2PLFA

The structure of aif2gamma subunit from the archaeon sulfolobus solfataricus in the nucleotide-free form.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title New Insights into the Interactions of the Translation Initiation Factor 2 from Archaea with Guanine Nucleotides and Initiator tRNA.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 87
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plfA01
3IIKA 4PZYA 5G40A 3AVQA 3R9WA 3FJOA 4WZAE 4D4LA 1R0XA 1EGAA 4DDUA 2LCFA 1ZINA 1WF3A 2QORA 1H85A 4HLUC 2WJJA 2O8CB 1D5CA 3ASZA 5DE3A 5TB5A 4AWXA 4PC1A 2HCJB 1XP8A 3GLHE 3KX2A 3BH7A 1TQ6A 3B2EA 3QBVA 3QEOA 5IK2A 3Q9LA 5DYGA 1CS4C 1GL7A 4KODA 2FSIA 5AK0A 2IA5A 5BYKA 1JAHA 4IOMA 1B0UA 1MKYA 4Q4JA 4Q7JB 2WKPA 1EXMA 2XB4A 1RRFA 3EXAA 3DM5A 4A8JC 1QHSA 2KJQA 3WMGA 1AQUA 1NBMD 2GTPA 1GWNA 3R9IA 3CH5A 1YHNA 1HH4A 5AWFC 1W7AA 2VHQA 5FPTA 1OH6A 4AKGA 3IBGA 3B9PA 5J40A 1S3GA 2GCOA 4M4SA 4Q4AA 4Q00A 1WBDA 1R5BA 3U6BA 3K1JA 1TEXA 2JLRA 3E5HA 4IW3B 1Q82D 3AKDA 3EWAA 2QMHA 1D2EA 2ZITA 2RKOA 4GP6A 5EXTA 1NY5A 3K0FA 3QKRB 4Q1DA 2IT1A 3CPEA 3GJ7A 4PC2A 3TW8B 4B2IA 4QJ5A 1GR1A 2C96A 4MUAA 3GLFE 1N5JA 1A5TA 2QGNA 1MRSA 1NMZA 3CM0A 4OQXA 5D3MA 2EWWA 1DG3A 3I32A 4LHYA 3TSOA 1KI1A 4E07A 2ZROA 3CCQB 3PEVA 1YR8A 5KSZA 1DOAA 1UADA 1ONBA 1N6LA 3NXSA 1SXJB 4PO9A 4ZCMA 1ANKA 1P9WA 4DKXA 2G3YA 3K53A 4NYJR 2H7VA 2QL6A 2GJ9A 2ZEJA 4M9SA 2QMUA 2IS2A 1QFYA 1G3RA 1OXUA 2OK8A 2PL3A 1U94A 2H5EA 3JZAA 1N5KA 4NYMQ 1T8UA 1GZSA 1KSHA 3ES9A 3NBFA 5H1YA 5SZHB 1M7HA 3U2QA 3P32A 1T0JB 1OIXA 2PEZA 1RIFA 2O8BA 1NY6A 3UATA 1NMYA 5UKDA 4LJ4A 2OCYC 1VQOB 3CC4B 3E20A 1FW6A 5AUOB 3GLGE 3BOSA 4DEXA 1OFTA 1KI3A 1TU3A 3HJNA 3I8XA 4MH0R 1VCOA 1P5ZB 3W8RA 1Q1QA 4HLDA 1A2BA 1CQXA 1VQLB 5GV7A 4IOKA 1DAEA 3BH6A 3I61A 3LX8A 4QXAA 2VNKA 3CRMA 2OLJA 4G5RA 4PPGA 821PA 1Z6TA 3U3MA 2I1VB 3GLIB 2JAQA 1S0UA 1Z8FA 3A4MA 4JL6A 4BZXA 1O3YA 2QPOA 4A0RA 4DHEA 4TN1A 5IT5A 4B43A 1P9RA 1V5WA 4B3CA 3CUEF 1KJWA 1YKSA 3GJ5A 5SZJA 1IN4A 1XTRA 3QE2A 3BC1A 1XCGB 2V9PA 1B2RA 1U9IA 1LW7A 4UNQA 1KDTA 1TX4B 4KBGA 1DTSA 4LYFA 1XJ0A 1KDOA 1W49A 3H4MA 2WZQA 1WP9A 1GAWA 5JHGB 1E2NA 3Q3JB 2VP4A 1LF5A 1ZU5A 3BGWA 3JQQA 1EFTA 1TADA 5E7MA 3GLHB 2ZI6A 4QG7A 5L3VA 1EESA 4F7DA 1UKVY 3T12A 2A2ZA 2BCGY 3GQBA 1DARA 1T6NA 2B7CA 4W5WA 1P6XA 1PUIA 4M22A 2DETA 2GNOA 2YNMA 4FCVA 1QVFB 4PPQA 3SE0A 4AY2A 4TQ9A 5EMNA 2AWNA 1JAIA 2CNWD 2SHKA 3GJ3A 1ZNYA 3CB4A 1YIJB 4DSOA 2C9OA 3TE6A 4JS0A 4QBGB 4DDWA 3E1SA 1EK0A 4DT1A 2WSMA 4UNPA 4R98A 2LKCA 1J2JA 1W47A 1HV8A 4A0HA 1Q3TA 2OCPA 1I4TD 2ZI9A 1KGDA 3PUZA 1E9AA 1W2HA 2XNDA 4HAVA 2Q3FA 4KYUA 3OFNA 4O0MA 3ZIAD 4DIEA 1XCPA 3EW9A 1EFHA 5FOTA 2O8EA 1UBCA 1G5TA 2GJKA 2R6FA 4C7OA 4XD7D 3VO2A 1G8FA 2G9NA 5J4HA 3C8UA 2ZTSA 1N6IA 4LPSA 1E3MA 4A8JA 2BEKA 4X8HA 1Z6YA 3AV0B 4TTRA 1OXXK 5KSYA 1QBKC 1NG1A 3F0TA 2NOAA 1X86B 1FNDA 2FZLA 1J7KA 4LYAA 3VFDA 1KC8D 4GL2A 1NI3A 5EE5B 1G291 3H86A 3KXIA 1E2KA 3S1AB 2OK7A 4A82A 1N6HA 2BMFA 1GVHA 1VDZA 2FWRA 2VP5A 2ZETA 1SQ5A 1E79A 4A2PA 2ZI5A 4GT1A 2Q0HA 5FPKA 1COWA 2BHRA 4L16A 1XTKA 1JI0A 3DMNA 3PJRA 1EWYA 4Z1MA 2G1KA 3KB2A 1RJ9B 5DI3B 3FKQA 5DGXA 5G41A 4D0NA 3CCJB 4F4JA 3W90A 3B82A 3EARA 3CCEB 2ZAMA 4MRPA 3AVPA 1SVMA 4M8NE 1G20E 2ANBA 1IOZA 2QAGB 2V4ZA 2EFGA 3ZS8A 3AB3A 1N5IA 4RCZA 1MOZA 4HUQB 2KBEA 4LZZA 4XIGS 3UIEA 3GLGB 4Q01A 5IK2D 2BKEA 1PLKA 4IDOA 2WWYA 2HLDD 1OLOA 1PZNA 1DG1G 1BH2A 4JLKA 4PQYA 3AQ4A 1Q1ZA 2RB4A 3E70C 1Z47A 1KJYA 3QKSA 2C8VA 1ZIPA 4BRWA 4LRWA 4UAJA 2EYQA 1P73A 2FN4A 4ZDKA 3HR8A 1ZUHA 4NMMA 2A5GA 2RGBA 4RFSB 4JMPA 721PA 1G5RA 1S2MA 2DWPA 3IKJA 3TSZA 4Y9RA 2J7PA 1X1SA 3CNOA 3L8YA 2CK3A 2C9YA 1US8A 4JVSB 1W5TA 2CLCX 2D2EA 2QENA 4Q7LA 2WMNB 4NYMR 3WNBA 1SVLA 2E1RA 3C15C 1QFJA 1XD9A 4DSNA 5H8WA 4WOPA 1DAGA 3RABA 1KAOA 1RRPA 1E4VA 4EQ6A 3NEJA 4LHVA 1X8LA 2AD1A 3NTUA 2GESA 2ORVA 2ZYTX 4IEIA 1W0JA 2J9RA 2W6IA 3CW2A 5F3WB 4HDQB 5A5GA 1Z0DA 2QSYA 3QY0A 3M6AA 4HYYA 4BWYA 4JJKA 5EP4A 2GAAA 3LLMA 4ZPXA 1Q81D 1QHYA 4CEJB 2JIZD 3FE2A 3NDBB 3QVUA 4KSCA 4C0AC 4B34A 2QT0A 3ZBTA 1TPZA 1E96A 2CE7A 2ZVPX 3LRPA 3MWJA 3QPWA 1VCNA 2IYLD 2WBLC 4UKDA 2REBA 1JA0A 2CHQA 3P20A 5FH9A 2A7QA 5HCNA 5TV2A 1I4LD 2XSZD 1Z63A 1KI6B 4GOJA 1DE0A 4ASUD 1XTJA 2ZI3A 3TVDA 4NCHA 4DLTA 3WBJA 2NPIA 2ZYWX 2D06A 3EX7C 4G5QA 1IB0A 1Q21A 2BEJA 3K9HA 1JB1A 3QF4A 3TMKA 5CDFE 4B3GA 4J0QA 3ADKA 1TVCA 1R0WA 1OXVA 5FBVB 1NVWQ 1E9CA 1Z83A 2IXEA 4CIDA 2JLUA 2ZREA 1AZSC 1VQ8B 5SZIA 4HEJA 1PV4A 3EZ7A 3SS8A 1W35A 3D31A 2FGJA 2V1UA 1F5NA 1G16A 1T91A 4GDFA 5FL7D 4I4LA 5JECA 2DWOA 1F6BA 521PA 5FOWA 2NIPA 4EUNA 4TTQA 3J81k 4DCNA 1DADA 5JI3E 3CMEB 1KTVA 3THOA 1YITB 1XJQA 5BQ5A 3PV0A 5JBQA 2WSSA 5FUXA 2HF8A 3G0HA 4U00A 3QENA 1ZUIA 2DFTA 2FPKA 2GK6A 3AP1A 3W8NA 1B23P 2XTNA 1W1WA 3WP0A 4GZMA 2X2EA 1Z0IA 4OHXA 1Z08A 4CEHA 3LW8A 3WNDA 1SM4A 1HTWA 4YXWA 4M21A 4B32A 2QPAA 3WP1B 2R6HA 5B58C 1NF3A 1E0KA 4KFUA 2ZRKA 4OHZA 3ZYCA 5LB2A 3GJXC 2QTZA 3FOZA 4B3DA 4FD2A 2OSBA 1KSGA 4DQKA 1IY2A 1VIYA 5IRCD 1CR4A 2FPLA 1IBRA 1XDBA 3BXZA 2MSCB 3P26A 4ASUA 4BUJA 4F7WA 4L5BA 5JLJA 4OHYA 2QNRA 