2WR8A

Structure of pyrococcus horikoshii sam hydroxide adenosyltransferase in complex with sah
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
259
structure length
258
Chain Sequence
GSHMITLTTDFGLKGPYVGEMKVAMLRINPNAKIVDVTHSVTRHSILEGSFVMEQVVKYSPKGTVHVGVIDPGVGERRAIVIEGDQYLVVPDNGLATLPLKHIKVKSVYEIIPDKIRKFTGWEISSTFHGRDIFGPAGALIEKGIHPEEFGREIPVDSIVKLNVEPRKEGDVWILKVIYIDDFGNVILNLENYEKPRTVELLDFNLRLPYLETYGLVEKGEMLALPGSHDYLEIAVNMGSAAERLNVKVGDELRVRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN PH0463
publication title Mechanistic Insights Into Water Activation in Sam Hydroxide Adenosyltransferase (Duf-62).
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 77
structure length 258
sequence length 259
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2wr8A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2wr8A01
2C2WA 2C5BA 5FIUA 2V7WA 2WR8A 5B6IA 2CC2A 2V7XA 4CQJA 2Q6OA 2C4UA 2Q6LA 2ZBUA 2ZBVA 2Q6IA 2C5HA 5LMZA 1WU8A 1RQRA 2Q6KA 2V7UA 2V7VA 2CW5A 2F4NA 2C4TA 2CBXA 1RQPA 2V7TA
chains in the Genus database with same CATH superfamily
3S40A 3SKBA 1NR1A 1MORA 1X80A 1KETA 1JJ7A 4OU4A 1RBQA 1JQJC 1VM6A 4R84A 3SYTA 3T3GA 3TK1A 3KOMA 1N8KA 1XFDA 2N3ZA 3USES 2FOXA 1QCYA 3WOHA 3HZRA 4WKCA 1TB4A 5JHGB 1GUBA 3BEDA 3HFGA 1QE3A 3NYQA 5IDQA 1R10A 2ADOA 4KACA 3L8GA 3LHSA 5K1ZA 3USCS 5KQLA 3CC8A 2XHEA 2VBIA 3GFBA 4XQ9A 4N41A 1M33A 1IRXA 4KQ1A 3THYB 1DAMA 3CXRA 2RGUA 4EA7A 4ZI2A 4HNTA 5HJ5A 1XDBA 3OPYB 1JIVA 2GM3A 1L7DA 2JLWA 4BOYA 4REMA 3SNKA 1OD6A 4G8DA 1PQ4A 1FQJA 2I71A 4CLHA 1WVMA 1HFJA 1IN5A 2C2WA 1F2UB 3JVDA 4N9WA 4RVNA 2HPZA 3G8CA 2AG0A 3KSZO 1WOPA 1N1GA 2C7GA 3WNQA 1G8AA 1V25A 1P7WA 1GDTA 1DQRA 2CXOA 4JX9A 4NG4A 2EC5A 1EPUA 3GP3A 4DB2A 1QNFA 2AMFA 4N5HX 4RL4A 2RK6A 5EMKA 3ZDEA 5JJCA 3T5CA 4PLCA 4XN0A 1XTIA 5JLJA 4QIHA 3F5DA 3GFRA 3JVUA 4FMCB 4OBWA 2O9JA 1XQ1A 4DQUA 1M1NB 1O57A 1WU8A 2JN9A 2FW1A 2O0KA 4ILKA 5LIPA 3BMXA 2CVQA 4C89A 2OCKA 3U3MA 2VXCA 2P41A 3SIRA 4AM8A 2YWCA 4BNMA 4EO7A 1LTHR 3AY3A 2Y4OA 2HI0A 5B57C 2XH8A 4DV0B 3DC7A 1K0FA 5F9MA 1PR0A 4NCKA 2BFBB 4GM0A 4HRAA 4XD7A 3RVKA 3UGKA 2Q3MA 3VJLA 3ZKAA 2IKSA 4E03A 1O7JA 1EUZA 3HXMA 1NNSA 2J5XA 1W0JA 2VNAA 4I55B 1DRJA 5AVUA 2Q4DA 4WZAB 5EYPA 3OU7A 2VEDA 1J8MF 3JD3A 4FCTA 1N0HA 5CLLA 1MZPA 3MIZA 4XRRA 3EGXA 1E99A 3T1OA 1SVUA 5ADHA 4L6IA 4WV3A 1HI9A 1WU7A 2JC3A 2BDUA 2DM6A 3S27A 3U0BA 1GTMA 4A0FA 2X4GA 3S5UA 2WLSA 2R8OA 3TDNA 1VMAA 4JY7A 2H07A 3ZEAA 5MHTA 1RAHA 1IBLB 3D7NA 4EEKA 4IIUA 5HPYB 2JAUA 1VYTA 2Q07A 3MWDA 5FL7A 2Y1FA 1S3FA 2IYTA 4MYHA 4TT3D 5AXDA 4E4YA 4CIWA 3SMQA 1LV8A 2W2QA 1CNEA 3ACCA 3CRNA 3U80A 1BCRA 2BOVA 2WIAA 3PC4A 3PFCA 4O2BF 2CDBA 1JNYA 3SI7A 4EFKA 5BUSA 5IT9A 2IBSA 2IOQA 4N0MA 3EBOA 3ZE7A 3RADC 1GPUA 3DMYA 4UZSA 3OW7A 3AR5A 1E4VA 4MJXA 2CE7A 4I46A 3LVBA 2FPLA 3FN4A 4YBRA 2YIJA 4KBFA 1W0KA 1F6DA 1EDDA 3DTYA 3NV9A 4NULA 2IXDA 2Q5QA 5IJAA 4AZ3A 2Z5GA 2J3IA 4GPIB 1TCAA 1YR9A 1L5WA 4BP3A 1C1XA 1FFDA 2HO4A 3NT5A 1CNMA 3NTXA 4LE2A 2GDZA 5BSVA 3AVXA 1GRNA 1U8XX 2CXHA 2PK3A 4IWNA 3UN1A 4CL8A 4E7OA 2WJVA 2D2VA 1VHTA 4IDCA 1OF1A 3PD1A 4MWSA 1US8A 1T0IA 4K81B 2XY4A 2OGSA 4JT4A 3KLMX 1D8AA 3D0RA 3HAGA 5FUBA 4CU5A 4I9FA 5IAGA 4H6XA 2PLWA 3V4FA 4Z4EA 2EFHB 3R7AA 4D2IA 1VB5A 1OXVA 3RHZA 2P90A 3KR1A 1PKXA 1U9JA 1UOEA 3H9GA 3Q9UA 1ZL2A 1D5CA 1PK9A 3CLSD 2F64A 4L8FA 3RRMA 2YC2C 3FPPA 3HP4A 4MAMA 5HEKA 3UOAB 5ADWA 3O9VA 3DDZX 1W1UA 1GQRA 2E4UA 3CGWA 3CLUD 1PSDA 3IBCA 3NFYA 2PL5A 2GLTA 3PXUA 4PNPA 4BX8A 4FB5A 4UUMA 3BA6A 2J6CA 5DCYA 4IHAA 1NBHA 4YAOA 5EL0A 1HC7A 4RQUA 3GLKA 2CNBA 3JYLA 3KJFA 3O8RA 3Q8LA 3UMCA 2YHBA 1U80A 3EMBA 4ZYZA 2XUOA 2XUQA 2FPPA 5DISB 5JAIA 1D0VA 2R66A 4U9UA 2B5OA 1I14A 1V7QA 2HJVA 3ZLUA 1Q50A 4XGKA 1KOLA 5B64A 2BBSA 4IZ6A 1GD1O 3ZHYA 4CCSA 1I9CA 2C2ZA 2QRGA 4RKQA 3TB6A 3NHZA 1E7QA 1K7EB 1O5IA 1WB6A 3FLBA 4R69A 4UHKA 2Z04A 1LBQA 2CLDX 2J0UA 4RW0A 4TOIA 4Y6LA 1DARA 5CR9A 2AJ8A 3UGJA 1QFYA 3VR1A 4R0NA 5G40A 3IR7A 4QAQA 5IKXA 2IFTA 2ZTUA 3T94A 1Z6PA 1N1MA 5LP6C 1LLUA 4S0XA 4KMRA 3AR8A 1H94A 1JU4A 1F2VA 1X7DA 4QWWA 4TT3A 1XRMA 1UD8A 2NYUA 2IEZA 3PQFA 4U5QA 2CLEB 5E9QA 2GQFA 1N9KA 3T4XA 2W0MA 3K5HA 1RU3A 4WCVA 4J3NA 1JLHA 4DHEA 4KK4A 3BWBA 3HJRA 1CZHA 4RH1A 4U6NA 4MAFA 1DSSG 3A8JA 3U7RA 4GR4A 1KXZA 3GN1A 4B6EA 4IDOA 2VSQA 3E9DA 3JQ8A 3RUFA 2O8DB 1G42A 4I1OA 3U16A 3BUSA 1TC1A 4F3NA 1XWIA 1A5SB 2GF0A 2Q7OE 4NCIA 2E6KA 5H4GA 1T24A 4H7FA 3I62A 1VMIA 3IBSA 4KUGA 3ZS8A 3GDWA 1N6OA 4IUYA 4O59O 3SBXA 3LJKA 3QLVC 1XIVA 3E3AA 3L0SA 4NOJA 5FEMA 4B87A 3ENZA 5LB4A 1Z17A 4XUGB 5K8JB 2ZTSA 1I0LA 5B53A 3GDFA 1P0FA 3RRXA 5BPHA 1RXYA 2QMQA 3LY7A 4Y2RA 5LKAA 3D7KA 4TYQA 2QU7A 4YRBA 4CU2A 1TAUA 2KSQA 4Y7DA 5E3JA 4GLJA 5AVRA 2ZRPA 2NT4A 2YHUA 5B3LA 2O6HA 4DCJA 5AHXA 1WIWA 4E5MA 1BHJA 1MQ9A 3AL2A 4XONA 3DFUA 4M46A 2VVTA 4GO1A 1NXOA 3TNDA 3ZQ4A 2ZBRA 1FUYB 3EZLA 4MUMA 4EB6B 5BMOA 4EX6A 3D6JA 4PRYA 1T3ZA 4J0HA 1BFUA 2IEBA 3BX1A 3PC8A 2ZAMA 4HGRA 5I4IA 1N2CB 1Z4MA 4MEJA 1DEAA 5KX5B 2FW9A 3L7IA 3TJZA 4ARVA 3WICA 4L9RA 5ALSA 1R50A 5FPTA 2NUBA 3EFOB 2O50A 1XX6A 4G89A 1IZ8A 1M2FA 2P91A 3EXEB 5TX7A 2D54A 4DANA 3WIUA 3NNDA 3H11A 