2PLFA

The structure of aif2gamma subunit from the archaeon sulfolobus solfataricus in the nucleotide-free form.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into the Interactions of the Translation Initiation Factor 2 from Archaea with Guanine Nucleotides and Initiator tRNA.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 87
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2plfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2plfA01
4P4TA 1Q3HA 3AKYA 2ZYWX 1YR9A 4L16A 3TR0A 1E0JA 5L3RA 2OAQ1 4CYMA 3LXXA 5HE9A 2A2ZA 3IHLA 1ZIOA 2WMNB 5IT5A 1ZAKA 2EVWX 1GNPA 4JVNA 4HUQA 1M8PA 4TL9A 2WTUA 2IS2A 2QBYB 4TLBA 4C0LA 4GRAA 1OYWA 4O0MA 4Z54A 3FKQA 3NC0C 421PA 1E98A 2ECKA 2E1RA 3CWQA 3QXCA 3ZVRA 5JWRA 1XPRA 3CONA 4HAVA 1DO0A 1KDRA 2C77A 2JJ2D 3Q8XB 3O8RA 1FNCA 2OCAA 4TYYA 3GJ4A 1OYYA 1G8GA 1G8PA 3EZ2A 3OZVA 4QM7A 1VQLB 1FUKA 2RHMA 3QE0A 1Y3AA 2VHCA 5A5GA 3E1SA 1MKYA 5JRJA 1DVRA 2NQ2C 1E2PA 1Z2AA 3Q5EA 5JHGB 4B76A 4DLWA 1BIFA 2A7QA 2QP4A 3A36A 1Q44A 4KO8A 1QG0A 4LGMA 4HE5A 2NMVA 1A4RA 2FGKA 5ELXA 4G5GA 3J81k 3VKWA 3KKNA 3A6PC 1M7HA 3B9QA 1UAAA 1VECA 3OIYA 2VF8A 2WWIA 4NYJQ 1SVIA 4MUAA 2QT0A 5CJ2A 1X8KA 4B3FX 1G64A 1P2SA 2GXSA 3W2HA 3SS8A 1W36D 4WZ6A 4JSYA 4BASA 1Z6XA 2ZITA 4V0KA 5EUMA 3TUIC 4LPSA 3CH4B 1ZRHA 4KYIB 1GUAA 1XP8A 4FMDF 4BE7B 2PMKA 4MKIA 5BQ5A 2EU8A 3X1XA 4LV6A 5CK4A 4MGIR 2ZRKA 3KFXA 1KC8D 3OEED 2A5FA 5G3ZA 2G88A 1YU9A 2JAQA 2IUTA 1MO4A 4UXJA 2XZPA 1IOZA 1KZGB 2ZREA 1YR6A 2E87A 1DDIA 2YJTD 2IXFA 4XWAA 2Q21A 1XZPA 721PA 4PHFA 3CRZA 2BMWA 1QGYA 3T35A 5IHPA 3IHWA 5JI2E 1MH1A 2WPDA 4AYWA 3W5JA 2WSMA 3ZYCA 3TJZA 3VR5A 1GL6A 3KXIA 3DM5A 3R8CA 4C2TA 2H8KA 1YVDA 3QQ5A 1DAIA 1ZJ6A 3AVTA 2PH1A 3FTQA 1FTSA 3KTAB 3FPKA 2CK3D 4DB4A 3U3RA 4N1AA 4TLCA 4RJLA 5FUXA 2ZYVX 1AGPA 1M74A 2GK6A 4OK6A 1MV5A 1ZIPA 2VO1A 2XITA 1G7RA 3IEVA 3WY9A 2XTZA 2P67A 1VG1A 5JBQA 3MSXA 4HAWA 3CH5A 5EZ5A 4LJYA 3CPWB 5FA6A 1PUIA 1WXQA 4LYHA 4BLPA 4C0QC 3WBKA 2EW1A 1XXHA 3QJYA 5AJWA 4PPGA 3EXAA 2FJUA 1XMJA 2CLCX 2LKDA 4YLGA 4AI6A 2EFGA 1NVVR 2R6FA 3FHCB 2RKOA 1GM5A 4P31A 4TYQA 4AK9A 2RC6A 4KV9A 3HU2A 2FZLA 3SI7A 1N6IA 3JVUA 4GFDA 1MRSA 1XNJA 1XB2A 4B4DA 4R98A 2CEAA 1XX6A 2FPKA 3K0AB 4DCTA 4DSOA 1J70A 3G82C 4PC7A 2IW3A 1I4DD 3KFVA 5CYPA 5EE9A 1P9NA 4QHTA 5HPYB 3H84A 3QFCA 4LV8B 1CKEA 4NP6A 3TK1A 5FTLA 3F3YA 2YINC 1P62B 2YWEA 3AUYA 1NBME 5DNYB 2D2FA 4WQMA 2QI9C 4TLAA 1GKIA 2J59A 2IL1A 2Q3MA 1S3GA 2D4HA 2BVNA 2IYLD 3MJRA 1E1QD 2IX3A 3SYNA 5JECA 1I7PA 4RD6A 2GCNA 2BM1A 2VNJA 1N6HA 2ATXA 2IYTA 1W4BA 2A5JA 2PX0A 2VP6A 4MRNA 4NHOA 4ESVA 2R6HA 4FWIB 3NBXX 3SJZA 4OQMA 2J0UB 1UKYA 3UK6A 5EE0A 3NDBB 4JLJA 1CJTC 1NIJA 1QF9A 1T9HA 2RGNC 2G1JA 5G3YA 4LJ6A 2KJQA 4Q9IA 1YJWB 3GEIA 1X1RA 2VEDA 3OIUA 3SEAA 1Q21A 2CNWD 2UZ3A 2XJ9A 2WVJA 2QENA 5JEDA 4PZYA 4MYTA 1TF7A 1CR4A 4D26A 4KU4A 1OXXK 1WBDA 2BEKA 3QF4A 4LJ8A 3NBZC 2GEVA 4DLUA 5HZHA 4FW9A 4WXPA 1UDXA 2ZI9A 1GAWA 4OK3A 4W5JA 4DKXA 4Z51A 4KVAA 4ESHA 2NO1A 2YWFA 2NPFA 4EFLA 4Q1DA 4TQAA 3OJWA 3HDTA 3CB4A 1TQ2A 2OE2A 3FYHA 1QHHA 3ZJYA 3C41J 4JLMA 5JS7A 1KI8A 4DLYA 3QXHA 1E1RA 1E9BA 4B3GA 2V1UA 1J7KA 3EASA 2GZDA 3W2GA 3OESA 2JDID 4FMBB 4IDNA 3NH6A 4YMSA 821PA 2O8EB 1Z2CA 4QBGB 5GJWC 2BGIA 4RY2A 1GVNB 2XTMA 1IQPA 1G21E 4D4MA 2QEXB 3KQHA 3IIMA 5EJEA 3BOSA 3CRVA 3CX6A 2IS4A 1YZLA 1DTSA 3B5JA 3CR7A 4GOKA 3SNHA 2XXAB 1ZCBA 4XSGA 1Q86D 2B92A 5LB2A 1YZKA 2BJWA 2W2TA 1CU1A 3IIJA 4Q4AB 1Z83A 3IDQA 2EFCB 3ADKA 1A1VA 1E2QA 3CD6B 5CB8A 2HCJB 4AIIA 1UEJA 3BC1A 4TMVA 2PBRA 1Z6TA 4EIWA 1VYTA 4Q1AA 2BPOA 3THXA 4PPFA 1VCOA 2Q6TA 3LQRA 4P6VF 2VHTA 1ZM3A 2ERXA 3LVBA 3O8DA 4W7SA 2ZAMA 1G3MA 1KDOA 1JXMA 3PFIA 3QNUA 4XSHA 4BUJA 1XU4A 4JLKA 4LHYA 3VU9B 3EW9A 1G4UR 4BPBA 1FDRA 1G19A 4MRVA 4OQNA 2VRWA 3RANA 2IK8A 1CBUA 4PHTA 2OFOA 3SU8A 5B58C 1XPUA 2MSEB 2D06A 3QENA 3A8TA 3EARA 1KGDA 2AKYA 5FOUA 4YAWA 1F2TA 1VCIA 2QM7A 2XNDA 1IXRC 3EIQA 3K9LA 3H2YA 1MO6A 1G5RA 1I2DA 1U99A 2ZSAA 1M90D 1JALA 2CDNA 1W5TA 1Q82D 1Z0FA 3ZQ6A 3GLGB 1XEWX 1UF9A 3VO2A 2CE2X 1W0KA 4OL0A 4KVGA 3ZD7A 4HLCA 3FMPB 2ORIA 3GJ8A 4UXIA 5HCIA 3RYTC 4B6FA 1T0JB 2QU8A 2OCBA 1NN5A 1ANKA 4DUGA 3CNNA 4B2LA 2NO0A 3CBQA 1H42A 4W5WA 1Q12A 2YV5A 5C4GB 1EFUA 1IHUA 2XTNA 2ZJAA 4MKFA 1GO2A 3EZ7A 2CLSA 2E9SA 4YXWA 2BJVA 2FPMA 4D0LB 2GDJA 1YZTA 2DFKB 4BFUA 4JZKA 2OO7A 4OI2A 1NVUQ 1OIWA 4QJ3A 1HT2E 1CNFA 3D6TB 2VF7A 4ARZB 4RD4A 1JI0A 3QG5A 4FCVA 2GBLA 3OEHD 1P3JA 4IDOA 3AVPA 3IGFA 5J40A 3GLHA 4E07A 4URVR 1E6CA 1FNDA 2RGNA 4P4SB 3SC3A 2IEZA 4EQ6A 2WWYA 1SKYB 3A37A 4OHWA 5FTNA 2B8TA 1DAEA 4KJZA 2ZRGA 2BF4A 4QRHA 1A2KC 3PV0A 1KK0A 1YRAA 4PAMA 4C30A 3QFSA 2OILA 4YMWA 4GDFA 4NCHA 1VIAA 2BV3A 1Z8FA 1IN4A 1AIPA 5KPJA 2HDNB 3WHLA 1EWYA 1N25A 4KFSA 4F7WA 1E2MA 1KI9A 3P26A 2FV8A 1SULA 4JJZA 4A6XA 3AKCA 4K1XA 2BMFA 2F1JA 3SHWA 3KQUA 1KI3A 4TT3A 1G3IA 3LDAA 5FUYA 3M4YA 3F0TA 1GKYA 1W44A 3CCRB 1AK2A 2QDXA 2P6NA 1OXUA 3QUSA 4JYCA 2GJSA 1SXJA 4QGHA 3DKVA 5C18A 5DI3B 3AVYA 4FMCB 2QPOA 2O0KA 5HXBA 2DEUA 1E99A 3B85A 3ZQJA 1E63A 3RSLA 4XH9B 1NMXA 1ZM7A 4LK2A 1JAHA 5KDLA 2VLIA 2YC2C 1ELOA 2FU5C 