2PLFA

The structure of aif2gamma subunit from the archaeon sulfolobus solfataricus in the nucleotide-free form.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into the Interactions of the Translation Initiation Factor 2 from Archaea with Guanine Nucleotides and Initiator tRNA.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 87
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plfA01
4NPHA 2FZLA 2I4IA 4CYMA 4MKFA 1CR2A 1OYYA 1XPRA 2CL7X 3W5VA 1XEWX 1FQKA 3VMFA 2GJ9A 5H1YA 2DWOA 3AH8A 3AF0A 1FX0A 2G1KA 4RKFA 1K5DA 3NBZC 1LFDB 2QP3A 1QHIA 4V0LA 5DSZA 3UATA 1L4UA 1RVDA 2JIZA 5HE9A 3OIWA 2V3CC 3VKHA 2FPLA 4JLDA 1VKJA 2OAQ1 1WDTA 4JLNA 2VF7A 2GEUA 1GUAA 1I7PA 4FN5A 3WNCA 2GEDA 3MGCA 4FMCB 1G8PA 3AKDA 2OESA 2O5VA 3KXLA 3ZBUA 4F7DA 1ODFA 3VR3A 5JWRA 3W34A 5E3HA 5CJ2A 5JLJA 3B78A 1G8GA 1DG1G 4EPVA 4CEHA 3B1VA 2AXNA 2CE7A 3UMFA 3IO3A 4OI1A 2VH5R 3CNNA 2IYTA 4KLZA 4QHSA 3ZS9A 3ADBA 2ZANA 1E94E 5DHFA 1FNMA 2RMKA 1CF4A 1NVVR 2ZEJA 3K70D 1CJVC 2ZI7A 2ORIA 4JZKA 4LV6A 4M1TA 3TLXA 4IDPA 4DUGA 1P9WA 4XD7A 3C16C 4LBYA 3NDBB 3FDIA 3TAUA 1BS1A 2B8TA 4MGIR 1OE0A 1NN0A 2CCKA 1W46A 1R4AA 2PMKA 2Q21A 1LV7A 2OFWA 1JR6A 1FX0B 3CMAB 4EQ6A 8OHMA 2DERA 2W0SA 4TMVA 1YR7A 4OHWA 4JLAA 5J4LA 4B73A 1W0KA 4E07A 1YI2B 4JSYA 3TUIC 3TVDA 1H8EA 2BKUA 1R0YA 4A2PA 4JLMA 2PX3A 4JJKA 2BMFA 4K81B 4CRWB 1RYFA 2ZU6A 5BQ5A 3ZQJA 1DADA 2ZSDA 5IK2A 2VSXA 4OI0A 1ZYUA 3UKDA 4RD0A 2CL0X 1Z0AA 2JGNA 1J9ZA 5EE0A 3U44A 2C2HA 4XVUA 4B3CA 1MO3A 4LC0A 4BZQA 3I55B 2GILA 2CCGA 2DFTA 5LDDC 4Q9HA 1KO7A 3U7FB 2EW1A 4B4DA 2ZRMA 4Q4LA 1D2EA 2C77A 3KJGA 1T4GA 2WJIA 4DJTA 4G1UC 1M7GA 2O8BB 3R9WA 4C0AC 4GRAA 3B2EA 1S1MA 2ZRFA 5IRCD 4KI0A 4DLVA 4ON9A 3CH5A 2ZUDA 4A6PA 2IXGA 2XOKA 4BPRA 3AKYA 2QP9X 1R8QA 4QBHA 4HUQA 3TAHA 4BFTA 2VBCA 2C04A 1G7RA 1VTKA 4KFTA 3NEJA 4TTPA 3OFND 2JJ1D 2ZJ5A 1ZM7A 4YMWA 5TB5A 3CRZA 1Z6TA 1GFIA 1P61B 1KHTA 4B33A 1KI6A 2GCNA 4MRPA 3EIEA 1XD8A 4TZ0A 3LBIA 2O8EA 2C78A 4YAWA 1NIPA 4GZLA 3TW4A 3PFIA 1E3MA 1OXUA 1YQTA 2GF0A 4BFSA 2F7SA 2ZR0A 2UVQA 2BPOA 3NBFA 4NP6A 1TQ6A 1FQJA 3DOFA 3FJOA 4EAQA 4HAVA 2BGIA 1JALA 1T91A 1IJFA 3LLMA 4OHZA 4WXPA 3K9LA 1FRNA 1JB9A 3A1VA 5HZHA 3QJYA 4Y0VA 5E7IA 1E0AA 3ADCA 4PX9A 2R6FA 3MUFA 3VU9A 1CULC 2QU8A 4PXAA 3FPKA 3CC4B 1T5LA 4QGHA 1Z29A 3GQBA 3RAPR 1FP7A 4ZO4A 1IN8A 1FMLA 4D80A 2B21A 2O8BA 3SQWA 2ZRCA 3KKQA 2QNRA 3EC1A 1KDTA 4U02A 4B35A 4NCIA 2X3UA 2NZJA 2OEPA 2PEYA 4TLDA 5JWOA 4TYNA 3K09C 5JHHB 3K70C 1QHGA 3VAAA 4LYFA 2B92A 2X2FA 2WJGA 4OJQA 4KVAA 2IHYA 2WWFA 1NVUQ 3PVSA 2R8RA 1SVIA 1OFTA 3CXCB 1KI7A 2R62A 5IK2D 3DO6A 3ETLA 5FL7D 4JVMA 3UANA 2YVUA 4CT5A 2H57A 1YHQB 1DTSA 1OHHD 2XITA 3HYTA 2ZJBA 1OSNA 1OV4A 2LCFA 1WE2A 1DO2A 5AN9A 2QTZA 2Z4RA 1DELA 3CRVA 2JASA 4MUBA 4HI0E 1J8MF 3LBNA 2QRNA 3TUJC 5SZHB 3NDPA 3CF2A 1AS2A 1Z8FA 2PX0A 1K8AD 2ZJZA 4R71A 5DIFA 1LTQA 1FNNA 2XNDD 3WRXC 4M1SA 2QTFA 4HDCA 5J40A 4UXJA 4Q9KA 2GCOB 4G5OA 2C9CA 2FZ4A 2P2LA 4QJ4A 1D9ZA 2WBLC 2DBYA 2FSFA 3HU2A 3GP8A 2J46A 3ZD7A 4EFLA 1CNFA 1GL9B 1X8JA 2QAGB 2F9MA 2YWGA 4ZGNB 4LV5B 5E4FA 2EFGA 2AHOA 3W2IA 4BFZA 3IHLA 3HPQA 1AGRA 1Z06A 5DI3A 5DLQC 5G3YA 3SFZA 1OGJA 3KJEA 1I4DD 3Q5EA 5AJYA 5KDOA 1ESMA 1BX0A 5G40A 2QQ0A 3K0FA 4RFSA 2VP9A 4MRRA 5FI0B 1EFUA 1FMJA 3P1JA 2IYVA 4M9XA 4KAXA 3WHKA 3OF5A 3S1AB 1QGYA 2PJRA 4MGKR 5FBVB 4A2WA 4F38A 2QAGC 1SXJE 1II0A 4KBFA 4E03A 1GSIA 1VQLB 2WKRA 4QFMA 2G0NA 3IKJA 4DT1B 1G5RA 2OCAA 2FFBA 1KI6B 5BN4A 3NG1A 1DE0A 4UNNA 2GXQA 4B76A 1OH7A 2JJ2D 1U0LA 1YZNA 2B7BA 2WICA 3CF0A 3KJIA 4DIDA 3OZVA 1VYVA 4RY2A 3WNDA 2V8OA 1M1YE 1G4UR 4IHQA 3KB1A 5L3VA 2BCGY 3IO5A 1OPXA 3W2EA 2QM8A 1TLLA 4FIDA 4ASUA 1CJTC 3SR0A 3W5IA 3QY0A 1ZCBA 3OFNA 4I1SA 1RJ9A 4RSGA 1JB1A 3G6EB 1KI9A 2XTNA 1GDDA 3KJHA 2FEMA 3VU9B 4ZI3A 5J4KA 2YWHA 5KNCA 4C30A 1OFIA 4OQMA 4OK5A 2V6JA 2WWGA 5JCPA 1FNDA 2QMUA 4B2PA 3OJXA 4PHGA 2E1RA 1YR9A 4TL6A 1ZJ6A 4HLDA 2PCLA 4HAWA 4TLBA 3ZVNA 3K0FB 1W35A 1TUEA 4YMSA 1DAFA 4C0JA 2CMKA 3C7KA 3TE6A 4B3XA 2QA4B 2IYZA 1JA1A 3SN6A 5FL3A 2FG5A 3BC1A 3LW8A 3SHWA 1KOFA 1KJWA 3LV8A 1YITB 3I8SA 1G17A 4TN1A 3O8RA 1PUJA 1GKUB 2FMXA 2RGEA 5FUVA 2QE7D 3LAWA 3R20A 3VR2A 4F4IA 4Y9RA 2A5FA 3V4RA 1RIFA 1JEEA 1Z0JA 4POAA 2DHRA 3CR7A 4PTLA 4MH0R 4WBSA 1UEIA 1E9SA 1DAHA 3FPAA 4HB4A 4PPQA 2VYFA 2MSCB 5SZIA 3B1YA 4LDJA 4KITB 3U7HB 4GL2A 1AS3A 2O8DB 2YWEA 3JQPA 5TDHA 3ZJYA 4DDTA 1XE1A 1GNRA 1T8UA 4OHVA 2ZAMA 2IYYA 4NYIR 2B5OA 2ZSEA 4DB4A 2QTHA 2QBYB 2Q6TA 3VO2A 5AUPB 1FZQA 2ZYTX 4FI3C 1QVFB 3HP1A 4WZAE 4QL3A 1P60A 1G9XA 1MRNA 1E2DA 4FD2A 2QPOA 4B3DA 1X6VA 5EJEA 1I4LD 1G1MA 3OE7D 4RCZA 1RKBA 2IYQA 5G41A 3T1QA 2JJ8A 2FX3A 3RRMA 2N42A 1EWQA 4TSFA 1KDPA 1IAQA 2DFNA 4I1UA 4DKXA 1E32A 1G19A 1OB5A 4R98A 1DAEA 2XTZA 3GCGA 3R9XA 2OXRA 2WIAA 1P6XA 3CIOA 5ANRB 4UJ3A 4GI7A 4A0GA 3QF4A 1J2JA 5FR2A 4B48A 2ZRKA 3GFPA 1Q3HA 3T35A 4F4CA 4PAQA 4QBGB 1HV8A 2AFIE 2B7CA 2RC5A 4FMDF 3W6OA 1T8TA 4ESVA 3THXA 3TKLA 2IC5A 2KBEA 2Q9CA 1YKSA 4AC9A 1ANKA 1W0JD 1W5SA 3BD9A 4OJKA 2FJUA 4JIMA 1AGPA 1UKEA 3UMSA 2D06A 1G8YA 1NDHA 1II8B 5E7JA 1N6OA 1EGAA 3CW2A 1ZUHA 