2CC2A

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
290
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGAGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Substrate specificity in enzymatic fluorination. The fluorinase from Streptomyces cattleya accepts 2'-deoxyadenosine substrates.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 75
structure length 290
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2cc2A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2cc2A01
2C2WA 1RQRA 2C5BA 2Q6KA 2V7VA 2ZBVA 2Q6IA 1WU8A 5B6IA 2C4UA 5LMZA 2CC2A 5FIUA 2V7WA 2C5HA 2Q6LA 2F4NA 2WR8A 2V7UA 2V7TA 2CBXA 1RQPA 2V7XA 4CQJA 2ZBUA 2C4TA 2Q6OA 2CW5A
chains in the Genus database with same CATH superfamily
4W7SA 1KOFA 2CBGA 1Z6YA 3LKVA 4OTZA 1N9GB 2VQSA 2Y0DA 4UXJA 4XIFA 1UM9A 4BO1A 1G2PA 2XR1A 1KO7A 1E0JA 1Z83A 2OBMA 3P9PA 4XTRA 4XUEA 4CFSA 5C7LO 1MHTA 4KH1A 2QR2A 1EVYA 3KTDA 2YYZA 3WYFA 1G3MA 1NVDA 3IOYA 3QKSB 1MO5A 1IRXA 1N6IA 1DQYA 2FRXA 2YJZA 3JQ9C 3PPXA 1T13A 1CFZA 3I5AA 1JIUA 1HL7A 3EIUA 4BMOB 2GVZC 5K20A 2YXBA 3IPRA 2O07A 1LQTA 1U6JA 2QVGA 2WTNA 4DWOA 1FFAA 2ROQA 5FNVB 2QVZX 3CBQA 2EKBA 3KAJA 5COQA 3SS9X 4UEQA 4I08A 2OTJB 1DC3A 3OPVA 5ARCA 4UTNA 3FI9A 5TEVA 4M0LA 1NUHA 4FVTA 4B87A 3K94A 5AUOB 3EPRA 4G5OA 1JR2A 2WU4A 1YAJA 2IS6A 4RVHA 2CE2X 3ZJTA 2O2GA 4CMJA 4TTRA 1D0VA 1P19A 2I22A 3ICVA 3ZYCA 3WGJA 1E3WB 4H16A 4U2KA 4LNHA 5L4SA 2PMBA 5GV8A 2PCLA 3OE7D 4HDNA 1JTVA 3ELBA 4TSFA 4A0FA 4KDCA 3JV7A 4HR7A 1U0FA 3LUKA 2UYHA 1XTUA 4WKGA 1TNDA 2AE1A 3L7AA 1G8MA 2R7AA 4M9UA 1P7YA 3BH7A 2QDXA 4X7BA 5EPOA 4KREA 1O58A 5KYWA 3ZY6A 2MTBA 1G6Q1 2YXLA 2CXXA 2FUG6 1NIPA 1Y3CE 3UV3A 3WRYA 4BU1A 3WV4A 1F3LA 2J6CA 3HBFA 2FRVA 3AKEA 