1QX4A 4ZCIA 1QVFB 1AZTA 5EE5B 1J8MF 4KFTA 2JJ8A 1BYIA 1CJUC 5DYIA 1E64A 1JECA 4OI4A 2IYWA 2ZS7A 1E3MA 5TB5A 3GFOA 3QIAA 2QNRA 3V4FA 3AVOA 4MITA 2JGNA 5AR1A 3A1TA 1WF3A 5JLJA 4S2EA 1GILA 4Q48A 3U3MA 2DYKA 2IHYA 4UKDA 3CCUB 1H8EA 2J3EA 1DE0A 1II8A 3CZPA 2IWRA 1Z22A 4V0MA 2KBEA 4NYMR 3AVQA 1Z63A 1KY3A 3IILA 2HEIA 1E2JA 1S2MA 3K70B 1XF9A 4H9GA 1LNZA 4A0FA 2W6JA 3CCSB 4PGOA 1DPFA 3B1VA 4ZO4A 2J7PA 1TX4B 3WHKA 4MGKR 1XMIA 1KI4A 4FINA 1PJRA 1DDGA 4POAA 2IWHA 3FFAA 3PEWA 1EX6A 5BN5A 1H85A 2NO9A 2XOKD 2WJJA 1NMYA 1JJ7A 1QFZA 2RAPA 3CR8A 2JLQA 5CITA 2W6IA 1KIMA 4R9UC 2J5XA 4GT1A 1Q1QA 4R2IA 1M6NA 3GJ5A 2WKRA 4CZ2A 1TF5A 5TV2A 5TDHA 1CS4C 2J41A 1ZYUA 2FH5B 4C0AC 1XZQA 2WV9A 4PTLA 2CL0X 3AF0A 3DKPA 4LC1A 1NBMA 2QTZA 4DT1B 2J87A 4HLDA 1AJEA 2GVZC 3QPUA 2WAYA 1XEXA 4M8NE 2UVQA 2C95A 3NHBA 3P4YA 2A78A 3RC3A 4V0OA 4KODA 1ZD9A 3QKUA 3TUZC 3LA6A 2OUKA 4JLDA 4LJ9A 1MRNA 2DCUA 3SFZA 2FE4A 4BFSA 4ZV4A 2CJWA 2ASEA 2F9MA 1T8UA 1ZNYA 2NTYC 3TSZA 1TAGA 4C4PA 1KO1A 4KLZA 4M1OA 3MD0A 1KY2A 2IYYA 1XTQA 4F38A 4GMDA 1E94E 5E95A 3QBTA 5J4YA 4AC9A 3R9XA 1DG3A 1FX0A 3IPXA 3UWKA 1MABA 2V6JA 2FFQA 4URWR 5F2EA 1BYUA 3RLFA 2HLDA 1AM4D 2EFHB 3QBVA 2RGBA 2ZR0A 1AS0A 1G8HA 3PVSA 4HEJA 1SXJC 4QNRA 3THWB 3BWDD 3AF3A 2RGAA 3VQTA 3SBDA 1T91A 2JDIA 3VR6A 3G0HA 5J47A 1OH7A 4QBFA 2WJGA 4HAXA 4R2HA 5HZKA 2ZIAA 4RD1A 5E7MA 1KD1D 3K70D 3LLUA 4B2IA 1Z0DA 2FEOA 1R8QA 2A9KA 4ABYA 5TMPA 3TIFA 1MR3F 4ITRC 1GJRA 3ADDA 2QORA 4CEHB 2H7VA 4AY2A 3BFXA 2BC9A 2NG1A 3KQKA 3UATA 4EPRA 1E0SA 1ZC4A 3HU1A 5FBLB 1VHLA 4LHWA 4A8JA 1Q81D 2BWJA 3W2IA 4WBSA 4KSCA 2XXAA 2GF9A 1OKKA 3K0SA 3ECCA 4GPTA 2R2AA 2R9VA 1XBTA 4IDPA 1EESA 4MRRA 1SGWA 2ZRJA 4TWZA 4BEJA 4YC7A 4ERNA 1P6XA 3QKSB 4Q21A 4CIDA 4X8OA 1ONBA 1S3SA 4X8MA 4F4IA 5KOYA 4DHEA 3PUVA 1GR1A 1E1RD 2XGJA 3K0FB 3N2EA 3MGCA 3TSOA 4A92A 1CULC 2CNDA 3CW2A 4LY6A 4BGDA 2C5LA 2PCLA 4NH0A 3D8BA 3UMSA 1AMOA 4MRPA 1A8PA 1JXOA 3LXRA 2YC4C 2BSAA 3C5HA 4B32A 4ILEA 3QPWA 2OCPA 4LBYA 3Q85A 4DSNA 4Q4JA 1T3HA 5AN9A 5FUVA 1G5PA 4Q9LA 4HATA 1AKYA 3TSWA 3REGA 1G18A 3TR5A 5KUTA 1U0HC 3GCGA 4LJAA 5JCPA 2B5OA 5JWOA 1U0LA 1XEFA 3OFND 5EP2A 3DO6A 4HAUA 5IF9A 1II9A 1SXJB 1US8B 5B30A 4WIAA 4HLUA 3LW7A 1R0ZA 1COWA 1R0WA 2ZRNA 1QGZA 2FA9A 3RRZA 3CZQA 1F2UB 4B43A 3RC8A 4MYUA 1GRQA 5CM9C 1OGIA 1G1MA 4QJ5A 4C0KA 2DHRA 4HB4A 3WBJA 5HE8A 1K5GA 3K0AA 3W5IA 1YR8A 2UKDA 1NP6A 3OEEA 1E9EA 3JQPA 1ODFA 1QVRA 2VP4A 3AF2A 3DHWC 3FMFA 5CIQA 4AG5A 1IN7A 4LJ5A 3SYKA 3U5ZB 2J0UA 4AD8A 3L82B 2DERA 3PR1A 4TYWA 4CF7A 2CL7X 4D0GA 2QE7A 2CVFA 1P7CA 4PSAA 1GOTA 4EFNA 5KDOA 1XCGB 4OHXA 1RC8A 1CNEA 2AK2A 1G8YA 2OV2A 4OYHA 4HZUB 1HE1C 5AJZA 4XTCS 3F5FA 3GLFE 1QG4A 3S1AB 3CCEB 2H57A 1KJZA 4I1VA 2PJZA 3B9PA 3ADBA 4OHYA 1R0XA 2BMJA 4HI0E 1JAIA 2ZYUX 4HZUA 4NCJA 3W3ZB 3PEYA 1SHZA 1UM8A 1QRAA 1KI2A 2FWRA 1U0JA 3PENA 2H5EA 1VKJA 5LD2C 5L3QA 1KMHA 3QKSA 3I55B 1XD2B 3EAQA 2W2XA 3CXCB 4F7DA 2GVDC 3RS5A 5HR5A 1Z5ZA 1VG8A 3NC1C 1CIPA 2F1RA 4FI3C 1AS2A 4CGZA 1I4TD 3PITA 4B47A 2WIAA 1NLYA 3I4LA 1AS3A 3U4QB 4DSUA 3W5HA 4F92B 2XNCA 1S72B 2DR3A 5HKKD 1U94A 2ZR9A 3IBGA 3Q3JB 1ZU4A 4PHHA 3GJ3A 1GFIA 2VP0A 1XEWY 1FP7A 1JJ2B 3LH5A 4B3XA 2IC5A 3U7EB 3JZMA 2FEMA 2GZAA 5FPKA 1Z29A 1NSTA 2GAOA 3H86A 2WKQA 4TZ0A 2GNOA 2CK3A 2N42A 4DLZA 1FMLA 5FI1B 1SXJD 3R9IA 4JJKA 4WZAE 1RPZA 1L2TA 2QMEA 1HURA 4IVPA 1X86B 1KDTA 1WP9A 2NPIA 2QGZA 5C1BA 3REFA 1H65A 2ZQ5A 2AXNA 1CR2A 1E2IA 4ZIRA 1RJ9B 1ZC3A 2QSZA 5CYOA 4TMXA 3W5UA 2ZU0C 3W2EA 5K8IA 1GVHA 3B1WA 4LV5B 4OQLA 3MWKA 2JCSA 2QAGA 2ZM5A 1QFJA 2BEJA 2XNSA 4YAOA 1JQLB 1W4RA 5TVKA 3ES9A 4QL3A 1XD9A 1UFQA 1MO5A 1CJMA 3IBYA 4D6PA 1VTKA 4A2PA 1V43A 1WA5A 4QGAA 2QT1A 4NE2A 4PQYA 3WRXC 3MG9A 4DCVA 3MWJA 4N0DA 4E22A 3K53A 3WNDA 1KO8A 5KO2A 3FVQA 5A4JA 4Q03A 3IKJA 1N5IA 3BH0A 2RB4A 1T4GA 3DZDA 4Q7LA 3RS2A 3M6AA 1HE8B 3V76A 1E96A 1W87A 1FL9A 4IOMA 3TNFA 2BHRA 3C7KA 3LFUA 1IY0A 1TEVA 4A1FA 4DIEA 1LF5A 4Q00A 4EDHA 3R7WB 2C9YA 1S1CA 2VHUA 4PQFA 4EKDA 3SQXA 4D0NA 2QAGC 4LWZA 3HYTA 621PA 1JR6A 4M1YA 3RVBA 2KB0A 4A36A 2HYIC 4NCNA 2FFAA 4I99A 3M0EA 4XJXA 3RHFA 4OI0A 4II7A 2AWOA 1YJ5A 4IDQA 3EIHA 4PXAA 5E7IA 5KSZA 1LS1A 1W4AA 5ANRB 2OLKA 1AQUA 1OHHA 2ZRMA 1U8YA 2ZVPX 4P0TA 4TQ9A 1A5TA 4UQOA 4YQFA 1KI7A 1Z0JA 4ACAA 3A58B 1E9DA 5F98A 1KSFX 4CEHA 3AM1A 1R8SA 5JJKA 3UPUA 1DAFA 2BBSA 2WJHA 1IJEA 2Z5FA 2WWHA 1OFIA 2YOFA 3WMEA 4QHSA 3AUXA 4JSTA 2WWWA 5DH9A 1FNNA 1UBCA 3B1YA 3K8YA 4ZKEA 1G3UA 1OW3B 3C14C 4XWKA 2FSGA 3R9WA 2YOHA 1N6NA 2G9NA 3QY0A 3CIOA 3CLVA 1FP6A 1SKYE 2LKCA 2QN6A 2OBLA 3ZS9A 1CTQA 2C03A 5FBVB 1P9RA 4PAOA 1HH4A 1HY3A 4Q7KA 1COWD 1NRJB 5AJXA 4XVQA 1M7BA 3CCMB 3ZH9B 4Q66C 2YHSA 5K8TA 4HZIA 3H0KA 2DETA 3RABA 1GAJA 4OHVA 2PJRA 3BORA 2I4IA 3VR4A 2KWIA 3ZIAD 3QFRA 2XSZA 2NO7A 4NKRA 1HQYE 2QRZA 4YDSA 3A1UA 3TQCA 3V9PA 2QE7D 2J0QA 2YWHA 1QHYA 3TAHA 4BZQA 4BFWA 1BMFA 4Q1EA 3B78A 1G3RA 3I72A 1DEKA 1VQ8B 2MSCB 4Q1FA 4DB2A 2FFHA 4QXAA 4DDTA 2PEYA 2OHFA 3AF1A 2ZRHA 2XX3A 5GVSA 3SJAA 4Q1CA 5JMTA 1Y63A 5L3VA 1FRQA 1P75A 1F2UA 2GETA 4HUQB 4I1SA 1XTRA 5KU1A 4PC2A 1L7VC 1BS1A 1NIPA 2WKPA 5DI3A 