4GBMA 1CU1A 1U0LA 2GK7A 5G3YA 1YRAA 2XNJA 2QRZA 4FIDA 5CIQA 3RWMB 4DLVA 1KI2A 1R7RA 4MITA 3KQNA 2ZE5A 1ZD9A 1X8KA 2VHUA 3WYFA 3AKEA 2FH5B 4JVMA 1YJNB 1BYIA 2CCGA 3LQQA 1BMFA 2W0SA 1T3LA 1XMJA 1PLJA 2BGIA 2ZSBA 3IGFA 4RKFA 3SFVA 4FN5A 2VPPA 4IDPA 1Y63A 2N1BA 3OW2B 1ZNWA 2HEIA 4LI0A 2VEDA 1A2KC 4MKIA 3OEED 4WIAA 2CCJA 4DBLC 4JLAA 4Q1CA 4LBZA 2YWGA 2XJ9A 2MMCA 3ZVNA 3B8HA 4GP7A 1W44A 3ADDA 5FTKA 3P1JA 5JEEA 2PZEA 2FSGA 1FRQA 1V43A 3LQRA 5L3SB 5A4JA 3TUZC 4Y0VA 4DLYA 4QHYA 2BJVA 1M1KD 3TLXA 2FNAA 3REFA 3ZVRA 1GFIA 4B3FX 3OZUA 1R4AA 1S96A 5HCIA 4YAWA 3W5IA 4Q5IA 4QJ3A 2WTUA 4IJMA 1ZM2A 3IIMA 5EXPA 1F20A 2NTYC 3CRVA 5EUMA 1GNRA 3T5GA 2WKQA 4Q47A 4XWAA 1M7BA 4MYCA 4N1AA 5GVRA 5KDLA 3BS4A 3NH9A 3OF5A 3DPUA 3QBTA 3W34A 5FA6A 3K09C 5J4LA 3RC8A 3C5CA 2D7CA 2OFOA 1MH1A 3CZQA 1ZYUA 1JPJA 2PH1A 2ZRIA 2OZEA 3K0CC 3SI7A 4A15A 3BAFA 1JALA 2OFXA 3U61B 3MRSA 2BGJA 1NMXA 3CX8A 2EU8A 2BMEA 1II8A 2WWIA 2D62A 1R10A 2JGNA 3THXA 3GP8A 1QVRA 1M90D 3HPQA 4FI3C 4RZUA 1YJ5A 2QMEA 2CHGA 1NBMA 5J5CA 2QMOA 3RS0A 2CMKA 1J90A 1L4UA 2ZRAA 3LXRA 4B73A 3VR1A 4TLEA 1JEDA 1XMIA 3IUYA 1ZC4A 4IXNA 1R8SA 5EE3A 5AUNB 1KO8A 1Q22A 1S4QA 1E2FA 1W4AA 2GCNA 4LOAA 4PANA 3VU9A 5CB8A 1NNEA 3KKPA 5CIWA 5BN4A 2XAUA 2VIIA 1KZGB 4AF6A 3QUSA 4PO1A 1DAFA 2QRNA 3TSWA 1UBEA 1MABB 3DDCA 2X8AA 1RE0A 3W6OA 3H0KA 1ODFA 5FBQB 1N3BA 4LV8B 1KI7A 1FRNA 2ZIAA 1SVWA 2R2AA 3FWYA 2WJHA 1NVXQ 3KQLA 3GEIA 4F38A 1KSJA 2JJ1D 4JLBA 2OO7A 1E6CA 1OPXA 2PT7A 2X77A 3MJHA 1N0WA 3SYKA 2HMAA 4ABYA 1M2OB 4U7DA 3ZZUA 1H8EA 3L43A 1FNBA 1UEIA 3PVSA 4BPBA 1JECA 1UPTA 5DHFA 1QUFA 4Q9LA 1TF7A 5JCPA 3T1VA 4H1UA 4Q4HA 4C3ZA 1CULC 1G41A 4V0KA 4PPNA 3I4LA 1OXTA 1N2CE 1SGWA 1XWIA 4HAYA 2GZHA 4DLUA 3BFXA 4E5UA 1A1VA 1US8B 1BIFA 5FPYA 2P6UA 2CBZA 2BJWA 4ZCLA 2BBOA 2W2VA 2F9LA 3QI2A 5E4FA 2FSHA 2ZAOA 4TZ0A 3D3QA 2PMKA 1NVVQ 1VYVA 2NO1A 2ZSAA 4TMKA 4BLSA 4XVUA 3OZWA 1XRJA 3I5YA 1M8PA 1GSIA 1OF1A 4UJ3A 2B5OA 4YMWA 4JLMA 1S3SA 2JATA 5FOUA 2BM1A 4OI2A 1N25A 3G6EB 4EFMA 2CNDA 3LBIA 4F91B 3KQKA 2GEDA 2Q3HA 1E9BA 1R5NA 1JXMA 4IVRA 1KK1A 1NG9A 1VG9B 4LJ5A 1Q7YD 1S8FA 2KE5A 4OQNA 2EIXA 4Q9KA 3PUVA 4ERNA 2PMDA 1E9SA 3AF0A 1Q12A 1AZTA 1P61B 3K0AB 4QBFA 4R71A 3LO8A 4JLJA 2NQ2C 2W2TA 1JB9A 2IEZA 3EIQA 2OLKA 4IDQA 1GNPA 3B78A 1K5DA 3EA5A 3OZVA 5SZKB 4PHTA 4B2PA 5HR5A 4KCGA 4IVQA 4L9WA 3FDIA 3NEYA 3Q72A 1Z0KA 2IHBA 5CB6A 3QXSA 1DO0A 1W0KD 4DDTA 2IYTA 2Z0MA 1W48A 4Q1EA 5FUVA 3C5HA 4D26A 5F9FA 1KO4A 1VQMB 2CVFA 4Z8YA 3AF2A 4Q03A 1XPRA 2IYSA 4C0LA 5IDVA 2XXAB 3RVBA 2MSDB 3NC1C 2JLZA 1ZNZA 1YI2B 2EWVA 2F1RA 2CNWA 5FL3A 2A5DA 1NP6A 1ZM9A 1S72B 4HB0A 2GBLA 1OIWA 1E1QD 4EJSA 4KITB 4OBEA 2W6JD 2A5JA 1NBME 3R7WA 1NL3A 3ZZTA 1P72A 2OILA 3UWKA 3RC3A 3OJWA 4US1R 3FPKA 1ZW6A 4URWR 5B64A 2O8FB 2J0UB 1JR3D 3A4LA 3ZC3A 3QQ5A 4PAMA 4ACBA 3B1VA 1KKLA 4TTPA 1VHLA 2QP4A 3WHKA 4XD7A 2IK8A 1XU4A 4Q1BA 1HEIA 3CCMB 5JJLA 1YRBA 3DEFA 3TVTA 3ZVMA 2BN4A 3N2IA 1F2UB 1UEJA 4HB2A 1SKYE 1KHTA 2YVUA 2RCNA 4QRHA 3O8CA 1SVIA 1EFUA 4TLAA 4GFDA 3K70B 2H8KA 1X6VA 2DB3A 3WYGA 3NBYC 1W87A 4HUTA 1VQ4B 4AYXA 3UMFA 1RFLA 1JNYA 2AFHE 4E22A 5EXXA 1E94E 2QU8A 1XFAA 4PC3A 3Q5EA 3SYNA 4L4UA 5GJWC 4EPXA 2VNJA 2C5LA 2VBCA 4MUBA 4QGFA 4TT3D 3KZ1E 2OTJB 2GJAA 1N6PA 4US2R 2PX3A 3FTQA 3W5HA 2P0EA 3ZD7A 3CCSB 5HZHA 2OEPA 1CP2A 1HURA 3ZGXA 1XEXA 3IO5A 1Z6GA 3PUYA 4TL7A 2ZUBA 2IS4A 2ZRGA 4TYPA 5JMTA 3VX3A 5E7JA 5FTLA 3K0SA 4BZPA 4M9QA 5DHAA 4QFMA 4BPRA 2DFKB 2HLDA 2QZ4A 2C03A 1AS0A 3CO5A 3FKSD 4BRUA 1J9ZA 3ADCA 1Z5ZA 2TMKA 2YWHA 4QBHA 2HDNB 3UWOA 2R65A 1OT3A 2AKAB 1II0A 2CCKA 2NO7A 4MA4A 4C43A 5KNCA 5CM8B 3ND8A 3RYTC 3FYHA 4BFWA 1ZU4A 4U02A 1G8GA 1QHGA 4ZO4A 4DIDA 1NLYA 1Z3IX 1FZQA 1QF9A 2P5SA 3FHCB 3MG9A 2ZSEA 3Q85A 1A82A 5H70A 1MV5A 5FFMA 3EPLA 3CLVA 621PA 3I1FA 2WIBA 4YHBA 4LJ8A 4B6EA 1F60A 2VTKA 2HXYA 3T06B 1BOFA 4B44A 3HDTA 2QP3A 4XWKA 1E63A 2IXFA 2UZIR 3KTAA 5CYPA 3JVUA 1Z07A 4Z51A 1R2QA 4QHTA 4HE5A 2B8WA 1P75A 2IUTA 3KKQA 5CJPA 3EPKA 4B4DA 5K8UA 3WRXC 4C0BA 3UPUA 3MCAA 1J99A 2BWJA 4YAFA 2QM8A 3AKCA 1RYHA 2GWHA 5EXSA 4A6XA 3U44A 3PCRB 1D2MA 2Y8EA 4NH0A 4DSTA 4R9UC 1H8ED 4QGGA 4JYBA 1NN0A 3OESA 4W9MC 4CEIB 3CRRA 2MMGA 2JIZA 3L82B 1FQJA 1ZRHA 1C9KA 3QXJA 2ZRDA 5FOXA 2O8DA 4ARZB 4ZV4A 3UG7A 3U7HB 4RD3A 3L0PA 3U4QA 1W36D 2NMVA 3T15A 1QGYA 2AFIE 4IRUB 1ZBDA 1XXHA 3TGPA 3T5DA 3VU9B 4M2LA 5KPJA 4D6PA 2C78A 4KFSA 2XTMA 4H9GA 1P2UA 2XSZA 3VHLB 2P6RA 2OBNA 1E9RA 4GSYA 2VLIA 4JLPA 2PJZA 2ODNA 1ZD8A 2WOJA 3DO6A 4RY2A 2ODWA 5EE0A 4GOKA 4JKYA 1X8JA 2IC5A 4LCBA 4JL5A 4YALA 3QG5A 4KLNA 2ONJA 1SKYB 1ESNA 4BFUA 1IHUA 2P6NA 2C9CA 4WZBE 4YDSA 5FI1B 3SFZA 2ZRHA 4BEJA 3U7GA 2RGEA 2W58A 4C0QC 3X1XA 3WHLA 3EZ9A 3PFIA 2GF9A 2HJVA 2ODEA 2V3CC 1WQ1R 4JJZA 2ZR0A 2BIFA 2P67A 2WWFA 3A1VA 1IAQA 2R62A 2QEQA 1D8TA 4G5GA 4RD0A 2X19A 2YC4C 2ZS8A 1JA1A 3QFSA 5FL7A 5HPYB 4B6FA 2Q21A 2HT6A 2VHTA 2ZJOA 1FX0B 3ZS9A 1KO7A 4LJAA 2WMOB 2NO9A 4HB3A 3IQXA 1VQ6B 5KSWB 1T8TA 2NZ8A 3QF7A 1N0VC 1OKKD 4NTZA 1KO5A 1KMHA 3W6PA 1BKDR 1CKEA 1A8PA 1G3QA 3IQWA 4GMXA 5L3QA 3WY9A 1ESMA 4RD6A 5AJYA 1G9XA 3FMFA 2EYUA 3QOFA 