1LK5A 2VAPA 3LQ4A 2YRFA 3VR2A 2IU6A 4ZMSA 1QAQA 5D3QA 4B2PA 4BFYA 4OXKA 1ZAKA 5FNZA 2R85A 5HGXA 5IYQA 1XEXB 1DPFA 1LBHA 3IT1A 1N3YA 721PA 5L8VA 4Z4QA 1RHQA 2QYOA 1NFRA 4JBHA 3BIFA 1ZK2A 1KEZA 2C2OA 1UFVA 2C29D 4FMCF 2R4TA 2O2ZA 4UEJA 4YMHA 4KR6A 3GIWA 4YUWA 1S4MA 4ZVSA 4Y1GA 2BFAA 1WUIS 2C97A 1EE1A 2Z9CA 3FDIA 3TZHA 1P8JA 3TJRA 3HV0A 3GJ4A 5DH9A 1DU4A 2D6FA 1YL7A 2J9XB 3ICOA 5TJHA 2F9FA 5F1YA 3E3MA 3VZPA 5KQPA 2RHRA 4YAGA 3U9LA 3MTIA 4HYEA 2ZZNA 4C0SA 1MBZA 1FRZA 4I55F 4TXHA 1SCDA 1K6JA 2RHWA 3FUXA 3U62A 3M7IA 3PQ6A 2VK1A 2OL4A 5G4KB 1QYWA 1N4DA 4BLWA 3ZQKA 4DJEC 4RHEA 1KSHA 4HYTA 4TL7A 3Q7IA 2HPVA 3SMVA 1Q0TA 2XA9A 4Z51A 3SXUA 3GHHA 3BREA 3QVSA 5CVCA 4ZV4A 4WWHA 1SNYA 2YW2A 1LDEA 1TQDA 2JPDA 2ZVDA 3MTBA 4FC7A 4C08A 1M66A 3ABIA 3E7PA 5UKDA 4E30A 1Z0IA 3DZCA 3SEFA 2FZGA 1XTRA 4UCWA 1EVKA 3W6OA 2WM2A 2WF8A 3NOVA 3H83A 5AW2A 2QGGA 1X1EA 1LDNA 1WSVA 4PLPA 2XYVA 4DDKA 2HH9A 2K4MA 1ESMA 2GQ0A 5A9SA 1CRZA 3CUUA 2QP3A 4EABA 1EXVA 2CJFA 4P4TA 1TF5A 4QHSA 5H68A 1M6HA 1XA3A 3DEZA 1N8SA 2ZETA 1SUBA 2QPOA 2XF8A 3KC2A 3FHTA 4OXRA 5FBLB 4IDGA 1F0YA 2AFHE 3DCYA 4IRUB 1L5HA 4JU8A 4JH0A 3S29A 3VNUA 1JLKA 2QJWA 3KKPA 4HH3C 2ZBQA 1EE2A 1L4YA 2ZJAA 3NHMA 3QKSB 2OLJA 4JP2A 3RC7A 3T3PB 3FAKA 2D5LA 4GLFA 2UZ0A 4FSXA 4Q03A 3OKXA 1CRPA 4ZAWA 5JS2A 5FIUA 1U98A 1FFHA 1IOWA 1M72A 1Q1EA 3D6TB 3ZU6A 3MUEA 3WWDA 5BSEA 4CEJA 1FBTA 3WYNA 4EG3A 2QGZA 4BLPA 2R1TB 3SBEA 5CFMA 1KI4A 4HN4B 2EATA 1G16A 1WCWA 2P77A 3EGIA 4BKUA 3U4MA 1M2NA 1XZ8A 4AY2A 1VCHA 4I6JA 1BDJA 1O03A 1WSDA 1YQUA 3PFNA 1BMFA 1SCIA 1T9DA 4TSFD 4ZQGA 2DSNA 2IY7A 4TKZA 1SK8A 1Z8DA 3ZZ0A 3SY8A 4D25A 4DQXA 4DR5B 4F0JA 3OOJA 2DZDA 1UCFA 5C18A 4D4GA 3KHKA 5A7HA 4ERXA 4EY5A 3WFJA 4XA8A 4CCYB 1WVIA 1KAOA 4P3OA 1IY2A 2QA5A 5KIAA 1EFVA 1J8VA 3VU3A 2WYVA 3L7CA 3EZ9A 1DBPA 3UJ6A 2HX1A 4YRMA 3HCCA 4M1WA 4R8KA 4O3MA 5L95A 2GERA 1DFHA 1KY2A 2C83A 1RAAA 1VHLA 1OV6A 4EY3A 1DXQA 1A69A 1ZI6A 4JOBA 4N3CA 3TS1A 4EJSC 2ZI9A 8MHTA 5LNK6 4KSBA 4A8JB 1MAAA 1XRSB 4JENA 1WG8A 2JHGA 3E0QA 3I04M 4NH4A 2YJ4A 4J7XA 5EIEA 1XP5A 3TIGA 1NVFA 2IYVA 1FLNA 3TUZC 3BCDA 3RUEA 3ANYB 4NCXA 2RHBA 4ZAYA 3IHTA 1F6WA 1DKPA 3MELA 4TMVA 5EMLA 4YC7A 2QWXA 4DVGA 1IL0A 3KNZA 2V6GA 3EVZA 3MGGA 3BIJA 1I4LD 4D9KA 1G64A 1THGA 4RA6B 4BUCA 1PJLA 4AURA 4C29A 3FYCA 1L1EA 1R0SA 1ZNWA 3E2MA 3RD5A 3SGLA 2F3TA 3U4DA 2VRNA 4D0NA 4DA7A 2C31A 4Z2AA 1Q6YA 3NVAA 2BBWA 3N74A 1D03A 1NXTA 1FFCA 2W2TA 4UD6A 5AM4A 3AFGA 3WO1A 5ADVA 4QFMA 3KKZA 4FS3A 1DQYA 3B3AA 4KFRA 2P75A 3SYMA 4KH1A 4O0MA 2ZJ5A 2HMTA 1SVNA 4M22A 3PHBE 1KO5A 5HOEA 3F67A 4RGYA 3P9QA 4BZWA 2GXAA 3I58A 2P9BA 4LXUA 4CODB 5CDFE 1PR4A 4II7A 1DXHA 5HQ3B 1I7LA 3KDSE 1F7UA 5AD1A 3QYJA 3OPNA 5JZVA 5AW4A 5M2QA 5LQRA 1QV9A 2J5KA 2JBAB 3GYBA 3OM1A 4UPVA 3ORSA 4X66B 2HDNB 3H1GA 3NHFA 3Q85A 1O94C 1HTBA 4JJ8A 1Z63A 4QVAA 2C3MA 2VNIA 3RYHB 4Z4HA 3O47A 2VBTA 4YJGA 2XYPA 3THOA 2G9RA 1H3EA 4FYHA 3IVCA 4X1YB 4EA8A 2GHIA 2IU4A 4DDWA 4TSFA 3L7BA 5BY2A 4OHMA 5EHXA 3E8MA 4UCFA 3S2SA 5BW4A 1RRCA 1CRLA 1D4AA 4PIVA 1QHXA 1DJLA 3T99A 5A62A 2YN4A 4KH0A 5A5EA 5AESA 3OJFA 4NG5A 2P6PA 3DWFA 1HT3A 4XGIA 1BJRE 3G9ZA 1J0AA 3QX3A 2BR4A 4UVIA 2WZNA 4WH0A 4DLRA 1D6SA 2W2LA 5BNTA 3HKBA 1SXGA 4DLXA 3HCRA 5KX5F 3ANNA 1OFUX 2GWHA 4KNVA 3WFIA 5B6IA 1VE3A 3V42A 2HADA 2R79A 4O25A 2O48X 1FRQA 2QG4A 1U8AA 3K0FB 5HFJA 3HVRA 4LF7B 2C3OA 2X1LA 4CKEB 2VJMA 2P9TA 2XAUA 2H2FA 2I4MA 3ILSA 4JS0A 4L1KA 4V24A 1TOAA 2ZBEA 3JTMA 4IUCS 4YWHA 5K4HA 4LY6A 1PEDA 3DW3X 4LA4A 1P9RA 3Q6QA 2A0KA 4IUDS 3TZLA 2IP2A 3JQCA 4HAXA 4G1EB 2I7TA 1UBKS 3ICWA 5DBEX 1PI3A 1KDYA 2KM1A 4O4IB 1WD7A 3NH9A 2G9QA 4DDTA 1G38A 1QIFA 2RKBA 2YINC 3IT2A 3PHIA 3UCEA 1FP1D 3TGPA 2YJZA 3K70C 2B7CA 5DI9A 3BMOA 1KDPA 2I66A 2AIRA 4P31A 1SAYA 3PGVA 5SZIA 5KYWB 4P3NA 3U7GA 3CB2A 3DE3X 3OCVA 4LVCA 2I91A 4IIYA 3WK8A 3A8IA 3CS3A 2Q7XA 1WXDA 4Z99A 3HZOA 5IYPA 1L7XA 2JK1A 3L6BA 1M83A 2BH9A 3U7JA 3U44A 1C4XA 5FLYA 2DWOA 2WMYA 4RU1A 3ZCTA 4PAOA 3R74A 1AHHA 4MV5A 1POWA 2O2EA 4KE8A 2B8NA 1TQHA 3SKXA 1NGSA 3F4LA 3HB4X 3GROA 1WMAA 3R6LA 1E79D 1B0PA 3U3KA 3ISTA 2KHZA 1WRBA 2I22A 4C06A 4OPOA 1D2HA 5AQEA 1AM4D 3KVVA 4P2NA 1IWBB 1GKIA 5CB6A 2FPOA 1LBTA 3L77A 5JDIC 5L3QB 3IQZA 1W19A 3PR3A 2ZUEA 1F4PA 1SG0A 1JJ2B 2ZE6A 3TOCA 2I33A 1QZUA 2V97A 3ZZNA 3Q41A 4M0FA 4XLZA 3MMZA 1SIOA 1U1IA 3LP5A 5I9TA 4F5WA 3VNBA 3DO5A 1SUPA 2LP4Y 1J1UA 3HJFA 2FFQA 2PD6A 2VTBA 3A6PC 4PG5A 4LRYA 3GX1A 1DAEA 4IKEA 3V76A 2GN9A 4EG4A 1QTRA 3QQPA 1PE0A 1N5MA 5IARA 4K9SA 1OCEA 1N7IA 2O2JA 3Q5GA 5DHSA 1NAIA 3CC4B 1NN1A 1Y7IA 4MNTA 4BO7A 2GASA 3BAZA 3HYRA 3M3PA 1I6WA 1I5OA 2DPLA 2Q29A 3EIUA 5GADl 3L9XA 3KKEA 2EG5A 1OZFA 2A7QA 1OFTA 2BLLA 1GTVA 3F9CA 5JS1A 3ESBA 5CFNA 3NXSA 1RFGE 4WA7A 2G5TA 3L3BA 2O2CA 3B9PA 1L5FA 3R20A 2ENWA 3ZE8A 2B99A 3OZIA 2Q1SA 2IIBA 3FZEA 3LYAA 3K53A 4RVUA 2ZPUA 5CHYA 4QRDA 4YRPA 3C6BA 2GZHA 2RHMA 2XMCA 2R6CA 3RJ9A 2HWYA 4AJHA 4ZCLA 3HWWA 2Q41A 1AS2A 2EHDA 1ISIA 4XIFA 3JSAA 4UHEA 1B6RA 4XOTA 3FF4A 4ARCA 1ORDA 1Q1AA 4QUDA 3BMNA 3O9MA 3B38A 2UAGA 1TVKA 2G7ZA 4OEHA 4LGCA 2QEXB 3TTTA 4BVJA 4JI0B 2OFXA 2ORVA 3IR5A 1SU7A 3DTTA 3VU8A 4R6WA 2PH1A 3OX3A 3OA2A 