2PLFA

The structure of aif2gamma subunit from the archaeon sulfolobus solfataricus in the nucleotide-free form.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title New Insights into the Interactions of the Translation Initiation Factor 2 from Archaea with Guanine Nucleotides and Initiator tRNA.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 87
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plfA01
2GESA 1DG1G 1WRBA 3WY9A 2BN4A 1G7SA 2HDNB 4WXRA 3MWYW 4DDWA 1E2PA 5HCNA 3CF0A 4B32A 5H70A 2QT1A 3KJHA 2OFXA 4RZ2A 1P72A 4EDHA 1G18A 3SE0A 3U3OA 2H8KA 1Z6TA 4KFSA 1J7KA 1SXJB 4D4MA 5C4MA 2WAXA 4ZCIA 4B4DA 1AKYA 2R6CA 3UWOA 3N70A 2VLIA 2BV3A 1OXSC 2H7VA 3EZ7A 2DETA 3KJGA 3PEYA 2GJKA 1H8HD 3CCVB 2GEUA 3OF5A 2FSHA 3B78A 3N2IA 3WHKA 3BAFA 4C0BA 5L8VA 2ZRJA 4XJXA 3M0EA 4R7ZA 5DI9A 1II9A 3SBEA 2OE2A 1Q82D 1UEJA 4CVNA 1AQUA 2GAAA 2ORVA 1RFLA 2EU8A 2J59A 3BE4A 1DOAA 1II8B 4V0NA 1NVVR 3OIUA 1ZM4A 4FI3C 4TTQA 3T1TA 1S1CA 4DUGD 2NIPA 2C99A 4RJLA 1GKYA 5JSZA 4H1UA 3JZAA 2GF9A 5H8WA 5AUQA 2CBZA 4DSUA 5JJKA 1KSFX 1XNJA 3B9PA 4US2R 1DADA 3MWJA 2KWIA 2HT6A 2PCJA 4LV5B 2J0UA 2FJUA 3M6AA 2QP3A 1FL9A 1W35A 4TL8A 2UZ3A 1UMKA 3PR1A 4LBWA 2JLSA 3B7GA 4GNKA 3LBIA 1ZC3A 4OQXA 3LQRA 4HYYA 3W6OA 3SR0A 3IPXA 3UATA 621PA 4PO9A 1CQXA 2WIAA 4YMWA 1OYYA 2Q3MA 1E0JA 1OXUA 3BK7A 1Z3IX 4GT1A 2J7PD 3GD7A 3DO6A 4MKFA 4EPYA 4E22A 3KJIA 2ZYUX 1GL7A 4M8NE 1DDIA 1VG8A 1Z2AA 2BDTA 2RB4A 3EAQA 2JLWA 2O8DB 2VHQA 1R0XA 1HEIA 3VX4A 2ZRNA 2QQEA 4Y7CA 2YJTD 4AG6A 3WNBA 2AXPA 2WWHA 4CRWB 1UDWA 2ZI7A 3IBGA 3JQQA 4Y9RA 5CDFA 2IHYA 4LBYA 4HZIA 3K70B 1BMFD 1FQJA 1G64A 1GRNA 3LA6A 4JMPA 1P75A 4MYUA 3ZYCA 3B13B 3QG5A 4IVPA 2ODBA 1VQ7B 3UG7A 1GFIA 2X2EA 4Q9HA 4EKDA 1N0WA 5D3MB 3EC2A 4WQMA 1LF5A 4P33A 3C41J 4NTZA 4AKGA 4IDHA 5KDDA 3ZVMA 1SXJA 1W4BA 2OT3B 3FVQA 1SVIA 3CUEF 1EESA 4M9ZA 2AFHE 1SXJC 2J3EA 5J4HA 1WF3A 4NCHA 1YZUA 3ZQ6A 4B34A 5C2JB 2WZQA 1G1MA 1JQLB 2JDIA 1NG1A 3VNUA 2WWXA 1JJ7A 1II8A 1JR3D 1ZM9A 4P0TA 4UNQA 4ACBA 1NMZA 2CK3D 4OYHA 1W0JD 2O8CB 4O2LA 1SVKA 4DLSA 3TIFA 1ZJ6A 3RRZA 3LO5A 4GBMA 5KNCA 2OUKA 1DPFA 3NBXX 1GZSA 1VG1A 2OCPA 2RCNA 1GAQA 2ORIA 1NP6A 1W5SA 4HLDA 5GJWC 2DR3A 3H4MA 4C0LA 1OHHA 2GVZC 2JJ1D 4PQFA 4GOJA 2ATXA 1E9SA 3KZ1E 4KFTA 3DM5A 2GAOA 4M2LA 3FE2A 1HYQA 2GF0A 4NZYA 3EPJA 2HYIC 2AL7A 1RVDA 1OV4A 4O3MA 3ZD6A 2ZI5A 3AUYA 4DJTA 3RS3A 3IO5A 2HF8A 1E9DA 5FPSA 2J46A 5JJLA 2ZI3A 1YR6A 2C96A 2ZJ2A 4KBGA 2CL0X 3W5UA 2CE2X 2WOJA 3GLHA 4J0QA 4KYIB 1EWYA 1T91A 3WMEA 1G3RA 3IIKA 4PXAA 4E07A 2PZGA 3CX6A 1YJNB 1QX4A 1KO5A 3C8UA 2A78A 2YOHA 3X1DA 2PX3A 3SU8A 3I92A 1FQKA 1A2KC 1XBTA 2WMNB 4KVGA 4Z1MA 2GVDC 3CPHA 4UNSA 1IN6A 4BE7B 3X1YA 1L4YA 2OFWA 2W6IA 4OJKA 4HE5A 1TEVA 3AF2A 1KGDA 3BBPA 1KO4A 1W49A 5G3YA 3O8CA 2JLQA 1KI6B 2G0TA 4D4LA 4AURA 5AUNB 3BFVA 3CPJB 2VNHA 1US8A 1G8FA 5FI0B 4B6EA 1NRJB 1KJWA 1ZW6A 2YVUA 1CXZA 4OK5A 3CR7A 5EXXA 4JYBA 1U8ZA 5GJBA 4A4DA 4HLQB 3LXRA 4BFYA 5AUPB 3RANA 4DLXA 2WICA 2V8OA 3SYNA 2ZS9A 3ECCA 2GZAA 1E4YA 3GLGA 1N0VC 3LLMA 1YKSA 1XJCA 4Q48A 1GILA 4EIWA 2D62A 4AI6A 5CM9C 5LD2C 2CL6X 4NCNA 1HUQA 3EPKA 3RYTC 4ZCLA 1F2TB 4D25A 2IUTA 4A0GA 3DVLA 2WJVA 1LF0A 2ANCA 2BSAA 3K0FB 4TT3D 3JVVA 1HT1E 1K6MA 4KSBA 3V00A 2FSGA 2V4ZA 4LJ7A 1T0HB 4A2QA 2CLSA 2O8CA 1ZRHA 2O0HA 2GEVA 5KSWB 4IDPA 1W36B 4WZBE 3V4FA 1GNPA 2QMHA 3A4NA 4KFRA 4RD2A 4LC1A 3ZBTA 1LS1A 4Z8XA 3V4RA 2OAQ1 1OB5A 2H92A 4R9UC 1VCMA 3QKRB 3W2FA 4MQBA 1GNRA 4GZMA 4RD0A 2GXUA 3AP1A 5G40A 5SZHB 4TQUS 3Q8XB 4TL7A 4Q4LA 1KAGA 3TSWA 2BWJA 3MMPA 2ZUCA 3E1SA 1NI3A 1Q12A 1VG9B 1Z28A 4Q1FA 1W7AA 2QTFA 3QF4B 2CRVA 4Y0AA 1OB2A 4GFDA 1Q1ZA 1JA1A 5LB2A 1E63A 2D2EA 5FOUA 1P9WA 4JT2A 1A1VA 1MABB 4D0NA 5AJXA 1E69A 3QFRA 4P4TA 4Z51A 2BM1A 1XCGB 3KKMA 721PA 1FTSA 2I4IA 5FR1A 4PC3A 1AMOA 2V3CC 1NF3A 1GTVA 2O0JA 1SKYB 4ZGQB 1R8SA 1N6PA 2O52A 3C7KA 3KB2A 1S0UA 1IY0A 4L4UA 4W5WA 2C78A 4OI4A 4OJQA 4F4CA 1XEFA 5EP2A 1Z29A 3WNCA 1AGPA 3F3YA 2WJJA 2YINC 2XXAA 4Q9JA 5KU1A 2ONKA 3W2HA 1AN0A 4XTRA 2CCJA 3REGA 1EFHA 4BFSA 1YZQA 4DT1A 4LC0A 1GSIA 1CR2A 1C9KA 1KHTA 4ZDKA 3GLFE 4XWOA 4TYNA 3E1YE 2Z5FA 1WBDA 1T4GA 4DVGA 4A1FA 3NH9A 4QGAA 1ZM3A 1OGIA 1VQ9B 4UNNA 1E0SA 4QC2A 2OBMA 1FZQA 2HCJB 1KO1A 1XPOA 4C3ZA 4D81A 2GQFA 1R5OA 2IYVA 3GJ3A 2A5FA 1X8LA 3QEOA 1SULA 4FIDA 1G5TA 4UNPA 1SHKA 4XSGA 1F2TA 2EVWX 2CLDX 1Q1QA 2QEXB 2BVNA 3BGWA 3IUYA 2VP9A 4ARZB 1W87A 2RGEA 2ZU0C 4AKIA 2OCAA 3LY5A 4A82A 1B23P 3W3ZB 2IYUA 1J9ZA 1GITA 3TQFA 3K9NA 2NO9A 4LJ6A 2YWGA 2B21A 1QHSA 3CD6B 2QTHA 4PSAA 4Q21A 3RSLA 5ELXA 4B48A 1JAHA 1XPUA 3QKRA 4YQFA 1E9EA 2J87A 1Z08A 4F38A 3AVVA 3CNOA 3NKVA 1RE0A 4II7A 5FBRB 2A5JA 2BKUA 2VHUA 4KJZA 5EJEA 1E0KA 1XMJA 3M4YA 1WDTA 1OJLA 3KXIA 4HATA 1U90A 2V9PA 3QF4A 1RYFA 1T8UA 4PZLA 3GJ5A 3UIEA 2RMKA 1EX7A 4TYYA 1HV8A 1RRFA 1P5ZB 5L3SB 1ZD9A 3PUZA 5FPKA 3RS0A 4LYHA 1F6BA 4HAUA 4XIGS 5KUTA 1N25A 1SKQA 5CB6A 3VO1A 2XNCA 1MABA 3SHFA 2XNJA 3EWAA 4BFZA 4I1UA 2PLFA 4MYTA 2VYQA 1NBMA 3C14C 4BZPA 4DLVA 1SXJD 1ZD1A 1HQYE 4AF6A 2FPMA 2LWIA 4A0FA 3PEWA 2H18A 2KBEA 4A36A 4HAVA 4QM7A 2ZREA 1TX4B 