4MRVA 1TUIA 2J0VA 3RNLA 1ETUA 2WPDD 2ORWA 3IPXA 5AUPB 2PIAA 4EPVA 4KVAA 3CXCB 4GI7A 3UMRA 4NL4H 5JSZB 2DFLA 3GEEA 3A4NA 1DEKA 2HF9A 1UAAA 1H65A 4FMDB 2YJTD 1E99A 2D4HA 1M6NA 2GDJA 2YYZA 1VHTA 4URZR 4EPRA 5CITA 1XPOA 4LHXA 4WXPA 3HP1A 3CPJB 3V4RA 1GKUB 2ZUDA 2BPOA 4JT2A 5TDHA 3RS2A 1X1RA 1GOTA 1Q57A 4B75A 1KD1D 3KXKA 3VKGA 4Q19A 2PZGA 2ZRBA 3OE7D 2YOGA 1FUUA 2QUZA 2N46A 3HPRA 4URYR 3EASA 3GLFB 4ZGQB 1OH8A 2J87A 2BMJA 2C95A 1U98A 2KI5A 2EFDB 4ITRC 5DNYB 2IXGA 1WB9A 2XJ4A 2ORIA 2C2HA 2FZ4A 4AYWA 2O0HA 1E2MA 1SZPA 2CJWA 3K8YA 3OEEA 4LJ9A 2AKYA 1DDIA 3R8FA 1CLUA 3HU3A 1I2DA 4NYIQ 3W2HA 2GXUA 2R6AA 3KKNA 3FFBA 2R6DA 2CRVA 4Q9IA 2IUUA 2JLXA 2ZUCA 4MYTA 1XEWX 4N3NA 3QXXA 4HZUA 4JVLA 5GVSA 2A9KA 1W5SA 3DZ8A 3KDSE 4IDHA 3QEJA 2GPJA 1ZAKA 3V00A 2OBLA 3CWQA 3HR7A 4Z8XA 1LS1A 1T5LA 4OYHA 1KDRA 3SNHA 2G0NA 1Z0AA 4QGHA 3G82C 2OXCA 3AVOA 4PHFA 3R7WB 2J3EA 3KFVA 4NU0A 5JHHB 4F93B 1BS1A 3AUYA 1HT1E 1GIAA 2FFQA 2VSXA 4PSKA 2CVHA 1W2BB 1K5GA 5DH9A 4M1KA 1TF5A 1XXHE 2ZANA 4A2WA 4EKDA 1XF9A 3ASYA 1AK2A 4UXJA 4RSGA 5CJ2A 2FFAA 2J46A 2VYQA 1CR0A 3EZ6A 3QJYA 4A36A 3WBKA 1G8PA 3KKOA 2DY1A 1E2IA 1QHHA 3W5UA 4AG6A 1JXOA 2PZFA 4ESHA 1CJTC 1G6HA 3UANA 4Q48A 4KLZA 5JS7A 2UKDA 4PHGA 1TTTA 4PC6A 1VG8A 3IEUA 4TL8A 1K8AD 1II9A 4PO8A 4S2EA 3THYA 4HSEA 3LX5A 2BM0A 5KU1A 1E2QA 3ND9A 1XD2A 2JCSA 3CRZA 2FFHA 1M1YE 1Q1BA 4FMCB 1VCIA 2H1LA 4NCKA 2QDXA 4JIMA 4MYUA 4RCYA 5HKKD 2QEXB 5EUQB 3TBKA 1MT0A 4ON9A 1AN0A 1W4BA 2YOHA 1IN5A 4LY6A 3BH0A 3MUFA 3TNFA 2H17A 3VAAA 1WBBA 2CL6X 1T5IA 4RZXA 3GFTA 5BYJA 5KSOA 1VYTA 2WKRA 5FUWA 4LBYA 1Q20A 1CTQA 2A30A 1W4RA 1XEXB 4GZLA 2ZRLA 1VECA 2QBYA 3P4YA 1CRQA 3FMPB 3LFUA 2Q9AA 4NCJA 2NO0A 2JJ1A 2YINC 4Q4JB 2HJGA 4O25A 3L0SA 1IJFA 2ECKA 1E64A 4S35A 2XNSA 1OFIA 4US0R 1NKSA 1OFUX 3AF1A 8OHMA 1Z29A 1YZLA 2F1JA 4LV5B 3SHWA 1QG4A 3E2IA 1ZM4A 1XE1A 2Q3MA 1G7RA 4XTRA 4KV9A 3BK7A 4ZKEA 4EFLA 1E2JA 2GCOB 3V4FA 4Q4AB 3RANA 1J8MF 1W34A 1VMAA 4V0OA 1VKJA 4MDEA 4M0LA 1E9DA 1EP3B 5HE8A 1E2EA 4Q02A 5HZKA 3OIVA 4W5HA 3K0FB 2G6BA 4R2HA 3D6TB 3LO5A 3U3JA 1G4AE 4HAUA 2WJGA 2OCBA 1XTSA 3VO1A 3QFRA 4B48A 2JLQA 2K5UA 3AVUA 2DFNA 2GETA 1E0JA 4LUCA 2QG6A 1JQJC 4X8OA 4NPHA 5D3MB 5AJVB 3KJGA 3SJCA 3ZVLA 3EG5A 1YZUA 4PHHA 5ANRB 4Z54A 1KK2A 2O0KA 5CYOA 2ZJAA 2IBMA 3I73A 3U44B 3MHPA 4P3YA 1IY0A 1YE8A 3LWNA 4TL6A 2QM7A 3BB4A 3LNCA 3RRNA 4JLVA 4EPYA 4PAQA 4XTCS 1XNJA 1S9DA 4LWZA 1ZP6A 1G1MA 4AURA 1G7CA 4XOIA 3VKHA 5FBRB 2XZLA 5FTJA 4DRZA 3LH5A 1NJFA 2O8BB 4BLTA 1CNEA 3QPVA 4OQMA 3THWA 1AA9A 4K46A 4A1FA 4TMZA 3O47A 2R8RA 4HZIA 1NN5A 4DQLA 3EA0A 2ZRFA 4HDOB 4C0SA 1Z2CA 3FVQA 4LPKA 3TIFA 5JCZA 5JRJA 1N0UA 1DVRA 1W0KA 2WOOA 3AEZA 4LHZA 4Q7MB 1W36C 2VRWA 3UXMA 4AI6A 4KFRA 1I7PA 1KY3A 2ZM5A 1LVGA 1FPMA 3ZLJA 4NYIR 5GV8A 3ZZ0A 2X3UA 1IY1A 1XBTA 2WJIA 2QE7D 3D8BA 1TQDA 1N6NA 1R8QA 5E7IA 4BECA 4D25A 2OBMA 4DC9A 3K9LA 5BWMA 5KNDA 1E1QA 4MGYR 4BFZA 2F7SA 1TAGA 3LBHA 3CCRB 2XB2A 2OT3B 4B76A 2W6JA 2V6IA 4TMTA 3VKWA 1OH7A 1IN7A 1A4RA 2ZQ5A 2OXRA 1FUKA 1S9HA 1HE8B 1XX6A 1YJ9B 3JQRA 2CLDX 3FFAA 1JR3A 3A1WA 3NDPA 4KBFA 2I4IA 4PX9A 3OEHD 4DLSA 4P32A 4P4SA 4WAUA 4OI0A 4TMWA 4HDCA 1OHHD 4PSAA 4LJ7A 2ZXUA 3W5VA 2JDID 4RD1A 4G1VA 1YZTA 3QKTA 4GPTA 1E98A 4WXRA 1BYUA 2R9VA 3GD7A 3IDQA 4G5OA 1VG1A 1SVSA 1E9FA 2GEVA 4C9BA 1Z06A 4QC2A 4D0LB 5LD2B 5FUYA 1N5LA 4F92B 1G6OA 1IN8A 4HAWA 2QY9A 4B3XA 1EX7A 2JEOA 2YZ2A 5JJIA 1YHQB 2Z4SA 3VHXA 2QN6A 2IF0A 3CF2A 2AX4A 2O8CA 3BFVA 1Z0FA 1NLZA 2J59A 4DWJA 2ERYA 2AXPA 1YJWB 3UG6A 4DT1B 3FMOB 4NCNA 2JLSA 4IDNA 1WDTA 4Q9HA 1G17A 3CX7A 3RRZA 4JLNA 3ETLA 1TNDA 1XZQA 1PLLA 1UF9A 4KYIB 4DB4A 3DZDA 4TT3A 2GBLC 1UBGA 4EJSC 1GRRA 1D2NA 2O8EB 3H2YA 3Q7PA 4C7OB 1ZCAA 1M34E 4PXAA 2PJRA 1RW4A 3GPLA 4A8JB 5B2ZA 3RS3A 3KQUA 5CK4A 1KRHA 3Q7QA 4RKEA 2C99A 4YMSA 2FJUA 2ZI4A 221PA 4PC7A 1CF4A 1IXRC 3I55B 2OM2A 3FKSA 3TK1A 1K8RA 1G64A 1YZNA 1OIVA 2F1IA 2VQSA 4BASA 4ZI3A 5LDDC 5JI2E 4QGAA 1YQTA 5EZ5A 4OI4A 5J4YA 5JRZA 4DEYA 1KI4A 4ZI2A 4HZUB 5AJZA 4V0MA 4PPFA 1RC8A 4TYQA 2QTVB 5IHPA 5DLQC 3CR7A 3SBEA 4D80A 1E32A 4WQMA 3QNUA 2QA5A 3FPAA 2QTFA 3SYLA 3DL0A 1PJRA 1GAQA 2X1VA 3X1DA 1KYIA 1U81A 4MGIR 1OE0A 2CXXA 4A0FA 1P7CA 1XEWY 1SXJA 2V8OA 5BW8A 1EG7A 3GJ4A 1XJCA 3RHFA 2F55A 2IYZA 3ZBUA 5DO9A 2UZ3A 1ZC3A 3MWKA 4YC7A 1RPZA 2IYRA 1WXQA 3BB3A 1OH5A 1YR9A 3QKSB 5FR1A 1L7VC 5LPNA 4DUGD 3C14C 5F9HA 1GILA 4MRRA 3CCUB 1GM5A 4LK2A 4AYTA 1KAGA 2CEAA 4LSGA 3TQFA 4EH1A 1F48A 4AK9A 4MKGA 3OAAD 1U99A 2WV9A 5AJWA 2VNHA 4HE6A 1FP7A 2ONKA 3GCGA 3SR0A 1GL6A 1GRNA 1N6RA 3AVYA 3SDZA 2WWWA 1DBSA 2KBFA 1LB1B 3K9GA 1E2DA 1JR3E 1NVUQ 3GLIA 3K0EA 5KO2A 3AVTA 4LJ6A 4MKFA 2WICA 3U3OA 2WWGA 4KU4A 3ICEA 1DAKA 2W2XA 4KI0A 1NN3A 2VNIA 2D74A 1G3IA 4QOSA 4EQ6B 3WRYC 1VTKA 1GVNB 4P33A 4P4TA 1OB2A 2A5FA 2RGDA 5JEDA 4FW9A 1K9MD 2E9SA 4QBIA 2AD5A 3B7GA 3RSLA 5KPDA 5JWOA 4TYWA 1GTVA 1Q1EA 5FPSA 4RVCA 4B74A 4FXPA 1AM4D 3I3SR 2H16A 3OIWA 4M1MA 3C7KA 3GLHA 4G5SA 2J7KA 3UMSA 4TSFA 4HAXA 1QG2A 1LFDB 2BC9A 1DAIA 3QFTA 5GJVC 1UKEA 1E62A 3A36A 2WAXA 4L8GA 5CLQA 4AF7A 1DS6A 1FFHA 2GVDC 4R7ZA 4XSHA 2HT1A 