1C41A 4LQ4A 4NBNA 4BU1A 1PEYA 3H2BA 1ZINA 2G63A 5HF6A 4D57A 7MDHA 4XWTA 5GZ3A 1CQIB 1KGSA 5CAEA 2CN1A 2J85A 2XVAA 1H6CA 2BMAA 4W5RA 2HJWA 4NMMA 5LYJF 4MKIA 5AKZA 3N6RA 4C7JA 1DINA 3AU9A 4X60A 3LBHA 4EHLA 5IASA 2NUAB 1EFLA 1KWGA 2V74B 3DGEC 4A4DA 1EXDA 4ME6A 4EKDA 3KZVA 1Y9ZA 1Y8QB 3PHHA 2HCRA 1AKMA 4MVJI 1BMQA 1K6EA 3PJEA 4W63A 5EXDA 4G7WA 1PK8A 2FUG6 2X6YA 2PXXA 2QF7A 4JLPA 1N5IA 3F9RA 2NT3A 3EF1A 3O3CA 3RU2A 5AVTA 2JIRA 2QTFA 1OZ0A 1WDMA 1FSPA 5AI4A 4PE5B 1W36B 3ZHCA 2HXSA 2EZ9A 1A04A 2X76A 3VPAA 3CM0A 1I32A 5AYVA 3HRKA 2GJSA 4MITA 4I4TB 1JT9A 3S1AA 2BHNA 4GP9A 2LGJA 4AF7A 4Q7KA 3DXXA 2YR0A 2VRCD 1C7RA 3P2JA 4I99A 4IV8A 4UNSA 2QDXA 5I47A 5BN5B 3S99A 1BE6A 2FPRA 2WFLA 5CFZA 1R4MB 3DOJA 4LYGA 5E3HA 4ZI5A 3HI4A 1RZ3A 4CM9D 1EXMA 1YZHA 2OGWA 3ICCA 3Q87B 4LWQA 1VKOA 4WDRA 3HSYA 3C3EA 5HCIA 5AVQA 2R86A 1Z4KA 3GVCA 4FYJA 3W77A 5BV0A 4BFSA 3W8DA 1K0UA 1PGOA 4CJXA 5KYTA 4UNNA 5IBQA 3DWIA 2ZYAA 4EVQA 3OI7A 5ARBA 2FUKA 3BIOA 4O8ZA 4Q9DA 5HYVA 2G5GX 1PNTA 3RHTA 4NNPA 3SJBA 3KSRA 1V96A 3W78A 3NFRA 1OH8A 2UZ1A 3AVYA 2C8KA 1T8UA 1BW9B 2YS6A 2ZI6A 1K86A 3EIOA 2IWHA 1ZGJA 1JAXA 3UJDA 1W44A 3OIFA 4WGFA 4YRLA 3VZBA 4DCCA 4E6EA 2ANCA 5JWOA 2DB3A 1EZ1A 1FDOA 2OZEA 1YR3A 5HX7A 1SK9A 3OP4A 4WMLA 4PC2A 3G89A 1N9GB 1RIIA 1J5EB 2OPHA 5K3AA 5BV7A 2Z5VA 3KQYA 5CYOA 2XQFA 1NFFA 3HLTA 1KQ3A 2CK3A 4RS3A 4P81A 1SC9A 5CW1A 2YVLA 4GW3A 1W94A 2MDTA 3A1EA 4N01A 1GIAA 1YZNA 2PWZA 1FNCA 3M83A 4KDCA 4RZUA 5E6SB 3K9WA 4ZV9A 5KVAA 1UDWA 1Y4SA 1RZVA 3EVBA 3LCVB 4KYTA 3MINB 5FYDA 5HS4A 1XOIA 1T5IA 2VDWB 5HJ7A 4ANFA 2CCKA 3FUTA 4QU5A 2JI7A 2W58A 5LOVB 3QUAA 1CQZA 3ZDCA 2BBOA 4QO8A 1RRGA 4NDAA 2IEGA 2CFSA 4RWEA 2AOUB 2ZJ1A 5LQAA 1XL0A 2FPIA 1WD5A 5I8WA 4B4VA 4C2UA 3ND6A 1PV2A 4GWGA 2PVPA 3QXCA 1QQ7A 3OECA 4DADA 1LPNA 1I3OA 1SB8A 2V65A 3IAUA 4KQXA 4P7FA 2YWFA 4UBIA 4BGUA 3O83A 2FWMX 4C0BA 4ER3A 4EATA 3KX2A 4MXDA 3EX7C 4V0KA 5H02A 1C0LA 4D5EA 5FTLA 3UFBA 3D64A 1FX0B 2ODTX 4RCVA 2OB2A 5IN5A 2LZJA 1KFJB 1LSUA 4R8RA 6Q21A 1VKNA 2HFKA 2MSCB 5KKAA 3X2SA 2XLBA 2QN2A 5A4JA 4KJXA 1U7WA 3TMAA 3I0NA 3JYHA 4G07A 4TMKA 1VKZA 1DBRA 2LNDA 3JZIA 2ZI7A 1H8HD 4ZVNA 1Z07A 1II8B 5I9BA 1EFPA 4LSWA 4O4IF 4E3ZA 621PA 1JX6A 3ASSA 2P9GA 3HXKA 3T7EA 4QL3A 1ZUD1 1HYQA 4KFSA 1SG6A 1TA9A 4O5AA 1AUQA 3LY5A 3CF0A 4TVKA 1QU3A 3KZNA 3L0DA 1E2GA 3FOBA 4N7MA 5KSPA 4BQSA 1TK2A 4IVRA 3V4VB 1G5TA 3C4QA 5EJAA 3WYEA 1TTHA 5EIXA 2AR7A 1HZEA 4CF7A 4YIHA 1R6AA 3ASUA 4HT3B 5EXPA 2FSUA 1E2IA 1YJQA 1GZ6A 4XW2A 5TVGA 2P9YA 3NHRA 4WJLA 1V16B 5TRDA 2VJPA 4C5CA 3FI9A 3QGMA 2ZWIA 1XT6A 2FDXA 2EW2A 4RIGA 4X63A 1O95D 5CB4A 1JU3A 3ONWA 1UEJA 3HR4A 1KE1A 5C5EA 2RHOA 3NPAA 4B8WA 4PQRA 4BO5A 3ZDXB 4C2TA 1L5MA 5EP1A 4GX2A 4OKNA 2AI3A 4TLDA 2J3KA 4KAJA 3EGEA 1TDJA 5HKOA 3OVMA 1NAHA 4QLOA 4DQDA 5CB0A 7GPBA 2HK8A 4N8EA 1RJEA 2ADFA 1ABBA 2GM4A 3C85A 4HQRA 3L1VA 1UZMA 1Y0RA 1NBIA 1QC5A 2AYZA 4IGKA 1EUYA 4RF2A 4GP6A 2C9YA 2D5IA 2IZ6A 3OWHA 2DERA 1IOLA 4JSTA 1QFSA 4MVJH 4W7HA 5KYUB 4AO6A 3PFGA 4GDMA 1YONA 4IJQA 3UC9A 3UUFA 5H7XA 4WLFA 2QEQA 2Z09A 5DSTA 2NPOA 3D5TA 1IXZA 2PSSA 3RWOA 2HSZA 3B1FA 5E2AA 1DEKA 3NCHA 4RESA 3IS3A 3G2OA 4PYNA 5D5HA 5JSZA 4JYBA 1A98A 2OCGA 4YUVA 1KEVA 3ETNA 3OEHA 1NI4B 4B6RA 1K6IA 3I72A 1EUDA 1S8NA 4NIMA 3TUJC 3URMA 3E70C 3AR9A 1IATA 1LXCA 2GZ2A 2WNHA 2FZEA 2VH1A 3EOBI 1NJID 1AE1A 1UZLA 1GNPA 3FMIA 4IOLA 2XRFA 5K3FB 3SR3A 3ZJTA 1UKVY 1P7ZA 1RCUA 3FRIA 3EXAA 3I9JA 4YT5A 3RUDA 4JGBA 4IGIA 1D3AA 3DV0A 3M9XA 3EUFA 1UP4A 4B0OA 1C0IA 1EX9A 4P6VF 1X7WA 3UJ9A 2MYPA 1Z2PX 1IPHA 3QW4B 2A0FA 2WZBA 1Y3HA 2YZKA 3B1YA 1CD5A 4TS1A 2F1IA 2BELA 1J5PA 2J09A 3CRQA 1Q7GA 2RBEA 4L76A 5A2GA 3H2ZA 4RLQA 1H8HA 3PEWA 2JD1A 1SIWA 2C4WA 4YROA 4Q1CA 1M1YE 5CNIA 3F5SA 2X1MA 2Q28A 2H4YA 3M4NA 5TT0A 4W8OA 3RSSA 2XGMA 2A9JA 3WLNA 4M87A 2HMUA 3X3HA 3GLGB 1UC8A 1Q3HA 5AH0A 2X14A 1VBKA 1GCIA 4F04A 1YD7A 4J76A 2EERA 1HL7A 3A2MA 1TZBA 1L5NA 1AGXA 1Z0JA 4YAUA 3BXXA 4PG8A 4V1CI 1JLSA 3PNKA 4O33A 1G7SA 4EG1A 1K6XA 4MRSA 2NYRA 1N2EA 4MUEA 4XJVA 3PA1A 5CFPA 1I94B 4D6YA 3WK6A 1LJ8A 3L8MA 1YI1A 1H9BA 5SZHB 4ZCIA 3QVKA 4PC1A 1P5ZB 3MMSA 3P7MA 4S1PA 4HOYA 2FRVA 3VPXA 4Q4JB 2A9KA 4G1BA 4I4TF 4WLNA 2ZRGA 1NVEA 3O92A 1Z6GA 1WNFA 1YHNA 3AEUA 3KYJB 3NBAA 4BRUA 1Y80A 2MIIA 3SC3A 3RFTA 4EI8A 2V5VA 1ULUA 3CMAB 3HP1A 3P5SA 2YHIA 3P52A 2BMWA 4B47A 3KU4A 4B2YA 1C3LA 1H69A 1ML4A 1ZRSA 2AOWA 1T5BA 1BQEA 1LVHA 1TO1E 4OJQA 2PS0A 3T1VA 5BXQC 2VP0A 2DBYA 2VZEA 3SZ3A 3PF8A 3HVKA 4J7AA 2Q3JA 4BFVA 4JLBA 2Z95A 2WJYA 4G01B 2DFVA 3FWNA 4F93B 3IMFA 1JXOA 3JARB 1V2HE 5EUCA 4EBBA 3CB4A 3AETA 4OIFA 2JZNA 3STHA 1G8SA 4UFOA 3EK2A 4AJKA 4Z4YA 2DC1A 1D4OA 2YJGA 3PEYA 4EHFA 1Y3CE 1GA4A 2G4CA 1RKUA 2PU7A 3H0CA 4ESVA 3VH1A 3VKHA 2GYUA 2SCUB 1A2BA 1L8AA 2NU7B 3QI2A 4YMIA 5ESXA 4RH0A 1X8XA 3SE0A 1GADO 2HQSA 2IVFA 3LT2A 2BF7A 1SPXA 1BXGB 1C0PA 2F9MA 4U7WA 4J8PA 4AROA 3ZDQA 5AW6A 3REQA 1NBMD 1QVZA 1WZEA 1U0JA 4AG6A 5BNZA 3S8YA 1T2AA 3VR3D 4TM8A 4RTNA 1YIJB 3GOQA 4YK7A 4DLTA 4X64B 1IBSA 3AEKA 4N3AA 3RIYA 2FN8A 3PQ5A 3WLAA 1NBME 3T1HB 3LW8A 2ZWOA 2C61A 4ND8B 5TY0A 3QOWA 2H5JA 2B1GA 1D6MA 3AZQA 3TAHA 5LOVF 2P67A 4FILA 5IJ9B 3URKA 