1G20E 1ZUIA 5TB5A 1OXXK 5H68A 3IEVA 4TMKA 4K8OA 3IDQA 2ZJAA 5B30A 3EIEA 1Z2CA 4JLVA 1S3SA 2QAGB 4Q1AA 5FFMA 4JT4A 5CM8B 4R2HA 3SN6A 2W00A 1KSGA 4IW3B 4Q5IA 3ASZA 4FMCF 5F9FA 3CNLA 3PVSA 4AG5A 3UG6A 3LVRE 2QPOA 3KUDA 4ZKEA 4TYQA 1OHHD 1UBCA 2OESA 2D4HA 2JGNA 2QSZA 2DFKB 1CR1A 1TPZA 3T1VA 5CK5A 4A6XA 2OBLA 4NBSA 1IJFA 4TMWA 3U6KA 1H65A 3GCGA 1G21E 4Q9LA 1Q22A 5DHFA 4QJ3A 4UKDA 1ZNZA 1TF2A 3VX3A 4ZKDA 3VR3A 1G16A 3W34A 2ZETA 5HZHA 1NN1A 2NG1A 1ESMA 4MRNA 1E2JA 4G5GA 1KY3A 2ZTSA 4TN1A 4MUBA 4PTLA 3TUJC 3QG1A 2R8RA 2ZRFA 4GP7A 4X8HA 4LOAA 1IN4A 1OPXA 3VU9A 3T5DA 1U99A 2AD1A 2NO0A 5K8UA 3ZD7A 1XPRA 4G1UC 1N5KA 5B58C 1VQOB 1EFCA 2WWGA 2ZE6A 3HYRA 3EPLA 1OH7A 4G0NA 1XCPA 5HKKA 2VZLA 2JLUA 2QPTA 4Z1MD 4D0LB 1V43A 1BO6A 3GEEA 1M34E 2W6ID 1VQMB 1Q3HA 4ZI2A 2ZANA 5SZKB 3MHPA 1G8GA 3PUYA 4IHQA 3CWQA 5BN5A 1TLLA 1W44A 3K70D 3AVQA 2ZXUA 1P60A 2J41A 2IC5A 2OK7A 3BB1A 4L16A 3PUVA 3A4MA 4MYCA 3T12A 5L3SA 3CXCB 3E70C 1NN3A 4QKQA 3LV8A 4WBSA 3ZVLA 1KD1D 3A8TA 3QVVA 2ZYTX 4HDQB 3U60B 2NMVA 1KSJA 5BYKA 3CMAB 1NVVQ 4LJ9A 5FTJA 4HB3A 2PZEA 2XOKA 1OYWA 4S35A 4N0DA 5FOXA 3B8HA 3BC1A 2OZEA 1R5BA 2VHCA 1N5LA 1KKLA 4I81A 4LYAA 3LO8A 3W9YA 5IF9A 2IS4A 3KTAB 4M1KA 2QBYA 2MSCB 4BZXA 2ZAOA 1XD9A 4BQSA 4U5XA 2B92A 2XNSA 4DSTA 3C15C 1U0JA 3SC3A 3I8SA 4MYHA 1Y3AA 4QGFA 2NOAA 1HA3A 1CLUA 3MWKA 1R4AA 3O8DA 1S8FA 4YHBA 2WV9A 3A58B 3LWNA 4Z54A 3L8ZA 3KXKA 3U3MA 1EFTA 4UXHA 4U00A 4QXAA 4DHEA 1OXVA 3H0KA 1J2JA 4FCTA 3WXMA 2A30A 1MRNA 2OM2A 5FR2A 1S9HA 2Z43A 3Q3JB 2IA5A 1F48A 3LH5A 4BZQA 4ZI3A 3WHLA 5C18A 4CEIA 1N6IA 4YDHB 2D7DA 1GM5A 2KI5A 3DDCA 1I2DA 1IAQA 1MO5A 2V6IA 1RYHA 2KJQA 3UMRA 3CB4A 4GP6A 4N0EA 3Q7QA 1W48A 2FA9A 4LV6A 2RGGA 1NIJA 4G5RA 2WKRA 3WBKA 1XU4A 3PV0A 5M04A 2GXQA 3FHTA 3IIMA 3T34A 4D82A 3BD9A 4A2WA 1K5GA 2XITA 4GRAA 4TYWA 3PIRA 4NPHA 3IBYA 3HR8A 2X2FA 3MG9A 5E3HA 3NDBB 1U94A 1G6OA 1WQ1R 5FPYA 4TLCA 5AR1A 4KHZA 4OHZA 4DCVA 1Q0UA 4DCSA 4Q1DA 2GJ8A 4TL9A 3TMKA 3VKHA 4JBWA 4URZR 2BBWA 2KE5A 2B7CA 3M1IA 2XAUA 1KKMA 5FL7A 3WYFA 1N5IA 2XX3A 4HB0A 1ZNYA 1D2MA 1D2NA 4HSEA 2GDJA 3UPUA 5F3WB 5SZIA 1VQKB 1QFYA 1N6LA 2BMFA 4YMUA 3QOFA 2IXEA 1EP1B 3CO5A 3FPAA 4QBHA 4KI0A 5BN4A 2VP0A 2AX4A 4GI7A 5GJVC 3CH5A 1WCV1 2GILA 4HLUC 1E96A 1XD2A 2R6AA 1NG9A 1KDTA 4M1YA 1FRQA 4UAJA 1X6VA 2DFLA 3FMOB 3Q5DA 4DEXA 3LBHA 3DZDA 2CXXA 2QN6A 2QMEA 2IS6A 4B71A 4W7SA 1YIJB 2QAJA 3ZH9B 3R9XA 2QA5A 1SQ5A 3PFIA 3CRRA 4AY2A 1P9RA 1BYIA 1L2TA 4LSGA 4WZ6A 3NVAA 1JXOA 4ITRC 4LBZA 1HT2E 3QE0A 1TF5A 2QZ4A 3BS4A 3JQPA 4LK2A 8OHMA 3EG5A 2V1XA 3P1JA 4Q7KA 2XJ4A 5CLLA 4DIDA 5IHPA 5JRZA 1N6KA 2OHFA 2ZRPA 4I99A 4XD7A 4AD8A 1W34A 1W36D 2J0QA 4HE6A 4WW0A 1QGAA 1ZINA 2F9MA 4B75A 1CNEA 5DHAA 4HUQA 4JLOA 2KSQA 5KSOA 3GLFB 3ZBUA 5HXBA 3CCMB 4PHGA 4DKXA 1JEEA 4M1TA 1I7PA 4TMZA 4H1VA 1MRSA 1NLFA 1IM2A 2GKSA 4EFMA 4POAA 2GRJA 1Z0JA 2ERYA 2W83A 3IHLA 4LJ4A 1FRNA 3ICQB 5K8TA 2IYSA 3NHAA 1C1YA 1GVNB 3TLXA 1QZXA 1CS4C 1ZBDA 3WBJA 3KKNA 5H59A 3Q7PA 5EXPA 2GK6A 3PEVA 2ZRMA 3CIOA 4LWZA 5GVSA 2QTZA 1VDZA 1CTQA 2Q6TA 2VSXA 3FYHA 5FTMA 1VMAA 2ZQ5A 1DAIA 3QI2A 5EP1A 1NBMD 3AVOA 1TQ2A 4IOMA 4P32A 3TW4A 1T3SA 3DOFA 4ZDIA 2NGRA 3R9WA 1SGWA 4HEJA 4EFNA 2Q9AA 3I1FA 4MRPA 3U61B 3CR8A 4WA7A 2REBA 3AF4A 5KSPA 2DWOA 2FN4A 3C5CA 3CKLA 1IN5A 3HJNA 4MKIA 2G1JA 3DHWC 3DEFA 5EP3A 5KNDA 3A37A 4RFVA 2IWRA 4M0LA 3WRYC 3LVQE 2C2HA 4F93B 4EAQA 2VF8A 4I4LA 4LBVA 121PA 4B3GA 1VCOA 1GNQA 1N3BA 4URWR 3Q72A 2FX3A 3A1SA 2JAQA 3N5CA 1H8EA 1AGRA 5J47A 2D74A 3AKEA 4Q7LA 5FA6A 1JPJA 4WXPA 2DWPA 5JWOA 2XZPA 4HLCA 1H42A 2RKOA 3EPHA 2ZI9A 5AN9A 3B1XA 3LQQA 3TAHA 5F98A 521PA 4U02A 1EWQA 2EYUA 3RWOA 4P3YA 5GVRA 4DLRA 2YV5A 4RFSB 4A8JB 3PENA 3LW8A 3FMFA 1KSHA 4XWAA 3GJ8A 5ANRB 3TUIC 2QM8A 4LHXA 4B2PA 1SVWA 1T8TA 4AYXA 1UFQA 2JLYA 3P32A 3GLFA 1VHLA 4X8LA 2AK3A 5K8IA 2P2LA 2Q21A 1KI8A 1XP8A 2GCNA 3TR5A 1GIAA 2DHRA 2RGAA 4LJYA 5HKKD 3QPVA 2XB4A 4NCJA 5IDVA 3I32A 2ZU6A 3GEHA 3NXSA 3CC2B 1CULC 2J1LA 1K5DA 1QVRA 3MUFA 1E1QA 3P27A 1N0UA 5J4LA 2ZROA 1E2NA 1KJYA 2FE4A 2QM7A 3TGPA 4CZ2A 2OFOA 3GLHB 2F1HA 3GJ6A 1TMKA 1D9XA 5DH9A 2IBMA 4L9WA 4AYTA 3R9IA 2JATA 3I73A 4A6PA 4CEHB 4KU4A 3ADDA 3AVYA 3EX7C 2BMDA 1CJTC 1MO4A 4TSFA 4D6PA 4DBLC 1AJEA 4PAOA 2XOKD 4MITA 1CEEA 2PL3A 1PVOA 1JEDA 2CJWA 3UMSA 3ZZTA 1IJEA 2HF9A 4C0JA 3TUZC 1MO6A 2VSFA 1G3IA 1XF9A 4Y0VA 5A5GA 3NBZC 1HE1C 1TAGA 2ZVQX 3VKGA 3OJXA 4RSGA 1US8B 2HT1A 1XE1A 3GJ7A 4ZPXA 1HH4A 3HYTA 2EFCB 5E7JA 1R0YA 1Z06A 1E64A 1J90A 3VHLB 1FNNA 2P65A 1L8QA 5DE3A 1G8PA 2QE7A 4QBFA 1JA0A 2VNKA 2OAP1 1BKDR 5DISB 1TF7A 3AH8A 3GLGB 3QY0A 1RW4A 4EPXA 4ASUA 1G8YA 5LD2B 1JI0A 1CJMA 5BQ5A 1LB1B 5IK2A 3P26A 1ZNWA 3ETLA 5THXA 2OTLB 1N6HA 2BIFA 2YWHA 5TY0A 2PJZA 3FB4A 4CW7A 1G3QA 1W0KA 4JYCA 3CX7A 1KMHB 1ZVQA 5KPJA 4DLZA 4TQ9A 2JLXA 2AWNA 1PJRA 2NO1A 1SZPA 4RFSA 1KTVA 3MLEA 5FOVA 1JAIA 2CCGA 4TMTA 1VQ6B 1CBUA 2XTZA 3FFBA 3AVUA 1R6BX 2IK8A 2W0MA 2YZ2A 2Z6VA 3QKTA 3QUSA 2F1RA 1XCMA 3AV0B 3TW8B 5JS8A 4NE2A 1UF9A 3ND9A 3IO3A 2YNMA 1UJ2A 2BCJQ 1AS3A 3OFNA 4RCZA 2D2FA 1ZCBA 1KI1A 4B3CA 5HPYB 5JZVA 1XJQA 4FMDB 2P5TB 