1LF0A 3C16C 4TLCA 1KJZA 1A7JA 1ZCBA 2NO6A 3BIFA 4C0KA 2OHFA 1OKKA 2VHJA 3KXLA 3I8SA 4JBWA 3T1OA 2PBRA 4NYJQ 1EX6A 4P0TA 3VR6A 2ZE7A 4D4KA 4A92A 3QFCA 1CXZA 3DKPA 1UKZA 4IOLA 1N6OA 2OG2A 1U0HC 2YV5A 4EDHA 2VL7A 4L9SA 1NSTA 3U5ZB 2Q9BA 3QF4B 4N3GA 1J70A 2F43A 4C0HA 2FF7A 2QSZA 2WPDA 2F3RA 2RGNC 3SEAA 1ZVQA 3SOPA 5B30A 2F1HA 2QPTA 1G3UA 2GILA 4Q4LA 4JVNA 4JYCA 5GADl 1P60A 2JA1A 2JJ2D 4PR0A 1TQ4A 4ZDIA 2V6JA 3REGA 1VCMA 1MO4A 3G71B 5K8TA 2AK3A 3CZPA 2DPXA 3TAUA 4BE7B 2LWIA 2J0QA 2FGKA 3EWSA 5EZ6B 2OCAA 2XOKD 5TARA 3K70D 1AGRA 1DO2A 3L2OB 3S1AA 2OESA 5KSPA 1I4DD 2F3TA 2YOFA 3GMTA 1U0JA 3OIYA 2GZAA 3GFOA 3OE7A 4LDJA 1PVOA 2ZJ2A 4Q9JA 3VNVA 4A4DA 4AKIA 3FHOA 1AGPA 4V03A 2XTZA 2IS6A 4LYHA 1Z2AA 2P2LA 2A3RA 4CEHB 2ZRJA 4FWTA 4MRNA 1RJ9A 5DI3A 2MSEB 3Q5DA 3IHLA 1QH0A 2RMKA 3B85A 5KDDA 2GF0A 1VQ7B 1KZ7B 3KJHA 3IHWA 4LGMA 1UFQA 2IF2A 5G3ZA 1RYFA 5H59A 2BSAA 3AGQA 2QAGA 2ATVA 2P5TB 1E1RD 1XMSA 4XVRA 3CONA 4HUQA 2G88A 4PFSA 3OIUA 3EAQA 5FI0B 3LVQE 4PZZA 1VYUA 3QXCA 2HCBA 2J45A 3VR5A 2GXQA 2ASEA 5DSZA 2QT1A 4DCVA 3CBQA 1OXSC 1HQCA 4NP6A 2BCJQ 4WBSA 4YMUA 2H18A 2QI9C 3W2IA 3A1SA 2FFBA 1OJLA 2VP9A 4PTLA 2B8TA 4OI1A 4PQFA 1HUQA 1CIPA 4IEEA 1YR6A 1QVAA 4TMXA 1XMVA 4JBYA 2GZDA 4OJQA 2FOLA 4AIIA 5KHOC 1OYYA 3RAPR 1D9ZA 5IF9A 4CRWB 2ATXA 2B92A 4I1UA 1G18A 2OAP1 3KUDA 2O0JA 2VO1A 1T3SA 2IYUA 4JLOA 4TLDA 2ZS7A 5BN5A 3IILA 3AP2A 4K81B 2ZJ8A 2OE2A 4I1SA 4ZKDA 2R6GA 1KQSB 1E0SA 3C4JA 2VHCA 1N6KA 4U5XA 4FCTA 1TQ2A 3PIRA 3B1YA 3B9QA 2O5VA 4KAXA 2D3WA 3MJRA 3ZQJA 2EFHB 4G1UC 1ELOA 1NIPA 4CEJA 1CBUA 3TRFA 4QM7A 1SXJD 5HKKA 5HTKA 3RSOA 4V02A 3P27A 4LC0A 2RC6A 1XPUA 1QDEA 2HV8A 3W5JA 5KYKA 4NKRA 1JJ2B 2R6CA 3TKLA 1IN6A 1BJKA 3PUWA 2D2FA 1GAJA 2EVWX 4O3MA 3QPUA 1NVVR 3QIAA 4HI0E 4MQBA 4QNRA 4EPWA 1Z0JA 2OV2A 3R20A 3T35A 5TMPA 3BWDD 1MR3F 4LJYA 5BXQC 4ESVA 1P2VA 5K8IA 1LTQA 2ZRPA 3BFKA 1W4CA 1II8B 1VG0B 4GNKA 2B7BA 1KI6A 2RC5A 3FB4A 2ZS9A 3DKVA 4QHSA 5FR2A 3THXB 1KKMA 3KFXA 5C1BA 421PA 1U90A 4BFYA 5K8LA 1XTQA 4D0GA 2FX3A 4E09A 3AF4A 1FL9A 5KDOA 4V0NA 4TYYA 2ZR7A 4G1BA 4V0LA 3R8CA 4A0GA 5KUTA 1LNZA 3QG1A 3A8TA 3LDAA 2AXNA 4F4IA 5AN9A 4HLQB 2BDTA 4IHQA 2RGNA 5AR1A 4OK3A 2GXAA 1P3JA 1Q3HA 1YR7A 2AR7A 4LC1A 2ZVQX 1ZD1A 4M1YA 4EPTA 4ZIRA 1QX4A 1T3HA 2RGAA 4B35A 5DYIA 2C04A 4FWIB 1RZ3A 3PEYA 3ADBA 3PXGA 2H57A 1E2GA 1E2LA 4DXAA 3MLEA 2C98A 2GQFA 2Z4RA 2AN9A 4QJ4A 3AM1A 2O52A 2YWFA 4WA7A 5FTMA 3TUJC 1FOEB 1HT2E 2ERXA 4TSFD 3LLUA 2OAQ1 4O2LA 2IYWA 5AUQA 2VP0A 1Z22A 3A58B 1BQEA 2Z5FA 5DN6D 3ZD6A 5JFGA 2GHIA 1NRJB 1CNFA 5CLLA 1T9HA 1IONA 4Q4HB 1G21E 1SKQA 1TU4A 2JLYA 4EIWA 2G0TA 3VNUA 4Y9UA 3GJ0A 3DM9B 3MGCA 4II7A 5E95A 4DZZA 1QVGB 2IHYA 4JL8A 4F4CA 1W36B 3CD6B 1KNXA 1F3OA 1XD8A 4B71A 2KWIA 4X8LA 2WHXA 5LBIA 3UKDA 2J41A 2WVJA 2D7DA 4G01B 4URXR 4KFTA 1QG0A 4CW7A 5JZVA 1Q86D 2NG1A 1E4YA 3H1TA 2ZE6A 3W9YA 2JLWA 3U6KA 5JS8A 4FMDF 4BLQA 1EP1B 1NKTA 1ZM7A 1CR2A 3ZJYA 3MMPA 3TW4A 1KIMA 1H42A 2QE7A 4D4JA 3RLFA 3VR2A 2FSFA 1WMSA 3MD0A 2ZJYA 4I81A 3MAAC 5BN3A 2ZSDA 2FDCA 1VQKB 4YLGA 4E03A 5M04A 2WM9B 3OZXA 2DWQA 3CPHA 1P2SA 2XX3A 2BBWA 2XGJA 4XSGA 3R9XA 4ACAA 2YWEA 1IQPA 4JLDA 4KO8A 1WCV1 3HU1A 5L3SA 3GFPA 3NHAA 1D1NA 3BERA 2OFWA 3OEHA 1CJKC 3FMIA 1LS6A 1OHHA 3SJBA 1TEVA 2JDIA 3GJ8A 4Q21A 4D2IA 1UDXA 2UVQA 4HLUA 1RVDA 4NBSA 1GJRA 1OFHA 2V7QD 4H1VA 4ZDWA 4K1XA 2OUKA 2BMWA 1HA3A 3QE0A 1CJVC 2F43B 2N42A 4M1WA 2ZJBA 4LYJA 4YMVA 1TL7C 1KOFA 4RZ2A 1SHKA 3W2EA 4KJZA 5FOSA 2A78A 1BX1A 1EFRD 2XZOA 1VPLA 3JVVA 4W7SA 5CDFA 1MO3A 3X1WA 4EJSB 1VIAA 1T0HB 2PT5A 4Q18A 1YU9A 3KKMA 3ONWA 3AP3A 2CHVA 4A2QA 1IJEA 1G8HA 1Z6XA 3BJIC 5L8VA 2REOA 3V76A 4WW0A 1FNNA 1GDDA 2QQ0A 4W5JA 2GCPA 2GRJA 3WMFA 1RRCA 1NJID 2WIAA 3PEWA 1Y3AA 4PAOA 4K8OA 4DCTA 3K70C 1GP2A 4KXFB 3SQXA 2HYDA 4O2RA 1E2HA 2QAJA 1AQYA 1DPFA 1TUEA 4LHWA 3CR8A 3CKLA 4L15A 4OKSA 1E0AA 2GA8A 3FGNA 2RGCA 5E3HA 4MDFA 3E1YE 2FG5A 1VQNB 3ECCA 2VYFA 5G53C 1MABA 2REXB 2YHSA 5GJCA 1GG2A 1DELA 4MYHA 2BOVA 3KUCA 2VH5R 2Z83A 4FMCF 2BKUA 4PZLA 1OYWA 2ODBA 1QGZA 1VQ9B 1OW3B 1P62B 4JSYA 4ZCIA 4GRAA 5GJBA 4UNRA 3G5UA 4Q1FA 2QTHA 1CJMA 1QHXA 1YZKA 1T4GA 2Q9CA 1H8HA 3MSXA 4TZ6A 3MFYA 3CCLB 3EIHA 4NDZA 5ELXA 2YC2C 4C2TA 3DVLA 2VP6A 1OB5A 1G7SA 3CCVB 1DAMA 3BD9A 3DOEA 5KNBA 4UQOA 4I1OA 3CF6R 5F98A 2XITA 1X3SA 3ZQ6A 4BEBA 1KK3A 1MO6A 2ZYUX 2ZU6A 3Q8XB 3B13B 3QKUA 1G5PA 5C4MA 1SHZA 3DHWC 1F2TA 5TR9A 3QXHA 1ZJ6A 1JJVA 4RD2A 4XJXA 5LB4A 2HYIC 2ZU0C 1C1YA 4I1VA 1D9XA 4DUGA 3L0OA 4P6VF 1CR1A 5AJXA 3SHFA 3NC0C 3ZDQA 4UNSA 3SC3A 1LV7A 1XTIA 3H84A 2AWOA 1U8ZA 3KL4A 2PCJA 3BRWD 2FU5C 1KO1A 5H68A 2F9MA 3OAAA 3X2SA 4CT5A 1M74A 2VZLA 1FMLA 2QGZA 4JT4A 3QSYA 3NVAA 4Y7CA 1K6MA 2GXSA 4YAUA 4WZ6A 5CK5A 1P4SA 3TR0A 4BLRA 4UJ5A 4EFNA 3O8BA 2G83A 1WE2A 1R6BX 3K9NA 5TY0A 1UJ2A 3KTAB 1OGIA 3SJAA 3NG1A 4M1OA 1N8RD 4OHWA 4P31A 4BQSA 4C2UA 3I72A 1HYQA 3T34A 3K0AA 3CMAB 3TH5A 1OSNA 3B1ZA 3N5CA 3TAHA 1IXSB 3O8DA 3PEUA 4FCWA 1SXJC 1UM8A 2VF7A 1EP2B 1P2TA 2FE4A 4NHOA 5J47A 1AJEA 3EPJA 4CGZA 2AHOA 2B6HA 1P9NA 1R0YA 5FOVA 4XVQA 1KMQA 4JBXA 3LVBA 2QA4B 4M9XA 2VF8A 3U60B 