2WR8A

Structure of pyrococcus horikoshii sam hydroxide adenosyltransferase in complex with sah
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
259
structure length
258
Chain Sequence
GSHMITLTTDFGLKGPYVGEMKVAMLRINPNAKIVDVTHSVTRHSILEGSFVMEQVVKYSPKGTVHVGVIDPGVGERRAIVIEGDQYLVVPDNGLATLPLKHIKVKSVYEIIPDKIRKFTGWEISSTFHGRDIFGPAGALIEKGIHPEEFGREIPVDSIVKLNVEPRKEGDVWILKVIYIDDFGNVILNLENYEKPRTVELLDFNLRLPYLETYGLVEKGEMLALPGSHDYLEIAVNMGSAAERLNVKVGDELRVRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN PH0463
publication title Mechanistic Insights Into Water Activation in Sam Hydroxide Adenosyltransferase (Duf-62).
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 77
structure length 258
sequence length 259
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2wr8A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2wr8A01
2Q6IA 4CQJA 2C5HA 2C4UA 5FIUA 1RQRA 2WR8A 2ZBUA 2C4TA 2Q6OA 2V7XA 2V7VA 2CW5A 2C2WA 2V7UA 2CC2A 2Q6KA 2F4NA 2ZBVA 5LMZA 1WU8A 2Q6LA 2C5BA 5B6IA 2CBXA 1RQPA 2V7WA 2V7TA
chains in the Genus database with same CATH superfamily
1NULA 1W4ZA 1D4FA 4FMDB 3HV2A 1DIHA 2Q1TA 1Y0BA 3A3BA 1IG3A 1AKUA 4YECA 5AOAA 3AHFA 1VQOB 2EDCA 3H2ZA 1V1RB 5JXHA 4W5HA 1K8ZB 2GETA 1MU0A 2BM0A 2JGRA 1FRZA 1O08A 3CB4A 5CA1B 2B4YA 4KIUA 3OLQA 1E61A 5DCYA 1EESA 3EOZA 4MIOA 1BW9A 3KQMA 4GYJA 4UUPA 4I5EA 4UU0A 2BELA 4CV0A 1S0UA 5TV2A 5LMZA 2I4OA 5ALYA 3BMQB 3TLZA 5CDSA 1NN1A 3ZJVA 1JDSA 1QYVA 1IIBA 4WKGA 4UPVA 5DXJA 2FR8C 2CYAA 1IM8A 4FZ5A 2QVBA 3ZD8A 5CD9A 1T43A 1WLYA 2WZNA 3NHJA 3IIKA 4KVAA 4XVRA 1A8PA 4J0IA 5HKKA 3HCAA 4KGZA 5B1SA 5DTMA 1LV8A 3CRMA 3EIOA 2NO5A 3RFVA 4RCYA 1GZ5A 3TQHA 3VR4H 4S1OA 4CMJA 3H16A 3U1TA 3RTCA 2X8WA 5KDLA 4IIJA 1VG0B 4G2TA 1UZUA 4D82A 3RHSA 5ITVA 4KIWA 4MHOA 1RPTA 5G1NA 2NUTA 1CKEA 2D0IA 1EFKA 2J3MA 3MC1A 4RV4A 3FH0A 2GD2A 3S5JA 1R4ZA 3T3IA 2OR3A 4NXNB 3DMTC 5JY6A 2KPOA 3LT4A 3ZV4A 1Z5VA 2R25B 5AW9A 3FLEA 4QDUA 5IYWA 4NYJQ 4R5MA 4RPJA 2AE2A 4KPEC 4Y0AA 4XYMA 2X9NA 5LKAA 4KR6A 1DEKA 3QPAA 5ALUA 2REOA 3BRSA 2JLYA 3VHRA 1QO9A 2XMPA 1VFPA 1BS1A 3GUHA 3ZVMA 2WVAA 2X9GA 5LB2A 1GOTA 1CV2A 3ILYA 3A25A 3NCTA 4IQ8A 4RTRA 4RDHA 2WZPP 1YBAA 2IYOA 4HG2A 1R6DA 3EZ9A 4QUJA 2NTEA 3C0KA 3K5PA 2VYQA 3N8KA 3PSHA 3V46A 2R00C 4DV1B 3SSNA 3VV3A 4E2WA 1QQTA 1CSEE 1A76A 3JAKA 2ZI7A 2L17A 4A8JC 4BC0A 2ODPA 5JAIA 4HZUB 4FLEA 5AUNB 4FN4A 4M0CA 3PHGA 4WGFA 2QBYA 4R98A 3D59A 3SQLA 5LOVA 2PKEA 2AOXA 2PWYA 2PUEA 2X8KA 5D5PA 1JSRA 1XF9A 1KZ6A 5LZ4A 1AF4A 1TKAA 5IXJA 4M60A 3QYFA 4US2R 5JNWA 3L6BA 2IT1A 2P7IA 3CIFA 3RUFA 1UR5A 2FHSA 1RYZA 4KRFA 1ZAKA 4OOVA 2H11A 1NQTA 2OOSA 1KI7A 1I2MA 4M2LA 3CLUC 4YRQA 3H97A 4Z1MA 1JQ5A 3KIPA 5CVVA 5DYWA 2C4TA 1D2CA 5J9FA 1DOZA 5E9QA 3THXA 4F8JA 3MPUA 3USES 3GLKA 3OI7A 5LXTA 4LYEA 2YFHA 5IVKA 5FI1B 4BU1A 2GCEA 4ND4A 1ITZA 2R6HA 2M2IA 3HB1A 3W9YA 1IXYA 2PIDA 4HLDA 1F7UA 3UGQA 1XPOA 1XTQA 2QX9A 2AMFA 4BNGA 2BLNA 1TMYA 1EUCB 2Y2UA 3A1CA 3QLTA 4FYKA 2QPLA 4WNIA 3G8BA 5C3UA 1QYDA 1U1IA 3P9XA 4UDYX 4YAGA 3EN0A 2GNOA 4NTZA 2F1HA 3IMFA 4HDQB 5BNZA 3OG9A 2QBYB 1ADBA 1AUPA 2XXJA 1X13A 4A3SA 3GOQA 3IT1A 1DFHA 5FPQA 4M9XA 2FG7C 4H0CA 4HFMA 4ER5A 5ARDA 3CCRB 1KAQA 2ZJ6A 3H9QA 1E1KA 1GL7A 3TD9A 4EI2A 3RPEA 1BMFD 4EF5A 2CDBA 3GPDG 1YZVA 3UHJA 2NYAA 4DLRA 1C0KA 4P35A 1VQ5B 3KBOA 2FP3A 3ES9A 5JDIA 3KQVA 4TSRA 4FSXA 1W34A 4DB2A 3HY3A 2LGJA 5LXTB 3UANA 2JW5A 5GV7A 4RDCA 2IU6A 3CZRA 5DN9A 3SZLA 2BBTA 1XMOB 4HXEB 1U2GA 1X7YB 3NUGA 3NVMB 3Q7RA 4CR7A 3P9KA 5C8DA 4XSGA 4IDHA 4Y1FA 2QY6A 5F33A 1NZDA 4Z4EA 2EATA 2DFLA 3OCJA 4GXQA 4PYNA 5B6PA 4Q1DA 3CURA 3NV7A 2CUNA 2Q3CA 2WM9B 1SVMA 4Y2JA 5ECYA 1U3DA 2N1MA 1A8UA 3A1FA 3E9EA 3GT7A 1GKLA 3KJXA 3MRXA 4Q5IA 3U4GA 4PGHA 4FFNA 3UJCA 4OB8A 4B3SB 2JCVA 4US0R 2AOTB 5CX1A 1TD1A 2WFLA 3T52A 3TJZA 3UCXA 4KGXA 5JE8A 3N59A 2PX5A 2A5JA 4CKCB 4N3GA 5L3ZA 5TXGA 1X42A 1PJSA 2WFMA 2XCIA 5DW0A 1UPCA 3IAUA 4L5JA 1RDFA 1NUAA 1F4PA 4GX1A 1ATZA 4BCCA 3AVXA 4WL0A 5IDXA 2FRDC 3WL8A 3DMYA 3RVJA 4FDVA 3KLPX 4COKA 5IU6A 2C61A 3U81A 3BWDD 2R5WA 2Q9BA 1XAHA 4KNVA 3VVCA 4INPA 5FORA 2CFSA 2WP0A 4D9EA 1QF6A 1X7WB 2ZJ5A 5FHQA 3UV3A 5MGBA 2OBYA 2B5OA 2W6QA 3IOBA 5G1OA 3WBBA 5L7WA 4MUIA 4D45A 1A8IA 1Z63A 4P33A 3V8RA 2QG6A 3GMDA 1L5WA 3GRAA 5ALWA 5LUBA 4OQNA 1J1IA 2Q2VA 4HXGA 3P2KA 3QBVA 4LJRA 5AJHA 2ZTVA 2CJPA 1ZN7A 2HWWA 5ENVA 1M6NA 3ROQA 3KYJB 3ZTTA 3A4IA 4OPOA 4BX2A 3VYRB 4CGZA 3AEYA 2Q41A 1NTRA 2X40A 3CC4B 2XCLA 2ZJ3A 3TL2A 2NVWA 2ZFUA 2V65A 3LK6A 1R1DA 2AFIB 5KSYA 1OI4A 1GUDA 3ICVA 3T15A 4EHKA 1HEIA 5IEJA 2BUAA 1U0OC 4RACA 1F0PA 3C8ZA 5T8KC 3QWFA 1SH7A 2W58A 3MGKA 3AR8A 2FMKA 1ISGA 3D5TA 3R6WA 1OA0A 2KLBA 2QTFA 2VPXA 4L28A 1CX9B 3JU4A 3A05A 1Q6YA 3H5LA 1HFJA 2B1RA 4GPZA 4Q15A 1PQUA 2TYSB 2C2MA 4L6IA 1A7JA 5D85A 2CXHA 2WA2A 2Z2ZA 2ZDGA 1CLUA 4GPD1 1FW6A 4TZ6A 2I1LA 5JXWA 4GLBA 1CY4A 5JCOA 4UC0A 3HDTA 4XD2A 2H1RA 1AQ6A 5C3MA 2QAIA 1FQWA 4KX3A 1XKQA 3R8XA 1PNOA 2Z9BA 4YASA 5AHRA 2P9YA 3LAWA 2WM2A 2PX3A 2RE8A 1DAPA 4L9AA 2PKQO 1HEYA 2FLVA 3B82A 3AF3A 3A0UA 2HF2A 2JKVA 3HR7A 1QXSA 4BUZA 1C5KA 3RWMB 3QMMA 3I39X 1ADYA 4FBGA 1VGQA 2J6CA 4F2WA 1DAKA 1QF7A 4F3RA 1E7YA 