3T1VA 1GL7A 3LO5A 1FTNA 2DWQA 4G5SA 1E2EA 1II0A 2FF7A 1QDEA 2WSSD 2FNAA 4OBEA 2OBNA 3UIEA 5EXSA 1FPMA 2AXPA 3WP0A 2DB3A 4L15A 3LV8A 1L4UA 5BN4A 4E03A 1DAGA 4TL8A 2J9RA 2X2EA 3GD7A 2ZUCA 3H1TA 1E79A 1HEIA 2XNJA 5L3SA 3L43A 2HXYA 1IXZA 1ZINA 4DLXA 2JLUA 3WXMA 2P6UA 2BGJA 1LF0A 1FOEB 1N6OA 4QG7A 4NTZA 3W5VA 2VHJA 1OFTA 5LDDC 3VHLB 3KKOA 2WOJA 4LYAA 4ZKDA 3CRRA 1I4LD 1OSNA 3U3OA 1VPLA 3O47A 1ZNXA 3U7HB 3K0EA 4FCTA 4L8GA 3W9YA 1W49A 4PAQA 3KKQA 1ZNZA 1RFLA 3N70A 1IY2A 2KI5A 2D74A 4C0JA 2VNIA 3C5CA 1OKKD 1OXVA 1QZXA 3KB2A 4URYR 4MDFA 3T12A 1TQ6A 4D25A 1SHKA 3OIWA 1JR3E 4AYTA 5GADl 2YYZA 3EPHA 1QUFA 1W4CA 3K0CC 1TQ4A 1US8A 1AKEA 1PLKA 2ORVA 3ZS8A 2DY1A 4FMCF 4WOPA 3T15A 5SZKB 1EP2B 2CVHA 2NGRA 4BWYA 5BWMA 4BQSA 3VKGA 1VQ4B 3T61A 1NKTA 4IHQA 1RKBA 4H1UA 4GOJA 3CRMA 3LRPA 2IXGA 4M1SA 1RRFA 3WYFA 2V3CC 3W8RA 4G1BA 4L5BA 1OH6A 3CC7B 1P9WA 2GA8A 3JZAA 3VR1A 2VNKA 1XEXB 3FMOB 4A4DA 3G4SB 2FSHA 3GLIA 1W2BB 4FXPA 1VCNA 4M1MA 4TMZA 4P4SA 5DISB 5JFGA 2O8CB 3SFVA 2GXUA 3FPAA 2DWOA 4FWTA 1IAQA 1VG9B 2JEOA 3MLEA 2D62A 2ODEA 3OAAA 3I73A 4NCKA 4A8JC 2EWWA 4TZ6A 3A1SA 3K9GA 1XPOA 4RFVA 3AF4A 1ZUHA 5D3MB 5FOTA 4U5XA 5DO9A 4MUBA 4PSVA 3RDPA 1EFCA 1YITB 4IFBA 2QTHA 1GSIA 3AVVA 2VTKA 2VHQA 2QSYA 4PR0A 5FOVA 4LOAA 2P65A 1E1QA 5E3HA 4HDCA 1W36C 4NYMQ 3I62A 4URUR 1SVOA 4KLNA 5FI0B 1BX0A 2OFWA 3TUJC 1KK3A 3B8HA 2C96A 5FR2A 5KDDA 2QM8A 3BIFA 2IUUA 2NZ8A 1JBKA 2ZSDA 2VSFA 4FN5A 3U3KA 1K73D 4B48A 2ATVA 1R2QA 2V4ZA 1G9XA 3C16C 3LVRE 3RWMB 1KNQA 3BE4A 4LHVA 4OQFA 1W35A 5H5JA 3AKDA 2ZPTX 4GBMA 1D2NA 4ARZA 4G01B 4CEJA 2X3UA 4TSFD 1EX7A 3NH9A 1LB1B 4DLRA 2HT1A 5CDFA 4M4SA 2J45A 4Q4HB 3ZBTA 4Y7CA 4BFXA 3ND9A 4LSGA 1BQEA 1G6OA 4F91B 3ZVLA 2EIXA 1N0VC 4CDGA 2QTFA 1W7AA 4MKHA 4JVSB 4U9UA 3T06B 1S8FA 2HV8A 2BCGY 3TH5A 3AEZA 1Z28A 2KSQA 2FG5A 1E2KA 3PIRA 1U8ZA 4BPRA 1KQSB 3AP1A 3MAAC 2C04A 1J90A 4QOSA 5DN6D 4PC1A 1FNMA 2D7DA 2QBYA 1KK1A 1HA3A 1LTQA 2N46A 4HB3A 1G7TA 1OV4A 4DWJA 1A82A 1G291 4B34A 3EPKA 1EXMA 1G41A 2GXAA 2ODNA 4LJ4A 1XMVA 3GFTA 2RMKA 4DEXA 3KUCA 4HAYA 1KSHA 4PHGA 3CMEB 3QG1A 5EUQB 1E32A 3TRFA 4AF6A 1NMZA 1GAQA 2W6JD 4QM6A 2H18A 2MMGA 1EK0A 1YHNA 1OIXA 4ACBA 3PUXA 3U44A 2IEYA 4HUTA 1QBKC 4IDHA 2VP2A 1QHIA 1FQKA 5GVRA 1ZCAA 3W8NA 3G5UA 5J5CA 3L2OB 1QVAA 1XTIA 3DOEA 4TYNA 2BN4A 1XMSA 3SOPA 5JSZA 2FPLA 5GJVC 4LBZA 1R0YA 4QJ4A 5M04A 5LPNA 3ZVNA 4EPYA 4C7OB 3LWNA 2OLJA 5J4LA 3QF7A 4Y0AA 3IO5A 2K5UA 2WBLC 4JYBA 1DG1G 3CWZA 3I3SR 1J8YF 3MWYW 1XD8A 1HQCA 2FGJA 2IXEA 1KJYA 5FL3A 1E2NA 1Q1BA 1NY6A 2JIZA 2BCJQ 5KSWB 1FNBA 2FSFA 5K8LA 2RGCA 1Z0KA 1S4QA 2QL6A 3W3AA 4RVCA 2CRVA 4C0SA 2GJKA 3TVDA 2OESA 1P60A 3SYLA 2WZQA 2XNDD 5FOSA 2O5VA 3BB4A 1XWIA 2C78A 4UJ5A 1R5OA 4XD7D 3JQQA 3U61B 2IYVA 1ZD8A 3THYB 1AQYA 3HYRA 1DELA 3BRWD 2DWPA 5EP3A 3TKLA 3GLIE 3GLHB 4TLEA 1KHTA 5AUPB 2QGNA 3NDPA 1EFHA 5BW8A 1VQ5B 4DDVA 1LVGA 5AK0A 4CEIA 121PA 1ZBDA 4J0QA 2WSSA 4EFMA 3W6NA 1NL3A 4F4CA 2ODWA 2ZRLA 5BXQC 3THXB 1VQ6B 1C1YA 1E9CA 4MKGA 3SJCA 1OH8A 3MWLA 2BBWA 3G71B 1E9RA 1CP2A 3LY5A 2NIPA 2JLZA 5FL7A 3W2FA 2BBTA 1DAHA 2AKAB 4MA4A 5E4FA 4ZCMA 1T5LA 4G5QA 3AVWA 2BIFA 4LPKA 1RW4A 4QNMA 2JLRA 2ZYTX 5C4MA 4O2RA 2XB4A 3ZBUA 5L3SB 4F93B 5KSYA 1YJ9B 5G53C 1QUEA 2ZI4A 3CNOA 1VDZA 4IOJA 3OFNA 4G5OA 1OJLA 1DAKA 3OAAD 2GCOA 4B71A 3UMFA 2SHKA 1YQTA 1OPXA 4M9XA 5C2JB 1RYHA 3KZ1E 5J4KA 2A5GA 2J0SA 4ASUD 4JKYA 3I5XA 3X1ZA 2JLVA 3KTAA 3TAUA 3TBKA 4ZI2A 2ZXUA 1Q0UA 3K09C 5AJVB 3QI2A 3CCJB 1CJVC 1XJQA 2HUPA 5FPTA 2VBCA 3L8ZA 1NF3A 3A4LA 1Q1EA 2QROA 4TTQA 3VNUA 2QTVB 2GZHA 3RRMA 4OI1A 4K81B 5EQTA 2QAJA 1OXTA 3QOFA 3RSOA 4EPTA 1GTVA 5JS8A 3VO1A 4TQUS 4MDEA 1NJID 1G3QA 4OJKA 4LHXA 2XJ4A 5AUQA 1UMKA 1X3SA 1E4YA 1NN0A 2G3YA 4N3NA 2ZE7A 1S0UA 4RD0A 1E9AA 2QQ0A 2KBFA 2ORWA 4TMTA 1LW7A 3IEUA 1W5SA 1SVLA 4A15A 4RFSA 1QG2A 2H92A 1YE8A 2FN4A 2ZE5A 3ZGXA 3ICEA 3E2IA 1XRJA 2QPTA 1GG2A 1XJCA 4B3CA 3LX5A 1NG1A 1CF4A 2GAAA 4WVFA 3NHAA 3AP2A 2CE7A 4G3XA 4PFSA 4KAXA 3CRW1 4D81A 1T0HB 3N5CA 3FGNA 2OEPA 3EC1A 4M21A 3GLGE 2Q9CA 3AKEA 3VX3A 3RNLA 4LYJA 4EUNA 2JJ1A 1XFAA 3IUYA 4LC0A 2REOA 4DXAA 1IN6A 3SZRA 2R6CA 1W0JD 1YRBA 1WQ1R 4C3ZA 2F43A 2L0XA 1M1YE 5FTKA 4Z8YA 3Q7QA 5KSPA 4WZBE 2HF8A 3CMAB 2W00A 1N6KA 2G1KA 5SZIA 3X1DA 1P61B 1ZU5A 1R7RA 2HJVA 3OJXA 1B23P 1FMJA 1G4AE 1UJ2A 1N2CE 3KKMA 2YVUA 4YAFA 1R4AA 2PMDA 1UKEA 3EWSA 3VFDA 5HTKA 4DC9A 4D2IA 2O8DA 1ESNA 4GP6A 5SZJA 4NMMA 2ZJOA 4NCIA 2F3RA 2YZ2A 1ZP6A 2VSXA 3LW8A 1Q1ZA 4KCGA 4C9BA 2CHQA 4KBGA 2X2FA 2XOKA 3CC2B 2J7KA 2BOVA 1KKLA 4DDUA 5CK5A 1N6LA 4BFYA 5EP1A 5DSZA 1XTKA 1BX1A 1LS6A 3CX8A 2CLDX 4IRUB 3VAAA 3IO3A 4Z1MA 1LY1A 1W0JA 4C0BA 1VQNB 3HU3A 1DO2A 1GL9B 2AN9A 3K9HA 3THWA 1TVCA 3AV0B 3EZ9A 4C2UA 1IY1A 3HR8A 3A1VA 4EQ6B 4TN1A 3QKTA 2NOAA 1ZUNB 3CKLA 2O8BB 4PSKA 3BBPA 3RAPR 2AK3A 3GMTA 1KTVA 3RRYA 2V7QD 1K6MA 4JLBA 1GNRA 1VMAA 1Z3IX 3BH6A 3CUEF 3LBHA 3Q72A 4EPWA 2O8EA 3KL4A 1TADA 2OG2A 3KDSE 2X1VA 4Y9UA 4IJMA 3ZVMA 2YKGA 2ZJ5A 3CRQA 3MFYA 4JVLA 4HSEA 3EA5A 4Q02A 4CW7A 1TUIA 4D4KA 2ZS9A 4ZDWA 4NYIQ 4DSTA 2C9OA 4O2LA 4US0R 1OF1A 4E5UA 5H70A 3THOA 2ZVQX 