2XXAA 4AKHA 5EE1A 2O8DB 1FQKA 3EC1A 3AVXA 2V54A 2G77B 3PENA 3C41J 2CE2X 5CM9C 3U4QB 2PLRA 1L2TA 2IWRA 1HY3A 2H92A 3CNLA 1XXHB 4NONA 1UKYA 1QFZA 3VR3A 1QHNA 4OL0A 3B1XA 3U7EB 1ZUNB 1AKYA 3T1QA 4ZIRB 2O8FA 2J0UA 1XEFA 4HAZA 2QROA 4YMTA 2LKDA 3JZMA 3VR4A 1JBKA 4N0EA 4G0NA 1HE1C 1FNCA 3A37A 4NCIA 4DSUA 3DMDA 4IXMA 3SBDA 4G3XA 2DBYA 4DCSA 5EP3A 2DEUA 1TMKA 3B5JA 3BBPA 2NGRA 3CC7B 2JJ2A 3IEVA 5A0FA 4DDVA 2WJYA 4BFSA 1W2GA 4B2LA 2ZPTX 4QL3A 4GMDA 4I99A 1F2UA 2IYQA 4DLWA 5J4VA 2XOKA 3RS7A 5C46F 1GKYA 2W00A 3IO3A 3CWZA 3B6EA 4TLBA 4URVR 3W2GA 4FINA 3VMFA 3CRQA 2FA9A 1KMHB 3AUXA 1BX0A 2PX0A 5DIFA 3T61A 5DISB 4A9AA 5L3QB 121PA 2FEMA 4M9ZA 2EFCB 4OQLA 2GJSA 3KJIA 2XNDD 2B21A 3OFND 4P4UA 3AVVA 4D81A 3CIOA 3KB1A 1E69A 2W0MA 2IYXA 1UBFA 4NE2A 4MRSA 1GITA 4NZYA 4B3BA 3P4XA 1L8QA 2PLFA 1GL9B 1I2MA 2FV8A 4RD4A 1TLLA 2FEOA 2P3SA 4TWZA 1E1RA 4YQFA 1VQPB 1JQLB 3OJXA 3GJ6A 4Q1AA 3NH6A 4MGKR 3RS4A 3U3KA 2IYVA 2XZPA 3NIBA 5D3QA 1GRQA 1XB2A 5H5JA 3VTKA 1AS3A 2IW3A 1EWRA 2JLVA 1AKEA 1MRNA 2FMXA 3X1YA 1JR6A 2OTLB 3HWSA 4DLXA 5KTYA 2ZR9A 4D4MA 3MWLA 2J5XA 4ZDJA 3T1TA 3GEHA 4U9UA 1E79D 3W3AA 1ZNXA 2WJVA 4AG5A 4Q7KA 1EWQA 1COWD 3PUXA 4URUR 3BB1A 4BLOA 2DERA 2BVNA 2QP9X 4RJLA 3TUIC 3PQCA 1JPNA 4Z1MD 3EC2A 4Y0AA 2RHDA 1QGAA 2RHMA 1SVKA 3AKYA 3I92A 4Q66C 5EQTA 2CJWB 1EFCA 4IOJA 5C4GB 1FP6A 3HYTA 3QKRA 1DDGA 1KNQA 4DJTA 4TYNA 2ZJZA 1VQ5B 2CDNA 2DYKA 2J1LA 5KOYA 2Z6VA 4RFVA 1AIPA 5L3RA 4AD8A 1S1MA 1KDPA 1SULA 3LVRE 1NSFA 4CYMA 3RWOA 1W46A 2I1QA 4IFBA 4HB4A 5FBWB 4YDHB 5JJKA 4LX0A 1OV4A 1E9EA 3M0EA 3EPHA 2QAGC 2KB0A 1O87A 3ZH9B 1H8HD 2W83A 2BMDA 3KJEA 2C77A 2IEYA 2I3BA 3LXXA 4CEIA 4PSVA 1UDWA 4C0JA 3WNCA 2VSFA 3L8ZA 4ARZA 2J7PD 5TXGA 3PR1A 1CJUC 2QTLA 4BFTA 5EJEA 4DB2A 2EFEB 5HXBA 2ZRCA 3SZRA 1S1CA 3TR5A 4IFEA 2CK3D 2GVZC 5P21A 2RGGA 1NLFA 1BO6A 1NN1A 2Q6TA 3RRMA 3IBYA 5THXA 4UXIA 1YVDA 4D82A 1QHHB 2DR3A 1G8YA 4XH9B 2NPFA 4B33A 3HU2A 1ZM3A 4POAA 4QKQA 2BF4A 2CLSA 1QRAA 2R44A 4OK5A 4UNNA 1WRBA 3UK6A 3THYB 3LA6A 5C18A 2BBSA 4HLCA 1G4UR 2PEYA 1W0JD 5EP2A 2W6ID 2GJ8A 3PITA 4GOXA 3JQPA 1XD2B 2ZRMA 5TVKA 4A6PA 3WYAA 3A1UA 2GKSA 3NBXX 2GAOA 2IS1A 2NZJA 4B47A 2IL1A 5DI9A 1NJGA 3PG5A 4AKEA 2VSOA 2ZI7A 4HATA 1QHIA 1QZXA 1Z28A 5EP1A 1G3MA 3BORA 1LY1A 1FX0A 4C30A 3SU8A 1C4OA 4IKEA 2XNCA 4RZ3A 1IXZA 2WWXA 3LV8A 2BV3A 3EZFA 2ANCA 1K73D 3CPWB 2ZJ5A 1XZPA 3A6PC 3DOFA 3MWYW 5J4KA 4BFVA 2YKGA 2QBYB 2FPMA 2HUPA 3SN6A 3CC2B 2EQBA 4QNMA 3LAWA 2ZSFA 4YONB 3W3ZB 3M4YA 4PQRA 3I56B 1YZQA 3FHTA 3WXMA 1F2TB 4YAOA 3W2FA 2QQEA 2V1XA 3CNNA 6Q21A 2IX3A 2AL7A 1AS2A 1G7TA 4KHZA 4EAQA 1NIJA 2CL0X 1L4YA 3NBZC 3N2EA 4JSTA 5DN6A 1HQYE 3VX4A 1PUJA 4XWOA 5FPHA 2Z43A 4N0DA 3AH8A 2CL7X 3X1ZA 4BGDA 1JEEA 5JSZA 3W6NA 1E2PA 3KQHA 4C4PA 4DCUA 1FTSA 4ILEA 4UXHA 1NDHA 4CZ2A 4M1SA 1RKBA 3O8RA 4M53A 2ZRNA 3LD9A 2WAYA 3SQWA 4DLRA 1RRGA 4CF7A 4FK8A 1WA5A 2ZYVX 2WWHA 5FTNA 1U8AA 5B57C 1D6JA 4X8MA 4ZGNB 2DHRA 5HE9A 3I5XA 2IUSA 2WSSD 1UMKA 4OK6A 2A5YB 4OJKA 3A1TA 1ZMXA 1TF2A 1DAHA 4LBVA 1R0ZA 3CH4B 4TQAA 2RAPA 1GNQA 3LW7A 4MGZR 4CT4B 1R5OA 3OHMA 3GLFA 2F6RA 1YZGA 4LV6A 1GO2A 3N70A 3CF0A 3CRW1 3U3RA 3RS5A 1ZIOA 3ICQB 1OGJA 4DVGA 4YXWD 4IVPA 1M7GA 3TJZA 4V0ME 5F2EA 3V9PA 4JZKA 4PGOA 4AC9A 2L0XA 2E87A 1AMOA 3NKVA 4FMBB 1J8YF 1GUAA 3F5FA 4MKHA 4QM6A 4CDGA 2J0SA 1G19A 3BE4A 3HYRA 2HXSA 3AGPA 2VP2A 4TMVA 4BFXA 1FTNA 1FDRA 2BBTA 3RRYA 1GKIA 4OQFA 3VQTA 3THWB 2JASA 3B60A 1SXJE 1KSFX 5FBLB 2AK2A 3NWJA 1Z6AA 4OHVA 2V55B 3I62A 5JWRA 4CVNA 1KY2A 3U7FB 3K09A 4KVGA 4JKIA 2V7QA 1U8YA 3SJZA 3D7MA 3IPYA 3K0CA 4M1TA 1BMFD 3M1IA 3NHBA 3ZIAA 2KSQA 3G4SB 3LY5A 3GLGA 2RGXA 3B1WA 1JJ7A 4BZQA 1KI8A 4BLPA 2IYYA 1EFRA 4KSBA 3TQCA 3RDPA 1CRPA 1Q0UA 3EZ2A 2GEUA 3WMEA 2RH5A 1U9IC 2EW1A 4WVFA 3CX6A 4TQUS 2XEXA 1KI9A 1IM2A 2VA8A 1Q44A 4DLZA 1FMJA 3IIJA 3L0IB 4RFSA 2X2FA 2JJ8A 1CEEA 1MO5A 3EIEA 1KK0A 3F8TA 4P4SB 1QUEA 5LD2C 1SVOA 3QVVA 3GLIE 3LBNA 5C2JB 2G1JA 2IWHA 2ZE8A 3AVWA 2DCUA 4TL9A 2PCLA 3AF3A 3F3YA 4R2IA 5EE9A 5JWHA 1XCMA 1FNMA 1U2RA 4LBWA 2P65A
chains in the Genus database with same CATH superfamily
1GCUA 1C8LA 2Q4BA 2X6XA 1BHJA 2AEFA 5AP9A 1MX1A 3JAWB 1NBIA 3NUGA 4Y9SA 3AEQA 1RI5A 2X42A 2O8CB 5KYXA 1D5CA 3ASZA 3FNGA 1G2IA 3RTEA 3UNXA 4AWXA 3U4GA 3JTEA 1TQ6A 3QBVA 3FCOA 3QLUA 1SCBA 5AM1A 1UMDA 3Q9LA 4YJFB 1CS4C 1GL7A 4KODA 2FSIA 3K5WA 4L57A 4UVHA 5AK0A 1B0UA 1MKYA 4J0IA 4J2OA 4CIAA 4NOMA 1UC8A 1NR5A 2JLCA 2WKPA 5LQMA 2W71A 1TZMA 1YBFA 3IVXA 2PGJA 4E0BA 1IVYA 3DDZX 4QPCA 5HDQA 1CYEA 2BFCB 3CGWA 3JATB 1L9KA 4URHA 3K20A 1EWTA 5FPTA 4JUBA 5KKCA 3DMHA 1BOOA 3AFMA 2GCOA 5FIUA 1HE3A 3WGZA 4M4SA 3IR6A 1NXWA 4OQPA 4Z4RA 3STXA 3TLJA 3I05A 3TW8A 3U6BA 3BTUA 1QLJA 2ACEA 2XD4A 3FUWA 1TEXA 3GELA 2F1OA 4DJ5X 3O4VA 3KD3A 3AKDA 3EWAA 4ZCSA 3TOVA 2ZITA 4EYSA 1DBVO 4K05A 2ZTHA 2IT1A 2PTGA 3QBDA 3L7LA 1RM5A 3KZVA 1H2EA 4FNGA 3TW8B 4CFZA 3GLFE 1N5JA 3N0XA 5AIBA 5IYRA 1QZTA 4OJMX 1LA2A 2RJ3A 3UW3A 4J3JA 4DRXA 1ES9A 3BL8A 3O26A 3AM5A 3NNSA 2JGDB 2EWWA 1OLUB 2R6ZA 4P34A 3F96A 1XA0A 5JUWA 4G5YA 4RXUA 1LTKA 1PJSA 2AN1A 3ANMA 5EJ7A 3IP1A 1Y5NA 