA 3L0DA 4Q7MB 4PS1A 3WA7A 2ZSAA 3HTXA 2WU1A 3LW7A 3PQEA 4FEYA 3H3XA 2WIBA 4PO9A 4I4NA 1K8XB 4RKEA 3BTOA 1BVYF 1CUZA 1MENA 3QNWA 1NIPA 2RH4A 5KPJA 2WWRA 5ICEA 2ILVA 5DBHX 4AX4A 1ZRSA 2ATVA 5AVZA 3JZAA 5K0JA 5EY5B 3JQFA 2WKRA 1EG7A 4F8YA 5GV7A 1ELOA 1GZUA 3A70A 3MOGA 4I50A 4LS3A 1U98A 1W6RA 2MSDB 4QA9A 5GMOA 3AOEC 2E1PA 1JHDA 2WFMA 3KOWA 3O03A 4MR9B 3A1DA 1X15A 2PVCA 4Q19A 5JDCA 3C3EA 1ZESA 2HOQA 1OFHA 4D5EA 3MC1A 4BGEA 3QEKA 3W3AH 1G1AA 1YS9A 1RJEA 4L27A 2XCLA 5COQA 1WRBA 4HZIA 1PCXA 4DDTA 1ZI9A 3MLAA 5H70A 1JX6A 1NR7A 6GPBA 2IIQA 4L4RA 2GN0A 3H5NA 1KZ4A 4ZAYA 3VTKA 4QELA 4LYFA 3WNZA 5JNSA 4Z3OA 4R8VA 1N32B 1P4JA 4ZGGA 2J4CA 2QU8A 1FDTA 1Y1PA 3WB9A 3D81A 3H4MA 1BQEA 3HCBA 1TE2A 3DT8A 2R2AA 3OEHD 4DSTA 4UAVA 2HWYA 3V8MA 1RWPA 1NNUA 3Q2IA 4MQUA 4B3IA 2QN6A 1AXRA 1M1YB 1ZXXA 2GA8A 4EJ0A 3FHJA 3Q38A 5IRCD 5HBRA 4F96A 1KAQA 3OZAA 1X80A 4GX1A 3A2KA 2WVGA 4MW9A 1I7PA 1ZUNA 1BQ4A 3DOCA 2VQDA 3GDOA 3NTLA 4MUGA 2O7QA 2Q41A 4IUDS 2C9CA 4JMLA 3HM2A 3LC0A 1NRXA 1G18A 5CT6A 1WABA 4YT8A 1EUDA 3HP4A 5H9VA 5HIMA 1BO6A 2NTJA 3KHUA 4MNTA 2BFDB 2GEUA 4LVCA 1V26A 4BMDA 3GBVA 4X91A 1IOZA 1DWPA 4LJKA 1UT8A 1DMRA 3GDHA 1L9XA 1P62B 2EWWA 1OZHA 4GH5A 4CV2A 3ASYA 1WEHA 1RADA 2XTMA 4JXXA 2J08A 3WNBA 3CTAA 1TECE 2QTBA 4RIIA 1LFDB 1DKOA 3KWFA 3C5HA 3TE6A 3UPDA 2V1XA 4CHTA 1V5IA 5DISB 1QRUA 2QBYA 3TEFA 4DFDA 5D3MA 5GTDA 3AHCA 3RJMA 3IUNA 5DV9A 1JU3A 3HH8A 3DWGA 1L5HB 5J63A 1N0IA 3ZWQA 1CJTC 5KJCA 2OZLA 4TYQA 3SKYA 1C8KA 1DHTA 4JWTA 3JQRA 4D3XA 3N76A 2X0JA 1A98A 3FFTA 1AHNA 2XUPA 3PUZA 3OLWA 2AZMA 3D4IA 4JOQA 4XB1A 3RFFA 4OCZA 1IN1A 4WCFB 4K9KA 5ELLA 2W98A 4IDCA 4K8RB 3K6SA 1W0JA 1Y8ZA 4A6EA 2ZAOA 3I2FA 2E21A 3JWGA 5AVRA 3I6BA 4MYTA 1KDZA 4IUCS 3B12A 2G6BA 1TYCA 5TMEA 1P4HA 3A6JA 2IYSA 4MQFB 3JATB 4ISCA 4KDFA 3NHZA 2PH1A 3WGJA 4U7FA 4TQUS 2DZDA 1X2BA 3DJYA 4LSZA 4Y1RB 5DLEA 3TO5A 4X90A 2ZBUA 1E18A 2EJWA 2FK7A 4JEUA 4JZKA 4MA4A 2Z6BD 1A2BA 2IYZA 2PJZA 3WE7A 5C51B 4C7OB 5MGBA 3VKHA 3PLNA 4RVOA 5FOTA 2HLDA 2VFAA 3CIOA 1U9CA 1FDIA 5FLKA 3HJGA 4PNZA 3RYIB 2D1TA 1XU4A 2ORED 4DCNA 4ENTA 2ACEA 1YA6A 3BN3A 4IICA 4QHYA 3CPWB 1WCXA 2AFRA 2C2YA 4DA0A 3L02A 5KW9A 5I9NA 3DM5A 1Z6GA 1GZ7A 2Q9UA 3OUUA 2Y71A 5AKLA 3K70C 3QITA 1HYEA 1ZCFA 5EZSA 3FPGA 4XQFA 3HEBA 1QYRA 1DEHA 2RH8A 1GT6A 2QLJA 4M9UA 2GK6A 3MK31 1Y9JA 3ASVA 1R7RA 1BE8A 1QVAA 1DRUA 1V95A 2JLSA 2ZIZA 3I9LA 3LYUA 2AB0A 2GK4A 3BH6A 4MMZB 5CYPA 1ZCZA 4HB0A 4R2IA 5DCUA 2HKIA 3IT1A 4D02A 4RMIA 4EAQA 5J3JA 3RC2A 3FX2A 1M6WA 5FKJA 4HY3A 2F3QA 5HE8A 5LL6P 2AJBA 3CW8X 3R7LA 4AJEA 1J2EA 3ICWA 4EGAA 2QN3A 3B3AA 1AGRA 2ECOA 3NT5A 3T9FA 1OWNA 3T9AA 1O95A 3CLTD 2CL5A 4TM8A 3VR5H 1M33A 2IODA 3EGVA 1J39A 3J81A 1X7XA 2JLAA 1B43A 4MLCA 2DEUA 1NJ5A 4MRRA 4PFJA 3UANA 5EXDA 3ZTTA 4OI2A 1JR6A 1L3BA 1NF8A 5BT9A 3B70A 1O8CA 5D5HA 5DGDA 3ZYZA 3TSOA 2D00A 3KJHA 1KQFA 3LL4A 1FBTA 2I34A 1I8TA 5JYBA 3ADBA 4G5YA 1NI3A 3TVDA 4ARZB 4YQYA 4CM4B 4QU0A 4YT4A 2DHCA 4NV0A 2HIHA 4CV3A 4DTIA 1KYYA 2P9BA 4QG3A 1JSXA 3UQYS 2B4AA 1JR3A 3GL9A 3DVAA 4PLFA 1QNFA 3PQ6A 4MIOA 2C5BA 2TMYA 1CS0B 3P9KA 4AIIA 4BV8A 1D2MA 2XKBA 5AHRA 3LUHA 3D54D 5A02A 1EFAA 1YKGA 3V7FA 1VJ5A 3HJRA 1S2NA 3PIDA 1VCOA 1C4WA 4IXTA 1L5KA 3NHFA 5K0EA 1P0PA 2PL1A 1QX3A 2DF8A 2OCPA 3IDOA 4I1RA 4OPMA 3W78A 4HTFB 2IL1A 1OIWA 4V0KA 4NXNB 2GYWA 3UAGA 3L93A 4KIUA 3HYNA 1EJ2A 2WC1A 1NSYA 3IUEA 1F12A 2ZITA 1DEOA 3ZOKA 2GGSA 2IHNA 4F1WA 2AYYA 1SY7A 1WSWA 3KSUA 4X85A 1KF0A 3EEBA 3EYAA 2WMNB 3ZNOA 1IJBA 1FYXA 3N70A 4P3YA 4QQNA 4EY8A 3OLYA 2AOTB 4Q3LA 4XL9A 1TZJA 5E2IA 3IT2A 5B12A 3WNDA 4WNAA 3WWYA 4PHGA 2JBAA 1RCUA 1DSSG 3RJTA 3RIYA 3FDXA 4QPZA 4E2YA 3MWEB 4XQ0A 4C0KA 1GL9B 4CEHB 4CLOB 1DJPA 1KXJA 3GRUA 2ZU6A 5AJWA 5C3UA 1NW6A 2WWWA 1XZQA 1RAAA 2ZIWB 5ALJA 2H2GA 1Y9DA 3VBEA 3LP6A 4QUJA 4EZEA 1W0JD 4L4ZA 3PUHA 1N8TA 2AHOA 1E5QA 3VNSA 4PNPA 3UYLA 3P71T 3S2UA 2E4WA 3JD1A 4X1YB 4BLQA 1CY0A 3B8EA 5IYWA 2WT4A 2XITA 3C3DA 