3EWAA 3H5VA 4JBLA 2H16A 2NP6A 3QVLA 3NHSA 4HTFA 1AS0A 2IJGX 4GSYA 4MW1A 1KI9A 3CUVA 4OB7A 5D7BA 1SQFA 4OI1A 1XTBA 2PZKA 1FUUA 1ZD5A 3CH7A 1G8FA 2D2XA 3GGCA 1OA0A 1PL8A 4KZPA 3KBBA 2D3LA 2Z3VA 2BR5A 4KDEA 1QM5A 2Z2JA 1N0WA 4GMFA 4HDRA 4BO3A 2IS4A 2XNCA 4HNSA 1QHIA 1XU9A 2PH3A 3U2QA 1I8TA 1N3IA 3F96A 1NVUQ 1POXA 3U3DA 4BKQA 3BIWA 3K0KA 4Y18A 1SCJA 2I67A 2VUTA 3IAS1 2ZU0C 1W2BB 3AFIA 4MVYA 4PX9A 4G8BA 1CRQA 2Q9UA 2BEVB 4M1YA 2QRKA 4PS1A 1T1GA 5CM2Z 1QMPA 3NW9A 4YLEA 5EJ2A 5REQA 1XU4A 2FNAA 2FEXA 4TS4A 4BE4A 2V7WA 1DBVO 3HSSA 3ZG6A 3WVNA 4RPDA 3B5IA 2CC2A 5TQ0B 2XCTB 3DTNA 3R24A 2HF8A 4U8HA 3NAMA 1Z38A 1PJ5A 4GOND 5CA0A 3CMCO 1O6BA 1RI2A 1XZAA 3F47A 1L7VC 3S2EA 3HCFA 5AHKA 3DDHA 3WZLA 4JAVC 3EXIA 5IEBA 3FNFA 1DCTA 5CNKA 2QQ0A 3A9RA 1U6IA 4NOKA 5ENZA 1SMKA 5ULLA 1HE5A 1XNHA 4MRAA 4D9NA 4ZCSA 4NZ9A 3VO9A 3ZGYA 3QYAA 4FJ0A 3SEZA 4CR7A 5D85A 3UY4A 2IH2A 2VS1A 3DS8A 2FVYA 3FFTA 1GLVA 4YCMA 4C0HA 1SFRA 1GNVA 2VDUE 3H5RA 1X1SA 2J9RA 4P86A 3ZHSA 1N0IA 3RPEA 2Q9BA 1MX5A 2EYQA 4BNHA 5BYKA 3RAFC 4X0CA 1TYEB 5FPQA 1QYCA 2H5EA 2AMVA 1AX9A 2OBMA 2JIOA 4JC4A 3ST7A 2XUFA 5B37A 2PZBA 4BL5A 2AOTB 3G59A 5JCOC 2V0CA 4KKSA 4HTAA 3SM9A 3BXEA 3D6HA 2ONCA 3KDAA 1N3LA 2A5FA 4WNYA 1EP9A 3KLPX 4KXYA 4P5DA 2Q4EA 1NI5A 1FUKA 1NBMA 1HKHA 1S2DA 3CCMB 1JIIA 1FU7A 1PJ2A 1EM8A 1OC2A 1UK9A 3WBJA 2WYOA 1F2TA 2QAGA 3OHPA 4JR1A 4CV0A 4DRZA 4DT1B 3FOAA 2B20A 2G6TA 2PKQO 1PUXA 3MUNA 2DUWA 4I4NA 4D4KA 3PNSA 2BJHA 5ITWA 4OX9Y 3QELA 1P1CA 4FDMA 2PUEA 4N6GA 4M0UA 3HUEA 3B2QA 4PLGA 4RULA 4UUPA 1JIJA 1T10A 3RIGA 2W8BB 3DBVO 3MT9A 3SZGA 3HXPA 1J22A 4MS4B 3I2FA 4M37A 4NOLA 3SZMA 4F6RB 4WKOA 3ONEA 3C6MA 3CH6A 4E1AA 4XLAA 2KI5A 1MV5A 2EL7A 3C5CA 3OICA 2YQZA 4MCHA 1HLGA 2A33A 2BM0A 3H9JA 1YZFA 1MC1A 1SVMA 3DE7X 8LDHA 1XMPA 5TQ2A 4H31A 2FVXA 5DEIA 3LGXA 1KL7A 1Y9EA 4DYDA 8AT1A 4J9UE 2H17A 3L41A 1SXQA 2JFFA 3QVGB 4EG5A 1GSAA 2JAWA 2I4NA 3JQGA 5KWSA 1DC4A 2O5RA 4Z4ZA 3MMXA 3IAXA 1Q19A 4ON9A 1YI8A 3BL8A 4R83A 1R4AA 4P4SA 5EHQA 4QE3A 1WPGA 4P7KA 2MYTA 3WMEA 4B8YA 4ZYVA 2QRJA 4HYYA 5ALHA 2NMVA 4AK9A 1A9TA 3W0LB 4Q6BA 1IEQA 2OMKA 4II3A 1SBIA 2R48A 4HYQA 1Q7RA 2ZJYA 1DZIA 1ZUIA 2QUHA 3WB1A 5KDDA 4UCXA 4JDUA 4PNZA 1RHUA 2HMVA 2P9CA 3KD3A 4LXTA 4OHXA 5LUAA 2V0GA 1HOXA 4MLZA 3S1SA 4NMHA 2NTVA 3W5AA 2VQSA 3LL7A 4K1LA 1X0VA 1AA9A 2C2XA 3GCWA 4OFWA 3GXBA 4XFJA 4QTYA 1WP9A 1SQ5A 2JLSA 3QK7A 2H7XA 2X6RA 5HKBA 3QITA 3HUUA 5DYWA 3WL3A 3K2QA 4KJZA 5EEHA 1BCSB 4HKTA 2JJQA 3R6WA 4JNCA 4GOLD 1SRQA 1XNJA 4U6SA 1O8BA 5AVJA 3DOHA 2WYRA 3G49A 4IDBA 4EJFA 1JFLA 2WM9B 3AZPA 4NECA 2F6RA 4C6TA 1OA1A 1ZK4A 4R1UA 4Y2UA 3ZTTA 4JASB 1VFNA 4EX7A 4M9CA 4HEHA 4PM4A 4QYIB 4TVOA 5BWNA 3QEAZ 1PJ3A 1XCPA 4GUAA 4PBSA 2HHLA 1SOMA 5KI6A 1P7VA 2HSDA 2Q3CA 4TZTA 3ANLA 1CIJA 4MICA 1WZIA 5C1BA 4XDYA 3PLRA 4MWDA 4L8LA 3ZCQA 3KTOA 2VDQB 3PFBA 3UMGA 4AICA 3OFSA 4AMBA 4BAGA 4OLAA 1TUIA 3HA5A 1ZN7A 1LUAA 2ZJ4A 3D9QX 3DBHA 3CESA 4ESHA 4DW8A 1ZM4A 4GNRA 3WISA 1I7SB 2BKVA 1H8ED 2QMUA 4Q3DA 3T1QA 1Z33A 2A94A 4ND6A 4AXBA 3QLTA 2VQ6A 2N1BA 2WP8J 1JHQA 1CX9B 1AQ6A 3VPBA 4DILA 2PZGA 1CERA 1DRUA 2VJDA 3GQBB 3LT5A 1VTKA 3KKOA 2D62A 3ZIDA 4OH1A 2FETA 4QEKA 5KAPA 1LW7A 1ZH2A 4FYPA 3W34A 1JQLB 3FNBA 2VF4X 4RVDA 4WZBE 4E12A 4MR7A 1RM4A 2ENUA 1ZX1A 1YR1A 3RAGA 2JVKA 3NMUF 3FX2A 5FJJA 1YHYA 4BQPA 4YQFA 4XKJA 2OTCA 2FEOA 4CYMA 1JHAA 5IKEA 4D5GA 1JDPA 1XMSA 1VRCA 4B3JA 2SKCA 3OUTA 1FS4A 3P9KA 1UDAA 4QBKA 1OXUA 1ULZA 2OD7A 3T7SA 1ORIA 1PW5A 2X41A 2FJPA 5HQTA 1Z25A 1MW8X 3W7BA 3DDYA 1RPJA 4H17A 1TMYA 4ENVA 5DGCA 1QBGA 1YMQA 4ZVOA 1MA0A 1R6VA 3UPDA 1VBMA 3WQQA 4J91A 5D84A 2X7XA 3DJFA 3NUZA 4AZ0A 2JIZD 2RG7A 2RGNA 3WQBA 2ZU6A 5AVYA 3QU4A 2DQZA 4LV5B 1DC7A 1U8YA 3CKKA 3QWIA 5FO1A 2QL5A 4PBRA 1N07A 1ZVMA 5LKRA 4JP3A 4A10A 3R9XA 4EMTA 4I50B 2XE8A 3IRVA 1D07A 3VJRA 1RLJA 1G21E 2QX9A 5LA6A 5BYBA 5DS0A 1J21A 3OJWA 3LPDA 1SRRA 1GXSB 1TTQB 4BMPB 3L7KA 4PLYA 4ZAFA 3ZV6A 1LVUA 1E9BA 3IO5A 4JGGA 2PGNA 3FM9A 4GPEA 2NU8A 3SHFA 1SCKA 2OBFA 3JYQA 3C5EA 3TFWA 1M1KD 1B3BA 1W52X 1JYFA 3AONB 3E5MA 1WW2A 4OL9A 3CLSC 1S2GA 4XVCA 3E84A 2G25A 2XNDD 5CDYA 2Y66A 1EIWA 3LFUA 2WEKA 4DV5B 3I2IA 4AG5A 5KW9A 4CM7A 5AXCA 1QLHA 3CLUC 3EULA 4HDCA 4O4LA 3TNJA 2AFIA 5HBRA 4RE5A 3TW4A 1SCQA 3PWKA 2AKAB 3LF2A 1M7GA 1ONNA 2GAIA 2H0RA 3EIHA 4RDXA 4AVYA 3AJ8A 4BNTA 4CLXA 3I61A 2N42A 5J2TA 1B8UA 4JK3A 3TTXA 2IU3A 3M5WA 4GH5A 4KPFC 5HF9A 4BNDA 1H8EA 2RAUA 3MYYA 2NVBA 3MLAA 3IVAA 1V3UA 3NT4A 5IABA 3AVVA 4NF2A 3NM4A 1YJ8A 2PV7A 4CQMB 1SHJA 3KZXA 3U3OA 1AXRA 4R41A 1KO7A 2YJ5A 2ZBGA 3O4HA 5ERGB 1QX4A 1YIDA 2HRZA 4I5EA 4ROSA 1YBAA 2QVCA 2IKQA 3K1YA 5B7PA 4WKBA 2DLNA 3ML1A 4ABYA 4EUKA 3AJEA 2UVPB 4DTIA 3KT8A 4D9EA 2DLDA 2L0XA 2EAUA 2VPQA 2ZANA 4X3CA 3HCDA 1OWOA 1DC3A 1K4MA 2QTZA 3AGQA 1XN4A 2I3AA 3T7IA 2C5FA 2QTVB 2CD9A 3CZ9A 4C7OB 3ZBTA 3ZKWB 4HS9A 1BJKA 1W2GA 2B78A 4YAIA 2ZRDA 3VV3A 3WRXC 1E0AA 3E9NA 4OH7A 3RVMA 4DM7A 1WMBA 1LF5A 3K2EA 1FJHA 2GPBA 3U4IA 3VR5D 3M4XA 3H05A 4XR9A 4D44A 1KI7A 1OI7A 3A3KA 2PMFA 2CL6X 5J4VA 4HZGA 2IP4A 4E09A 2AC2A 3V4ZA 5K6AA 3MAJA 2X5XA 2JIZA 3T12A 1SIUA 5I9IA 1DV1A 1ZUNB 1MJNA 1MVNA 2X9VA 4QUIA 3TJMA 2D13A 