2PLFA

The structure of aif2gamma subunit from the archaeon sulfolobus solfataricus in the nucleotide-free form.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
publication title New Insights into the Interactions of the Translation Initiation Factor 2 from Archaea with Guanine Nucleotides and Initiator tRNA.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 87
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plfA01
2V4ZA 2JJ8A 3E70C 2JLRA 1AKYA 3Q3JB 5FBQB 1BMFD 2O52A 3Q7PA 1L4UA 3P26A 3N2IA 4PO1A 4XOIA 5HR5A 1UJ2A 4TN1A 3PUWA 4D6PA 4A6PA 4ARZA 3U5ZB 3T1VA 4C30A 1VG9B 1ZIOA 5E7MA 4RY2A 4YAFA 4LPKA 1UKVY 2RH5A 2IW3A 1CKEA 3CCEB 3V76A 1GTVA 4YONB 2K5UA 3AVTA 1J8YF 1U2RA 3FOZA 4ZGNB 1GNQA 2D7DA 1W0JD 4NCNA 1GO2A 3CRZA 5AK0A 4GDFA 3GEHA 1Z2AA 1I4LD 1L4YA 1G6HA 1RKBA 1YHNA 4ZV4A 4Y9UA 1RIFA 3TW8B 1PLLA 5G41A 4JYBA 3A4LA 5EUMA 2PCJA 2QENA 2J87A 1YHQB 1MOZA 3BE4A 3C14C 4JLKA 2QAGA 4DDVA 2FU5C 2ZS7A 4Q1BA 3RC8A 1P2SA 3V00A 1VQ4B 5GJCA 3KXLA 4P4UA 1ESNA 4Z8XA 1T3SA 1K9MD 4JLPA 1KO8A 3U6KA 1RRPA 1KI9A 3ZD7A 2CDNA 1YITB 3L0IB 4Z54A 1YI2B 1N5JA 1U9IC 2GJ9A 1DE0A 1MO5A 2N42A 4GNKA 2FE4A 1E0SA 2BBTA 1J8MF 1DTSA 2GXQA 4IOJA 4Q9LA 3DMNA 4IHQA 1EXMA 2VSOA 2ZJAA 4Q4JB 3T1TA 1NLFA 2JLWA 2ZUDA 1LW7A 4OL0A 4CIDA 3GP8A 4I1OA 1G16A 1EFHA 4BRWA 1RYFA 3LLMA 2Z43A 5BQ5A 1GRRA 1UPTA 2I1VB 2QA5A 4Q1DA 3TR0A 5JJKA 1K6MA 4EPVA 1TQ4A 4Q9HA 1VCIA 1VQOB 3Q5EA 2XNCA 5J40A 3PVSA 3GJ5A 1NBMA 2QA4B 2WHXA 4ZI2A 2QT0A 4B3XA 2ANBA 2CMKA 1E2IA 3IGFA 5L3QB 3H0KA 3K1JA 2OBLA 3EPKA 2FG5A 4IEEA 1KDRA 1XNJA 5KYKA 3C5HA 1MH1A 2ZQ5A 4KYUA 3QEJA 4XVRA 2DYKA 2HCJB 3RWMB 1XU4A 4A15A 4WXPA 3TQCA 1N6RA 5LD2B 3IO3A 1SVOA 5JZVA 5DH9A 1ZRHA 1VIAA 3CUEF 2Q3MA 1OIWA 1FZQA 1KK2A 1KNXA 1FRNA 1P9NA 2GDJA 2XOKA 4L5BA 2Z0MA 4WIAA 4MQBA 4DSTA 5CDFE 5JEEA 4BLPA 4MRPA 2ZRCA 2ONJA 4BRUA 1TF7A 4OK6A 1AQYA 1M2OB 3ZQ6A 1KK1A 3NWJA 1DAEA 2JDID 4D25A 1QVFB 1W46A 3D7MA 3Q9LA 2KBEA 4JIMA 4UNPA 3MD0A 2IS4A 3P20A 4PPNA 1ANKA 4A0GA 4HB4A 1VYVA 2UVQA 5E4FA 2BGJA 1E2MA 3ZS9A 4DBLC 2HV8A 1D2MA 2NGRA 5JLJA 1W34A 3F8TA 4JMPA 4JZKA 4TLEA 5TARA 2WJIA 5C4MA 3AKDA 1FNNA 4MGYR 2NO7A 2J0UA 4LYAA 5LD2C 8OHMA 3KFVA 1B2RA 1UM8A 2O5VA 1GIAA 3SS8A 3DZ8A 4DLUA 1Z63A 2ZYWX 2BM0A 2WSSA 5D3QA 2QPOA 1FTSA 4N0EA 3R7WB 4CEHA 4HSEA 1AIPA 4CEJB 1ZM3A 1NJFA 1NVVR 1CRPA 4QGHA 4YHBA 2ZR7A 4BFWA 3CC7B 2EFDB 4KXFB 2GTPA 3OEHD 1OB5A 2RGNC 3IIMA 3K09C 2RGAA 4V02A 2JGNA 3AVYA 2C99A 1GR1A 2BIFA 3TUIC 2NO6A 4DUGA 1S9HA 3ECCA 2CXXA 4U00A 2BHRA 3R8CA 1F60A 4UAJA 3MAAC 1X8KA 2A5DA 5EQTA 2IYVA 2CNDA 3CCQB 1OH5A 3ZYCA 4DDTA 1XCGB 2XNJA 3GPLA 4AYTA 3PUZA 4JT2A 4GOXA 2VZLA 2J0QA 4DCNA 1QHYA 1YZKA 3FTQA 1XZPA 4LRWA 3B8HA 4AF6A 4RFSB 2LWIA 4FWIB 2J46A 3CCSB 3JVVA 2GK6A 2F55A 1VECA 3CX6A 3CR7A 3LVBA 1G3IA 3X1DA 3VAAA 4AIIA 1GL7A 4FK8A 5BYJA 1N0UA 2BBSA 2RGBA 3U3JA 2OFOA 4MRRA 2DY1A 1RC8A 2HYDA 3BK7A 1VQNB 4KVAA 1E32A 4Y0VA 3E1YE 4EUNA 4B2LA 2REBA 5EXXA 1FPMA 3B60A 5JRZA 2FX3A 1W5TA 4EJSC 3U44A 2YZ2A 4HZIA 3DDCA 1U98A 4WOPA 3BFXA 2OO7A 3HP1A 3DVLA 4D0GA 1EX6A 1AS0A 2DWPA 2JEOA 1D9XA 2MMGA 4NZYA 3THXB 1I2MA 2X2FA 1B23P 3AVQA 3IPYA 3MUFA 4DWJA 1Z5ZA 4A8JA 3ZC3A 3W2GA 1E2LA 1WQ1R 3OIVA 3WBJA 2J7PD 1D8TA 2A5FA 3UPUA 1JNYA 1QF9A 3EZ6A 3A58B 2NZ8A 5JI3E 4MKGA 3UATA 1NP6A 3UKDA 1JPNA 3PEUA 4LBYA 4BE7B 2VP0A 2QRNA 4Q4AA 3B1VA 3DM9B 4OQLA 3TR5A 4BFZA 1Z28A 2F1IA 3CIOA 4Z8YA 5LB4A 1UKYA 4KLNA 1HQCA 4ZIRB 2WAXA 3VNVA 3DPUA 3OF5A 2MSCB 4LJ7A 1QG4A 3LNCA 4JLDA 3LRPA 1CJUC 2H1LA 4FMCF 4C0QC 1ONBA 2X8AA 3CPWB 3CCRB 4URUR 1HYQA 2XSZA 3ZIAD 4QGFA 3K0AB 5BWMA 1DPFA 1H8HA 4LZZA 4AD8A 1E0AA 5J4YA 1EGAA 1N0WA 1M74A 3QI2A 5EE0A 4YALA 1XZQA 2V54A 3T61A 4V03A 5J4VA 1TF2A 4BEBA 4Q03A 3VKWA 3VMFA 2ZRBA 4DLRA 1GKUB 4DCUA 1W2HA 2ZRDA 3RRMA 3VU9B 3JQRA 2BOVA 3GJXC 2ZYUX 4BZPA 3RRYA 3P1JA 1DAIA 1VG0B 4B3CA 4E5UA 1UBFA 2W6IA 3L8ZA 1EX7A 1XD8A 1YQTA 1KSHA 1X6VA 1AK2A 1O3YA 3O8DA 4WA7A 3RHFA 1OFIA 3A1VA 1E4VA 1OXVA 4IOLA 5SZHB 3WNCA 4J0QA 1GDDA 4GP6A 4KO8A 2GCOB 1CLUA 3KQHA 1Q82D 1YJ9B 4DDUA 4X8OA 1BH2A 1PZNA 1GUAA 1EFUA 2J9RA 2P0EA 4FMCB 4TQ9A 1GWNA 3ZZUA 5AR1A 5B64A 4CZ2A 3BWDD 2W6JD 1YRAA 3C8UA 4C3ZA 2GRJA 1YR9A 3LQQA 1KI6B 5DHFA 4TTRA 3FYHA 3ADDA 1JA0A 4W5JA 2R44A 1GKIA 1MRNA 1UBCA 2ZI7A 2H5EA 5JI2E 1ZD9A 2HLDD 3BB4A 3VX4A 1KO4A 4URWR 3T5DA 4IEIA 2H17A 4KFSA 3THWA 4RZ3A 4TZ6A 4DSUA 4RSGA 2XEXA 1P2UA 5EE1A 4BFXA 1NBME 1J2JA 4LWZA 4LGMA 4G5SA 1ZW6A 3QKSB 2O8CA 2EVWX 2RCNA 3IDQA 2OCYC 1PV4A 3IPXA 1VDZA 2QP3A 1FX0B 1II9A 1R6BX 2CK3D 4TSFD 5SZIA 2JLYA 1QHNA 3SN6A 4HEJA 1PUJA 5IF9A 4MDFA 3UANA 4BFTA 3QG1A 3C15C 1LY1A 4L16A 4V0NA 1RRGA 3SC3A 2GZHA 3QE2A 1KMQA 1O87A 4HAUA 3GLIA 3FMOB 2EFHB 2FGJA 4WXRA 2QM8A 2PEZA 1UEIA 1MABA 1KC8D 2IYYA 2V7QD 5DN6A 3FJOA 2BKUA 2OK7A 1AQUA 1E2FA 2H16A 2C2HA 3RS7A 5BN3A 2HF9A 4NMMA 3ICEA 3FDIA 3ADBA 1F2TB 4JLJA 2XX3A 3QKRB 4OQMA 3VNUA 3FVQA 1I7PA 3EW9A 2XITA 3CCJB 1UF9A 4P4SA 2BCGY 4TQAA 2FMXA 1XP8A 2KBFA 2X1VA 2BM1A 4RJLA 1LS6A 3W5IA 4EPTA 5L8VA 3VO2A 3QFRA 1US8B 4XWOA 1NN1A 6Q21A 4OHYA 4URVR 2ERYA 3LO8A 2YC4C 5BW8A 