3WK6A 4BRWA 4ZZ2A 3P45A 5T4EA 1NXXA 3BC9A 5EEHA 4ZI7A 2B36A 2GSDA 4Q4AA 5JJBA 3GFBA 5HYVA 2D8MA 2Q4RA 1BU8A 4FFSA 2JRCA 3ESYA 4LS3A 4DMHA 1AK1A 1XDBA 1RCFA 2J6HA 1Z08A 3HR8A 4IWYA 4B6RA 2KSQA 3WLSA 1RLTA 4ZODA 2ZS9A 1T5LA 3R6WA 4FHDA 4ZCLA 5DM1A 5DFAA 1CQJA 2E4XA 3LOQA 1TZCA 1AK9A 2CL0X 2DKOA 3IHKA 3NFYA 5DBEX 1YJBA 4GYJA 2YY6A 1KDVA 2ERYA 2CD7A 2H0AA 3D6JA 4EZEA 3H9JA 1E2GA 3OUTA 4ZU3A 1HR0B 2NXWA 2VK1A 3V1MA 4XVCA 1ZMOA 3MJTA 1E3MA 3RTBA 1KNXA 1KZ9A 1RYFA 1ZKDA 1A7UA 2J1LA 3OI7A 1WKCA 2F3TA 1PNRA 2QN1A 2Z83A 2O3SA 1H23A 1MA0A 5IU6A 1SBHA 1POWA 3FCSB 1TKBA 5JZSA 1FFWA 1SM4A 2OCKA 1K92A 3GP3A 3WL3A 3KJHA 4HFRA 2HRBA 2WF8A 1M67A 1RI3A 1C0KA 1VF7A 1EGHA 5G53C 4DA6A 1W88B 1YB6A 4HYTA 1W1IA 5EGSA 2ONKA 1O1YA 1TMKA 1ESZA 1UAGA 4EI8A 1PUXA 2WZCA 2BZSA 2ZSUA 3GHHA 3A32A 2WV7A 4RLQA 4TTVA 2ZI5A 1CJSA 4QDZA 1G2IA 3RQSA 4EHHA 4P6YA 1KAOA 3HHPA 3HLTA 3LQ6A 4Z4SA 1VE3A 3PQ6A 2DYKA 4R98A 3W06A 3S44A 3BXEA 3RAFC 3WLRA 3BE5A 1Q22A 2UZ1A 3CZRA 4ISCA 3RRMA 4BGDA 3E22A 2UVDA 3QVLA 4FBGA 5LBIA 5H9WA 3VJRA 2A78A 1RD4A 5DJ5A 2O1XA 4FX2A 1G8PA 3OCWA 3CLTC 4RPIA 1A9ZA 3F3MA 5IASA 1AK2A 5TQ0B 2GA8A 3E3LA 1YJ9B 4Z4IA 2B30A 4Z99A 2VBIA 2A84A 5J1SB 1GPYA 1M5TA 2ACWA 1DOAA 5JXHA 3F46A 2NXCA 3TTTA 4FMDF 5EJFA 1JR6A 1ZMXA 2HCJB 2XBUA 3AUFA 4Z8YA 3VYWA 3EK2A 1TKCA 4HWGA 1RDFA 1KTVA 1LTQA 2X4DA 3PX2A 4RU1A 4DV3B 2O8CA 2R8OA 1W4CA 1EG7A 1Z5ZA 1FDVA 2G08A 3ETEA 3PKZA 3E05A 4GQIA 4IGKA 5KNCD 2AR9A 2JJ1D 4JU8A 2QRPA 1TU0A 1MH9A 3H75A 1RVV1 3FCUB 3WSWA 5L4LA 2CZQA 1XCOA 3NVAA 3M4YA 4KRYA 3MN1A 3STUA 3RYHB 5EE3A 1U5AA 1HPLA 1OJ7A 2OESA 2Y1FA 3RO7A 3QG5A 4PZAA 4RKQA 3SEFA 2P77A 3KPUA 1KI8A 2D0PB 3GG2A 1F4VA 1J9GA 1XDWA 2BZ1A 3CF4G 3K6RA 2I9PA 3OCVA 4DXAA 4E14A 3BCUA 