5JIBA 1W2GA 3BILA 4OJTA 1W85A 4LXGA 4C76A 4UM9D 2IY8A 2FEWB 3PL1A 5FA8A 3E4CA 2R6GA 4OGLA 5L7YA 5JJLA 3ASZA 2FMXA 3KKQA 1M5UA 3BHMA 5KYWB 2HLNA 3EAGA 4S0ZA 2GA8A 2ZG6A 5AP9A 3M6LA 5DHAA 1IZ7A 3RRNA 2OTCA 4Q47A 1KAEA 1W5FA 1WMSA 1F6WA 3PTLA 4TWIA 3RWBA 4YPFA 2G9UA 5HXAA 3LQ2A 1OH8A 3IQXA 1YRLA 3QOFA 1QVZA 3MEQA 4GH5A 2E1PA 1OWPA 2JRLA 2YXLA 3PDCA 3FMPB 4C9BA 4E1BA 2JKZA 4B3JA 4L9RA 4OHWA 5IF9A 2ZAMA 1OREA 2NACA 4X1IA 4LYYA 1CR2A 4U8GA 1H4VB 5F64A 1ENOA 1UEIA 4ETNA 4ZZ0A 2DG2A 2EARA 2ZWPA 3OZAA 4V03A 1PS0A 1EP2B 4YVFA 2VEDA 4X6LA 4IQGA 4RVGA 3CR3C 3FI9A 3ADDA 2PXCA 1QQ7A 5A5DA 2I4RA 1EP1B 1E6LA 4MUMA 3WGMA 4NL4H 1F0NA 2BONA 2B5WA 2JI4A 2Y2VA 1W85B 1BIFA 2CLCX 3KYIB 3NWBA 4LRUA 4ONEA 3WJ1A 1CXZA 1KQOA 1F38A 1Q1EA 3C3DA 4PSDA 2X5XA 4H7KA 3V7YA 4CKWB 1IUOA 2PHZA 4LVCA 3C6KA 4H7IA 3GH3A 2FPGA 1R0YA 3FCCA 1KDPA 4NCNA 3SIXA 3GVIA 5AM5A 5FA6A 5IXYA 3GLSA 1QKJA 5DYYA 1UK9A 5CBPA 1YRYE 4WOPA 4GI3A 1R0SA 3TS1A 1ONNA 3FZGA 2IYLD 4LWPA 2J9GA 3GJ7A 3GIDA 1BWRA 2CE2X 3MIZA 4OXRA 4C0AC 3A3KA 2QVYX 2AFIE 2I54A 3GEGA 1I7NA 4FGSA 3DV0A 3TNFA 3LQ1A 1HGXA 1QVAA 4FS8A 3SKVA 3R5TA 3B70A 4JT4A 4KRYA 3W2TA 3HP7A 5LA6F 2A5LA 2OXFA 4QDTA 3ABIA 5K1ZA 5H8WA 4Z3OA 5IYPA 1VA4A 1P81A 3TAHA 1JYSA 2QM3A 4RK4A 4X1YA 2HSZA 3AF4A 4IIVA 3MN1A 3TL3A 2D7DA 4UBOA 2D2XA 5JARA 1WSBA 5DJ5A 4HH0A 4JU9A 1WB9A 1OTXA 3GJ8A 1H1LB 4I1YA 1U7DA 4DSZA 4JS0A 1UINA 2I34A 4X6XA 2EG9A 3F4BA 2FPGB 2QD2A 3G9QA 2DLDA 1ZDMA 3RUIA 5L53A 5FCDA 1BQEA 4J4BA 1NV9A 1ZNXA 4P92A 2EBFX 5D84A 4DUPA 5L4LA 2HQSA 1W0KD 4PAOA 1YA8A 4RORA 2J41A 5AW1A 1OGJA 2BSAA 2ODWA 2J3IA 3MINB 1SG6A 1SG9A 3ZCQA 2WJGA 1G5HA 3NPAA 3S5UA 1JFLA 4U39A 3AUUA 5BRAA 2QD4A 2QENA 3R0VA 3GMIA 3JQBC 5JYCA 4I46A 4X1YB 1VSQA 3F98A 3OZXA 3IP7A 1PYOA 1MTZA 1WHTB 3RK1A 2C9YA 2IBTA 4MHTA 4B75A 1FS4A 4G85A 4MWOA 1VI6A 2PZMA 5BQXA 2NZYA 4ND5A 4X44A 2CVPA 4C78A 2GQFA 2ZJYA 5FV7A 3N7TA 4I19A 4IINA 2IZ5A 2VUUA 3GUVA 4JLPA 4UQLA 2YMMA 4M76B 1Y80A 1Y8RA 2XSZA 3I5UA 1V5IA 2QTNA 3PI7A 4HADA 2ID9A 5E0OA 3KPYA 3SYKA 3AFHA 1ZSVA 4MZDA 3KVYA 4IBOA 3O3CA 1EVKA 4BLQA 4DNOA 3ZGYA 4QYMA 3V4FA 1KMIY 1KYZA 1YKGA 2V97A 2P2CA 3DDCA 4NY1A 1K0FA 1AZSC 4CG1A 5C81A 3ANMA 4LMRA 4EJSC 4QVIA 2I3BA 3KSDO 1G291 1QONA 3IB6A 2I99A 2JHGA 3L1IA 1F06A 1N2SA 1ZSNA 2W11A 1JTEA 4GZ6A 4K9SA 1O87A 2H6EA 3ZI7A 1A9XA 1VL6A 1W0KA 1ETUA 4JXJA 3W6NA 3W90A 2BZ1A 3QKTA 4HC4A 1IY8A 1HMYA 1SHLA 3L7NA 3UFXA 2W2MA 1AQYA 1ZGJA 1Z7EA 2XGSA 2XAUA 1M6WA 3DF7A 4PONA 5T3YA 1G5TA 3VRHA 3RU9A 2C5HA 4RD6A 4PAAA 3ECCA 5JEDA 5FL3A 1AIPA 1JLSA 1Y8RB 3BC1A 3N8GA 1AGYA 3IDOA 5BRNA 1E2LA 3ROZA 1VCOA 1Q7TA 1JLRA 3FTPA 3MCTA 1P2VA 3Q3HA 4P2BA 4Q1FA 2BHTA 1VQLB 3DO6A 2ZBEA 4G8CA 4M0MA 4XFDA 5IJWA 2IEAA 4CTMA 1SHZA 1VMEA 1ODCA 1Y4SA 3N1UA 4QQKA 3ER9A 2HDOA 4PLHA 2XR1A 3TVDA 3UA3A 1TW2A 2BJHA 5CIYA 1NWHA 1PUIA 2A7XA 2Y1EA 2YRFA 1R8SA 4H7FA 2HT6A 2WTAA 3M1YA 5JXGA 1A5SB 3KKZA 4QXMA 1TUIA 5A6SA 1ZD2P 1EIZA 4JL5A 2WDPA 1Q7RA 1M0TA 3BL6A 1Z5PA 1VDZA 4DNTB 3VJMA 2C9DA 5T5QA 5MDHA 5JLAA 2CVFA 1OLSA 2LVBA 2PZJA 3OZGA 2CVOA 1ZR2A 4AJEA 3ND6A 2OYSA 2B1IA 2XGOA 2QTZA 3P4YA 1I8TA 3MT9A 2YVQA 1ADCA 3N8DA 1D2AA 1RI5A 2C9MA 2VAXA 2ZRPA 3CRQA 1GARA 1UFVA 1YTUA 2EZTA 3VO9A 3A6JA 4M6WA 1FYXA 1YI1A 3AQIA 1G7SA 3VHXA 5KJ1A 3CVJA 1ZK4A 1U1DA 1DXOA 5IYRA 4YR7A 1EDZA 1L9XA 1PO7A 5DM0A 9ATCA 3AV0B 1FC0A 3QIVA 2IHZA 3PDIA 1LWOA 4RYDA 3STWA 2ZRAA 5FWXB 2B1GA 2DUMA 3CSSA 3GRPA 3FYCA 3U4CA 4PQEA 3IVAA 3RFUA 2GEKA 1FX0B 2QTCA 2YS6A 2Q1UA 4FEYA 1E1QA 2WD9A 5D2CA 3RIEA 1P1CA 1Z62A 2Q62A 2W83A 3ZHRA 5JISA 3D6HA 3A2KA 2V03A 3UZUA 1FFYA 3NYWA 1WY5A 2WUWE 4UZUA 4PFQA 1UOOA 4RGYA 5KSOA 3OA2A 4QUHA 2FMTA 3FWZA 5DM4A 4XX0A 4L8FA 2EW8A 3V1YA 5BORA 3L8FA 4EJ0A 2WPDA 1OLSB 4A82A 1G59A 1NNEA 1ZRSA 2UV8A 4UE3S 4IWYA 3QA3E 1OXVA 4NARA 4TX1A 4QPCA 4PLVA 1YDMA 5DB4A 1RJDA 1DJLA 5DEIA 1LCIA 2DJ5A 3SF8A 2VS1A 4ESEA 2R4UA 2OGSA 4IZOA 3EPHA 3O6VA 1D4ZA 3GWZA 3K94A 2NZVG 4GOXA 3RVBA 4YP6A 2J4DA 1VLOA 2RHBA 3STXA 4EEZA 5IVHA 2G28A 1IVSA 4W8OA 2KB0A 3L8CA 5DHSA 4YRTA 2OCBA 4DCJA 1KU6A 2XUFA 1LBQA 3FDFA 4PPQA 4YJFB 2ZWMA 4B40A 1Z7YA 1T9KA 2AKAB 3HWWA 3CEAA 4L5YA 4YCJA 1J22A 2VZLA 5E2IA 3GB9A 2A84A 3GIRA 3FFXA 4FW8A 3KR9A 1X0XA 4YCAA 2BFFB 4NBLA 2JIDA 2O3QA 4IRUB 3TEFA 1U1GA 1N6IA 5BXYA 5JSUA 5E6RA 5K51A 3AR6A 2EJUA 3NM6B 3ZDCA 3UWDA 4AY6A 2R85A 4EFLA 3BWYA 2WTEA 2BI4A 4J3NA 4XWWA 4RTKA 5C52B 1QH8B 4BN0A 2RGYA 4B7UA 4I5IA 1UKEA 1CF2O 1YGYA 3RBAA 2DLCX 3W1WA 2J9ZB 4IEFB 3CM0A 2IZ7A 5E95A 1EFAA 4FU0A 2WHQA 4CM4A 3U7FB 3OOCA 3NC1C 5KYTA 4KKVA 5AKHA 1PLLA 3A9TA 3BKXA 2O0LA 4F6CA 3QKIA 3SICE 1R5BA 1ZA1A 2CMFA 4QE3A 5BMVA 4FNGA 3R7WA 1H3FA 2IODA 1W6RA 3HL4A 3O95A 4AVZA 1ZISA 3C85A 4IS3A 4MCIA 3M6AA 1LV7A 2J0UB 4U9UA 3RS5A 2QNIA 3QUBA 3IUYA 4Q37A 4IFTA 4RQTA 4MO2A 2ZBQA 3H83A 3DNPA 5ECWA 2QD3A 3UWKA 3CNQS 3COSA 3ITNA 1EZ1A 1NBWB 4C0WA 3EXHA 1DRKA 1J99A 3F6RA 4IIBA 4CODB 3Q1LA 4LXTA 5EZ5A 1VCMA 4HUTA 2X9LA 2JGLA 5MFZA 1RWWA 4P5PA 5E6RB 2XUGA 1GU0A 2NTJA 1DX6A 2OHFA 1GRCA 3H1TA 3R3VA 4QXQA 1TLTA 4RANA 2HYIC 4MCAA 5BN3B 4UTRA 5FBQB 1R6AA 4OM7A 4WN9A 5FA5A 3H13A 4CM4B 3TX6A 2PGJA 1P91A 5CFLA 2VYFA 