4G5QA 3W2IA 4HDOB 3G82C 1BX0A 2F43B 2QUZA 3PG5A 5A5GA 5JWRA 3AF2A 1U81A 4YMTA 2QN6A 2YYZA 4CT4B 2G6BA 2D74A 3K9LA 2A9KA 2WZQA 4I1VA 2RC5A 1G4AE 1G8FA 3IBGA 4XD7D 1KO5A 3GLHB 3LW7A 1H42A 3KJHA 2DFKB 3BB3A 3CNNA 3R20A 5FFMA 3FKQA 3JZMA 2GHIA 4MYTA 4EH1A 3CMEB 1KGDA 2WAYA 2WJVA 1IOZA 3BS4A 4Y9RA 2FZLA 2GA8A 4DLVA 2BSAA 4RZXA 4OHZA 1QHIA 1IN5A 3ZS8A 2ZM5A 3ETLA 3PUXA 2Z4RA 1NY5A 3GLFA 4GOKA 4LHXA 4N1AA 2NO9A 4JSTA 1SXJD 2Q21A 1IM2A 2IYQA 2ZETA 1GVNB 1XEXB 3A4NA 4U02A 3SNHA 2PX3A 1KMHB 1JBKA 4NE2A 1T8UA 4QC2A 5DIFA 2VPPA 1XJ0A 4LI0A 1H65A 4UJ3A 4NYJR 5SZKB 3W3AA 2VNJA 3FKSD 4Q1AA 5FBRB 4B35A 2G83A 1F5NA 3U3KA 2BGIA 1XTKA 3THYB 3QBVA 4F91B 3RRNA 1SVIA 4CW7A 2ZRMA 5LPNA 1SKYE 3TGPA 1NVXQ 1TQDA 2PEYA 2ASEA 3EA0A 1SKQA 2JIZA 1SXJC 4Q48A 4C0JA 5JSZA 1F2UA 1KO7A 4UXHA 2BVNA 1RE0A 2VP4A 3ND9A 1Q57A 4PXAA 3UWOA 1S3SA 1E2DA 3UG7A 1CR0A 3LD9A 4HLUC 4PC1A 3WYFA 1YRBA 1EP3B 1UDWA 1W44A 2IYSA 2CHGA 2N46A 3K9GA 4BFUA 1W48A 1S1MA 4GMDA 1E79D 1QHHB 3JQPA 2C77A 3GFOA 3SQWA 4AY2A 1W36B 4UNRA 2BPOA 4IFBA 3EG5A 2FFQA 1AS3A 5FI1B 3OEEA 4PTLA 4DLWA 3H84A 3PEYA 1Z83A 4ARZB 2GCNA 4PSAA 1UADA 1K8RA 2AWNA 3UMRA 1QFJA 2R9VA 1FQJA 1HUQA 3CRVA 1KJWA 3ZGXA 2AL7A 3K9HA 4PZLA 3ZBTA 1LVGA 1ZVQA 4PPGA 1XX6A 2ODEA 3TW4A 1AN0A 5BN5A 1BX1A 3AVWA 2PZEA 3DKPA 1U94A 4PHTA 3ZD6A 1OXUA 2AXPA 1HH4A 3VQTA 1U8ZA 2ODWA 3HWSA 1BIFA 4LV5B 1NJGA 1LS1A 3EIQA 4LDJA 4HAVA 3WY9A 1KYIA 2VHTA 2NO0A 5HXBA 3KUCA 4RKFA 4BFSA 2JLXA 2GJ8A 2QAGB 4K81B 4IDPA 2X19A 2FA9A 2VHQA 3EZ7A 4HAXA 4TMWA 1Z29A 2OXCA 4S35A 1GG2A 4JVLA 5JWOA 2TMKA 5HE9A 1COWD 4A82A 2BF4A 1A5TA 5FTJA 1CF4A 2Z4SA 4HB2A 3TMKA 3BD9A 2YOGA 3U60B 2G0TA 3LBHA 2ZI5A 3I32A 2GESA 4KHZA 3C41J 5EP1A 1AJEA 1II8A 2O8FA 3VTKA 2ZSAA 4S2EA 4DDWA 4PZYA 4P32A 4KVGA 4DIDA 4OQNA 3GEEA 1VG8A 4HAWA 4BLQA 2B8WA 4BLOA 3ZVRA 1MT0A 1N8RD 1IN4A 3IHWA 2G88A 4PANA 3NC1C 4UJ5A 5CLQA 2WOJA 2QAGC 4MRVA 3CPEA 3KTAA 5AJYA 5FOVA 2OBMA 3W90A 1QUFA 2Z6VA 5TDHA 3AKYA 1BYIA 3NKVA 3W6OA 1OE0A 3SDZA 2VP6A 5CM8B 2ZJ2A 3QKTA 3EARA 2WWHA 3CH4B 4JVSB 5FTNA 1P4SA 4B32A 1LF5A 1DG1G 2HXSA 4I1SA 5GJVC 1XD2A 2P6UA 1NBMD 4AKGA 2VP2A 3MGCA 4DHEA 4M1YA 4M1SA 5CJ2A 2GK7A 3WYAA 2GVZC 5SZJA 3RDPA 2V1XA 4A92A 2J59A 4EQ6A 1RZ3A 1W7AA 1ZNZA 2XZLA 1KAOA 4JS0A 4XJXA 2WWGA 1Z0FA 3KKNA 1EFRD 1GJRA 2BBWA 4II7A 3K8YA 2XTMA 3GLIE 1W4AA 3IILA 4HATA 5FL7D 5DI3A 3AKCA 4XH9B 2GILA 2RGXA 1ZCBA 2QU8A 1XMIA 4BLSA 3U4QA 4ZO4A 3B7GA 1GAWA 1FFHA 1R0YA 1W0KD 3D31A 2R6HA 4D4LA 1SVSA 4LSGA 1CS4C 2J0UB 3B82A 3EAQA 5HE8A 1E64A 3AF4A 1DBSA 1VG1A 5JBQA 1Z6AA 1NLZA 5E7IA 2QMHA 3MJRA 1ZUHA 2E87A 2OBNA 5B2ZA 4F4JA 5C46F 1CP2A 3ND8A 1YZGA 1RFLA 1D6JA 4V0OA 4EPRA 4PGOA 4DCSA 4PSKA 4CEHB 1D9ZA 2J41A 4R9UC 1IBRA 4N3NA 2RC6A 4P3YA 1LTQA 2QP9X 4OBEA 3DZDA 5H59A 4XTRA 3RSLA 5EZ6B 2CL0X 5DYIA 5A0FA 2A78A 2CLSA 3AEZA 2XNSA 2JA1A 2C5LA 5JEDA 3SBDA 4OK5A 1ZU4A 3KKPA 2IS6A 5DGXA 2IYTA 2GBLA 4NBSA 1PLJA 4XSHA 2QG6A 4IXMA 2X3UA 4R2IA 4YMVA 2FN4A 4HUQA 4IVRA 2IXEA 4PX9A 3LV8A 1ZD1A 3RWOA 1JAHA 3UMFA 1E1QD 3AVUA 1JEEA 5FUXA 3G71B 3QFCA 3HYTA 2ZJOA 3KUDA 3M0EA 1OJLA 3HDTA 1R2QA 5HKKD 3F3YA 2VYFA 3OW2B 1OF1A 4C0SA 3WRXC 2ZJYA 4M9SA 2DBYA 3W5HA 2FF7A 4X8MA 3GLFE 2ZRIA 4JJKA 1U8AA 3B1WA 2V1UA 2CVFA 1LF0A 1IXSB 1S8FA 2RGGA 4NYIR 3KQUA 5GVRA 1SGWA 3QUSA 4UQOA 1NKTA 1T6NA 3HJNA 5JS8A 1CEEA 1R8SA 3QPWA 2IWRA 2Z83A 1OHHD 2CEAA 5IK2A 1E2GA 1AMOA 5HCIA 2WWIA 1RYHA 2ZI4A 2PL3A 4K1XA 3CW2A 2DETA 2QORA 4L4UA 1G8HA 2ODBA 4RD3A 3I72A 3U44B 1UKZA 3Q7QA 1G21E 3QXSA 5L3RA 3A1UA 1JAIA 1SKYB 4G01B 2FEOA 2DEUA 2P5TB 3RRZA 3NG1A 3BH0A 4DEYA 2QAJA 4RCZA 2YVUA 4QGAA 4BFVA 2GZAA 1W35A 4HDCA 3RVBA 4A8JB 3THOA 5B57C 5KSYA 2CNWA 3NEYA 2DFTA 1DO0A 1HURA 1I4TD 2F9MA 3O8BA 4H9GA 2PBRA 3NBFA 1T3LA 2CCJA 3I61A 1XPOA 5F98A 1IN6A 4N3GA 4BASA 1BO6A 5IDVA 2QE7A 5J47A 4TTPA 1FP7A 1XBTA 3ADCA 4RFVA 2Q3FA 4TMTA 4Q4AB 1P75A 4HLDA 4LOAA 2WPDA 3CR8A 4KAXA 1HQYE 2FFBA 1KTVA 4AYXA 2BCJQ 3ZVMA 4NYMR 1KI7A 1ZC3A 1OYWA 2Q9CA 2W00A 5KSWB 2ZS8A 1CIPA 1TU4A 3FB4A 1VQ9B 4A8JC 1E9DA 2BEJA 1D2EA 3E5HA 1G7RA 4BZXA 4E07A 3BB1A 1CU1A 1T0HB 2QPAA 1W1WA 4JKIA 4MDEA 3SOPA 4JLBA 3BIFA 3GQBA 2DFNA 1WMSA 2A5JA 1IHUA 3AP2A 3EWSA 5EXSA 3O8RA 1H8HD 4B75A 3HU1A 3AGQA 4F92B 4B76A 2RHDA 1CULC 4NL4H 1Z07A 4JSYA 2BMDA 1KI2A 1Z06A 2VRWA 4KCGA 5EXPA 1TEVA 2AD1A 2QTHA 3KB1A 4FCWA 5FTKA 5HTKA 1G7TA 3AUXA 2H57A 1G291 3CRMA 1R5OA 3LDAA 2IK8A 1B0UA 4MRNA 5KSOA 2W6ID 5K8TA 2ATVA 2XNDA 1SVMA 4DLTA 3IIKA 3PV0A 2BC9A 4P6VF 2ONKA 2ZSBA 2FNAA 1FW6A 2ANCA 2YWGA 1G7CA 3QOFA 2GJSA 4G3XA 2GXAA 1N5LA 3WNDA 3B5JA 3M6AA 2RB4A 3U7FB 1U0LA 1G8GA 1ZCAA 4JLVA 3OZXA 3I56B 5KSZA 3C16C 1ZAKA 3SYKA 5B58C 1T5LA 3W2EA 3BFVA 4IVQA 5FTLA 1Q22A 3RS2A 5AJWA 2H18A 5FUYA 1SVLA 3TSWA 4Q47A 1TU3A 1FNCA 2BMWA 2JJ1A 2O0JA 3JVUA 3PITA 2ATXA 2OAP1 4Q4HA 3EZ2A 3GFTA 3WMFA 1QHGA 3OZUA 3TLXA 1NRJB 4ZDWA 3T1OA 2AX4A 5K8UA 3THWB 1KOFA 5AJVB 2QEXB 1SVKA 1BQEA 4LJ6A 3QKUA 2QTVB 1E9SA 2IYRA 4MRSA 4QBFA 2O8CB 1NMZA 2R65A 2VIIA 1DDIA 4KLZA 4OYHA 5DE3A 4EDHA 2BMFA 2FPLA 3HPRA 4TYWA 2O8BA 2XZPA 3HYRA 1L2TA 2E1RA 4Q00A 3GLHE 4TLAA 