2OFOA 1KSGA 4RD6A 1TX4B 4AG5A 5H5JA 2YC4C 2ZRJA 2JLQA 1TU4A 3CX7A 4JYBA 3V76A 4D81A 5L3QA 1LF5A 5H70A 2ZVQX 4V0KA 4DT1A 2J0VA 1OH6A 2QBYA 4TTRA 3DPUA 2E87A 1D9XA 3DOEA 1NMZA 3B6EA 3AVYA 1YZGA 1Z63A 4PC3A 2GJSA 4A15A 2VHUA 1CP2A 1QHHB 1ZBDA 3SI7A 1G5TA 5KNDA 1YJWB 4RKEA 2EFCB 2FFQA 3QPWA 5EQTA 2R65A 2HEIA 5FTKA 2W00A 5AJWA 4PFSA 2GK6A 2VEDA 3AP1A 1KC8D 5GJVC 5FOUA 4LBZA 2ZUCA 2XEXA 3JZAA 2H1LA 2YINC 4WZ6A 3TSWA 5KHOC 1GM5A 4W7SA 1MO5A 4JKYA 3V00A 3TGPA 2QPAA 2ZJOA 1UBGA 3FHTA 1R0WA 3JVVA 4KYIB 1N6NA 2NMVA 1VIAA 1XTSA 1VCOA 3E5HA 2EWVA 1IONA 1ZNZA 3B85A 3EZ2A 1VCNA 3G82C 1KK3A 4QNRA 5A4JA 1E2QA 5H59A 2QT0A 1JR3A 3HPRA 3B82A 1IQPA 1ZC4A 2VSOA 4QGFA 2PL3A 2NPFA 5J4VA 3BAFA 4LJ4A 3VR1A 4FCWA 1VG0B 2NO6A 3QG1A 1G291 4JLBA 2XAUA 1K5GA 4DIEA 3PR1A 4AY2A 2FNAA 4F7WA 1XMIA 2ZRDA 3NKVA 1QUEA 3U6KA 5D3MB 5K8UA 3MFYA 4DLYA 2F1IA 4I81A 1OXXK 1TADA 2RGXA 2XZLA 2P5TB 1VHLA 3TSZA 4HLCA 4FW9A 2JA1A 3AVTA 5AJZA 4DSNA 1YRAA 1W5TA 2OBNA 1JEDA 1LS1A 2ZI9A 3MWKA 5KUTA 2REOA 1OKKD 4L9SA 1I2DA 4EDHA 2QT1A 2DEUA 1BO6A 2PT5A 1R2QA 2H7VA 2R6CA 5THXA 1MKYA 4Q1EA 4XJXA 3TNFA 2AL7A 3FGNA 3WRYC 1JXMA 4M1YA 1EXMA 3CUEF 1QHXA 5G53C 4QKQA 4XVQA 1U90A 3GEEA 4W5WA 2J0QA 3CH4B 3QSYA 3U3KA 5DN6A 2G0TA 4NCNA 2J87A 4AYWA 2VYQA 4M53A 3P27A 1VQOB 4ITRC 3ZVMA 3SS8A 1QUFA 4PZZA 3B60A 5L3SA 3L0SA 4ZI2A 4QM6A 3ZIAA 4ZIRB 2IS2A 3TSOA 1KSFX 2ZYUX 3L8ZA 3I62A 5HZKA 2GJKA 3B7GA 2OK7A 4QHYA 2ODNA 4PPGA 3AVVA 1AM4D 1XPUA 2BC9A 3VR6A 2J9RA 4JVLA 3LY5A 3AF3A 2NO7A 1JA0A 3A1TA 3MMPA 1KO8A 5AUNB 1XXHE 1K6MA 5KSZA 2PIAA 1YIJB 3LQQA 2ZRBA 2BM1A 3G71B 2EWWA 1E2PA 4WW0A 1TEXA 1N0UA 2GHIA 4Q00A 2JLVA 1O3YA 2Q3MA 2XJ4A 4B32A 1AKYA 2PLRA 1TUIA 2GCPA 4ZKDA 1W0JA 4BLSA 2ZPTX 1II9A 1K8RA 2PZGA 3UMRA 1U94A 1KAOA 3KKNA 5CK4A 2RKOA 3R7WA 2ZETA 2G77B 2C95A 3EXAA 1FW6A 4PC2A 1Q22A 2ZE5A 3RC8A 1G7CA 1OB2A 2W6ID 2HJVA 2P3SA 3E2IA 3RWMB 3SDZA 1DO0A 5LB2A 2WMNB 1CRQA 1G3RA 2J59A 2L0XA 2PH1A 3SU8A 5JSZB 2GXAA 3BRWD 1FL9A 1UPTA 1XTJA 1IN5A 2OLJA 5CDFE 4IEEA 4N0DA 2R6AA 1UKZA 2EQBA 2ZRIA 5K8LA 1HE1C 5FOXA 1KKMA 1ETUA 3WBJA 2NIPA 2GRJA 1KY3A 5FUWA 3PENA 3GJXC 4NZYA 1KYIA 2XZPA 3VR5A 2H18A 1Q3TA 3EA0A 4LI0A 2DCUA 3OAAA 1PV4A 4WOPA 1X86B 2OG2A 3H0KA 1E2GA 3PITA 4QC2A 2H8KA 5K8IA 1Z6GA 3I92A 3LBHA 2DYKA 1S3SA 1HEIA 1VYUA 3K9GA 1CU1A 1D6JA 1N6PA 3AVUA 2VF8A 5FTJA 1H85A 3K0SA 4MITA 5FBQB 5D3MA 1QZXA 3R7WB 1YVDA 2QMOA 4YAOA 2N1BA 1XNJA 1ZUNB 4ZDWA 3A4LA 4HSEA 4JJZA 5JECA 1NRJB 1OIWA 2H16A 1VQ8B 3ICEA 1AQUA 3RABA 4PQRA 3G0HA 1UEJA 1U0HC 3VNVA 4EFMA 2AD1A 2V6IA 4NHOA 3L8YA 3TBKA 3IDQA 4US0R 1BYIA 2IYUA 2ZS9A 4URZR 1W7AA 3PIRA 1XJQA 3CZPA 2GESA 2GTPA 4B2IA 1UDWA 1X8LA 2BBOA 5EE3A 1D2NA 1S4QA 3U61B 4TMKA 1LS6A 2CLSA 3TR0A 3KXIA 3IQWA 2F55A 1RRFA 3MHPA 1Q82D 4B74A 4P0TA 1UBCA 3BH0A 3REFA 4DEYA 2DWPA 2GVZC 3LXXA 3CC2B 1F3OA 4HDQB 2X1VA 4D26A 5KO2A 2V9PA 2YC2C 3CCRB 2ZRNA 3CRRA 4TWZA 4L16A 1M74A 1HE8B 4C2UA 1FUKA 1T9HA 1E0JA 1JR3D 3AP3A 1GAWA 3AF1A 1P2TA 4BWYA 4Q18A 3H84A 5D3QA 1KI1A 2WMOB 4IDHA 1E9DA 3CWZA 2HJGA 4Q66C 4RD3A 3BGWA 3FYHA 3ZYCA 3EZ6A 1E79D 2QMEA 1EFCA 3EPHA 1WF3A 1SKYE 1Z6YA 4NCJA 1IXSB 3GLGB 2C98A 2LWIA 1NBMD 3FMFA 1D5CA 3MJRA 1GWNA 1P3JA 5CIWA 2QTLA 4TMWA 5P21A 4J0QA 4ZCIA 3R8CA 2AWNA 1OT3A 3SZRA 4UNQA 1K9MD 2QPTA 3NC0C 4ZGQB 2W83A 4HAZA 4IFBA 5EUQB 3LO8A 2WPDA 2ONJA 1HQCA 1BX1A 1Q0UA 3QBVA 4PSKA 2W6JD 4I4LA 1HUQA 2JDIA 4EPYA 3MCAA 4OBEA 3KDSE 1OGIA 1CBUA 3KTAA 4DCUA 4HDOB 3JQRA 1OH5A 1TVCA 3CCSB 4Z1MA 1QFYA 1DPFA 1JI0A 1F2TA 1XEXA 1Z0FA 2CLDX 5JI2E 4GOJA 3QKSA 1GL6A 1QG2A 2PT7A 3F8TA 1CJUC 4Q03A 3BFVA 121PA 4LZZA 2IT1A 2EU8A 2HYDA 4Q9IA 5IT5A 1JXOA 4A4DA 2J41A 4DHEA 1HURA 1VQNB 1OH8A 4US2R 3A1UA 3THYA 1G41A 4KODA 4DXAA 4JLJA 4GP6A 1FPMA 1W0KD 3DZDA 3OEHD 4Q02A 4QM7A 3G5UA 3NC1C 4CEIB 3SJCA 1YR8A 2IX3A 2ORWA 3A37A 3CBQA 3EW9A 2D7DA 1GZSA 1Z3IX 4BUJA 3N2EA 2V1XA 1N5LA 1GG2A 2EYUA 3FMPB 5JJLA 2ZI4A 3CCMB 4KV9A 3QPVA 1QH0A 1YJNB 1W49A 1E2EA 2ZSBA 1OLOA 2XNJA 1NVXQ 2W6JA 3W9YA 4IVQA 2ERXA 3TW8B 2KSQA 4R9UC 2AD5A 4MA4A 3MLEA 1DS6A 1EFRD 2QSZA 3KTAB 4LJYA 4UJ5A 1F60A 2CVFA 3CWQA 3EIHA 4P4SB 3W5UA 4QOSA 4H9GA 1KZ7B 2XJ9A 4DLUA 4LOAA 2WJYA 5HKKD 1F2TB 1XEXB 4Q7JB 3OE7A 2IEZA 1R8SA 2R9VA 3BBPA 3GEHA 4KU4A 4L8GA 1RRPA 2WWIA 4G5GA 3VR4A 4FWTA 2ODWA 1KI8A 3CRW1 3IPXA 4IKEA 3CKLA 1QGZA 1XTIA 4CEHB 4QBFA 1H8HA 4TYQA 5GVSA 4XWOA 3K0AA 3AVOA 4UXHA 4D0NA 4RZXA 1O87A 4HAUA 3C41J 1VPLA 2F3RA 1KQSB 2WWHA 2OBLA 4M1WA 2IF0A 4MQBA 4U5XA 1CQXA 2AR7A 2QG6A 1HA3A 3PUZA 4W5JA 4TYYA 4UAJA 2F6RA 2P65A 3E1SA 2JJ1A 1E96A 1VQKB 2AK3A 1GRNA 4S35A 2CBZA 2EVWX 3RVBA 5DI9A 1XTKA 3Q85A 2I1VB 2OHFA 1NSFA 4ZV4A 3EPLA 4A0HA 1YZTA 4YXWA 1K73D 2XZOA 2FPMA 5JZVA 2H17A 4C4PA 3EX7C 1G7TA 5BYJA 3BIFA 1UJ2A 4LPKA 3RRYA 2ZRHA 1EK0A 5EP2A 2AX4A 4NYJR 3ZIAD 4X8MA 4C0KA 4D0LB 3THWA 1G6HA 3OW2B 1FOEB 2YYZA 4GOKA 4PO8A 4UXIA 4WVFA 2EFHB 3VX4A 4YMTA 3KFXA 1AN0A 1RW4A 2BF4A 3KUCA 4WA7A 1AS0A 5FOVA 1P73A 3AVPA 3C15C 1AA9A 4D4KA 1ZAKA 4KCGA 2ZI5A 4C0BA 2ZU0C 3RS0A 2DPXA 2OCPA 4ASUD 1PVOA 1E9RA 3GLFA 1Z2CA 2VLIA 3VKWA 2AXPA 1ZM4A 4F91B 