4OI0A 1M6NA 1E79A 2P6UA 3EZFA 1XXHE 3H1TA 4EPVA 2DBYA 1DAKA 4ZIRB 3QIAA 1VPLA 2J0SA 1FW6A 1U9IC 3CLVA 4DSNA 2PX0A 1KDOA 1QHIA 1R0WA 2ZRBA 3AF0A 1XMSA 4M1OA 2VP5A 3QF7A 4KO8A 1I4LD 2QQ0A 5FL7D 1VHTA 3RS2A 1RKBA 1K8AD 2D3WA 5BYJA 3RVBA 2GHIA 3IILA 4A15A 1E2MA 2ZEJA 3MJHA 4A0RA 4CEHA 4JL8A 4D80A 2PMKA 3Q85A 5JECA 2GJAA 2XTNA 3MAAC 1XB2A 1MV5A 2W58A 2H5EA 1QHHA 2ZRGA 1KI3A 4Q02A 4QJ4A 4DXAA 4YONB 2BMWA 4PHHA 1KK2A 2ONJA 4C0AC 4WVFA 3QBVA 1KIMA 4HUTA 2ERXA 4AYWA 2DERA 5L3QB 1W4RA 1VYUA 3FMPB 1BX1A 2F9LA 4U9UA 2XXAB 4QL3A 4D0GA 3CC4B 2WSMA 1KRHA 1E2DA 2CEAA 3KJEA 4OHWA 4TLDA 3T61A 2G1KA 4DT1B 2H17A 1X8JA 2QL6A 1OH5A 1MR3F 1QGYA 3OJWA 3KUCA 4PHTA 1E9BA 4M4SA 4M1SA 3A1VA 3THXB 1TL7C 4XD7D 5FTKA 4QBGB 4LV8B 2FG5A 2IYRA 3QPWA 2CHVA 5FTNA 1Q57A 1TU3A 4F7DA 5HE9A 2FFHA 1CRPA 1S96A 2ODWA 2P3SA 1SVMA 3CF6R 4B2LA 3U44A 1CKEA 1ZD8A 1G3MA 2QGZA 3B1ZA 1Q86D 3T1OA 3QEJA 2Z0MA 4L15A 4X8MA 1T3LA 1DS6A 1R10A 4URYR 1NKTA 3U6BA 2WVJA 1KMHA 1Z0KA 3PEUA 3W5VA 1KI2A 1BS1A 5DYGA 1KC8D 1HY3A 2C03A 4IDNA 4BASA 1TADA 2RGDA 1XDBA 2AKAB 3B1VA 3DMNA 4JKYA 3VR2A 3AGQA 2HCBA 2PT7A 4DLTA 2A2ZA 2JJ2D 3FHOA 4QM6A 4UNRA 4MA4A 3G5UA 5JLJA 3D6TB 3ADBA 3L0PA 5P21A 4OI2A 1L4UA 5EE5B 2FZLA 5JMTA 1ZYUA 1MOZA 2BPOA 5SZJA 2CLCX 2P5SA 4HDCA 1Q81D 1ZM7A 1E0AA 4ZIRA 2QTLA 2ZSBA 1OH8A 3P4XA 3LRPA 3QFSA 3KQKA 4R98A 4QGHA 1OW3B 4CT4B 2X1VA 1GOTA 2NZ8A 5AJZA 2AD5A 1S1MA 3B9QA 4CIDA 1W4AA 2OCBA 1Q1EA 2NTYC 2QPAA 4LUCA 5KDLA 1E62A 1F60A 5FBQB 3W90A 4PQRA 1CF4A 2SHKA 4IVQA 4YAOA 2JLVA 1G3UA 3EARA 2R6DA 1SVOA 2XSZA 2W6JA 1MH1A 4Q4AA 1WBBA 5J4VA 4FXPA 1CR0A 5L3VA 3D8BA 1KO8A 1H8ED 2HEIA 3QJYA 4KLZA 5HCIA 5FI1B 2ZS8A 5DSZA 3OE7A 3IKJA 1H85A 1ZM2A 2FSIA 5L3QA 2RC5A 4LYFA 3A6PC 421PA 3T5GA 1ZU4A 4Q4JB 2QENA 4D4JA 2WAYA 3WNDA 1FP7A 1DAEA 3G71B 2ZITA 2P67A 3EIQA 3CCRB 3EZ9A 4PPFA 4P6VF 1W1WA 3K9HA 3VQTA 1F20A 1JR6A 1MKYA 4B3FX 2YOGA 2EFEB 2HXSA 4M9XA 3K9GA 3THXA 1ZP6A 4PANA 3CM0A 1XRJA 2V7QD 3BRWD 1Z5ZA 1U2RA 3PQCA 3U7GA 1BYUA 1R0ZA 3Q9LA 1QHYA 3KDSE 4QG7A 4RD4A 4QJ5A 3NBYC 1DELA 1DARA 3I62A 4FCVA 2CL7X 3HR7A 4PPGA 1Z6YA 4E03A 5K8LA 3TRFA 3V76A 1QVGB 4Q66C 1E1QD 5JWRA 3AF3A 3DMDA 1R7RA 1UKEA 5JEDA 3DL0A 1AQYA 1KI7A 1CRQA 2AFIE 1DO2A 1E2FA 4MGYR 2D7CA 4BECA 2FDCA 1NL3A 2JASA 1GP2A 3VU9B 5EXTA 4FINA 4IEEA 1X3SA 4ON9A 4EQ6B 1Q20A 1OIXA 2BOVA 4CF7A 4PC7A 4DLYA 4BGDA 5KNBA 2V1UA 4TSFD 1YHNA 5KPDA 1FMJA 1D6JA 4KAXA 2QNRA 1Z63A 4AF7A 1KDPA 3FDIA 3NG1A 2WM9B 2NPFA 5J5CA 1UADA 4RVCA 1JECA 4NHOA 2R44A 3A1UA 2LKCA 2UVQA 2VA8A 3NEYA 4O25A 3SI7A 5FBVB 1G5RA 1N6NA 4YC7A 3DZ8A 3C16C 1TQDA 1Z0FA 3KFXA 1ZAKA 3NTUA 5FUXA 2NZJA 2F43B 1AS0A 4B3DA 1OH6A 2EW1A 4P31A 1OFUX 4G5OA 2IWHA 4B3XA 4P4SA 2YHSA 1GKIA 2ZE7A 5DN6A 1RZ3A 3CCLB 4ILEA 3SDZA 4PPNA 2QE7D 2PCLA 1D1NA 3S1AA 3ZVRA 2C98A 3ES9A 1E9CA 2JJ8A 4ASUD 1GWNA 3LBNA 1G291 1IONA 2PEYA 1SM4A 3CCUB 1EWRA 5A4JA 5JHHB 1RRPA 4NU0A 2QBYB 2DCUA 5IK2D 3FMIA 1HURA 1FX0A 1XTKA 3HU1A 4HZUA 1IN8A 2IUUA 4Q1EA 3L82B 4OI1A 4Q4JA 3FWYA 1KNXA 1HQCA 1W0KD 2NPIA 1J70A 1XX6A 5B2ZA 1A4RA 1XEXA 2ZJ8A 2HLDA 2IYZA 2F1JA 4ZO4A 1LNZA 2HXYA 2JEOA 5KOYA 4TZ0A 2DYKA 4EJSC 3KQUA 2VF7A 2PLRA 3FTQA 2L0XA 3PUWA 5G41A 2FOLA 3E20A 4F7WA 1R5NA 2XZOA 1E2HA 3OFND 4HI0E 2C9OA 4MGKR 3AVPA 1IB0A 1COWA 4L5BA 4CEIB 4NYJR 1PZNA 1E79D 2C5LA 1OF1A 3AP3A 1LY1A 1UM8A 3W2IA 1G9XA 2ZR9A 3ZQJA 5CB8A 1UPTA 4C2TA 2XEXA 2IYQA 4M22A 4OQMA 4PX9A 4PAMA 3ZIAA 4MKGA 2X8AA 4GDFA 2DEUA 4C9BA 2ZRHA 5FPTA 3GP8A 1CIPA 2QRNA 1IN7A 5DI3A 5E4FA 2BGJA 1YZGA 4EQ6A 4PC1A 4C43A 3EZ6A 2V6JA 2OXRA 3NWJA 5GJCA 4ZDJA 1CP2A 4LHWA 3T35A 3UXMA 4AIIA 4ESHA 2NO6A 4G5QA 4M9QA 2BJVA 2VP2A 1G6HA 4JLJA 3SFVA 5D3QA 1AK2A 3CPWB 3DPUA 1P73A 3WMFA 2QP9X 2MSEB 4QRHA 3T1QA 2F43A 4YAWA 4G01B 2EQBA 2E9SA 4DDTA 1AIPA 3H84A 2FV8A 4OK6A 4M1MA 4BFVA 2PMDA 1G7TA 3BOSA 2FEOA 4DZZA 4DB2A 4AKHA 3VFDA 1XD2B 1E6CA 4JL5A 2GCPA 2GCOB 2VL7A 5KTYA 2IT1A 1VIAA 2IYLD 2XJ9A 1VYVA 4Q7MB 3G6EB 1L7VC 2WWWA 3HPRA 4Q01A 3CW2A 1YZTA 2Z4RA 2ZJZA 3CCSB 1X1SA 2WBLC 2HJVA 3D7MA 3N2EA 1FUKA 1ZNXA 1A7JA 4C2UA 1IY1A 1P6XA 1ELOA 2K5UA 2GXAA 3SJCA 3QSYA 3BORA 5EUMA 4LI0A 5EZ6B 4OHVA 3OZXA 3A1TA 1JPNA 2REXB 4IJMA 1NVUQ 4DB4A 2V55B 5B57C 5JHGB 3W2GA 1WP9A 1QRAA 3EC1A 4IXNA 3VR4A 4BPBA 1GKUB 3RAPR 3L0SA 2F3TA 3TQCA 3PJRA 4HUQB 2YC2C 3W5JA 1NJGA 1GRRA 3B1YA 4MH0R 2OTJB 2YKGA 4KODA 3GPLA 4JIMA 4FN5A 1U8YA 3LW7A 2BJWA 1VQNB 3L0IB 1CU1A 1EX6A 2DY1A 1DE0A 5FOSA 1QF9A 1YJWB 3VO2A 3EZ2A 1AA9A 3U3KA 5BWMA 2P6RA 1Z0IA 2EFDB 5DIFA 5FUYA 5KHOC 2H1LA 2QSYA 3U7HB 3CRW1 3QPUA 2VEDA 4V0ME 4GOKA 2ZAMA 1N8RD 3AKCA 2N46A 1OSNA 1XZQA 4W9MC 2FU5C 2VHJA 3X1WA 2RHMA 3BH6A 2N42A 1U98A 2X3UA 3TSZA 4EFLA 3KQLA 4RZ3A 3CCQB 4MDFA 2QUZA 3AKDA 4UXJA 4Q18A 3ZC3A 4IKEA 4Q1BA 4JVLA 3SJBA 4IFEA 5DYIA 3TJZA 4BFWA 2BMJA 2O8BA 3BFXA 3SS8A 3EIHA 2MMCA 4JZKA 2XSZD 4OBEA 2W6JD 1RIFA 1M7BA 3U4QB 4ZGNB 1M7HA 4OHXA 4FK8A 3OE7D 1E2EA 4LHVA 1A2BA 4KBFA 3DM9B 2I3BA 4Q1CA 4Q7JB 2CVHA 1E32A 1NY5A 1OT3A 4JVNA 2GPJA 1XTQA 4CDGA 1QG4A 3VAAA 3CF2A 1E2GA 2ANBA 3IHWA 3TNFA 4HLUA 4K1XA 1KK1A 1ESNA 3EASA 4V0OA 1LFDB 