3P20A 4A2QA 2O8FA 1VQ9B 1ZMXA 1U81A 1QHNA 3H4MA 1BO6A 4IXMA 4U02A 1DAMA 4CEIB 2RCNA 1J99A 1X8JA 4KI0A 3NEYA 1U2RA 2ZRDA 2IF0A 1KRHA 4JL5A 1U9IC 4B3DA 2VYQA 5KSOA 3ND8A 1JB9A 3PEVA 1H8ED 4A0RA 2JA1A 1JJVA 3BD9A 3KQNA 2WAXA 2OFXA 2GJAA 1P72A 1O3YA 5CLLA 1W2HA 1QHXA 1Z07A 2JIZD 3PXGA 1IONA 2GTPA 5CB6A 5FPSA 2CCGA 1EFRA 1E9FA 5DYGA 3T1TA 2GEDA 2P3SA 1EFRD 2AD1A 5F9HA 2PZFA 4W5HA 3W34A 1NY5A 3BAFA 1YJNB 1JA1A 2PLRA 4NPHA 4YMVA 1J2JA 4JVMA 2IYRA 2ZI3A 4YMTA 1CLUA 2JLSA 3K0FA 3Q5DA 4EH1A 2D3WA 2F1HA 4OKSA 3VU9A 4AWXA 3U60B 1D2MA 3BERA 1E4VA 2PEZA 3NBFA 3TVTA 1KK2A 3ZC3A 3HR7A 1S9DA 5F9FA 5DLQC 3R8FA 5GJBA 1JR3D 3VR3A 3OIVA 1PLJA 3IQXA 4B6EA 3GJ0A 2BDTA 1YR7A 2AFHE 5DI9A 3AB3A 1KO4A 4PO8A 2N1BA 4LRWA 4B73A 4FK8A 1ESMA 4M1KA 1JPJA 1VCMA 2ZI6A 3EA0A 3OZXA 4LYFA 4PO1A 3X2SA 4IOKA 4EJSB 5BN3A 2ZI5A 1R5NA 5GV8A 1EFTA 4D82A 3QF4B 1NVWQ 4B3BA 4IFEA 3Q7PA 3U2QA 1HUQA 2IF2A 1KAOA 3L0SA 3K9NA 5LD2B 2P2LA 4JLAA 2BMDA 4PO9A 2PZGA 1XTJA 3MHPA 1OB2A 2RGGA 3FFBA 2WOOA 2ZAOA 3LBIA 1RIFA 2PIAA 1Z0IA 4N3GA 2ZETA 2Z43A 1G6HA 4HYYA 2OSBA 4UNQA 1SKQA 2OXRA 2P0EA 4Z8XA 3VX4A 3GPLA 1RRPA 3U7FB 2BM0A 2W2VA 1E2GA 4IKEA 3VMFA 4BEBA 4NL4H 1M2OB 1Q20A 1F6BA 1LFDB 1TQDA 2GJ9A 5DE3A 1KDPA 4M1TA 4PZZA 1F20A 1VQMB 4FIDA 4DIDA 4ZDJA 3EG5A 4FCWA 2QA5A 5BYJA 4AKEA 3RS7A 5B64A 3ADCA 1NNEA 2I3BA 4URXR 5EXXA 1Z06A 4CT5A 1KZ7B 1CQXA 4TLDA 4AG6A 5BYKA 2VH5R 3BFVA 1VYUA 2PZEA 2P5TB 4ZPXA 4B74A 1IXSB 2ZE8A 1TEXA 5KNBA 3FJOA 2WWXA 1CEEA 3KXKA 1DS6A 2RC5A 4CRWB 2ZJBA 2ERYA 2GWHA 4CT4B 5J4VA 3BH7A 2AL7A 2IA5A 1QVGB 2GKSA 5EXPA 3U7GA 1NI3A 4Y0VA 4YALA 5F3WB 1D9XA 5DHAA 4M9ZA 1LV7A 5AUNB 3U6KA 2RGEA 2VP9A 2ZTSA 4X8LA 2P6RA 4HE6A 2PT5A 1ZM4A 2IYQA 1K5DA 2ANCA 2A30A 3DVLA 3WMFA 2JLXA 3P4XA 2FMXA 4GP7A 1JNYA 2NO6A 3NWJA 3A1WA 1EP1B 2RGDA 3U3JA 1II8B 2F7SA 3L0OA 4K46A 4MYCA 2FX3A 1XJ0A 4M0LA 3GJ6A 1Q7YD 1IM2A 3AQ4A 2R6DA 3B6EA 3UMRA 5GJCA 1W36B 1F5NA 5G41A 4EPVA 4WAUA 4NONA 3T5DA 2HT6A 2CXXA 3ZDQA 5C46F 4G5RA 3N2IA 3NBYC 3NXSA 3V00A 3EC2A 1UKVY 3LQQA 2C2HA 3A4NA 3WYAA 4KHZA 3MRSA 2ZJYA 4P3YA 4ZIRB 4LBWA 1CR0A 4UXHA 4TTRA 3VHXA 3V4RA 4EJSC 1PV4A 4Z1MD 1U90A 3GQBA 1YHQB 4BZXA 1Z47A 3LVQE 2VP5A 3B13B 1N5LA 1P4SA 1X1SA 4S35A 2WPDD 1N0UA 4PC3A 4UNRA 3ASYA 2FSIA 3MMPA 4DBLC 1KI6B 3QKRB 3D7MA 4IVQA 4WA7A 3I5YA 4PPNA 3RWOA 4I4LA 3GJ7A 4Q5IA 2CCKA 4FMDB 2F1IA 2GK7A 2X8AA 3T34A 5J4HA 5JI3E 5H59A 3KB1A 1WMSA 2ZJZA 1TU3A 3LBNA 1XDBA 2REXB 3C8UA 4O25A 2MSDB 5IK2D 2TMKA 1R5BA 3ONWA 1OB5A 2W6ID 3D31A 1OE0A 1BKDR 4ZCLA 2NZJA 1XD2A 2O52A 3ZZUA 1ZUIA 3P1JA 1SQ5A 2Q3HA 2OK7A 5FTJA 2JASA 4DJTA 1GWNA 4BECA 3NIBA 2EYUA 4PZLA 4YMUA 3R7WA 1TLLA 3CM0A 3NKVA 3GP8A 3ZD6A 1B2RA 3L0IB 3BS4A 3EIEA 4Q47A 2IS6A 2P5SA 1W2GA 2B7BA 1VIYA 1Q57A 3WNCA 2Q3FA 1E2FA 1NBMD 1A2BA 3X1YA 3KKPA 3IIKA 1B0UA 3AP3A 5SZHB 4JKIA 1RVDA 1D1NA 2W58A 2OM2A 1TNDA 3VKHA 1GRRA 3W90A 2CCJA 4HLQB 4XWOA 3SQWA 2GF0A 4BFZA 3U6BA 2QTLA 1H8HD 5JCZA 5EMNA 4LUCA 5EE1A 1R10A 5JJLA 3VR2A 1ZM2A 1L8QA 2GILA 2AD5A 4OK5A 1SXJE 4IXNA 3NEJA 3NG1A 3SE0A 3UG6A 2V1XA 3UXMA 3CF6R 1M7GA 4U00A 2R6GA 1VQ7B 5DIFA 3KUDA 3ETLA 4JLPA 1HV8A 2WWFA 4AKGA 1VQOB 3RS0A 1T8TA 1ZNWA 3IPYA 1GRNA 1EWRA 4A82A 5UKDA 3O8BA 1E79D 2CHVA 4FD2A 5GV7A 5FUWA 4ZDKA 3E70C 3MUFA 1IBRA 2QZ4A 1IB0A 4DCNA 3AGQA 1K9MD 3HP1A 3EX7C 2LWIA 4D4LA 1T3LA 5P21A 4V03A 1S9HA 1W46A 1JA0A 4AKIA 3SN6A 2IS1A 1ZVQA 3B82A 2ZUBA 3LLMA 5K8UA 3JVVA 3W6PA 4IOLA 1E2HA 2VSOA 2OAP1 2ZSEA 2IBMA 4YAUA 1NLZA 3TW8B 1P5ZB 3O8CA 4JMPA 2A5YB 1MT0A 1E0KA 4LDJA 2ZJ8A 3TMKA 4ZDIA 2PX3A 1P2UA 4W9MC 2W0SA 5JEEA 1KOFA 4HDOB 2HLDD 1O87A 3PUZA 2ZR7A 4BLTA 3GLGA 2Z0MA 4KFRA 5B57C 4A6PA 1N3BA 1VYVA 4KFUA 5G40A 4LI0A 1WDTA 3BFKA 4PC6A 1TU4A 2Q9AA 2CMKA 2OXCA 3EZFA 4LZZA 1PUJA 1QHSA 4MQBA 2J1LA 5FFMA 3OF5A 1PZNA 4JIMA 1L4YA 2I1VB 2BBOA 2AWNA 4V0LA 2RHDA 4ZGQB 2AHOA 4RKEA 2ODBA 4D4JA 1YZGA 3ASZA 3PJRA 1R6BX 3K1JA 1D5CA 4MGZR 4NDZA 5KTYA 2YWGA 3QSYA 4GI7A 2B7CA 2RH5A 4MH0R 2O8CA 1UBEA 2CBZA 5JRZA 1AGRA 4G0NA 3UWOA 1K8RA 1U98A 2WM9B 4TMKA 2PCJA 3OEHA 5JWHA 4XTRA 2H17A 3LNCA 4HB0A 3MCAA 4DEYA 1ZM9A 3CCLB 2ZRFA 1QH0A 3GJXC 2YOGA 2EYQA 2VA8A 2QAGB 1KO7A 1QHGA 1TPZA 1EG7A 3DMDA 1CRQA 5DHFA 3I92A 5KNCA 4L9WA 3FOZA 4RZ3A 3THYA 4AKHA 1KI1A 2XSZD 4QC2A 2ZJ2A 3AGPA 1TTTA 2ZI7A 1NVVQ 5LB4A 3WMGA 3ZLJA 2V54A 1N6RA 3DMNA 2ZRPA 1W1WA 4OJQA 1DADA 4RKFA 4QFMA 4QKQA 4KXFB 4RZXA 4E09A 1OXSC 2ZEJA 4TL6A 2HYDA 5TXGA 2DPXA 1NSFA 3CCVB 4GL2A 1ETUA 3B1ZA 4RSGA 1TL7C 1RE0A 5EXTA 3WP1B 3SBEA 2MMCA 5EZ6B 2BKUA 2UZIR 1W0KD 5FR1A 2ONJA 3CC4B 3AH8A 4NYIR 2IT1A 1WCV1 3DEFA 4L4UA 4ON9A 4M2LA 2ZRAA 4DLVA 2I1QA 2AR7A 5CM8B 3FHTA 3BB3A 4XVUA 4L9SA 3R20A 1WRBA 4NU0A 1KMHB 3QEOA 3BGWA 5CJPA 2B21A 2VL7A 2ZSBA 1G20E 5EP4A 4TYPA 3W6OA 1Z6AA 2FFBA 2VQSA 3CPJB 3FB4A 4AURA 1Z0AA 2J46A 4AF7A 1PLLA 1OFUX 3CNLA 3S1AA 4PX9A 2WJIA 1NG9A 1RYFA 2XZLA 2ZUDA 4IVRA 1FX0B 1KNXA 2G0TA 2A5DA 1W47A 4C0HA 2GCPA 2CNWA 2R62A 4M53A 2Z83A 1P73A 2WJYA 1GNQA 1G7SA 2REBA 3QVUA 5JJIA 1U9IA 3I1FA 1NN3A 4JBYA 3B1XA 2O8BA 3GEEA 2J7PD 3C15C 1F60A 3KQLA 3D3QA 4QBIA 3I61A 3EZ6A 3K0CA 4Q18A 