4QULA 2RGRA 4E07A 1I7LA 4ZOQI 1SOWA 1TTHA 2B99A 4KEAA 2EJCA 1YR8A 4JI3B 1DOAA 1R6DA 5ALMA 5JATA 1ZD2P 3WB0A 1ONBA 4XLAA 2RBEA 2YZKA 1QRDA 3JXEA 4DJFC 3ZE6A 3K53A 4NYJR 5IXYA 1JLMA 2QMUA 1E3DA 1MZPA 1UP7A 3AUSA 4MICA 1F4PA 1SUIA 1N5KA 1PFKA 5AKYA 1CCWA 1G20A 1XRLA 3NBFA 5H1YA 5KTPA 4X62B 5SZHB 2X4LA 1U63A 3A35A 1OIXA 2D13A 2OP1A 4BNMA 3DLIA 4EUHA 3AF6A 4OX9B 3JQFA 1UZUA 3VKVA 2H8GA 3F5MA 3GRVA 2E48A 1SQGA 2OCYC 2QTTA 3H1EA 4HC4A 4AZ3A 2NNLD 2YL2A 4BP1A 5KQMA 4J49A 1C0PA 2DFDA 5LYYA 3BOSA 3GLGE 3HJNA 3I8XA 2GEFA 1Q50A 2NTJA 3W8RA 3GYBA 4Y6OA 3HCOA 3AUAA 3G8CA 1OLXB 3BWBA 3O90A 1DAEA 4P5DA 2FZKA 1LPOA 5IJ9B 3WB2A 3I61A 3OM1A 4OHFA 1CUUA 3F7TA 4J91A 3FHLA 4C08A 1NPYA 2OLJA 1BQ4A 4B5LA 3EQ6A 4OKIA 4PPGA 3AESB 4WVLA 5HKAA 3I5UA 3EZNA 2JAQA 1S0UA 1C1DB 1Z8FA 1Q0PA 4KXLA 1V0FA 2CXQA 2QPOA 2C7VA 4TN1A 4BZXA 5IT5A 1JZQA 4X0EA 4BWVA 1MQSA 5DBFA 4I9UA 3CUEF 1KJWA 3GJ5A 1WMEA 3GLRA 4NG5A 5SZJA 4TTIA 3VVLA 1M2VA 4GI5A 3WGYA 1NZJA 1B2RA 4IF6A 4UNQA 2WFZA 1Z6QA 4UATA 1TX4B 3C2QA 1DTSA 4KBGA 4ZYWA 3H4MA 1WP9A 3DMTA 4KGZA 3ABIA 3CNEA 2VP4A 3BGWA 1ZU5A 4L2IA 3TLGA 2PT6A 1EFTA 1R9GA 4QO8A 1TADA 2WKSA 3GLHB 3L0CA 3FBWA 4HJRA 4OFWA 3T12A 4W5RA 2DBVO 2A2ZA 1P6XA 3EGWA 4HNAA 1T35A 3TF5A 4M22A 4BVLA 2DETA 2IEDA 4FCVA 4IJKA 1QVFB 4JR1A 1UOOA 3LDUA 1IG0A 2PE5A 4WN9B 4XI9A 5FV7A 3T38A 4DSOA 3IKLA 2R66A 4QUIA 2FAXA 1R37A 4DT1A 1RXUA 2WSMA 2WM3A 4ZO8A 1QB7A 2FXVA 5CTJA 3A8JA 3GEBA 3CEHA 3WGOA 2LKCA 3R4VA 1V7PC 4YFVA 4A0HA 1GKLA 1Q3TA 4U2CA 3HL4A 4QV2A 1VKZA 1Z5PA 4O0MA 4MULA 4Y2RA 1W2HA 2L19A 4HAVA 5JROA 4KYUA 2W7TA 1PSDA 3ZIAD 1XCPA 4MDHA 1EFHA 2XWJI 5IJ0A 4H0CA 1XVUA 3Q9NA 1G5TA 4N8DA 3T5BA 4C7OA 2G9NA 3VO2A 1PJ8A 3VISA 2DUJA 1M66A 2W42A 1OXBB 1TECE 1USKA 4AO6A 1UM9A 4X8HA 3I53A 1Z6YA 2PGOA 4KKSA 3AI7A 2HTEA 1XKXA 3ECSA 3FRJA 4ZARA 5JXJA 3B1KA 3GVHA 3GAZA 4P2BA 4A8HA 3L79A 1FNDA 4BMSA 1AGXA 1VI5A 1J7KA 3RSSA 4PM4A 3VFDA 4EI8A 1PWXA 2AN5A 3WWZA 2WD9A 1H2ZA 1ZN8A 3OEYA 3CFYA 2R86A 4M8SA 5EE5B 2FP3A 3ZDQA 4BV8A 3FA2A 1NQTA 1CLEA 4CKXA 2ATCA 1SQSA 4MP8A 2OK7A 3ORFA 4RIEA 1RYEA 1TU0A 2YWRA 1N6HA 2HNKA 2HU7A 3LUHA 1VDZA 3UJ3X 4CFYA 4F5WA 4R1UA 2VP5A 4XYLA 2V7TA 4YRKA 2VVTA 3IAHA 5JQGF 4FI3F 5DGCA 5EGSA 1COWA 3N8GA 3HJRA 3HDHA 2WF7A 5F78A 1GR0A 5EL0A 4DR7B 3HLTA 3L04A 4WEQA 3DMNA 5DGIA 5GAJA 3ERCA 1F14A 4G7XA 4Z1MA 4QBKA 2VTBA 1RPNA 1XPJA 4E5MA 1RJ9B 2WMDA 3DFKA 5G41A 5KEIA 2ZUFA 3MUOA 3MN1A 4WESA 2I71A 1XYVA 4ZCQA 2EHJA 3BZWA 2ZAMA 1U7ZA 2XMCA 4K9QA 1G20E 3NTQA 2SECE 4MW9A 1QAMA 4QDJA 1IOZA 2SICE 4RC9A 3QU2A 3AB3A 2PH5A 1N5IA 4RCZA 5IUNC 5CLJA 4HUQB 1BCSA 2KBEA 4W7IA 4BE9A 4NNJA 1LZLA 3O2QB 2D0PB 4MQFA 4Q01A 1ZX1A 2BKEA 4DMCA 2WWYA 3EXIA 4IO1A 2BFPA 4YT5A 1HYBA 5JPCA 2GBGA 1BH2A 2PSHA 3L8EA 5I7WA 4OQQA 1Q1ZA 3OU7A 3R24A 1C0LA 1KJYA 2C8VA 3WYEA 3MMNA 3UJ8A 1EFPA 4UAJA 2V74B 5AI9A 2Q4EA 1ZAYA 4A3SA 2G4LA 3AXTA 3T9CA 3PNKA 4AL4A 5A3RA 5J5AA 3PFWO 3QFHA 2P9YA 1A98A 1VLJA 1H2XA 1G8SA 1S2MA 3CZAA 1YJQA 1MAAA 4CCAA 1VMKA 1CK4A 3NLLA 3LYAA 5KOHB 1UDRA 1XCOA 4JQYA 1Q95A 2X6WA 5I7FA 4RKQA 1US8A 4M76B 1NYLA 1X7DA 4JVSB 1W5TA 3S8EA 2FPXA 4CGYA 2QENA 2A1UB 2H1SA 3CZ4A 2IJGX 2EZUA 3JQ7A 2OBXA 2Q8NA 4Q7LA 2WMNB 4IDAA 1RD4A 4GO1A 4NYMR 1SA0B 4DWOA 4NBUA 3KCQA 4MQEA 1KY5A 2CNBA 3ISVA 4FN4A 5BN5B 3ZCUA 5FEMA 3K6RA 2V98A 4EY8A 2C4VA 4ZT6A 1RKXA 5DX8A 3NEJA 4FNAA 3NTVA 5B6PA 5CA1A 4QEDA 3N0VA 3K9FC 1QRSA 2J9RA 1Y7TA 2XMDA 3H05A 1AA6A 2ZB7A 3CW2A 2YVKA 4RGQA 3C1OA 1PEAA 2O8NA 4HYYA 4PU0A 4B2YA 5IWAB 2HBQA 5EP4A 3LLMA 1IAVA 3T7IA 4TOIA 3GVXA 3QVSA 5DRTA 5HW0A 4KR6A 1EE1A 5FWAA 2BP7B 2BCEA 3L7DA 3ZOKA 1XA4A 4JROA 2H54A 3T3IA 1N2HA 1LPPA 5I4IA 3WKCA 1U3DA 3CX3A 3FM9A 4DMGA 1J2EA 1IK6A 4JXJA 5CT8A 5I3CA 3MWJA 1QPZA 2J0EA 3H17A 3WGIA 3QPWA 1JFLA 4WY5A 4D4IA 3MTJA 3PE4A 4Y6GB 5BVGB 3CW8X 4N6OA 3VJRA 4Q3KA 3W4KA 5FH9A 3MYYA 3DZCA 4YCLA 3BSFA 3DXFA 2A86A 1KI6B 1Z38A 2HDWA 3AJAA 3PYXA 1XTJA 4GOJA 5AKGA 3WBJA 2D0DA 4C3VA 1V1MB 2C8LA 5A2GA 4G5QA 5JRDS 4KXVA 2ZAGA 1IB0A 3QF4A 3QPBA 3EGCA 1JSXA 1FDOA 1MC1A 2QYOA 4U6QA 3C8MA 2ZQZA 4JD5A 3PXDA 4Y6LA 2F1KA 5CXXA 1P18A 4BE4A 3GZ4A 3N8IA 1KHHA 2LVBA 3E03A 4GEGA 3SS8A 1T4MA 1W35A 1DIRA 3D31A 3IXLA 1F5NA 4GS5A 4NJMB 3VUEA 4F2HA 1T91A 3VVCA 2VN8A 5FL7D 1K92A 5JMPA 1U80A 2XADA 1N33B 3RIEA 4MUXA 4FB5A 1NI4A 2NIPA 3E9RA 5FOWA 4TTQA 3V8QA 1BD3A 4X65B 4GXRA 2PMCA 1FNSA 3V7FA 4NZNA 5FF9A 5G0SA 6PFKA 1XJQA 1UK8A 3A7EA 4J8PA 4UFNA 1N78A 3GB9A 1RCFA 2GJPA 5JBQA 1KBQA 2C54A 2Q7DA 4B8YA 3SKYA 3MQFA 3QENA 3FG9A 1M2WA 3N75A 4HWTA 1X7XB 4UBNA 1B23P 2PNJA 2YJ5A 3WGTA 1Z0IA 4OHXA 3MJEA 3LW8A 1HDZA 3A1DA 2CLEB 1WOOA 2D1QA 3KE8A 4UMFA 2DQYA 1MF7A 4M21A 1L5GB 2O2XA 2QPAA 1KJ8A 3Q1LA 2JZCA 2IOQA 5ECDA 5FI5A 4B3SB 4P0QB 1QGED 2FUCA 1FLVA 3LCRA 3ZYCA 4XUEA 2WU1A 3B52X 4YP6A 1NWHA 1U4OA 4XR4A 4GSKA 3IPAA 4ZVTA 3W2TA 2DHDA 4B3DA 4NXMB 5EJ4A 3IEXA 2COKA 3FPHA 2VDUE 3HUTA 1QP0A 2FPLA 3CLSD 5KHAA 3A2LA 3BXZA 2V6FA 1OZGA 3P26A 3AERA 1GARA 2AC2A 1SU8A 4ZPJA 1U0LA 1SNYA 2I2XB 1UT6A 5AICA 2Y76A 2QRZA 5BRJA 1R7RA 1SZDA 4OHCA 4J1TA 2VHUA 1JKMA 3I4CA 3ZK7A 2AW5A 