4A1FA 1E6CA 1HE1C 1W4BA 4HB0A 1WCV1 2O0HA 5C2JB 2A5GA 4FINA 2XGJA 4PR0A 1JJ7A 3QQ5A 4DLSA 2H92A 4G5OA 5KNBA 4PHHA 1IB0A 5KDLA 3GLIB 2VO1A 1ZUNB 3R8FA 2GQFA 2QEQA 1MABB 1JR3A 4QJ3A 2OLJA 4M53A 2YWFA 4E03A 1ETUA 2NZJA 2RGEA 4OHWA 3PQCA 2YKGA 4C0HA 1EESA 2OCBA 1HA3A 1P6XA 3U7EB 3AVVA 4XVUA 5FOWA 4BPBA 1Q20A 3OHMA 1BMFA 4KI0A 4PQFA 2DERA 4H1VA 3W2FA 1DAKA 1W5SA 4UKDA 3WRYC 1UKEA 4P4SB 4OI4A 5THXA 4URYR 2UZ3A 2WWWA 4AI6A 3EPHA 4TLBA 3MMPA 4P4TA 2J0SA 1K73D 4GZMA 2ZPTX 1VCOA 4LBVA 3SJAA 2NMVA 2G0NA 3KKOA 3A1WA 1LV7A 3DKVA 2CCGA 1W0JA 2ZREA 2ZRHA 1CJMA 5DHAA 1GAJA 3CBQA 3BOSA 1U90A 2FSIA 3FMIA 3LFUA 4A2WA 3BFKA 3EWAA 4D80A 1JPJA 2XTZA 1U9IA 4B34A 4EFLA 1UBEA 3KJIA 3GLGA 2VNIA 1QGYA 4XWKA 4B43A 4EFMA 2QBYA 4AKHA 4JLMA 2EYUA 4PAOA 5JCPA 3R9XA 2OFXA 4CVNA 2P3SA 2ORIA 1N6NA 3A4MA 3QPVA 1XMVA 3KQKA 1M1KD 1E2EA 1S72B 2CJWA 3LAWA 3U2QA 2R2AA 3D3QA 5H5JA 2VH5R 3QNUA 3CCVB 1CJKC 3TQFA 4QGGA 121PA 1D2NA 3RS4A 3PEVA 3EXAA 4C0LA 3M1IA 4I99A 4TYPA 2GF9A 5G53C 1Z2CA 1JXOA 2CCKA 1QG0A 1EFCA 1WXQA 4D0NA 1DELA 4US1R 1N6HA 1XEWY 3GLFB 2DWOA 3MJHA 4FWTA 1OPXA 3I1FA 5H68A 3K0FA 3L8YA 2IC5A 1ZM2A 4G1VA 1RJ9A 1YE8A 4YXWA 1OB2A 2WWFA 1MO4A 4PFSA 2IL1A 1VTKA 3TH5A 4O3MA 3ZZTA 4ASUD 3KL4A 4TL6A 1FOEB 2RHMA 3FHCB 2IYUA 2CVHA 4Q9KA 4YC7A 4KYIB 1IQPA 1YR7A 4PPFA 2HF8A 3WBKA 4BFYA 1XCPA 4ERNA 2G1JA 1NIJA 5DI9A 4DVGA 1ZNXA 2IXGA 3PUVA 3KX2A 2Y8EA 4RD2A 1OKKA 4I1UA 4HAZA 3OFNA 1F2UB 2B6HA 3E20A 3NEJA 1EWQA 1NVUQ 1OV4A 3Q72A 4YAOA 1LB1B 4ON9A 3IKJA 4JBWA 5KPJA 2WJHA 4MH0R 3SZRA 5JS7A 1KDPA 2ZYVX 4A36A 2BWJA 2ZJBA 2GKSA 4G0NA 4BLRA 3EPLA 2ZRGA 4G1UC 4NHOA 2R6DA 3IQXA 1R8QA 2BBOA 3TAHA 3TVDA 2IBMA 1DEKA 3K0EA 4HZUA 4IDOA 2HUPA 4IDHA 1RW4A 2VF8A 3CF0A 3QE0A 1ESMA 4TYYA 2JDIA 3SJCA 3TE6A 3ZZ0A 2IX3A 1G1MA 2GEUA 4CT5A 1WBDA 3SQXA 2HDNB 1FL9A 1NVWQ 4TT3D 3LXRA 1PJRA 4ESHA 4C4PA 1GFIA 1GP2A 3PENA 3EZ9A 1SM4A 2RGNA 1M34E 3CCUB 3MLEA 1Z0AA 4OKSA 721PA 3TRFA 4M21A 4B3GA 1J7KA 1GZSA 3W3ZB 2ZUCA 5KNCA 1ZD8A 2H8KA 4JLAA 4DB2A 4K8OA 4M9XA 4ITRC 3VR6A 3V4RA 2MMCA 3FHOA 3K0CC 1H8EA 1G6OA 2GJKA 3PUYA 4OQFA 1NKSA 3GCGA 1ZUIA 4PHFA 2QSZA 4Q1EA 1JXMA 2HEIA 5E7JA 3CO5A 3FFAA 4EAQA 4B73A 4Q7JB 5HZKA 4ZI3A 1IJFA 5CLLA 4W9MC 2JLSA 4MA4A 4Q19A 2EIXA 5BN4A 3OEHA 3B9PA 2ZSEA 4TLCA 2QGZA 3OAAA 1E9RA 1KZ7B 4AF7A 1OFTA 4QJ5A 2QROA 2GNOA 2ZVPX 3X1WA 3VKGA 1A7JA 4PAQA 1MO6A 4PSVA 2XJ9A 1XTIA 2YWHA 4M1OA 1G18A 4LYFA 4LV6A 4D4JA 3U7GA 1EFTA 1FDRA 4F7DA 5CJPA 1A1VA 4PQYA 2EWVA 2QDXA 2QPTA 1F48A 2ZYTX 1E98A 2VNKA 1P9RA 4CF7A 1TVCA 1E2PA 4Z1MA 1II8B 1P72A 1ZMXA 4JL8A 2O8FB 3O47A 3LY5A 1T91A 1N2CE 1U99A 1XTRA 2IYZA 4EJSA 1N6KA 1VQLB 1TQ2A 2D3WA 3BJIC 1GNPA 4M1MA 2YOFA 2G3YA 1KIMA 1KDOA 1T0JB 3B1ZA 2O8EA 3QF4A 3KTAB 2ZRLA 3X1YA 4P31A 5FPTA 1NN3A 1Q0UA 4JYCA 4EPYA 4B2IA 4DT1A 1VQMB 4F4CA 5JHGB 5DYGA 1M1YE 2GVDC 1JJVA 1VQ6B 2VTKA 1NLYA 1XD2B 2N1BA 4Q01A 2WWYA 1QVRA 1W2BB 1CNEA 1QDEA 3BORA 1V5WA 4IOKA 3GJ4A 2ZRKA 1G5RA 2UKDA 3LX8A 4O0MA 3RAPR 1FUKA 1JQJC 2OXRA 3A37A 3MCAA 2OUKA 1VCNA 1FP6A 4I81A 3I5YA 3U61B 1VQPB 1N5IA 2W2VA 1VCMA 4QJ4A 5G3ZA 2VP9A 2AD5A 2D7CA 4QBGB 4G5RA 3W34A 1AA9A 4MGKR 2ZAOA 2ZITA 4QKQA 1E1RA 1VPLA 4JBXA 2LKDA 4C0BA 1JR3E 1KK0A 2IYWA 3FHTA 3LVQE 2J7PA 4D2IA 2ZU6A 3GEIA 2GJAA 5DI3B 3FE2A 4N0DA 1VQKB 1SVWA 2C9CA 4GI7A 2ZE5A 2W2XA 3SR0A 3U4QB 2FOLA 2Q3HA 3EIHA 3B1YA 2PJRA 4NCIA 1OGIA 4RD4A 1NVVQ 5AWFC 1E9FA 5EP4A 5H8WA 2J45A 4NCHA 1S9DA 2OCAA 3KKMA 2GCPA 3W8NA 1Q1QA 1UFQA 1YZNA 1FNMA 5KPDA 4TL8A 1SQ5A 1Z6YA 3KB2A 3KQNA 4ACBA 2YJTD 3ZIAA 1GILA 3TAUA 3BBPA 1GVHA 4HE5A 2FFAA 3WMEA 5KDDA 4QM6A 1FUUA 4A0FA 4OK3A 4ABYA 1S1CA 1JECA 4LJ4A 3GLGE 2QM7A 2WKPA 1P9WA 2QNRA 3L2OB 5ANRB 1T3HA 4NH0A 4AKIA 2XTNA 3GJ3A 1ZM4A 3DM5A 3R9WA 3AV0B 2FDCA 5CYPA 1TPZA 4O2RA 3NDPA 3CXCB 1R4AA 3VR5A 4KFUA 3FGNA 4TTQA 5FA6A 2IF2A 1VQ7B 5UKDA 5GJBA 4Q7MB 4HUQB 3AVOA 3UK6A 1HV8A 1CRQA 3NC0C 1BYUA 2OCPA 2ZJ8A 4LHVA 1JJ2B 1U0JA 4YMUA 1W36D 1Z3IX 2P65A 1OH6A 4A9AA 4BLTA 2XB2A 3DL0A 4UNQA 2AFIE 2IS2A 4B3FX 2QTLA 4KV9A 5KOYA 2AR7A 1A82A 2JJ2A 5DNYB 4TWZA 2W6JA 4RZUA 5FH9A 2FSGA 2J3EA 1DO2A 4JJZA 4DQKA 1TAGA 3SFVA 4US2R 2C98A 2HLDA 3EC2A 1IY1A 2WKRA 3S1AA 1P2TA 4Q18A 3AF3A 4QOSA 5DLQC 4MYUA 4MGIR 821PA 3SBEA 5FL3A 1CNFA 5IK2D 1W36C 2VHJA 4F4IA 1EWYA 1CR4A 1FRQA 4YLGA 1NSFA 3LO5A 1M7GA 5CB8A 4GP7A 1DAHA 2GF0A 3I8SA 2EYQA 2CL6X 1VYTA 1R0WA 4TSFA 4Q1CA 4C7OA 2ZTSA 4FI3C 1PVOA 3H1TA 1TLLA 1QVGB 5BXQC 3CF2A 4B2PA 2VYQA 4IRUB 4MYCA 4JLOA 1Z8FA 3ICQB 2JATA 3WHLA 4Q21A 3CLVA 3MHPA 5TY0A 2B21A 2CNWD 1Z6GA 2REXB 2ZANA 4M9ZA 4JL6A 1DOAA 4H1UA 3IO5A 3B1XA 2JAQA 1QFZA 1X86B 3PJRA 4ZDJA 2OT3B 3CZPA 3FFBA 2ZAMA 1G3UA 1CR1A 3PEWA 3HPQA 5HPYB 1GL6A 1E62A 3CX8A 4C9BA 1KI4A 2VSFA 4QRHA 2EU8A 2Q9AA 4BUJA 3SYNA 1TUEA 1VHTA 1XJCA 3MWJA 4JL5A 2I4IA 2V6JA 5FOTA 3CMAB 1K5GA 4LYJA 3LW8A 4IDQA 3T5GA 4Z51A 5JJIA 3OESA 3A8TA 3DO6A 4ZGQB 2QGNA 4Q7LA 1OW3B 2WM9B 1GSIA 4JLNA 1II0A 5FR2A 2EW1A 1JA1A 4QHSA 3SJZA 2D2EA 2KI5A 2MSDB 2ZJ5A 5TMPA 1EWRA 1KAGA 4YMSA 4U7DA 3CNOA 1JEDA 1F6BA 2OAQ1 3LBIA 1QZXA 1ZYUA 4D4MA 2FEMA 2RGDA 2ERXA 1X3SA 