1FZQA 1VQPB 5HCNA 2WICA 5IK2A 4NYJR 4YHBA 1OGJA 1T3SA 2AX4A 3TE6A 2IYZA 4Q9KA 4QGFA 1MO3A 4BZPA 4G1VA 1F3OA 1WBBA 2EFDB 4DLTA 2EFEB 4GZMA 3Q9LA 1M34E 2W0MA 3QPVA 2A3RA 1OH5A 1NN1A 1NJFA 2ZRIA 2PL3A 3C4JA 4Q01A 2QQEA 1E0AA 3K09A 4PQRA 3LO8A 4MYHA 4BLOA 3JQRA 1AZSC 3FKSA 2QMOA 4QBHA 4R71A 1BH2A 4JLVA 3WRYC 2KE5A 1EWQA 3AVUA 1N6PA 4HLUC 2DBYA 4CVNA 4M1WA 1RJ9A 4A0HA 3T5GA 1GITA 2XAUA 1XCPA 3PEUA 2V7QA 5IRCD 2JLWA 4RFSB 3CF2A 8OHMA 2DFLA 2VPPA 3F8TA 4NZYA 1KJWA 2RGXA 4DRZA 1UBFA 4AYXA 3SDZA 4DQKA 2ZU6A 1VQKB 4URZR 1XE1A 1N5KA 5FOXA 3PUYA 1OLOA 3QE2A 4OHZA 2BKEA 2JLYA 2QA4B 4I81A 2R65A 1IN8A 2ZS8A 2V9PA 3MJHA 1YIJB 4UNNA 5H1YA 4Q4AA 1Q22A 2WHXA 5FH9A 3A4MA 2OTLB 1Z08A 3B7GA 4F4JA 1RRGA 1X6VA 2OK8A 1UKZA 3KJGA 2CHGA 3GFPA 1OT3A 1P2VA 5FBQB 1D2EA 4DLSA 3HPRA 4JBXA 4PANA 1CRPA 1X8LA 4TL7A 2C9CA 1NJGA 4KITB 4Q9HA 3CPEA 4JL8A 2V6IA 3EPJA 4BLRA 1CR1A 2PT7A 3TLXA 3CX7A 2Z6VA 4YDHB 4US2R 2O8FB 2IYXA 4JT4A 221PA 1GP2A 5JSZB 1QFYA 1W34A 1FQJA 2J0VA 2R6AA 4I1UA 5E7JA 1EGAA 1WE2A 1G8FA 2GHIA 2B8WA 1I2MA 1QHHB 1AN0A 1YZUA 2G6BA 2LCFA 4EJSA 4LHZA 5H8WA 1FW6A 4UJ3A 2EWVA 4RCYA 1C4OA 1RZ3A 3RS4A 2F6RA 3LD9A 2JJ2A 3OZWA 4ASUA 2ZROA 1FRNA 1VG0B 4UNPA 3FHOA 3FWYA 1G5TA 5KPDA 1D9ZA 4ZGNB 2D2EA 2WIBA 4LX0A 1TUEA 1OHHD 5L8VA 4QHYA 1HT1E 1OIVA 3BK7A 4GOXA 5FOWA 4Q4HA 1S1MA 4Q4JB 1M1KD 2QMHA 1YKSA 4X8HA 1BMFD 1C9KA 3EPLA 4TTPA 1KAGA 2AFIE 1NKSA 4I1OA 4JBWA 4ZI3A 3FDIA 4N0EA 3QXXA 4EPXA 4GZLA 3DM9B 3FMIA 3P27A 4P32A 2O0JA 4HAZA 3U44B 4TMWA 2R8RA 5CIWA 1N5JA 2FDCA 1EP3B 2V55B 2G83A 3ICQB 3U4QA 2Q9BA 2W83A 4UNSA 5D3QA 3RRNA 1JB1A 1T5IA 4Q1BA 2OZEA 2C99A 2IYSA 4A8JB 3IQWA 5B2ZA 3UANA 3QFTA 3WNBA 2CJWB 2H1LA 2R44A 4M22A 2WWGA 3E5HA 4DUGD 1GDDA 2XEXA 3ZIAA 4LBVA 3PUWA 4C43A 4OQXA 4RZ2A 3TGPA 1JQJC 2Q0HA 1V5WA 5FL7D 5KNDA 1XCMA 5AJYA 1SVWA 5TY0A 5JZVA 4US1R 2QP9X 3DPUA 4A0GA 2PLFA 4YXWD 2C98A 2ZRBA 5AUOB 2XZOA 4TT3D 3KJHA 1GZSA 1SVMA 4XD7A 4DZZA 1KSGA 2FZ4A 4U7DA 1E2DA 2JATA 2WMOB 4V02A 1G16A 1UEIA 1N0WA 2G0NA 4CEJB 4BFVA 2O8DB 4KYUA 5EE3A 5A0FA 1CXZA 4P33A 1HTWA 2O0HA 2YNMA 5CLQA 1DBSA 3GEHA 3KJIA 3SHFA 4IEIA 4RD2A 2X19A 2CL6X 2FOLA 2QEQA 4B2PA 4RD3A 1XTSA 1BOFA 1P2TA 1XXHB 1YZQA 2VZLA 1QGAA 1KSJA 3DL0A 4Q19A 3TW4A 2F3TA 5DGXA 3X1WA 4Y9RA 2QP3A 1PVOA 2F43B 1UPTA 1Z6YA 3T1OA 3GLHE 1K8AD 1UDWA 3DOFA 3I32A 4Q4LA 3K70C 4YONB 5FBWB 1Z6GA 2XB2A 2GJ8A 3EWAA 4XIGS 5KYKA 4A9AA 1ZW6A 4GMXA 3E20A 4JT2A 4DCUA 1JPNA 2ZSFA 3I8SA 3SR0A 3CO5A 5CDFE 2ONKA 4BFTA 1U8AA 2HF9A 4D80A 4Q9JA 1E2LA 1XXHE 3NTUA 2ZANA 3PQCA 5D3MA 2ZE6A 4XVRA 1A7JA 3WYGA 3OZUA 2D7CA 3BJIC 3KJEA 5FBRB 1KMQA 1IJFA 1Q3TA 2HJGA 4R7ZA 4V0ME 2OT3B 3T1QA 4Q7MB 3I8XA 6Q21A 4RZUA 3RS3A 1W48A 5H68A 3CF0A 2C8VA 3CCQB 1FUUA 3GLFB 3L0PA 1SVSA 4GNKA 5FTMA 2JJ1D 2QUZA 3BB1A 1SM4A 1D8TA 4HB2A 3E1YE 1KO5A 3KXLA 1UBGA 4WW0A 4UAJA 3GLFA 2HCBA 2GCOB 3OHMA 2Y8EA 3G6EB 3ZZTA 4MRSA 3M1IA 4V0NA 2F9LA 4A2WA 4BLQA 1KI6A 4DQLA 5HKKA 2X77A 1D6JA 2Z4SA 3BXZA 1HYQA 1NDHA 3VNVA 1BJKA 3B60A 2GXQA 2WJVA 4QGGA 3DDCA 3AVXA 3DZ8A 3VTKA 2DFTA 2IUSA 4O3MA 5JHHB 4KBFA 4LCBA 2GEUA 1WB9A 1T6NA 2QMUA 3LAWA 4B44A 4M9QA 3TQFA 5TARA 4TSFA 4WXRA 2GBLC 3OW2B 1RRCA 1SVKA 3QKRA 4C7OA 2B6HA 2IHBA 2QRNA 3OE7A 2QPAA 4EAQA 3UG7A 3I56B 4K8OA 1F48A 4Q7JB 1E62A 1NLFA 1GKUB 2ZRCA 3GLIB 3QVVA 4JLOA 5TR9A 3QEJA 2GESA 2HXSA 1TF2A 4HDQB 3FE2A 4IEEA 2F55A 4PPQA 2OTJB 1VHTA 2BMEA 5LBIA 2OBMA 2V8OA 4M9SA 4KSBA 1DOAA 1F2TB 5DN6A 3P32A 3LX8A 4RCZA 3PCRB 2VNHA 2EQBA 2IYUA 1G7CA 4IW3B 1MABB 4XOIA 3SJBA 3FKSD 4JLNA 1JR3A 1NVXQ 2ANBA 4G1UC 1N8RD 2G77B 5FPHA 5L3QB 2GPJA 4JS0A 2QY9A 3ZZ0A 1TMKA 2DFNA 4NBSA 1E9SA 1CJKC 1SZPA 5THXA 2HMAA 1AA9A 2GQFA 2VIIA 2OCYC 3CPHA 3NVAA 3QXSA 1G17A 4JL6A 4B75A 4DDWA 5FPYA 1H8HA 1DARA 1UADA 1ZD1A 1S96A 3OE7D 1YI2B 4DCSA 2GRJA 1KKMA 4BLSA 1GIAA 4BRWA 4B35A 4H1VA 1IN5A 3HWSA 2H16A 1YZNA 2Z4RA 3KX2A 5KHOC 3QXJA 1KYIA 1JEDA 4DVGA 3PG5A 4GSYA 4LJ7A 3HJNA 4DT1A 5AWFC 521PA 3B2EA 1FFHA 1JEEA 3L8YA 5IDVA 2VYFA 3UKDA 4B33A 1J9ZA 1E69A 4P4UA 4MGYR 1OFHA 1MOZA 4BRUA 3HPQA 2QG6A
chains in the Genus database with same CATH superfamily
5HQ3A 1QX3A 3OZAA 3C3CA 4L16A 2FG7C 1YR9A 1JUDA 2DG2A 4KWHA 3LUGA 4LZLA 5L3RA 4CYMA 5HE9A 2I34A 3CCCA 5IFKA 3VVLA 2G72A 5FBHA 3SHOA 1WW8A 1GNTA 2CF4A 1ZAKA 2EVWX 4MICA 3MJVA 1H2ZA 4HVAA 1M8PA 3VPAA 5K03A 1AO0A 4PLFA 5CCXA 1SFRA 1S8NA 2I9PA 4OKIA 4TLBA 4WGFA 4OH7A 5KTKA 2JHFA 4O0MA 4RIFA 5J2UB 3UJCA 4Z54A 1P7VA 3SC6A 3TTVA 2PMBA 2WIDA 3CWQA 4Q82A 4FEAA 5IC6A 2OORC 3N2GA 5BN1A 1NNSA 3O8RA 2Q29A 4KSYA 1Q50A 1FC0A 1RYMA 1OYYA 3H17A 5JVDB 3VOTA 4YJKA 2X40A 1T9KA 1YQUA 2IGTA 3FPEA 4BMNA 1G8GA 4E08A 1G8PA 5ALVA 3ANYB 3EZ2A 3OZDA 1AUVA 4ZGWA 3OZVA 1FUKA 1BJTA 1L5SA 1Y3AA 1VFNA 2RHMA 3QE0A 5A5GA 5DYWA 1MKYA 5ICSA 4RH1A 2P9YA 3KTDA 5BORA 1ZRMA 4IYJA 5JHGB 4BN4A 1TA0A 3HJCA 4Y9TA 4DLWA 5KI6A 4X54A 4PRKA 1J00A 3BWVA 2OBSA 1G60A 1Q44A 1QG0A 4HQ0A 4KO8A 4KP7A 2FN3A 1I32A 3FYSA 4QUAA 2GQ0A 2FGKA 2G7MC 5ELXA 4G41A 2JKZA 3M4JA 2ID8A 3W3AD 2ZIVB 1EVYA 2P0AA 1SCKA 4UDXX 2H48A 8ABPA 2XDWA 5DM0A 3UBMA 3R3JA 4IS3A 4B3FX 1X8KA 1G64A 