3K0AB 2HUPA 4UNSA 1NG9A 1A2KC 3QKSB 2ODEA 4CGZA 2JJ2A 1FP6A 1NN1A 4B44A 1WCV1 3OAAD 1DOAA 1NP6A 5F3WB 5EXXA 4RZ3A 2GA8A 1QFJA 3B9QA 3K0EA 4HAYA 3CCLB 3A58B 3CRMA 4PZYA 5HE8A 5J4YA 4EFNA 4Q1CA 1S3GA 4EPXA 1P2UA 1Z83A 1VQMB 3TIFA 4C0LA 4HB2A 2ASEA 1GNQA 2IYWA 2YOGA 3AKCA 2A30A 2BHRA 1QFZA 3Q5DA 1W2HA 4KFSA 2VHJA 3U7GA 4ILEA 4V02A 5FUXA 2F1RA 1DVRA 2WWXA 2WAXA 3D8BA 1C4OA 3A4MA 4KFUA 4NTZA 4ZDKA 1PLJA 2O8EB 3F5FA 1QVAA 2F43A 1HQYE 2RGNA 4PO9A 3REGA 1IXZA 2G3YA 4M22A 1S9HA 1W4BA 5CLLA 4DDUA 3K1JA 1LVGA 1BMFA 1BH2A 3IIMA 1SXJD 3LXRA 1W34A 3GLHA 4EUNA 1SM4A 4GPTA 1KDRA 2GETA 5EP3A 1W48A 4TMZA 4DQKA 5LPNA 1KY2A 4AKEA 3G4SB 3O8CA 3O8DA 1J99A 2QL6A 2J0UA 1G3MA 1XEWY 2LKCA 2O0JA 2OE2A 3LQRA 2IUTA 4PQYA 3RS4A 3HJNA 4FMBB 4A0FA 1KNXA 2Q0HA 2G6BA 1H65A 5EMNA 3HU1A 2AFHE 4URVR 1E9AA 4BFXA 1VQPB 1UKVY 2RGAA 4B47A 4LHZA 4EPRA 4RJLA 5TMPA 3I5YA 2R6HA 1E1RA 3WYGA 1NIJA 4EJSB 3LRPA 4OHYA 4YALA 2DWQA 3AGPA 2QA5A 2ZJAA 4HZUB 5DHAA 4IVRA 4PPFA 2Y8EA 1N6LA 2VHCA 4MGYR 1FFHA 1SXJB 2QEQA 1Q86D 3QE2A 3OZWA 1ELOA 1BYUA 3V9PA 1W36D 3PEUA 2XB2A 3A36A 3TR5A 1E1QD 5LD2B 2YOHA 3SYKA 3EASA 3FFAA 4MYCA 4OHXA 4GDFA 2BV3A 3QBTA 4G3XA 3ZQ6A 3QI2A 1BQEA 5H68A 5CYOA 4PSVA 1QHYA 2VA8A 2QUZA 2YOFA 3BERA 3SBEA 2Z4SA 3DMDA 4EPTA 1P72A 2FN4A 3AUXA 4IOLA 1G21E 2J5XA 4HLUC 4HYYA 1E2JA 4UNRA 3THWB 4AYXA 1AZTA 2FGJA 1AKEA 4JVSB 5LB4A 3RWOA 3ZS8A 2J0UB 4IDNA 4JLKA 1OKKA 5KDLA 1OFUX 2KI5A 3FE2A 3VO1A 1W2GA 2GAOA 1KDOA 1U8AA 3DM5A 4PO1A 4LJ9A 4V0OA 1WQ1R 2PMDA 4B2LA 3KL4A 6Q21A 3I3SR 4EPWA 4LWZA 1E2FA 3GLFB 5J5CA 3SJZA 3T06B 2VO1A 2VP5A 2ZXUA 4C2TA 1RYHA 3EZ7A 3ZH9B 5JJIA 1W47A 3AGQA 4Q4HB 5DI3B 1G4AE 1VCIA 1G3IA 4PHHA 4TLEA 2SHKA 5AJVB 4ABYA 2A78A 1CXZA 2GNOA 4W5HA 1QF9A 2D62A 4NYIQ 1A7JA 2D3WA 3OIUA 4TQUS 2IUUA 1IN6A 4PAMA 3EPKA 1Z0KA 1TPZA 3QXSA 1KSJA 4MYHA 3U4QB 3NWJA 4EJSC 4BGDA 3CCJB 2HYIC 1U9IA 5BWMA 4NDZA 1LNZA 1IB0A 2QMHA 2HCBA 3I8XA 1GKYA 2HT1A 5TY0A 5A0FA 4DSOA 4XTCS 5GJWC 1FRQA 4QJ3A 4ZKEA 421PA 1NVVQ 4HATA 3L43A 4JBYA 5EXPA 1IM2A 4FWIB 3HU3A 1IY1A 1N25A 1NN3A 2ATVA 4M1OA 5FPSA 2AKYA 5CM9C 5KPJA 4LHWA 1MO4A 1F2UB 1WMSA 1CIPA 2XB4A 1W44A 4L9WA 5EP1A 2O8CB 1VG1A 2OO7A 4Q4JB 4KSCA 4TT3A 2QQEA 4PGOA 4KVGA 3W8NA 5B58C 4BLQA 3THOA 5CITA 2HF9A 2OTLB 2YZ2A 5B57C 2BEJA 3AF2A 1DAGA 2YV5A 3WMFA 1E1RD 2ZYWX 3BH7A 4PAOA 1AQYA 4LHVA 1ZD1A 3C5CA 4PHTA 3HDTA 5FI1B 2NTYC 3TJZA 1RPZA 2OXCA 5AR1A 2R6DA 1VQ7B 4CT4B 2ZE8A 1XJCA 2ZR9A 3IGFA 1XBTA 2DFLA 1AZSC 4EJSA 1OFHA 1T0HB 2WZQA 1W1WA 4XSHA 1GP2A 5KYKA 1DDIA 2O0HA 2ZSFA 4Q9JA 5FBWB 3NH9A 2IF2A 1OYWA 3BB1A 3W5HA 2CL6X 2ZYVX 3SHFA 3IEVA 1FNBA 1SXJA 3LVBA 2IBMA 1VQ4B 4B34A 1UMKA 4Q1FA 3F3YA 4RZUA 2BEKA 3RDPA 1GL7A 1X8KA 1NLFA 1VHTA 5TXGA 4IW3B 1N8RD 2QEXB 1X1RA 1US8B 4ZDIA 3B1ZA 2D2EA 2KJQA 2ZUBA 3EAQA 3P26A 1KK1A 4MDFA 2WWWA 5DISB 4PPNA 2P6UA 4Q4JA 4Y7CA 1QVRA 5GV8A 2O0KA 1XD2A 2XNDA 1XTQA 4ACAA 1E9BA 3RS7A 2OAP1 3QNUA 2IS1A 1S72B 3VHLB 2R44A 3KQUA 2VRWA 1PLKA 4IXNA 3ADDA 4GFDA 4YDHB 2H5EA 4MRVA 2JAQA 4A9AA 1XP8A 5DE3A 3Q72A 1A2BA 1YR6A 2J0SA 4Q4HA 3X1DA 1ZCAA 2QE7A 4URWR 3QQ5A 5AUQA 4M1KA 4DVGA 2XXAA 2ZI6A 1GJRA 2XNCA 3T61A 1PLLA 3NBYC 3MD0A 1UBEA 3DKPA 4TYPA 1NBME 2GF9A 2ZSAA 3FVQA 3IIKA 4DWJA 1G6OA 1FDRA 3GJ5A 4Q7KA 5FL7A 821PA 3IQXA 1VIYA 1N6KA 2FH5B 3QKRB 4G0NA 2FGKA 3D6TB 1XPOA 1IY0A 2ERYA 3CPWB 1JECA 4BLRA 4DC9A 3ZBTA 1WRBA 1L7VC 1CKEA 1E1QA 2VHTA 1Q81D 2FF7A 5EE5B 1E63A 4JMPA 2NO9A 2CK3D 5KSPA 1QHHA 4KJZA 4TLCA 2OCYC 3MG9A 4V0NA 2GCOA 3KB2A 4BLPA 1A4RA 4EH1A 3Q9LA 5G3ZA 1M2OB 1WA5A 4PQFA 4FINA 3AM1A 3B5JA 3I4LA 1YZQA 4C0QC 5HPYB 1UF9A 2QAGA 4L4UA 2O8CA 2Z6VA 4QJ5A 1XXHB 4DCNA 4Q1AA 5FBRB 5FOWA 2FPKA 2NGRA 3NH6A 2REBA 3C5HA 4O2RA 5CB6A 2F1HA 3N2IA 2QORA 2XXAB 2FE4A 1GAJA 2JLRA 2VP2A 3OZUA 4D6PA 3FKSA 2OTJB 1Z5ZA 1YRBA 3CONA 5F9FA 4QGAA 4RFSB 2RHDA 3BFKA 2RGNC 2VHQA 2ZRGA 4JVNA 1UFQA 4OQXA 4CDGA 1QDEA 4LYHA 1VMAA 5AWFC 2KWIA 4GMXA 1ZW6A 4BLOA 5HXBA 4LJ8A 1V5WA 4B75A 3AF4A 4R2HA 3A1WA 3QKRA 1WP9A 4AG6A 4BFWA 1ZINA 4M2LA 2VIIA 4KO8A 1Z47A 1N5IA 1B2RA 1VECA 5C4GB 3DHWC 1U9IC 2QENA 3EPJA 1TF2A 4CW7A 4IOKA 1WXQA 1YE8A 2JCSA 2GVDC 1T3LA 1GAQA 2O8FA 1NLZA 3ECCA 3BS4A 3FB4A 1J70A 2GXUA 2GZHA 2W6IA 3DMNA 3NIBA 3ZZTA 4JS0A 1ZNWA 4I1VA 3UWOA 3ZVRA 1QGAA 2FSIA 2P67A 2RAPA 2BGJA 4R2IA 3LLUA 4A2QA 1OXTA 1XJ0A 5FA6A 3NHBA 4OL0A 5DYIA 3T12A 3K53A 2FSGA 2RHMA 3CNLA 1XEFA 1QHNA 4W9MC 1DARA 2WWYA 2RCNA 2QY9A 2ZRLA 3IUYA 1UKYA 3M4YA 1LY1A 1TAGA 4DLRA 2MSDB 2A7QA 5FOSA 3U3JA 1VQ6B 1Q1QA 1W2BB 4G5RA 1IN7A 5JFGA 1P9RA 3HWSA 5KPDA 1JQJC 3PUVA 5BN5A 3QIAA 4FCVA 2YKGA 4Q47A 5KSYA 1KJZA 2VNKA 1AK2A 4NCHA 2MMCA 4OQLA 5CLQA 5EXSA 3B1XA 2CLCX 3J81k 3GJ7A 1ZM2A 3SC3A 5JEDA 3D7MA 4YLGA 4Z1MD 5FPKA 1XCPA 3QKTA 4URXR 2VP4A 2WIBA 1PJRA 3FKQA 4IDQA 4A6XA 1QG0A 2HLDD 2G88A 5DGXA 2O8DA 3QFTA 3M1IA 4DUGD 3FFBA 4I99A 2AK2A 4YMVA 5JJKA 4BQSA 4DDVA 3AVQA 1S9DA 3W3ZB 4PC6A 2X77A 3OIYA 4Q21A 2W2VA 2OBMA 3BXZA 4NH0A 2IYRA 1G3UA 1CTQA 4UKDA 4AKIA 1WB9A 2IYSA 3ZLJA 3LFUA 3SE0A 1ZMXA 1F20A 4NKRA 1SVSA 5FPYA 4TL8A 4JL8A 3CMEB 4EIWA 1N6HA 1GTVA 2CJWB 1N2CE 