3ETJA 4YMIA 3EBOA 1A9SA 4CDNA 4Z6KA 2VTVA 1DEAA 1JHAA 2ZIVB 3D0OA 2IDZA 4OX9Y 1L7RA 1N0HA 4NWIA 4F4HA 3LF2A 3Q2OA 1U8EA 1MC1A 2NU6B 4BFTA 3MUFA 3ILVA 2IV2X 5EKXA 1CDOA 1EBFA 3OY2A 3ZWOA 3A8KA 4L8GA 4X00A 3GLGA 2H92A 3WWPA 4RVOA 1PZFA 3HCOA 3N9IA 5MGNA 3PA6A 3VZRA 1GO2A 1A5BB 1O57A 3ITDA 4KKSA 1A7KA 1YS4A 2XZDA 3CY6A 4PX9A 4O6VA 4Q93A 1KF0A 2HJHA 4EF6A 4BIMA 9GPBA 4G3XA 2DH5A 3MBOA 1ZIXA 5JNRA 1OXMA 3I9V1 4XOTA 2C2BA 1NYRA 2IU3A 3BB4A 1K7EB 4O1IA 5AKGA 3WP1B 1KFEB 1RWVA 2E4YA 2V7BA 3DNFA 1KGDA 5DSXA 4E22A 1I0IA 3RV3A 4I08A 2B9EA 1KEPA 3B8EA 5K0TA 1D8TA 1GXSB 4G4GA 1LSSA 3DVQX 1YIDA 4EPTA 1C8KA 1YDEA 2W0MA 4RS4A 3KM0A 2GR9A 3TI9A 4MRMA 5KVQA 4B43A 1PW5A 4XVHA 3UKOA 1R4NA 5B58C 1NG9A 4ED9A 3HSKA 4LJLA 4EUNA 1CRZA 4X63A 4NBTA 2XKBA 1P5FA 2H18A 2PFSA 5T67A 1GZ3A 5C7LO 3ZJUA 3RVRA 3KEWA 3PENA 2VAPA 4NU6A 1ARZA 4L8LA 4OSEA 5K6RA 3GJTA 2DCUA 1MQ9A 2R2GA 1QVVA 4XB1A 2IXAA 3GLGB 2X4DA 1E2HA 1DBIA 1KMQA 3N6XA 4JJAA 2O3TA 1HA3A 3KQNA 2QX6A 3O1HB 1Y7IA 3H7AA 1D4AA 4Z8XA 4F38A 2CB9A 1OWMA 3GGOA 3P2OA 2O57A 2G08A 2J9YB 1O6FA 2MIIA 3BD6A 4ENPA 5KEIA 4WXMA 2NTVA 1U8UA 3S40A 4FGWA 2G3YA 1XD8A 1DUIA 3LPNA 1RFLA 1SQ5A 3DMDA 4MQ6A 4R1TA 2A9JA 5DV9A 1AMNA 1XHLA 3BMOB 4E5UA 1N5LA 2CLOB 1OLUB 1Q14A 1TOAA 1YU6A 2GXUA 2AZMA 1SR8A 2WG1A 1J09A 1GILA 3D6FA 3EXFA 1ZGGA 2HDHA 4J4TA 5THXA 2EIXA 4PQYA 1C3OB 2B4TO 5EPEA 3PNMA 3KXDA 3EUEA 1JJBA 2J3QA 3UWMA 2XUQA 2PVCA 5CNMA 3SSAA 1HX7A 1XA3A 5CITA 1E7WA 3M6UA 3QPDA 3KAKA 1PGQA 2O3SA 4OX9B 1XTBA 4S1VA 5BQOA 2GOYA 3KB8A 1ZUIA 2LTAA 4JKOA 1I01A 4AUNA 1VBNA 1BTOA 2NSYA 5JBQA 4KO3S 5HR5A 3N53A 1Z35A 3RUDA 2QLTA 2YW2A 4EP1A 3IUQA 3MT8A 2WZDA 2M6KA 3TCKA 1PJRA 3FPHA 4FQ8A 3NH9A 3CP2A 4PBTA 1LVHA 1ZMOA 3THOA 3HWX1 5KSZA 1MGPA 2EFYA 3IAHA 5FOTA 4LJ6A 4OYLA 5IT4A 1P2TA 5KQGA 1DLJA 2W6ID 3PFKA 4OPMA 2BR4A 2FEPA 1GYQA 3DLCA 4K3VA 4O08A 4ZU6X 3SPXA 1D2EA 3GI1A 3BRQA 3MTGA 3NBZC 4YCLA 4RZ2A 4QIHA 2G9NA 4O0LA 4UMEA 3P9YA 4B46A 4ASUA 4LGMA 5IK2A 2VP9A 3C7AA 3RT7A 1Z8NA 4AG6A 3OFSA 4GX0A 4HLCA 4CCYA 1LK5A 3HYTA 4ARIA 3EK2A 3QPCA 4DQ0A 3NVKI 3W78A 4D6PA 2C1ZA 3I83A 3U80A 2P3QA 1CUYA 4LK2A 3W06A 1N8SA 1O03A 3BHJA 3ESBA 1C14A 3IJPA 3LUFA 3CG4A 3T5MA 1I13A 5ESRA 3W79A 4KXNA 4BEWA 3OOWA 5CD1A 1A9PA 5IH7A 3ED5A 2WSBA 1KI8A 2QNBA 3EXIA 3ZV5A 1KERA 4P0PB 2XRZA 3TTVA 2H2GA 1XTKA 4FUQA 1NF9A 1F5NA 4B3FX 2AQHA 2EC5A 3DL4A 5F77A 5F7ZA 4PC7A 5DISB 3RTGA 4DG9A 4KWHA 1MTOA 2FFAA 4QYIA 2BKVA 2YASA 3R3SA 3FYDA 4WNAA 3X1MA 2ONZA 3LVQE 3OQIA 1SCJA 5AM0A 4WZEA 2GZSA 3E82A 3DE3X 3KLBA 4FD3A 5HRUA 1OH7A 3I9FA 3GG9A 1O95C 2NUAB 1PGJA 2VDKB 2NNWB 3IHKA 6REQB 3UAGA 3S0JA 1JSZA 2H52A 3HEAA 1QOZA 4GRIA 5AVJA 1V26A 2CL6X 4G7XA 1C9NA 5KNBA 2RBGA 1NOKA 1O94D 2C7OA 4XIFA 1NWCA 1ONBA 1PJ6A 5DX1A 4DIDA 3B5JA 4QBFA 1EK1A 1UXHA 2YXPX 3DLBA 2QAGB 1JX6A 2H0AA 3HJNA 1P80A 4CLOB 5AVXA 3GLGE 3UYKA 3EXIB 3PLRA 4BLVA 1J0CA 2X77A 1AKQA 3C6XA 2RHDA 2ZI9A 3FXAA 1OXUA 4IV5A 3DS8A 1L7VC 5AJUA 1MB9A 3FKSD 2BFEA 3JQ9A 1RQXA 2D5CA 3IAM1 4HPXB 5LQKA 5HCNA 1U5AA 3C1AA 2ATXA 4MUGA 3IQDB 2FLWA 3KEMA 2V9CA 1P33A 3E9CA 4DNRB 2FPUA 1RXUA 1OLXB 1VJTA 1A9QA 2PX8A 2O2ZA 1R6VA 1U8XX 1QQ6A 1I18A 1Y7PA 1Z07A 3QLJA 4OKNA 1L4GA 2FF7A 1BXRA 1QFSA 1FK8A 3B2QA 3YASA 4DRZA 3BFKA 4A0QA 3PPVA 4GM0A 3ZD6A 1X14A 3FPGA 1KEZA 5DBHX 1KVRA 2NO0A 3GN2A 2H2FA 3CISA 4UBNA 1PWXA 3RS4A 1N6PA 1QYXA 2VBIA 2JB9A 3TSOA 3TW8B 4RQUA 3HDQA 2YOFA 3C8UA 1UZAA 4YN3A 3FVRA 1G8YA 4GXNA 2XRYA 1US8A 4OVKA 3SOPA 1BCSA 3UAOA 4X20B 5GV8A 1ORDA 2GAOA 4YMSA 2BFEB 3DR5A 3TLKA 5B55A 2A33A 2ZLBA 1ID1A 1DV2A 2OCLA 2PT5A 2AN9A 3H2IA 3IUSA 3NB0A 3O4GA 4K9QA 4F7WA 2R1VA 3COJA 1MG0A 3H6KA 1SCNE 4Y1GA 4CTJA 2PSEA 2YH2A 4CEHB 1YIOA 4G5QA 4L85A 4UCWA 1W4BA 2JFWA 2JJ1A 2MTBA 4FGJA 1E3SA 2D74A 3B8HA 4QFMA 4C1NA 4EHIA 4IRXA 3TZHA 1E69A 4JLOA 3QU5A 4QJBA 4CKZA 4GZ5A 3RGWS 4ZV7A 5LMUB 3SK0A 1XEFA 2AYXA 3CT4A 3EFOA 1FRNA 3O2SB 5COAA 1UWKA 2WJPA 2REBA 5DU2A 4RZHA 2XUZA 1PL7A 3GHYA 3KE8A 1CFJA 1BWPA 2H2IA 4NOJA 1NUTA 2GN1A 3UGJA 1WXEA 4MRAA 1YNSA 1LI5A 1QHSA 2QTVB 1NVFA 4BL5A 4DIOA 1US8B 2XTNA 2ATVA 3GRUA 2QYSA 1MAVA 4LJ5A 4OBXA 3C87A 3CC7B 4YP1A 1BXGB 4NP6A 3UHPA 4P8RA 2IZ0A 3S68A 4EELA 2Y1KA 4EHHA 1F2VA 4AF7A 1SD5A 3D02A 4OJNA 1SCKA 1VLZA 4BQPA 5BUZA 4J0FA 4QPNA 3NC0C 3AHGA 2R1VB 5EVCA 4I4LA 2QUJA 3FNQA 1YKFA 3MGAA 2HU2A 2FW0A 1D03A 2YRXA 4YXFA 1ISFA 1FZQA 1IATA 1K7CA 4MJ7A 4MVWA 1XDDA 3HDVA 1ES9A 2FUKA 1WOOA 3K2EA 3N05A 4LE0A 5K0NA 4A23A 5FEUA 1ZD3A 2J3JA 1M8FA 1GJRA 3EFOB 3TQRA 2WMDA 1U28C 5G0UA 2D0OB 3OJLA 4L7VA 1N32B 4DQKA 1X7XB 1BDIA 3ZG6A 4DBZA 2Q5QA 2HMUA 4HVCA 3T7IA 4MR9B 2WIBA 2Q4RA 4DNFA 3PUZA 5E2AA 4EG7A 1B74A 1AHHA 1EZ4A 1E98A 2QD5A 3JAWA 2YBDA 1UKYA 2VJMB 3DEYX 5JD5A 2WB2A 1AKWA 3MHTA 4UHCA 1U7PA 3B48A 2JJ2A 1UKZA 3BBPA 3EIFA 4TMXA 4G9BA 5EN4A 4L57A 2JIQA 2WAOA 4QU9A 5FB3A 3QEBZ 2IYZA 4DWJA 2G07A 2RAFA 2I7TA 1L2TA 3FX2A 3ZWVA 4BU0A 4BLSA 1UFRA 1P7YA 4HV4A 5HKOA 2FEOA 7AT1A 5HZHA 2WSIA 4WLOA 4GKBA 4TYWA 3CW2A 2YZGA 4IMRA 3VPGA 4EHFA 3HABA 1DCKA 2W8BB 4OUDA 2MYTA 3EVGA 3G2IA 4Q9KA 4BCBA 1LNSA 2AR9A 4M4SA 3C5EA 3GGSA 1CETA 4KDFA 1T8PA 4WFJA 4Y2UA 4TYYA 4LUCA 1NQVA 2OGTA 