2HI0A 1QE5A 1H3EA 1P91A 3CURA 5AW4A 3UKJA 3PJGA 4FGKA 2HC9A 2PLAA 4Y6LA 3O2NA 5EUMA 4LPSA 4RZSA 4BASA 4KYIB 1G59A 4JI1B 4FMDF 4L6AA 1WM1A 4MKIA 4RTNA 5E2AA 1JHOA 4AN0A 2JZOA 2AV6A 3IMKA 3PC8A 5EQFA 2XTAA 2HFJA 1UC5B 2VUUA 3WGQA 1QR6A 4WK4B 1Z37A 1I1NA 2A5FA 3I3OA 2YWCA 4G1FA 3FNBA 5DGHA 2VYVA 3KJZA 4CDRA 4QTUB 3CF0A 5LU8A 3STWA 4WV3A 3RC8A 1DDIA 2EJTA 2VUHB 2YJTD 5CLIA 4JKOA 3V55A 3SS9X 3UC9A 3ZU5A 2AC4A 1KEEA 3KYCB 5DASA 3SQNA 4EBBA 2O06A 3DDSA 4ISBA 4N4AA 3N2KA 2WSMA 3KWLA 1FSPA 4KR6A 1GL6A 1DV1A 4ICIA 3KXIA 5KAMA 2HF2A 1YVDA 1QIIA 4EEXA 2ZZMA 1GZ5A 1ISSA 4R40A 4LS3A 4OHUA 5HQJA 4GDMA 4GLOA 3U3RA 3U19A 3RAEC 2WP8J 2C20A 4TLCA 4XARA 5FUXA 5FD8A 3RODA 2DTXA 1AGPA 2VHZA 4DR2B 1RWQA 2X0DA 3CLTC 4UE3S 4QQFA 4AMVA 4OK6A 2PKRA 1R9JA 4H7DA 1ZIPA 3LS2A 1FW6A 2BI7A 2HUNA 2OCIA 2QHXA 3HM2A 3WLJA 2P6MA 1YGPA 1NJSA 3NBMA 4JQCA 7MHTA 4P5EA 1OLXA 5KNCD 5AESA 1DEHA 1ECFA 1S3IA 3CPWB 5A3SA 5FA6A 3E35A 1SIBE 4LQDA 4FW8A 3JYOA 3EXAA 1IHPA 1Q5PA 4U7WA 1LGYA 2FSPA 2R6FA 4B1FA 1Y3DE 4C3VA 4FFNA 2V96A 5BR4A 1GA1A 4IV8A 4F96A 2DSNA 4ENWA 3FVWA 3TZHA 1N6IA 3FGZA 3I9OA 3FPCA 1HSOA 3PXUA 1MRSA 5IDWA 3SIXA 1O6ZA 1UD5A 3KE8A 4TWBA 5G1OA 3RSQA 1V0FA 4PC7A 1UZLA 2YV2A 5CYPA 3OBBA 1CF2O 4MQ4A 5CW1A 1NUUA 4P6YA 2G4LA 1CKEA 1GZ7A 3QTTA 5DN9A 4LX8A 4YIHA 5FLXA 2QJWA 4NCBA 3F3YA 4MXDA 4PAAA 2YINC 2YWEA 5A88A 1NBME 1Q95A 1W52X 3HUDA 4W99A 5D2CA 5AW8A 4DNTB 5A62A 3TO5A 1S3GA 2RH9B 1WCIA 3V42A 4FFMA 3C3EA 1L0BA 3CJRA 1YA4A 3E05A 4FQ8A 1E1QD 4HWSA 2IYTA 2GCNA 2ATXA 1IHMA 2LIVA 1W4BA 2RHRA 4JJGA 4WL0A 4ESVA 2V7GA 2AS0A 3TQTA 3DAYA 1PRYA 4FWIB 5BUZA 1BDBA 1Y34E 3SX4A 1ND6A 3UK6A 2HIMA 5AXDA 1EM8B 2XQFA 3AY7A 3FB1A 3I05A 3ENNA 1ES9A 1EGQA 4R2XA 5LU9A 4Y3UA 2QU7A 3VVBA 4Q3OA 4DCCA 2RGNC 3MFQA 1SURA 4ALJA 3KQVA 4QUHA 2YV1A 3OIUA 4FC6A 2B5WA 1L3CA 3K72B 2WVJA 2QENA 1KQPA 4IIXA 4RV4A 4MYTA 1FUEA 1TF7A 1UWVA 4D26A 1OXXK 1J0BA 1UBNA 3KKLA 2BEKA 4YN3A 4LJ8A 3U4DA 1XRMA 2ZWPA 3WNVA 2FZGA 4WXPA 2CFSA 2W2KA 4P4GA 4K9PA 1MO2A 3SDSA 2R1TA 5E6RA 1GAWA 4OK3A 4CLEA 2VJBA 2G63A 3MS2A 2L69A 4Z51A 1TCBA 2H0RA 4CWAA 4KR0A 2YWFA 5JPCA 1QVWA 4I6GA 1E2UA 3I2KA 1WMDA 1NPDA 4ER3A 2VCHA 2Y6VA 3DPIA 1F14A 2AI3A 2OE2A 3EIXA 4YYEA 5A4DA 3ZJYA 1YFJA 5CA0A 4JLMA 2P8SA 3CVWA 4U3JB 2HRBA 2NVUA 4R8KA 1BQ3A 4HO1X 3EASA 2GZDA 1UC9A 4QEKA 3L7DA 2JDID 4IDNA 4E13A 2IBTA 2NSYA 3SHQA 4JLUA 2O8EB 4PBRA 1N2GA 3GZNA 1GVNB 2XTMA 2B94A 4DQDA 3FX2A 3ND5A 2HNBA 3B53X 3IIMA 3QYFA 2HDWA 5GIPE 4ZTZB 2ZWIA 3OQMA 1NDQA 1YZLA 3B5JA 3DGFC 4WJZA 1UIRA 3SNHA 4JUIA 4CI9A 4QLBA 4QYIA 4X3CA 3RU7A 1WB5A 2B92A 1A9TA 5ADVA 1IG3A 4KX3A 1L7BA 2QD5A 3CLHA 3QUAA 1MENA 1Y9JA 4INAA 1LV8A 1WOOA 3V1UA 2NAPA 3WIUA 3QGMA 3IDQA 3PT5A 4AS3A 4Q3BA 4RTOA 5EZYA 3BHIA 3EEIA 4KTTE 1YRQA 4PGMA 3CD6B 5BT8A 3EVFA 3BC1A 4AIIA 3DVAB 5KOHB 5JV5A 1C2TA 2CUNA 4ZXFA 6GPBA 1YQQA 5A5VA 1KQOA 2A0KA 3DQQA 2F1KA 2PKCA 3NFYA 4JD5A 2RHTA 1CVIA 3M82A 4EFDA 2ZAMA 1G3MA 1KDOA 4QJIA 1SZJG 4GXTA 4OPMA 5LQSA 4ZI7A 3BA6A 4JLKA 2W11A 4KR2A 1A7UA 4EI2A 1G19A 3L6CA 3DE6X 2QN3A 3RANA 4KQMA 1Y0BA 1GAEO 4FX5A 2HCRA 2OFOA 1XPUA 2EF0A 1W19A 2ZKLA 2DZDA 3LCVB 4ZYWA 3VGPA 5JAIA 3A8TA 2HB6A 4C03A 2YDXA 4KZKA 3FN4A 3QA3E 1KGDA 1PQ4A 2UZ4A 3L1UA 1U0NA 4CQMA 1AXGA 1VCIA 2QM7A 3H2YA 4IXWA 5BSRA 1G5RA 1I2DA 2DBQA 2XCRB 1Q74A 2Y27A 3OTIA 4IDDA 1B93A 1YB5A 3ZQ6A 1XEWX 2A9FA 5LFAA 4YJGB 3RFTA 4BAZA 1K92A 2WWTA 5BSVA 3EF3A 4LXIA 3K7EA 3ZD7A 1SUAA 3FMPB 3LECA 3PS9A 1GUZA 1U9JA 3RYTC 4YK7A 1TVEA 4UCWA 1NQTA 1T0JB 4B6QA 4B6FA 4RTLA 1K9SA 1SZDA 1TD9A 1MX1A 1WVIA 5K3FB 3RBAA 1HDCA 3BF7A 1NN5A 4OSEA 4D46A 2HTEA 3PYLA 1EJ2A 4DUGA 4W82A 3CBQA 1STOA 5C4GB 1V7QA 2YV5A 3U13A 1IHUA 4G8JA 3RIYA 2JN9A 1LQUA 2C9MA 4UHJA 1H4SA 1NUTA 3AJ8A 3MB5A 4M8LA 3E53A 3TLAA 4I7EA 2X23A 2P3MA 1JQ3A 3OOHA 1U6KA 3U26A 2FLWA 3MQ4A 2P9FA 1WDKA 4HGOA 4ZFNA 3H5VA 1RTKA 3GOQA 5F52A 3EJWA 3MMNA 1S02A 5HJEA 4PZUA 2DFKB 2QTGA 4JGBA 3DTVA 4JZKA 4DQUA 3PD7A 4CKZA 1OIWA 1U1GA 4IKOA 3ZUPA 3RC1A 1N06A 1HT2E 4LNHA 3WQQA 4DNOA 1CNFA 5EZYF 5IARA 4ARZB 3ORYA 1JI0A 4WBNA 1I7DA 4NCXA 3M34A 4K3UA 2VJKA 3HB5X 3FUTA 4MYDA 3V97A 3SC3A 3A3GA 3HYLA 2WWYA 1QYDA 4UEOA 2E18A 4M54A 1B00A 4WNCA 1RQNA 1DAEA 3DYIA 4UHBA 4L5JA 5FTNA 3ZHUA 3PVZA 1XZKA 4J07A 4AO7A 2JLYA 1DT3A 1EVEA 1F0NA 4IXTA 1SOWA 1A2KC 1EFPB 1V7CA 1LI7A 1VE5A 3N05A 4L85A 4M83A 4MV6A 4PAMA 1E43A 4C30A 7GPBA 5JAUA 2OILA 3HNOA 4HMOA 4OGKA 2XUGA 1WXGA 4XMYA 3I83A 2WABA 1W75A 2BV3A 2QVCA 4PW0A 4XGKA 5IBQA 1IN4A 3E0QA 2QXUA 3KHTA 1PSZA 3WHLA 4KFSA 1V47A 1I6WA 2W8BB 1E2MA 5CA1A 1SULA 3H9EO 5C51B 3L7AA 2R7NA 3E7XA 2BMFA 4ZEWA 2HGSA 4FX2A 4D45A 2X85A 2MSNA 5H3CA 1S01A 1SKUA 4IPTA 1OLSB 4NIMA 2NU9B 4C3UA 3F0TA 4EA8A 2AJBA 5B6JA 1XK6A 3OFKA 1GQRA 2P6NA 4NV1A 4OOFA 3U9SA 3RGWS 2GNPA 1DJOA 4MVXA 3WIEA 2W2LD 3ZKWA 4QGHA 1NW3A 2CF6A 4B8YA 2FZCA 3M3HA 3RTGA 4DQXA 4EVIA 1LDMA 2QPOA 2DEUA 4E2YA 5BUSA 1IEWA 4YRIA 1E63A 1JAZA 1L1QA 4XH9B 3RSLA 1NMXA 4LK2A 1JAHA 3M81A 1RXIA 2ZSJA 4FFOA 4H0FA 1RPNA 4UHEA 3N8NA 5CG2A 4F4DA 3ZGOA 5IYNA 1PV2A 1NBOA 2PXHA 2HA4A 2GN8A 2GPWA 4DZTA 5DYIA 4KDEA 