1EP2B 1VQPB 2QP4A 5AWFC 1JB1A 5TXGA 1XZPA 2IYTA 3B82A 2GCOA 2YWFA 4BWYA 4B3BA 1T5IA 3F8TA 1RRGA 2CE7A 3QFCA 1XFAA 4BRUA 4CEJB 4JBYA 1YU9A 3WP1B 821PA 1W5TA 4G5SA 2Q9BA 3BIFA 1U0LA 2ZS7A 3RC8A 4TYPA 5JFGA 3K0AA 4W5JA 3VHXA 1DBSA 3KKOA 4YAUA 2BCGY 3LDAA 4RKEA 3I8XA 1OKKA 3LNCA 4LX0A 3ZS9A 1Q1BA 5FUWA 4IOJA 1TQ4A 3R7WA 5A0FA 1EFUA 2FGKA 1JJ2B 3OESA 4D26A 4F91B 4JLMA 4HAYA 1YQTA 1CJUC 3ZZ0A 3QENA 4A8JA 3WYGA 2ZJ5A 3QE2A 3U7EB 4LPKA 4A8JC 3F0TA 3JQRA 3WYAA 2ZI4A 3LD9A 3HP1A 1T5LA 1EXMA 3TAUA 1KY2A 3TR0A 4LJ8A 1N2CE 1JJVA 2PZFA 4WAUA 1Z8FA 1OIVA 2PJRA 1HTWA 4NCKA 2WJGA 1T3HA 4URVR 2BBSA 3FKSD 4JLPA 4KXFB 3CC7B 2FH5B 4JBXA 1DTSA 4XTCS 5CJ2A 3VNVA 2KB0A 3RC3A 4YMSA 2QROA 2HJGA 1YR8A 2C04A 3FHCB 1E2LA 2JJ2A 5DN6D 2QMOA 2ZI6A 4S2EA 5EE1A 1E9AA 4LDJA 3GLIE 1D8TA 2ZUBA 4DQLA 3REFA 1QUFA 3TVDA 2PBRA 3R20A 4US1R 1M2OB 2YYZA 3NC0C 2VNJA 1WE2A 2CJWB 3OZWA 3U4QA 1QHNA 2Q9CA 5AJVB 3RNLA 4E09A 4URUR 4RCYA 2E87A 1TVCA 2ZE5A 3CRVA 3QQ5A 4KYUA 4TTPA 3W6PA 1SKYE 3RWMB 3LX5A 2AHOA 4MGIR 4TWZA 2HLDD 5JRJA 4ESVA 1IQPA 4PSKA 3SYKA 3HU2A 4NYMR 1E99A 5J40A 1I2MA 2RH5A 4FWIB 1W2HA 2ZJBA 3SEAA 3ZLJA 3CX8A 2ZR0A 1G5PA 3I55B 2ZYWX 3A1WA 3MGCA 3A4LA 1OLOA 3BWDD 5KYKA 4CEJA 4QHSA 1IY2A 2HV8A 3VMFA 3DKPA 1FTNA 2XTMA 4PHFA 4Q03A 3AUXA 1S2MA 1COWD 2GA8A 1W4CA 3LAWA 3BERA 2BBOA 3O47A 4RKFA 5CJPA 3W8RA 4F4IA 3KB1A 3QXJA 5DGXA 5AK0A 4I1VA 221PA 3RHFA 3TE6A 4JVMA 1RRCA 4DQKA 3PUXA 2ZSAA 2GTPA 4NMMA 1GVHA 2O8EA 3ZIAD 2O0KA 1P62B 3FKQA 4TMXA 1I4TD 2P6NA 4A9AA 5HZKA 4YAFA 2V7QA 1NSTA 1K73D 1AZTA 2QORA 4UXIA 4RY2A 2WTUA 5CITA 2ZRAA 5HR5A 2A3RA 2A5YB 3HU3A 4IVRA 4FD2A 4LJ5A 2JIZA 1SVLA 1Z47A 2BHRA 2QI9C 3CCJB 4L9SA 3I61A 1RJ9B 3SHWA 1YJ5A 2EYQA 1QVFB 2YWEA 1S9DA 3L8YA 3SJAA 1PUJA 2BM0A 2QA4B 4DCTA 1N5JA 1P2SA 3THWB 1NMXA 2CMKA 2IX3A 2FZ4A 3W8NA 3TVTA 1QHHB 3RS5A 1BX0A 5EZ5A 4JS0A 4ZDWA 3VTKA 1DAHA 4KSCA 3RRYA 3KXLA 3X1XA 3C4JA 4DEYA 5BW8A 1EP3B 1E1RD 1Z6XA 2FWRA 5FUVA 4DLUA 4WIAA 2ZRCA 4BLRA 1FNCA 1JXMA 3MSXA 3OIVA 3ZZUA 4CT5A 3AB3A 2BEKA 2VSOA 2WKQA 4C0QC 1IHUA 2C8VA 2ZRIA 3KX2A 4GL2A 1ONBA 3BXZA 1NN0A 1QG2A 2J9RA 1PLJA 3RABA 4RD3A 1F3OA 1G8HA 2ATVA 2UZIR 2Z83A 3CPEA 3EA0A 2CHQA 2HYDA 1VQ4B 1R2QA 1X1RA 1NY6A 2F3RA 5FTLA 2Z4SA 2Q3FA 1DVRA 1Z6AA 2WHXA 2QTVB 3RS7A 2BKEA 4EPWA 2FSFA 1JNYA 3D31A 2QG6A 4NYIR 4LGMA 1XMIA 3A36A 3R8CA 1IBRA 1CJKC 2VNIA 4QFMA 2W0SA 5EQTA 4JLBA 3ZGXA 1AKEA 2G77B 2BF4A 3ASYA 2R6HA 2IS2A 3U44B 4AC9A 1DAGA 5EE0A 1M8PA 1Z6GA 5GADl 1U0HC 3B5JA 3L2OB 3AKYA 3GJXC 1FUUA 1D5CA 1DG3A 1M1KD 1P2UA 1B2RA 4BFXA 4M9SA 4RD6A 2B7BA 1IOZA 5C46F 1XD8A 1M74A 2IYWA 5DLQC 2FPLA 2V54A 1OIWA 2FFAA 1YJ9B 2FPKA 2IYXA 4HAZA 2RGNA 4N3NA 2F7SA 1FPMA 4KITB 1NLYA 1VYTA 4Q4HB 1VG0B 1IXZA 1JR3E 2RGNC 4WOPA 5J4KA 4PFSA 2RGBA 1JQJC 1KJZA 2LCFA 2PH1A 4LZZA 1NVXQ 2WOOA 3CBQA 1UKZA 1OFIA 2QY9A 2GJ9A 2RGCA 3I72A 3QXHA 4XVRA 3X2SA 3SQXA 1AS2A 1G19A 1U9IA 4EPTA 1YE8A 3BH0A 5H5JA 3GMTA 3MWLA 1Z0AA 1OXTA 2JLRA 4LPSA 2B8WA 5B64A 1RJ9A 3IPYA 4KVAA 1AM4D 3FFAA 2CDNA 4IEIA 5KSZA 3HWSA 3KKPA 4DDVA 2DWQA 2WMOB 4JLKA 4EH1A 2A5DA 2EIXA 3THWA 3GFOA 3KQHA 2F1IA 4OHYA 3MRSA 5JWHA 1GO2A 3O8BA 2RC6A 1TU4A 1TUEA 3EWSA 4YMTA 4Q4AB 3B2EA 1GDDA 1C4OA 4H9GA 1GAJA 1GJRA 4F4JA 1YVDA 2NO7A 3RDPA 3CMEB 2ZRLA 1E2KA 1ETUA 5CIQA 3UK6A 4JKIA 1FP6A 4LY6A 4TL6A 4QGGA 1GR1A 2OLKA 4CYMA 4F92B 4PQYA 2R6FA 2VHTA 1AZSC 1G4UR 4Q19A 5GV7A 1YITB 2ZVPX 2VPPA 2BGIA 1A5TA 4DRZA 3KKQA 5J4YA 3MCAA 3K1JA 4NYJQ 2BC9A 3ADCA 4BPRA 3J81k 1OKKD 1TQ6A 2GWHA 4NKRA 5IT5A 1NNEA 2ASEA 4DLWA 1PLKA 2QRZA 2W2VA 3K09A 2O8DA 1KO7A 3U3RA 4RZUA 5FOTA 3HDTA 2E1RA 3THYB 3K09C 3AQ4A 1GRQA 4KV9A 1UBGA 2ECKA 2J0VA 4TZ6A 3U2QA 3GJ0A 1ANKA 5JI2E 2CNWA 1X8KA 4R2IA 1DAFA 1XTJA 4GOXA 4V0KA 4OK3A 1FFHA 1B0UA 2VP4A 2EWVA 3L0OA 4EPRA 2BBTA 3K70C 3ZS8A 4QNMA 3HPQA 3I4LA 3I56B 5D3MA 4XSHA 3OEHA 5DO9A 1E94E 3K8YA 1ZUNB 1TUIA 4TLEA 3WMGA 4V0LA 1E4VA 3CNNA 5EP4A 4CGZA 3GFPA 2F6RA 6Q21A 4Q4HA 3R8FA 3KFVA 4PC6A 2IYYA 2R62A 4YXWA 4JVSB 3W2EA 2LKDA 5KO2A 4OQLA 1FMLA 2GETA 2GNOA 1KMQA 3QXCA 3X1ZA 4JSTA 3QKUA 5F9HA 1YZLA 4FCWA 2GBLA 2OK8A 2IF0A 4AWXA 1QFZA 2BEJA 2GBLC 4ERNA 2C9YA 2VP6A 5JJIA 2ZRKA 3AVXA 1EK0A 2OEPA 1RC8A 2ZE8A 4B73A 4P4SB 2OXCA 4BLTA 2JCSA 2WJYA 3B60A 3OIYA 1KI4A 4K81B 4V0MA 1S3GA 2BMEA 1FNMA 5JS7A 1QDEA 1M1YE 2WSSA 1FDRA 3CZQA 3S1AB 4AK9A 1GUAA 4E5UA 1VQLB 2ZR7A 1NJFA 3K9LA 5TMPA 4MRRA 2G0NA 5C1BA 4IOKA 3G4SB 4D2IA 3GLIB 4JLDA 1FX0B 4HZUB 1XEWY 3U5ZB 2VTKA 1YR9A 1T9HA 4UJ5A 1BQEA 1BJKA 3IEUA 2IHBA 2G83A 2XB2A 2C77A 1PLLA 3F5FA 4O2RA 2IEZA 3VR1A 4EJSB 1XEXB 2RHDA 2CCKA 2NQ2C 1ZU5A 2VYFA 2JLZA 3SZRA 2I1QA 2D06A 5FPHA 3THYA 2GZHA 1BOFA 5AUOB 5JEEA 4B44A 2PT5A 5E7IA 4BLOA 3PXGA 4DC9A 4TTRA 3NBFA 1KI6A 4B47A 1LV7A 2ZSEA 4C7OB 1KK0A 3UKDA 2C95A 4YMVA 2OBNA 3W5IA 3K0CA 4Q00A 1QVAA 4LCBA 2WPDA 4LHYA 4BRWA 2JIZD 5TV2A 3ZDQA 4PO8A 4OKSA 2XNDA 2FFBA 3K0CC 3LX8A 3LXXA 3AVTA 1WA5A 5LDDC 2IXGA 1G41A 4HAXA 2VO1A 3P20A 4N1AA 3B6EA 4Z8YA 3UMFA 3FPKA 1FOEB 4QHTA 1S72B 5CIWA 2ODNA 1FNBA 1VTKA 5EE9A 1V5WA 2ZSDA 5DI3B 2G3YA 3H86A 2CNDA 1E9FA 4Q47A 4GMXA 