4BQIA 1AF7A 1QG6A 3R3UA 3CPXA 1FP1D 4FWIB 2SCUA 1K06A 5EYPA 1ZOOA 3O8NA 1N9GA 1T10A 2REBA 3LRPA 1HDGO 3S1AA 2QM8A 3F74A 4Z0NA 2EW8A 3HCWA 2GTHA 3DCJA 3OIDA 3GUZA 2HLDD 2Y76A 1ZW6A 5B1DA 4G86A 4L3WA 4QUBA 1HEIA 2P4UA 1HFWA 1RLOA 4JJFA 4ZDIA 5TQVA 1YSCA 1YZKA 2D62A 1KE2A 5JSZA 1U8CB 1VPVA 2BP7B 3DAGA 4O6VA 2UZ1B 2OO5C 2B3TA 2J3JA 4ZCQA 1QVGB 1ISIA 3F7OA 5LXTB 1WZ2A 3ASTA 2E4XA 3IESA 1G59A 3K9FC 1EK6A 4HNUA 4GX2A 3D4NA 5DNWA 1W4BA 1UMKA 4XWGA 4LOHA 4B4KA 1G7RA 2XB4A 4M8SA 4ND8B 4AYWA 2VZ8A 2EEZA 4JYPA 4GC9A 1ZONA 1G63A 4G1FA 2GPJA 3AT1A 4RESA 1Y0BA 5LPNA 5CMLA 4GGPA 5BOVA 3I8SA 2FZWA 4HRVA 3LNNA 1XV5A 4XJTA 3WADA 1Y7HA 5AJTA 5ALLA 3UXYA 2GCPA 4BB5A 1R27A 1JALA 1X1EA 2LRHA 2SBTA 1ND5A 3RK4A 5JAMA 4OQQA 2VK8A 1O95D 2QAGA 3E53A 1G4HA 4N3BA 4R1PA 1WP9A 3RS0A 5C35A 1XL0A 5LDDC 2NV2B 4NPHA 4ROTA 1VGRA 2H7XA 1K2VN 1U1DA 2GF0A 4PV7A 5KVCA 3K0SA 4Q7JB 4F2DA 1L7NA 3QJYA 1XLWA 2FR1A 4HNVA 2AWNA 4B3GA 3GEMA 4NZMA 5C8YF 5A6SA 3KJFA 5H02A 3QKTA 4LTMA 5D01A 2GZ2A 3H9JA 3P9QA 4IOMA 3FGPA 2Z5FA 4D2IA 3P96A 3SLNA 4UFPA 1JR3D 2A0YA 4FHZA 4Z86A 4MPRA 1U7DA 5BSFA 2PGDA 3NR2A 1TAGA 4G24A 1BCRB 4CMCA 2YKGA 4RTPA 2FN8A 1XE1A 2QE7D 1UDWA 1D0IA 1R88A 1YZVA 3M1LA 4XQGA 3FCEA 2WYIA 1EESA 1W9HA 4Y8VA 1DCTA 2QD2A 2AOXA 1Q57A 1K5PA 2I03A 2L17A 3KJEA 1JKFA 1OLOA 4MI9A 2X0EA 3RC1A 2NO0A 1SOWA 4ZJUA 2ZTGA 1VC2A 2FPOA 1CZKA 1FU8A 1GR0A 4P2GA 4AMUA 4FHDA 2PUBA 1G3RA 2E6UX 3CCBA 5BQPA 3NI2A 4DLXA 1E96A 2VAMA 2EXXA 4KN9S 4N76A 1P0QA 2VT7A 3QHQA 1XEXA 5EHXA 5AXAA 1CYDA 2ATEA 2FAXA 4F5DA 3B9QA 4KLAA 2I2BA 3SFZA 1AMNA 2AHRA 1ODFA 2HA0A 4JP2A 4D92A 1UMBB 3FA2A 2F9FA 4JJ7A 5A89A 2ZUTA 4DDMA 2ZP1A 4RY8A 1N5MA 4OMFG 1J07A 4G5QA 4KQKA 1WSVA 3DBOB 1J0DA 4PC6A 4R1SA 3REQA 1NQUA 1P74A 1G4UR 3GDWA 5LM3A 1F3OA 2NUAA 3OC6A 4E1VA 2PUEA 3EVFA 1E3LA 5TE9A 4Z9YA 2E3JA 4LE2A 3G9UA 2VJDA 2CNNA 3AONB 5HZGA 3FYDA 2GQFA 1HT2E 1WDLA 2AEMA 3DOJA 4W5HA 3O3MB 4YASA 2HTFA 1KTVA 1WSBA 4URYR 1O6CA 1X77A 2A0WA 3HDYA 3N0TA 3W1VA 3H1BA 4K6CA 5I7RA 1F5SA 4XUDA 1YJQA 2RGNC 2X0NA 4YRCA 8OHMA 2YWFA 2ERCA 2VTBA 3VGJA 1JPNA 1Q12A 2FV8A 2ZRKA 4TTTS 1GG5A 3X2FA 3ZE2B 3F6SA 4G84A 3RM3A 2O8FB 1NP3A 4MEJA 2VHYA 4PZDA 3VYUB 2R96A 1YRYE 1LBTA 3QLTA 4FT4A 4OI0A 2FWPA 3VTZA 3JPWA 3ZKAA 4BMXA 3OE5A 2EFYA 2RGEA 4D3ZA 3W5IA 4DMMA 2ZTHA 3ESXA 4C20A 4E31A 4AZ3B 3T61A 3IVCA 4ZZ1A 1CQIB 1OLXB 3TIFA 1E5LA 3QXGA 4ND6A 5F76A 4ZMSA 1EVKA 2PX3A 3GGGA 2W2LA 5IC5A 4PPNA 2R87A 4BDTA 5BR8B 1VE3A 4ZT2A 2PUCA 2W4MA 4WY5A 1DFIA 5IZ4A 1WORA 3VO1A 1NMYA 4M22A 5F64A 4D6XA 3RRXA 4BPBA 2RHCA 3ULKA 1GPMA 1NP7A 3FCXA 4BRSA 2BFCB 3N74A 3VO8A 3T9CA 4LRXA 3VHQA 1FNBA 3EUWA 4GXRA 4ER6A 1XWIA 4GI5A 1Z8FA 3I01A 1GVNB 5LYJA 3MNFA 2Y9PB 4YRGA 3EPKA 3AUYA 2KVOA 5KHLB 5A4MS 2K4MA 5BPHA 2HK9A 1CJBA 1KK3A 4PAOA 1NJID 3IT3A 5DW0A 1IH8A 2OTLB 4XJSA 2YUIA 1QU3A 4H35A 4UZFA 1MD9A 1WVGA 5DE3A 4AN1A 2C4HA 3ZDCA 1X8LA 1BGXT 4O2BB 3CH7A 3WKCA 3ROGA 1D5WA 1JQEA 2QR3A 5C8YA 1FXSA 4YMUA 1QO0A 2QRPA 5ADHA 1MMFB 1BMTA 5DHRA 5LKAA 4MPPA 1FJXA 2Z83A 4N0DA 3WLLA 2G83A 1ZP6A 2QLMA 4YI3A 3ENWA 2G1PA 3AYZB 2YV3A 5IYQA 1UMDA 3MD0A 1WDWB 3B2QA 3UZUA 2GBFA 2BR4A 1SUWA 2UKDA 1P80A 2GHTA 1D6NA 1MXFA 1XWFA 3C41J 3C3JA 1U2SA 5TC4A 3JYPA 1JJFA 3ROQA 2FQYA 2RGGA 5JZVA 5SY6A 1JN0A 1CB7A 3AWIA 3N7AA 4S1TA 3T5BA 3WK4A 2FRDC 6CHYA 3I6IA 1VQOB 1XL1A 1W36D 4NENA 4NE2A 1PNQA 3O83A 1UD6A 3ZJTA 2WQ6A 2P2SA 2PIAA 4G4SO 4F8JA 2LDXA 2XCIA 1SG9A 5FUQA 3USZA 4U7JA 2YYAA 4RLSA 5AW2A 1M7HA 3D64A 4QX6A 3WIUA 1NW9B 3L3BA 5KX5F 1AUXA 1NT2A 2C4MA 3A1PA 1XZDA 4D45A 2HA6A 4XJVA 2HGZA 2NNWB 1TMGE 5BSUA 5FTNA 1E2HA 4WINA 3W3AA 3B13B 1EHIA 1VJGA 3CZQA 4QTXA 1M7BA 1PFQA 3ZPNA 1TM3E 4R9VA 1EGHA 3LT1A 4CDGA 4F2HA 5JH7F 4GZ5A 4MV4A 3SS8A 2H08A 5FJIA 5REQA 5JR3A 3GUVA 4M9ZA 5IJ9B 1GGVA 1NZFA 2Y67A 2E55A 3X1ZA 1I1QB 5JS7A 4GL2A 3PQ2A 3CZMA 3DWEX 1MOSA 4JP1A 1MA0A 4ZPJA 2UU9B 3K0CC 2WFLA 1A5SB 2XMBA 3IB3A 4QPPA 4ZQGA 5LP6F 