2E4VA 2YS7A 3PPIA 1IAVA 4OXKA 3QIAA 4DV4B 4NXMB 4N18A 5DCLA 5HEKA 1Z38A 1T5OA 3G2OA 4MW2A 1YMVA 3A1TA 3EVCA 5DDIP 4YP6A 1WF3A 3RYFB 3P9CA 3EGDB 4Q48A 3I64A 3U3MA 4W6ZA 2WD8A 4L22A 3UJ6A 4JMLA 4EG5A 3QE9Y 2G04A 3ZI0A 4OHMA 3K16A 3PVDA 3CZPA 1PI3A 1NA5A 4QZVA 2BGTA 1NUHA 4HVTA 4G6IA 2HQBA 4IDEA 1PGOA 4QVGA 1BRTA 2DPLA 3O95A 5K0FA 1YVRA 3IILA 4MHSA 5BMVB 4D79A 2XF2A 3IJ5A 3LRTA 2AFIA 1I30A 3K70B 3U4MA 1XRNA 2W6JA 3B1VA 1SHUX 3DOUA 4QEDA 4F3TA 4PLVA 2EAUA 3LG2A 4MGKR 1QBGA 2ENUA 4OHCA 1PJRA 3EFEA 1V9CA 1LWOA 5HZBA 4CU5A 5AFSA 2BFCB 2GDZA 1JH8A 4AY6A 2RAPA 3CR8A 5BNWA 5CITA 5AW3A 2W6IA 4Z4YA 2QX9A 7ADHA 3ZIDA 5JH7B 4GT1A 4R2IA 1ARZA 1XMPA 4YNBA 3TSCA 4CM8B 1USGA 2YTZA 4PLGA 3REOA 1XF1A 3EUFA 4CZ2A 1R0CA 3ZOKA 4CQMB 2B25A 1ZYUA 2C4KA 2FH5B 1XZQA 1S2OA 2ZSUA 2AX3A 3NCHA 2GPYA 2WV9A 4PTLA 1KL7A 4XVHA 3AF0A 4V1CI 2QTZA 1A5AB 2JGKA 5CW2A 4HLDA 4OAOA 4TKLA 5ECYA 3IKTA 2IEGA 2BEWA 2GVZC 4Z7NB 5C8ZA 2Y92A 2UVQA 1Y0RA 3P4YA 4R31A 4XB6B 3FTEA 3KAQA 1ZD9A 1YOVB 3DZGA 4CCYA 1MRNA 1JDJA 3TM5A 3CNQS 4TMYA 1O0SA 2TS1A 3AFOA 1K8ZB 3Q3CA 1SCIA 2ASEA 2F9MA 4K2HA 1GA4A 3D2BA 3CUTA 4HRYA 2VBIA 2ARKA 5BV8A 1KO1A 1AK1A 1X1CA 3DVAA 5AI5A 5K01A 5EI5A 3H2GA 2IYYA 2FOXA 4LOKA 3HRHA 2HSGA 1E94E 3L7NA 1AC5A 2J9FA 4Y7DA 3TCKA 3QBTA 5B2FA 3PL1A 3UW3A 2PX2A 1DG3A 5GONB 4I4TB 1YV9A 1I5RA 3EDOA 1L7OA 2E4AA 5F2EA 4OMDA 1BYUA 3RLFA 1G1AA 3O9ZA 4L7QA 2Q3JA 3U4AA 3V2UA 1OCEA 1UJ4A 4HEJA 1SXJC 3AUAA 3LC1O 4ZVNA 1WPRA 2WU0A 3SBDA 1T91A 3AIKA 4PGAA 4AO6A 2A8YA 4FR0A 4XM1A 4XOTA 4QBFA 3D2CA 4GYJA 2RB5A 3R6TA 4QVKA 5TRDA 2VC2B 5HZKA 4IJUA 4RD1A 1N0IA 3D2AA 4Q39A 4EMSA 3LNTA 4KQXA 1P19A 4HNAB 4ITRC 1A97A 1UH5A 1PD0A 1U3GA 4AY2A 3JYQA 1HVXA 3FZQA 4PS1A 5M29A 3KQKA 3T7JA 1JEQB 1YRHA 1F8GA 3UATA 3A28A 2BISA 3HU1A 1QO0A 4LHWA 2Z5GA 4JJFA 1BMDA 1ZIDA 1PT6A 2GBIA 1MVLA 4NAHA 4KSCA 3K0SA 1NU6A 2W9XA 1TCVA 4CDMA 4GPTA 2R9VA 1H3NA 3TG8A 3ACCA 3EY4A 3OZBA 4NBLA 1RVV1 2AN4A 1SKBA 1V35A 2Q4TA 2ZRJA 1A9ZA 5LQUA 1P6XA 3QLTA 3QKSB 4Q21A 4J1SA 1SUSA 3RFXA 3PA2A 1IOVA 1S3SA 3D6JA 4IV0A 5KOHA 3I4CA 1CY1A 2PKWA 3CW2A 3GP3A 5E6UA 5JAHA 2C5LA 3AYXB 1PKVA 4ONEA 4NH0A 1AMOA 4MI9A 1O95A 2XUJA 4MJ7A 5H81A 3ZWPA 2B1QA 1C9NA 2YC4C 1SOUA 3C5HA 3NHMA 2ZGVA 3T9CA 3RJ9A 3H9CA 5BT9A 4N82A 4Q4JA 1QWSA 1T3HA 4RHYA 5AN9A 1JTEA 3JWJA 3SYMA 1XHEA 1ETHA 1TKCA 4M9RA 4M38A 1AKYA 1V8FA 1SH7A 4Y2XA 5AW9A 1UL1X 3REGA 3ZE0B 3I23A 4QARA 1YBVA 4FD3A 2WIJA 4LJAA 2HRQA 5B2EA 2B5OA 1F17A 2JHPA 3LWBA 3VTAA 4QG3A 5JCPA 5JWOA 3V46A 4X6XA 4HGRA 5EP2A 3QMMA 2G9RA 3VBCA 1XCLA 2HWYA 2FF5A 1SXJB 4R5HA 4JDPA 2QW1A 4WIAA 5I7RA 3LW7A 2Y1EA 1MB3A 2VS1A 4HVCA 2FA9A 2XKBA 3AXSA 1VLZA 4R0MA 3ETJA 3AI7A 3ETEA 1G1MA 1YCGA 2EJUA 4MAFA 5HF6A 1GNSA 4HB4A 1X94A 2VI5A 4H08A 1CQJB 4O4HB 1K5GA 4R3WA 3W5IA 2UKDA 1ISFA 1K3TA 3NATA 1NXXA 1HDIA 1E9EA 3AF2A 1B26A 3CMCO 5LQRA 1F12A 4LJ5A 1EVIA 2DPGA 2OR3A 3OA0A 4QRIA 4KR7A 2D8MA 4D0GA 1BE1A 1P7CA 3KM0A 3RC9A 1XRQA 5EHZA 5IVHA 2AW3A 1GOTA 3KR9A 5KDOA 4ZO9A 4EA6A 2SNIE 3MCVA 4XYGA 1S4MA 5F1OA 4NV3A 1X1QA 1DQRA 1C14A 2G5PA 1ZMRA 2OV2A 1BDJA 4QYSA 4YX9A 4HZUB 4XTCS 2QRVA 1IRXA 2JIOA 1A8IA 3WWOA 2BGNA 5JSKA 1F4VA 3CCEB 2H57A 1T15A 4ZOLB 1UPXA 5KJ1A 1FS4A 3ICVA 1DUVG 1R0XA 1JAIA 2ZYUX 2Q5IA 3E9YA 1DUSA 1MOSA 3C2QA 4PTYA 2IP2A 5BSMA 1UM8A 5KTNA 1EIWA 1QV6A 1IHYA 1U0JA 2H5EA 3GJYA 2FRXA 3D1JA 3JTMA 1VKJA 4R51A 2YV4A 3BDIA 1Z8NA 4O2BF 3I55B 4LRXA 2FYTA 2F59A 2W2XA 2WUFA 3RFVA 4OJTA 3RVKA 3RYFA 3SJ7A 4BMZA 4BMYA 3WGTA 3EBLA 5KQGA 1JSLA 3AESA 1BCRA 3ITEA 5K4AA 1ORRA 1Z5ZA 4UHDA 5DCWA 2FOIA 1CIPA 4DJJA 4CGZA 1AS2A 2JAUA 2VAVA 3MWEB 3ZHOA 3VV3A 4B47A 2X53S 1G21B 5J1TB 5DJ5A 3OCUA 2QDKA 1YTUA 1PEYA 4F92B 1S72B 1GGNA 4GXQA 3ZN2A 2ZVJA 3L77A 1C8BA 3AHEA 1JLKA 3DUFA 3PDIA 1YC2A 3GJ3A 1GFIA 1XEWY 2OM6A 2G28A 3DT6A 4N47A 2ZBVA 1JG4A 3U7RA 3EGWA 2WR8A 5FO1A 1TC2A 4NK5A 5JDCC 2JFVA 2ONCA 2ZG6A 3OTHA 2WKQA 5K8VA 3MRTA 5FAXA 2CK3A 1QFXA 3QPBA 2J5RA 1SXJD 3R9IA 1L2TA 2QMEA 3AL0C 1A0OA 5DMHA 2KS6A 4FE7A 2B1JA 4RTMA 2DPYA 3EULA 1ZGAA 3RASA 1EDEA 1H65A 1YI8A 1YIAA 2C2YA 3N53A 3TLBA 2IKQA 2VAXA 2ZU0C 5A6SA 1NVKA 2X4DA 1H6CA 4O4JF 1GVHA 4GLJA 3MWKA 1JVSA 1W1UA 5EMLA 5KNBD 4BN5A 2OGTA 4JJ4A 2QL5A 1U28A 1K27A 1E1CA 5CLGA 1FS6A 2JHCA 3RKSA 5DGCA 2J5KA 4KREA 1I1OA 2JFNA 2YHIB 1C9YA 2O48X 2OENG 2VJLA 3O38A 4HDSA 1MO5A 1YS4A 4J0KA 3CVOA 1X7XA 3H2HA 3ZWXA 4PONA 3AHCA 4AECA 1WA5A 5LP6F 4IRMA 3KEOA 2WE8A 1QH8B 3R3SA 3BCRA 3RYIA 4COKA 3MWJA 2IZZA 4DCVA 5I3CA 1FVXA 3A1EA 4N0DA 2FTKE 4E22A 3AUUA 5I8PA 4NZZA 3VNSA 1I13A 3R76A 2JFBA 2Q2OA 5A4JA 1R18A 1KXZA 1NJ2A 3IKJA 1FFBA 4X92A 1SBQA 1NPTO 5FJJA 5JS1A 3PC2A 3V76A 1E96A 1W87A 1NNUA 1VGVA 2Y1CA 3SSOA 4FB5A 4ZI7B 4UZEA 2JG3A 4FKBA 1TEVA 3NTLA 2DBZA 4BJHB 1VOTA 1U9CA 2A9PA 4PQFA 1S1CA 3L93A 3SQXA 4AJHA 1JG7A 4PO3X 4XX1A 4J6EA 1T2AA 3RVBA 1TAQA 2AYXA 3D9QX 3GFGA 1YU6A 4RTQA 3FPFA 4K0KB 4EX7A 2NNLD 4NCNA 2HYIC 5JXJA 1LBTA 3NVMB 2FPRA 3INRA 4GLFA 3M0EA 4EO7A 3FHLA 1HEUA 4PXAA 3R75A 3WLTA 5K0TA 4H35A 4PLPA 4J91A 5ANRB 4BKMA 1A9QA 5K3BA 1OHHA 4OXXA 3WLAA 4IBOA 4P0TA 4O59O 1KI7A 3A2KA 