2FEPA 2OD7A 2QT0A 4Z54A 2ZE5A 4UM5A 1ZVJA 2AG5A 4YRBA 1A8SA 4UM7A 4FSDA 2HRQA 3G2PA 1TT7A 4ZOEA 5JNRA 1TIPA 3GLIE 4RGYA 4Z0PA 1FVXA 2HLHA 1XZNA 3V42A 1USIA 2UUBB 1V4NA 3H2ZA 1SCBA 3CUVA 2NTJA 5HSGA 1MV8A 3GZNB 5BYBA 4Y0AA 3V4VB 3TPFA 1RRGA 3I34X 1T36B 2ORED 4DV2B 4UUNA 3PQ5A 3WBJA 1GADO 4NVRA 2GN4A 2SCUB 3E0XA 4MV5A 5CFLA 3MTBA 1CRPA 1O6BA 1M2OA 1XHFA 2CNKA 1V3TA 3A8KA 3I64A 3T5BA 5EG5A 3TN7A 1DXYA 1T0JB 3E5HA 3OF5A 1V48A 1NV9A 1V8DA 2XMQA 4KAJA 4UAGA 3DBRB 4CNBA 4DBLC 1T9HA 2R3SA 2TS1A 4NZMA 5E9QA 1QMGA 1RC1A 3BRSA 4N6NA 2DZDA 2PWBA 4QQNA 4C4ZA 3PUZA 1JFVA 4QUEA 1U7DA 2PS1A 4EELA 3EPPA 2O3RA 3D0KA 5FUXA 3UZUA 3TR6A 1K2WA 3OBIA 2JLRA 2NWQA 2VTBA 3MYYA 1Y5LA 4QBFA 4NPAA 1NNUA 4P32A 3KYCA 1IY9A 3AUTA 3IT1A 2OXIA 3NHMA 5C37A 3A11A 1TTPB 3S68A 5A5EA 4V0NA 2ZIXA 3CP2A 1CBUA 1JQBA 2W5UA 2V7VA 2JIBA 1UPTA 4W9RA 2Q0SA 5ALLA 4CDNA 4CZ2A 1R4NA 2H07A 5B1EA 1FPQA 4PLFA 1PQWA 3PUKA 1L6RA 3TCNA 2O7RA 3JD2A 2J41A 3K9WA 1S2OA 1XRQA 3IEKA 3QELA 4XEUA 4YQYA 2AT1A 4OQMA 4B35A 3G2JA 3WOVA 5JADA 1VI5A 4L73A 4YPFA 4NYJQ 4QXOA 5H83A 3VJLA 2F2TA 2RKBA 2BWJA 4LYYA 1YHQB 1KAHA 4JX9A 3HACA 4MDHA 5FULA 1XHLA 4COKA 2PUFA 4BZWA 1SPBS 3X3HA 2XXAA 1S9DA 4AQYB 4KQMA 2CZCA 4P4UA 4P0PB 4PWZA 2Q9BA 4N65A 3TTUA 3MFYA 3E4DA 4LVCA 3KXDA 2GLUA 1UMKA 2FPIA 1XF9A 3BB4A 3KYDA 1CUEA 4OGLA 4XWOA 1G21A 1FC0A 3RAPR 4D0RA 3GMTA 1JSCA 1KAQA 1RQXA 2WYWA 3TSCA 3WLTA 3KWFA 4B80A 3GVPA 3M9WA 3JTMA 4QQKA 5BURA 2GNPA 3X1MA 2QZZA 3TWOA 3HYTA 1DEHA 1C4XA 4DBZA 4DNPA 3LYUA 2CYBA 4CU2A 4QQFA 2FCAA 1KPHA 2GESA 3H8VA 4MR7B 1KFJB 1XCJA 2AS0A 3ZOKA 2A9QA 5GJCA 3ZK9A 2AJDA 3H9BA 4GS5A 3IMEA 1JPUA 4XB2A 3DEYX 3OKFA 2WNIA 4FSXA 1VQ8B 5CTJA 3ZD8A 2J9FA 4XAQA 4G5FA 4GP9A 2EQAA 3AOGA 1OXVA 2ZWIA 