2EKPA 2J5KA 3D81A 4JJEA 1DJQA 2BGJA 1N78A 4JMLA 4AMUA 1NSTA 2CUZA 3COPA 3IS3A 2ZJ8A 3ONEA 4FHZA 2ZXEA 3DAHA 4IKOA 3OQJA 3EPKA 1M6VA 1R37A 1SK8A 5LYYA 5H4GA 5LC1A 2R4TA 2WWYA 2JGEA 2WUVA 4L07A 1OFUX 2ZSEA 1M90D 2VHVA 4W4TA 7MHTA 4NQZA 2IYUA 5SZJA 4R3UC 5AUPB 1I6WA 3TTYA 4I9HA 1TTHA 4WADA 3LPAA 2IBSA 4WLEA 3LX5A 1KJNA 3O3OB 4B2YA 5BV8A 3GFTA 1AQIA 5FUMA 1VQ8B 3EGIA 3QJ5A 2HGZA 1W1WA 1IHUA 1UMKA 1F17A 1VQPB 3GBVA 3NR2A 3L5KA 4FCCA 4LVUA 1EIWA 2W71A 1VRVA 1GGHA 2QSZA 1BDBA 1BZYA 3L7AA 4E4RA 3BA1A 5FT9A 1RYNA 2ZUSA 1UOQA 4HWOA 4KRGA 3TM4A 3HM2A 3V76A 1IJEA 2LZJA 4RDJA 4MWTA 1CQPA 3EDQA 2IP4A 4KPFC 4PINA 4UUBA 1YS1X 4D4KA 2OBRA 3BCSA 2RONA 2Y4OA 3PD0A 2WLSA 2JZNA 5IJAA 1OGIA 1M6VB 1XDSA 1EX1A 4QBHA 5B3LA 3DPUA 2GF2A 3CCVB 1YB1A 2OFPA 4QDXA 1NVBA 3KDPA 4RK6A 1JE0A 2HEGA 3S2YA 3GFOA 1EG7A 1Y4DE 2ATIA 3GVLA 3VR2A 5I7EA 4WQMA 4PZYA 5HA5A 3ZD7A 4R54A 2WYVA 1SCQA 4QO7A 1NW9B 1W94A 3LD9A 3LO5A 1AN9A 3M81A 4Q3AA 4M0UA 5ERYA 4E7PA 3UUEA 3C3AA 3EMKA 2II6A 3VO2A 5D3MB 3FCYA 2IPAB 1SC3A 2OQIA 2XE7A 4CM8A 1UKAA 1KETA 3GHHA 3T5TA 5KWSA 1B1CA 4NULA 2VJBA 1N57A 2QPAA 3O4JA 4DXAA 2P67A 4DA7A 3QF4B 1KK2A 1O97D 3VH3A 4OFBA 2FWRA 1IZ9A 4KWIA 3RVNA 4MYTA 4QG3A 1Q2XA 4YBZA 1Z5GA 3KQHA 4QM6A 1N5IA 1UBGA 2Z2YA 2CF4A 4PWYA 1SK9A 4WA8A 3WLJA 1BG6A 2ZR7A 3CRZA 4ZVVA 3PTAA 3NDBB 1JQKA 5KOJA 4JLVA 1IZ8A 1W75A 4HLNA 3DTNA 4HNRA 3MERA 5K0LA 3F5FA 1BN6A 4CNQA 1MLDA 1WXIA 4K8RB 1Y9JA 3ORHA 3K70D 1F1JA 5LNK6 3EYWA 3BY2A 1GUBA 4N82A 1DX9A 1QZZA 1UM8A 4IUCS 5ED4A 4PHFA 3D6MA 5EI5A 3IOEA 4QHSA 4UXHA 2RSLA 3QSGA 4FJ0A 3T0IA 3UOAB 3ZLVA 1W1UA 1S2OA 3JTMA 2XWJI 4J16A 2JN9A 4EY8A 2C7RA 1M8GA 3OURA 3TIFA 3FOEC 2FFJA 1HSZA 2GZ2A 2OORA 2AX3A 1J90A 1TYAE 3BB3A 3PQDA 4REOA 3RJMA 2GXAA 5FTKA 2P9JA 4PE5B 1QH9A 1H6DA 5DCLA 5EWMA 1VJCA 2FHPA 5L46A 3SS8A 3WJ2A 3TKAA 1Q95A 4GD3Q 2ZCVA 2CK3D 4C29A 2WJ4A 2XRMA 1ZHHA 5FRDA 1KDOA 3FBTA 3G6KA 1K9SA 2C31A 1EJ0A 2W37A 3BRCA 1XMSA 3TVTA 4DLAA 3I1IA 4WERA 3AZOA 3UMYA 4F2DA 1N5RA 1EVEA 1Z28A 2OA0A 2CHQA 3E6AA 2UZ1A 2VXOA 3T61A 1AZWA 4OCZA 2PMWB 1HO3A 3D6JA 4Z4TA 3OHSX 4IJUA 3ORFA 4JJKA 2WP8J 4UASA 3WK6A 2VYNA 3K9WA 4OXYA 4BV9A 1PG0A 1B26A 3DBVO 4LXUA 3C45A 1QIMA 1TPYA 2OXRA 2ZAIA 3IEKA 4NH4A 4YROA 1WKVA 2XCQA 5ALEA 3UKJA 4EATA 3GAZA 4KQFA 3RIYA 2VBFA 1HDGO 4PGGA 1LQUA 2CGEA 3E70C 3GJ5A 3TECE 5AM2A 3E9DA 1PZGA 2JFGA 3IIIA 4YRIA 4ZP1A 1EJ6A 3NXSA 2WWRA 1DAMA 2X6RA 2W2LD 4LDQA 4QOFA 3TQIA 1GQQA 4D9MA 3WYCA 1Y9AA 2G1KA 3MOGA 3HFSA 2G9ZA 4PYMA 4R9SA 3BZBA 3ZHSA 1HLDA 2HF7A 4G25A 1N6NA 2Z4RA 3KWFA 4IFIA 3WB9A 1UPXA 1FMFA 3ZR4B 2ZETA 2E2WA 2WUDA 1DXQA 1KBZA 2O6LA 3EG5A 5IJXA 1E4OA 1VJGA 3DWFA 3SXUA 2V0GA 4EG3A 4YQFA 1HRKA 1M34A 2IUTA 5LZ5A 1Y8QB 2JCXA 5TEWA 4DPMA 4EI7A 2CV1A 3BH7A 4JLDA 1RT9A 1YNOA 1ZC3A 2CK3A 3AHJA 3W5VA 1F8XA 3R2JA 3A1TA 4MW9A 4PYLA 4ROTA 4BQOA 1LGYA 4RFSB 4F46A 2Q5OA 2PSDA 3NT2A 3KYDA 1VSVA 1LLFA 2DY1A 1YONA 2PZKA 1NPTO 4FZRA 4F6RB 1AUOA 2PA3A 2F3RA 2SCUA 1I4TD 1QC5A 4XJSA 1B0UA 1QGED 2HCRA 2PA0A 4GEKA 1QHHA 4BNLA 3OLCX 2YJNA 2WMOB 3IT3A 7MDHA 3KZCA 4Z99A 5JYBA 3O5AA 4LKRA 3DHWC 3VR3A 9ABPA 1Y81A 3P2YA 4XB2A 3LUBA 2O5CA 1WW2A 2I3ZA 4AKEA 2I4TA 4D9NA 3OTOB 3W2IA 3LCJA 2VPIA 3UUFA 3NIGB 3L18A 4KYTA 3BF7A 3ZS9A 2AZXA 1IDN1 5D6OA 4S04A 3CD6B 2XVYA 4DJFC 4TROA 4YDSA 2GREA 1H8EA 1C1DA 2IEIA 1EHIA 1UAYA 5G4KB 3P9CA 4I50A 1VQ7B 4J94A 5B58T 3TTWA 2Y92A 4B34A 5K3BA 2UYHA 2GBFA 1L1EA 2W8ZA 5ITZB 1JZTA 4OBEA 1KVQA 2IITA 4FMDF 4ND3A 3EAQA 3DKPA 1EB8A 4N0QA 3HCPA 3IPXA 2F9LA 4NMHA 1ORTA 1WBDA 1CVRA 1R2QA 1NVEA 1KAGA 3PDUA 4Z8YA 2DHRA 1M74A 2YJ3A 3E7FA 3HU5A 1LEHA 3GCDA 3SVTA 1QC5B 3AOEC 1CDEA 2CCJA 1F6BA 1QHHB 2NZJA 3TGWA 4OYHA 3TGPA 5EMNA 2WTNA 5HQJA 2DPMA 4BGDA 1SCUB 1IHYA 2W6OA 2VSOA 1EFCA 1GG8A 2C83A 1Y5MA 1U9JA 3Q6MA 1WDTA 2GPNA 2JAPA 1JXMA 1A72A 2NV2B 1JDUA 1P4SA 3L7OA 4MIEA 4XOIA 3C6BA 5ILGA 4YV1A 1GPWB 1D2HA 1O89A 1P9RA 2AZTA 4UU7A 3CVOA 3RUEA 4BBAA 2I03A 2Z8YM 3QYJA 1Q0ZA 4P7GA 4UVGA 4HQ6A 3NV9A 5CCBA 1YSCA 2XLCA 5CUQA 2XIQA 1T6BY 3DM9B 2P11A 4IHAA 4BMXA 4F5DA 2BGKA 5JVDB 4RTMA 1RHMA 4I50B 1DJMA 1QNFA 3AZQA 1LK0A 4L4SA 4NE9A 3HJTA 2XXBA 5LD2B 3K1TA 4L8YA 4DV2B 1GL3A 2NO1A 2QD1A 3JRNA 3VSCA 3N3BC 2O0HA 4TV8F 3RRMA 4AY2A 2BOVA 1DRUA 1WEHA 3HXTA 5L6LB 1E18A 1PZNA 1T5DX 1WPQA 4X7MA 4ZQBA 3UJNA 1RP1A 1SULA 1W2WB 2XAAA 2ODQA 2JG3A 4R83A 4U5QA 2WWFA 3BQNB 1EAYA 3GUUA 2ZSDA 3R5HA 3SEAA 3UH1A 2IC5A 1UKBA 2XYQA 1GWNA 3R1IA 1LBTA 1PEYA 4JGIA 5LZ2A 3WRVA 4DDMA 3V8QA 1ENYA 1MF7A 4C14A 4I1IA 1GYRA 2JIBA 3IAFA 4Q7EA 1LPMA 3AKCA 5T6MA 3H9CA 4B7AA 4E46A 1GP2A 4LJAA 5C5CA 1Q1ZA 3PA1A 1E6WA 2IXEA 4PHCA 4XLFA 4XONA 1L4HA 4H7DA 5EXPA 2XUPA 4NDZA 4WFKA 5KTKA 1G3UA 3FZEA 4E0FA 2Z3VA 2UUBB 4JP5A 5HK9A 1M67A 2IY7A 2RGCA 1KC3A 1LJLA 4Y98A 3BXZA 2WZCA 1VKJA 2PSJA 1Z38A 1H8HA 1YZKA 3AF6A 1OOEA 4RPIA 3SKXA 3HCCA 3OZBA 2ZZGA 4C4PA 2KVOA 3D6TB 4LY9A 5AXBA 3TD6A 1RRGA 3OM1A 1LNQA 2KM1A 1Q1NA 2O3JA 2R7MA 3BK1A 3EDMA 4YUZA 4C04A 5KNBH 4AP9A 4F72A 1M75A 3HNOA 4JBLA 4N6OA 4XZ3A 4RTLA 3WQSB 3QKRA 1TNDA 3KBBA 2C4UA 2Q1YA 3IQEA 4IKEA 4PZCA 1DXHA 3C3XA 3JQ6A 4P9SA 1FFAA 3FRHA 1M8KA 1YJXA 3BE5A 1X1EA 4U1RA 2IDKA 