2WICA 4JZYA 3JS5A 1CUHA 1YHNA 4PQFA 4EF6A 4KQXA 3OQ6A 3HNOA 2O06A 4XOIA 4MHTA 4RXUA 1PU2A 1FRNA 1ZU5A 3LUPA 3WRYA 4B33A 3KFLA 1VZ2A 2BFOA 3KTOA 2QX6A 3INYA 5L3SA 5UKDA 3EQ8A 1DKNA 1RMQA 2PGAA 2OECA 1VYVA 1RQXA 4KITB 2IOYA 5MDHA 3CVVA 1FFWA 3KV1A 1T25A 1IEVA 3EYWA 4AUNA 1FDWA 4WPGA 1CNEA 2HX1A 5GIPE 1J7KA 1VXOA 4FFOA 4CNBA 2R65A 2EC5A 4JLJA 4C78A 1Z5VA 4ENVA 1YB5A 4NFLA 2BBSA 2VPXA 2XGMA 3L49A 1E4VA 2W2LD 3BEDA 3M5DA 2C2BA 4MUKA 2YJ5A 3C7AA 3M6LA 3WSWA 3QV2A 5J5VA 2GFHA 2XDQB 3R0IA 2OQ2A 2FEWB 5AVSA 5K0BA 4J7CA 5JAQA 3CMCO 4RWEA 3ZDRA 2Z5GA 1PRYA 1NDHA 3WL8A 4PYNA 3JCZA 1V1RA 5BORA 3GEDA 3IAHA 1U02A 3BCUA 3U39A 3V4VB 1SXJE 1YE3A 3HWSA 3EVNA 4MX8A 1SKAA 3U09A 4BTEA 2K7FA 3PEUA 5ILGA 3ZWPA 3BK7A 4RJJA 1Z13A 2NUBA 5I4BA 4NCJA 3WGOA 1ECJA 2BCJQ 3EG9B 3E81A 4HE5A 1CFJA 2I5PO 2ERYA 3EULA 4AMGA 1EVEA 3O1LA 5HXAA 5KOYA 3DTVA 5GONB 4C29A 5IAAA 4J2TA 2WV7A 3LX8A 1DRKA 4Z4CA 1G8AA 4PRZA 1MV8A 4UD2A 1SJ9A 1VQ6B 3U0VA 4NFHA 4I4TF 1OU4A 5AO9A 3FHCB 1NN5A 2CZQA 1Z4KA 1QO0D 3AESA 4QYIB 3UT5A 3ZN2A 4RTRA 3EF1A 1N2OA 3P0FA 3LBNA 1L7QA 3RI3A 1KNQA 1M1YE 3HA3A 1J1UA 4JI0B 1QJCA 1TCVA 2PGNA 2LCQA 2V3VA 3AZPA 3ER8A 4JJEA 3SN6A 4FZ3A 1JXMA 3LGAA 1LXCA 3Q1KA 4HKTA 5FEMA 3N0XA 3U17A 5CFRA 5JROA 2CCJA 2B34A 5CLGA 3WWPA 1DELA 1VJRA 1JEDA 3JQBC 2PMCA 1YTUA 4DLSA 4TKMA 1FQKA 2GNOA 2QD5A 2WVHA 4NI5A 4QOIA 4YO8A 4P34A 3TCXB 2O8DB 2YBDA 2R8YA 4NTZA 5FLYA 2HSWA 1MH1A 2C7GA 2R7MA 2WV9A 4GP6A 5B57C 4P81A 5KX5A 3FYUB 3AVUA 3GJTA 2VHEA 4HVAA 2OOKA 5FAXA 3VSBA 3G2LA 1XRJA 4WWHA 4TMFA 4DNPA 1IZYA 2FUG6 3HGMA 3ZW7A 4TSFA 1O3YA 3ANLA 1CNFA 3DYBA 5JH7A 2ZXHA 3THXA 3AVOA 3Q88A 5CJ2A 5IBRA 1R50A 4F6RB 1O0BA 1LWOA 5BSXA 4AUMA 3W3AD 2DERA 4RDHA 5TQ0A 3E9CA 3ZK8A 2J3IA 3KZCA 5D6OA 1WETA 1X9GA 3PDUA 2BR3A 2VK2A 4KWIA 1PK8A 1QQTA 1V8FA 3OQIA 4QUAA 1ODSA 2BYTA 1PUIA 2ZYTX 4MV9A 1P7PA 4ZALA 5DI3A 1MX9A 4N9WA 4ZVTA 3VR5A 5LP6A 1YF3A 4PAGA 3LG2A 4GWKA 4RHCA 1SXQA 3Q5DA 5MFZA 4NLLA 4QBTA 1HG1A 1PEYA 2C0CA 4IH4A 1E0AA 2EF0A 2UUBB 4RVFA 3ZIUA 5ALPA 2ZUSA 1XGKA 1UINA 4E08A 4EZBA 5BSMA 2RK3A 4TS4A 4ALJA 4H27A 1H3NA 2HQOA 1UC5B 2O8CA 2F1KA 3D0OA 1A88A 3IFSA 1T4CB 1KY4A 2WIFA 2I4TA 3Q7SA 3ERCA 5KAPA 1WDKA 5JRZA 5HS4A 4ZN6A 5LNK6 2B9EA 4CKXA 2GR9A 1PR6A 4TXNA 4X97A 5KSOA 3O8OB 1GWNA 5TVKA 1QBGA 1SC1A 1Q0LA 4KH1A 3RHFA 2BCEA 3BMQA 5FJJA 4F71A 3HXTA 4LEIA 2FLWA 3L8CA 1TI7A 2DWOA 2RHGB 3G59A 3JYHA 4U3JB 5HA5A 3SC6A 3SP1A 4AD8A 2YZ2A 3U4DA 2AXEA 1CZHA 3QX9A 2ZWVA 4IZOA 5BMVB 1HT3A 2ODAA 4MV6A 1IRXA 5AMXA 2CSXA 1BU5A 4DNFA 3G2JA 3WQQA 2PS1A 2CLIB 4LNUB 3PYXA 1TU4A 4G63A 4Q0MA 3LQYA 4ENPA 4EKYA 1NY6A 2FNAA 1YZNA 4U63A 3FVRA 5A9RA 1NE2A 1WW3A 1TZKA 3ETJA 5IABA 4KPUA 1CJKC 1ND6A 3ZE9A 3U6BA 3DEJA 2BMWA 2HPVA 3AVQA 4HC4A 2YIVX 3PQ3A 4QVAA 4NBWA 3GJ0A 3CPEA 5LZ9A 4AJOA 4JQCA 3DZFA 4Q7EA 1HE3A 2HDOA 2O2XA 2VR1A 2ZOSA 5EKDA 3I1JA 3K8OE 2FJ0A 4I4TA 4XKVA 3DTVD 4XONA 1VKJA 2NVOA 3MXTA 3U1TA 3UJ8A 4MYHA 3FCCA 1YMUA 3MLEA 2GD6A 2YW2A 3IPRA 3ML1A 2OPHA 5CBPB 3MT0A 1H9AA 1ORRA 3BQMB 2BDUA 2YMQA 5CU7A 1ZR4A 4PCVA 4CUJA 1FFXA 3OSUA 3OEWA 4IXNA 1JE0A 3MGKA 4BKRA 2CLLB 1SBCA 5D87A 3EIXA 4DQKA 3PBKA 3S8EA 4MTCA 1RXWA 2W6QA 4L3VA 5FUMA 3OPOA 2C2HA 3ZC3A 3L46A 4BFSA 2FSPA 3UHPA 3CW9A 1P7WA 2QMHA 5GZ1A 2Z2XA 4RK7A 3OFVA 2Z2YA 3JRNA 2ZB8A 3M3HA 4CTJA 2TS1A 1U3TA 1YA8A 3LECA 3MWYW 4RJIA 4XCQA 4XDYA 4ZAWA 4BE9A 4CKCA 4GGMX 1TUIA 3F6CA 4OBEA 4GC5A 1RRPA 3UMFA 4C6TA 1FFHA 4EGQA 1YS4A 1V6CA 1IZ9A 3PUVA 4CCYB 2C4UA 4HQKA 1NPDA 4ZEMA 1D0SA 3O4VA 1V43A 1P2GA 3PJDA 1E3MA 3R74A 3ZZUA 1W88B 2AH5A 2W6IA 1JUDA 2AS0A 4W1RA 3PDHA 3DKKA 3V55A 4B0OA 1PKXA 3L0IB 4HZGA 1N2CA 3HLYA 1OZGA 1XN1A 4MGKR 2Q0SA 4DLZA 2D2VA 4TSFD 1J23A 4BLPA 2VHZA 4TMWA 3MCAA 1VL1A 3J81k 4RKYA 1K7FB 5SZHB 3IPCA 4MUNA 4X5OA 3YASA 1X7WA 3KELA 1FMFA 1K6MA 1VBFA 2XH8A 3C1OA 3C24A 3NCTA 3IBSA 4MEAA 5BVHA 1WSRA 3RYHA 1YL6A 3GHHA 1BTOA 2FN3A 2E4UA 2KLBA 1VCIA 3D8UA 2O0LA 3VR5D 