1LLQA 4KL8S 4UD2A 5DTQA 1I3LA 2CCGA 1EEXB 3KYIB 4BBPA 2W0SA 1AMNA 1DX6A 1QVZA 2XY4A 1VHQA 3Q87B 2C2KA 2ZSBA 1EFLA 2I76A 2ISQA 1OT5A 3IGFA 4HVAA 1WTHD 5EKXA 2N1BA 3LOUA 3OW2B 4GMHA 1JKJB 2HEIA 3S7ZA 4LI0A 4ZQEA 3UMJA 2RAFA 3WYCA 5CD9A 1O54A 1PT6A 4DBLC 1QIJA 2ERCA 3L4EA 3Q1KA 2Q4TA 5CRIA 5JNUA 3ZHQA 4LF6B 5F23A 3CO0S 3HBAA 5CYGA 5JDIA 4CQLB 2V7EA 5FTKA 8ATCA 3VKFA 2PGAA 2RH9B 4RZHA 2FSGA 3J81A 4MR8B 3CEAA 2JHCA 3S5JA 4WKBA 5A4JA 3TUZC 5U9CA 2VAWA 1H23A 1LLDA 2VBFA 1P9LA 2FHSA 3DC7A 4RQAA 4GNRA 4B09A 2FNAA 3H42B 1Z2EA 1GTRA 2X41A 3PNOA 3OZUA 1I80A 4QJ3A 2A0KA 4Y3UA 3VSCA 5I7HA 1Z25A 1A8IA 2GSDA 2NTYC 4RGYA 2I4LA 4FBLA 4CV1A 5CMLA 1TVKB 1UMBB 5KDLA 4RGBA 1DQZA 3BS4A 3F90A 2BEWA 3OF5A 5ICEA 1C9MA 2FG6C 5CVJA 1OC4A 1GHTA 5JSFA 3RC8A 4EAAA 3ZK8A 3KOYA 3P94A 3CZQA 2JNWA 5HHTA 4A15A 1UOEA 2ZT8A 2OZEA 4KPUB 4NENB 3RR2A 1YA8A 1UZNA 3V55A 1JALA 2ZBDA 1K7EB 4HWKA 3S2EA 1Z4PX 1JWLA 4K26A 1A77A 2EU8A 1UFKA 4OXRA 2ZZQA 5AW0A 1H1LB 1II8A 3A6ZA 2D62A 3OQBA 5JNVA 1R10A 4W1RA 1QVRA 1OI2A 3C8HA 3RYFA 3S28A 1N1DA 3TXAA 2GRAA 3SX2A 2FPSA 3U40A 5J5CA 2HQRA 2QMOA 4FGKA 4RANA 3RS0A 3STYA 4WK0B 4YAKA 5JS1A 5FQOA 2FZEA 1QGDA 1SCUB 2Q2VA 3EE6A 2JCGA 3VR1A 1FDIA 1JEDA 3WLIA 1ZC4A 3EVAA 4NU5A 4R1OA 1W4AA 3OLWA 4PANA 2B30A 2GCNA 4JT8A 1NNEA 5KW9A 2B94A 1JT9A 4INOA 3KKPA 4XD2A 3B38A 4OBWA 4U9IS 5JOQA 3FPGA 1GFSA 4BJ3A 1UBEA 3EG9B 3K5IA 3K73O 5IKOA 1EHYA 1FFEA 3EVCA 4AJJA 3W6OA 3RODA 3UT5B 1LDYA 3WDKA 4LV8B 1I94B 3U4IA 3UGTA 2R2AA 3FWYA 4MWGA 4UCFA 5C0OE 2JFNA 3W0LB 3RUEA 4L9AA 5C8YB 4F38A 1Y3CE 5AVWA 2X4GA 4ROTA 3PD0A 4CMCA 3PC4A 3GVCA 3WISA 2P7HA 3HJGA 2QN8A 1DFHA 4QOIA 1FCJA 1MORA 1E0DA 4UDXX 1Y5RA 5H4GA 1CDOA 3L43A 4MMZB 5DHPA 3PVSA 2R7NA 3R0QA 1JECA 1EVQA 3KB6A 1KS9A 2VATA 3M9LA 4H3HB 5U4QA 1QUFA 3QEBZ 2BTEA 1TF7A 1U2SA 2UYQA 3MGGA 4KXWA 4MV7A 5KTOA 2UUPA 4H1UA 4DWWA 1AUVA 3D7RA 3RBVA 4ER0A 3BDIA 1KAEA 4H7EA 1ZGAA 4UZEA 4PPNA 3ZE7A 1K0FA 2CHEA 1VGVA 1RLOA 2GZHA 1NRIA 3BFXA 5MGBA 3OSUA 2BJWA 4ZCLA 1U1CA 2F9LA 4I4TA 3LLCA 1EDZA 5E4FA 1TM5E 3R5HA 4EUEA 4TVSA 1IZ8A 2JL1A 2Y77A 4TMKA 4GPBA 4PWZA 1MAWA 4QU0A 5HKOA 4RELA 4LXXA 5JTUA 3VVMA 1X1BA 4AQ7A 5J5VA 2VZ8A 5LZ5A 1ZJWA 2OG1A 1PJCA 3WS7A 1M8PA 1OF1A 3R0IA 4YMWA 1NSYA 2Q1XA 2FCAA 5FOUA 2BM1A 4OI2A 1DUVG 4CMAA 3IUBA 3FSJX 4HDMA 2WQZA 2ADMA 2G7ZA 5ESXA 1E9BA 5C34B 1XLWA 8LDHA 1EUZA 3ZGNA 1AF4A 1RLIA 1E7MA 3FPJA 4E94A 1BZYA 4MLZA 2PMDA 4NFLA 3AF0A 1Q12A 4R83A 3V1KA 4IAOA 4H4EA 3LY8A 1NE7A 5BURA 4IDQA 1EUYA 3SKVA 1XZJA 2V45A 4BX9A 5JCJD 3UT6A 1R0BA 1I4EB 2YRFA 3K94A 4OQ4A 4C4XA 2P11A 5CDYA 5B3JA 4NH4A 3UENA 3QX8A 3AFNA 2Z9CA 1S3FA 2MTBA 4NIMA 4INJA 4P54A 1CV2A 5EWLA 4W8GA 5BVHA 3C5HA 3WLNA 3CE6A 2WYIA 3WJ2A 4UPVA 2QX8A 1CR6A 4FW8A 1XPRA 3ODGA 1PW7A 4F06A 2XXAB 3GDFA 2Y67A 3DZIA 2G82A 2JLZA 4XGRA 2QW0X 2P9ZA 1YI2B 2VJOA 1NZDA 1EQUA 2FQQA 3V4PB 3GRKA 4HB0A 2B3TA 3R3UA 2EJUA 1E1QD 3FPFA 4KQCA 3BNWA 1RWOA 4AJPA 3MGKA 6REQA 4ARCA 1EJ6A 3HSSA 5FX2A 3ZZTA 1BJTA 1TK3A 1DIGA 4KAAA 4OB6A 1BFDA 5CDSA 3OCWA 2O8FB 3L7IA 2J0UB 1JR3D 3W1EA 1WPCA 3ZC3A 4TTPA 2QUBA 3B1VA 4QXPA 5E9AA 2WMYA 2FE1A 2GN8A 3EF0A 2B0JA 1BDJA 5TPWA 2V6GA 3PKJA 1PZXA 2IK8A 3VH3A 1YS6A 1HEIA 2EXXA 1G60A 2BGTA 1HYHA 4U4AA 5JQGA 1A2OA 1GQYA 4RACA 4WLUA 3HR4A 3DEFA 2YJNA 1E3QA 1XHEA 1ZUD1 2QG4A 3GFFA 4WUTA 3KKEA 2BN4A 1HC7A 3N2IA 1F2UB 4LRYA 3EZLA 2DIEA 1SKYE 3KL9A 2IXAA 3ZD8A 4EEKA 4IDDA 1GPH1 2YVUA 3R0VA 5KTNA 4YQYA 3HNOA 1OBVA 2DB3A 5FWYA 3WYGA 1NQXA 1W87A 5A8AA 1KMIY 4PGHA 4U2BA 5CBPB 1GA4A 1I14A 2AZTA 3C6ZA 3IODA 3IAEA 4E22A 5LZ9A 1CEXA 1AUOA 3ZDCA 2GASA 2NUPA 4PC3A 3NASA 3SXPA 3Q5EA 3VOAA 5TIIA 2YIJA 4NOLA 3C5EA 4GQBA 3D1JA 4FJ2A 5CB0A 3KBBA 3ZTTA 5ITSA 1U31A 4KMSA 4TT3D 1PJLA 1TO6A 3PDIB 3G9TA 2GJAA 5JADA 3MPUA 1ORIA 2HX1A 1UKBA 2H85A 2E4XA 5REQB 2V7PA 3CURA 1HNWB 3EIFA 2AF4C 1J56A 1L5NA 1SD5A 1G9TA 4G1MB 3TTSA 3BX1A 5J63A 1LI4A 4TL7A 5FWXA 1PR0A 1ACJA 2ZRGA 1SCNE 5FTLA 3HNPA 2WQ7A 1Z7BA 3WQHA 3FH0A 4BPRA 1AS0A 1YMUA 2NU6A 3GBSA 5GONF 5A6VA 3ADCA 2TMKA 1U2GA 2HBYA 2KHZA 2R65A 2WTMA 1MQ8B 4ZOEA 3RU9A 2VDQB 4QRDA 2CCKA 2NO7A 4MA4A 4M6WB 4J7AA 5CM8B 2BFOA 3FYUC 4L4XA 1M6VA 2Q9UA 5JH7B 3H1FA 1REQB 3JX9A 4CTKA 3V8BA 1I1HA 2CXRA 5DHSA 4DM4A 2EHDA 2CKMA 2B83A 3Q85A 4FFRA 2I29A 4N03A 3U3ZA 3M1AA 5H70A 5T4EA 1VRVA 1D1PA 4K9OA 4XWWA 1NV8A 3JARB 2WIBA 1U8XX 4UUMA 5DNEA 1EB8A 1K9SA 1WCWA 1V9CA 2CGEA 3EVGA 4IVNA 2X0FA 3RE1A 2HA7A 1ZCZA 3SR4A 4L50A 2UZIR 4X71A 3JVUA 3GT4A 1FF9A 4Z51A 4QHTA 1EXVA 1RACA 2HHJA 3KKQA 1KZ9A 3IUQA 5CJPA 4B4DA 3RSCA 3DCYA 3ZCXA 4H27A 3UPUA 2BWJA 2I4TA 2QV0A 4RTRA 5FAXA 4YAFA 3H9NA 1MJFA 1FMTA 3NX4A 2QR5A 2CJPA 1F0PA 4URFA 2CXNA 1ZY2A 2ICAA 2JGLA 2NXJA 3FNIA 3RGWS 3RJTA 2PV7A 1IMJA 1XVAA 2X0DA 1NN0A 1UC9A 1YDHA 2D3TA 1M1NB 4EMSA 1R1DA 4CEIB 5C53B 3CRRA 1E2BA 1IM5A 3PC8A 4FR2A 2ZRDA 3WWOA 1M2HA 2ZZGA 4GPZA 3A9UA 3I28A 3D6MA 1PNRA 1VXRA 3D4PA 2Z98A 4KAJA 3V4OA 3UG7A 3U7HB 1Y9DA 2VJDA 3HS3A 4RD3A 3L0PA 2D2IA 3HO8A 4GM1A 2NMVA 2I1LA 2QTAA 3G13A 3HXTA 3T15A 1QGYA 5LWQA 4IH9A 5J59A 5F12A 3FXAA 4FZRA 5M3BA 1ZBDA 4G0PA 3NANA 