3IPYA 4U7DA 1P2VA 1JAIA 2FDCA 3LA6A 1D8TA 1MR3F 5AUOB 3SFVA 5SZJA 4ZDJA 1U8YA 3F0TA 3CPHA 5EZ6B 3OEHA 3FKSD 4M9QA 3SOPA 3SYLA 3B9PA 1XF9A 5GJBA 2NPIA 4JYCA 4C7OB 4Z8XA 4FMCF 3THXB 4DZZA 1WBDA 2ATXA 3GLHE 3QG5A 1IN4A 1TQ2A 3FHCB 3EWAA 4NMMA 3X1WA 4A36A 2XSZD 1UADA 3DDCA 1G64A 4TL9A 4XSGA 4A82A 3MWLA 2OLKA 4AURA 1U2RA 1E98A 1G8FA 2F1JA 3W2GA 5C2JB 5L3QB 4C43A 1A1VA 2WPDD 4H1UA 2G9NA 2IXEA 2O8FB 3UXMA 2UZ3A 1ZD8A 5CK5A 3CLVA 4DLZA 1T6NA 3CPEA 1KI4A 2I3BA 1GITA 3O47A 2ZS7A 1SVOA 3CCEB 4HB3A 2ZVPX 4IDOA 2YNMA 4E09A 5K8TA 4LGMA 1U0JA 2ZITA 3NEYA 2IW3A 4TQAA 1AMOA 4BRUA 1G18A 3AUYA 1MH1A 4OYHA 3EG5A 3UG7A 4Y0AA 5JEEA 4C3ZA 4AKGA 1SHKA 2JLUA 4AKHA 4RZ2A 4Z51A 1ZIOA 4O0MA 3E20A 3M6AA 1H8ED 4QG7A 1EX7A 3LVRE 4YQFA 1R7RA 1GKIA 1NMXA 1R0ZA 2TMKA 4OQNA 1XDBA 1JNYA 4X8LA 4IJMA 1E2NA 5JHGB 1IY2A 1KO1A 3VFDA 1Z28A 1E0KA 1Z6XA 521PA 1MRSA 1TF5A 1B0UA 1E9CA 2WOOA 3CF6R 5KSWB 4MRNA 5CYPA 5FTMA 4BASA 5H8WA 3QXJA 5UKDA 1J8YF 4F92B 1SVKA 5C1BA 4BEJA 4URUR 1NJID 4MRSA 3RRZA 4DQLA 5A5GA 3ADKA 4G1BA 1CR4A 1R5NA 4A0RA 1NI3A 1CJKC 1E2HA 2FWRA 3L82B 4EQ6B 3K09A 2CEAA 3H86A 2V1UA 4F93B 2C96A 1M1KD 2ZRPA 1X3SA 3T1TA 3BB4A 2WOJA 4DCTA 5JI3E 2FFAA 4L5BA 1EFRA 4YAUA 1W4RA 3KKMA 4HLUA 4RD4A 1COWD 2CHVA 2BWJA 2WJJA 4TTQA 5TVKA 2WAYA 2X19A 4RFVA 3C14C 4IOJA 3TQCA 3N5CA 1RJ9B 4LV8B 2J7PA 1SZPA 5F9HA 5KU1A 2CJWA 4IOMA 3FWYA 4NE2A 2XGJA 1R5BA 4M8NE 2K5UA 4M1MA 2MMGA 2Z43A 3WNBA 1TQ4A 3PG5A 4YC7A 5BN3A 2XTMA 2JLZA 1BOFA 5TARA 4IXMA 1FTNA 4IRUB 3K0CC 1XMJA 4UQOA 2EFDB 3ES9A 1DAIA 3CPJB 3LX5A 3UIEA 1BIFA 621PA 3A6PC 3LDAA 2ZTSA 4II7A 2PLFA 2C8VA 1XFAA 5JCZA 5FUYA 4NYMR 3W90A 5KNBA 4HUQB 3D3QA 2C9YA 5GVRA 3PXGA 2GZAA 4ARZB 3PEWA 1HT1E 2ZE7A 1ZNYA 3CNOA 4P4TA 2WJVA 4JLVA 2VTKA 1KK0A 3K70B 1COWA 3RC3A 3ONWA 3SBDA 3TQFA 2HT6A 3QXHA 3K0CA 3VKGA 2OT3B 2IL1A 1EFTA 4ESHA 5ELXA 4DSUA 2RB4A 3AEZA 2D4HA 3RS3A 3QOFA 2DY1A 4TMXA 5C46F 2JLYA 2JATA 3P32A 2N46A 4IVPA 4JLOA 1VG9B 2QSYA 3ND9A 1N6IA 4RCYA 3BH6A 2XSZA 4BZPA 1UM8A 1GRRA 3NHAA 4MKHA 3SEAA 1P2SA 2FSHA 3U3RA 4D4JA 2H92A 2WVJA 1OXVA 2VSFA 3IBYA 4QBIA 4WZBE 4KXFB 4E22A 3GJ3A 4BLTA 1GRQA 3X2SA 4CVNA 3PCRB 2IS6A 2LKDA 1M90D 1L8QA 2W2XA 2WHXA 2FV8A 3UWKA 3BJIC 1AJEA 2Q9AA 3SYNA 3VTKA 3L2OB 4LRWA 5TR9A 2BMWA 3X1YA 4GNKA 4F4JA 5BW8A 1E4VA 2WSMA 1H8HD 4D4LA 1KGDA 2GBLA 3NXSA 3B13B 3QF4B 1U99A 4V0ME 3QFSA 4P4SA 1LW7A 2BM0A 3IBGA 2BBTA 4LX0A 2ZE6A 1G8HA 2ONKA 5F98A 2V7QD 1P5ZB 1N6RA 4ARZA 4M4SA 3CC7B 1Q1EA 3U60B 1OHHA 2OK8A 3DEFA 1JJ2B 1TNDA 4NBSA 3VHXA 4GMDA 1KJYA 3FMOB 2A2ZA 1VG8A 4LJ7A 1NY6A 4HB0A 1W36B 2KBFA 3OEED 4DSTA 2DB3A 1KIMA 4RD1A 4M9SA 4OI2A 1V43A 3ND8A 3WHLA 4FK8A 2PZEA 2ZAOA 5C4MA 4PHFA 1RFLA 4TYWA 2XX3A 4K46A 2G83A 4K1XA 2YJTD 4WQMA 3QXCA 4L15A 1XZQA 2CDNA 4A8JB 2OM2A 1MO6A 4N3GA 1P9NA 3JVUA 4OK6A 5L8VA 1E2MA 4Q1BA 5EE9A 3E1YE 4Z8YA 3QUSA 3QKUA 4K8OA 4XVRA 2ZIAA 3NVAA 4KSBA 3CRQA 3QEOA 3TK1A 1NMYA 1SVWA 2BSAA 2HV8A 3MWJA 4TL7A 1XTRA 2CXXA 4D0GA 4DB2A 2V7QA 4DLXA 4ACBA 1KD1D 2CNDA 1XMVA 3W2FA 4XTRA 2CHGA 2BIFA 1ZNXA 3BOSA 3MSXA 4LSGA 4MUAA 3VX3A 1ESNA 1E6CA 4XH9B 1A82A 3UG6A 3UPUA 3ZGXA 4PZLA 2ZJ2A 3WY9A 5HR5A 2WV9A 1Z2AA 1GILA 4LHYA 4KYUA 3WXMA 4B6FA 4MDEA 2QGZA 3GMTA 1KI3A 3GD7A 1MOZA 2NG1A 3KQLA 4BPBA 2IWHA 2ODBA 1Q7YD 3H2YA 4BFUA 1WBBA 3TRFA 1JBKA 2PBRA 3GFOA 2DETA 3S1AA 3LX8A 1JJ7A 3DL0A 3Q3JB 4O25A 2DR3A 2MSEB 1SVLA 2RGGA 1R10A 2REXB 5J47A 1AIPA 2J45A 4HAXA 2F3TA 3HR7A 2RGCA 3L0IB 2BN4A 3X1XA 1E99A 2IA5A 2GQFA 2CVHA 3K8YA 2Z83A 4V0MA 5HKKA 3IILA 4CZ2A 2AWOA 3EIQA 4GOXA 5JRZA 5DNYB 3FHOA 1TF7A 3FMIA 1IJEA 1VCMA 1N0WA 2GAAA 1FNCA 3CX8A 2GZDA 3MJHA 3QVVA 3D31A 3T5DA 2F9LA 2HDNB 2RH5A 4QHTA 4LJ5A 3RYTC 1T5IA 4Q9LA 3BORA 3LNCA 3GLGA 1HTWA 5FFMA 2IWRA 1E4YA 2X2EA 1E2IA 2CRVA 5JS7A 3RRNA 2I1QA 4DRZA 1XB2A 3ASZA 3ASYA 1M34E 1QRAA 1YHNA 2ZS8A 3T1OA 3OIVA 3OZXA 1S2MA 2ZROA 4KLNA 1A5TA 1W4AA 2UKDA 1YJ9B 3P20A 4NONA 4OI4A 1F5NA 1XRJA 5JMTA 3AVXA 3I1FA 2IUSA 1ZM9A 5BYKA 1XWIA 5CB8A 3Q8XB 1SKQA 4XOIA 3CO5A 3RSOA 2IXFA 3KZ1E 3PUYA 2OCBA 5L3SB 4ZIRA 2B6HA 1SQ5A 1EX6A 4M9ZA 4NYMQ 5KDDA 1JAHA 4U9UA 5AJXA 2WKPA 1Z07A 4LJAA 2FFHA 3KX2A 4JBXA 2OUKA 4M21A 1NL3A 2GKSA 4KBGA 4RD2A 4RVCA 1YZUA 2QN6A 2BKEA 2GK7A 2QTVB 2Q3FA 3WYFA 2NO0A 3MRSA 4C0HA 4DLTA 4LBWA 1N5KA 1ZRHA 3ZZ0A 4XD7D 1E62A 3THYB 5CM8B 1P62B 3QE0A 4ZCMA 3EARA 4I1OA 4BE7B 1EP1B 3ZC3A 5JS8A 3CB4A 3W6PA 2WKQA 1SGWA 2RGDA 4ERNA 4YXWD 5FOTA 3IEUA 4HE6A 3CCQB 4CEIA 1SKYB 3GJ6A 2OV2A 3HYRA 5AK0A 2GPJA 1MT0A 2GJ8A 4NU0A 4QGGA 4A8JA 4CF7A 4GP7A 3LH5A 4US1R 1NN5A 1ZIPA 2XNSA 2FOLA 1QHSA 1GVHA 4LY6A 4V03A 2D74A 2VNIA 4OQFA 4DEXA 3QVUA 1NBMA 5IDVA 2D2FA 1QBKC 3GJ8A 4XWAA 1XZPA 4LPSA 3WMGA 3TH5A 1G7SA 2CE2X 5DYGA 2PZFA 1NF3A 1KSHA 5IHPA 2O52A 4GSYA 5FR1A 4JL5A 2BBSA 1JPJA 3T1VA 1XD9A 2GWHA 4XWKA 3M0EA 1NG1A 1L2TA 2JIZD 2Z0MA 3LD9A 4X8OA 2IK8A 2W2TA 4EKDA 4O3MA 2JLXA 1KRHA 1D1NA 3DVLA 1R6BX 4JT4A 2JEOA 1VQ9B 5GJCA 3KQHA 5HCNA 2VZLA 2BMJA 2VQSA 3QXXA 2IS4A 4U00A 2WTUA 4N0EA 1ZM3A 4GBMA 4YAFA 1CS4C 1HYQA 3W8RA 2Q9BA 4LHXA 4AYTA 5HTKA 4DLWA 1NSTA 1TEVA 2A9KA 1II8A 