1UJCA 2FWRA 1WIWA 2WLSA 3TQFA 2YOGA 2A0UA 2POQX 2QVCA 5LMUB 4FC7A 1KY5A 4M60A 5F4ZA 4ZC8A 2OAGA 4MVJM 5ANRB 4EQ6A 4KOAA 3CLUC 5C1PA 1R9NA 1OAOA 2PD4A 2DR3A 3N2GB 1H6AA 3ZWOA 5KTTA 4NZ9A 3PD7A 4RGBA 2H4XA 2IPNA 3KBBA 5E6SA 4A1FA 4DA7A 1PK7A 3A1TA 4B4DA 4C4TA 3WBJA 1W8IA 1AOXA 4EKDA 3L4JA 1FRZA 5BRAA 1Y4SA 3AKCA 4MQLA 3DR5A 5F5XA 4CIDA 4NDZA 3ZH9B 3CT4A 4UNRA 1WWKA 4MV0A 2VDKB 3JU3A 1D04A 3RLIA 1F51E 4M7OA 4BVAA 3HY4A 1R10A 1NW4A 3F3KA 2RGDA 2XT6A 4IIBA 5C7LO 1QC5B 4WX2B 2PQ6A 3C4QA 5FBKA 1M1NB 1OXUA 4CCWA 3KALA 4GPZA 5BYBA 2MU1A 2ZETA 3LHIA 1FU7A 4FLFA 1R4AA 3BTVA 3DEYX 2PV0A 3BCRA 4OKNA 3N2IA 3TIGA 3WRXA 2PNJA 5EHGA 1KJNA 1HUQA 3CLRC 3EGDB 1KOLA 4BNKA 4D7AA 3N8IA 1BX1A 4XIJA 1NUTA 4CM5A 1OBCA 3N0RA 1KAGA 1ORIA 1W0KD 1MB3A 3VKUA 4U4AA 1AUQA 2W58A 3MPUA 4A6PA 4OXIA 3NM4A 1HTTA 2A0KA 2SNIE 4QOJA 1UOEA 4FZ5A 1VP9A 2IXEA 5CP8A 1FMTA 2EFGA 1S9HA 3GCZA 4HH0A 4JFAA 4EM6A 5HDQA 3HRKA 3O3OB 1JTVA 3O73A 2OA0A 1KKUA 4G56A 1TYEB 3N8GA 3P9RA 2JFHA 4F60A 3HN7A 3HLTA 4ALLA 3SYTA 1XZLA 4L78A 3C5EA 1MCZA 3SYLA 4PSCA 4F3RA 1GYRA 5LVAA 3RC8A 5DO9A 2DKOA 3RUPA 1TQ4A 5K9ZA 4LMRA 1RQNA 2XQIA 2GJ8A 2DQSA 4G89A 4XN0A 3NV9A 2VBCA 4EA6A 3QE9Y 1NMQA 5K1ZA 4XLLA 1FFAA 3SDBA 1Z63A 1PSZA 1Y82A 1HFJA 3CN7A 1LSOA 4M88A 4I55B 1XEAA 1KR2A 3ESBA 1NBHA 1IBRA 1YAHA 2BR5A 4Q1AA 4Q16A 2DPYA 2IV3A 2IZ1A 2F9MA 2PZBA 2ZJ5A 4HX5A 2PTHA 1VMEA 1I94B 1SCNE 3LVBA 3ONVA 4LK2A 3E7WA 3E8XA 2X15A 3F6EX 2XRZA 3EUEA 2OHJA 3G3EA 3T94A 4UTPA 2HRBA 5HJ5A 3M4JA 3OZIA 1LPOA 3T0GA 4CR7A 1NX6A 3ZWBA 4DNOA 2WMOB 4YIKA 5I4CA 2FX5A 4PLVA 1KYXA 2FPSA 1X7HA 2W6ID 1E4EB 1V7ZA 3M6FA 3UB2A 3QVLA 1RJGA 2JFQA 3RPEA 5CEJA 2WQ7A 3EPJA 1O97D 1DG1G 3TEMA 4P4SB 5DGCA 5ILQA 1SIWA 5AM2A 1EMDA 3U44A 1QIJA 3RT9A 3V3TA 1WVIA 1T2NA 2G8LA 3C16C 3W9UA 2DT5A 4MDHA 4NYIR 2NU8A 1ILWA 1T3SA 4X45A 3CZAA 4INZA 4NZOA 4BP3A 1XTRA 5AXCA 4Z49A 4UQLA 2QL7A 4F21A 2ZS7A 4L02A 1GFIA 4FEGA 2WJPA 1G19A 3QZUA 1PJSA 5D3ZA 4I1VA 3LXUX 3NJ8A 5DBIA 5CCXA 3NNDA 2J9XB 4IMIB 2W2PA 3EGXB 3SFTA 1T0PA 3EH2A 3NAGA 2WSBA 1HL7A 1PLLA 4KE8A 1E1CB 4ZQIA 3WLOA 1MLDA 1L5RA 1QIIA 4XRGA 2CUZA 3BFKA 1NLFA 3DONA 1XVVA 4MW5A 4QU9A 1ZBQA 3PXXA 3VOBA 2R1VA 1Y3IA 3FHTA 2V7EA 1JEOA 5F3RA 2FPIB 4ZC1A 4R0VA 1ZK1A 3AR2A 3HRHA 1G38A 4V24A 4U9UA 1SKUA 3P4YA 2VYNA 3FLMA 3PDCA 5H7XA 1U8YA 4MWBA 5IZCC 1V41E 1RLIA 3E58A 2I87A 3U13A 5L7WA 4UVIA 3FRJA 4WXPA 4IVQA 1V6AA 2EZ8A 2JHAA 2OFXA 2J31A 2H52A 1QUFA 1Z34A 3VGPA 5FRDA 5F9HA 4G97A 3DHNA 1BA3A 4FN4A 4C4ZA 4Q9IA 4PQEA 4Y2VA 1JAIA 3KB8A 4CETA 2CHEA 5T5QA 3O8CA 2WABA 4HAWA 3DJFA 3OCVA 1EXDA 1ZI8A 1T9DA 3BH7A 2GDJA 2PWZA 3RAGA 3V6LA 3GW8A 3HYSA 1R37A 4OB6A 3GD5A 4OFWA 1E2LA 2NGRA 2R44A 2YJ3A 3ZUGA 4XM0A 5AKEA 3VISA 5HR5A 4P4NA 1A1VA 1UCFA 3DLHA 3VKGA 2CF5A 2QN8A 4JI1B 5LA6F 3SMQA 2IEDA 5T6BA 3WTBA 3GJ6A 2FDXA 1UBJS 1FDUA 4YMWA 5KVVA 2QTVB 5KHOC 3B6ZA 2ZRIA 2OZEA 3E9YA 5CLFA 1E1RA 1P77A 4E7OA 3I04M 1JIIA 2H5EA 3EVCA 4XDHA 3W05A 1RLJA 1GOTA 2Z56A 4MRPA 2IHBA 4NPAA 1V47A 3TPFA 2HQBA 4ER7A 4D1YA 3ZCPA 4CPDA 1PP4A 2GKGA 4BAZA 1ZM7A 3LWDA 4Q3EA 4PYMA 4OHBA 5GIOE 2F43B 2R79A 1XQ1A 4Z4TA 4CLRA 4RVNA 4DCUA 3K0HA 4NYIQ 2VJMA 5IKXA 2OK7A 1P81A 4YJDA 1U0GA 1H2FA 5IJXA 8ABPA 1SUCA 2HM7A 2WD9A 3CZPA 3KQPA 1XVLA 4PZ9A 5H3CA 1EDDA 1ZK4A 3QQPA 4AI6A 1HK7A 5KYWA 4US1R 1WMFA 3G23A 4JXKA 5JZOA 1LX7A 1YUMA 3CTPA 4FDTA 3I6YA 3AUSA 4RQAA 2EVWX 4OXQA 4FFWA 1Z35A 2PKQO 1ZN2A 5E2AA 1OFUA 1XTKA 3PZBA 2JFGA 1CEXA 1S7CA 2B5VA 3EC2A 4RFSA 3RS2A 3SEQA 1BHSA 4AJPA 4WESA 3GFRA 4IRMA 4Q4AA 3GEBA 3FYSA 1UKAA 2ZJ8A 3DW3X 5F4MA 3O38A 3CKMA 4GRAA 1G3QA 3WZMA 3GT4A 3K9GA 4YMTA 3FUCA 4QXMA 4FCVA 5IAOA 3GRPA 5KZMB 4G67A 4I8XA 3NETA 3O26A 4LYYA 3R76A 1JEYB 1JFFB 2G0NA 4GEKA 5AVJA 4JITA 1WDTA 2FA9A 1S02A 2Z1NA 2C2GA 4WVFA 4F46A 2QA4B 3FMFA 5DTIA 1IFXA 5FFMA 2YY6A 4NCKA 4QJBA 4AP9A 2EZUA 5J40A 3S44A 2HBYA 3ZOZA 4LYHA 4MGIR 4Q37A 2J4DA 1Q11A 1EP9A 1XZKA 3RGWS 3DCNA 4F3KA 