5D7NA 3ENVA 3P4UA 5L8VA 3OQNA 3JVVA 3N2YA 1INLA 2RHLA 1XTIA 3BTSA 4HDSB 1NV8A 4MQUA 4QGSA 4MPDA 2A1TS 1XZIA 4NS1A 4KWTA 4E3WA 2B94A 3AKDA 1EEXB 2IWHA 4JJGA 1KIFA 2C5BA 4YMWA 2WHXA 2I55A 2R7NA 3CIOA 4HYQA 1QG4A 2JH9A 1DO8A 4PBRA 2QTHA 3VKFA 4XVQA 4JDUA 2RIPA 3A1WA 2FSVA 2DECA 3EUFA 1L5KA 3GZNA 1PEAA 2QMHA 1QCZA 4MWGA 5HIJA 3JRWA 2QJFA 3IP8A 1VTKA 2ZWAA 2J0EA 4BZZA 5CXQA 4TXHA 1D2GA 1ZQ9A 2P35A 1YR8A 2OCGA 2WSMA 3U17A 5ADWA 5T4EA 1ADFA 3P5SA 4CN9A 2WNSA 2W2KA 5F5NA 4B6GA 4MCJA 3ZY3A 3DULA 1H9AA 1U3WA 3QE3A 3QKRB 1W36C 1QUFA 4EPWA 3IE1A 1NXXA 1P4RA 4NSNA 4TYNA 2QSUA 2P2NA 1C4WA 1B8VA 2ZRFA 3DQPA 3OEEA 2BKUA 3SBOA 4CT5A 4IMJB 5K8TA 1JFFA 1VOTA 4V0LA 4X93A 4S2EA 2I7CA 4K9OA 3KALA 2BR3A 5AI6A 1K4MA 3HVJA 5J2TF 4B45A 2W4QA 2PUTA 3T5CA 5A4FS 5LU8A 1A97A 3P0FA 3WY9A 2VJKA 1VHJA 3OIFA 5FJJA 3WS7A 2Z3WA 1E2NA 3VTFA 4XGKA 1JG4A 4YJ2B 4W5TA 2DF8A 3ONWA 1WSVA 1X74A 4TL9A 2I33A 2DSNA 5G2OA 4PYJA 4AMZA 3EWNA 1AY0A 4KP7A 5FTNA 4BNWA 2L42A 4X7RA 1WV0A 1CZOA 4JROA 2UXDB 1D0SA 1ISHA 3I76A 4IFEA 1GTJ1 4MPRA 4FONA 1CUVA 1XVAA 2RGXA 1RW4A 1O0BA 4OHBA 3MWFA 3IXMA 2DFPA 3HBNA 1XEWY 3GBPA 4IH1A 4WK4B 3H5NA 2IRWA 1T2AA 3H1BA 4FMCF 3VYWA 5JFTA 4UM7A 5BUCA 3Q0EA 3VUEA 5HS4A 1DTSA 3LX6A 3AXSA 1NR1A 1T0PA 1T9HA 1QVWA 2JDIA 1JWLA 3GLVA 2FPXA 3MTDA 4U63A 4V0NA 5THKA 3RE1A 2K6GA 3ZXIA 5B1IA 1TJ5A 3COZA 1OROA 4NMLA 1DUVG 1X0VA 3D8RA 4UEJA 1QFXA 3U4MA 4JYAB 3L6CA 4QX6A 2E9SA 3OIGA 4CU5A 1RBYA 1UL1X 4XB6B 4ADSG 5FL7A 1NVKA 1AMUA 1UUFA 3IEXA 1Z83A 4WNYA 4I8XA 4YGXB 3JQPA 3GNLA 1JKFA 4Z4HA 1BJRE 1H93A 4HN4B 4DCVA 2NVUA 2O7VA 4IZIA 4E11A 3JYOA 1TJ4A 4C0JA 1T6XA 3E1GA 4ZT4A 9MHTA 3FLBA 4DARA 1UQRA 2XMZA 3U7GA 4R9RA 1T9GS 1VDMA 1V16B 1XAJA 2PBFA 5DS0A 4Q0MA 1OI3A 1PL8A 3QFHA 1CEEA 4EJFA 3FPEA 1VPDA 3NS7A 3T1TA 1QKIA 3KKLA 5AKLA 4DOMA 2BUCA 5CVTA 3ZZ1A 2FE1A 5M34A 4RAQA 2OUIA 2H1LA 4FOTA 1YJAA 2ZIGA 3N2IA 2BHLA 1MVLA 3TW0A 3ZWQA 3FYTA 4PPNA 2HUNA 5KHAA 1GLVA 4GBMA 1YVDA 2CYCA 3A7EA 1L5MA 1MO2A 3ACCA 2SECE 4I2VA 4M0EA 1D5WA 1UD5A 1NTOA 2TS1A 3IQFA 3UJBA 4AJHA 1V41E 2TMGA 4MI1A 2HOQA 1YCHA 5C51B 1GGFA 3Q6NA 1Y1RA 3RHTA 2B92A 3AX6A 3HYRA 4BV8A 3WWCA 3OX2A 5D6NA 2NVUB 4BMCA 4IHQA 5GONA 2C99A 1EVLA 1ZXBA 2W9XA 4DYHA 1DKLA 3SLNA 3DL0A 2QJRA 2P2YA 3HWSA 1BRTA 3GGGA 3JSXA 3U4IA 4DLNA 2G9RA 1U6JA 3HP4A 3SZMA 3T3DA 3WIBA 2R8YA 4U2BA 3K8QA 5DTIA 5ADVA 2IZZA 4G5FA 3TRHA 1H2WA 2OD2A 3U0BA 4MARA 2XKAA 4PR0A 3WNBA 2GCIA 3U0VA 2X5JO 1KO7A 5EJIA 4W5RA 5E6UA 5GY7A 4R4JA 4IGIA 4FFWA 4LC0A 4R69A 1CY8A 1UPBA 1GGJA 3FVQA 2Q21A 1JP7A 2QY9A 1FX1A 1A69A 2P6UA 4HTFB 4K88A 1TPZA 2NXJA 4O8ZA 4PBSA 5COQA 4JVSB 5DYNA 5A8AA 2AZDA 3SZOA 4MGZR 1C8LA 2VK1A 2MYNA 2QL7A 4TS1A 1ZP6A 5ISMA 4FXOA 1N9GB 2V8BA 3HGTA 2IPMA 3V4PB 3AP3A 3I2GA 5B3KA 3SFZA 2YOGA 4L8VA 4W63A 5CXUA 5GM2A 2GAAA 1XR3A 2QN3A 5ERXA 5CH5A 2E82A 1RJWA 4LZZA 1G21A 4GU5A 3OTWA 3S3TA 1TZBA 1GNPA 3DOEA 3WTCA 2IE0A 4MEBA 3EZ6A 2OCAA 4O3FA 4RTPA 3VO1A 3E2PA 4O2RA 1ZD9A 1JALA 4KREA 1HLFA 3S7TA 2NUPA 4YIKA 1REQA 3WLFA 3TPZA 3EZFA 5KPJA 4MVJM 2AI3A 1YVEI 3E27A 3HDGA 4HS9A 1MZPA 3T3EA 1IOVA 1TQHA 2F1KA 3U3KA 1JAHA 2ETVA 1MUUA 2VPPA 1CNMA 5JT1A 2J7PD 2BY4A 2M6LA 2AZ4A 1SXJC 3KSRA 4CM9D 3VSBA 3E1SA 4FNOA 2FOIA 4LHZA 1SUCA 3NHAA 3BGWA 6ADHA 3UQZA 3NNDA 3P0IA 2GJ9A 4NEQA 2EZ4A 3OUZA 4JB8A 1EGAA 4POAA 1RAGA 4PN7A 5JUWA 1B8OA 3IDSA 5MFPA 4BS9A 2P65A 2D2FA 4QGGA 4DMKA 5IJ0A 1CQZA 3HNPA 3TB6A 1VLHA 4LDNA 4FX2A 4PPYA 4ZDJA 3WOHA 3LCCA 3GF4A 3ZX5A 3IBCA 1R27A 2FN4A 3CN9A 5LDGA 4BRWA 3FHJA 1A8HA 4LNUB 4J6EA 4PO9A 5AN9A 3RROA 3BK2A 3L4JA 4ZWNA 4ZC8A 4LRSB 1KVTA 1T9AA 1SZPA 2XD9A 1II9A 3JCZA 3EH1A 3CO0S 4U9HS 1N2JA 3QH4A 2C5EA 2IGBA 1AKRA 2FWNA 2ZE8A 3OT1B 2R11A 4Y2XA 3NGXA 3WQRA 1H2YA 1RYYA 3BPSA 2IJGX 3FWPA 3OLVA 4UUNA 2OXIA 4ON9A 2FE4A 2HN9A 5AI4A 3L0YA 1T1GA 1WKBA 5IBQA 1BKYA 4TM7A 1DTWA 4ISCA 2RFLA 2QW1A 3QKSB 4JIGA 1WQ3A 3L02A 1UJ4A 4EQ6A 2GBCA 5JH7B 1CIVA 1PWHA 1H5NA 1N75A 3OE7D 4MNTA 3TW6A 3E9YA 4JLBA 4FSHA 3OEHA 2R96A 5HKLA 1FU4A 2LBPA 2OT3B 4J4HA 2DWQA 5FOWA 1L5VA 1T1RA 3MOIA 2IFTA 5JMWA 1QRSA 4D3SA 5EWLB 3UJ3X 4DRXB 1K98A 2BSXA 4FR2A 4CM9A 2IP2A 4PX2A 4EPVA 2O2JA 4YV0A 3E61A 3DP7A 4GT1A 2FX3A 1D6SA 1V37A 1NJFA 3CLTC 1JU3A 4R0NA 1VECA 2JFBA 3AESA 2WD8A 3SIWA 1WPCA 2V74B 4IDOA 4A73A 4CJXA 3UIEA 3CLUD 3KJHA 4QU5A 1AKYA 2QT0A 4YK7A 2P2GA 2B69A 5EKTA 1KNQA 1KZ7B 2XDWA 4GUAA 2ZB2A 4D74A 4DUGA 5FBRB 3V4SA 4B76A 3IPLA 4OI1A 1DTWB 4CV2A 2ZM5A 2ZQZA 4TL6A 4Q3BA 2JCBA 3SG0A 5CLLA 3KOOA 4W5WA 3ZDRA 3HR4A 4YV7A 4EGSA 2EKQA 4X84A 2NM0A 2PLAA 4FM9A 4S1PA 5FBLB 1ONPA 1LLDA 5ADUS 4ZU3A 4ZMBA 3TSZA 7REQA 3D31A 3T9FA 2XKKA 3M0EA 3ZK8A 3ZDXB 2VJYA 1Y82A 3ZKWA 4P4GA 2R84A 2HFKA 3A9VA 3LC1O 2QI9C 5CIQA 3RHZA 1JBKA 4ZCPA 3NWJA 3HZRA 5ABPA 1U5CA 3WSWA 4TMYA 3G85A 4KKTA 2C42A 4JFAA 4X91A 1E5TA 2O48X 3HN2A 3DEIA 3VH4A 4ESVA 3SJCA 3A6LA 1YJQA 2G4CA 1UFOA 2C7PA 1V2HE 1MC5A 1PKXA 1M2EA 1W2BB 3GPIA 1WQ1R 1G66A 4HAYA 3GFPA 3WA6A 4XN3A 3SQXA 3K1ZA 1Z29A 2G0NA 2DTEA 2PT6A 4MYRA 3Q7QA 3WL5A 4UTOA 3K31A 1TL7C 3M9WA 4ILKA 2HF9A 4ODIA 2ZSIA 4CF7A 1P61B 4HRVA 4DC9A 3R9WA 2G83A 1GY8A 2A7QA 3BVPA 1G21E 3DD1A 2ZS8A 2PSHA 1PR3A 