2AKAB 2ZJ8A 221PA 4DCSA 1W36C 4CEJB 3SJAA 1KKLA 3BE4A 2CNWA 2D7CA 2V54A 1M6NA 4ZCLA 1NVWQ 3NTUA 4AD8A 4AWXA 2WSSA 5FH9A 3I56B 2Z5FA 4MGZR 2RC6A 4Q7MB 2JLWA 3GFTA 3X1ZA 2A5YB 1L4YA 4GZMA 2E9SA 2J3EA 3I61A 3W5JA 4D2IA 3GEIA 4YDSA 5FPHA 3T34A 3B1WA 2P5SA 2PJZA 2QM7A 3IIJA 4HZIA 4Q48A 5C18A 3AVWA 3RANA 3ZD6A 2HCJB 2ZR7A 1CRPA 3GPLA 3KKPA 2GJAA 3AP2A 3RLFA 3U4QA 4B3FX 1JR3E 2YWFA 2HF8A 1D2MA 1DAKA 4YONB 3QENA 3LWNA 2A3RA 3RS2A 1OF1A 4LUCA 2ZRAA 5LBIA 1QVGB 2C99A 1KNQA 4UNPA 1CR1A 1Y63A 2FEOA 1YJ5A 3LVQE 4B3GA 3CM0A 1NJFA 2NO1A 1E2KA 2ANBA 3Q7PA 1M7HA 1QG4A 4TT3D 2J7KA 3AKEA 3W3AA 2A5GA 1F2UA 4OKSA 1UDXA 3I72A 3O8BA 3GLIB 4B6EA 5JBQA 1KAGA 1DEKA 5F2EA 1P75A 4X8HA 1G5PA 2IEYA 2V55B 1JPNA 1X1SA 3I73A 2RGBA 3P4XA 4B43A 1U98A 4PSAA 1YU9A 2EIXA 3EWSA 4A92A 2JDID 4DCVA 1T0JB 1ZC3A 4AK9A 1TU3A 3RHFA 2BJWA 4O2LA 3GLGE 1VYTA 1EESA 2P6RA 3R9IA 4ZPXA 1ZD9A 1BMFD 4AF7A 5B30A 1W4CA 1UAAA 1CNEA 2QAJA 2BOVA 1EWRA 4P4UA 3CD6B 4Y9UA 1Q57A 2FA9A 3I32A 3U3OA 3PEVA 3UK6A 1G16A 1C1YA 3RNLA 4Q01A 2UZIR 1EFHA 4TSFD 4YHBA 1E79A 3K9NA 2QI9C 1TMKA 5KOYA 2PCJA 1XCGB 3N70A 4B71A 3LO5A 4LK2A 3MWYW 3A1SA 3IHWA 1SHZA 1KI2A 5LD2C 3GLHB 4A8JC 4KHZA 4QNMA 1GVNB 4PR0A 5HCIA 1US8A 1Q1ZA 2GDJA 4G5QA 1GR1A 3Q7QA 2ZM5A 3GLIA 1BKDR 3H4MA 1RC8A 1S96A 2ZREA 1DBSA 3L0OA 1DG3A 3SQXA 1BJKA 2VL7A 1Z6AA 4MYUA 2ZQ5A 4NCKA 3R8FA 3SNHA 3VNUA 3A4NA 1GIAA 1I4TD 1R0XA 3MAAC 3NBXX 5FBLB 2VNJA 3VQTA 4DLSA 1N3BA 2CK3A 4Q4AA 3WP0A 4FXPA 4TMTA 1LF0A 1Z08A 1IOZA 1N5JA 4CEJA 4PC1A 4D25A 1N0VC 3PQCA 4CIDA 3JQQA 5E95A 4D82A 2PEZA 4S2EA 1IBRA 2WSSD 4WIAA 4TLAA 1VQ5B 1EP3B 1S1CA 4DBLC 1RRCA 2GBLC 1J7KA 3T5GA 4Q7LA 1S8FA 3BWDD 1Q1BA 4AF6A 2QROA 2QZ4A 1Q12A 2VP6A 3ZDQA 4D4MA 5J4HA 1OIVA 4OK3A 3BB3A 3U5ZB 3QF7A 1H42A 1Z0DA 4Q5IA 4FMDB 4QRHA 3QFCA 2ANCA 3U7EB 1NNEA 3WBKA 4AI6A 4Q1DA 2IHBA 4LYJA 1E64A 5GV7A 1YZKA 4R7ZA 3GJ4A 4JBWA 5CIQA 2R2AA 1PUIA 4IFEA 3CR8A 2OILA 5EE1A 4BRWA 2OSBA 5DH9A 5BXQC 1KMHB 4LC1A 4G01B 3C4JA 1I2MA 4JSTA 3E70C 1CR0A 3V4FA 5JSZA 1G3QA 2VP0A 3BFXA 1GOTA 3QEJA 1XX6A 1G20E 1F48A 4TZ6A 1F6BA 3AQ4A 1DAMA 3L0PA 3JZMA 4P31A 2HMAA 2A5DA 2QRZA 1XCMA 3DM9B 4Q4AB 1HT2E 1KO4A 1FTSA 4C0SA 1TL7C 4HLQB 2J1LA 4LBVA 4PC7A 4N1AA 1MV5A 1KTVA 4P33A 2ZJYA 2NZ8A 1XXHA 2QGNA 2CCJA 4IEIA 4WXRA 5KSOA 4LYAA 2P0EA 3U2QA 4JKIA 3AB3A 1ZU5A 2OZEA 3A8TA 1KMQA 1RE0A 3W2HA 4BFYA 4WAUA 1LB1B 2CHQA 2WJHA 2QDXA 1ZVQA 4JL6A 3PUWA 3T15A 3AV0B 1ZUIA 2KB0A 1GNPA 1SXJC 1KO5A 3OJWA 5CDFA 3PJRA 2X8AA 5M04A 1ONBA 4PANA 1NJGA 4NL4H 1EWYA 2HLDA 2NQ2C 1Z0IA 1CJMA 1EG7A 2BBWA 1EP2B 3EA5A 4YMUA 1U8ZA 1FUUA 1U81A 1P4SA 1QX4A 5EZ5A 4HUTA 3RSLA 3KFVA 1KMHA 1P7CA 2BMEA 2QP4A 4KFRA 2W58A 1MABB 3FTQA 4NYJQ 1E2LA 4G1VA 4Z54A 3FOZA 2BMDA 3LW7A 3B8HA 1SULA 2W0MA 5B2ZA 3KKOA 1NKSA 1J90A 1W87A 3EC2A 3CX6A 4Q19A 4BEBA 2BVNA 2XOKD 3GLFE 3ICQB 5KTYA 4MYTA 4C9BA 5E7MA 1IXRC 1T3HA 5FPTA 3I5XA 4G5SA 2B8WA 3CZQA 5DN6D 3WYAA 3BK7A 4URYR 2J7PD 2BJVA 4BECA 4MKGA 1T3SA 1E9EA 2C5LA 1OJLA 5SZKB 1R5OA 2GXSA 2HXYA 3TMKA 1GO2A 1B23P 1ZP6A 3PEYA 1M8PA 3W6NA 5B64A 3KQKA 1OW3B 4P32A 3SJBA 4B3BA 1Q44A 5JRJA 721PA 1HH4A 1Y3AA 2IYXA 3GLIE 5L3RA 1RZ3A 2V4ZA 1TTTA 3U3MA 2EFEB 4LCBA 3OEEA 1OXSC 5TV2A 3WP1B 2FU5C 4JLPA 1TQDA 5IF9A 3DKVA 1HY3A 2HXSA 2P6NA 5CJPA 4DDWA 3DZ8A 1C9KA 3HR8A 3ZZUA 1MABA 3TVTA 5JWHA 1E9FA 2VNHA 3QFRA 2DFKB 2F43B 4P6VF 1Q21A 3KXKA 3QPUA 4TQ9A 1JJVA 1XMSA 5DO9A 4FCTA 1KK2A 1E69A 1CLUA 2NOAA 1NY5A 4QXAA 1JQLB 1UBFA 2C03A 2C9OA 3PUXA 4A1FA 2AN9A 3H1TA 2A5JA 3ZVLA 2WM9B 1DDGA 2G1JA 3RS5A 2ECKA 2R6GA 5EXTA 3U44B 1IHUA 1A8PA 1XD2B 1CEEA 4BZXA 3GJ0A 3K9HA 3OHMA 2KE5A 1Q20A 2OFXA 4XIGS 4P3YA 3WMEA 4N3NA 1ZU4A 2BCJQ 1S0UA 4HE5A 3C8UA 4E5UA 2ZI3A 1XU4A 2JLSA 5EUMA 5FTLA 3EZ9A 2ORVA 3KUDA 2EYQA 4MKIA 3U6BA 1SVMA 4AIIA 1NLYA 2YHSA 1YZLA 4BFVA 3OESA 4LJ6A 1OIXA 3CCVB 4M0LA 3P4YA 1PZNA 4C7OA 1NKTA 3TUZC 1E0SA 2IYLD 5EP4A 1RRGA 4HEJA 4JT2A 4GT1A 2Q3HA 2CNWD 2BDTA 1Z22A 3CCUB 4HZUA 5FTNA 1KZGB 1M7BA 3PV0A 4H1VA 2GEVA 1VDZA 3KQNA 2VPPA 3EZFA 5GADl
chains in the Genus database with same CATH superfamily
1U9YA 4DMUB 1TZMA 2FZLA 2PMWB 3HCAA 4MKFA 4PICA 4CYMA 2ZPAA 5BR8B 3AR4A 2CL7X 3ML1A 4GBED 3W6UA 3ECAA 3JAWA 3I9NA 4XIIA 3HZHA 3O9VA 5FCDA 1FQKA 3WJ7A 2XMCA 2GJ9A 3D6UA 4D8TA 5H1YA 3QEAZ 4U3JB 4YCMA 3W8DA 1LFDB 3DMYA 1DTWB 3HS3A 4LJLA 1QHIA 4V0LA 1P4AA 4G2NA 4AZ0A 2XADA 2NZXA 5HE9A 2P9YA 2PKYX 1NBIA 2FPLA 2P0YA 3DAFA 1LLQA 3EQ7A 2OAQ1 5EFZA 2UV8A 4K7JA 1E6MA 3DDZX 1I7PA 2IU6A 3HB7A 4YCNA 1EGHA 5B3JC 3N8IA 2O19A 3F6SA 3ZBUA 1RMTA 4CR8A 1ODFA 3HFSA 5JWRA 2JI9A 2VTDA 1BU8A 3W34A 3CTAA 5E3HA 4GI3A 3R3JA 3D0OA 4AZ3A 4EPVA 3V5NA 4AJ1A 1DOHA 4CEHA 5F3WB 4Y1FA 2OGWA 2CE7A 2IIVA 1RKVA 1UBUS 4LNUA 2IYTA 4HWPA 2R1VA 3ZS9A 3D6FA 4FGSA 3NUGA 2YWCA 1F17A 4F6LA 3SXJA 5BR7A 2WA2A 3ADBA 5DHFA 4PG7A 4XXHA 3M6FA 3PYXA 4BDSA 2IHTA 2DG2A 4RVUA 3ACBA 3NORA 2YL2A 1B6RA 1J0DA 1CJVC 1CK4A 4AZSA 5I7WA 1XO1A 2ORIA 1EUCB 4FGZA 5IFLA 4LV6A 5LKAA 1Y4ZA 1P9WA 3P9QA 3Q1LA 3H5RA 2RFLA 2NW6A 3DMHA 4BCCA 4UTRA 4TTTS 2CKDA 4OHMA 2OBYA 2UXBB 4OGLA 2B8TA 4MGIR 4B6GA 4B2YA 