4Q02A 4RZ2A 3RNLA 1CTQA 3RSOA 4A2PA 2O8DA 4TL9A 4UNSA 1UAAA 1ZBDA 1GOTA 1A8PA 4MUBA 4QNRA 2GXUA 2XOKD 1A2BA 1QGAA 3CRW1 5FUWA 4XD7A 3I5XA 1K8AD 1J9ZA 3E2IA 3WP1B 2KSQA 2QMOA 4FN5A 1HEIA 1C1YA 2XAUA 2UZIR 4US0R 3IBYA 2ZIAA 1NL3A 4NONA 1QVAA 1Z6TA 3HR7A 3NHAA 3P32A 1R7RA 1KD1D 1E2NA 1NIPA 1CXZA 2W0SA 4KU4A 1DDGA 2BMJA 5IRCD 3C5CA 1G8PA 5ELXA 3Q5DA 2CE2X 2NOAA 3P27A 1G20E 1TADA 2W2TA 3BRWD 4JBYA 2ZRJA 4Q4HB 5FPKA 1SXJA 2CL7X 3H86A 2PH1A 2CE7A 3K70B 1KI3A 2OG2A 2GETA 3CKLA 4A2QA 1E9CA 4HB3A 4O2LA 3RYTC 4M2LA 3I62A 3OE7A 3WP0A 2WSSD 2DR3A 3FKSA 3K70D 4HLUA 4MYHA 3H2YA 2KE5A 2QQ0A 4XVQA 4Q5IA 3SHFA 1GRNA 1Q44A 1VMAA 5BYKA 1KQSB 2IEZA 1IAQA 1ZM7A 3MRSA 2MSEB 4YAWA 3N5CA 2O8BB 2PZGA 4HYYA 5F2EA 5FI0B 3UXMA 1VQ5B 1E2QA 5EMNA 2F9LA 2OTLB 2IEYA 5FPYA 3X2SA 1M7HA 4KSCA 3EX7C 1WA5A 2F3RA 4DUGD 1L8QA 1ZNYA 5EUQB 4ZCIA 2I3BA 5FPHA 1C9KA 1Q1EA 1Q1ZA 1E3MA 5KTYA 1OH8A 1JALA 5EXTA 3CNLA 1KK3A 4WAUA 2C96A 5A4JA 5J4HA 3K70C 4EPXA 1XTQA 4LC1A 3IEVA 1R0XA 5KO2A 1I2DA 5JECA 1IJEA 2RMKA 3OZWA 1ZNWA 3BERA 4PZZA 4Q9JA 1AZSC 3AF1A 1CR2A 4QBHA 3TJZA 1KKMA 4GSYA 1VIYA 2FWRA 5G3YA 4OQXA 1UMKA 2OK8A 1G3RA 2NTYC 3E1SA 2WIBA 3LBNA 1XFAA 5B30A 3TK1A 3U7HB 1QRAA 3NBYC 1AKEA 2VEDA 2QTFA 1E63A 4V0LA 2DB3A 1TTTA 3ASZA 3QXHA 3G5UA 2ZRAA 2WSMA 2QSYA 1R0ZA 2D4HA 1OH7A 1EK0A 3AF0A 3OIYA 5L3SA 3R9IA 4GPTA 1N6LA 5J5CA 3CWQA 4XIGS 3CC4B 4OJQA 2YHSA 3VHXA 4GZLA 4B71A 4WQMA 1YZUA 1NY6A 1FNDA 1IONA 1J99A 4G1BA 1KZGB 2QQEA 4DLYA 2VQSA 3KFXA 3GLGB 1G19A 1XD9A 4HDQB 3VR3A 2QBYB 3Q85A 2IXFA 2OLKA 4MKIA 4PO8A 3TVTA 4YQFA 3AUYA 1TL7C 4C0KA 2Q0HA 4NCJA 1G5TA 5D3MA 4LBZA 4GBMA 1HTWA 1QX4A 1BS1A 1G7SA 2AXNA 2P67A 2J0VA 4WZBE 2CJWB 2VHCA 5E3HA 3QSYA 1KRHA 1VHLA 2A30A 4LJYA 2B92A 1E2HA 2ZS9A 3VKHA 2R6CA 4BZQA 1G3QA 1S2MA 4MITA 5M04A 4C0AC 3W8RA 3X1XA 3ZLJA 3PXGA 3ES9A 5EE9A 1COWA 4URZR 3UWKA 1UBGA 4NYJQ 5IT5A 3VR2A 1QG2A 4ILEA 1P73A 2HT6A 3QBTA 2E9SA 3NH9A 4LY6A 4OJKA 2PJZA 2DPXA 2ZRPA 2AHOA 4G5GA 1C4OA 3GJ8A 3NH6A 3RLFA 3BGWA 1QHSA 2NQ2C 5JCZA 3B2EA 1LFDB 3K0FB 2KWIA 4TMKA 3OIWA 1RJ9B 1NI3A 1KO1A 2R6AA 4R7ZA 2Z5FA 3CM0A 1HT1E 4Y0AA 4WW0A 5CIQA 3N70A 1F20A 1OGJA 2XSZD 4R71A 3AM1A 1NDHA 4YXWD 4DCVA 2XXAA 3A1SA 1NSTA 2V55B 1Q81D 2W58A 4JKYA 3MWLA 2IUTA 1OXXK 3MG9A 4RD0A 2LKCA 3BH6A 5F9HA 4QNMA 2QRZA 1PLKA 5DO9A 2AFHE 1OXTA 5TXGA 1CQXA 1NMYA 1JB9A 2GEDA 3TUZC 1T5IA 3ASYA 1KY3A 1BKDR 1X1RA 4D4KA 5JJLA 2R6FA 2YINC 1YVDA 1FQKA 3QF7A 1OKKD 1ZC4A 1HY3A 4QG7A 2VNHA 4B4DA 3OFND 3KQLA 4IOMA 4LHYA 4OHVA 3NXSA 2C78A 1EFRA 1SHKA 3L0PA 5J4KA 4C43A 1T4GA 3OIUA 4AG6A 1PUIA 3EIEA 2PIAA 4HZUB 1NF3A 1U8YA 3U3RA 1OIXA 5FL7A 2QY9A 4KBFA 2W83A 3W6PA 3BC1A 3H4MA 1Q86D 2OTJB 4M22A 5FTMA 1GL9B 3W5JA 1UEJA 3B85A 4MGZR 3FPKA 5JHHB 1E4YA 1YZTA 2WKQA 1W0KA 1SZPA 1JB1A 1Z0IA 1T9HA 1DAMA 1G8YA 1D5CA 2WWXA 3L82B 4W7SA 2IT1A 4BECA 2G77B 3PIRA 5IHPA 2EFCB 2GWHA 1Q3HA 5AN9A 4LC0A 1FMLA 2BV3A 4A6XA 2B7BA 3QEOA 4HAYA 1NG1A 1R5BA 2JCSA 1H8ED 2CRVA 2BDTA 1XTSA 2YV5A 4P33A 2F1HA 1MRSA 1P60A 4WZAE 5C1BA 3TIFA 1VYUA 2BJVA 1P5ZB 2FV8A 4L9WA 3RS0A 4CEIA 3T35A 4MUAA 3EA5A 2EQBA 1VKJA 5KNDA 2JLQA 2NO1A 4AC9A 2BKEA 3SJBA 3UIEA 1NNEA 3TSOA 3VHLB 1YJWB 2YC2C 3OAAD 4RCYA 3LX5A 3QXXA 1AM4D 2CHVA 5FBLB 3OZVA 1A4RA 1YZLA 2JLZA 5DN6D 4HUTA 1X1SA 1R5NA 4B6FA 1XXHA 4KFRA 2IWHA 1E1QA 4GMXA 3LWNA 3P4XA 4CRWB 4PC7A 3OJWA 2ECKA 1IY2A 1RRFA 3EC1A 4OI2A 4EJSB 2OV2A 2P2LA 5HKKA 1JR6A 4B74A 2AK2A 4Z1MD 2ZR9A 1M90D 1G41A 4M1KA 1VQ8B 1MV5A 2IF0A 4HLCA 1OYYA 2F6RA 2WBLC 4M4SA 1P3JA 1SXJE 4I4LA 3QF4B 3REFA 2O8EB 2AKYA 4ZDIA 4Q4LA 1OXSC 5P21A 4DT1B 1P7CA 5HCNA 1OHHA 2ZUBA 1JQLB 4KSBA 3QXCA 2Q9BA 5KHOC 3IEUA 5J4LA 4GFDA 3W5UA 3C4JA 5GV7A 2AK3A 3FPAA 5EE5B 3G4SB 3ONWA 4UXJA 3A36A 5EZ5A 3HU2A 3CH5A 1X8LA 1XRJA 4LPSA 2JASA 2OSBA 1QFYA 2B7CA 2QP4A 2R62A 3QXJA 4D26A 4FCTA 1KJZA 2IS1A 4U9UA 2V8OA 5AUOB 3GJ6A 1JI0A 2IHYA 3WMGA 5E95A 2C03A 4A4DA 4L8GA 1KI1A 1NN0A 3B9QA 1DADA 1XF9A 4FW9A 4LX0A 2VL7A 2A2ZA 3SFZA 2FZ4A 4DXAA 4EFNA 5K8IA 1Q21A 3JZAA 4PHGA 1E1RD 2O0KA 4FIDA 2XB4A 4C2UA 5EP3A 3TSZA 4D0LB 1AGRA 2D06A 4F38A 3KKQA 3NBXX 1N0VC 4R2HA 4KBGA 4Q4JA 1DG3A 4TLDA 3SI7A 2A3RA 4X8HA 3T15A 3JQQA 1DVRA 3IUYA 4GRAA 3B6EA 4AURA 4TYQA 3MWKA 4JVNA 1N25A 1HE8B 1OT3A 2IUUA 5EP2A 2NIPA 1OSNA 3HU3A 5EE3A 621PA 4IKEA 4DJTA 5K8LA 2GAAA 2REOA 4DSNA 3ZVLA 4DQLA 2PCLA 3NBZC 4AKEA 4RD1A 1W87A 3VR4A 2ZJZA 4CGZA 4KODA 2F7SA 4PO9A 4BPRA 5L3QA 3KXKA 2LCFA 3IIJA 4RKEA 2SHKA 5JSZB 2PLFA 2B8TA 4O25A 2JIZD 1F3OA 1XWIA 2ZU0C 3DOFA 3BH7A 3SE0A 3SHWA 1D1NA 3F0TA 4UNNA 3ZQJA 4IJMA 3J81k 4YAUA 4NYIQ 3K9NA 3WHKA 4BWYA 4DZZA 2ZEJA 4RVCA 1N5KA 2AWOA 4IDNA 1XPUA 2HXYA 2WICA 3L0SA 1AZTA 3FWYA 2HJVA 1W49A 3CZQA 3KZ1E 4WBSA 3VR1A 5F3WB 3OEED 3DEFA 3K09A 4LK2A 3T12A 1GITA 2HT1A 1QGZA 5JFGA 3REGA 3SU8A 2A7QA 1N6IA 4ZKDA 5LBIA 2JJ2D 4YDHB 3TBKA 1E9EA 2VHUA 4ZCMA 3M4YA 3SYLA 4EKDA 2WVJA 2VP5A 3CC2B 1YU9A 1ZINA 3D8BA 2OHFA 3S1AB 421PA 3K53A 1Z08A 1QBKC 2DFLA 2FSHA 5TVKA 1K5DA 4PAMA 3VO1A 4R98A 1E0KA 1H85A 1E94E 1SULA 3NHBA 4IFEA 3ZVNA 2XZOA 3GJ0A 3R7WA 4NTZA 4B44A 1AS2A 3KJEA 1KSJA 