3CZQA 3OPYI 2OFOA 4CL8A 1TJPB 3R3WA 5U4QA 3ZXXA 3ZHVA 3DA8A 4AJNA 5KC9A 1Q1QA 3HRIA 3ZCRA 3ZKWB 2OL4A 1SRRA 1R74A 3ETEA 3MWEA 1VGVA 2Y76A 3WMEA 1OXKB 4CM6A 3PXAA 4YRDA 2OCDA 3W5DA 1E8NA 3UYLA 3LLCA 5JD3A 4PABA 1L4LA 1PFKA 2AQKA 3BGVA 3TOSA 4BWFB 5HJ7A 1Z4IA 2G77B 2PZGA 1FDSA 3FIUA 2HRCA 1KKLA 1OI7A 2VF8A 3S2ZA 4YAKA 4KYUA 5HF5A 1XN4A 1RWQA 3FTQA 4C07A 2QJOA 3RHFA 4D56A 5C7OO 4JBGA 2HQOA 1E3ZA 5LP6C 3CC8A 1SC6A 3UA4A 2BD0A 6GPBA 1XTPA 4G4JA 1JLHA 1XZGA 3ZI4A 1U94A 4M1SA 3MB5A 1I4LD 4JWTA 5F5LA 3SM9A 3ZDQA 4KN6A 2BR5A 3A1DA 3B6MA 2I3DA 3GLIA 3GRZA 1ZCBA 2G80A 2J0VA 4CIWA 4KI7A 3VKHA 2PMCA 3JATA 2GSWA 2GYUA 1XCOA 2UZ4A 1VYTA 2D4AA 2X7JA 3TAXA 3OAAD 4GM4A 2C4VA 5IG2A 1JFTA 3PEYA 3HB7A 1Y1LA 3NDRA 4EI8A 4H7EA 4ZOLA 1N05A 2NU7B 2V6BA 3MWEB 4OGWA 2VSXA 4P36A 8LDHA 2IU0A 5GQSA 3UXHA 1Z2CA 3U4HA 1QHEA 1KQFA 2YFYA 4BVGA 2QPTA 4R2KA 4ZI2A 1Z5WA 3E84A 3JW8A 3N86A 1RZUA 1ZD1A 1CUIA 3OU6A 4NFLA 4WNCA 3ZX4A 4E03A 3KZVA 1ZUHA 3R7LA 1T6ZA 1WY7A 1NOIA 2VK2A 5ENDA 2A94A 2KWIA 3RYIA 1OXSC 1FU8A 4L5BA 4R1MA 5EE5B 2HDNB 1Z06A 4RKYA 3O92A 1QFJA 3W0LB 4XL9A 4Y6SA 2IUSA 3U1VA 1XU9A 2NU8B 4NYIQ 3LGAA 4MHSA 4F0JA 1Y3DE 4K6OA 3RS2A 5CTJA 4A1FA 5IJ9B 1E5DA 1XQXA 4DBLC 1Z0JA 3GLIB 1C7JA 1CY2A 1ZA2A 3NEJA 4XQCA 4HDCA 1YZUA 3JATB 5DRTA 4A91A 4IOMA 3QMWA 4OXXA 4CIYA 4E94A 1FMJA 3WGNA 2ZXUA 4LE1A 1UDXA 1T29A 1HY3A 2OHHA 2WKWA 1L4UA 1TQ4A 1VKHA 2IS6A 3D4OA 4YAJA 4RABA 1DWUA 1BKDR 4TRRA 4DV6B 2ZIAA 3JARB 4HF7A 2EBUA 5BSHA 2ZIFA 2OYRA 3ZE8A 3JY6A 4DJTA 2P5UA 1GTL1 5AJZA 3K1AA 1GPDG 4JC4A 3A6GA 2DTDA 2I87A 1QR2A 2ROQA 1E5VA 2RARA 5ELMA 2H5JA 3LPDA 4CETA 2Z5GA 1P44A 2IDMA 1TUGA 2DPXA 3N0VA 4XCQA 4TXLA 1UXJA 4BZXA 2FMFA 3DEKA 3THSA 4ECEA 3Q3JB 3H2GA 5ARCA 1UBEA 3OAAA 4QODA 1PJBA 4WCDA 1VC2A 3K96A 4YIHA 4AIRA 1QVRA 5DLPA 2HHHB 1P1BA 1U9ZA 3STHA 1QUEA 2JFHA 2GYVA 3MT0A 4XCVA 5IYZA 3KUDA 2ZTGA 5A0FA 3MSCA 1S02A 2QMEA 5AOCA 5G41A 3ZGOA 4JJ8A 2A3NA 3SS7X 1GA4A 1AXRA 2EWMA 1KJIA 3VNAA 4BB0A 3KR2A 1EJ2A 1TFRA 2OBBA 4G5RA 2HSDA 1L4FA 3MSXA 3MWDA 3FOFC 2BM8A 2WUEA 1N2GA 3FWNA 2FVYA 1F20A 2Z6BD 2YINC 4JENA 4OOXA 4HIZA 3NUQA 3FUWA 4PIVA 1WUYA 4J2HA 4EHAA 4DILA 3I23A 2MT9A 3OJXA 1E3WB 3BIFA 4RFVA 3IKTA 3FYUB 3B9BA 4XWOA 3BFVA 2R8OA 2VJNA 3ASYA 4TKMA 5LDDC 1E1YA 3WYBA 2KQUA 3H2HA 2JLQA 3ZE9A 1SBZA 1G2QA 1AHIA 2OHXA 1PZXA 1ZO8A 1MAHA 4QM7A 3OOSA 1QB7A 4Q66C 1VB5A 2AI1A 1XB2A 1BHJA 3IMCA 3RVOA 1SQFA 4OIMA 2AJ8A 4ALLA 2EERA 2FXVA 1EVJA 4M9RA 4KSCA 1Y4UA 4MVJA 3CLSC 4ZJYA 2D8AA 1OFIA 1XXHB 2B83A 5AQ1A 1AQJA 5LWHA 1JT2A 2PGIA 1FUKA 2Z8ZA 3DLPX 4RVHA 3W9UA 5B2ZA 2CNKA 1FF9A 3TKLA 2YMPA 4DPLA 4HB3A 1HC7A 3UJ7A 1VG1A 1VHDA 1JIKA 2YIVX 3G13A 1PE0A 1T6YA 1WZ2A 1HH4A 3BWEA 4RGBA 3FB1A 3L3BA 1WXXA 2HT1A 2A9FA 1UDBA 4UD2A 4YREA 1AKVA 1T3LA 2E4VA 3LH5A 1TGVA 2G5TA 3NKFA 3FB4A 3L46A 3M3DA 3TAUA 5A89A 1EVIA 5LN1A 3F0TA 1YXMA 1VMKA 2V6JA 4ICIA 4LJKA 5CLHA 4R05A 3QU7A 1SO8A 4I6JA 4XLEA 4RH0A 1JHXA 2AQIA 5B7QA 1YTLA 5FX2A 4KHPB 2IS4A 3O90A 5HXBA 2WMNB 5H9VA 3PQ7A 5REQA 3GLIE 1TC2A 1B0PA 3DSRA 3HB9A 2VWHA 4PCVA 2CZCA 5FIUA 4OOFA 2GVDC 3SHOA 1QP4A 3ZLJA 1YOVA 3L9WA 3FFTA 1G16A 1HFEL 1U9CA 4PANA 4QFDA 5HZAA 1ECFA 1QRDA 3KWLA 4O29A 3VNQA 1U3FA 2Q5HA 8OHMA 5LD2C 1D1NA 3NONA 4P84A 1M0EA 5I4BA 3ICQB 1E6KA 4LPKA 4UTXA 3DE2X 1S72B 2VIIA 3HUUA 1XDUA 4YO7A 2WAMA 2CWDA 4K3UA 4OIFA 3ZWMA 3U7HB 1ZMRA 1NY6A 2QN2A 3DYIA 2QLLA 1YK0A 4MJ3A 1F9EA 3Q10A 1N2HA 4Z86A 1XROA 4C5BA 3A2MA 3OZWA 3KUXA 1V4BA 3LGXA 5JV5A 3VNBA 4ZGWA 3HACA 1OWNA 4BX8A 3B6KA 3AR9A 3CUTA 5E9JA 2AFHB 1E9EA 3ABQB 4DCCA 2LIPA 1ZJZA 2BFAA 5AICA 1NHWA 3L8ZA 1SCIA 3OLYA 2OGUA 4UEKA 3I32A 5DI9A 3TMKA 2CDNA 3UMGA 4ERNA 5JXIA 5REQB 4CEJA 1QDLB 3WL7A 4Z51A 4CM7A 1DRWA 3MYYA 1KVSA 4YMUA 4XQ0A 3WXBA 3K0AA 2VP6A 4C6RA 4P3IA 2P1RA 1NFRA 1V1MA 5F4ZA 1EFPA 5SYMA 3RWOA 1L5LA 3UAVA 2GPSA 3NRBA 4F56A 2HMAA 1MBZA 1OC2A 1N6OA 4LTMA 5ETJA 1ZR4A 4LCEA 4BLWA 5TRDA 4IV8A 3HVHA 5HKAA 3GLHA 5FHRA 1J33A 1OJLA 1UDWA 1VA5A 3NKLA 2XQVA 2PE5A 4JB3A 1RJ9A 2C59A 1Y7LA 4F11A 1VJ5A 5CP8A 3HB4X 5I5EA 1E79A 1KS2A 2KJQA 3A4NA 4HUQA 3GN1A 1TCBA 3BEOA 5C34B 3WL6A 1RFGE 3WADA 1WQ4A 2OYNA 1C8BA 5FR1A 3O8RA 2RCNA 1G5QA 3OPQA 2ZTMA 2X6TA 4A0HA 2ZGVA 1PR9A 3JALA 1JKXA 1DKQA 2XT0A 4HHEA 3RTDA 3F6PA 1P5HA 3IX7A 4BRUA 5KSPA 1IZYA 3LDFA 3QU4A 4EG6A 3P8ZA 4YT5A 2C0CA 1MOPA 4HNGA 2QM7A 2YHAA 2W22A 4Q1AA 5JCPA 2HO5A 2R66A 2OZPA 3K73O 4MR8A 5J4LA 3G82C 1XXHE 1UBMS 3K0AB 3JVDA 3TIVA 4KXYA 4C1BA 4M9UA 2VQSA 3TLMA 2H16A 1VXRA 1SZCA 4JQOA 3ZDEA 4JA2A 4TL8A 2K4MA 4PR3A 1CQWA 3RGGA 3F3YA 1MPTA 4XUEA 3FFWA 4TPKA 1J23A 3MD0A 1X1QA 1TA9A 4FLMA 5IAOA 1UD6A 1W87A 4CMAA 3OJWA 3DHVA 4OFXA 5H9WA 4TTAA 2AV6A 1JW9B 5EQTA 2CFOA 2XNDA 1U80A 3EA0A 2HNBA 1H2RS 1VL5A 1A2BA 1R9MA 2IP1A 4IWNA 4Y1RA 3M5PA 5K3SA 4CG2A 4JH0A 4LRWA 3JALB 1S4MA 5AVTA 4H9GA 1P2BA 1ZX1A 1IXZA 3PNSA 3Q7IA 4I9FA 3FOZA 4ZHSA 5E6SB 3WHIA 1SRQA 2OXEA 1PT5A 1TO2E 3O38A 3BS4A 4H27A 2PVPA 2PBZA 4KW7A 4WOJA 5EE1A 3ZXUB 1SIWA 1ZSYA 3ZZTA 4DQDA 3W1VA 4H3KB 4MVJE 4YMVA 2MINB 4MR8B 1SAYA 2G63A 2DUUA 5ICSA 3WBJA 4RCVA 5TQ0A 4ZRNA 3VYSB 1JJIA 3HCEA 4WZKA 5KTOA 1XJ5A 4TT3A 3BWCA 4ZKDA 3DKKA 3SE0A 