4E5VA 4BYMA 4DV7B 4NL4H 2UXBB 2Q45A 1K5PA 3I9LA 2QU8A 3RLFA 2CSXA 1FFSA 2FJUA 3ASYA 2IHZA 1R8QA 3GLUA 4IVQA 1Z6ZA 4R4JA 2EV9A 1PBNA 5CM8B 2QLBA 1R6DA 1N6KA 3LRPA 1N2BA 3PX2A 3VBCA 3OP1A 3JS5A 4FDVA 2XKAA 4FGSA 1W85B 3V48A 1JEYA 4LYAA 4V03A 1JHDA 3K0SA 1M34E 3DXZA 3AL0C 2V9ZA 1WOSA 4WCFA 3HJBA 4H7PA 1W49A 2NPFA 2D7JA 2VYND 2RCNA 1PVVA 1Y4AE 3ZBUA 4K3UA 1LX7A 2QTTA 1L4EA 2NXCA 4LVNA 1Q5PA 4WPGA 4YWJA 1CE8B 4Q15A 1MC8A 3UCXA 2XNDA 2AHOA 4FQ7A 4FBMA 3I45A 4ZO9A 2PANA 2Q1XA 5AM3A 2QK4A 4F11A 3RVSA 2QJOA 2O06A 4HEQA 4LVOA 1XCMA 4PPQA 4CLEA 1DUIA 4QBTA 2FSHA 1BNCA 3O2NA 1JDJA 1MC5A 4IDPA 3C7AA 4LXGA 3WGJA 4P9SA 1ZD8A 1A8HA 4WZZA 1CY8A 2AX4A 3NHBA 4YV1A 1FTWA 5KC8A 2Z6QA 5JISA 2F90A 3BWCA 1QVVA 3D8HA 4X1IB 4KGXA 1PG2A 3C3PA 4ZCRA 2AXPA 3H3XA 4KDRA 4BMZA 1IUKA 1GCAA 3RFVA 2VBUA 1FFEA 3EIEA 2B69A 4KQHA 1MXHA 4PRZA 1SUDA 4B7XA 1F4VA 1MTZA 4BATA 4FXUA 2A4KA 1AKQA 3ENQA 3ID6C 1SQSA 2BGTA 2JLRA 1UXJA 1XDUA 1IJBA 1H5NA 2AF4C 2GPSA 2GPTA 1M67A 3NHKA 4ML3A 5BNFA 3SHQA 4DNQA 1XK7A 3CQ9A 2VOJA 4N8SA 2RHCA 1JHPA 4DJAA 3NM6B 1U0GA 3DF7A 1XCBA 1FYDA 1VLHA 1U3FA 2OY0A 2QVYX 4CF6A 1UK7A 3M8KA 2P5YA 2CWWA 3I6YA 1ZGZA 3T56B 2PBZA 4TTSA 1J06A 1KFCB 3Q3GE 2GRUA 3MNFA 4ZEVA 3T1NA 4UUNA 2IX3A 1J2YA 3LVFO 1E5TA 4IF4A 4Q5IA 3GT4A 3SS8A 4G0UA 2XB9A 3MK31 1Y81A 3FJ1A 1K7CA 4HZUA 5D1HA 4BXOB 5JCJA 5EP2A 1TVEA 3SF0A 3RTGA 2V1UA 4G5GA 4NCNA 4YGYA 3NB0A 4RCYA 3DAFA 2ZJFA 2X4DA 3DDNA 3T7DA 1O9HA 5DGIA 1M6VB 2BEJA 5BSXA 3GRYA 1GLNA 2JLXA 2C84A 1GCGA 4XM3A 2L2QA 3CNOA 2I3ZA 4OJKA 4C4OA 2XKKA 5EZYA 1T4CA 2Y1GA 4ER7A 4HJRA 2OV4A 1E2UA 4OQNA 4ASUA 3L8ZA 1I7NA 2C2MA 2WAOA 1YI2B 3JQBA 4JC8A 4PZLA 2JFQA 5FPSA 2QJTA 1ISPA 1ODTC 2IF0A 5H3CA 3WDSA 3PEUA 4A5OA 3WV4A 3R4CA 2QL9A 1UMDA 1CW2B 2VTEA 1OGJA 4IH4A 4OJTA 4Q9NA 3X1DA 4CEHB 4WDQA 1KYTA 3X2FA 2FZWA 5DTMA 2QPTA 1ZI8A 1DWUA 2FR1A 2E21A 1ZK0A 4RHCA 4NICA 3AGPA 2EZTA 1XMVA 2ZT8A 1IUPA 2AFVA 3FLAA 1HQCA 4I50F 3LLUA 5GGXA 2REOA 3KJIA 4C2AA 5LP6B 3EEIA 4RHFA 1VL2A 2R6FA 5ALPA 4AYTA 1C4KA 1KJWA 3UF0A 3V2IA 2IHJA 2W4QA 3NS7A 4FTWA 4AMGA 3HP7A 3ZGNA 1SUWA 3Q88A 3WZ2A 5IC4A 5IYWA 1E3IA 5AJTA 1GDHA 2WUDA 4AX8A 4IINA 5JZSA 4JLKA 2V7UA 1B23P 3N2YA 3NHUA 1NBWB 1XC7A 2HMSA 3QV1A 2C98A 1YVRA 4N5IX 4PGAA 4W5JA 4NHEA 2JG3A 3RS2A 1LC0A 3H2SA 2BGNA 2YV5A 3A31A 4F56A 5JT1A 2QN8A 2CMGA 3SZOA 1KQGA 1C2YA 2RD2A 1DJNA 4IY1A 1ISSA 1TJ5A 1VA4A 4EB0A 3DZHA 4MWEA 5A4IS 4YJFB 2AEJA 5DM70 1DDGA 1G7CA 2JKZA 3ZX4A 1E6WA 1YJ9B 2WTNA 3C24A 1F1BA 3EWNA 5JZMA 4ZWNA 3X43A 3HR8A 4FQ8A 3VZSA 5JSKA 1W4ZA 5A3JA 5I7SA 4EB8A 4JR2A 1BQ4A 4EF5A 2PSJA 1YR7A 3BCFA 5C8ZA 3OMLA 4X95A 2JI6A 3LGSA 3OZ7A 4PG4A 3OZTA 5SZKB 3WI7A 4F45A 3NGMA 1V43A 1XEFA 2G4LA 1Q2XA 2H11A 3L05A 4LOAA 4DSNA 2CT8A 1IVNA 4ESOA 1SC4A 2QW0X 2WJHA 1PR6A 4DG9A 1VYHA 1S02A 2VQ3A 1WUHS 3RK1A 5KTOA 4B31A 2NUTB 3QSYA 2BISA 1Z6XA 1QS0B 2VQDA 3SN6A 2YQ5A 3LOUA 1Z47A 4P32A 4XSGA 2RCYA 4NVRA 2IV2X 5JQGA 1DMRA 3DSRA 3BKXA 3KTFA 1ZVVA 2XZOA 2H3HA 3K5IA 3TD9A 2DPGA 3TR5A 3JAKB 4Q4AB 3EYWA 3FWHA 1DHTA 1T25A 3LNNA 2BDEA 2P2CA 4H4DA 4XWAA 2ZIEA 4YYZA 2J3MA 3M2TA 5JXWA 5K2OA 3LUPA 3OMXA 4M8IA 2QP9X 4DVJA 4EPRA 2O8FB 4BC0A 3L7DA 3BMQB 4H60A 1YQXA 4LI3X 2QNRA 4B84A 5C1PA 1JZQA 3DV9A 3BF8A 2JCSA 4CL3A 3C43A 1DRVA 3QXHA 3SIPA 3ROKA 3PDWA 1K3TA 4P80A 3O1LA 2HUPA 2ZSIA 1WBJB 4PRLA 3TFQA 3VH2A 1NSYA 4CM4B 4DMUB 3VTAA 4F4JA 1NDQA 1PRYA 5JECA 2BGGA 2Q2QA 2H2HA 3HUTA 4K7JA 2VP3A 1YJNB 1JWAB 1XZGA 2RHTA 4B76A 2P6MA 1F3LA 1JA1A 2HHCA 1UBNA 2DVMA 2XTAA 3OZSA 3OQ6A 3RUHA 2CUTA 4R9NA 3TQCA 3KB1A 1EDEA 4MR8B 1P5JA 2RH4A 4XCXA 3CSDA 3D6AA 4ND5A 2X2PA 5F73A 4DTCA 2B6HA 1NQWA 4BNFA 2F55A 3CCBA 4YNBA 3VSDA 2NXWA 2BONA 4PNHA 5FR2A 2MYUA 3U7IA 1M6EX 4ID9A 3R9IA 3K6RA 4PSDA 1U0OC 3A6KA 4KIUA 3M6MD 2COKA 1JEQA 5L6MB 4CLOA 2TMYA 1GAQA 1E2KA 3KT3A 5JFOA 1N0VC 1XTZA 2Q50A 1FZQA 4HQKA 4UQPA 2AE2A 1SC6A 1QR2A 2FX5A 2CSUA 2PSHA 4DC1A 4EAAA 1ZJ4A 3I92A 4LKOA 5SY6A 1Y7LA 3H04A 3SHVA 5THKA 2NOAA 4PHHA 1EG2A 3ZLTA 4NTZA 1ZR2A 5FWYA 3T7TA 1W6UA 1L7QA 1HQDA 3LX6A 4LMRA 4TS3A 1RWKA 1E2DA 4MWBA 5DK6A 2HOQA 4LE0A 4LHEA 4P8RA 3W5JA 4G9BA 2PH5A 3IKTA 3H0KA 2C9ZA 2GK6A 2RGRA 5DULA 4RIFA 3PJRA 4NS1A 3RF7A 1QRSA 2FN4A 2R1VB 2Z6VA 4W1PA 5EMMA 1V8FA 3T6KA 1YZYA 3O1HB 5K01A 3USZA 1VI6A 3LX4A 3KOWA 1NXWA 4HJXA 8ADHA 5IU6A 3SX2A 1IB6A 1KZ9A 1MW9X 1SOWA 4FIDA 1NVBA 4Q1VA 5DSZA 3U7EB 2VSYA 3UXEA 2PMDA 3SJZA 1ENZA 4PABA 1ZIXA 3GD7A 4IQ0A 4BS9A 1TYAE 3ZGVA 3AIKA 1I7DA 1XWWA 1KZLA 1XFOA 2IDZA 4K46A 1A9ZA 4ZAGA 1PNQA 3WKAA 1XWFA 4CNBA 1H22A 1NY6A 2PH7A 3DXFA 3PD0A 4IRMA 5EERA 4CT5A 1T34A 5GJBA 2BLNA 1KP2A 3TLBA 1RPAA 5I48A 2IPNA 2QUBA 4I1IA 3TLJA 5LZ8A 5IM4F 2RKWA 1CJBA 3J7TA 2JLVA 4WNAA 1MFZA 4TROA 5EZ5A 1AK1A 3TQOA 4C01A 4MI1A 1DX6A 4YP1A 1XZNA 3FOEC 4GBGA 2WIDA 3K7EA 3Q6MA 2PDAA 1V4VA 5ALOA 4I6GA 4NBTA 4R7ZA 2ZT6A 1OZHA 3U6BA 1JH8A 3IAEA 1TJ3A 1RBZA 5DCWA 4I7EA 4WXRA 2PAAA 1E2EA 2W83A 1OX4B 2IQ5A 4X8LA 1QG0A 3MCWA 1CP3A 2RGGA 3IX7A 4RQBA 4Q7LA 4G1CA 2ZVQX 4ZYUA 4RD6A 4U8GA 3T41A 1Z08A 4G36A 4UJ5A 3HXLA 1KBZA 4KX3A 5J3JA 3DDUA 1WHTA 4JI2B 1L7RA 1K9VF 2HNAA 1NJSA 4LTDA 4FFRA 4EJSB 3SK0A 4XPIB 1MC4A 1AK2A 