2FFQA 5FBLB 5KDOA 4PAQA 5TR9A 4BFUA 5UKDA 1YRBA 1R8QA 3JZMA 2ZPTX 1E3MA 3W5HA 3GJ4A 1KAOA 3CWZA 4JJKA 4TLAA 4B6FA 4BLQA 4BUJA 3K0FA 4BEJA 1MO3A 4YDSA 5CLQA 2VRWA 4OQNA 1QG0A 1I4DD 2ORWA 4C0KA 2ZIAA 1UAAA 4WZAE 3FKSA 4Y9UA 4RZXA 5BN3A 1A82A 4ACAA 3CRZA 4N3GA 1ZIOA 1LTQA 2H16A 2R9VA 5TVKA 4R71A 4PSVA 1CNFA 4W5HA 1EFRA 1G17A 1N6RA 2FF7A 3OEEA 4O0MA 4XH9B 1W36C 4Q9IA 5CDFE 3OAAA 3C5HA 2RGXA 2ZYVX 3JVUA 4GMDA 4MRVA 5C4GB 4MUAA 1GAWA 4ZCMA 1E2QA 4M53A 2KBFA 4C0HA 4V03A 2I1VB 1P7CA 2VH5R 2DFNA 3GEIA 3GQBA 4LJAA 2AN9A 3GLIA 1SHZA 1W47A 4X8OA 1SXJE 1NN5A 2IF2A 1XTSA 1ODFA 2DFTA 2IL1A 3I5YA 2B8TA 2IS1A 1K8RA 3FGNA 1YI2B 5E95A 4EJSA 1EG7A 2VIIA 4C30A 3NIBA 4QBIA 4HB2A 1ZCAA 2A9KA 4OL0A 5JI3E 4NP6A 2DB3A 1XTIA 3L43A 1E2IA 4PGOA 4JSYA 4P4UA 3OHMA 3BFKA 2PIAA 4QNRA 1P2TA 2AK2A 1F5NA 3MFYA 2TMKA 5CYOA 3T06B 2C9CA 4XOIA 5LPNA 1XTRA 3WRXC 1D2EA 4C7OA 2JDID 2MMGA 3PG5A 2FNAA 5F2EA 1KYIA 1WMSA 3WP0A 4NL4H 4JLAA 3LFUA 2F55A 2MSDB 1II0A 3I3SR 1U8AA 1XMVA 4TQAA 2ODEA 3UANA 5BXQC 1KOFA 5HTKA 4NH0A 2GZDA 5IRCD 1QUEA 2GK7A 1ZMXA 5H1YA 3RRMA 1DO0A 1H8HA 2YC4C 3NHBA 2W2TA 4LHZA 1NDHA 4HDOB 2O8BB 2Q3HA 2JA1A 1MT0A 3BH7A 1DEKA 3PITA 4PZYA 5TDHA 1UDXA 3GLHE 3ADKA 4NYMQ 4D4KA 1D9ZA 3K0EA 5JBQA 4LYJA 3CZPA 4YALA 1E9RA 3T15A 3V9PA 4ZV4A 2RAPA 1YHQB 2FMXA 1KK3A 1KNQA 3QKSB 5AJWA 1NIPA 4ARZA 1BIFA 2AKYA 2OO7A 4DUGA 1GL6A 1VQ8B 1LS6A 4TMVA 4IFBA 3AGPA 4MRSA 5GV8A 2HUPA 3UWKA 2J5XA 3AP2A 5L3RA 1XXHB 1GL9B 2YOFA 1YRAA 4DCNA 3W3AA 5G53C 1ZIPA 1FNDA 1VCIA 1KI9A 4G1VA 4PO1A 3ZVNA 4NCIA 3IIJA 2WWYA 2O8FB 1Z0DA 4URXR 2GXSA 1G7RA 3AVWA 3NH6A 5FBWB 4PC2A 1E1RA 2R2AA 3TSOA 3H2YA 4PZZA 4BFTA 5LBIA 4TLBA 1U81A 4XVQA 2CNWD 1NJID 2J7PA 4AKEA 1A8PA 2FEMA 1DAMA 1YR7A 3SOPA 3GLGE 3KL4A 5JCPA 3K0AB 5EE3A 1UBFA 1UKVY 3QNUA 4B2IA 1QFJA 1TNDA 1GG2A 3PCRB 3OEHD 4UJ3A 1J8YF 1J8MF 1F2UB 2X19A 3CRQA 3R7WB 4B76A 1X86B 3CRMA 5EUQB 2DPXA 2XGJA 2R65A 1W2GA 1Z07A 1CR4A 2B5OA 3BJIC 3THOA 4BLSA 3E2IA 2N1BA 4PR0A 1PV4A 1BH2A 1DDGA 1G4AE 2G88A 1KDRA 2OG2A 1W2BB 3CH4B 5EMNA 2J45A 3MD0A 3CCEB 3AEZA 3NEJA 4IRUB 4IXMA 4Q9KA 3VR6A 4YXWD 4MDEA 1P3JA 1BMFA 1E98A 1XJ0A 3OIWA 3ONWA 1QHXA 5CYPA 3IQWA 5HE8A 2G9NA 3LLUA 2OV2A 5G3ZA 3RSOA 1G7CA 2WIBA 3NC1C 4BLPA 5FL3A 4FWTA 2X77A 3P4YA 2Y8EA 1KZGB 4DSOA 2IEYA 1N6OA 1OGJA 2QAGA 4IDOA 5JCZA 3DKVA 3K0SA 3B85A 2ZM5A 1LW7A 3DOEA 2QAGC 1UKYA 4FW9A 4JL6A 1K9MD 2WWIA 4NONA 4DDUA 2A7QA 1VCNA 1UBEA 3EXAA 4DIEA 3KQNA 4JJZA 4A0HA 1O3YA 3TH5A 4A92A 1IXSB 2EWWA 2ZJOA 4QOSA 3SNHA 4KLNA 4EUNA 2WSSD 1JB9A 3MJRA 1QGZA 1OFHA 2ZRDA 5AJYA 3AM1A 4NYIQ 2P0EA 1JR3A 2G6BA 2CK3A 1M7GA 1W0JA 1XEWX 2AWOA 5TARA 3QKSA 4U7DA 4C4PA 3OZVA 1OFTA 2B6HA 2OCYC 1OE0A 3RS4A 3SJZA 4V02A 2R6GA 1XXHA 1T0JB 3O8RA 2JJ1A 3EW9A 1P2VA 1S4QA 4HAWA 1WB9A 4KCGA 1XWIA 3CONA 2O8FA 4QHYA 4ABYA 2CHGA 3TK1A 3W6NA 4DCUA 5EXSA 4FMCB 1RPZA 4BEBA 2VQSA 3OW2B 1J99A 3FOZA 4M21A 1KQSB 1NLZA 1Q21A 4OQFA 1QHGA 1KZ7B 3G0HA 3SQWA 2WJIA 2XZLA 2QMUA 2WPDD 1O87A 3NDPA 2XNDD 1EGAA 2EFHB 4KFUA 2QU8A 1Q3TA 3AF1A 4C0SA 4XWKA 4L8GA 1F2UA 1SVSA 4US0R 2O8EB 4A2PA 1P9NA 3D3QA 4G3XA 3GFTA 2IXFA 2CVFA 1UEIA 2GEDA 4B35A 3BB4A 3I5XA 1ZC4A 3BB3A 3KTAA 3EA5A 2REOA 1P4SA 3SBDA 3VR5A 1PUIA 1LVGA 3TKLA 2EFGA 1TTTA 4DWJA 2HMAA 2QT0A 3RLFA 2H57A 2W2XA 3SFZA 3QFTA 4G1BA 1T6NA 2A5GA 3U7FB 3QVUA 2GJSA 1M90D 4HB4A 3FJOA 1IXRC 5FH9A 1P61B 1VQ5B 4B74A 4XVUA 1W46A 1NSFA 4GPTA 1YZNA 2ZSFA 3VKWA 3ZJYA 2PEZA 2AR7A 1HE8B 2VBCA 3QXXA 5JSZB 1VIYA 4LRWA 1CJVC 2J7KA 1QH0A 1NVWQ 2WJHA 4GZLA 3Q5EA 1Q44A 1Z83A 1EFRD 3OEED 4UQOA 1JALA 2J0UB 2UKDA 3IQXA 3OAAD 3QXSA 4MKHA 4NDZA 3ICEA 5FOWA 4I1SA 2OILA 2QGNA 2QEQA 4M1WA 3G82C 3K53A 5DNYB 1VKJA 4GSYA 1VECA 1WXQA 1NMYA 4TT3A 3U3JA 2IUSA 2Q0HA 4B43A 1NKSA 1TEXA 1QBKC 3LVBA 1NBME 4YLGA 1YZKA 4PPQA 4FMBB 3OZUA 2WWFA 3TBKA 3B1WA 2QDXA 2AXNA 3E5HA 1ZUHA 1Z22A 4IOLA 1Y63A 4FMDF 5E7MA 4IDQA 2O5VA 1Q7YD 4B33A 2WKPA 5LB4A 2OSBA 4K46A 4RD1A 2OLJA 3IGFA 2ZJYA 2ZUDA 4JLNA 4I1OA 2FGJA 5CK4A 3RRNA 5KSYA 4MGZR 3SYLA 1JBKA 3QBTA 3ND8A 2IW3A
chains in the Genus database with same CATH superfamily
4MRMA 1OXKB 3AEKA 4ML3A 2GESA 1DG1G 4HKTA 3WY9A 3C3AA 3SS9X 1C14A 2DYIA 3FCSB 2HU7A 2PWPA 2WE7A 1E2PA 1Y8AA 5HCNA 3CZRA 2WAMA 4JELA 5K3FA 3KJHA 2A33A 5BO5A 4XD2A 5TQ0B 1OR8A 4MICA 3TYXA 4X1YB 1IATA 3JD1A 3RV4A 3U3OA 1KKUA 3MTBA 3VA7A 2R2GA 3SQLA 1YF3A 3A05A 4ZCIA 1QQ6A 2R6CA 3JQ7A 3P9CA 3N70A 2VLIA 3PC4A 4RJJA 1OXSC 3KLNA 3EZ7A 1EWTA 2G5PA 4ZVPA 3DH0A 1LBQA 4NARA 3V8EA 4XYLA 4JJGA 3N2IA 2Y1LA 5BV1A 1W2WB 4E0FA 2GNPA 1TI7A 3P0JA 4C0BA 2VDJA 2VAVA 4W5NA 3WK8A 3UUWA 4R7ZA 1XZJA 4ARAA 6REQA 3W7AA 1Q82D 1H9CA 1JI3A 1F51E 4XLFA 4TKOB 1P1CA 2GAAA 1RFLA 2J59A 2WF5A 2XV1A 2JRCA 1DOAA 3BE4A 1ARZA 3OIGA 4UM5A 4W8GA 1AHIA 3O93A 4XJSA 1NVVR 3OIUA 3IMGA 3S55A 4TX1A 1ZM4A 1MCZA 1U0GA 4KE9A 2GTIA 4BLVA 2NIPA 2UZAA 2ZDGA 4GX2A 3S81A 3JZAA 4J1TC 4R1UA 2VZ0A 2IVFA 2ZZKA 2VQDA 2HHAA 4DSUA 1J1UA 4E6EA 1KSFX 4XX0A 4US2R 4HQNA 2KWIA 4ID9A 2J0UA 2FJUA 3X2EA 3M6AA 3SG0A 2QP3A 3Q5GA 3T99A 1W35A 3BC9A 2C88A 3PR1A 5JCOA 5C8VA 2HFJA 2JLSA 3B7GA 1ZC3A 