3CF6R 5KOHB 3KL9A 4TLAA 2VQEB 2CLFB 2GYWA 5EERA 5CVJA 5DFAA 4QD3A 4TKVB 3TH5A 5I7SA 2WJAA 1SA0A 1OIWA 3CE9A 3Q11A 4I7EA 3SC2B 1ZVMA 1RRKA 4Z0PA 1P7VA 2FFBA 3LBFA 3OTIA 3A4YA 1E5XA 2FA9A 4PC3A 4PICA 4EHNA 3G0GA 4ARUA 5KMGA 1TTPB 3CVXA 2A1IA 2BKLA 4Y1RB 1LVGA 4BNNA 2DLNA 5JDIC 1TVEA 2FPKA 4Z4QA 4JSRA 2ZZEA 2AFHE 1ILWA 4XLAA 2PH1A 3BTOA 1KIMA 1T35A 3GG2A 4IP0A 3S1AB 4DLSA 4ZV9A 4JLNA 2P3MA 3QTBA 4LJ9A 4TTPA 2XT6A 4WOCA 1T2CA 1T9DA 1DQSA 3U37A 1MO4A 3D2LA 1GT91 3TPFA 1G98A 4NMXB 1DCMA 1Z2PX 2QUZA 1SUPA 3L06A 4X85A 4YRZA 3RLFA 2A9QA 4X05A 1M1XB 2O20A 2XYPA 3A1EA 4FJ2A 3EW9A 1YX2A 4DTCA 1G2OA 2E4AA 2F43B 5JCJD 4HAUA 2HAEA 3I45A 3ROMA 2HIHA 3DE6X 3L7LA 5CEJA 3UPUA 5IULC 5KMGB 3X1KA 4IX1A 1XYYA 1Q91A 4D0GA 1ZZEA 1DMRA 4MUJA 2D5LA 4ATNA 4BMYA 2CNOA 5JC1A 3RD5A 1L7NA 3ESZA 3TQFA 2OD9A 1E3DA 4XSVA 1IUPA 2F2TA 4QLAA 1U0TA 3C15C 5LYJB 1IIRA 2G82A 2VHEA 5AXCA 4CLEA 5BYKA 4G0WA 4J7CA 4C05A 4IFBA 3VISA 2NQ8A 2A57A 1JSCA 1AT1A 2HA5A 2QYHA 4BVLA 2XNSA 4Q7JB 3GA0A 4ITUA 4AXBA 1WB5A 1HKUA 2JH8A 3LIPA 3PD7A 5ESXA 5EQJB 4DLYA 1JPUA 1RLOA 5FPSA 1MABA 2CJWB 3AI2A 4PZLA 4LA4A 1POWA 5E3IA 2XDQB 1GD1O 3L8YA 2F1LA 1SIBE 2XWSA 2FPRA 5ARBA 4G23A 4INJA 4FGKA 4DSAA 5B12A 5I7UA 4GL4A 3GJSA 4KG7A 4C4XA 1VPVA 2E5LB 4WDRA 4FI3C 4GS5A 5ADHA 2H48A 4ENTA 1B73A 1YB5A 4INAA 4UQPA 2W2QA 3F71A 1XMQB 4Q3DA 1U0JA 3TCXB 3JZAA 3A9UA 2FVXA 3HZHA 2C7GA 3WAGA 2JLXA 1C0PA 3ZWPA 1CU1A 2XMGA 4UE6A 1ENZA 1TYEB 5EVJA 4GQAA 2CDAA 3ZDDA 2BM1A 1JBQA 1E7MA 1Q20A 4IIUA 4BNDB 1KSFX 8ADHA 4BGIA 1XTZA 2O5RA 3ESYA 2NMVA 3M9XA 4J2TA 4XYEA 3NHUA 3IO5A 3UMFA 5B4TA 2E55A 2PYIA 1E0SA 1CT9A 5FYDA 5GVSA 1KC8D 3LT0A 4IEIA 3TRFA 3BDAA 3V1UA 5JQGB 2OENG 2AEFA 4IV0A 3PT5A 1VLJA 1YC5A 2Y3IA 2AVDA 3E9QA 3L7YA 5FYQA 5AESA 2EBWA 3AEXA 2REQA 4O25A 4TVBA 3IKVA 5KBYA 2FUNB 3NM4A 2IF2A 10MHA 3Q98A 4HB2A 2C98A 4MRPA 4MS1A 4RLHA 2OVFA 4D9FA 3UK1A 2JASA 5DYGA 1N1DA 2FR1A 1XNGA 4PTYA 3QLUA 1M33A 3RVPA 3H4IA 3SX4A 5KCMA 4Y6GB 4RMJA 1GTMA 2Q45A 3VAYA 3D3JA 2PFKA 4YAUA 1UJ2A 5BT9A 4O2AF 3T1OA 5CDYA 1I14A 3OQMA 5HOQA 4N5NA 1Y9ZA 4II7A 2OM6A 3THWA 3F5DA 4HDKA 5SYAA 3ZGNA 2J6IA 2VHQA 4OLHA 3MCUA 5AI9A 3UGKA 5E7JA 1E64A 2HCFA 2LXNA 5K6AA 3RTAA 1XZNA 4PAGA 5BOVA 4EYKA 4YAWA 1YDWA 2UXCB 1JHMA 1LTQA 1ZGHA 1WPRA 1RQRA 1WDKA 3K6RA 1P9LA 4X92A 1XCPA 3HCBA 1YA6A 2J5RA 2UUOA 4MWZA 4NZYA 1JQDA 4GGOA 5ECDA 5EXTA 2G9VA 2X15A 3REFA 3WGJA 2WFZA 3AI3A 4TMFA 4DB4A 2Q9UA 4K1LA 4AAYA 3ACDA 3QVGA 1IZZA 1T1JA 1W0JA 1CUDA 3IRUA 5AK4A 3GYBA 5BYAA 5ICCA 5J40A 1GNLA 4CT4B 1IQRA 2IHBA 4FHDA 4GDMA 4NYMR 2PKRA 5LR6A 3H19A 2BBOA 1CZNA 2J3HA 2MR5A 3LTEA 4KODA 3VNSA 3EWIA 1Y63A 1E99A 2LKDA 2PPVA 3D2CA 4Z7JA 2C9BA 4C08A 3CNHA 2YS7A 1R4MA 3HRHA 4V38A 3HZOA 1PVVA 2WU4A 3DDSA 2PK3A 3DNMA 3BC9A 3EEYA 4I4TA 4O4LA 4TSKA 4YFVA 5EIWA 1BOOA 3TG8A 4L0MA 5BQPA 3MXOA 4JL6A 4YP7A 2CUKA 1SCDA 2IHVA 4BB5A 4I55B 5ALMA 5CB0A 3WISA 4EUSA 1IOZA 2QYOA 3IQWA 5G02A 3PC8A 3NLLA 2VHYA 5KINB 2I3GA 3G2QA 3HHEA 5F4BA 3DEZA 4QRHA 4XWKA 2NXNA 3NP9A 1FNNA 2P8SA 5EZQA 4EY3A 5D00A 4OHRA 4RIHA 2CXPA 4AC9A 4K87A 1MC8A 1RLIA 1NM5A 4KGVA 4NBRA 5SY4A 5TPWA 2QG9A 4JOCA 2IYEA 1Z9BA 1Z08A 4OQDA 1GU7A 3ENWA 3B5IA 3PPWA 3SQDA 4B8ZA 1LF5A 3IBYA 4IXMA 5JFGA 3FCOA 4G65A 1VQMB 4G8JA 3PXUA 4MP3A 3JRXA 4YJGA 4HNQA 3ZNPA 1LQ2A 2RHTA 3GJYA 1SB8A 2A4MA 5ALZA 1J9EA 4B83A 2B20A 3OF2A 4DQUA 5FOQA 3QXXA 1DG9A 3A28A 3G79A 4IG9A 4I4TB 3UT5A 4BJ6A 3W3ZB 3RBXA 1GPMA 3HN7A 3L0ZA 2W90A 1DINA 3KZMA 2F8SA 1G4UR 1G8AA 1FFHA 5AW7A 3GCZA 4UNQA 2DX7A 1SUFA 2YNMA 1GPYA 1Y5IA 3UMJA 1ZL0A 2H1OA 4ZT7A 2O2HA 3AWDA 3WIUA 1F14A 1IJKA 1Q74A 3DFZA 3Q0IA 4QUEA 1ZQ1A 2N75A 3WGKA 4NCAA 3P94A 1XRMA 1G4HA 2R6ZA 3PDHA 4X07A 3EG9A 4Q24A 5AR1A 1M7GA 5TB5A 3UVEA 4DMLA 1MB3A 1KIAA 4EGJA 5AVKA 3ZGZA 4A36A 1SD2A 2Q3LA 1B0AA 3ZWYA 3A1NA 1XKTA 3MMXA 1NMSA 4JASB 5IDYA 1BOFA 1PF7E 4PG5A 3JYLA 4KQ2A 4N7RA 3NFYA 1A1SA 3ESDA 4K6HA 4DF3A 3U56A 2ID7A 3PX7A 3IUEA 4HL6A 4LJ4A 2A5GA 1EVZA 1TT5B 2J31A 4YQZA 5E4YA 4DCNA 4OJYA 4QVAA 2PD4A 3E58A 3RNOA 5LQJA 3UAXA 5BPHA 4K9RA 2VK8A 2VYVD 4E31A 1N4AA 3UT5B 2H4FA 1L4MA 2RJNA 3LVRE 1C7FA 4IMPA 5KKAA 2ZTNA 1U0EA 4V1CB 4PRZA 2OTJB 3WK8A 1ZFNA 2R7KA 3NU1A 3C5HA 4OEHA 1TIKA 2HKIA 4DTIA 4BXOB 1FLAA 1VG9B 4N8DA 1VQKB 3L7CA 3GPBA 4DCSA 3TQQA 4DHEA 1FLVA 3NIDB 4ZICA 3GR6A 2GBLA 3QBTA 1O95D 2ZJ7A 2NVOA 1Q0SA 2CZGA 2D3NA 4RHCA 1NU6A 3P45A 3SAJA 1SZJG 4PQGA 4B4WA 1FTYA 3RR2A 2OZVA 2P9EA 2XE4A 4WXYB 1VQNB 5FWYA 4P93A 5CAEA 3BXPA 1Y48E 2VRBA 4FINA 3FTEA 4IOJA 2HRQA 3PVCA 3T41A 3A58B 3EIQA 1H66A 3ZLTA 1YJWB 5FUXA 2ZDQA 4M7RA 2QZSA 2YJ6A 3EZYA 2QE7D 4JGGA 5DSZA 1F9AA 1FTQA 1S2DA 1T15A 1A1VA 4MVJH 4PRYA 3LYHA 4IIEA 4BVEA 4S35A 3VR6D 3OZFA 3VC1A 5K09A 1R0CA 2CHEA 4FDTA 4JSTA 3FYSA 3RRXA 1WE2A 1FVHA 4RD4A 2VTBA 3D3WA 1DWQA 5B1DA 1HQKA 3DHNA 4F8YA 4HDAA 1NBMD 3M6MD 1VP3A 1QH1B 2BJWA 3OLXA 5C5EA 4RVDA 4EVQA 4J29A 4MI6A 1D9XA 2DJIA 1RKVA 7YASA 2XQJA 4DN6A 2ZR0A 4KBGA 2EBHX 5TNXA 5FUQA 2DERA 4EX6A 5JCXA 3RYCA 2PTHA 4C7KA 3TIXB 2D5AA 2GUGA 1D09A 1RHRA 4PRKA 4AROA 4ZMSA 1RHJA 3DFKA 4O4IB 5FWYB 5JU6A 4CEIA 3U7QB 4TTRA 1PNVA 1ZC4A 3A1SA 1U3CA 1UWCA 2XV1A 5CAEB 3SE7A 