5AUNB 1DS6A 4Q1FA 4CEJA 3Q8XB 4W5HA 1Z6XA 2V9PA 3ADKA 3QVVA 2P5SA 3CRQA 3I92A 3QY0A 1RRCA 2J7KA 3KJGA 4C7OB 2FPMA 4IVPA 4QL3A 1I4DD 5KUTA 3RANA 1EP2B 2EWWA 2V3CC 3CWZA 3QVUA 1NN5A 3LA6A 2QT1A 3ZDQA 4NYMQ 1Z47A 4LYHA 2IYLD 2FGKA 4LBWA 2OZEA 3MWYW 4LV8B 2JLVA 1QUEA 3CX7A 2C9OA 1Q7YD 1XEFA 4LJ8A 2GPJA 1XEWX 4M1TA 1NJID 1KY2A 1EP1B 3QFSA 1XE1A 3IQWA 3PCRB 2C04A 4PQRA 5LDDC 1RVDA 1V43A 1T8TA 2FSFA 3CPHA 2YOHA 4DC9A 5KDOA 4JVMA 4RFSA 5FBWB 1KJYA 2R8RA 2FH5B 2GXSA 1E2JA 1J90A 1MO3A 3B13B 4V0MA 2CBZA 4B33A 3G0HA 1E96A 5LB2A 1FTNA 3EPJA 2OFWA 2OEPA 2DCUA 1E69A 1ELOA 2IHBA 2PMKA 1OIVA 3B78A 4FMBB 2PX0A 4M8NE 2R6GA 5GJWC 4F7WA 3AGPA 3MSXA 5L3VA 4DB4A 2G1KA 3C7KA 1DAFA 4B3BA 3I73A 3CB4A 3WNBA 4FXPA 1WBBA 2GZDA 4ZDKA 3WXMA 3I4LA 3X1ZA 1HT2E 3NTUA 1WF3A 5AJXA 3PR1A 3V4FA 4EQ6B 3I55B 4YDSA 4A0RA 3GJ7A 3W9YA 2C95A 2X2EA 3MFYA 2O8DB 2ODNA 3VX3A 4FD2A 5FBVB 1KI8A 4F93B 3THXA 1G5PA 1TX4B 3ZH9B 2HMAA 1CJTC 5H1YA 4PC6A 2FJUA 1E9BA 3CCLB 1G9XA 5DISB 4BEJA 2F3TA 3A1TA 4DEXA 1WRBA 2RKOA 2WOOA 1ZU5A 1XXHE 3L43A 4Q66C 4QBIA 2IA5A 3CONA 1N6OA 2ZI6A 1G4UR 3GMTA 521PA 2FPKA 5CYOA 1WE2A 1Q3TA 5G40A 2GEVA 1XPRA 1XDBA 3GD7A 4B47A 4JT4A 4M9QA 1MR3F 2WJJA 1E2KA 3A6PC 1WDTA 4M0LA 3RABA 2XJ4A 4ZIRA 1XTJA 2RGCA 1SXJB 1TQ6A 4TMZA 2ZE8A 4LCBA 4NU0A 1S96A 1KSFX 5JRJA 4DLZA 1YIJB 4POAA 2KB0A 4XWAA 1KSGA 3U3MA 3EASA 1S3GA 2EFEB 5FPSA 4QFMA 3DHWC 4PPQA 5AUQA 3K0AA 3IHLA 1M7BA 4ASUA 4K46A 3RC3A 3N2EA 1OFHA 1IXZA 4TZ0A 3O8CA 3OE7D 2BMEA 2FFHA 2GAOA 3HR8A 4X8LA 5C18A 4HLQB 4B3DA 5CITA 3QPUA 3T1QA 3TNFA 3VU9A 1QH0A 3AVXA 1YKSA 3P4YA 1RPZA 5KU1A 1P2VA 3AKEA 4BQSA 2PLRA 5TR9A 4FMDF 2C8VA 3T06B 1GRQA 2OILA 4AWXA 1ZP6A 4DRZA 4ZPXA 3CCMB 4DLXA 1OLOA 2VA8A 2X77A 3QIAA 2GCOA 3UMSA 2ZE7A 4NP6A 5FOSA 4E09A 2D62A 2H7VA 2VBCA 4NPHA 1YJNB 2C9YA 3V9PA 1CBUA 3GFPA 3BXZA 5FR1A 4B6EA 3K0CA 4RD6A 5GVSA 4ESVA 4W5WA 4E22A 1M6NA 1KHTA 4ZKEA 4XSGA 5FOUA 1KI6A 1EG7A 2HCBA 4TT3A 4A0HA 1TF5A 1W4RA 2ORVA 2WIAA 1XMJA 2ZVQX 1YR6A 2L0XA 4YMWA 1DAGA 1Z22A 2CHQA 2QMEA 2GBLC 4GT1A 5AJZA 5CIWA 2NPIA 5L3SB 1G17A 1AGPA 4LUCA 4M1WA 1YZQA 2BN4A 4PC2A 2WTUA 4FMDB 3KDSE 3LXXA 5CM9C 1W47A 3TUJC 4AG5A 3DOEA 5CB6A 5AUPB 4DCTA 2PT7A 2CK3A 3QKSA 3K0SA 4GL2A 1N6PA 1S4QA 2DHRA 3AVPA 4Q7KA 4DIEA 1E9AA 1OFUX 3D6TB 1FX0A 3CPJB 1G3MA 3NVAA 2EFGA 4NKRA 5D3MB 4OI1A 1WB9A 4P0TA 4OHXA 2NPFA 1A2KC 2PZFA 3KXIA 2CLDX 2AKAB 1TNDA 1IN8A 5F9FA 2AN9A 4LHWA 2CLCX 4EIWA 2V7QA 1ZIPA 1G64A 2ZSDA 5CDFA 1U0HC 3I8XA 2ZRFA 2IUSA 2QE7D 4B48A 2QZ4A 4DKXA 2ZE6A 2I1QA 3SEAA 4Q9IA 1E99A 2VSXA 2WPDD 3W6NA 4KJZA 3F5FA 3AH8A 1F2TA 4CDGA 5FOXA 3QKRA 1XCMA 4LHZA 4TMVA 2VF7A 5CK5A 3AP1A 1E0JA 2ORWA 1SHZA 3FMFA 1FNBA 4AK9A 4MKFA 1MKYA 2PT5A 1ODFA 1ZJ6A 3CRRA 2ZXUA 2HYIC 2F1RA 4V0KA 4D82A 4TQUS 4HI0E 3LLUA 3QJYA 1FMJA 1KNQA 4CYMA 1KKLA 3UG6A 1GNRA 2XXAB 2ZR0A 3LQRA 1US8A 3W5VA 1BJKA 2OESA 1X8JA 1YR8A 2ZROA 2WJYA 1R10A 4QXAA 5TV2A 3ZJYA 4NDZA 2ZSFA 4D81A 1DARA 3BAFA 1NG9A 2F43A 5TB5A 3TKLA 2YNMA 4TL7A 1YJ5A 4QHYA 2ZRNA 4BGDA 3NDBB 2ZI3A 1L7VC 1LNZA 4OI0A 1W4CA 1N3BA 4AYWA 4ACAA 3RS3A 2XNDD 5JMTA 4EPWA 3G6EB 4QHTA 3GLHA 3L0OA 2WV9A 5JWHA 1Y3AA 5KSPA 5CK4A 3CD6B 2ZI9A 4Y7CA 2J1LA 2Q6TA 5GV8A 1IY0A 4IW3B 3QENA 1P62B 1GKYA 1NMXA 3T34A 1M8PA 3W2HA 2J5XA 3PFIA 4L15A 3QFTA 2QL6A 1TEXA 4NCKA 4U5XA 1S0UA 4ZCLA 1XJQA 1IN7A 1Y63A 2P6RA 2NG1A 2VLIA 5DSZA 2RAPA 5EJEA 2D2FA 2KJQA 4MKHA 4V0ME 5C4GB 3AQ4A 2JJ1D 4TMXA 3LH5A 4XTCS 4L9SA 1XB2A 2A5YB 4UXIA 5FUVA 1BOFA 1XEXA 1Q12A 1KMHA 1GAQA 2QMUA 2HJGA 2F1JA 4TYNA 2WMNB 1WP9A 1Z0DA 4C2TA 2JLUA 2OM2A 4FCVA 3WYGA 1QHXA 3QG5A 4LJ5A 1Z0KA 4LJAA 4HE6A 3THYA 4DSOA 3ZBUA 3VFDA 1TMKA 2YWEA 3AP3A 4WZ6A 2G9NA 2P6NA 2WJGA 2DWQA 2PMDA 1Q1BA 2IYXA 5GADl 3RS5A 2WMOB 4CEIB 4QM7A 3OJXA 4GOJA 2V6IA 2BEKA 1XMSA 3U6BA 2BJWA 1TUIA 4PC3A 1J70A 2W0MA 3U3OA 4URXR 3FMPB 4WVFA 2OE2A 4IXNA 3LVRE 3NIBA 1P61B 3CF6R 4LJ9A 5H70A 1E79A 3DMDA 4KITB 1GM5A 3I3SR 5HZHA 3EZFA 1W2GA 1Z0JA 2QTZA 1JR3D 4KFTA 1CJVC 3AB3A 1KDTA 1UDXA 1ZM9A 2QI9C 1XXHB 1IXRC 221PA 1QHHA 2B5OA
chains in the Genus database with same CATH superfamily
2JJ8A 4X71A 1RAIA 4OOVA 5IH3A 1ACJA 5CVDA 2HSJA 5FBQB 4CM4B 4HRAA 5I9NA 4JJIA 2C7OA 1Q83A 4YCJA 4CF6A 1FXSA 4KXUA 1G2IA 3DF7A 1X1CA 3R4CA 1N3LA 1QNFA 4I2VA 4DZTA 3D6MA 3RK4A 3UUFA 3KU4A 1ZIOA 1ETHA 5CDSA 2NO4A 2IHZA 3SC6A 3I62A 4B4WA 1JE0A 1AGXA 4F8EA 3QWBA 3O93A 2WYVA 3AVTA 1IUNA 1J8YF 2CZCA 4OQZA 4PV7A 5C9ZA 3GPCA 2MSNA 1J22A 1NNLA 4BO0A 1A76A 1W0JD 2X1LA 2ZJ4A 2QYOA 4XEHA 4MP6A 3D8SA 5LFAA 3G5TA 3WGNA 2J5RA 1JLLA 1Z2AA 5K2OA 1I4LD 1J0BA 1ISFA 4CFZA 5K99A 3MJDA 2ILVA 5DULA 1GADO 2VJMA 5D5HA 5AHKA 3RNOA 4HO1X 2RONA 4DIMA 3IP9A 4EB3A 4JYBA 1J9GA 3A4LA 3MYYA 4WD3A 1C1DB 2UZAA 1EK2A 1D8AA 4ND5A 5EUMA 3WGMA 1MOZA 3WWEA 2J6HA 2VXOA 3K3PA 2QAGA 2FU5C 1MAWA 4X3PA 4HAIA 4Q1BA 3RC8A 1P2SA 4MUGA 4HMPA 2V4MA 4K05A 5GJCA 4P4UA 3LT1A 4Q24A 1ESNA 4Z8XA 1T3SA 2C3PA 4JLPA 4Y6RA 2BMAA 2Q3EA 1ADFA 1KI9A 3ZD7A 3KOZA 4EF6A 4ZVMA 2QRMA 3UMBA 2J3LA 3L0IB 1YI2B 1N5JA 1U9IC 4M83A 4EEZA 3ZHRA 1LLQA 3C97A 2IE0A 1RZRA 5I7VA 4ZI7B 1I3NA 5C8YA 