1C30B 3I6IA 5EJFA 1A8UA 2A14A 1IEQA 3NTQA 3WGMA 2P90A 3WO1A 1DL5A 1KZLA 1TTQB 2HAEA 4BO1A 3BGVA 3AM1A 3CLRD 4FT2A 2P3OA 1TD1A 1IMJA 2CD7A 3GZNB 4QBTA 1UBRS 2PS9A 2X14A 3AUXA 4CL8A 4W1QA 4GWGA 1CQJA 2AMVA 3J7TA 3Q7TA 2C7VA 2RGUA 3F6CA 3QZUA 2FSGA 3GQBB 3U9LA 3R9WA 4CE6A 4KFCA 4UUNA 3CLVA 5KJFA 3P9IA 3LC0A 2O1SA 1FP6A 1SKYE 2GZRA 2KHZA 2WTAA 5FBVB 2AFHB 4N12A 1P9RA 2D0IA 4YRKA 3T4UA 4J7CA 1HH4A 5F73A 2IOFK 4ZMSA 2GKGA 2ZTMA 1NRJB 1RHKA 4PYQA 5I6DA 1FX1A 2WQ7A 2PQ6A 4AKTA 1KJ9A 1PG5A 1UFRA 3RLIA 5F4JA 4Q66C 4BFCA 1ABEA 3H0KA 4JI6B 1F2VA 3O21A 1JE1A 1KARA 4JASB 5JCOA 1K8XB 2AVNA 2E5FA 1MVNA 2PWAA 3ZIAD 5CYGA 4GYYA 5EWMB 2NO7A 1Y1QA 3DEZA 3IURA 4OB7A 2IPXA 2J9YB 3AOEA 1Z2NX 1ZMBA 3IEKA 1ZSNA 3V9PA 2QE7D 3I9V1 5A6VA 3E5NA 2ZYHA 3BRQA 2NV4A 1PK7A 3TAHA 2FKAA 4G9EA 1ZLXA 1U02A 3B78A 4NEGA 1G3RA 1Y6JA 1DEKA 4YP1A 4CLXA 5K9ZA 4QXAA 5IP5A 4DLNA 3GPCA 3G1UA 2OHFA 2ZRHA 1TM5E 1PJ4A 1XZHA 2CY0A 1HZZA 2I4OA 3G2IA 1TE2A 3JALA 4FBMA 5FA8A 2GETA 3ESDA 4I1SA 5LQAA 3B6ZA 5DI3A 3RKUA 1LBIA 3GA0A 3H7AA 2VDWB 4EW1A 4LSMA 2JAPA 1ZL2A 3AR3A 5FUMA 1G8SA 1II0A 5BPFA 2JJQA 4WFKA 1WZIA 4BNWA 3PWTA 5EXSA 1CJCA 1EAMA 5BN4A 1L4UA 1DAGA 3E8XA 2J9RA 1ZGGA 3HA3A 3VR6D 1E0DA 4UULA 1E79A 3V4SA 4AUKA 5HS4A 4U2DA 1BGWA 2XNJA 4MROA 2C4TA 2BFFB 4DLXA 1IUPA 4CN9A 3REQB 3WXMA 2BGJA 5KVVA 1ZX1A 2O8DB 1P4MA 3ZDBA 2AOUB 1FOEB 4FQ5A 4L50A 4LYYA 1Q7RA 3MWDA 3W5VA 2IE8A 2E6KA 1KPHA 5LWHA 5LDDC 3AM3A 3GJTA 4TTIA 5EXDA 2CJXA 4U1RA 2Q3LA 3CRRA 4I4IA 4QATA 1I4LD 4CODB 2YY6A 3A2LA 3U3OA 5KQSA 4IP0A 5DTMA 4XDGA 4ZHSA 1W49A 4EUFA 4XD2A 1Z39A 4RTRA 1ZNZA 4YJ3F 1IY2A 2DF8A 3GRAA 2JH8A 5ALUA 2D74A 1J0CA 2YV3A 1LNQA 3HO6A 2VNIA 1YJCA 3VC7A 3W8DA 3WWZA 3BVPA 4C0JA 2VDOB 3TTYA 1JKMA 3UYLA 2D2VA 1QC5B 1EIZA 3GVIA 3EPHA 2IPLA 3WS7A 1W4CA 4C1BA 5BSHA 4N5HX 3DE5X 4FBGA 3REQA 2C83A 5KS2A 2DY1A 1D1PA 2Y77A 4P38A 2YYYA 2CVHA 3VKGA 4BQSA 2Z3VA 1RCTE 4ZEXA 2RHCA 1XE3A 2Q2VA 1EQAA 3AR7A 3MB8A 4H1UA 2VDJA 1J97A 3DZBA 4UE2A 2VYNA 5AM2A 3BMNA 2BD0A 2K2QB 4G8CA 5ALWA 3O8NA 2B0JA 3A8KA 1WXFA 3W8RA 3W05A 3VNAA 1B15A 3A31A 4G1BA 4L5BA 1OH6A 3CC7B 1P9WA 2GA8A 2JANA 1V3VA 3JZAA 1A8QA 1OWLA 1RBZA 5DLEA 3VR1A 3FMOB 3OOSA 5IJZA 2R6JA 3JQ8A 1CWUA 1PQYA 5LYYA 3RPEA 4DNFA 4TMZA 4I8DA 1I24A 5JFGA 3M83A 2GXUA 5JZOA 2CFOA 4XGQA 1VG9B 1WOYA 3OAAA 3I73A 2XVXA 4XJSA 3AL2A 4V2UA 1ZGJA 3DDZX 4JA0A 1NWCA 1XTUA 2DQSA 2G4CA 3K9GA 5E7QA 5G0SA 3AF4A 4UM7A 4BQNA 3AFMA 5D3MB 3IVMA 6REQB 3PEEA 1JKFA 1M54A 3A6GA 2EZ4A 3CG4A 4MUBA 4PSVA 5TPWB 5A4KA 1RRVA 5JIBA 1DT5A 4ZAXA 1GSIA 1HLGA 2PAAA 3M70A 1NQOA 5EMMA 2HMVA 2WFMA 5U4QA 5BOSA 2VTKA 4RMGA 4Y6RA 3J81A 1L5OA 5ED0A 3GRZA 4B6OA 4UAVA 4QE3A 7REQB 1HC7A 1SVOA 2C2MA 1VA5A 3R6JA 3P2IA 2J08A 5HVNA 4F11A 2XHZA 4CM4A 5CH3A 3TUJC 3UJNA 5KDDA 2QM8A 3JQAB 1EZZA 3EG9A 1HL3A 1U0SY 3PLAE 4ZRNA 3QYJA 2INGX 4R8RA 1WUIS 2Z2KA 2DCMA 1K73D 3HBLA 4KN9S 4PBTA 4QOIA 1G9XA 1SC1A 2J6BA 3EGDA 4DM4A 2R00A 4MMZB 4WWHA 1B1AA 3NASA 4ND8B 3EXFA 1G20B 4U8GA 4C22A 4J49A 2N3ZA 3AKDA 2VZEA 4UTZA 2PS1A 2Y68A 3ZW8A 1VZ3A 3WWEA 4ARZA 2H6EA 1NR5A 4G01B 3NVDA 3KT0A 1NUSA 5DPMA 2FR8A 3N59A 1SXIA 4TSFD 3AC0A 4P1VA 1V26A 3TTUA 3Q15C 2IPNA 4C2BA 2OHVA 3GNLA 4JBNA 1U2GA 3MMXA 1BQEA 1G6OA 4LSGA 2ZUTA 3W06A 5AVVA 2EIXA 3TECE 1J56A 1QS0B 2WHPB 2QTFA 1PEKE 3D6HA 3L4BC 3BL5A 4WOJA 3FPPA 3IRUA 1MORA 1ZOOA 1S8FA 3T06B 4J0CA 2G36A 2HV8A 4OFWA 2BCGY 2HIAA 3PQ7A 3HFRA 1U3TA 2MHCA 1ECGA 1Z28A 1YB7A 2VUTA 3FNEA 3QUTA 1UAGA 2GX6A 3PIRA 5I9TA 5NLLA 2ZT7A 4BPRA 3P71T 3UQYS 3EXG2 3S1SA 2DH5A 5AM1A 2C04A 4QOSA 4N40A 1B3BA 1RR6A 3ET4A 2OCKA 4TMFA 3T7SA 1J49A 3H1EA 1VJ1A 3MTBA 2N46A 1PKXA 2V6MA 1GQFA 1G7TA 3EPKA 4A7PA 3C1OA 1BXGA 1X8XA 4F8JA 1FP2A 3GFTA 1OA1A 3NNNA 5F9MA 4DEXA 5C8XA 1CIJA 1U63A 3ITNA 1EFLA 2EX4A 3F4KA 4DYVA 1AT1A 5AI8A 5EUQB 4PNEA 3KB8A 3TYXA 3FTCA 1NMZA 1OC2A 2FPSA 2WT9A 3QBJA 3R3XA 4N5LA 4QM6A 3LGXA 1EK0A 1YHNA 1SHJA 3GA7A 1JG1A 3W7VA 2JLBA 1OIXA 2V45A 4CLOB 3G0BA 4N5IX 3S2GA 4IDHA 5IJXA 3JSAA 5FQNA 4XIIA 5H4HA 3T5BA 2X5OA 5FA5A 3D59A 3L2OB 4TYNA 1XMSA 3NDJA 4RF3A 2VG8A 2FPLA 4ENTA 2LZJA 1W1IA 5LMUB 2CZGA 2O59A 1J33A 4QJ4A 2EX0A 1BVUA 4XW2A 3ZVNA 4C7OB 3DNPA 3LWNA 5F4MA 5JQGA 2OLJA 1X7XB 4UMDA 1FYVA 3IO5A 4CM4B 3HKDA 4W5QA 2R1ZA 4ZOAA 3MWYW 4YMIA 1DLIA 1UJMA 1Z7BA 2DH6A 1KJYA 1SG6A 2PYZA 3ENWA 2PSFA 4QRDA 1WB6A 4B9EA 3LF1A 2B8NA 2O2GA 1FNBA 2Y05A 4YJ2F 2E1PA 3OJEA 5J5AA 3ZWVA 3GUUA 1PGNA 4RVCA 3ZV6A 4WZKA 3EEFA 4C0SA 3NANA 5HP4A 1N2OA 1JHXA 3SYLA 1U04A 5T3YA 4B79A 1C4XA 1VIDA 4EARA 2XVYA 1JT9A 1AQYA 2ENWA 3C7CB 3TQRA 3UOWA 1MQAA 4JT9A 4LHEA 5K51A 2XLBA 2KVOA 4PSUA 3I2GA 4TUYF 4CQLA 4JY7A 4XGIA 3DFIA 1GPKA 2QUKA 1UFVA 3K4QA 4DE5A 5GPBA 1ABFA 1ZL0A 1JDNA 1V1MA 3ZNNA 5BW8A 5HQ3B 1LVGA 4TTTS 2KX7A 3E3LA 5AK0A 1VKZA 1U5BA 2EEZA 2I67A 3EAFA 2JFWA 1R0SA 2JGJA 4LJLA 4RJJA 1CW2B 1GZ3A 5K3AA 4DG5A 8AT1A 3OF3A 2ZRLA 1H2RS 1E9CA 1C1YA 3AINA 1PJ3A 3IQHX 3KEFA 1H4VB 3N58A 4B83A 4ALMA 4GVXA 3MWLA 5DNDA 4XFKA 2CJFA 2R11A 3G71B 4RHUA 4IDBA 5FL7A 3W2FA 3OCXA 3P9YA 5ALLA 2A33A 4WVLA 4Z9YA 4DM3A 1QRSA 4WZEA 5E4FA 4YWHA 1PGPA