4TZTA 4KX3A 5CDSA 1OE0A 1F4PA 3DE0X 1M0WA 1O03A 2JIMA 4W4TA 1R4AA 3VVBA 2Q21A 4P08A 4EMTA 1EUYA 1HPLA 1SBNE 4JLSA 3NGLA 1L5GB 1FX0B 3CMAB 4TV9F 4TMVA 3DDOA 3H2ZA 4OHWA 3UT6A 4BKUA 5FLXA 3URKA 4RHXA 1YI2B 5C5EA 2O2YA 3K8OE 4FOSA 2R4TA 1R0YA 2IVFA 5AVZA 3HVIA 1O8BA 3SIXA 1DV2A 2BMFA 4K81B 4KAAA 4Z4TA 5ALFA 1PDVA 1BQ3A 5L7YA 3UV3A 1DADA 3V4OA 3KB8A 1PBTA 4GOLD 4LTMA 4RENA 3DV0B 3JWIA 3UKDA 2NSYA 2QM3A 4KO3S 1ORHA 1RR6A 1CUHA 2CL0X 1WV1A 2UYQA 3R75A 2UXDB 1Z0AA 2EGGA 4XE5A 1W85B 2JGNA 2OV4A 1H6DA 2BD0A 2F62A 2BCEA 2FWPA 5EE0A 5BRJA 3U44A 3TXXA 2X6QA 5KX5B 2PSHA 4QXPA 4R8KA 4L4SA 2CCGA 4D3XA 2NZWA 3A3YA 5LDDC 2IPAB 1KO7A 3U7FB 2EW1A 4F84A 4B4DA 4KGXA 3OC6A 4Q4LA 5MFZA 3GGOA 1D2EA 2C77A 1JAZA 1SQFA 4FDTA 4DJTA 2G8NA 2HDHA 2ZKLA 2HWUA 4G1UC 3ZZMA 4D9CA 3R9WA 3CMMA 1GRVA 4UFNA 3IA2A 1I80A 3RC1A 4HNQA 1Y1PA 4HVAA 3RFUA 4EJ0A 2G04A 1JHZA 5JCXA 4RLFA 1UPBA 2IXGA 2XOKA 4CLRA 3X44A 5AIBA 2QP9X 4PSDA 4GPZA 4HUQA 4BFTA 4WZBA 1E0DA 1PL6A 4MDYA 1VLZA 1VTKA 1YDMA 3DEZA 4HT3B 1WDWB 5LDHA 3NEJA 1OX5A 1YIAA 2YMMA 3QLUC 4L8FA 4QTZA 5T64A 1Y98A 1A2QA 4G67A 1GFIA 1P61B 1YFLA 4B33A 1P6UA 3EIEA 2G0AA 4RWZA 4C4XA 1PX2A 2J5QA 3RYCA 4RJJA 2GN1A 4RACA 1P6QA 3GRPA 3TW4A 1QE0A 4RORA 2VDNB 1YQTA 2GF0A 1NUSA 2F7SA 1OLSB 3KTDA 3L8EA 2BPOA 1MB9A 3ELUA 4UCFA 3U9TA 3W06A 3FJOA 4EAQA 4PAGA 2BGIA 5KHAA 3Q7SA 1I3CA 1JALA 1T91A 4M0MA 1P0MA 1WMBA 3K9LA 1IEQA 1FVXA 1JB9A 4U2DA 3HK2A 1JDTA 2I4LA 5E7IA 1VHOA 1WXGA 5HZBA 3BFPA 3MUFA 2IEBA 5TMBA 5PGMA 5FLEX 4B0OA 3CC4B 3RUFA 1TAUA 1T5LA 1TYCA 2NO4A 1LLDA 4QGHA 2LV8A 4GMHA 1QWOA 1EA5A 3RVNA 2DYIA 3CNBA 5CCEA 2X4GA 1FMLA 4ND8B 4D80A 2YMQA 2B21A 3N2KA 5IC4A 3EEFA 5THQA 3EMVA 1A71A 3KKQA 1QX3A 1UMBB 5F5LA 1M6VA 2WV7A 1R6UA 1V8PA 2LPMA 4U02A 2OCDA 4B35A 5JAPA 1EB8A 2UZ4A 2OEPA 4TYNA 3HJBA 3T51B 2P9HA 2W93A 3DCNA 3K09C 1EBBA 3JQGA 4RA6B 2PO5A 1QHGA 2JFVA 5JHHB 2AZXA 3LUHA 2XAAA 1AK1A 4OJQA 5D7NA 2FEKA 3G0CA 3SHTA 1ECFA 1NVUQ 2VWQA 2I7XA 2IZ7A 1KDVA 1R8JA 5CXQA 4HYQA 3ZHOA 3WYDA 1SCKA 2X1MA 5HUQA 1KI7A 1LK5A 3ANXA 4LZAA 3DO6A 3FDZB 1DRVA 4OPOA 2K7ZA 4RTRA 4G0YA 5FL7D 2GBCA 1P7YA 2QN8A 4JVMA 5C35A 4YCCA 1YHQB 1OHHD 4ZVPA 1LPSA 3BN3A 3KNZA 1AHIA 4GX2A 1I6KA 2QTZA 2GK3A 2Z4RA 4N65A 3ELDA 4Q7EA 3LBNA 3TUJC 4I5IA 2R60A 3DB2A 3CF2A 1Z8FA 1Z39A 5BRNA 1M34A 4R71A 5DIFA 3MK31 4ISCA 4UBKA 3WRXC 2JAWA 1DEXA 2L17A 4JR2A 2IW1A 2VHEA 4M0CA 5HEKA 2GCOB 1E8MA 4RV9A 3I2IA 2X4IA 1GQSA 2QRVB 4P3XA 2ID4A 3S5UA 4NV1A 1D9ZA 3R6GA 3BBLA 5CCXA 2XCTB 2WBLC 2DBYA 1WPQA 1PWZA 1XCLA 4EWLA 4EFLA 3S0JA 1EFLA 1T1GA 1CNFA 3IMGA 4UE6A 1CY7A 4AM8A 4C89A 1GL9B 3K72B 1BDMA 2B5WA 2QAGB 3I3OA 5KQRA 2PUGA 1GYPA 1YAJA 2EFGA 2PD4A 4YY3B 5AW1A 3HCPA 4C87A 1MQ9A 3IHLA 2ZKIA 1AGRA 3C3MA 1MUUA 3AG6A 5DLQC 5G3YA 1D3AA 3TL6A 2X0RA 5DCWA 2BGUA 1UZMA 5AJYA 1E3ZA 5JW6A 2C59A 1T1SA 4KPFC 3TO5A 1T10A 2HMTA 5T67A 5K5EA 4RFSA 4HRYA 1X1TA 5AVWA 2R1TB 2R68A 1DFGA 3NONA 3P1JA 2Q6VA 1NP3A 3P9CA 4D9MA 4X06A 3H9NA 1E59A 5D01A 4A2WA 4PYNA 2KW5A 2CF4A 1WSDA 1NF9A 4JFRA 3VR6H 4C21A 1Q2XA 1N33B 5BYAA 1SXJE 2DUMA 3SXPA 4N6NA 4QASA 5JYBA 3IKJA 2PMBA 4DT1B 1G5RA 2OCAA 4XFKA 1W88B 4JWTA 1T8YA 4JI1B 1LNSA 5CVCA 1DE0A 1NJ8A 1K3UB 1RQNA 4UNNA 3S2ZA 3KBBA 1K7FB 2IOFK 2ZIFA 3GLTA 5HFAA 2JJ2D 4U6QA 1U0LA 1YZNA 2FQYA 3REQB 4CF6A 3K32A 4DIDA 2WP8J 2H2HA 1H6CA 1VYVA 2FVXA 1BA3A 2P79A 2QXYA 2ZBGA 2KX7A 1G4UR 1EVIA 1MJNA 2G67A 3HJUA 1BMDA 1I3LA 2BCGY 3LKVA 4HDNB 4QULA 2QV7A 2HDOA 1VJTA 4EO9A 4X64B 5BNZA 3LYAA 4GPEA 3SR0A 4NDAA 1PR6A 2XMPA 3FGPA 3OFNA 3OZGA 3QY0A 5J3JA 4RSGA 5D51S 1BDHA 4F3TA 4N7RA 5AKJA 1MIHA 4AMVA 3DCJA 4FNGA 5KNCA 1GZDA 2IV7A 3CJTA 2WWGA 2Y05A 4B2PA 3IXMA 3UC5A 5CPBA 1N8KA 3VNSA 1J56A 1JYSA 1Y5NA 1FS4A 4RVFA 4TL6A 2ZDHA 1ZJ6A 3TS1A 3WBBA 5BV1A 2JNWA 3ZD9A 4NR0A 2PUCA 4FGKA 2FG5A 2ZT8A 1CDOA 1T9GS 2GT1A 2J3KA 4O08A 1G17A 1V5FA 4HN2A 1PUJA 3ISTA 4LS3A 3WR5A 2WABA 3R5TA 5A04A 2FMXA 4HEA6 2QE7D 3LAWA 3VR2A 4Z86A 3QXGA 1RIFA 4PTLA 1UEIA 4A1OA 3FPAA 2I1LA 2YHAA 4PPQA 2A7XA 3UJAA 4Y6SA 4GWLA 3U7HB 2PQ0A 2POQX 5EGSA 3ONFA 5EHGA 4I55F 2H1IA 3WGUA 5C51B 4TVKA 3BWBA 1TKBA 5DTQA 1Z5VA 4OHVA 3UK7A 1PYDA 5ALRA 2ZAMA 3VOSA 2PDAA 2XEDA 4ENWA 3SICE 1I8DA 2QTHA 4UQPA 4B4VA 3CFYA 5KOHA 3QA3E 2AMFA 4FYVA 5EKSA 1QIIA 1FZQA 2IPLA 2ZYTX 2PWPA 3G8YA 3NHFA 4KXQA 4IMPA 1L5HB 4CQNA 1E2DA 2QPOA 3H2GA 2MT9A 2CXPA 3AIMA 4I4TA 4PZUA 2Q5IA 3PX3A 4PZPA 3S1LA 5EJEA 1RKBA 4RF4A 3CVWA 4X0CA 3FETA 2AN3A 5G41A 5ALXA 3D8RA 1EWQA 1L4GA 4I1UA 4DKXA 4QV2A 3PA1A 3M7IA 3PXEA 1SELA 3GCGA 4R0VA 5EJ5A 2YJ6A 3A05A 1H23A 1XDSA 4IHJA 4UJ3A 2YNMD 4A0GA 1O4VA 3IDOA 1J2JA 5JDIC 4B48A 5J2UA 3HI6A 3GGDA 2V45A 1L5MA 1RLOA 2IEIA 5K3BA 2AYXA 2CHUA 1HNWB 2DGDA 2V6GA 2A8YA 2Y4OA 3IAXA 1QYRA 3NPMA 1H6BA 1JHYA 1T8TA 4FMDF 4TM8A 3VPHA 3W6OA 4JVOA 4W1QA 3ZDBA 1P1JA 2QVGA 4Y9DA 3UH0A 1W5SA 2P4UA 1X13A 3W05A 1DWOA 3DBVO 4O4HF 1G8YA 1FE8A 1N6OA 3FCUB 4KDRA 1ZUHA 3GFFA 1XDUA 3LYUA 2I62A 3DF7A 2YC4C 3EUWA 4AULA 1MAUA 3K6SB 3CX7A 3HYLA 5G4LA 3V76A 5L3QA 1PG2A 3D7SA 1YS6A 1V0JA 1AO0A 2QNBA 4TTRA 5CTAA 5B4TA 2XQKA 3DOEA 4CCSA 3DVAB 