1R9NA 1J8MF 3F3SA 1GUZA 3SQMA 1R6XA 4XJTA 2GXQA 4GIBA 1KBOA 2QPLA 4IOJA 4Q9LA 5CFQA 3PX7A 1NVFA 5CX4A 1NLFA 5KTKA 1DBPA 2ZUDA 1LW7A 1JQBA 3M1YA 4OL0A 4ZODA 4CIDA 4EJ0A 2K7FA 4KE8A 4I1OA 1KPIA 2D9RA 2QJTA 5EMMA 3TLAA 1EFHA 3A9SA 3ORRA 1BEUB 1RYFA 2HDWA 2TS1A 4YUAA 3UMMA 3N05A 2B1QA 3PE4A 1GRRA 1UD8A 1PDOA 2EKQA 4FOTA 4V3BA 2QA5A 3RFUA 4ZHQA 1SQ6A 1Z33A 3KHSA 3WWOA 4Q9HA 4E0BA 4LF9B 1VQOB 1U0EA 4I9HA 2XNCA 1MOPA 2IHVA 3IPRA 4KE7A 4DNRB 3KS9A 3GJ5A 1KY4A 5J40A 5JISA 4GUDA 2XBUA 3TXYA 5EZYA 2C54A 2CMKA 4Q7EA 2XI4A 5L3QB 2OBYA 1PR9A 2IZ7A 3RUIA 3G8YA 1L5QA 1OR8A 1XNJA 3R6GA 3WGHA 1TECE 2XKBA 1ZN9A 3RV4A 2Z56A 2HCJB 4A15A 1XU4A 2BGMA 1VPVA 3JYQA 3M5CA 3G7UA 4WXPA 5AKLA 3TQCA 5A0TA 3HUFA 5LD2B 3GIWA 1SVOA 2JFPA 5ALPA 5INTA 4M8KA 3CUEF 4JJFA 4XIFA 2Q3MA 1OIWA 2RGWA 1KK2A 1P9NA 4P53A 5DM2A 3WGGA 5BQ3A 4OX9Y 4IHJF 4JNKA 4RKYA 4X0CA 1KYTA 4BLPA 1W93A 2OMKA 1K27A 1CY6A 2P2CA 2VWPA 4J0FA 4Q3CA 3ZXXA 2ONJA 4EATA 4Z86A 2C1EA 3BDAA 3R1IA 4FS3A 2KW5A 2OPBA 2IV2X 4Z4HA 3PE3A 1QLHA 1I1NA 2W48A 3PJGA 4D25A 3D7MA 3OZSA 2GJRA 3PR2B 4DLAA 3UICA 2IS4A 4PPNA 3PD1A 3BRQA 4QPJC 4QOEA 1OXBB 1VJ5A 3DBHB 1VYVA 2ZQZA 3GVJA 2UVQA 4HX9A 5E4FA 2I6QA 1P4JA 3F71A 3HUEA 1WWKA 3DZKA 4KWTA 2EOAA 1D2MA 4NFYA 5DBHX 1E3LA 4YR9A 1CVIA 3FOAA 5TARA 1OTXA 1KE1A 1SUCA 1JYFA 3I4CA 1YOBA 2WQ6A 4XQ0A 3MJ4A 2OTCA 2J0UA 1XZIA 3AY3A 5BNIA 2IDMA 4QPNA 2B1IA 4KDRA 3VR6D 5DCWA 4CMIA 1RCTE 3SSAA 3F9CA 2SKCA 1Z63A 1JSZA 3CLSD 2WSSA 2R1TB 2QPOA 2VI5A 2QZSA 2YZKA 4CEHA 1J25A 2BUAA 4QUZA 4HSEA 1AIPA 5JH7B 1FUIA 2AQIA 1K7SN 4EITA 2ZR7A 2VBIA 1PCXA 2CJYA 2ZRQA 4KXFB 4B85A 1KJIA 4WUVA 3ETCA 3IIMA 5BV0A 5IZCA 4J1TA 2RGAA 4MR8B 4B3HA 1GR1A 5D86A 1Y5IA 2W7TA 2WUDA 5K6AA 1H1DA 1E3SA 1S9HA 3PFBA 1OBHA 1P1KA 2CXXA 2X5OA 1ZJWA 2BHRA 2I78A 1PP4A 4FU0A 5K3SA 1NLUA 5ICCA 1Z4OA 2NZYA 3PQDA 2JI4A 2PRIA 3CLSC 4ENQA 1OH5A 2ZUUA 1B8UA 2BEWB 2AC7A 3O8RA 1K9SA 5A4KA 4JT2A 1ORRA 4X5OA 1SQGA 2EX1A 4H4DA 3TD6A 4F3CA 3ZW7A 4YUYA 2J0QA 1XZPA 1RI4A 2NAPA 5FFNA 1EFPB 1X19A 1YZYA 3PQEA 3BHJA 3RGGA 4BVLA 5LZ5A 1I2CA 4AZ3A 4YCDA 1H9AA 2GAJA 4B7XA 5A9TA 4E2ZA 1HDZA 4UM9D 2GN9A 3FZNA 3HRKA 3P8ZA 4L3VA 3ANYB 1H4QA 4AIIA 3H1GA 5JZBA 4HDSA 1JIJA 2QV0A 4HDMA 4FK8A 3P97A 4GUAA 2CLOB 3CE9A 1N0UA 2KPOA 3IIEA 5BT8A 2RGBA 3K20A 2JIOA 2OZPA 2DY1A 5JV5A 1RC8A 3IUQA 4G26A 4GLOA 4MB0A 1E32A 2AQ8A 5DTJA 4KOEC 5AOAA 4B2LA 3AR5A 1FPMA 2ZIEA 5EWJA 3E3AA 1NSYA 4X8IA 3WLPA 3WYBA 1M5UA 4E1BA 2FX3A 3CEAA 1KFCB 1RQNA 1CUIA 2AEMA 4TWBA 4EJ2A 1WY7A 2XYRA 4UVEA 4YP7A 3H99A 2YWDA 4BBJA 5HDQA 3A31A 5B3KA 5JAMA 4D43A 2Z8YM 2HSGA 2MMGA 1YMQA 3REQB 4NZYA 1CQIB 4S05A 5KYYB 3QU7A 1U0RA 5AHWA 4X94A 1KXJA 1R9JA 4DWJA 2W6PA 2I7XA 3IB6A 3ZC3A 5SY6A 3W2GA 5T4EA 3T99A 4LW8A 1NE2A 1T9CA 4KJXA 4PCUA 4RY8A 3MOIA 2X8JB 3L0ZA 4YREA 3NKFA 2J7PD 5CT9A 2O2XA 4Y6SA 4CCYB 3SVLA 5I5GA 3KOYA 4LVCA 1VLJA 5K3DA 4GBED 1OOEA 5JI3E 2P8SA 2QRQA 1RYNA 3VV3A 3S2SA 3ST7A 3IQHX 4GOMD 1L4NA 2JCBA 4Q4AA 4YECA 4BFZA 5G4LA 1Z28A 4ZMBA 5A62A 1NXQA 5JCXA 4KLNA 3ROMA 4RF3A 4NNJA 2E89A 1HQCA 2KYRA 3SOZA 3TIGA 2CUZA 3DPUA 2A1UB 4OPOA 1BRMA 1W6UA 2MSCB 4LJ7A 1L3CA 3BREA 5FV4A 5TQ0B 2XNKA 1D1SA 2JBAB 3CX4A 2H1LA 4FMCF 4L8VA 1E4EA 4M7RA 4U2EA 5EJFA 3T0FA 2WHRA 4BC0A 1N2EA 4F5DA 3CPWB 1IYZA 1V37A 4MV5A 4QGFA 5JBNA 1DPFA 4LZZA 1E0AA 5J4YA 1EJ6A 3T61A 4WCFB 4FB5A 1L4EA 3GRAA 5JASA 2PV7A 3BZUA 1DJMA 3OFJA 4O4JA 3U9TA 1BCSB 1EDDA 5IM5A 2QTMA 3DOIA 3FIJA 1RYDA 3VU1A 4DLRA 3WX0A 2RE8A 1W2HA 3IR5A 3VU9B 2W2MA 4BZPA 5DTQA 4CJXA 2D2XA 4OB7A 4B3CA 4E5UA 2BZ0A 4UPDA 2VUHB 3LUAA 3N0TA 4P2BA 1EKXA 3MYRA 2WZBA 4KACA 4F9FA 3S7ZA 1AK2A 2CXUA 1O3YA 3F74A 4RIIA 4WA7A 3MTIA 3UOWA 3DUFA 3A1VA 3BVPA 3LC0A 4IOLA 4H7EA 5AW8A 5ALTA 1KU0A 2DOKA 4DYVA 5TPWA 3WAJA 1Q82D 5MN5A 3HYNA 2V03A 3P2JA 4QZVA 2BFWA 4YRLA 3W7AA 5KOHB 1GUAA 2HRZA 1O6BA 4LWOA 2FK8A 4R7GA 4ZPJA 3STYA 1NW3A 1GWNA 3YASA 1H0KA 5AR1A 2I3AA 4MVCA 3QRWA 2IH2A 4CZ2A 3IVGA 4R54A 3G3EA 4EG4A 5DHFA 1T15A 5K3FA 4GZ5A 2I22A 1JA0A 2XUDA 4Y1GA 1JG4A 1H1TA 2XDQA 2JF0A 3BIWA 4MPPA 1PQUA 2JFOA 2A9FA 2H5EA 4TM8A 4TVKA 5JI2E 1A72A 1SBTA 4AMGA 4ZCTA 4WOKA 4URWR 2RFLA 3BMOA 3R7AA 4IEIA 2A1TS 1R16A 2Q45A 4LMRA 4X1KB 4E1VA 4LXXA 1ULTA 4O2AA 5BRJA 1P2UA 1D5WA 3IS3A 4D3YA 4JBIA 2MINA 3H2ZA 4AMYA 4R8SA 1O8CA 2QSJA 2ISQA 3DOJA 2K2QB 1TVEA 4KPFC 1AQ6A 1ZW6A 2WF8A 4N4AA 5FADA 3R5FA 4DIOA 2O8CA 5BO5A 3N3AC 4BBAA 1JG3A 1RSZA 1W94A 3PXXA 2HLHA 3DC7A 1II9A 4R68A 2CK3D 5SZIA 4DG9A 3NTOA 2JLYA 3EPKA 3G88A 2QMQA 2B4YA 5JO0A 4MYRA 3C8MA 2MTBA 3F8WA 3TM4A 2CL5A 1LI5A 1SQ0A 3QVMA 1HDRA 2XMRA 4NX2A 3C15C 4O2BA 4YHHB 1POXA 8AT1A 3P9IA 1EYZA 5IAKA 3QE2A 3SC3A 4BZZA 2D3TA 3RBVA 1HC7A 3CEMA 3E3LA 3M7IA 2EFHB 3P0FA 5EY5B 2IUYA 2QM8A 5HUQA 2D5CA 1L8XA 1KC8D 1E20A 3EIOA 3BD8A 1JKFA 5IH7A 4DKJA 2O2YA 3A2MA 3UJAA 1NR7A 3GPIA 2XWJI 5I9BA 2C2HA 2FMUA 1IZ7A 4LKRA 16PKA 2R8YA 4MHSA 4BNXA 3ONNA 3FDIA 2GBIA 2UUOA 2DUNA 4C7JA 2FZVA 4DNQA 9GPBA 4OQMA 3D02A 5KTRA 3H2HA 3VNUA 3H6KA 3JS5A 1QAOA 1MCZA 2RK3A 3O3NB 3EW9A 2FEXA 2FWAA 1UF9A 2BLLA 1O96A 2OZLB 2XITA 4L0CA 3E84A 2F1LA 1JZSA 