3W04A 4XLZA 4E1AA 1OZHA 4AM8A 3DL2A 2E87A 4N7BA 4YXWD 3ZCVA 3AV3A 2Y1XA 4X1OA 5E8RA 5ALOA 1DKMA 5A04A 2I80A 1QP8A 3O0DA 1P73A 1ZI6A 4B4KA 2PQ2A 2VFAA 5GJBA 1XVTA 2A5DA 3RB8A 3C70A 4NESA 2CZQA 1XCLA 2FV8A 4HEA6 1Z45A 5KI6A 1JHRA 3TLGA 4DBVO 3K9NA 2EKLA 1C9KA 2JLRA 5IXSA 2QVLA 3DZHA 2WM3A 5HZMA 4WDQA 2VTBB 2QRNA 3G88A 1FFDA 3DUFA 4RY2A 4NX2A 4TZKA 3IXLA 4J75A 1L1FA 3EFHA 1UPAA 4FE3A 4C6SA 3OIYA 2PLFA 1PKEA 2GD0A 2ZJ0A 4LBWA 3AERB 2CXXA 4MUKA 4LZAA 1UC5B 1TAGA 3NETA 4ZHQF 2IHJA 3F74A 1MC4A 2QMZA 4IYRA 4NJEA 4WPGA 1UMCA 5KB3A 5NULA 5HMMA 1Z8DA 3ADOA 2QE7A 4B8YA 1M10A 4ZI3A 2YWHA 5DXFA 4CEIB 4I4IA 4G5OA 5CA0F 4MW4A 5B2FA 1QIHA 2IIVA 4M86A 4XARA 4XW2A 2UYOA 4XLHA 1Z39A 3AEKA 3J81k 1JU4A 1MRSA 3WMRA 4Q34A 4ZTZB 1PEKE 5JO0A 5CDUA 1E2UA 1FVFA 1FVXA 1QHGA 2YYYA 3DVLA 3RNLA 2Z43A 4DJ5X 4HAZA 1T36A 4PPGA 1BGVA 1Q11A 1WCWA 3TLGB 5EZYF 2ZUDA 5DX8A 4W6ZA 4RZIA 2KYRA 5C2JB 1NHGA 1YDFA 2C3OA 2WA1A 3MILA 4BO6A 3CPXA 4BQRA 2BLLA 1KJQA 2ZP1A 4GLJA 2QLNA 3DBRA 5LP6F 4C6HA 5ICEA 2CF5A 4DXDA 3N7AA 3E8MA 4MQ5A 4TKZA 2RHMA 3I1JA 3MWKA 4I5FA 4XM3A 1FZTA 1MN6A 1YZGA 4KQCA 1MJNA 1R0XA 4D43A 4F9GA 5C8YB 3U7JA 1UT8A 3A4LA 1P77A 5DPMA 1EUDB 1UMCB 3HA3A 2DBZA 3QV1A 4AZ0A 3GLQA 2E49A 2WUFA 1GV0A 4FBMA 2BMDA 4RDKA 4N47A 4YRBA 2DOKA 5CG1A 1Q15A 3FMFA 2V0CA 1KI6A 3MJ4A 3RAPR 2PGAA 4F84A 5JDCA 3PUVA 5JNTA 1KEWA 2YMLA 2BL4A 3B5EA 1K7XB 3DDWA 3HKCB 3QBDA 1CDZA 4QZVA 1HT2E 2AIRA 2N46A 1RYMA 2VT3A 3JQ8B 2CFRA 5ALTA 1QPGA 4HNUA 4Z4VA 2GXSA 2C7VA 2A4KA 1KO5A 4DRYA 3COYA 2YN4A 3CLRD 1XNQB 1GTVA 4REQA 1AXGA 4WAUA 2GFIA 4ZYUA 1NDUA 3DV9A 4IM7A 4A1OA 1KH1A 4WCFA 3RUHA 3ROGA 3GCWA 1DXYA 3H05A 4FUTA 3KSAC 2MOKA 3AP1A 5BR7A 4FOLA 3TLJA 5DHTA 5ERGB 3SJZA 4WT7A 2Q4BA 1OIVA 4DZRA 3D4BA 1WCIA 4AZ0B 3I8XA 5GJVC 1Q0UA 1YBVA 3B7PA 4N5LA 4Q3KA 1KOLA 3J7AC 2RCYA 5JAHA 1MOZA 3C7DB 2VSNA 3PF9A 3OP4A 2JH3A 5HFNA 5CCDA 4N0PA 2WINI 2FOLA 1L7EA 1W96A 1Z13A 2DR3A 3GCXA 3G5UA 4IJWA 4U2EA 5CTAA 3HXMA 1I6MA 1PWEA 2IHYA 4R9NA 4MWEA 3F47A 4EY7A 3EXHC 5JOQA 1H1DA 2A9RA 4GKJB 3KQSA 3D26A 3LW8A 1G20B 1RCTE 4H17A 4KN9S 3CZ4A 4REQB 5TVGA 3NG1A 4FFVA 4M46A 3ZIDA 3T5PA 3GLFA 2F1RA 2X0FA 1T24A 2JZOA 1HORA 1CUFA 2W4IA 3D9QX 3PGVA 4FB5A 1XJQA 5A4IS 1PX0A 1E3JA 3GFQA 4OH7A 2JLWA 4UVIA 3ISVA 1Y5NA 2IYXA 5HRAA 5IDQA 1JQAA 3UJ8A 4C3ZA 4H4CA 3IP5A 4IH9A 2EKDA 1D2RA 3ASUA 4MRSA 1WCIB 3CMMA 1B23P 2JFUA 6Q21A 1JWAB 4MQFA 2PR2A 3CMCO 3ISJA 3PNKA 2WTUA 1LWNA 2HNKA 3KZOA 5AWFC 2ZT8A 4FX5A 2ATEA 2FSIA 3OF5A 1IJBA 4FHGA 4PZ9A 4X1KB 4DY4A 1PNRA 1F2TA 4XN0A 5E3JA 3R77A 1JEAA 3KVVA 2WQ7A 3K70B 1LPPA 4WACA 2EGUA 3WLEA 1KTVA 4RHUA 3QVOA 1MR3F 3OZVA 1DPFA 1HDOA 1PW7A 3N2NA 4XWAA 1V8DA 2KI5A 4HB4A 4HNAB 4UZSA 5KNDA 3KFXA 1JMKC 1ONOA 2OE2A 3RUCA 2ISQA 2ZSHA 3I9MA 3PK0A 3WLIA 5ICFA 1JLLB 2PQMA 4BEBA 1N9KA 3EC1A 4MUAA 3QELA 1UC9A 1F2UA 3WX0A 5IC4A 1JPJA 3VFDA 1BD4A 3B13B 4I5DA 1UH5A 1J06A 2QIPA 3I6BA 4MKHA 5FO1A 4FP9A 4D57A 4F5YA 4TS9A 3OQVA 2P6PA 3OETA 4MQFB 1JR3D 5M3BA 1GTSA 2HCBA 2HRDA 2C9CA 4QARA 3GLRA 3ET5A 5LIPA 2DULA 3ND5A 2WJWA 1IBKB 2NW6A 1MZVA 3E7XA 5F9FA 4RUKA 1NJGA 3QHAA 1KO8A 3JD2A 1YBFA 1D9ZA 1SKBA 3C16C 4B87A 4IDNA 4EL5A 5BW8A 2K2WA 4WOBA 3O7WA 3U48A 1IBLB 3IPAA 1D7OA 2I6XA 2QUAA 1KI9A 2X6WA 4G0MA 5G0WA 3UTCA 1ST2A 2BGNA 3BGOS 5A9SA 5JJKA 2DFKB 2FGJA 1PVDA 1HUQA 3V8NA 4E5YA 4ZCMA 1QV9A 1X7ZA 4KIJA 3HJAA 4LYFA 4QATA 4G0XA 4Y9TA 5DNEA 5TGTA 1JECA 3NTQA 3UUWA 1F8YA 3B36A 1H2EA 1XZQA 4LISA 5AI5A 1QMPA 1IVNA 2AN1A 3KRTA 3ZNNA 3I2IA 1T2FA 4ZO4A 3WOVA 4FFLA 1OILA 4AX8A 5HFAA 5L3VA 1G6Q1 2CVQA 2CKDA 2XVZA 3RK4A 2VPQA 2Q27A 4KE8A 1KAOA 1VP9A 1USKA 1NBHA 4GOLD 4OK6A 5CLIA 5ALSA 2J09A 3SHTA 2WHRA 1M5RA 4DV7B 1TAQA 3TNYA 2PSFA 4O5OA 4ZGBA 2F4VB 1EBBA 2NXCA 4IIFA 1RRVA 1XD2A 2R4QA 3BWBA 4LZWA 1E8DA 4JX8A 4E15A 3Q6QA 2OV3A 3E5MA 4MMXB 5I48A 5L3SA 2O8EB 2FZWA 1GDHA 2ZBGA 2ST1A 3S2GA 2G67A 5IFLA 1EQUA 3FM9A 2BF7A 2PT7A 3FUUA 3MRSA 4JBHA 1YHNA 4LV5B 4UBLA 4YLYA 3NYQA 3AI1A 3BSYA 5LA6B 4B3XA 2VATA 1UOEA 3QITA 1DC4A 1M5TA 5FNZA 1JS1X 2VPWA 3F46A 1AF7A 3NRCA 3S6JA 5DRYA 3T7TA 1FXSA 4PG4A 1G20E 3ZCUA 3DJFA 3F8SA 2YDYA 3EARA 3WL4A 1X7ZB 4OHXA 4E4YA 3UICA 2WJHA 5KJEA 4KUEA 3FGOA 3A4TA 1P7PA 1WUIS 2PCLA 2QRZA 5FBKA 3VXKA 4AIIA 5KYXB 4XUGB 3K71B 2ZR9A 2O8FA 3Q8XB 4F4DA 1H6AA 5EPUA 5L4SA 3A35A 4MRVA 2QJWA 2N3ZA 5F12A 4B0PA 4Z54A 2J48A 4GX2A 3PQ4A 1XD2B 1Y42X 2O8NA 2BCEA 4MA4A 1G9TA 1M9NA 2QP3A 1XE1A 1Q7GA 2B3DA 2CEAA 1GITA 2YZ7A 3A3OA 5K0ZA 5L3SB 1QPZA 1OYWA 4O2BA 5T64A 3PGMA 1N4DA 2BAGA 4C0BA 1HDZA 1YKSA 4B48A 4I3HA 3PQ3A 2ID4A 2OP0A 4U2DA 4ROSA 1GCOA 5J2UF 1QANA 2SKDA 2IOQA 4JHLA 1QORA 4FYYA 4JJ7A 1NMQA 4G5SA 1CUZA 1NUHA 1P62B 3O9VA 2ZVQX 4A4DA 2ILVA 2ZQYA 3BZWA 4IGFA 4URWR 3SVZA 3HU3A 1V5FA 2JAXA 3U31A 1VJDA 3KXKA 1DMSA 1WABA 3RC9A 1YULA 4PQFA 1QM5A 1C7IA 3PE6A 2NP7A 1I3OA 3G23A 2ZE6A 3ZLBA 3UENA 4YI5A 4XR9A 4JVMA 2FPIB 3ZLUA 3AVUA 4G8DA 1C9EA 5GJWC 4CWAA 1G2IA 1Y37A 2ZANA 3FPCA 5HCUA 1T8YA 1SD1A 1ZUD1 2JAQA 4PLYA 5CLGA 1Z4MA 4DZTA 3GVKA 2AH5A 1M2OA 1WSAA 1YCDA 2E4WA 2HSWA 2QRJA 4G0NA 4MDHA 5EZSA 2IH2A 5DMHA 1O8BA 3K0KA 1QTRA 4BE7B 4C7OB 4M1MA 3LOPA 1PZMA 1RTTA 3T3GA 3W