1VSBA 1BMQA 3CEHA 4EHDA 2AN9A 2V3CC 2A3NA 2V98A 2NVBA 1AMUA 2C5LA 4LZWA 1IEQA 1H9CA 4N0PA 1AURA 2GPSA 3D3WA 3L2OB 4DLNA 1IY9A 3FFBA 2ZRAA 1RWKA 2JZOA 2YY5A 3GP3A 3NBUA 4M46A 5DHSA 3L8HA 1EGMB 1XD8A 3HG7A 3OM0A 1QFSA 2JAHA 4I1SA 1XVTA 1OREA 5CUQA 4ROSA 3CMAB 4WERA 2BEVA 3OBBA 3ZXYA 4GZ3A 2AJLI 2VF8A 1J6UA 2VYND 1AVTA 1JEAA 1V2HE 1ESMA 1MU0A 1GDHA 1Z5PA 4H2DA 2F9LA 2HT6A 2JAWA 1TVKA 2IZ0A 2KB0A 3EQZA 4F4UA 1N2GA 4C4SA 3RWOA 2GF2A 3B6JA 4MHOA 5ECYA 3ZY6A 5KKCA 1SHJA 3WOVA 4WKCA 2X9NA 4GNRA 5D3KA 3S8YA 2VH1A 1Y81A 4P4UA 4JJ6A 2JZNA 5A3SA 1SU7A 1O96A 3E03A 1JLHA 3IUQA 5A1JA 5LA6A 1N0VC 1UDAA 2GM3A 5L6MB 3F0TA 1CY2A 1I0LA 1PVVA 1TK2A 1VYHA 1ZWKA 4XGQA 1R4ZA 5F7ZA 5HS6A 4CV1A 5B6PA 3LMKA 4LF7B 1Q0ZA 2JFWA 1E6UA 4OFBA 2C97A 3GLSA 4AO8A 5EE0A 2FR0A 3J7AC 4YAGA 4JJ4A 4BVBA 1ZNXA 3FCAA 4MRMA 1N6NA 4FKBA 1XKTA 4PGFA 5EMLA 4UPVA 3UFBA 4ZRDA 4EEKA 4MH0R 5I51A 1R74A 4WA8A 5AI9A 1E1RD 4I0WB 2GZAA 5JATA 3DAHA 1UFQA 1CUXA 4H6PA 1CK4A 4KXNA 1IM5A 4KO3S 2ZJAA 1DQRA 1NR5A 2XI4A 2XWQA 3ZDYB 4HUTA 4FFNA 4B6FA 1NJ1A 2E49A 4JL6A 5K05A 2RG1A 4QLAA 4P25A 3AR7A 3CX7A 3FSEA 1JDZA 2VQEB 4M8LA 4N7RA 3H5WA 4QEZA 2I2WA 4K28A 4TWRA 4X92A 2FMUA 1Z5OA 1PUXA 4B4VA 5T7BA 1A7UA 2XKAA 5E0OA 3AINA 1PQWA 1SVKA 3I0NA 2YVLA 2EX4A 1IRIA 1CIPA 3V1LA 1AN9A 1XRNA 5BXYA 5JS8A 5ALWA 3P5BA 4Z4ZA 4YJFB 2B61A 1J2UA 4DLPA 4XWKA 1CZUA 1JJIA 3G1WA 3UFXB 3OQJA 2UUCB 3EIEA 3SHWA 3GLGA 1MIHA 4WLFA 1SXPA 3FPBA 1QQAA 3TFOA 3RBXA 3BIXA 1HT1E 2C03A 2PT6A 3NUGA 3MGGA 5E6RA 3ZV7A 1GUAA 1P2DA 5ALSA 4JLAA 5CIWA 1EEHA 5BWLA 4IQGA 5DULA 2FW6A 3V8QA 3VJKA 3AP3A 3K4HA 1QH1A 3HU1A 3OZCA 3REFA 4LBVA 2Q21A 5LQNA 5FWNA 4JHXA 1DWUA 2V6FA 4FI3C 2VXBA 4MCIA 4INAA 2VHXA 3HXPA 1P6QA 1F5NA 1MP0A 5COAA 4BBAA 1K6JA 1BWSA 5G41A 2PJRA 2GREA 1E1LA 2J48A 2W00A 4KAFA 4OLAA 2H18A 2KLHA 2QLLA 3FZNA 4BVLA 4EG5A 2DSNA 2GD2A 2CXUA 1IXZA 2VS1A 3M6UA 1VA5A 3ZWAA 2QRVA 1ZGZA 2R3SA 1EGAA 3VHRA 1ZIOA 3BXOA 2C1XA 1MPXA 1AZSC 3DE4X 1KYIA 2IU0A 3DMTA 2XXBA 3WMWA 3A4YA 4CF4A 1T13A 4ITRC 4BFTA 2PJDA 3ON5A 2R0QC 1DDOA 3C3CA 1N5RA 4U7TB 3TVYA 4KBFA 2CVFA 3LYLA 2LKDA 1FNMA 1PJBA 3NM6B 4L0CA 5FPYA 4CQJA 2KI5A 1YZTA 1DCKA 4LV8B 1QHYA 4NCHA 4G5RA 1PW7A 1L5LA 2OUKA 3A6FA 3F90A 2Z43A 5A4FS 1N4DA 4OHZA 2R751 3MUFA 3WX0A 5FNVB 4EPYA 4MVJP 1U9IA 1NI4B 1Q22A 4RD4A 4R01A 3IAEA 1P5HA 3URMA 4AJNA 4Y9DA 3V1NA 4UHKA 5KWJA 5IXSA 1QVZA 3A7EA 1XAJA 1XMPA 1KI6A 5A4JA 1A5TA 2QTWB 4LQCA 2V6MA 2I6FA 3D2BA 5CAEA 5LQCA 4LDJA 1J5PA 1UT5A 1IMOA 4BFCA 3BHMA 2XE4A 4M21A 3I8XA 1DRJA 4NU8X 1U31A 4H1WA 3RU2A 2AUTA 3EIFA 1ZN8A 2HU2A 1APBA 4EARA 1FSFA 3AB8A 3K5PA 4IDAA 1C2YA 3PCRB 3HV0A 8MHTA 1PV4A 2B36A 2ACVA 3WL6A 1B6TA 1IHPA 5EKXA 2ZE5A 5E6TA 4ARIA 1K66A 4DB4A 3FOCA 4MKXA 1AK9A 1Z4OA 2NLOA 2BSAA 2OHFA 3OPQA 4K6KA 4QEDA 4Z3KA 5FI0B 1G20A 4HLUC 2ZL5A 3EVEA 1XMXA 1IK4A 1QHXA 3QJ5A 2QGNA 4PYRA 2BZGA 4XJXA 2QM3A 5EA2A 2H7YA 2DKFA 3JWIA 4GLFA 4ZCLA 2PKXA 1M3SA 2X2PA 2X40A 1T3TA 3NHKA 4UDYX 3V7WA 4X1IB 2P3LA 4D80A 1JA0A 1LRLA 3AVTA 2DUMA 2P8JA 4QDJA 1U7WA 2RK6A 2XB6A 1FDRA 3DC2A 3PC6A 4OYLA 4W9RA 5GOZA 4C5CA 4DIEA 3F3MA 4NU5A 3TTXA 1EX7A 1IY1A 4ZCIA 4RPGA 2BGLA 2VBIA 2QSJA 4W8HA 5DBFA 1D6SA 2AI2A 1X9IA 4BP1A 1KORA 4E3WA 4IGKA 4QFCA 3ZWXA 4FXUA 1F6WA 1T9BA 4Q1DA 1P18A 1YJBA 3KKZA 4X95A 4A27A 2RJNA 1IN8A 3ZCTA 1UPAA 2G67A 3CV3A 4IDBA 1K5DA 5DPMA 3LC1O 2XKJE 1BRMA 1Y3FE 1KJ8A 2WTEA 3JWEA 5AOBA 3QPBA 2P27A 5E9JA 5F52A 4R8LA 2VUHB 4G5SA 2HB6A 2PUTA 2IK8A 2Q29A 3CKKA 2FVXA 3I55B 4D3DA 5JYDA 1SZJG 3CC7B 1YBMA 1QV9A 2HPAA 4AKTA 4FE3A 2I3DA 2DOKA 4LXYA 2Q4BA 3PDJA 4X44A 2FMIA 2WNIA 4IEIA 4TMYA 1YJ5A 4LYAA 4B43A 2QMUA 1TF7A 5IUJC 4I4IA 5DB4A 2I2AA 1ACMA 5IUKC 3AUXA 3R23A 3T3NA 3RS9A 1CUUA 2JGLA 1FNCA 3IDZA 4C89A 1PJ8A 1Y1QA 3GK3A 3KSZO 1XD9A 3I64A 1PVDA 1QKIA 4YJ3B 3H13A 1K92A 4DLKA 1Y9AA 4CUKA 3HPQA 1EUYA 1OI3A 3BL6A 3U26A 1PNTA 1E9CA 1U9YA 1VGQA 2JGKA 3HYLA 3VH1A 4JMPA 3ZW8A 1VKHA 5J1SB 