5LWQA 3AVYA 4ZVQA 1YZGA 3T1HB 1R8XA 2GJSA 3UMRA 1APBA 2VHUA 2XYQA 3CUWA 4A15A 1QHHB 3H8WA 1RLJA 4GVPA 1W4ZA 1RXYA 4OQQA 1E4EB 1PIWA 4FI3F 2FFQA 2P75A 2R65A 1AKVA 2H65A 4HEHA 1NXXA 3DS8A 2VEDA 3CEMA 5FYQA 4DM7A 1UBRS 1RTTA 2X1HA 2X8JA 2AI1A 5K0NA 3TDNA 4F4UA 1YRQA 5EWMB 1EI9A 5FFFA 4EI2A 2YINC 4WZ6A 5KHOC 1LXCA 4EB3A 3CZAA 2FCAA 1JVNA 3EEQA 2VSYA 5EFOA 3TGPA 1UBGA 3N58A 3ASQA 1R0WA 3KAQA 2NMVA 3MLBA 1XAGA 1L5VA 1XTSA 2ZUSA 4NECA 4O5OA 4DCJA 1W36C 3NHRA 1VCNA 4EA9A 2PD3A 1A9ZA 3HB0A 4YROA 4BQFA 4ETWA 3CEAA 3H7AA 4NJEA 3WWCA 4QSHA 5IP5A 2I5PO 5GINE 3FI9A 4YCJA 5EWLA 1PR4A 4D9FA 4H6PA 5CNJA 5CVVA 1VRVA 3QKWA 3B48A 3OQNA 3ZI0A 1Z4JA 1U8EA 3ICWA 3KKLA 3PFKA 1JHAA 3QEMB 4OP1A 5CAEA 1DV1A 1ZN2A 1K5GA 1KETA 2FNAA 3ZZNA 1NVMB 1MJHA 4F7WA 1N4DA 3WMWA 4BQNA 4O4IA 5TC4A 4DY4A 2Q7OE 1IQUA 1UH5A 2F1IA 4DLYA 2RGXA 1TADA 5B7QA 2XZLA 2J6HA 3EN0A 4M87A 1OT5A 1U9JA 4FW9A 1QIMA 1HDIA 1SMKA 3ZI7A 5I5EA 3ENKA 3WZMA 5I8WA 2CMGA 1YRAA 4YPOA 4JXZA 2HD4A 1JEDA 4MZXA 3MWKA 3SVZA 4B4WA 3A31A 3B12A 1R2QA 3A9CA 2H7VA 3F47A 4K88A 4Q1EA 2Y77A 4MV1A 2WVGA 3MINB 1JXMA 1XR3A 2WFLA 3RPEA 5ECYA 4D74A 3GEEA 3CH4B 1DQZA 3QSYA 1YQQA 1LK0A 2G0TA 3N75A 1VE6A 1RBZA 2H52A 4ZC1A 1JEQB 4AYWA 3KCNA 3OA0A 2ECQA 4FFBB 3ZIAA 4ZIRB 2IS2A 1M1NA 3TJRA 2CUKA 3GV0A 2GM9A 2R66A 4UTOA 1EZZA 2GJKA 1YJQA 2OK7A 1ZIXA 2ODNA 4OP7A 3C74A 1EZ4A 4YJHB 3QPCA 5A9RA 5EINA 2XF8A 3QPBA 3AF3A 1GGEA 3SX4A 3A1TA 4E08A 1ZICA 1SUEA 3DQPA 2WUEA 5F1KA 5KSZA 2YJ3A 3CN7A 4CI9A 3D8SA 2ZRBA 5FB3A 3O6VA 4MVJG 4TM7A 4B3JA 1JDBC 1XLTC 2JZNA 2XWQA 4IJUA 1ZWLA 2C5BA 4ZQBA 2G1PA 5D1NA 4HLNA 1N0UA 2ZUFA 2XJ4A 1AKYA 3B6IA 3Q7EA 1K8XB 1TA9A 1W0JA 2QRQA 4BLSA 2GKGA 4RPKA 4DPMA 5TE9A 2VDQB 2DKOA 3GH3A 1IAVA 1U94A 1VHJA 1KAOA 1P5HA 1U7TA 3JS5A 4G65A 4H7IA 4NRDA 3OZ7A 5I5GA 3UYKA 3ONUA 2Z5VA 5ALKA 2ONYA 3VPBA 2PT6A 2ZETA 3JWJA 5CT6A 3VOAA 2FY8A 1Z5WA 1FW6A 1Q22A 3IT1A 3RC8A 1T3TA 4PRYA 4HFJA 2W6ID 3QZUA 5HMMA 2P3SA 3E2IA 3RWMB 4ZT3A 2HK6A 3MRXA 3KHSA 2PRSA 4DV2B 4AUKA 4OM8A 1CRQA 2J59A 2L0XA 4A91A 4CQMB 5F2OA 1EFPA 3N6XA 2J07A 4X45A 2YJ5A 4F0JA 2UU9B 1IN5A 2QX8A 5KYXB 1LDBA 4IEEA 4J94A 1UKZA 4HAIA 2B34A 3HTXA 1F8FA 5K8LA 1NZJA 3L40A 4I2NA 1HE1C 5ESWA 5FOXA 3BEOA 4TVOA 3KQYA 2NIPA 3ZWYA 1CUUA 3CLUC 3PZBA 3QBJA 3DMFA 4RDIA 3PSAA 1UL1X 4B84A 2H18A 1Q3TA 2G09A 1ZR4A 4CTMA 2DCUA 5E2AA 4RZQA 3RIGA 4AAYA 1B0PA 3PFCA 1OC4A 2ZTLA 1EYZA 1MNAA 1TOAA 1X86B 2OD7A 3HHPA 3M89A 4REMA 4ZO9A 1DEOA 3F49S 3WFJA 5LWHA 3C85A 1E2GA 1I1HA 2H8KA 3NHSA 4UVEA 1P1CA 5JZBA 3I92A 3L5KA 4UATA 3MJCA 4Q6WA 1U3CA 3DFKA 1HEIA 4L78A 4LDAA 4IJKA 2OUIA 4RPBA 2J3MA 1N6PA 1LVHA 1SD1A 3FVVA 1QNLA 2BONA 4MITA 4XM0A 2W6OA 2OCKA 3TG8A 1E6LA 3EVAA 2RHGB 2L82A 4XOTA 4WJKB 5DGHA 3D8UA 3R7WB 2QMOA 1JWAB 3M1YA 3AT1A 2N1BA 3U4HA 3QPAA 5JDCC 1F0PA 4RY2A 3VYUB 1WTHD 4W9NA 4BNUA 1AKUA 1NRJB 1OIWA 1TQHA 3I23A 3AEYA 3ILHA 1WULS 1EBUA 4UM7A 3RABA 4PQRA 3QFFA 4ZOLA 2PMEA 5DLYA 1W8IA 1JFTA 4LXXA 1E3EA 2E4VA 4EFMA 2AD1A 4R6XA 3IV9A 2Q50A 4DCGA 5MN5A 1NQOA 3QU9A 4PX2A 3WLKX 2OR3A 4PSCA 2FW0A 1U2TA 4WACA 3WL3A 5BP7A 1BEEA 5DIZA 2E1BA 1TC2A 3GT7A 4ZAVA 3T94A 1E7WA 1X8LA 2BBOA 1DIHA 1D2NA 2Q2QA 5EE3A 4CR7A 2FSVC 4F1JA 3A6KA 3IVRA 1U7XA 1LS6A 3I9V1 3TR0A 1LSSA 2XCOA 3KXIA 4A6DA 2HI0A 2Z3WA 3QWFA 2G5PA 4ZC8A 2P4SA 4O29A 3U13A 4A5SA 4WKCA 3KWMA 3GYBA 1UBCA 3REFA 3KJFA 3UENA 2DWPA 3BTSA 1F3OA 5K0ZA 3S2FA 1YZ3A 3AEKB 3K6JA 4R16A 4MEJA 3ZNNA 3CCRB 1NOKA 3C98A 1X2EA 3G2PA 5E0OA 3W78A 4L16A 1M74A 1TD1A 3CTMA 4ZOQI 5B1YA 4HNVA 1X42A 2JJYA 3KFLA 5E6SB 3E27A 3WKDA 4E3WA 1JR3D 3AP3A 2A5LA 1GAWA 5IC5A 3SKVA 4Q18A 5D3QA 3ASRA 5JSQA 2XMRA 4Q66C 3CWZA 3DP7A 4RD3A 3EXG2 3IDFA 3ZYCA 1O6GA 2SKCA 5KTMA 1VJ5A 1E79D 2QMEA 3G68A 3GYGA 1WF3A 1SKYE 3PA6A 4NH4A 5TNXA 4MR7B 2P9TA 2RH4A 2GLXA 1MC1A 2Z8ZA 1FNSA 1AK9A 1YL6A 3AR8A 2Z8YM 2OGUA 2X2PA 3HKDB 2LWIA 1D5CA 2PZLA 1GWNA 5EVJA 1RJFA 2Z1MA 2AOUA 3ROKA 4XM1A 4TMWA 4QVAA 2OQ2A 2XUJA 2X0JA 2FPPB 3MZ0A 1OT3A 2WWTA 4O63O 3NC0C 2QPTA 3V1NA 4HAZA 2YRFA 1DC6A 1CHDA 1HFKA 3OM1A 2HZ7A 2YN0A 4L0QA 1YB1A 4L28A 3AILA 4X92A 1HUQA 4EPYA 3MCAA 1JFFB 1HRKA 4OBEA 1CBUA 3KTAA 1ADYA 1UPFA 1OH5A 3JQRA 5JVDB 4YQYA 2X3YA 1TVCA 3AL2A 1HZZC 3CCSB 2C0CA 3CLSC 3G0GA 4OOVA 3NW9A 4YRIA 3RODA 1OA1A 1H0KA 3HNOA 2C07A 3F8TA 4Q03A 2R1ZA 3G1UA 4LZZA 4QUJA 1ODLA 3JQFC 2QTVA 3CRNA 1Y9ZA 1OH8A 1RWPA 3A1UA 1PO7A 1XHEA 3J7AC 1TI7A 3THYA 1O6FA 3CLHA 5CGZA 5HG0A 5HX7A 1G41A 1N2IA 1XRMA 4KODA 4LVOA 4TV8F 1T3GA 4DXAA 4JLJA 4IGIA 1M6EX 5DTIA 3F5DA 4EI7A 5C7IO 3A3NA 3OEHD 4NZMA 5EXEA 4NMXB 3BJRA 1KQPA 1VBNA 4GBGA 4ZYXA 1L7RA 3SJCA 3K0HA 4CM9D 5GGYA 3T38A 3UQZA 4YEJA 1MF7A 1TT7A 3CBQA 3OPVA 1M2FA 3WNVA 2D7DA 2FR8A 5JARA 1Z4NA 1Y34E 2V1XA 3T3DA 4DM3A 5BMVA 2ZI4A 3DDHA 3DR5A 1P39A 4DK0A 1XTTA 2IFTA 3NUQA 5J58A 1CY1A 3A7EA 4WECA 3R8XA 4XDHA 1QVZA 4PVCA 4YDQA 4AO7A 1V1JA 3HBFA 2PSEA 2IU3A 1OCEA 3INGA 2ERXA 1OAKA 3EVCA 4R9UC 1IVYA 4ZYYA 2PNJA 2QSZA 4DC1A 4ER5A 2VAPA 4FDAA 1KF0A 1Z25A 1NYRA 3EIHA 3W5UA 4QOSA 4DLUA 1UXOA 1UJCA 3V7UA 1XEXB 4ZVVA 4D9HA 1BH6A 2K7FA 2R9VA 1CDDA 1R8SA 1Z17A 