3G82C 1H1TA 5E4TA 4AO8A 1AKEA 2PCLA 4F86A 3KZKA 3OX1A 4K0KB 3KUXA 4EY4A 3IQDB 1SO8A 1C7EA 1IOVA 1E9CA 2WWVD 3UEOA 1CF9A 2J6BA 3RUIA 2LIPA 4UXJA 3WAKA 4EI2A 4H7EA 5DM60 3E8XA 1OY1A 1OWPA 3IEKA 3SKYA 3GI1A 2QD4A 2ATXA 4KYUA 4PLWA 2XUPA 4LPSA 4N5MA 1GWNA 3ZPXA 4ZTBA 3I37X 4Z53A 5E4FA 3WMWA 5DXAA 2KVOA 5BUCA 1XLVA 1Z75A 4NCAA 1XQBA 4MQUA 1KNXA 1WPQA 4ZPXA 2CB9A 4QHYA 1EHYA 1V4BA 3I09A 4DDHA 5LP6F 1OKKD 3W9SA 4ZTUB 1OV4A 4D6XA 5FUQA 3DF9A 4WESB 5FV7A 3CZAA 2A4MA 1ST3A 4L8WB 4NK5A 3ICPA 3RYIA 2R25B 4BAZA 1KQOA 2CZQA 3QKIA 4J0CA 1ODJA 1NQUA 4JYPA 3ROQA 1PJBA 2RBGA 1UDXA 3C70A 1DFGA 5KVSA 3E22B 4HLNA 2IE8A 1VQNB 3E9MA 1C8LA 2PZMA 3FRHA 2WTEA 3MRXA 2OFPA 3ZD6A 4NQRA 3N76A 5B1EA 4J9VA 2WV7A 4AWAA 4NWIA 2GOYA 1CQXA 1EA7A 3R3UA 1A9RA 2HA0A 2GGSA 4KQFA 1PW7A 1E9FA 1F48A 4IKOA 3LSYA 1EDBA 2BE7A 1RYFA 4R3WA 3UTCA 4OFBA 5AVWA 3U4CA 4KOAA 3TZEA 4AWXA 3RSLA 4BNGA 1JMVA 1T36A 2PWBA 2VHEA 3FYDA 4FNAA 1KNQA 3OC6A 1JPNA 2D1YA 3ORYA 4NR0A 4ZQBA 3UWDA 5HVNA 1E9EA 1I0IA 2Y93A 4L5JA 2C5LA 5CUQA 4P25A 3HJNA 3I4CA 4L3VA 1R4NA 1T2VA 3GJQA 3JYOA 1MVOA 3B1XA 3SBDA 3RY8A 1W47A 3JAMA 4K9MA 1E2PA 2J0QA 3IIKA 1JR2A 4EUNA 2A35A 4ISCA 4CPDA 3KIPA 3VQTA 3M5DA 4J6EA 3PUWA 4Q4DA 1EX1A 4QGBA 2GHRA 2H7VA 2I2AA 4AVZA 2HHJA 4J0EA 3W2GA 2P9ZA 2QRUA 4CIAA 4MYSA 4JP8A 1PGQA 4RA9B 5HHTA 1L1QA 3RHFA 2JFUA 1L7PA 3G1UA 1EI9A 2BE9A 3EHDA 3LPAA 1ZWKA 2OQVA 3WJ1A 3HHPA 4BTEA 4CHGA 1RRMA 2VJLA 2QTLA 3OWXA 4HBZA 4UAVA 5BWBA 1GU0A 4OA8A 1JSRA 2NXEA 2RONA 4JXKA 4YO7A 2BMVA 1SJ9A 3DP9A 3LK6A 1LNZA 2I7VA 2PWPA 4MAAA 1ZMOA 5T41A 3HY3A 3CBQA 2F00A 4FN4A 4PLVA 5E9AA 4DNOA 4ZGGA 2N1MA 2TYSB 3EVNA 1KYVA 4TWRA 1ADGA 3PGLA 5FLKA 3OAAA 2J0EA 3BXOA 3MQ4A 2IYQA 3KOUA 2HA5A 4N6OA 1C3XA 2BRUA 3B89A 4HV4A 4M9QA 1MAHA 3K70B 4KKVA 4PY2A 3ZWMA 1J1ZA 5GVSA 1RKQA 4NJEB 1XVUA 3JU4A 3IFSA 3L8YA 4AF8A 4BZZA 3HJHA 5LLTA 2WTBA 3O8LA 4RACA 1OKKA 3TRFA 1W93A 5DNWA 3VM6A 2AK2A 3D54D 1WOMA 1EVYA 2FW0A 4H7KA 4ZQHA 2PNJA 1E2FA 5BT9A 1H4VB 4DEXA 4YMVA 4HFJA 4HWOA 3IT0A 2C8JA 4P7GA 4P58A 4BVFA 4GZMA 3UV7A 4ECEA 2RJNA 4G0QA 2GVNA 2IUSA 3AERA 3LFTA 1TJPB 1PAUA 4FFPA 3UJ8A 2QHXA 3UV3A 3FOFC 1Z8HA 3QEMA 1TW2A 3HB9A 4H16A 3TPFA 5ITVA 3GD5A 2FSVA 1JF8A 5LZ9A 3I01M 1PU2A 1ZMTA 4DUPA 1TQ2A 1LLCA 2XQJA 2KE5A 5AI5A 2DULA 5F77A 1MABB 3WLFA 2QRZA 3F7OA 1EMDA 2X9LA 4AJOA 4H6PA 3E18A 4Q21A 3GT7A 5JD3A 2FN3A 4PXYA 2OCXA 1AB6A 1E7WA 4KG7A 4PAWA 4JJIA 1G6HA 4HDKB 1G0OA 4ZOAA 1FFYA 5EJ5A 4JUBA 4LG1A 3KHTA 3COYA 2R2GA 1BS2A 3NVDA 5THXA 4DEVA 3LBFA 4PZZA 1V39A 2A6PA 3HBNA 3HO6A 3PQ4A 4FHZA 5BP7A 1H4QA 1ORHA 1ORRA 1U4NA 1T0JB 2XKJE 3CONA 4UATA 3RGWS 5JFTA 1P9LA 4X93A 3U37A 1OPXA 2XUZA 3WGNA 2C07A 1LRKA 1L5OA 2GCIA 3B6MA 3BXHA 4QXOA 4TYPA 4U1RA 5EZQA 1C0KA 2DEUA 2GLXA 2ZUDA 2MOKA 3G68A 3KZ1E 1EXWA 3R77A 4X6UA 1EX6A 4JZYA 5EIBC 4P54A 5LQJA 2OBRA 2R9VA 4G5QA 2ZK7A 3IV6A 3L8HA 1UMCA 4OMCA 4XX0B 2ES4A 2W2NA 1HNXB 5DXFA 1JHYA 2RI0A 5AICA 3C3KA 2WWFA 4OHPA 1EKXA 3OCCA 3HVUA 4JVOA 1LDMA 1X42A 1X86B 5ECDA 1NOJA 4BMDA 2GEKA 4X61A 1O95C 1VP3A 2R7AA 4TUYB 1W25A 3PKIA 1MO6A 4HSEA 3GCGA 3L02A 1TT5B 4MB2A 5TNXA 3FGZA 3BCHA 3SSMA 2BFNA 3WC4A 5DP2A 3W5SA 4Y1FA 1VSTA 1SOAA 2VYFA 3EDOA 3RJZA 3AMVA 3TIIA 3MM4A 4YASA 1R5BA 3CLTC 1TI7A 1UM9B 4IF6A 3FNGA 5DPMA 2ZAOA 3DLAA 4MUYA 4QDKA 3ABRB 4XASA 1P74A 2BMDA 3F9IA 3KL9A 3C1TA 2P2YA 3IAM1 4TN1A 2QQ5A 3NWEA 1NUUA 4K6KA 1UD4A 2H4ZA 3I5MA 4KE6A 4QECA 1G9TA 1MAWA 1TA4A 1QTIA 2PGOA 1ZJYA 1Q0SA 3FUVA 3HL0A 4OHCA 5DASA 2ZZMA 1L8QA 1RHRA 3SSAA 3PEEA 3GK3A 4KR2A 1CY4A 5H80A 4TXLA 2FSSA 1RAGA 4EA6A 1UXOA 1SD2A 3JR7A 1DRWA 3HB0A 3O4RA 4G5RA 3OE5A 3NQ41 4R68A 4HBGA 1D6JA 4D8UA 1PWZA 3GNLA 2PMWB 3NIWA 4DGSA 2DPXA 4WT7A 4DCSA 4WJZA 5JS6A 4R9VA 4HVCA 1AH2A 1Q16A 2W8ZA 5C8YB 2RJ3A 4KXNA 4BJ6A 4YHHB 1IWPB 4CDMA 5IK2A 2Q4BA 3WMGA 4FKMA 2GKGA 3RVLA 5J47A 5COBA 2CCGA 2BFCB 1T9AA 2ECFA 1KYIA 2FWRA 3ONDA 2RHGB 1P9NA 4LF6B 2XQVA 2ZQZA 4BZPA 1XKTA 5JW6A 1DHRA 3N53A 4YJHB 3QPUA 4PWYA 3THSA 5CCXA 2QE7D 2PO5A 3KJQA 4P3KA 3DVAB 1NC3A 2V98A 2X1VA 1EFUA 3F97A 5HUQA 1PNRA 2IYRA 1E3QA 2OXEA 2JLYA 5AI8A 2FEAA 2MTBA 3UJ7A 4CM8B 3AM5A 3M49A 3H86A 2QTNA 1V95A 2C7PA 1KU0A 3IDFA 1J2EA 3KQTA 4J4TA 4TX1A 2YIDA 1SWVA 3H9QA 1XFAA 3L8DA 1PZFA 3P9YA 2XSZD 3LOPA 3GVJA 1AGPA 2Y4NA 4R9RA 1AKRA 4TSRA 3M1AA 3G4SB 3FROA 4AJIA 1J97A 1YB2A 3OPYI 4OFXA 4A0GA 4JMPA 1T15A 5T3YA 4CMEA 3E4CA 1HURA 2PQMA 4RF5A 2BHRA 1V6SA 5E7IA 1PYDA 3I1JA 3NDIA 3D6UA 3G2LA 1Z45A 3ZE6A 3UHFA 2OV6A 5IZCA 1I2ZA 4C30A 4UHHA 1N9ZA 1GR0A 3LBAA 3OCXA 1B00A 1TKCA 1N6NA 4B17A 3OZFA 2J0VA 3DR5A 4IS2A 4ZJUA 1MB2A 1YJWB 4AP5A 3PRKE 3REFA 4YMSA 3VDNB 1M2OB 4B7UA 4YUYA 2CYAA 3CMEB 5TS3A 1KDVA 4CG0A 1ECCA 2WOOA 4EELA 1MT0A 2ZRNA 3VPHA 4HE5A 2HA4A 4I1RA 2AC4A 5EE9A 3E5RA 4OJNA 3FTCA 2AC7A 4FNGA 4UTVA 5LD2B 2NPIA 3NXKA 1UF9A 3GLSA 3LBYA 4GRIA 3B51X 1D09A 2O2DA 3C14C 3U6KA 4H0FA 4JT2A 5EOVA 2F59A 2VDMB 3FMFA 4Z9BA 3T9BA 1GTSA 4RO0A 2XMQA 3LZCA 3NP9A 4MW9A 4BWVA 3W9UA 5B4VA 1QB7A 1JKIA 5EMNA 3G3EA 4QXMA 3LXXA 2ZCUA 1H42A 1S96A 3VTFA 3BBLA 1RP1A 3O4JA 2Y9MB 5FO0A 1D0IA 1IIRA 2BFDA 2VDVE 1JIKA 4LDRA 1RYBA 1QONA 1ADCA 4TS9A 5IWCA 1OYYA 