4KQJA 1N2HA 4DJEC 3K0FA 2VWQA 1FUIA 2H9YA 5MF6A 3HJFA 1S3IA 2N3ZA 3BDVA 3FSRA 1QF9A 4RV5A 2XVAA 4AJ2A 1Z2OX 5HPYB 1JU4A 3PFCA 1GEEA 5TGTA 3T7IA 5JCPA 3LDGA 1CRWG 3DDOA 3K9QO 4LRUA 5EPEA 3WLEA 4DV1B 1JNYA 2IQ5A 5TLSA 1CR2A 4UAUA 3SIPA 1MGPA 1MJNA 1YJ9B 1K6XA 4BUZA 1L4EA 1R6TA 3EQ6A 3GIWA 2FZKA 5CK5A 4MK4A 3U4AA 4DMHA 4QLBA 1ZH4A 2OXIA 3RUAA 5JCJD 2V7GA 4LYJA 2BEJA 3K15A 2VNAA 4UPEA 5AM3A 3KQSA 5F77A 1TXGA 1K4MA 3HDGA 3QFRA 2M6RA 3I6QA 3KEMA 4HMQA 4JN6B 4GE0A 4EG6A 4GX5A 4GUDA 3KUXA 3R3SA 2JH3A 4LRYA 3V33A 5TEVA 3DDUA 3RVQA 1GG2A 2J9GA 4EUFA 3U4QA 4O4JB 4ND5A 1NUPA 4D3SA 4GXTA 5AUPB 3CLSD 3CM0A 3GZNA 4Z4RA 5BUZA 1SUPA 5IWCA 2O2DA 4AQDA 4FFDA 3G05A 4URZR 4JBGA 3SQWA 2XUGA 2CV1A 3LFTA 2XOKA 1QZTA 2DWQA 2HHCA 2BIFA 3DT9A 2HJHA 1J24A 2PSFA 3LXMA 4JJKA 1HLFA 5FA5A 2Q0QA 1QOQB 1YX2A 3WGNA 1DXOA 2P65A 2QNIA 1W2GA 3RH0A 3ZVLA 4AJLA 1MC4A 3SJ7A 1BE1A 5AI0A 2X0IA 2Z9DA 3LFHA 3NPMA 3GEIA 3NTVA 4HD8A 3RT1A 3SI7A 4B87A 1Q0RA 2GPYA 4XFJA 4ZVNA 5BNWA 1FRVA 4Q4HA 1MB4A 3P0HA 5U4QA 1UC9A 2LUOA 4IHJF 2IOFA 4F4DA 3AUAA 5JAUA 4ZYXA 2ZBRA 3KQVA 4MKHA 1RJFA 3JQAA 3MCVA 3HNPA 1KBZA 3O2QB 2HLPA 2G09A 1H4QA 5HRAA 3EFEA 5G02A 4HWPA 3T5CA 5DXAA 5JJLA 3FNBA 5F9FA 4B8ZA 2R1TA 3MILA 3NHSA 3IKTA 1U0BB 2XB9A 2BONA 2WOOA 1OGYA 3E3MA 3EGEA 2FJPA 3ILVA 4YJHB 5JSYA 2DOGA 4WACA 4JNKA 4DLWA 3FG9A 5K0FA 3G2IA 3RK0A 3SU8A 4G36A 3HGQA 3N2LA 1R9GA 3WFIA 1AJEA 3ABOB 1VRVA 4HWOA 4IX1A 3UWSA 1KAHA 1W44A 1U4OA 2JCYA 4RE6A 3C3MA 3WTCA 5G1NA 1QTRA 3QKWA 4LX0A 1H2XA 5EIWA 3T9EA 3DE5X 1IHXA 3C6YA 1R5JA 3L04A 3PDIA 4P5EA 5JFGA 5JQGA 3EG5A 3PHBE 1OFUX 2JI9A 2ZI6A 3HMKA 3PPIA 1A69A 4H7IA 4HH1A 4MWOA 4WLOA 4QXQA 2HU5A 4M87A 1WMAA 4RA9A 2CFCA 3CISA 3SZMA 3Q39A 1DG9A 4L2IA 3TLEA 4BQQA 2HW8A 3WSTA 2HEIA 3A6LA 1PBNA 2BMVA 3MMXA 2F1IA 2Q8PA 1RIIA 4YRMA 1Z16A 2IP2A 1J8VA 4RLHA 1L5NA 3CMMA 1QIKA 1VLMA 2ZYVX 4FOSA 1UODA 1SWWA 2C7QA 5L3VA 1H94A 1E2JA 3T56B 4J49A 3I52A 2P0AA 2ROQA 2SKCA 4CT4B 2GSDA 3FIUA 3HB9A 2I7TA 2E5LB 1F2TB 1QFYA 4JJIA 4QICA 5DGHA 1D7AA 2XUKA 1GGEA 4BP9A 1FDSA 2OG2A 5TPWA 1GAEO 1P2UA 3CLTC 1XDWA 2A0FA 3VH4A 4AL4A 4ATNA 2BGRA 1EWYA 4DVJA 1PWEA 2QI9F 3KLNA 5IAGA 5A1TA 2XXAB 3D6MA 3KOZA 4TRRA 5AXDA 4Q3BA 2FG5A 3BMOA 3H8JA 3LOPA 4Y6SA 2QM0A 3AUTA 4FKMA 3NGXA 5CH3A 1XP5A 5A4AA 3GLIA 1TUGA 3P2KA 3FOZA 4F84A 2PS9A 2YQ4A 5BYJA 5A5DA 2LE0A 2GK7A 1GLNA 2MWMA 5FP0A 4YCBA 2B3DA 3G8AA 2QU7A 1Y89A 2WLTA 2FEKA 5H83A 4S1NA 3VOAA 2AXPA 4C7BA 1BE0A 1JHMA 2D2IA 2NV6A 2FPPA 1FLVA 4NECA 4EBFA 1Z6QA 4LNHA 3CO5A 2OL4A 1IN7A 2JI7A 3FCUB 2ZRNA 4HS9A 4L5AA 4WADA 3CWCA 1ADJA 4UU7A 1OXVA 4OO3A 4DZRA 1U7OA 1FXWF 3QTTA 4BFXA 1C7RA 3ETCA 1X7ZA 5I3ZA 1IXSB 2EL9A 5ALIA 1Z45A 3ZQ6A 4UHJA 1U11A 2NWQA 2CXTA 4IR7A 3HDVA 3ZCUA 4NATA 4YAWA 1HDOA 1S8FA 2ODBA 4PGHA 3V6MA 2A5YB 1C41A 2XOKD 4Y0VA 1OXKB 4RZXA 2ORYA 2D5CA 1WZNA 1WKVA 2XNHA 1Q1EA 4PLHA 4D56A 4ZYUA 3C3KA 1Q5PA 5K0ZA 3U19A 4LIPD 1DUVG 3ET4A 2ONJA 5A71A 3NYQA 2X6XA 3NM5A 1ZKMA 1XMJA 4L51A 2OYRA 2CKDA 2ZUCA 1P4GA 1WB6A 3IB6A 2R6ZA 4IHJA 1KVUA 3PIIA 2BV3A 3FJOA 2G0AA 3BB4A 4AROA 2C2ZA 2ZB7A 3SYMA 4DNQA 3FYCA 4ENSA 5NULA 4OSOA 4UJ5A 4ZYWA 5AKHA 1R8SA 1OTYA 3I2HA 2O7NA 1NMSA 3PHHA 4OHRA 3WQSB 5TDHA 2CV0A 3GLVA 3KL4A 5FWXB 2IXGA 3JQAD 3TLKA 1GZSA 4NG4A 4RZ2A 4B6EA 4CKYA 1PWXA 4W5RA 2D1YA 3W04A 5A3JA 5JZ9A 2QYHA 4I5FA 4BNVA 1S6YA 4YRQA 1SKMA 1NQ5A 1V71A 1N6KA 4LV6A 1RYFA 2IFTA 3JYOA 3H9QA 4RMJA 1XFOA 3LQEA 2P79A 2R4TA 3E9MA 2NVWA 4RHUA 2VNSA 1K0UA 3R9KA 4RVCA 8ATCA 4M8IA 4IYRA 5IDWA 2IXTA 2ZL7A 2WJAA 1TA0A 2WJWA 1RVDA 2PLFA 4I50B 4UM9D 3RVMA 4A2WA 5ICGA 5BRNA 3PHIA 3D3QA 5B58T 2FPKA 2WJ3A 2F64A 1U0OC 2GBPA 4IILA 4Q15A 4Y6LA 5F1YA 2DETA 5CURA 3EGIA 3BJRA 1XD2A 3R77A 2G6TA 1NQXA 2VSQA 2XVZA 4LGCA 4G5HA 2FB9A 3P19A 4QAJA 4LZOA 1EDOA 2O4UX 4TL8A 3R8XA 3SVZA 3ZZNA 4JBLA 1QCCA 3VYWA 1HRKA 2IPOA 4BL5A 1HZEA 1R6DA 1LPSA 2WPNA 3PEVA 4FHFA 1VFPA 2HO5A 3CF4A 2ZYUX 1QJ4A 1B41A 4A9AA 2BGUA 