3VVBA 2JD1A 4XNFA 4B3JA 4ECAA 3TGPA 3RVLA 1K3FA 2DKNA 2C78A 2XTMA 2WRZA 3UK7A 4G0VA 3HG7A 4DDMA 2OBNA 1E9RA 3ZWKA 5KTSA 3DS8A 4FGWA 4N7RA 5IAJA 4G1EB 1IYZA 2H07A 1X7WB 4HPWA 3WBFA 3NM5A 4JL5A 4JXKA 1DLJA 2HMTA 2ONJA 4QAJA 4AJKA 4BNVA 1ESNA 1ZRSA 2GWRA 2P6NA 3KZXA 2ZRHA 3U7GA 4EHLA 2W58A 3EGIA 2QNIA 3PFIA 2GF9A 3NHJA 1J1UA 4GWLA 2LW7A 2HJVA 4ZHQB 3TNYA 5I4BA 1Q74A 1ID1A 5HFAA 3NBUA 4LZAA 3E18A 5DHAA 4YK7A 2X19A 5FL7A 4G5GA 2FB9A 4RMGA 1WMDA 1ISHA 3Q41A 2Q21A 1PJBA 1P6UA 5EG5A 1FX0B 3WQZA 2I22A 3LFTA 2P9BA 2SNIE 1GPLA 2IYEA 3EULA 3N0TA 4E5PA 1QOQB 2ZXEA 3ONEA 4LXHA 4WZAB 2GO1A 1T8TA 4XYGA 3QF7A 3GJRA 3ZE9A 1OKKD 4MHSA 5EZQA 1VPVA 1PNTA 1Q0RA 4HX5A 1ITZA 4PX3A 1A8PA 2JAXA 3GU3A 3IQWA 3HJBA 2ZIWB 5DHUA 2E6KA 2ZKLA 3MWDA 3LOPA 1W581 2XQJA 2K2QB 1HDGO 2XMGA 2DKOA 5HRUA 2XUAA 1ETUA 1XFOA 3L4SO 3I9NA 1B41A 3IPXA 3Q9SA 2PT9A 4KVAA 5BV8A 2CEKA 5TQJA 1TJ4A 3T5AA 1V8BA 3UMRA 4IBOA 3SYTA 3ORYA 3H0EA 4NL4H 4EY6A 1QCYA 1ZUWA 1DEKA 2B4RO 2G06A 2HF9A 3A4NA 1H65A 4FMDB 4KLAA 1E99A 1Z68A 2D4HA 3KWLA 2YYZA 4K6FA 4URZR 4EPRA 1D8AA 1EGVB 1OI3A 2XA1A 3WXBA 1FS4A 4WXPA 1O6GA 1VJGA 3KTDA 2A5LA 3CPJB 1K63A 1QIKA 5A1TA 3AOEC 4KG7A 2ZUDA 1XAGA 3RS2A 4JI0B 4A7PA 3G9ZA 1X1RA 2VT6A 3GAMA 2I8AA 3VKGA 3M89A 3PWTA 4Q19A 2BFBA 2JRLA 4Q6WA 5ILGA 4DUPA 2OZLB 4QYIB 3BHJA 3H9UA 1URPA 3T56B 2JH8A 2OGWA 4CF6A 1LFAA 1GN9A 2CXHA 2OB2A 1FUEA 5AHKA 3PR3A 2CLIB 2J87A 4MWBA 5AOBA 2EFDB 4TLAA 2D1YA 3DV2A 1KF0A 5G1OA 3BILA 1CY7A 4FFWA 3E27A 4AYWA 3TCKA 3OI7A 1E2MA 1SZPA 2CJWA 3K8YA 4LJ9A 4RQUA 3O95A 2AKYA 4QXRA 1MMFB 4NYIQ 1OV6A 4H60A 4XCQA 4YRDA 4YQEA 1PGQA 1QH8A 4F1KA 4ZZIA 5D84A 1J0XO 2C88A 2Y68A 3WGMA 3AHEA 4Q9IA 1ETHA 4N48A 3ZN2A 3UCXA 3PQ4A 3X3HA 4IUCS 1OI7A 1XEWX 4HZUA 4K9DA 4JVLA 3RQSA 4RE6A 1W5SA 4WBNB 3JQAD 3KDSE 1GCAA 5JASA 3QEJA 3RK0A 3V00A 3R3VA 3HR7A 3WKBA 2F8SA 2YY5A 1WVMA 5FI3A 4YYZA 5NLLA 1JKFA 1FYWA 1JTVA 2G0NA 1HOTA 2Y1WA 5CVVA 3H3XA 3LHFA 4ZC1A 5ADWA 3G82C 4FONA 2XYPA 3AVOA 4S1PA 3RBAA 4GVXA 3TLEA 4LEIA 4D1YA 1N3LA 5HTOA 3KFVA 1E3TA 4OA8A 4NU0A 3WNVA 4CIXA 5LP6F 1BS1A 5F4ZA 3AUYA 1HT1E 4WCDA 1O5TA 4BBZA 2VSXA 1K5GA 4M98A 5D1NA 5DH9A 3KFLA 4A2WA 4B0PA 5AVKA 8MHTA 1X2BA 5DJ5A 4FUTA 4RSGA 2J6CA 4QUKA 1A9TA 1T8PA 2Y0EA 1JDTA 4I50B 3TEFA 3EZ6A 1ISMA 1FSGA 2KPOA 1VE9A 3F5SA 3JYLA 3KKOA 4AG6A 4ERXA 5JANA 1JXOA 1SELA 3UANA 4Q48A 4YCNA 3FX2A 3BMQA 4CMIB 1Y9AA 8ADHA 2OZKA 5A5VA 5EZSA 1JI3A 5I9BA 1ZESA 2OORA 4PO8A 2Z6QA 1ZKMA 3LX5A 5AD1A 3CSSA 1ZZGA 3N2GB 2HQOA 2LCQA 3FZYA 1JYFA 4XQCA 4AM8A 5KU1A 2W2MA 1XD2A 1V3VA 3ND9A 5INTA 5JSQA 3CRZA 3TQOA 3Q4GA 3ZQUA 1VCIA 3COSA 3MQ4A 5FD8A 3A6DA 3WL6A 4CLOB 1IZ7A 1JNXX 2A57A 3QW2A 1GGMA 4RCYA 3PXXA 4F2DA 3BDAA 3PGJA 4Y30A 4P36A 3DEJA 3R4CA 4LY6A 2ESRA 2C97A 3MUFA 3TNFA 1UBOS 2H17A 3DAYA 2CL6X 3IS3A 1ZCJA 5BYJA 4UHCA 3WG9A 2CLLB 2ZBFA 4BWFB 4AMVA 1H0KA 1T36A 5F1OA 4J43A 5FUWA 2C4HA 1CTQA 2OR3A 1RQ2A 1XVTA 1SCKA 3SJUA 1MD9A 5EJ6A 4UDNA 2RE8A 1IN1A 3P4YA 3LFUA 4D4HA 4NCJA 2R48A 3EBLA 4JUCA 2IZ0A 1ZGCA 3PQ2A 2QRMA 3KPVA 4FJ0A 4FYHA 1E64A 4ZRMA 3R5XA 4CKWA 1P81A 1R3DA 1W5BA 1X80B 2XNSA 3MGAA 5K01A 5L53A 6CHYA 1JT2A 6ADHA 1K8QA 2F1JA 3VOSA 3SHWA 3VGPA 4DE5A 1Y9ZA 1A0OA 3GRRA 3E2IA 4DMMA 4UPEA 5L51A 4FHCA 2G7MC 1E58A 2Q3MA 4FBMA 2OO3A 3BRCA 1XMPA 4D0SA 1F5SA 2XB8A 4PLGA 3KALA 2WAAA 3ZDYB 4AO7A 5EWMA 4J75A 3SEJA 3ABRB 1Z16A 1FFWA 2JFOA 3NTXA 2X15A 3QVMA 1RLUA 3BKXA 5JZ9A 4F1JA 2MWMA 5HE8A 3OA0A 1Y1KE 1X19A 4HDSA 4C0XA 4CPDA 4EHAA 4JI8B 1FVOA 3KTFA 3UBTA 2JBAA 3K0FB 4KW7A 1VHJA 1SC9A 2REQB 3FLBA 4IO0A 4QYTA 1HZZC 4BY9E 4RJJA 1G4AE 2WYWA 1G55A 4G2TA 3ZHCA 1H6AA 1V11A 1VB3A 4YV0A 3QFRA 2VAXA 2O4UX 4MJXA 2DFNA 4X8OA 4BZZA 4CT0A 4LNHA 5J35A 4NPHA 5D3MB 5F5NA 2FETA 1DXYA 1YZUA 4JVOA 4Z54A 3V48A 1KK2A 2O0KA 3A1FA 2C07A 4RK0A 1Z5NA 2P90A 1TE2A 2CDAA 1C3OA 4MMXB 3HVRA 4OMUA 3T53B 4ZHSA 3OKPA 3UFXB 2IV7A 1GYPA 2B4TO 1NXTA 1W9HA 3DZGA 2QM7A 4JH0A 3O8LA 4ZAWA 5AKLA 4KQMA 2VQEB 1OZHA 2JFWA 1M0SA 1XNJA 1S9DA 3VYUB 4AURA 3ZHTA 1G7CA 4C7BA 3MJDA 1I3CA 4XOIA 4FFNA 3RVPA 4QUHA 1Y8RA 3WVNA 1XQVA 3M3PA 4D8TA 4N7MA 5JCJA 1SEVA 2GM3A 4TROA 1LI5A 3BPSA 4S1OA 4KQKA 1U5BB 3Q5GA 2L18A 4HZIA 4L5YA 4MVJM 4XCVA 5E2AA 5ES4B 1ECJA 2ZRFA 1QANA 1EK2A 4RVFA 4NWIA 4EG3A 5LNK6 5DKFA 4MWCA 3T99A 2VRWA 5K05A 4AI6A 1NM5C 4L3WA 1WUHS 1CB7A 4J3NA 5CEJA 3C3AA 5KNCH 2H9IA 1FPMA 1VBKA 5LQNA 2R1VA 3G2QA 5GV8A 2X3UA 4YRSA 1XAJA 1ZIYA 2QE7D 3D7LA 3WHIA 1PSWA 1FE8A 1N6NA 4BMCA 4D25A 4GLLA 4DC9A 1RP7A 1E1QA 4XOPA 2CD9A 4I3FA 2F7SA 4QUJA 3BGIA 4X7EA 3DW1X 4DAOA 5E2BA 1GNVA 4RX1A 4LZNA 1XX6A 2OZPA 2RHGB 1LU9A 3GX1A 3KM0A 4D3DA 1JR3A 1OY1A 2Q28A 4PLCA 3W04A 2YJ4A 1XEAA 4DLSA 4LW8A 1QIIA 4LZLA 4TMWA 2A9QA 2BI4A 3L8MA 2JDID 2ZXUA 1YZTA 5IYZF 2H0RA 1JLLA 4GPTA 3IP7A 4HSGA 4M7OA 5HK9A 3ZDEA 1IQRA 4JBGA 1FJHA 4XGIA 1Z06A 4O1MA 4Y1RA 4AUMA 1E6UA 3FUUA 5FUYA 1N5LA 2PYZA 4MIYA 4R84A 3VSBA 1EX7A 1WHSB 1J9EA 4JB0A 4MS1B 3DP9A 5JJIA 4E4YA 3VHXA 2CDCA 1D6MA 1LWNA 1RQLA 2G40A 5ALOA 1K7XB 4YWJA 4R05A 5H82A 5MHTA 4PZ9A 2AX4A 2NX2A 3WO1A 2CWWA 1EP9A 4IJVA 4ZWNA 3R8XA 2YS7A 3B3JA