4HYYA 1LWNA 4J0KA 2KMLA 4YJ3A 2D3NA 4DQ0A 1TYAE 4KIGA 3OM0A 2O4UX 2B0CA 4KW7A 1I7QB 2Q3MA 3BK7A 3T7KA 2H6EA 5MN4A 3HBJA 4D4IA 3BWBA 3GD7A 3I45A 4H0FA 4BNNA 3F9IA 5ARCA 2BW0A 3ERCA 1KYWA 2JD1A 2RAVA 5L46A 1OLUB 1SXPA 2CWWA 5A88A 1GL7A 1RI4A 3QWAA 1JHOA 1DDIA 1JKMA 3OZTA 4WZAA 3WICA 4KXVA 2H5LA 2H1OA 1PJ2A 1R0XA 1CUCA 2Y1CA 3F2VA 5EQDA 1MOSA 3VX4A 3N86A 4EB0A 3UT5B 4BNDA 3WNBA 1Q15A 4HEA6 2A0XA 4XN3A 2VPZA 4CRWB 2ZI7A 4O4HB 4OYRA 2Q5EA 1SRQA 2GLXA 2PBZA 5IKPA 3IQZA 5LMCA 1FQJA 2YXBA 1GRNA 3LA6A 2AI3A 3MS2A 4MLPA 5THKA 4CLXA 3D3WA 3GIWA 4XWGA 2ODBA 4QVAA 3OQIA 3O92A 2ZWVA 5LZ8A 4ZAVA 3R74A 4Z4YA 4GZ6A 3UG7A 3CVXA 1DCTA 3PVDA 2XDQB 3U7IA 2UYCA 3PNMA 2C54A 3NTVA 4HNAB 4A73A 4WQMA 1LF5A 2DLNA 3C41J 3UFBA 4NTZA 4AICA 1R5JA 1SXJA 1XEAA 3R7AA 1QV9A 3FVQA 4GYKA 1JLSA 1SVIA 1EESA 4KXYA 4M9ZA 5PGMA 3BMXA 5EERA 2J3EA 3MWDB 5K3DA 3ZIDA 1AH2A 3ZQ6A 2TYSB 3B1FA 3B5IA 3KV1A 3RRXA 1U0SY 1XDUA 1RJEA 1JQLB 2SICE 1KAQA 4DA6A 3Q9NA 3OPMA 1IH8A 1NG1A 2PRSA 2KW5A 4HJXA 4E33A 3MJTA 1OLSA 1JJ7A 4NSNA 4WLEA 4X7EA 4HEQA 4UOEA 7MHTA 1CUSA 4AZ3B 4P0TA 3IP6A 5I7RA 2C7RA 1YJQA 4OYHA 2O8CB 1HDOA 3RJMA 1JZTA 1CUYA 2F00A 4DLSA 3TIFA 1XVTA 4AT1A 1WIWA 1ZJ6A 3D5EA 1I0IA 4QDZA 4ZMBA 4QOJA 4TXMA 3GP3A 1VG1A 2TMGA 3BIOA 4BDTA 1GZUA 2ORIA 3H5TA 2RFLA 4J43A 3UOAB 4C0LA 2HO5A 3JQ8B 1OHHA 4IX1A 2A1TS 1U2SA 3ZWOA 1FSSA 4KFTA 2G1PA 2ZBFA 2GAOA 3DM5A 1AV7A 3OETA 4OM8A 2YNMC 1SD1A 5DOVA 1HYQA 4NZYA 1NM5C 2HJWA 4IQGA 3EPJA 2XWSA 4KIUA 3C7TA 5SV2A 4V1CB 1KMIY 3JWHA 2W9XA 1GTZA 4O3MA 4S1PA 3TSAA 2JCBA 4C0WA 4DJTA 1TZ2A 5AVWA 3R6GA 4DN6A 1ZN7A 2G76A 3DTNA 1H4QA 2ZI3A 1UDRA 4UREA 2IFTA 3A2NA 1ZSNA 3B2QA 2CE2X 4GUDA 4NVRA 3GLHA 4WUVA 2M6LA 5IWAB 1EWYA 4J0JA 2WFLB 3WMEA 2VDVE 3N75A 3HXLA 3N2KA 2QJWA 3KQWA 3CFYA 4EOGA 1EWVA 3AR7A 3C1TA 4DLKA 3OQPA 3OWHA 1DQZA 2IDZA 4XDZA 3GMDA 2EBWA 4XFJA 1GGHA 4BFLA 1QO9A 4J7CA 3G5MA 3JTEA 1I3OA 2GVDC 3CPHA 1RD4A 4L74A 5THQA 2OFWA 4OUKX 5LWQA 3AF2A 2ATIA 1G66A 3CTAA 1KO4A 3WNVA 3R4CA 2UVPA 1RHKA 3TIGA 1O9GA 1RXCA 5HF5A 5GOZA 3SLGA 4AURA 4D4LA 4RZSA 4LRUA 4AKSA 1US8A 1SNYA 5JYBA 2XT0A 1KJWA 2YVUA 1G55A 5EXXA 1KMMA 3I23A 3IAHA 3IA2A 3IMKA 2VK1A 3MVEA 1IEVA 1S2DA 1U8ZA 4HLNA 1QIDA 3LXRA 5HW0A 2VUHB 3RANA 1F7UA 4DLXA 1LJUA 3FBGA 4BQQA 4AWBA 4EI8A 4IIJB 4CLOA 3V6LA 1YR1A 2GZAA 1JKJB 5BSKA 2YXDA 1N0VC 3UPDA 3VH3A 4DIFA 4Q48A 2H2WA 2YIJA 1RPJA 4M0MA 4NWIA 3UCEA 3ZHZA 3QWHA 1CZHA 5CM9C 4F0JA 5LD2C 4AI6A 2R0QC 2Z57A 4PYKA 2CL6X 1BXGB 3FUCA 3MCVA 4JEIA 3C2QA 5EVJA 1PGNA 4JJ6A 1M6HA 3JVIA 3EIFA 1BHO1 2F64A 2IUTA 4A0GA 2RARA 2F62A 2ANCA 3LKBA 4JASB 2AN1A 4RTRA 3I9NA 3M6XA 3V00A 2K4MA 3GGPA 1QYDA 3GMSA 3MQ2A 4IZOA 4AXXA 1YZFA 3EY4A 5DYTA 3ZE9A 1ODSA 3IPLA 3ESAA 3LUAA 4XB2A 1KA9H 4WZBE 3M49A 2QMHA 3A4NA 3AHDA 3HB0A 3MRVA 2Z1DA 1E3JA 1ODTC 2J48A 2OG1A 3DCIA 4LNAA 4NFSA 4ZAGA 2FMFA 2R11A 4REQA 1EUCB 5DULA 1A9RA 2FP4B 3PHJA 3ONYA 3R5XA 3W8FA 1BE8A 1NW4A 1ZDMA 1C9YA 1CUEA 1ORRA 2C4VA 2OC9A 3AP1A 3E9NA 3OBBA 4TQUS 3ZHVA 1AXGA 1H2YA 2IUYA 4Q4LA 3GG2A 1YQDA 2BWJA 3E8MA 4LRQA 2HSWA 4NCXA 5CNJA 5WRFA 1Z28A 4IJUA 2QTFA 1XWWA 3HLTA 1VB5A 1Q19A 2DTDA 3NCTA 2BKVA 3WMWA 1OB2A 3JASA 4UBNA 1BDBA 1I3MA 1Q1ZA 2QQ5A 2ZJ0A 3GYGA 3ZH2A 2YBDA 2ZYHA 1QOPB 3ELYA 1K3UB 1P9WA 4JT2A 3QZUA 2P8SA 2Y68A 1A1VA 3DOIA 3DUWA 4EENA 1GZDA 2Y67A 4D0NA 4H08A 1NFFA 3HCOA 2HD4A 2QTWB 4AJIA 1UXGA 5TSDA 721PA 3UHFA 1NONA 2CLOB 2F4VB 2QVBA 1G8SA 2BLNA 3KPYA 2XOEA 2O0JA 1R6XA 1SKYB 4ZGQB 1R8SA 3C7KA 4YCAA 4F4UA 4KQJA 3ZXSA 1KQFA 1FFCA 3DZIA 4FONA 4HDNB 3EOZA 4WOCA 2PU7A 1B8OA 5K0GA 3FGOA 5I7SA 2WUEA 4RTKA 1LFAA 1VP3A 1E6KA 1A72A 3DO5A 3BGIA 2CLEB 1UK9A 3ITNA 4UPEA 3GH1A 4IJKA 3RB8A 5L6LB 2A0KA 4UHFA 4BNVA 1N06A 3PWZA 3ZCSA 4OUDB 4G4SO 1EFHA 1E89A 4ZVNA 4UMEA 4LC0A 1GSIA 3FZQA 2BI8A 1C9KA 1KHTA 4L02A 1JMKC 4TS3A 3LDGA 3LLVA 4N18A 5F7XA 1P1KA 3IUJA 4CF5A 4B5LA 1T4GA 3F7MA 3PDUA 4A1FA 1QP7A 3ETNA 3K4PA 4QGAA 5C7OO 2X85A 1VQ9B 3V1LA 4QC2A 2ZIWB 2Q41A 4IICA 4RESA 2YV1A 2Z30A 3PJFA 4LKRA 3SNKA 3PLAE 3VC1A 2EWMA 1X8LA 3MB8A 4FYHA 1T8RA 2QRPA 4DMRA 3R6WA 3OX4A 1UDAA 5ALNA 4FYYA 4GQAA 4XSGA 4WJKB 1P5HA 5TRDA 2EEPA 3F9RA 2OV8A 5BW4A 2CLDX 2O7SA 2YRXA 1JMYA 3O91A 4ZZIA 2QEXB 4RVDA 3GRCA 2D2VA 1KYTA 2BR5A 4BTEA 5KC9A 1GLVA 1EAMA 2C9MA 1BN6A 1RQLA 3HXPA 4X44A 2OCAA 3T4UA 5EJ8A 3W3ZB 1J9ZA 2VOEA 1LDYA 1GITA 4OXXA 3OLQA 4QDTA 2NO9A 3EWNA 4L08A 3AI3A 4K0RA 3RR2A 3G2MA 1CUDA 1O1YA 2VDWA 2HCTA 2QTHA 1TM4E 4CF3A 5ALXA 2HSZA 2MSKA 4G37A 4P83A 3F6SA 3IAS1 4HDMA 4X1IA 3FOAA 3AVVA 3CNOA 5ALTA 3NKVA 4B09A 4F38A 2WNHA 3QU7A 5GM2A 2O9JA 4II7A 2VHUA 2A1IA 5E1DA 5FBRB 3RK1A 1OJLA 3KXIA 1VE1A 3ANTA 2XQJA 5JZOA 1Q17A 4BN5A 5CVDA 3GJ5A 2OYRA 5J2UF 1RRFA 3LQEA 5KYVA 3AR5A 2CXPA 4B82A 3RS0A 1C9NA 1F6BA 1ZI6A 5COBA 1P3Y1 3ZCTA 4DUPA 3IAS6 3D6AA 4FDVA 4ICIA 4JOCA 3SHFA 5AYVA 1H6BA 1M33A 2PLFA 4G23A 3L18A 2HRCA 4MYTA 4I1UA 4PZAA 1NBMA 1EQAA 2HWKA 4NNPA 5FV7A 4EF4A 2XF2A 1WUJS 1ZD1A 4AF6A 2E89A 2EAUA 2VWQA 2QYHA 3ZD8A 5HSGA 1ISJA 7GPBA 4U7FA 3LGXA 1H4SA 4QM7A 4GKKB 4FUQA 2LDBA 5CX4A 3ZLTA 1TX4B 3EDMA 4HQ6A 4NE7A 2C2MA 