2OCLA 4X3CA 1CHNA 1LSSA 5HQTA 2CBZA 3WNVA 4N82A 1OWMA 3G5TA 3N5CA 3PPVA 2H3HA 1UFRA 2QROA 5EIXA 1H9BA 1XNJA 3N8HA 3TOZA 3BFXA 4BRZA 1Y5NA 2R11A 2YVQA 2O2EA 5ADUS 1I7DA 3ITDA 3CESA 1Z2AA 2C2WA 4ENQA 1IUOA 1X80B 2VYVA 3JQEA 1ZUNB 4ZGQB 4H3KB 2PV7A 1KVRA 2JAOA 3H2GA 4CWAA 4F3NA 3GBPA 1GDTA 3BJMA 4FYMA 3TSYA 4WCVA 5DM4A 3BF8A 3R41A 2H00A 1JEQA 4MJ7A 3W9SA 5AVYA 1EUDB 5AJXA 5MN5A 3NIFB 2IY7A 1IONA 5T3YA 1CP2A 2YY7A 4YRPA 1Z2PX 3U2QA 2NYAA 1WNTA 3TLZA 4QO8A 1UZMA 3TR6A 3ZJ4A 1N2ZA 3WAJA 2EP5A 4WNYA 1C3JA 1JHUA 1PGPA 2OZPA 3MYYA 4PRLA 3P2EA 5ALRA 1RXIA 1EKXA 2FZGA 1FEZA 2MDTA 1BHO1 3RV3A 1B42A 2NQ8A 4KAAA 1FXWA 3AB7A 4BKPA 2ASVA 2X41A 1G9XA 2QBYB 2VHCA 5WRFA 3AM4A 1A0OA 5D3MB 4B0PA 4ZDKA 4TS9A 1X86B 5IP5A 3LXRA 2ISQA 1G7SA 1Q1NA 2JF0A 2HADA 3C8UA 1S5PA 1WM1A 2RHWA 2XE8A 4FOOA 3PTLA 2OZLB 1RC8A 4YHHB 4OQMA 1G2QA 3ND7A 1PK9A 1I32A 2GPBA 4FBLA 1SXHA 4M86A 4H6WA 1KZYC 1U3WA 2HZBA 4JENA 3DA8A 5LBTA 4HI0E 1SHKA 4CFSA 4EPRA 5LWQA 3KD3A 4J76A 1XPRA 3K6SB 3KQTA 4IIUA 2K2WA 1PZHA 4E5DA 1SN7A 1U4NA 1FP6A 2VDWA 1OQAA 2W9XA 3O4IA 3OKFA 4IGAA 3SFVA 1UK8A 9LDBA 3EE6A 3F7NA 4O1MA 1GTSA 2PGLA 1FF9A 1EYZA 3EXEA 5KO2A 3ND9A 4MP8A 1GNPA 2VEOA 2VJQA 3EXIA 2R6FA 2WUDA 4QU8A 5EQJB 3ZNPA 5ADWA 4XCVA 1YWGO 3SCZA 3AY3A 3BPSA 1VHTA 2A58A 2EOAA 3GIRA 3ELUA 3FNHA 3EA0A 2JRCA 2EQBA 2P35A 5AKZA 4TXLA 3IEVA 1Y1TA 1OGIA 1WZEA 3MEQA 5F51A 1T5SA 4AP5A 2XCSB 1U2ZA 1KAMA 2I4MA 1TW3A 2ZRPA 1T2AA 1Q0TA 2MSLA 2W2QA 1P5FA 1H0RA 1WXDA 4IMPA 5LFAA 2XOXA 3AF3A 1UKEA 4K6MA 1QV7A 4J1QA 4YJ2F 2JG3A 4G0XA 4GBED 4M55A 2Q3DA 1E6CA 5FI1B 2YWCA 2HXSA 1E2NA 2F3TA 2JIQA 2REQA 3GCGA 5TF4A 3AEYA 3IRUA 5KEIA 4TMVA 4PZAA 2BE7A 1B74A 1X8JA 2VEDA 2JBWA 3P45A 3PC7A 4JIMA 5TB5A 1DO2A 3TTUA 4MQBA 4PCUA 5CCEA 5M04A 4WAUA 5A05A 3CN9A 2WHYA 1PFWA 3CNBA 3ZHUA 1GZVA 1E3QA 4RPJA 2H0AA 4IGEA 1E8NA 1WOSA 4CIXA 5CVEA 1VHEA 4IJUA 4KLNA 1E0JA 1L2TA 3I45A 4MVWA 2BTOA 4E5UA 3E35A 4CKEB 4YALA 2ET6A 2IZ7A 2Y4NA 3IELA 4G8JA 2E0IA 5KC9A 2CF6A 4J43A 1ZVVA 1JEJA 1X7XB 3DOHA 4MGYR 2JJ1A 1ZVQA 1G6Q1 2J5BA 2WU8A 3LXXA 5E95A 4RCVA 2A6PA 3OCUA 2HMAA 3PR2B 5DGXA 5H0IA 1U2DC 4E2ZA 4QM7A 3CONA 4YDQA 1E89A 5CVUA 5ALHA 3UMJA 3ZW9A 3L4BA 2ZVQX 2GARA 2FEXA 3HVIA 4LF6B 2XQJA 4J3JA 1DFHA 1SXIA 3DVAB 3UAOA 4ALIA 4MR7A 5B7QA 1M2JA 5BPFA 3IUBA 3NEJA 4RSMA 1DAOA 2JAUA 5IF9A 3KHTA 3QEMA 5AJYA 1E8DA 2WAAA 3O8DA 3CRW1 3HFJA 4KXQA 4K6GA 5FXMA 5T4EA 1KJWA 1RQRA 3PNVA 5CA0F 4E3ZA 1JFSA 1E3WA 2O0HA 3B5EA 4IO1A 3GNQA 4L22A 4BO8A 4FCTA 1Q17A 1A8QA 5C18A 3CFYA 1G55A 3AL2A 3LW8A 3MYRA 4AJJA 1FP2A 3OIUA 4QUKA 3GJ7A 3ZY3A 4WHMA 4MKIA 1G66A 2MR5A 1CP3A 2QW1A 5DN9A 1SURA 1G60A 1GM5A 3KWJA 2AV6A 3WR5A 3TW0A 4XD7A 1CVIA 2HGSA 3BL5A 3LUFA 1M67A 4ZZIA 3CNEA 5IKEA 5CFNA 2BKLA 3OWOA 3B89A 2MCFA 4WNAB 4BMZA 5CCDA 3UH1A 1GNVA 4BNWA 2JBAB 5EUQB 1L4BA 3CC2B 1E7MA 1BWQA 2PIDA 5KYNA 1W73A 1Z83A 3O7MA 4L9RA 4KQMA 4W5QA 4GSLA 2G17A 2V45A 4YQFA 1JKJA 1TGVA 3PX3A 2PZ8A 2OHOA 3GGPA 3TQOA 5BQOA 5HW0A 5HKKA 2ZDHA 4DYDA 2F8MA 2C7VA 1QUEA 2VT2A 2WA1A 4MYCA 3KYIB 2ZR8A 3B3JA 3L0YA 2WNHA 1OY1A 3ICQB 4UAJA 5CVCA 2RGAA 1Z22A 2VXCA 2P9HA 3DGFC 3OQBA 4XLTA 1S4MA 3V7UA 3VZBA 1CDZA 2I6SA 3VNAA 5KBYA 2XMRA 1DTEA 3OBIA 1D2NA 3AETA 5DBOA 4BASA 1R0YA 1SZDA 2SCUB 4NAHA 5EYPB 1N9GB 4Q39A 3S1AB 4MV3A 1DKPA 3H5VA 1KSGA 4F45A 3EQ9A 2RFLA 3ILSA 3WLQA 3PVSA 4EUHA 5K6TA 1K73D 5JRJA 1V35A 1XQ9A 2RH9B 5EMMA 3KPUA 4LHZA 2QN7A 1H5UA 3FOEC 3OH8A 5JSZB 2ZZNA 3TB6A 4YJ2A 1FX1A 5L4NA 4G7WA 3S2ZA 3SHFA 3OTHA 4ZMBA 1T9AA 4UTNA 4K46A 5JE8A 1H1LA 2X6RA 1UM9A 2ZGVA 2F2TA 3KR0A 3GSIA 1ZMBA 4EHKA 4R4JA 1RRCA 5IT4A 3ZDEA 1RYDA 2HPHA 4RXMA 2VF7A 3Q3EA 1Z6YA 1C0LA 2Z9BA 4TTIA 4I3HA 3UB3A 5K01A 4KC0A 3TMYA 1YS2X 3PPYA 1ZHFA 5BWCA 1KXZA 4EHIA 3MTBA 3FGOA 3L7MA 3FN4A 5K3FA 3W9BA 4Z5XA 3CUTA 5B4UA 5KWVA 1KJIA 1TJPB 4LCJA 2XMPA 1C30A 4MB0A 8LDHA 3RYCA 5DI9A 2Z1DA 3VTFA 1K75A 5TVGA 2GZHA 1XRQA 1SPXA 2EJTA 5TQ2A 2OQRA 4A2QA 