3G0DA 2KPOA 5TV2A 3SQOA 3ICQB 2VAXA 3CNHA 4FEEA 3H2JA 1CUGA 2W7TA 1FSGA 1PJRA 4IV0A 4P1ZA 4PZEA 4BRSA 5JNVA 1CZUA 4EYEA 2JVJA 4A73A 2PMKA 1CQJA 3KLOA 1TEVA 5DI3A 3L6DA 2B8TA 3LCMA 4GR5A 3K0HA 1RJGA 3KJGA 1ODLA 2QAGC 3G85A 2XECA 3H16A 3HDQA 1JFFA 3OQ1A 3UJPA 3VYWA 3UBTA 2SKDA 4OAPA 4MW7A 4RIEA 2NV4A 3HRIA 5LM3A 5EHIA 1VCNA 1HT2E 3OF3A 3P20A 3PDCA 2IY8A 3H0EA 1C81A 4FUQA 2Z8XA 4CDRA 2QE7A 2XTZA 3LG2A 4MQBA 3QBJA 2NO7A 2XDQB 1N36B 2SECE 1F8FA 3AUJB 3OUZA 1UXHA 4IFEA 4Y7CA 3SOZA 3AUTA 2J3JA 3O4IA 4OBXA 4MIEA 4OOFA 4GEKA 1GRQA 5EHGA 2YZNA 5EUMA 3OE7A 3RUPA 1FU4A 2EGUA 1O96B 4TWAA 5ICFA 4PX3A 1DDIA 1KYXA 3KXDA 3VU9A 3KHUA 4BNKA 1JXMA 1MOZA 1Y1KE 1Q0HA 1QIMA 1JR3A 2GZMA 2WDPA 4FEAA 1T3GA 5ALKA 1B7GO 4UOQA 4R8SA 4C3VA 3EXHA 1AKWA 4CLDA 5KPJA 3R8CA 2J33A 4OOEA 2AXEA 3IQEA 5AW3A 4RK6A 2FDRA 1U7DA 1UM8A 3GLFE 1HZZA 1PVDA 2ZPTX 1IY0A 3L7NA 2D1TA 1LNQA 4FC6A 4YAJA 5F4JA 2FCAA 4DBZA 4JQCA 1ECGA 1P44A 3UK1A 5L3SA 5CVTA 4US1R 2A2ZA 2HDWA 5BXYA 3H3JA 3MSXA 1LPPA 1P2DA 1R1DA 3A36A 3A9CA 3FH0A 4OGFA 4DLNA 4ZZ0A 5K03A 5ENVA 1B8NA 2XZLA 5A6SB 1Q1NA 3PYLA 4BMXA 3E81A 2HBZA 1I2AA 3RCBA 3VPCA 5IVPA 3U09A 1J1IA 2PFKA 3V8QA 2A59A 2Q3EA 2Z08A 1VE9A 4KI0A 1IVSA 4W8GA 2RGWA 3PS9A 2OFFA 4R3NA 3RU9A 3AR2A 4JJEA 2JI4A 4CM5A 2PS3A 2W37A 3DQQA 4H0CA 4URVR 4DDVA 3PKJA 2ZR8A 5KTSA 4MQFA 5IUKC 2X13A 4B8ZA 1FLDA 3L0BA 3SC2A 5L4NA 1A82A 4X44A 5J1TB 2LDBA 1ZSNA 3BWDD 4QM7A 4EHJA 4JYZA 1JH9A 1RR6A 3FIUA 3RT7A 2OV3A 1BYIA 3DL7A 2WZPP 4TUYF 2WWHA 5T8KC 1UBUS 2H31A 2OV2A 3T1TA 4AW9A 2C4VA 2RH5A 3E27A 1TKAA 1PTJA 4JVNA 1GPDG 1LA2A 3OPVA 3ABOB 4O2AB 4QYTA 2IL1A 3IAHA 1NDHA 1TJ4A 1XALA 2QM8A 1RTKA 1CZOA 3SZLA 3VNQA 2PZJA 4EY7A 1F20A 2CFRA 2IPAB 1NQXA 2X8JA 3GC6A 4NQZA 3EODA 1X1DA 4F92B 2Z6BD 1CSEE 6ADHA 2HYIC 1GTZA 3A3OA 1XKXA 4L8YA 1E1CB 4HUJA 3ELBA 5KHLB 2QY6A 1LSJA 2EJWA 1CVIA 3AV3A 1M0TA 1LI4A 2XF2A 3PGMA 4HLCA 2P3SA 3OPOA 1KZYC 4R2IA 5DWDA 3SP1A 1WO8A 4G0OA 3ZTYA 4ZOQI 1QFZA 3ECSA 4CEIA 4EZEA 2F8TA 1MZVA 1Z4PX 2PA3A 4GYJA 3E9RA 1XTPA 2AEMA 3I12A 3MJTA 3NETA 4HLUA 1S9HA 4PG7A 4DZRA 4JQZA 4ZICA 4KREA 2PIDA 1R0ZA 1DFIA 4KQCA 3WIBA 3U17A 2VOEA 1BLIA 4L3WA 4OKIA 3DUFB 4Q0MA 4OA5A 4RLSA 2BKEA 3KJZA 4QT0A 1T35A 4EHKA 3HG7A 2G67A 3V1LA 2QIPA 4ITUA 6REQA 1CFJA 2JFXA 5C8YF 1M2WA 2NZWA 3NBZC 1WF6A 5CYPA 3UMSA 1E3JA 2ZSHA 2QSYA 4GSLA 3FCAA 5H9WA 3PWZA 2UXCB 4KIGA 4FX2A 4WRRA 1OT3A 2AMLA 3EC1A 3OIDA 4BUZA 4Q4HB 4I9HA 3WGOA 1E77A 2GEJA 4P9NA 1HFKA 2EP8A 3S2IA 2WVGA 4BLRA 5A0VA 4KDFA 3NALA 1FNMA 1FP7A 2E1PA 1X1CA 4KLCA 4LWZA 4DG5A 3EEQA 3CYFA 2D0IA 4YREA 3QTLA 3ENNA 1BJTA 1R0YA 3HL4A 1YJ5A 4CM6A 3NORA 1YBMA 1Z8FA 2F8LA 3ZIUA 3SVZA 1I18A 4BVGA 2CXUA 2QRVB 5DFAA 1JWLA 1MN6A 4BDSA 1H4TA 2FEWB 2BTQB 4Q16A 5KU7A 1W7AA 1TRKA 3S28A 5KWJA 4A23A 4Q7JB 4IH1A 2QN1A 3BB1A 3W6NA 2H57A 5FFNA 5LB2A 4D9BA 2VHYA 1Y6JA 4HXEB 1HDGO 5JRJA 1UPTA 5HCNA 5K0EA 2XXAB 3C7DB 1MB9A 2PX0A 3AVOA 3C8HA 1IVYA 3PDUA 3WGLA 2CJWB 5CIQA 4CT4B 4D0RA 2ZW9A 4J0IA 3PU6A 2WHPB 4AX4A 4E46A 1VLYA 4RYLA 5BV8A 5C8DA 5IUJC 3L7AA 5DM0A 1C1DB 3RS8A 1BGVA 4RPKA 2DG2A 2KQUA 5C32A 4A6DA 1RNLA 1ZN9A 4UTZA 1XLUA 3TE7A 3PXXA 5CB8A 5EXEA 1PK7A 1R0XA 2EKZA 3DO6A 5E0OA 4L5IA 3OLYA 4DMRA 1VG0B 1EQAA 1PF7E 5IF3A 1NN0A 4NU8X 3WKDA 4FD3A 4D0LB 2OM6A 3TL3A 1PR9A 4X3OA 1B0ZA 3DTVA 3I0ZA 2VHZA 4G24A 5GOTA 4FW9A 1HE8B 2QSJA 4CWAA 2F9LA 3B7WA 4DR7B 1CB7A 2R8PA 3C3AA 3MTDA 2EFGA 1QHHB 3GT3A 5TPZD 1FDUA 1SU8A 1Z4IA 4KCGA 4S12A 4G65A 5AI0A 4EM6A 1U8TA 2DX7A 3QJ5A 1S7GA 4RGVA 4BO8A 1XPUA 1QKJA 4A6PA 4RY2A 2J5BA 4ZYLA 3UK2A 4YP9A 1B14A 4A5SA 1TU0A 4WXYB 3R7SA 4G0PA 3OQIA 2BCEA 3S2GA 2GXQA 2QYTA 1PTKA 1Q11A 2G40A 2GPNA 3UH0A 1JS1X 1Z0SA 3KYCA 4LZOA 5BQXA 2PFGA 4RV4A 3M1YA 4KIFA 5HS6A 3WG9A 3Q4GA 2DQSA 4KE9A 1JAHA 3OJOA 5ALIA 3TW8A 3EYAA 3VSEA 4CKBA 1WHSB 5CTAA 4RXMA 5JXIA 3EEOA 2CF4A 1N77A 4WN9B 4UDOA 1H2ZA 3QVXA 3D7RA 1XZLA 4ZHQF 3K9FC 2IOFK 5A4AA 2EW1A 1BE1A 9LDBA 3CCUB 2D4AA 4LJSA 4DV6B 4ZI7B 1T5TA 4O1HA 3PQ8A 1VIMA 1JBQA 3ENWA 1PKEA 4YQEA 2FTKE 3GL9A 1YF3A 4AJEA 1U3VA 4EA9A 1ELOA 4DLVA 2O1SA 2QN9A 3UHOA 4D9CA 4Z54A 1U94A 1Z37A 5SICE 2F1RA 2PS1A 2V7BA 2VBCA 3C1OA 4ZO4A 5TT1A 4NH0A 2YWJA 5K0NA 4HAZA 1G59A 4GKVA 4R7TA 3K2IA 2Q21A 3EOAI 4HB4A 1KXJA 4ZO8A 4KP7A 3GLIA 4ZV7A 2ZKIA 2O7RA 3DBLA 5TMPA 4MO9A 3JV7A 2GBGA 4DLLA 2GESA 5CX1A 5T4BA 2HMWA 1LTQA 1C7QA 2B94A 4RBNA 3UMVA 3AHIA 3T4PA 1RAIA 2Q7DA 3WGKA 1D04A 3IE1A 2ZE7A 2NG1A 2R8BA 5IULC 2JCXA 5K0TA 4IYRA 1H0RA 1Z16A 3AB8A 3SX0A 3NR2A 4Q7QA 1NWCA 2OORA 1A50B 2OVFA 4X3PA 4FFBA 3WLJA 3HS3A 4BEBA 2R62A 4MSUA 4WFJA 1PQPA 3KTAB 4LV6A 1SUIA 4F3TA 1GGMA 3WMXA 1YZQA 1XJ5A 3KEOA 4W4TA 1ORTA 3BMCA 2Y77A 1DKUA 1RAEA 3MCTA 3NANA 1NUQA 2PRYA 2BFOA 4XI9A 5EIHA 2W6IA 3LP6A 2GZDA 1TZMA 5SYAA 4C7BA 4B3HA 1EDOA 3DL2A 4AI6A 4MGIR 2V45A 4LYFA 4M8SA 1E92A 4YJ2B 1UXGA 2YOGA 2PPVA 2WUGA 3KAKA 5HG0A 3AUAA 5A4DA 5TMBA 1IN8A 2B4YA 3WDKA 4LBWA 3INGA 2TSYB 3O94A 4HDAA 2UUOA 4OUDB 4WOBA 4E3WA 2E4VA 1KEUA 1B8PA 3FYUA 4QOJA 3MWDB 5DTQA 3FIJA 2NZ2A 2P0AA 3DDOA 3TSZA 4IH9A 5D3ZA 5AKLA 4RZ2A 1FS6A 1WDTA 1O54A 5E9JA 3GFPA 2X40A 1IH8A 1LBEA 2PRKA 3DZIA 4MV6A 4O2AF 3SHOA 1HVXA 