2H4WA 1M6WA 2LPMA 4RLQA 1G9TA 2VRCA 3IEVA 1GPAA 4K8OA 2C59A 3SEFA 5EXDA 2FMUA 3FWZA 3D0RA 3PHBE 5P8WA 2P0AA 4WE3A 2GRAA 2E7ZA 2W4IA 3C70A 2VLBA 3ILYA 1MJFA 1S3SA 2ZZEA 3WLSA 2G0AA 2NZYA 1VSVA 4BE4A 5KOHB 1O94C 4JC8A 3CPXA 4BMSA 4KRXA 4ZRDA 1CDZA 1KSGA 3M5DA 4XIFA 3CNLA 3TTTA 4Y98A 1NW9B 1TB4A 5KNCD 4UCQA 2ST1A 3LTNC 3H9JA 4Q4DA 5JXHA 4BVBA 3G68A 1UBCA 2RHTA 4KYVA 4EFKA 2OESA 2D4HA 2FXIA 1TPZA 1BKSB 2QX8A 2QIOA 4BKUA 1H65A 2BUCA 4TWIA 4QJ3A 4NCBA 2CXOA 4GSKA 1G16A 2PGOA 2Q45A 5T3YA 2XYHA 4AMBA 1U3UA 4NV3A 4R41A 2AJLI 1NN1A 2NG1A 3ZCRA 5IH7A 4JODA 3LXMA 1G38A 5IYWA 1NJ6A 2GI4A 4PTLA 1KY3A 1H0SA 2OFPA 3IV9A 3KQYA 1ECGA 3M6IA 4U4AA 5HMMA 2ZRFA 1X87A 3KAJA 4GP7A 3O82A 2C1XA 3VU9A 3HSYA 1U99A 2AD1A 2II6A 2DBZA 4J7UA 2FWIA 3GRAA 5ENZA 3T5DA 3W05A 3GLKA 3LMKA 4DYHA 1N5KA 2X5OA 3QLEA 1QYRA 4UFPA 1DO8A 4LRSB 1M8FA 1XDGA 1OH7A 4JV5B 3G6KA 4MPRA 4E31A 2B4AA 1P0QA 1B0PA 4AZVA 2QPTA 4Z1MD 4OOSA 2GYWA 1REQB 1PSDA 4D0LB 4I6EA 1WMBA 1VQMB 1QB8A 2W6ID 3QOWA 2YWJA 5SZKB 4LNUA 3HA2A 3UKOA 5AW3A 1TRKA 2P90A 4BKOA 5BN5A 1TLLA 1W44A 3DVAB 4A5SA 2AR0A 3PFHA 3AVQA 2DUMA 4IQFA 1C30B 5JE8A 1R00A 3ANYB 3ZE6A 2ZXUA 3OLYA 1YQ9A 3TIIA 3T12A 4MYCA 1PT7A 5L3SA 5CUQA 3WIEA 1RM5A 5E9QA 3ZVLA 3UOWA 3OMLA 1DEXA 1OYOA 1N7GA 2AMJA 4TTVA 1PK9A 5EINA 5HQJA 5ICSA 1HNXB 1Y82A 2NMVA 1DBIA 2BFFB 3OLVA 1P81A 3FJYA 4LJ9A 3VYTB 1GPWB 1UOPA 1BRMA 2PZEA 1ORVA 5FFFA 4S35A 1AQNA 1QQAA 3NUGA 3BC1A 4QXRA 3KVVA 1R5BA 2VHCA 3HG7A 3R6JA 3W9YA 4LGCA 5IF9A 3IIEA 4M1KA 2QBYA 4MEAA 1RE1A 1EVKA 4FSDA 4LN1A 3STHA 1ZCFA 3I01A 3JALB 3O3MB 5ALFA 1V16A 2Z5GA 1U1DA 4ALIA 1E5LA 2VJQA 4BX9A 2TSYB 1TC2A 1GQFA 3GFGA 4Z9XA 2QNIA 3RT7A 3O8DA 5LA6F 3HYCA 4EL0A 5EJ9A 2Y2VA 4E5MA 4CMJA 5HF6A 4Z54A 3GGSA 3A1DA 3L8ZA 2GEFA 1JS1X 1EFTA 4FE7A 4UXHA 1VPDA 2AX3A 1K88A 4GKVA 5D51S 7MDHA 4OIFA 1SKAA 4FCTA 1FF9A 1U5BA 3WXMA 2A30A 1YRHA 3B3JA 2R7LA 3GC6A 4TS9A 1U9ZA 1R0CA 2OM2A 4X5OA 1DAPA 2UUBB 2B4TO 4YELA 1ENZA 1RWXA 1UJBA 3HCNA 1L5OA 3D7LA 5BMVA 1SMKA 5JSFA 3KHTA 3L93A 3NBMA 3U4QA 2I4TA 2W93A 3D6HA 4WK2B 3U31A 4AMVA 3TG2A 2D7DA 2AFHA 1Q9SA 2P3OA 1IAQA 5JD4A 1EQ2A 2KJQA 4G0MA 2DKFA 4ITUA 2AB0A 3MJCA 1FYVA 1WPXA 4GP6A 4CKXA 2FA9A 1B93A 4S1TA 1YGPA 4C6HA 1OX4A 3G23A 2RGGA 3U81A 5CLFA 5LUBA 2FFJA 3L05A 3O4IA 4QJBA 4ZTBA 2GXQA 1A69A 2M32A 1UOQA 3T34A 1B3RA 4FX5A 3BD9A 3T7AA 3AWIA 4GRAA 3ZUPA 1UP4A 4NPHA 4D82A 3HCFA 5EESA 2DF8A 1ST3A 4S3MA 4AECA 2QL9A 1ZXLA 1U94A 1G6OA 1N8NA 1WXIA 2XQGA 3EGOA 3KRTA 4TLCA 1IHDA 5DNWA 3SIXA 1A8IA 4KHZA 4HYTA 4JROA 2WY2D 4TL9A 2GJ8A 1LNSA 1G42A 5LCXA 3KZMA 1U4OA 3KOZA 3NHSA 5CEEA 4R1NA 5I7HA 4URZR 3E7DA 4UBLA 3HZOA 1TQHA 3CVWA 4ZMSA 3LRXA 5JUWA 4HB0A 1D2MA 4JXJA 5KQSA 5B6IA 1JWAB 5A3SA 5IU6A 1XUOA 2VAXA 3AEQB 1P7PA 2ZM6B 5SZIA 4YMUA 1N6LA 2N3ZA 3ZK8A 3IKTA 1WXXA 2IXEA 2JLAA 3EGXB 1XA0A 3FPAA 5K7SA 4FFWA 1GV1A 4GI7A 1EP9A 1IZ0A 2GS9A 2QD2A 5GJVC 4HLUC 3BMCA 1E96A 4AQ7A 2FPWA 3IAXA 4M1YA 4DSAA 5ES4B 2PMWB 3JQAD 1HX7A 1ID8A 4Q93A 4V1CI 3HVIA 1E8DA 3BTVA 1NTRA 2QTAA 4YCBA 4BYGA 2HBQA 1E6EA 2GX6A 4BNMA 3R9XA 3JZFA 1PU2A 2QA5A 1F3LA 3FBTA 3K31A 4AY2A 2B3TA 4PRLA 1R3UA 3RFXA 1BYIA 3PQFA 1JXOA 3S28A 5D85A 4LBZA 4YDQA 3FSJX 2QZ4A 4RPCA 1MX3A 5DFAA 3WSTA 3EG5A 2V1XA 1TPYA 5JRZA 3EPRA 2F17A 2DM6A 2W2MA 2WIFA 4X20A 5DYYA 2W2QA 5E6RA 4C03A 4D41A 3M3PA 3O4VA 3CCCA 4R54A 4AD8A 2J0QA 1Z17A 4FMPA 2F9MA 2YN0A 2WIKA 4MP3A 3OCUA 4O2BA 4EG5A 3A9SA 2KSQA 4Z4EA 1CEYA 5HXBA 2R79A 5AFSA 1Z9BA 3A6FA 4DTIA 2IHNA 4DKXA 4YDRA 1KRWA 1ZA1A 2O6HA 1L4GA 1V25A 2YX1A 4ZQCB 1IM2A 4EFMA 2X1MA 1DX9A 1JQAA 1UKBA 2FVXA 4H17A 4E5YA 3MIZA 2ERYA 2WM2A 4G26A 4GS5A 1DSSG 1FRNA 1X9IA 1HLFA 3PXCX 2P3QA 3D6VA 3NB0A 1GZ4A 1W76A 2NYRA 3PWTA 2XB9A 3TLXA 1FP1D 2X76A 3VJMA 1H3NA 1ZBDA 2CNOA 3KKNA 5HOQA 5H59A 2FPRA 3ITDA 3QW2A 3YASA 2GK6A 5AM4A 3WKCA 3PE6A 3KYCA 1JHQA 1N2GA 1QBGA 5IJAA 3STTA 2IU3A 1DKQA 2BF7A 4O5OA 2QTZA 1VDZA 1VIDA 3FYHA 3CU5A 3OBIA 3TSCA 4G0YA 1DAIA 5EP1A 1F8GA 1S01A 3MTJA 3II6X 4PCUA 1WSVA 1GYQA 3D1LA 2H2GA 2OMEA 1CUWA 2JF0A 4P32A 4YR7A 4HDSB 2GK4A 1D2RA 1SGWA 5EHXA 3NP7A 4C7KA 3JYOA 1TUGA 5EA2A 3PEEA 5B3JC 4RHEA 2FN4A 3C5CA 4HFMA 4MKIA 1XLVA 4UQPA 2QMZA 3DHWC 1J0EA 3T0FA 3WRYA 4LJRA 1B1CA 5LXTF 4BGUA 2W48A 1Q14A 4RFVA 1P4JA 1XKQA 3CS3A 4RQUA 1JRLA 2HKIA 3LVQE 4TUYA 2ZZQA 5D6NA 4ZJUA 1LU9A 2M9MA 2VF8A 1T1RA 3RIEA 2D0IA 4RTMA 3QI7A 4BFWA 2HY7A 4GM0A 5FD8A 4K26A 4GGPA 1GNQA 1WCYA 1IQ0A 1OAOC 3O1IC 4URWR 3Q72A 4EGCB 2FX3A 1E1MA 3N5CA 2IX9A 4AP9A 5I6DA 2B94A 3W6ZA 5A2GA 4WXPA 4LEIA 3RNOA 3WYEA 9MHTA 1BU5A 2C3OA 2WMDA 2RGYA 4M7OA 2RKOA 5DHRA 5EUCA 4C2AA 3IESA 3MMNA 3K6JA 4U02A 521PA 2F3PA 3SDSA 4P3YA 4PLGA 1EUDA 2A1TR 4C88A 5KQLA 1JE0A 3QX9A 4IZHA 2IW1A 2OO5C 5JTUA 4QYWA 4TRMA 3LW8A 4L22A 4ND3A 2R6ZA 1YA8A 2XKKA 1KSHA 5CT5A 2DECA 3TUIC 2QM8A 4OL9A 3BRWA 4B2PA 4DVJA 1LRJA 1SVWA 3KZOA 5JD6A 3WYBA 1IZ7A 1CUHA 1QK4A 2JCGA 4X8LA 4EG4A 4A1OA 2GCNA 4OGLA 2DHRA 1R88A 1QKJA 2RGAA 3Q7RA 3VZPA 4HH0A 1PX2A 3DBLB 1KPGA 2XAAA 1M8JA 3ZGVA 3GEPA 3E2MA 4L8WB 4NEHB 1FY2A 1K5DA 3RKRA 3GPIA 1EJ0A 3P27A 1J42A 3IBTA 5J4LA 