3HVKA 1SRRA 4YMHA 1XNHA 1W19A 3IMKA 4V0QA 1MZVA 2F3PA 3EIXA 5DNVA 4EPTA 3VO2A 1V5VA 1P0FA 2VXBA 4QREA 6Q21A 2C42A 2WFMA 4X7FA 3UGKA 2MSWA 4HVCA 4IO1A 3LO8A 3OQVA 2XMDA 4I1YA 1VE6A 4PQEA 4R8VA 3B3AA 1TZKA 1RWNA 2WABA 5BW8A 1BX0A 2I2DA 2F43B 5DV9A 4CU2A 4DILA 3PG5A 5K05A 4XVCA 3FRJA 4C4AA 2JGEA 4M0MA 4YMTA 2GN8A 3S4YA 2NW6A 4RUKA 4RK0A 2A9KA 4RWEA 2RC5A 3H8SA 3T7RA 3HHEA 1CZUA 1J2EA 1FBNA 1AT1A 1OZ0A 3KDAA 3DMGA 3PX2A 3IBGA 1V47A 3B6ZA 3HZRA 4OIFA 4PNEA 4G2TA 5B7QA 2PE5A 1Q0TA 3EULA 1CS0B 1NZJA 1T5EA 5HIAA 2D1RA 4IIDA 3WLQA 4YRMA 3FKQA 1Z38A 2GHIA 3T9EA 2ZG6A 4R1PA 3R8XA 3R5HA 2BHSA 3FCUB 2V7TA 5FWYB 1V5GA 4Y9RA 2ONZA 2VWHA 4UQPA 4LSZA 4C0WA 1LQ2A 7MDHA 3KZXA 2WB2A 2GA8A 1WHSB 1Y1TA 2VS1A 2OY0A 3TX2A 3WYEA 4L22A 3ZCVA 4FR0A 1QHIA 3K73O 2R8PA 4MB6A 2BE9A 1PK9A 2HLNA 3CLTD 4O4IA 3PUXA 2E1BA 2PX6A 4C88A 2HDOA 2XDWA 5I3ZA 1HF3A 3K8QA 4WBNA 5EHZA 1ZHFA 3A4NA 2ZETA 3EXIB 1XEXB 4A03A 4R0NA 4CG2A 2O59A 4QC2A 1JBKA 4DEVA 3B6KA 2H07A 4J8PA 1WUHS 5D1NA 2VZ0A 4G25A 5SZKB 3W8FA 1O94A 4JI6B 2VNJA 3I9NA 2GCIA 4JEHA 3V1TC 3IMCA 3R0ZA 3ETHA 1VKNA 3NT5A 4MR7B 3HJRA 3DMFA 1T1RA 5AI8A 5DEOA 3U3KA 2XKKA 1Z74A 1KQ3A 4DSZA 3THYB 4F91B 4CW7A 3U4GA 2ZRMA 5LPNA 2H1HA 1IUKA 1GGKA 1TZ2A 3CLTC 3DEAA 3PB3A 4RVGA 2VNAA 4YROA 3WA6A 3CVXA 3EJ6A 1Q14A 3N8HA 2YN4A 3AZPA 4M86A 3URKA 4EHIA 3Q7RA 1TB4A 1M33A 1TXGA 3O8QA 1VF7A 4Q48A 3CKKA 3EC7A 4H3VA 4DRXA 3ND9A 2VP4A 3OZBA 4PXAA 3RIYA 2QXYA 8ADHA 1FFGA 1X80A 3MPUA 1S3SA 1UD2A 1E2DA 2RGYA 2ZB4A 4Q6WA 1CR0A 1CJCA 1KZHA 3HWX1 2H2WA 1L5GB 3W0LB 3P0HA 5AM4A 3D4OA 3DE7X 3WYFA 1AHIA 2JHCA 2N46A 1AN9A 3DKKA 3IDAA 3FPFA 4EMUA 2FMIA 4YAGA 5B2EA 4BXOB 4GMDA 1QHHB 3JQPA 1YS4A 3SQWA 1W36B 3V32A 5CEFA 3ELDA 4IIJF 1KP2A 2VYVA 1U0GA 2WTXA 2XRYA 4IUCS 4P34A 4XEUA 3OEEA 4PTLA 3OLQA 3D3JA 3ACDA 3T52A 1E1KA 4X1YB 1YDHA 1DFIA 3ELUA 3OPMA 2CHUA 4OIMA 4O33A 3RS8A 2W2NA 3UMRA 3VPAA 1FQJA 1KJWA 2O8NA 2ZBGA 1DXQA 2AL7A 5B5SA 1LVGA 4PPGA 3RV3A 3GGOA 4C06A 4RTRA 2PUJA 1XX6A 1K3TA 5BN5A 2CUKA 1IWBB 4JWKA 4QEDA 5E4JA 3AVWA 4CETA 1VMKA 1K7YA 2OWEA 2DHQA 3A6EA 1UFVA 2UVPB 3ZD6A 1OXUA 1UBRS 5AKHA 5A7HA 1I18A 3OUZA 1DTWA 2ODWA 3AI1A 3HWSA 4HXGA 3RVMA 4LV5B 3SXUA 4A6DA 1BA2A 1NJGA 3KXDA 1H1LA 4HAVA 3EGCA 1U2EA 3WY9A 2QKYA 4OHBA 5FP0A 2NO0A 1L4KA 2BR3A 2V5VA 3AM4A 1P9OA 4J2HA 1C7IA 4RKFA 2JLXA 3E8XA 2GJ8A 3JWHA 1ZO8A 3AEXA 4UVHA 3T9CA 3WOVA 5HIMA 3FUCA 5C1DA 2RG7A 1DFHA 2FA9A 3CH6A 2H3EA 2YS7A 4N9WA 4ZVQA 3EZ7A 2WY2D 3VDXA 4HAXA 4V2UA 4BJHB 3GHYA 2Q2VA 1T1JA 1Z29A 5CLGA 4S35A 5AKXA 1GG2A 3OC0A 5EEGA 1C9JA 4O4HA 3UFXB 1S8AA 1F51E 2PUDA 1A9ZA 5JWOA 1ZBQA 4JJ7A 2IVZA 3H75A 1ZD3A 3DZFA 1P29A 4UMEA 2BYTA 3ZNOA 5CAEA 1TK2A 1R8XA 4HB2A 4GGOA 4OF4A 3MINA 4UVDA 3VR2D 3LBHA 1W8DA 2O8FA 4LRSB 4S2EA 4DDWA 4DV4B 2QJRA 3L6CA 1XU7A 4OQNA 4DIDA 1WZIA 5IJ0B 4HAWA 5JW6A 2WF6A 3TPCA 4BLOA 1J07A 2C2GA 3DDSA 4IDGA 3OMLA 4WNAB 1MT0A 2WUEA 4P4NA 3ZVRA 4UJ5A 4AWAA 3NC1C 2ZBPA 3PSAA 3RKUA 3W5AA 2FCAA 1P3DA 3WIBA 1DJPA 2OBMA 2NYUA 2PQ2A 4WLFA 3AKYA 3SDZA 1GUBA 2VPTA 2VP6A 3D0RA 1A8UA 2OZKA 3C3MA 3DCJA 2I2XB 2XXBA 4L85A 3TLBA 1PFGA 3EARA 3FCEA 4KO4S 1PNTA 4HH4A 3KEMA 5THQA 5IEJA 3VHRA 1U4SA 1OLSB 2A0WA 4M0FA 1QJ4A 1LF5A 1DG1G 3FVVA 1PFUA 3L40A 3C1TA 4MW7A 5JJCA 1M72A 1S2IA 1U3WA 2I6GA 2A94A 4DHEA 4M60A 3MBIA 2X8LA 3P9PA 4XQCA 1JN0A 1XHEA 4RM2A 3WYAA 5FTWA 3UCFA 1Z5WA 1DP4A 4J9VA 4WFKA 4A92A 2J59A 4WKNA 2C2KA 1LNQA 4QULA 1JEYA 5IHXA 3IODA 2BBWA 4BB0A 1CK4A 4P98A 3AIIA 4R6WA 1W4AA 2C4HA 3G2OA 1OBOA 1YB6A 3OQMA 1XA4A 5ALYA 3TBHA 5HQ3A 1NF9A 3C6MA 4RV9A 3EY4A 4CI0B 1TM7E 5DI3A 5BPFA 1O95D 3H5VA 4XFDA 2GILA 5DSTA 5CFMA 4JI8B 3C98A 3P5BA 4OD0A 1KMMA 2XKAA 4KU4A 3U4QA 3MILA 1F4PA 1O8BA 4IKPA 1GAWA 4IIYA 4XDZA 4YCBA 1R0YA 3VZQA 5KOJB 3QJGA 3MVEA 3FPBA 4XQEA 3D31A 1GA4A 1TC1A 3TWOA 3FX2A 2X5JO 3NUQA 2BEVA 2ZB2A 4LK3A 3V8MA 4F9TA 4C7KA 1E64A 1CPYA 5JBQA 1IBLB 2QMHA 3MJRA 1ZUHA 4MLZA 5B2ZA 3UQZA 4F4JA 5M2QA 1DNPA 5ALKA 1CY4A 1NQAO 2QUBA 2EKLA 4MUNA 3VI3B 1EUZA 4EPRA 5ENZA 4PABA 1O95C 4DCSA 1PV4A 4PSKA 1LSSA 1U1FA 5E6RA 3MQ2A 1LTQA 1RJGA 3DZDA 4I14A 1IXKA 3BGVA 4L78A 2IIVA 1RRVA 1SVNA 2WU1A 3AEZA 1P5RA 4BQIA 3LZ6A 1HLPA 3WWDA 4HX5A 3B3GA 4HOYA 2WHQA 4JELA 1SPBS 2PYDA 5KNDD 2YBDA 4CCSA 3ZCQA 3SBDA 4UTOA 1ODKA 2IOFA 5ED4A 1HQDA 3IYLW 3LL7A 4QUJA 1Z4QA 2XADA 3QPDA 1TM3E 2QG6A 4YMVA 1NBWB 1UC5B 4LYDA 2MHCA 1T13A 2IXEA 3DKIA 1K97A 3EB9A 3LV8A 4R1TA 4EMTA 1B6RA 1JAHA 4XX1A 5FUXA 4L4XA 2YDXA 3L92A 2AN5A 1Z5OA 2NU9A 1VMDA 3MFQA 4IMIB 4MV8A 4MWZA 1Y3HA 5DASA 5AVKA 4FKBA 1KQPA 2BAGA 3HDTA 1R2QA 3F3YA 5FPQA 3K92A 1OF1A 3LRTA 4EHBA 5DRYA 2DBYA 3GLFE 4PYQA 2Q07A 4REQA 1P7YA 4JJKA 1U8AA 3BN3A 4NJMA 1PG0A 3HXTA 4B17A 4U6NA 3JWIA 3BY2A 4EUKA 1IUPA 2WVAA 4NYIR 4AKTA 2Q6LA 3BJMA 4HFJA 1JH9A 3M2PA 4CQJA 1P74A 4MULA 1CEEA 5TPZD 3Q15C 2IWRA 3ZKWA 1X2BA 1OHHD 4ZICA 5IK2A 1AMNA 2HHHB 1ZZEA 3MT8A 4NS4A 3LCCA 2UV8A 3H6HA 2X0DA 3U39A 4E94A 5LZ9A 1QR6A 4OHPA 1RYHA 5LZ7A 2PL3A 3RT9A 3ZWWA 1QCZA 1KBQA 2QORA 5B58T 3BBLA 3R6KA 3RSFA 1IOWA 5THKA 4A0QA 3FWPA 4CQMB 4RTPA 1UOEA 5L3RA 3A1UA 5TQVA 1G9TA 3HJHA 