2XD9A 3UOWA 1C7FA 2ATEA 4H1UA 1QZZA 4NAVA 1WUKS 2OC4A 3FFAA 4DA6A 5AMXA 4XAQA 2IK8A 2VNJA 4FMBB 1CQWA 1X6VA 3K0CA 2OK8A 2J31A 1V7ZA 2B7BA 1AN0A 1IQPA 1TKRA 2X6TA 3LI2A 4IVPA 3O8CA 2ZYUX 1ST2A 3K6KA 3O8OA 3SYRA 4AZ3B 4HE6A 1Z13A 1E7YA 2WG0A 1UT8A 4U2FA 5LC1A 3TI9A 2FLVA 4FGKA 4JJFA 3VAYA 5BSGA 3CINA 4PPNA 3A8TA 1ZO8A 1D4FA 1Z35A 1G8KA 2R65A 4RF3A 4NYIQ 3OQPA 4INAA 4A2CA 3BYZA 3A2NA 1WSBA 1WUYA 5JJLA 4UBLA 2Q5FA 1CG6A 5C8VA 4JBGA 1MKYA 4TM7A 5EWJA 3RT9A 3CURA 5JXGA 1QJCA 3JVIA 2TECE 4LE1A 4Y0AA 1GLGA 3GU3A 5DZSA 3CUYA 5IS2A 1TD1A 4YJKA 1EESA 2WSBA 3QJYA 1OLSA 5KNCH 1EVLA 2VKQA 1UBEA 1GA6A 1ULHA 3C8ZA 5JBNA 3ESZA 4LJAA 1FP6A 3BERA 1PZHA 5D87A 3JQ7A 4J03A 5TPWB 3PDIB 4D8YA 4F84A 2CDNA 4CL2A 2FJ0A 4KLRA 3QTBA 3P9SA 3UPTA 2XMPA 3A9VA 2AG8A 3S70A 3LCUA 3T4UA 4URXR 4MHTA 4C0QC 4BUJA 2P3MA 1PZEA 4TKUB 4J0QA 5DTRA 3CLVA 4UU7A 3FCSB 1NMZA 3VMMA 3ROMA 5KJ6A 4HIZA 2NYAA 4J2HA 4UTOA 4BNIA 5CFOA 1L4BA 3O73A 1KPHA 3PT9A 5AKJA 3ZLBA 1GUAA 4CQNA 3IVMA 2FE1A 4EPTA 4PANA 4JLUA 3TLXA 5A4KA 3QFTA 4QVKA 3C7KA 1C1HA 1VSUA 2W6JD 3HC7A 4KXFB 1YB6A 3H4MA 3VKVA 3AF0A 1GPMA 1U2SA 4H1VA 1Y7PA 1I51A 2ZT5A 1PQWA 1V0FA 5LZ4A 1Y3BE 1OUMA 4XRGA 2PE5A 2CHFA 3IEIA 1ZGBA 3E82A 4XDHA 2VPTA 4P33A 3IV9A 3UUGA 3SDSA 3AKCA 3DEJA 4BASA 3QUTA 1GKUB 3H7IA 3ANTA 4LSGA 3D3WB 4G4GA 1DKRA 3SNHA 3QVVA 1A5ZA 4ENRA 3DYBA 3W5VA 1CZNA 1SA0A 3TLYA 1RI3A 2HRRA 5L46A 2VHTA 1N57A 4K5QA 3ZPNA 1UJNA 3FF1A 1DTWB 3Q0EA 3VR0A 1CT9A 3RRFA 4B9EA 4V1CB 4EGCB 1FFXA 1IK4A 3I5YA 2CGEA 3UAWA 1XUOA 1TQ4A 4JJ7A 4MVJF 2GTPA 1WSRA 4AZTA 2IYOA 4Q37A 5FNVA 4E31A 3W2TA 3N8DA 1L6RA 3WJ2A 3M3DA 1GAWA 1UIMA 2EWVA 2Q8QA 2ZLBA 3BVPA 2UZ4A 4IJVA 2FB9A 3PKZA 4ROTA 4KWIA 4MRVA 4ND7A 1VOTA 1NBEA 2AN9A 2G5CA 2GN8A 1WMDA 2YWRA 3GJ0A 5EXXA 1TF2A 4JWKA 1O6ZA 1CUSA 4MWCA 2QRNA 4L4SA 5TJ9A 3SSOA 2WWXA 3H18A 4V0RA 5DBOA 2C3YA 3T9EA 1W6RA 1U65A 2ZJ6A 5JD4A 2FX2A 1CY7A 2PZEA 3UJBA 4GIBA 2EQBA 1Z73A 1E7MA 4JOCA 3GLHA 2IOFA 3G7SA 2X0DA 3R7LA 3WYFA 4ENPA 4G81A 3VMFA 2QR3A 3UCFA 2I6FA 4L75A 2QGFA 3CN7A 5FTKA 4Y2GA 4YR9A 4FDUA 2OAGA 1VZ3A 1XA0A 5EZ6B 2JFWA 3DLCA 4H7DA 3IVRA 5HOQA 3DYVA 2XUKA 4B0PA 4DR3B 2H0QA 3FKSA 2FQYA 1B16A 5JYCA 5KUTA 3Q8KA 2FFRA 3EZYA 3ASVA 2WFMA 5JNLA 4OI0A 1HE3A 1XLTA 2BJVA 3WGQA 2QJFA 4ZI7F 5IG2A 2BH2A 3BWXA 4MGEA 1EHIA 3CZPA 4HI0E 1OIVA 1GNTA 2P6RA 3ZZTA 2VJQA 1G63A 5BRJA 3VJKA 3KELA 1WXQA 2C0QA 1PGPA 3LUCA 4OGKA 3HWSA 4OQ4A 3UW3A 1F3OA 1W96A 2HO5A 2I29A 2JAHA 4IMIB 4O2BA 2H08A 3FMPB 4L9WA 3JZAA 3SLRA 4OGGA 4FXOA 1EJ6A 2H4XA 1MXFA 4TVBA 4D3YA 3ADBA 3U7HB 2J7PD 2IW1A 3MRSA 3NGXA 3A4YA 1P29A 3F6CA 3IV7A 2OGTA 1GGHA 2IZOA 4I2NA 4KKUA 1V1RB 3I4LA 3L4SO 1O0BA 4V0QA 4MV3A 4B1FA 3GJ8A 2XB8A 5KYNA 3CIOA 3AHGA 1O97D 1RC0A 2GCOA 1NFQA 1P61B 3NP7A 3OQHA 4KB5A 3ZJ4A 4DIEA 3IP8A 4BGEA 5J4LA 2YXPX 4JUCA 5BWOA 1F14A 1G7RA 4RGQA 1HL3A 4IQFA 5LVAA 1DIAA 1J99A 1E2NA 1E3WB 3DMRA 3ZH2A 3HXQA 1XPJA 1UKAA 2HLNA 4CTNA 2PQ6A 3F3SA 4EEZA 5EWMA 1ZN8A 3PI6A 3V8NA 2WSMA 3STTA 4OP7A 1TUGA 4Y0NA 1DGQA 1PFUA 4P2BA 1RHJA 4MI6A 2MINA 3BGOS 8OHMA 2WAYA 3SXUB 4FR0A 1Y8RB 2DMRA 2O5VA 1YKGA 2PIAA 2R7KA 3N3BC 4YJ2F 5JEDA 5HRUA 2C58A 3VSAA 1UK8A 5LZ7A 5JSQA 3O91A 4DLPA 1E3EA 1ZMXA 4FHDA 1KK1A 1CDDA 2RGCA 3VZCA 3B3QA 1Y63A 5IWAB 2B61A 2WVJA 3LYHA 1L5ZA 3WK4A 2WE7A 2DBRA 4NBWA 1XQVA 4TWIA 1UJ2A 1ZEJA 3EH1A 2MMCA 1RYMA 4L0CA 1TEZA 5IFLA 4UASA 3RODA 4EY6A 2O2SA 3JATB 4I1VA 2OCIA 3AZOA 3RTCA 4N12A 1E98A 1KVRA 1NUPA 2F3QA 1Q95A 1AHPA 5DRYA 4ZN6A 9MHTA 3ROEA 1K4KA 2HCFA 4WSOA 4DCTA 1IIBA 5IVDA 1XHFA 4XB1A 1VE5A 3HZHA 3I4FA 1HZJA 3RT1A 4JJZA 2YZMA 3DNMA 2PD4A 4QTUB 3PE4A 3AY0A 2GO1A 4X65B 5ITZB 2FPSA 2IZZA 4QQ8A 1ACLA 2LUOA 5IFKA 3LWDA 2JAQA 4IYJA 3AUSA 4JV5B 3V8BA 1NJFA 1CUFA 1GGJA 2W2OA 1LPMA 3OU2A 3OQNA 4Z5XA 1LQ2A 3OSUA 4GL4A 5AM5A 3RVNA 4U9HS 3VZDA 1RC1A 5FWNA 3KL4A 1PSWA 4GZ3A 3BJIC 1T8YA 2E6UX 1A9XA 3AH8A 2XYRA 3K0AA 3TQTA 5IKPA 2XBMA 3EDMA 2YFYA 1XP8A 2ZJ3A 1CZRA 2J7PA 1AXEA 3TPZA 2V8BA 2JFOA 3GVKA 3QLUC 2V6FA 1Q7EA 1H2WA 1EB8A 2VBGA 4BBJA 5KSZA 2OKGA 3P9RA 4RFSA 1VLJA 2M1XA 2VLIA 1FDVA 3UV6A 4DSTA 2GA8A 2I9KA 1E0DA 4U7JA 1Q14A 4FNOA 2A7XA 2IITA 5ADUS 4KMOA 4Q12A 1YDMA 5CVUA 5TIIA 2AZXA 5C7YA 4GUDA 3CPSA 4KAXA 4KPEC 2VXBA 3R0XA 3VO1A 4X97A 2OC9A 3D7SA 3UIEA 2ZJ8A 3BFPA 2NAPA 3EZNA 1ZJJA 5ALXA 1HEYA 1QXSA 2B4AA 4NLLA 1Z2NX 2FLWA 4GMXA 1NE2A 2AG1A 4GI7A 1FX1A 4KO8A 4D82A 4I8IA 4HAVA 5LP1A 3RSOA 3R7NA 3X44A 5J58A 4TKMA 4WVLA 1J2TA 2AV6A 3AEYA 4PG6A 3EGVA 4Q3CA 4YRTA 1PD0A 5C53B 4OB6A 3E2IA 5HZKA 4H9GA 2PX2A 3BOSA 4URFA 1U4SA 4W9MC 2BGJA 2YMMA 3THYA 1XAHA 4YX9A 2I99A 2WD9A 3U3JA 1DEXA 4Z1MD 1QH1B 2ZPAA 3ADDA 2PR7A 4IS3A 4X1KB 3ZD7A 2AJTA 1P5FA 2ZULA 2XYGA 3E05A 4L4YA 1TRHA 1AUVA 1Z34A 2NO1A 4UTXA 5BWLA 1F2UA 3A1PA 2YV1A 5DLQC 2PM8A 2ZYDA 4K8RB 3C39A 1UMBB 4NRDA 5JYBA 1V11B 1FL9A 3QVOA 2DFKB 3CPJB 2P11A 3ZHOA 5AM0A 1TVMA 2IS1A 2MT9A 3NYWA 3S55A 1JWBB 3ZU2A 5KJ1A 2PD3A 1IAVA 2AFHB 1T2UA 1U9ZA 3ENKA 1WTAA 3P2OA 1BTOA 3UMYA 4Y9RA 3E58A 3G5UA 4N54A 3SM3A 4B9AA 1M1NA 2WZCA 5B5SA 3AKEA 3LU1A 4ALIA 3VUFA 4HB3A 6PFKA 1WXHA 4UBMA 4UZUA 4BO1A 4QT4A 1H9CA 2BKAA 2OXIA 4K6GA 1MG0A 4RHYA 2R47A