1DLJA 5EKSA 3PUJA 4UBMA 4I6EA 3UUGA 4V2IA 4YTEA 2QAGB 3VH3A 1OJLA 4O25A 1G5TA 2L42A 3EDOA 4FZRA 1Q7TA 2JJ1D 1K6EA 1SVWA 5AW3A 1YR3A 2VSOA 4IIDA 3G6EB 4TN1A 1R9JA 3KP1A 1ZGJA 1R0RE 1NRIA 2WU4A 5K0LA 5IKMA 5A6SB 5J4YA 1XA4A 3N2EA 4K7JA 1WXQA 5IXYA 4ZOCA 2WRZA 3OKAA 1U3GA 2VLBA 2GAAA 2OYNA 1ORHA 2Q07A 3IE0A 3GEEA 4FXOA 3W1EA 4OA5A 5JYCA 5CA0A 1OYYA 2BBWA 2YHIA 1KERA 2XRFA 2YOFA 3EVBA 2PSSA 4FCWA 4J4TA 3U3KA 4QGSA 1Y3AA 3WHPA 2FKAA 1MRSA 2QG9A 3TGWA 4U7DA 1DI0A 2WM2A 3THYA 1Q91A 1KMMA 5A4DA 5BT8A 1ULHA 1W36B 3UOWA 4KO8A 2NSYA 3V8EA 2EF1A 3QUTA 2AFIA 3E7XA 1XDUA 1E5XA 3FSGA 4MRAA 4BMPB 1NM5A 1Z3IX 3NKVA 5DCWA 1OV4A 2J3DA 5U4XA 2X0DA 4ZT7A 3W6NA 2RD2A 1OXXK 2ZAIA 4KLCA 1DAFA 4KVFA 1L5ZA 4XD7D 6REQA 3V32A 1XEXB 3ZHXA 1Z47A 1FLNA 5DNVA 3TRHA 3QOWA 1RHKA 3RADC 3MJEA 5CYFA 3HFGA 1PS0A 1UJ6A 1C7QA 1NLYA 4J0FA 3I5XA 2AN3A 2IXFA 4ZU1X 1G5RA 3REQB 1JZSA 4G4SP 3C39A 1N8RD 4Q1CA 1ZC3A 1WVMA 3F49S 2NUAB 1USVA 1LLFA 4B6RA 4F56A 5F98A 4WZKA 1L3IA 2WD7A 4KIFA 1W34A 5AM1A 3GLFA 2Q8NA 3BS4A 3NLLA 1A4RA 2R4UA 1BJTA 4FJ2A 1A95A 4LXTA 5ALZA 2Q3MA 4DGQA 4IQFA 4B3RB 2CMGA 3E15A 4OFZA 4CQMA 2VTBB 4UM8B 2NU9A 1W35A 2O3RA 4R2LA 2JLVA 2ZVJA 5A0VA 2OGSA 5DCYA 4H1HA 2GCIA 3REOA 4AS1A 2G0TA 1WQ4A 1RI4A 4F9FA 4MP6A 2ZULA 1YS1X 3SXPA 1GQYA 2IVZA 3MT7A 4Y2JA 4BZPA 1B8UA 4QVKA 4O63O 2Y1KA 1H6BA 4W99A 1V7PC 2JK1A 4K88A 3I32A 5E1DA 1PYDA 4II7A 2R8OA 1NUAA 3WIVA 2EGGA 1YQXA 1EB8A 2ON6A 1F17A 3FDZA 4C6RA 2MYUA 4IMJB 1LVGA 1YXMA 1X39A 2Q5CA 3LHFA 4G0MA 4PGMA 3UGQA 1WBBA 4FJ0A 1NQVA 1SCKA 2FFRA 3D5QA 4V3BA 5HFNA 3FMVA 1BFUA 4AYTA 2KYRA 4FYYA 1HQCA 3UVEA 3NBMA 3VHLB 3QPVA 3W5JA 3ZQKA 1EFPA 2XNKA 1XMOB 2YWGA 5DNUA 5LYJB 3A3PA 4LJ7A 4B75A 2QLFA 4GOLD 3TOXA 3K2EA 1QIDA 2IYVA 3PA2A 2AJ8A 3G6KA 1OUMA 4HNGA 1I2ZA 5E8JA 3RAFC 1NASA 4LQ4A 3DV2A 3TW4A 4G0WA 2ZZQA 2BZSA 2N47A 3FFAA 1SU4A 4TYMA 5C8YB 5C52B 4HWRA 2WIDA 3I01M 4GUAA 1ZK0A 3O91A 2H2IA 4ZDWA 2H4WA 2GI4A 3EBOA 1IBMB 3IS3A 5EWMA 1RLTA 3DDZX 2WDZA 2XGJA 1KI7A 2DY0A 3FMGA 1BMFA 4HOYA 3PXAA 4BX2A 1XDSA 4EG7A 2F55A 1UMDB 1RSZA 1HO3A 2D1SA 1TT7A 3DFFA 2J6IA 4Q3NA 3QBVA 3HUFA 1A71A 3GQVA 2XA1A 4K1XA 1GL7A 5ILOA 5H3HA 1L9KA 2LXNA 4NBTA 4OIMA 4DQVA 1F2UA 2QKYA 4YAJA 4TZ0A 3G0CA 1GGMA 4CT0A 2IEIA 4URUR 2HQSA 1QP7A 1D4AA 1TO1E 1O87A 5A5FA 4A5OA 4P0PB 5E3HA 1FYDA 1QHEA 4NENB 3OF2A 3RKUA 3JRWA 3L18A 4FQ7A 4REOA 3U4HA 2ZZMA 3LWZA 3WQRA 2P30A 4EUEA 2YNMA 5AKYA 4CIVA 4DJTA 3KVYA 5B1SA 4XGIA 4BIIA 1BXKA 1IN5A 1H69A 3E84A 3IX7A 4E51A 1JLKA 1MF7A 4WKBA 5G40A 4DIUA 2KWIA 3A4LA 3WIOA 1Z39A 1GNSA 4ZVOA 5J9FA 1Q92A 3BCDA 1Z7BA 2C1ZA 4RANA 2GLUA 1CTQA 3HWRA 3R6DA 1CB0A 3KM0A 4HSGA 5CIQA 1X9HA 4GI3A 1D2RA 1A9SA 4H4CA 3ZTWA 3QELA 4N3CA 1QP0A 3FYTA 1UKZA 5C4IA 3TLGA 1IJKA 2FSVA 3ONNA 4QXOA 1RABA 1BS1A 2D06A 1M5UA 4KACA 1VHJA 1B15A 1LJLA 1PTKA 2WWYA 2ZCVA 1QOZA 4MPTA 2QRMA 4PLWA 2WFLB 1GXSA 5LC1A 3ISTA 4K0KB 4CDNA 4KQ2A 4P8RA 3RC9A 2VBTA 5H4GA 1QDUA 3R7SA 4US2R 1DX6A 3LX5A 1IJEA 2PK3A 3L9WA 3R6GA 1NN0A 1X1DA 2O7VA 3QVOA 4N39A 4I8DA 4NCXA 3I53A 3VKWA 3EXFA 4EEZA 1OE0A 1BH6A 2HIMA 3MWLA 3NC4A 4INJA 3EWSA 2C4KA 2B8NA 3R2JA 1QRDA 3A1CA 4JVSB 1Q0PA 2BEUA 5TQ0B 4CQMD 1CZRA 3OJ0A 1JDVA 4J0JA 3DQQA 3E23A 5D7BA 2YBEA 1FSZA 5L3SB 1XMQB 3FJYA 5AJUA 1KDTA 3DPIA 4E5PA 3AI3A 3I05A 2BCGY 2A5GA 1V2GA 3E3NA 3PXGA 4C0HA 1QGYA 4JC0A 2YWBA 4QDKA 1GT91 1HEUA 2I67A 2IZOA 1VHQA 3NX4A 5CJPA 3RARA 5JLJA 2JGMA 2OTCA 1YC5A 2NUPA 3ND5A 3LUAA 3QBDA 2QTNA 1E61A 5DTRA 3PF8A 3HSSA 3Q7TA 2QRZA 4C05A 1RYNA 2I6XA 5I7EA 4X6LA 3AF4A 4EIWA 3WIBA 2FUNB 1RPTA 4D96A 3PNBA 3MJHA 2CNKA 4KDCA 2V5UA 1V1RB 3HP7A 5FAKA 4PHCA 1TLTA 2GVNA 1T8RA 1N07A 2NM0A 4OU5A 2J4FA 3Q5EA 1I7NA 2NZVG 3KEGA 4NESA 2A1IA 3OZDA 5JXWA 3TTWA 3MTIA 3KYDA 4GHWA 3UGJA 1W75A 4ZGWA 5I45A 4JP3A 2JJ2A 3DTVB 3G0OA 1GTVA 3VPDA 3W77A 4BKQA 2YS7A 1RS0A 3C6QA 3QYPA 1PZGA 4FE4A 3AJRA 1J8YF 5LD2C 3SMVA 5SY9A 2ZJ4A 4EHHA 3BZUA 1PBTA 2CUKA 2IDZA