1E2NA 2JAUA 3WK5A 2B9EA 2FE4A 3TGPA 1JLKA 1DWUA 1ECFA 3RSCA 2CLLB 1E43A 3PFFA 3GJ6A 1F1BA 1NXPA 5DH9A 4EHBA 2IBMA 5CD9A 2DXIA 2JVJA 4KQ2A 4CEHB 2O2YA 4KU4A 1MNAA 3HCBA 4WK4B 1JU4A 3EX7C 2XRYA 2BMDA 3BFJA 4K9OA 3MA0A 4EHIA 3F5SA 4RY9A 4RVHA 5DJ5A 1CEEA 4MITA 2ZBEA 1M2OA 2CJWA 4NU8X 2OVBA 1J5PA 2AG1A 1MIHA 2VUUA 2XRFA 3C85A 3PF8A 2VSFA 4PXYA 4TTAA 2YICA 3ZTTA 5A5GA 1HE1C 2V3VA 3GVIA 2WU3A 3W3AH 2FPXA 4UEKA 4B34A 1PO7A 2K87A 2BDUA 4HK4A 1JP7A 1K7SN 2FXVA 1QH1B 3M3HA 3NKLA 3ZE8A 3AX6A 4QASA 1J0AA 2QR5A 2XCUA 5E7JA 3UFXB 5JH7F 1J90A 3DE6X 3DE4X 5DE3A 2QE7A 4H6XA 3GFQA 4I4TB 4QBFA 2VNKA 3L7BA 3T3IA 5A04A 1BKDR 2IXBA 1PKVA 1TF7A 3QY0A 4NJMA 2PUBA 3HKEB 2B20A 4EHJA 1CJMA 4C3UA 5BQ5A 1RQPA 3E48A 2JB9A 2JI8A 3OZ7A 2ADOA 3KAQA 3OU7A 2I55A 5H7XA 1N6HA 2OTLB 2CLKB 1E7SA 4HWPA 1MVLA 1RWMA 5REQA 1VXRA 2A4MA 3JZDA 1T5TA 3G2LA 4IHJA 3WL4A 4E2FA 1U1IA 3NWBA 4WADA 4U7PB 3WDMA 4BE9A 1R18A 1L7PA 4JEMA 1SZDA 2DJ5A 4JH0A 4QEZA 2XYVA 4ZTUB 4DLZA 4RYLA 5JISA 3HUEA 3SIWA 2NO1A 3ISTA 3SPXA 5LDGA 5HQ3A 1KTVA 1U3FA 1I5EA 2ECOA 3MLEA 1MB2A 5ARDA 3UJ7A 2X1HA 1ZKMA 13PKA 1BE0A 4NECA 3OJEA 4TMTA 1CBUA 4ZZ1A 2Z6VA 5I01A 3EDCA 2J6BA 4TV8B 1V41E 1T5EA 1NXSA 5AOBA 1EXWA 2YV4A 2AXQA 4AY3A 4RCZA 2BP7B 1QIIA 1ZCBA 4WMLA 4MV0A 1WOSA 1XFOA 4CKEA 4ZPJA 4FMDB 5JZVA 4KWIA 2P5TB 1U2ZA 1H1DA 3T4XA 4B83A 1E6UA 3JQBC 4D8VA 1P31A 4J0GA 1RI5A 2J0SA 2VP3A 2A9VA 3CLVA 3GVCA 4DSNA 1R8YA 1G5FA 4MS4B 3F6EX 4BCBA 5CX1B 5IC4A 4KO8A 1CRWG 3GDOA 5FL7D 3WAKA 5KX5A 3GRYA 3BFPA 5BYJA 2GHIA 2VYVD 1E2MA 4I46A 4MR8A 1NW7A 3MPOA 3K8QA 4QUZA 1JIUA 4I1IA 3FLEA 1LJLA 4JLWA 4HS9A 4C7XA 3MAAC 1XB2A 2XE4A 4IMIB 4DXAA 3U9SA 3H0CA 3D02A 4YONB 5CCBA 2BMWA 3DZGA 2DUNA 4PHHA 2ZW9A 3LYUA 5DM70 1SY7A 2XWBF 4LQLA 4WVFA 3EFHA 3BTUA 4YS6A 1GUYA 1NUUA 1MAVA 5CT6A 3ZEIA 5IYZB 4H7PA 4Z2AA 4JP5A 3K2IA 2H1IA 5BW5A 1IULA 1D6MA 5DVZA 1PZFA 4WOKA 3PXBA 5DGDA 1FBTA 5TGTA 3QIVA 4Z4RA 2CEAA 2ZT8A 1V3QE 5GONB 1KEKA 1M34A 1BGWA 1X8JA 2FZWA 2QL6A 3OOEA 2QMQA 4FQ5A 3VR6H 3GEDA 1QGYA 3TI9A 2FMKA 4CR6A 4JOQA 1B6RA 4BQPA 2OD9A 4M1SA 1FZTA 3A1VA 4XD7D 5FTKA 1PQPA 2YXEA 3JQAB 1RQXA 2IYRA 5JNSA 1Q57A 1EZZA 4GOLD 3C45A 2V97A 1RQ7A 3CF6R 1ZK3A 1VMEA 2A58A 2ZCUA 3O2SB 2AYYA 1FMTA 4DG5A 3U44A 3I9V1 4X8MA 5DW3A 3SWWA 5A9TA 3KSMA 1NKTA 1KIFA 2H2HA 3NVMB 4IDCA 4CL8A 3GRVA 3K0KA 1UP7A 1BA2A 3KZCA 5DYGA 1O0BA 1CY1A 1KC8D 3PUHA 3JQEA 2C03A 1C8BA 3OJLA 3HVRA 4MDEA 1F8FA 4ZWNA 3B1VA 4N40A 1ZXXA 3LVFO 2CY0A 1RPNA 1IRXA 2QGFA 1A27A 2A2ZA 3ZW7A 2ICAA 2JJ2D 3VZBA 4F97A 4QM6A 1O4WA 1NVGA 3QV2A 1PTJC 3P2IA 4LYEA 3HNPA 4BV2A 3LHDA 2HJRA 2XUOA 3UK2A 4C78A 2JIRA 3K1YA 1QMGA 2VK2A 2JAWA 4JCOA 1L4UA 2YMPA 3OOYA 5JMTA 1ZYUA 1E7YA 1MOZA 2BPOA 3HEMA 5AOAA 4EHNA 2P5SA 1NYQA 2OA0A 2OFFA 3CSDA 4CU2A 1C2YA 1O4VA 1R6DA 1D6NA 3HB4X 3P4XA 1DQNA 1EK1A 4R98A 2YXNA 4MS1A 1AVTA 3H2ZA 2NADA 4U2FA 2ETVA 3OD1A 3R7LA 1A71A 5JCXA 5KNDD 4RELA 2WG2A 2X1VA 1GOTA 3SF0A 3B9QA 3ZWKA 1B1AA 2OCBA 4QVKA 1CF4A 3MT8A 1E62A 4JDUA 5FBQB 5JS1A 4G36A 2V7BA 2SHKA 4IVQA 1RWNA 3OICA 1G3UA 3RUCA 1J20A 1IPHA 3F49S 5K6RA 4ZU3A 1V5GA 4GQBA 5GIOE 4FXPA 3NASA 4Z4GA 4RENA 4KLZA 5BSUA 2I7CA 1EGVB 5FDFA 2JBAA 3IKJA 1Y89A 2FSIA 4OF4A 4EHKA 1Y6FA 3PB3A 3H9GA 3COJA 3LUJA 2WFMA 2VHYA 1TT5A 5H0IA 2O2HA 1BRTA 3VC7A 3MQ4A 1WOPA 1BW9A 2WLTA 3FI0A 3SSOA 4D4JA 2WMYA 4ARUA 1FP7A 3SR3A 1DAEA 3G71B 1TMYA 2P67A 4DK0A 2FOIA 4CM8A 3CXRA 3CCRB 3OQ6A 4OHKA 4PPFA 3TD6A 3VQTA 3PCTA 1F20A 3DDZX 2BRUC 2EFEB 1RLTA 4KPGA 5H81A 3WO0A 1XDZA 3DZHA 5BV8A 1ZP6A 4PANA 3CM0A 1XRJA 1BH6A 4R8MA 5ICEA 2JCYA 5FHQA 4OAOA 3D0KA 1U2RA 1B8VA 3PFCA 5IYPA 1GA4A 5E6SB 3U7GA 5KBYA 2IIQA 4FHGA 4QYSA 3Q9LA 3KDSE 4QG7A 1HRKA 1VRVA 4JJAA 1URPA 4RABA 3GROA 4FS8A 4MQEB 3I62A 2IITA 2FPUA 1ZI8A 4G8JA 5T3UA 4RAQA 2WIDA 1YC2A 3HKCA 2WQZA 1MNQA 3Q40A 3V76A 1C29B 1RABA 3E6AA 3IAM6 4Q66C 3TRFA 4JBNA 5D3KA 4KXNA 1R7RA 1UKEA 3KELA 5JEDA 1FP4A 1HOTA 2AFIE 2CF6A 1E2FA 2WDZA 1U7UA 3H8WA 4FEAA 1XLTA 1YFJA 1PNRA 1V6SA 2X4LA 3AY6A 3SDBA 1RYDA 1IPEA 3PYXA 2CV0A 1HDCA 4G81A 1UMDB 4E2ZA 4LIPD 1BD3A 1X3SA 4EP1A 2R96A 5LZ4A 1SOMA 2IQ5A 3HJHA 1V45E 4KLCA 3M4JA 4BVLA 2HR1A 5KNBA 2X2PA 4WINA 4WV3A 4MQMA 4TSFD 5KPDA 1F12A 1RSZA 2OGTA 3ABSB 1Z63A 3G2IA 1X7DA 3FR8A 2ONCA 3IEXA 4MKZA 2NPFA 1XAIA 3H1EA 4QE3A 4RVCA 3PKJA 1ISRA 4O25A 4QFBA 1WHSA 5KWEA 4YGXB 4LXYA 3FYTA 5FUXA 1EVYA 3PXXA 2VN8A 4QUEA 2F43B 2W2OA 1OBHA 3BBLA 4KKTA 5EFOA 4B3XA 1Q2XA 4IDGA 5F7ZA 3SDZA 4I5GA 4ILEA 3HZRA 3FROA 1TRHA 3L84A 1DOHA 4Y2UA 3W7BA 1JDZA 1XHLA 5K0EA 2BTEA 4MYSA 1YT5A 2JJ8A 4E4YA 1GWNA 1YJCA 1G291 1IONA 2VZEA 4UUOA 1WR8A 3AB7A 4CQLA 5JHHB 2B37A 2YY5A 2VBVA 1FTWA 3FMIA 1E2UA 1HURA 1YS2X 3HJBA 3PRKE 5H80A 1IN8A 2IUUA 3RVPA 4G0VA 3HDQA 5F1OA 3SQDA 1CF9A 3L04A 2EARA 3ANMA 4Q4JA 3FWYA 1KNXA 1HQCA 1W0KD 4MLZA 1J70A 1E18A 5EAIA 2O54A 1LDGA 2ZJ8A 1P39A 2IYZA 2F1JA 3WBBA 5DBEX 1OI3A 1LNZA 4A03A 3O03A 3PK0A 2VF7A 2QLLA 3KQUA 4XGNA 4ZAYA 4D57A 3WK4A 2J4DA 3FTQA 3PHIA 4JQCA 2L0XA 3ZQ4A 3D64A 2YNMD 1T8PA 2JAXA 4PAWA 1U6JA 3OFND 4XN0A 3FTEA 2AA3A 4K6CA 1CB7A 1CJSA 3IODA 3P94A 4L5BA