2DEUA 3MGKA 1U4OA 3IAS1 3NG1A 2EGHA 3Q41A 2I1LA 3BH0A 4XYMA 2Y2UA 4MVJH 4TV8F 4RCZA 4DEYA 2R79A 3UT0A 2P9HA 2OGZA 1C8LA 4OMCA 2GZAA 3PHJA 3RVBA 4BNHA 1R3UA 4BTEA 4DCJA 4FQ8A 2IIQA 1NYTA 3NEYA 4ND8B 2OGSA 1DO0A 3EAFA 4Q05A 3FVRA 4ZN6A 3O8BA 2ZXIA 1WCIB 4D3SA 4H9GA 2PBRA 3NBFA 1Y5MA 1IG0A 3QGMA 4W6ZA 5JMOA 3I61A 2ZJ3A 3PU6A 4MO9A 3T3OA 3I2GA 2ORED 4PRYA 5H3LA 5J47A 1JHYA 1FP7A 1Q3KA 1XBTA 3JZFA 2Q3FA 1LTHR 5F2OA 4TMTA 1P75A 1G66A 2GFHA 3GRZA 4KAXA 2FFBA 1KTVA 2JGJA 4AYXA 3SK0A 2F1OA 4NYMR 1SBQA 1QMGA 1KI7A 4KQEA 3DS8A 1KQOA 1PGPA 2XW6A 4PGFA 5JPCA 3G5MA 1M34A 3GOQA 2ZS8A 4HXEB 3RYHB 2OO3A 1CIPA 1TU4A 4AUKA 2Q62A 3V8VA 2YWBA 4OGKA 5DNAA 4C01A 3O26A 4CMAA 1XLVA 3ZJ4A 3H2JA 3DDHA 3CQ9A 3D8NA 3FCCA 3GLUA 3LPCA 2X0EA 5I9LA 3BB1A 4KQGA 2B3TA 1Z4PX 3SOPA 3GQBA 3M4NA 2PU7A 4A27A 4JQYA 1G60A 1WMSA 4X84A 1NC1A 2FSSA 3RHZA 1AUXA 3PLNA 1BJRE 3AONB 2Q6IA 5JAZA 2AZTA 4DR7B 1CY8A 3NEPX 1JDBB 4NL4H 4B76A 4ER0A 1N2GA 1KBZA 1Z06A 4GR9A 1NXVA 4UW9A 5EXPA 2AD1A 3P2IA 4XOPA 2G8NA 3OTHA 4RYDA 4KPUB 5FTKA 3CUTA 3TLGB 5C8VA 3NU1A 2I33A 2H57A 1G291 2EDAA 2JI7A 1BEZA 3CRMA 3CF4A 1V8FA 3E1KA 4G0QA 4GZ6A 5M3BA 4EKYA 1VIMA 5KSOA 3D3WB 4DARA 4WY8A 5K8TA 2ATVA 3DXFA 4PFQA 2XNDA 1SVMA 1ZGAA 1ZRMA 5HJEA 1QE3A 3A06A 1YC2A 3BDIA 4RMJA 1G38A 4U2BA 2P2SA 3DCYA 4GGMX 5FA8A 1UP7A 5REQA 2XF2A 3B5JA 3ICCA 1NVKA 1G8GA 1U0LA 2V6GA 3KQTA 1XV5A 4B8WA 5KSZA 2OB2A 5B58C 3RYCA 4ALLA 5FTLA 2YXEA 1WMBA 4JI3B 4E5SA 4G9EA 3H05A 3I3OA 1TU3A 1FNCA 1MA3A 5JNTA 3MCWA 1JHVA 2FQ1A 3GNSA 3WMFA 4RTSA 2WTEA 3S2YA 3DW1X 4UZSA 4ZDWA 1RYZA 4J3NA 1JHDA 1AKTA 2UYOA 4J2TA 2BGTA 3FTEA 1AG9A 4N7RA 3RIXA 4BNVA 5I45A 2L82A 1BQEA 4YH1A 4Q39A 2ORYA 2W2QA 3UJ8A 1IB6A 4E5KA 1RS0A 2LD4A 1R15A 4TTTS 1ZH4A 4OYHA 3WKBA 8ATCA 4KLRA 3INTA 1WL8A 4UCQA 2O8BA 1EUCA 3IKVA 3LDUA 3S81A 4D92A 2QYTA 3BQ9A 3GLHE 1XHFA 2IU3A 2AA3A 1E6CA 4PIVA 1HE1C 1ST3A 5FBKA 5C2JB 4J4BA 3FZQA 3M8KA 3M9WA 1EFVA 1JJ7A 5ALJA 5HM8A 3BXXA 4K6KA 5EKDA 3IXQA 2NSDA 1JBQA 7REQA 3DTTA 1VL5A 4QTYA 4EB6A 4PHHA 1IB0A 5KDLA 9ATCA 4JUIA 4HK4A 1TCCA 3KL2A 2DRIA 5HP4A 2CNOA 2YVQA 1IRXA 2JFHA 3HI4A 2OLJA 5J5VA 2QL7A 3SWWA 4CXMA 4OHWA 1NQXA 1M6YA 3PQCA 4FEYA 1T0IA 2O3SA 4XLFA 4XM3A 2C5GA 2QTNA 1B6TA 2ZUWA 2WHPA 3AVVA 3CVOA 2DBRA 4GPBA 4XLZA 5FOWA 1L5SA 5LBTA 2H0RA 1DAKA 3WRYC 4R01A 1N5MA 1NZDA 2C1XA 2ZBFA 5T8KC 3SQLA 1U1EA 3QFFA 1JP7A 4OI4A 4P4SB 5DGHA 3SIPA 3VC7A 1LBHA 3ZWCA 1OI7A 2X85A 5BW4A 2I2FA 2I2WA 4ER6A 4AI6A 4Y2UA 2BFBA 4ZOCA 3H8WA 4F6CA 2J0SA 3EOAI 4B8YA 5LP6C 5A2QA 4HNAB 4U6SA 3G7NA 4AX8A 4IX1A 2XPCA 3I9JA 1FYXA 1QCCA 1XDSA 5HKAA 2CCGA 2YVLA 2YRWA 5DHAA 3LQ4A 1L8LA 3HGTA 1RXUA 1S7CA 1UBJS 3EWAA 4D80A 1JPJA 4YJGA 1Z34A 3NXKA 4QRDA 2VNIA 3K4HA 4EFMA 2ZT6A 1U5AA 4JLMA 4R9SA 4PAOA 3NBKA 3NB0A 3QTTA 5IKXA 4FX2A 3LC2O 4J0HA 3QPVA 4EYQA 3N8IA 2X4DA 3NTRA 5DU2A 1WU8A 1PFKA 1YBAA 3MUOA 5LA6B 1S72B 2CJWA 1W8IA 2R2AA 4MAFA 4FDLA 4MV0A 4ZOLF 1S01A 2P3MA 5J1SB 3NYWA 1J4AA 5KMGA 2X2PA 3PP8A 4QGGA 4BCBA 4C89A 1RQXA 2A57A 2B9VA 4MNTA 4WJZA 4HDNA 4YYZA 4TS1A 3C24A 1PQWA 3IE1A 4IJKA 4LS3A 2OYRA 1U2GA 2ZK7A 4EG3A 1QG0A 1K7CA 4OG2A 4D0NA 1BKYA 3QLTA 4I55B 1XEWY 5LIRA 3DNPA 1RAGA 4A0SA 2ZZMA 1DQYA 3T95A 1KKUA 5EMLA 4G1VA 2X0FA 1RJ9A 2FLWA 4U7FA 1Z8NA 1HEUA 3CNBA 1MO4A 2ATIA 3RVKA 3TH5A 3I83A 3KV1A 3LZCA 4RGYA 3ZZTA 3H1PA 3UV7A 4XQ9A 1P7PA 4ASUD 2IYUA 4KR0A 2GBFA 3KV3O 1I2BA 1BE1A 1K9VF 4KYIB 5FQOA 3D7SA 1GAXA 1RM3A 2I4TA 3WBKA 4BFYA 1NUUA 3DMTA 1XCPA 5LP6B 3EVTA 1UBLS 5CP8A 1O97D 1ZA1A 1XP5A 2CXQA 3A3GA 4GECA 2J5KA 3AHFA 3QWIA 4NEQA 2PRYA 5AXBA 3SZOA 1W88A 5EQJB 4A5OA 4BGIA 4CM9D 5BV1A 3N9IA 3V7NA 4RD2A 4IQFA 5AXAA 4BVAA 2B6HA 1VLMA 2D4AA 4D9MA 1WTHD 1K2WA 3A28A 1LB1B 1Y3BE 3IKJA 5KPJA 1GGNA 3A7DA 2JBHA 1F7UA 4P5PA 3SZRA 1RP1A 1KDPA 4A36A 3DYIA 2ZJBA 4J4HA 4DIKA 2ZRGA 1L7OA 2PUGA 1TM2A 4FE3A 3TAHA 2BBOA 3AW9A 3NNNA 4FYIA 3K0EA 3RCBA 1QF6A 3MLBA 2HUPA 5EJ4A 2AOXA 2PS3A 1O97C 2QN9A 2Y1GA 2X8BA 3NETA 4GPEA 3SJCA 5B1SA 2BCEA 3UAXA 4ZVSA 3E4DA 3FF1A 3TZ6A 4CT5A 4G0MA 2GAIA 5EZQA 4ESHA 1KEWA 2WWTA 3PENA 1M0TA 2WW8A 1IHOA 3EZ9A 1LA2A 2JCXA 1N05A 2RGNA 4GM4A 1F2VA 3TG2A 1EB9A 4G9GA 1T8WA 1OU0A 3L7YA 1TAQA 1I7DA 1P2BA 3E03A 1C80A 1UBHS 4B3GA 1Q0RA 1Y7HA 1NDQA 1Z5VA 2QLTA 3FBWA 5TEVA 1P2FA 4E5DA 2VJNA 1ZH8A 3BFJA 4M9XA 3F4KA 3QWFA 3U5ZB 1P8JA 1PX2A 2JB9A 3ESXA 1NQWA 1KGSA 3PUYA 2B4TO 1ZUIA 4R1QA 2QSZA 1YKGA 4BO9A 2PUAA 3ZBPA 1Y6RA 3FFAA 4BAUA 1MORA 4ZI3A 1IJFA 1GTSA 6YASA 5LYJB 2Z58A 1OBCA 3GUVA 4MA4A 3FLEA 3OFKA 3PUNA 1O5TA 2O2SA 2YJGA 4ME6A 1JIUA 2OP0A 3B9PA 3CBGA 3H2BA 2JNWA 4WKPA 3TLJA 1G1AA 1E7YA 2FW1A 4TLCA 2I03A 1SN7A 4AF7A 2AFHB 3VKGA 1CZNA 2ZIUB 4B9EA 3EMKA 2GSDA 4XE5A 1MO6A 4OKIA 5KJEA 4E31A 5M7EA 3PHCA 1YS7A 3JZDA 1SCAA 4HQKA 5BSYA 4L28A 4LYFA 4KQ6A 4NULA 1SO8A 4Q82A 1BC5A 1Z2EA 4TMFA 3WGUA 4F9EA 2GT1A 2QDXA 1VMEA 3GVIA 3K1AA 1GTG1 1E98A 2BFEB 4EKEA 1P9RA 4BWFB 4LF7B 3TIVA 4CF7A 3ERCA 1N1DA 3GZ4A 1ZMXA 3G59A 4TUYF 4F5EA 3H9CA 3O47A 3NEAA 3BPSA 3WKCA 3H7AA 4EJSA 2CB0A 1TQ2A 4LQDA 4NBLA 4NENB 4AY5A 4TTJA 3UH1A 2GM5A 5CLIA 4UEWA 1HEYA 1Q50A