2HQOA 2IEZA 3B8EA 3RS8A 4ZWNA 2PGLA 4FWTA 5AI5A 1KI8A 4IKEA 4E15A 3F96A 5BUSA 4WMLA 1T8PA 5DYWA 2QJTA 4F9GA 3O83A 2CXOA 4IUBS 1F4LA 1N3LA 3NWPA 3T3EA 1WSAA 2VPYA 1UZNA 1YBFA 2M6RA 1P0PA 2W71A 3INTA 3H8SA 2IDKA 3ANSA 4BKQA 1EXVA 1J7JA 2XQIA 4S1NA 4PFKA 1O5IA 4WCFC 3HDHA 2JGDA 2WWHA 1HYEA 3L8HA 3LHKA 2OBLA 4MQBA 3ZDYB 1QONA 3ZX5A 3LBYA 4HGNA 1HA3A 4TYYA 1H9AA 1DNPA 3HCDA 3O0TA 3C6QA 3OFVA 4JY7A 5FXMA 1OASA 2X7XA 5EMLA 1AUQA 5T4EA 4B4OA 1IM8A 3H5LA 2CBZA 3RVBA 4Q9DA 2VRCA 1WPXA 2OHFA 3K1AA 1NFFA 3IKVA 2Z2IA 2PPVA 2OSVA 5DW3A 2YHBA 3GDWA 2PMCA 2RHLA 2WYVA 1HNZB 4PINA 5TVGA 2XZOA 2H08A 3I83A 2Z09A 5LVAA 1X87A 1IPHA 2JFBA 2IPXA 3RRYA 3ZCSA 5IYWA 2O0MA 4AICA 4YJ3F 2OKCA 1BVHA 2I8LA 2Q1TA 4WE3A 4X8MA 3H6GA 4D0LB 3UW1A 3FZNA 1H22A 1G6HA 4O2AB 1FOEB 3P0EA 5LP6B 2J32A 3K92A 3FCYA 3P71T 5K3FB 4R3UC 1RW4A 2EFYA 3MRTA 3I2JA 2HBQA 4L02A 4EHLA 5IZCC 4F1KA 5KYYB 3C15C 1U6KA 2J9FA 2X0IA 3GCXA 1K89A 2DPXA 3DGEC 3HXOA 2VNSA 1V5IA 1PNRA 3VKWA 3N3BC 4CN9A 3KOOA 3U37A 1LLFA 2NVUA 1NG9A 3E0XA 1U80A 2VPQA 3MWEB 3QKSB 1PR9A 2P6MA 4LX8A 1FB5A 2CF5A 1NVFA 3IP5A 1Z88A 2JHPA 2PY6A 4M0KA 4CGZA 2J4CA 3STXA 2PSFA 1NN1A 4B44A 4FYWA 3OAAD 4BVFA 1MPXA 3TOVA 4QBKA 3IVCA 1DOAA 1M1XB 5IM4A 1NP6A 5FUBA 4RA9B 2GA8A 2CFSA 1DXQA 2EGUA 1QBGA 2ZIVB 5HE8A 4BO7A 1GG8A 3NIWA 1P2UA 1D6NA 1ZSYA 4BJ3A 3TIFA 1B6GA 2IYWA 3MMNA 4ND3A 4YELA 5A4FS 3TFOA 2BHRA 1QFZA 3LE8A 3Q5DA 3TW6A 1TAHA 1W2HA 3N2GB 5J5AA 2G7ZA 4INPA 3TI9A 2WHQA 5FUXA 4W9NC 2GM3A 4P6YA 3D8BA 1C4OA 4KRXA 4MQFB 3GA5A 1VXOA 3GAAA 1PLJA 4MSUA 3F5FA 2JAOA 2RGNA 1HQYE 1JQDA 1ABEA 4K6KA 1M10A 5DDIP 4OHKA 3REGA 1IXZA 2G3YA 1S9HA 5REQA 5CLLA 1N78A 4JELA 3FF4A 3WQQA 1BN6A 3EVEA 2IU4A 2Z1NA 3IIMA 3MIIA 1X1CA 3PQ2A 3KQPA 4X7FA 3SSOA 3Q5GA 5HJEA 3ASSA 4GPTA 1YB7A 4BO4A 4U7HA 2E55A 1NUQA 2CHFA 1WETA 4GR4A 3PDIA 4TMZA 2TRSB 1C3JA 4MYDA 5H83A 4AKEA 4Y1RB 2BGNA 4KZPA 1UD8A 3SJ7A 1XEWY 2OE2A 5ESXA 4MLPA 3OP4A 4CL2A 5HWSA 1IH8A 4KXNA 5BSRA 3RS4A 4E32A 2Z95A 3F6EX 2Q0HA 4JLUA 2G6BA 2FEPA 5B7NA 4MV0A 3C5VA 4EP1A 3NTOA 3MEQA 4J4TA 1HRDA 1N1DA 1RM0A 3H17A 1QQAA 1E9AA 4BFXA 5F3DA 4HX9A 2O20A 1UANA 4K9RA 4ZVNA 3I5YA 5KCMA 2Z9CA 1N3IA 3WYGA 3WJAA 4K6CA 5ITZA 4QG3A 3DOHA 3ERCA 1OZHA 4EQZA 4N5LA 2KM1A 4DGQA 1E18A 1N7JA 2HSEA 4YMGA 4OHYA 4YALA 1S2DA 4CBVA 5L40A 2Q8NA 4J03A 4XA8A 4PPFA 1KOJA 3PUIA 3L4KA 1ENOA 1G4HA 4FEGA 4MGYR 3G17A 1S7GA 1FFHA 3A4YA 2QEQA 2XCIA 1Q86D 1DEHA 4QDTA 1YGPA 1W36D 4CLOA 1U31A 2I3ZA 3PEUA 3A36A 4CKCA 1JLHA 1E1QD 3IFSA 5EA2A 3SYKA 4V1CB 5IF3A 4LF9B 3NBKA 4K6GA 4OHXA 4H18A 1YQDA 2BV3A 4PABA 1P8AA 3CJQA 4G3XA 4S2UA 2XW6A 1GTG1 3BERA 3E22B 4MAFA 3SR4A 4Z0TA 5ALGA 1U3DA 3OCXA 3AUXA 2WT8A 4M0FA 1TC1A 3NV9A 2JPDA 1SHJA 4RNCA 5T5QA 2PE5A 3D3KA 4P26A 4H7KA 4JI7B 2H1HA 1SUCA 5KDLA 1SCJA 4ZICA 3DFUA 3OQJA 4A73A 2G4VA 4IDFA 3QIVA 4CMIB 4BP9A 1U8AA 4DR1B 3Q7TA 4LJ9A 4IWYA 1LSJA 2EG9A 4WEOA 5CFRA 3O2SB 4MA0A 3D7LA 1KJQA 2O1WA 1COZA 6Q21A 1LH0A 2HB6A 3I3SR 4Q3DA 4EPWA 3OO0A 5J5CA 3A1FA 2VSQA 1HVXA 3A0UA 4POOA 4C2TA 1RYHA 3VC3A 3ZH9B 3OUTA 5JT1A 1P1KA 4C0XA 3COVA 4ZEXA 4Q4HB 1T9DA 2ZZNA 3FNGA 2YY6A 2SHKA 5AJVB 3AWIA 1WU8A 1JWBB 1NYQA 1YI1A 4RPGA 4U1RA 5DGDA 5E9AA 4EB0A 2HQRA 3EGXB 2CYBA 1QF9A 3R3XA 1NFQA 1A7JA 2D3WA 1OJ7A 1A7AA 5B2EA 2P9EA 5KVAA 2P5YA 1JEAA 3GP5A 1U3WA 4MVCA 4PAMA 5FWAA 5JRDS 3UJ7A 3EPKA 2PO7A 3I1IA 2NP6A 3MGGA 3NM6B 1DBVO 3JYQA 1RAAA 3EZXA 1CIJA 2AC4A 4MYHA 4UEQA 1PWHA 5DW0A 5G0SA 3CCJB 3EH2A 1PT5A 2OAGA 5CBKA 1ZGJA 2D2XA 5GM1A 4L5AA 1EDOA 4ZU1X 4X90A 3QU5A 4DA4A 5TY0A 2X0KA 1I9GA 1YB5A 2YNMC 4J0FA 4KQGA 5A0FA 3RU3A 3VPCA 4QJ3A 1NVVQ 4HATA 3L43A 4UOZA 1C2TA 1GCGA 2IYAA 2O3UA 4FWIB 4CWAA 5L6LB 2HRZA 5FPSA 3KR9A 1QK4A 1H4VB 1IY9A 5BURA 3KSZO 5CNKA 2AQIA 1W0CA 1CIPA 2W2OA 5AK6A 3RVRA 3SEZA 2V9ZA 4W8GA 4DA0A 5C32A 1R6XA 1VG1A 3OZTA 4PBRA 4PAAA 4Q4JB 4QYWA 4UTPA 4KVGA 4PGOA 3W8NA 2VT3A 5FWYB 1C1XA 2JGRA 4TS9A 1IK6A 4WNIA 3AF2A 3RJMA 5CVUA 1YIOA 1HZEA 4R4JA 1ESEA 4G25A 3H1BA 4P1VA 4PAOA 4UDYX 3TDKA 3E3AA 4L50A 3ISXA 4LHVA 2OA0A 3TAXA 3ZTYA 4N12A 3AM4A 3G2LA 2QUAA 5FI1B 4E2XA 1EEHA 4BQOA 1OBOA 4CT4B 2ZR9A 1R8YA 3J7TA 4TZKA 2L42A 3ZTWA 1V8OA 4EJSA 3STVA 4TVSA 1OFHA 4Q24A 2AKEA 4O3FA 1L5YA 1AQNA 3ORYA 4X7MA 4F21A 3CUTA 4WCVA 3ZHXA 1L7EA 3S99A 2C0QA 4BNVA 1FSSA 5FBWB 3GLUA 1T26A 1XZJA 3O38A 1JQAA 3PYMA 4S12A 5F77A 1AUXA 1NBWB 6AT1A 1SJ9A 1A98A 1FNBA 2AQ8A 4WK0B 5G02A 3E84A 4KRGA 4O8CA 4EA7A 3VXKA 3I6BA 1WDMA 2A6PA 2IIQA 3ENVA 4RF3A 4DLNA 1T1RA 4EW6A 1HNNA 3K1ZA 4HRXA 3SHQA 1EA7A 2BEKA 3JZFA 3RDPA 1JE0A 4GUDA 4U4AA 3A7DA 4D7AA 4HGRA 4DIUA 1JKMA 4DJEC 3N86A 1H93A 3IAM6 2ZXIA 5HJ5A 4CTOA 4Y1EA 1NR5A 3I52A 2ZUBA 6ABPA 2ZT6A 5HJ2A 2HFJA 1FUIA 4OATA 5BQFA 2V4DA 5DISB 4MDFA 3U81A 3GUUA 3H9CA 5GV8A 2GTHA 2A57A 4IS3A 2VWGA 5CA0A 3OG9A 4NEHB 5LYJF 2UUCB 1XTQA 4FGLA 4L27A 5DULA 5EEGA 5B7PA 2OAP1 2W2NA 3B70A 3Q1KA 3QNUA 4I3GA 2DUNA 4EHHA 1U7HA 1XRLA 1PLKA 1J0CA 3B6JA 4GFDA 1JKXA 5CXUA 2H5EA 4MRVA 2JAQA 4NF2A 4CM1A 3X43A 4PNEA 3W1WA 4NZZA 3A6JA 2E0IA 1AHHA 3FDXA 1ZCAA 3X1DA 1GG5A 4DVGA 2QYOA 1TU0A 2Q8PA 5F33A 2XXAA