1U94A 4K2HA 1OFUA 1O5OA 2O2IA 4AUNA 4BXOB 3FIJA 5F64A 4MKFA 1TIKA 5L7TA 2WP8J 1C0LA 2FLWA 2JDIA 1KAEA 4HDNB 4HZGA 5DW0A 2H4JA 5KDDA 3SDSA 4DJAA 4B7AA 3KQSA 4UQLA 3RT9A 5A5FA 1RHMA 3KXLA 2IK8A 4CI0B 1HEIA 1ZNWA 2WDZA 2OC4A 3EISA 4OXIA 4CUZA 1FJ2A 2AOXA 5LP6F 4FGJA 4U2GA 3I04M 5IUNC 4D9BA 1A2OA 2VSFA 4KN8A 2QL7A 3M4XA 1IOVA 4NULA 5IPFA 1PSDA 1D1SA 2P7IA 4MVJP 3WOHA 3A3NA 4UBMA 2FDRA 1D2NA 4ERNA 3DOCA 3ICOA 2WP0A 1R66A 2Q3MA 1ZGJA 2VJKA 3SX2A 1V5GA 3SLKA 2VT3A 4ZI7B 2X4IA 3JQCA 2EZ9A 4ZVPA 4UOEA 5JV5A 1JAHA 2FWNA 2J67A 1F4PA 3FOWA 5DLEA 2QZJA 1EX7A 2FQ1A 3Q12A 4HAYA 3HXMA 4LNUB 5BSUA 1Z15A 2H2GA 3OP4A 3KCNA 5ALUA 2XQVA 3ONUA 1AT1A 2OP0A 2V4ZA 3BH4A 3N58A 3ZU3A 1DX6A 3V8RA 3IAUA 3NHLA 3ZD9A 4E1AA 4E6EA 1NMQA 3WGLA 1MC8A 1VHQA 4UU1A 2HMWA 2OCDA 5JSYA 2Z2JA 1LJLA 1LD3A 4H60A 2JVJA 2AA3A 2V54A 5EE5B 5KVCA 2VPYA 4BNGA 4PZLA 1Z68A 4PCAA 3GWZA 4RPLA 3KAQA 3ROKA 1AIPA 1CZLA 2HADA 4PLPA 1Z39A 1ZRMA 3S2UA 1ZU5A 2JCVA 3I6QA 1FBNA 4JH0A 3RS7A 4R1OA 1VXRA 1NIJA 1O8CA 1ZIDA 2G25A 2XOXA 2DR3A 4DBLE 1H8HA 1RYDA 2F3RA 4K6MA 3ZDRA 5BMVF 1Y8QA 5L3QA 3J80A 3A3GA 2WWHA 2BCJQ 2RK6A 3WGKA 2GPTA 3PGXA 5FORA 3OAAA 1EQAA 2YQ4A 1HYQA 1UDWA 2C20A 2JFWA 3RVJA 2ONYA 1GFSA 2R79A 4ECAA 5TXGA 4S1PA 4QGSA 1C3XA 2QRGA 1KK1A 1BWSA 2PANA 4JNCA 3I9V6 1L1EA 1S8NA 1UFKA 3HVJA 4RAQA 2HX1A 2FKAA 2DHCA 3TLYA 3SWWA 1Q9SA 3Q3HA 3IA2A 3PPVA 1T43A 1IH8A 5D00A 2UZ1B 1VDZA 1ZGAA 5JXIA 1IN4A 2I76A 4Y6QA 3RS9A 2JG3A 3E22B 3P9QA 2C07A 3FWNA 3UTDA 4DB2A 2DHQA 1OAOA 4YMVA 5DXJA 4MGKR 2VT2A 4MZXA 4MMYB 4JSRA 2VK8A 3F6YA 2P9BA 2RKOA 2B69A 1E1NA 3MT7A 3CW2A 1K0FA 1JBQA 1C7ZA 1E3JA 1YNOA 3KEFA 3SC2A 5K4HA 3L7KA 3QKTA 5CX1B 2ZAOA 3S6JA 5LYJF 2B4QA 3B2EA 3WGMA 4KWHA 4MDFA 2P5TB 2O8CB 4P84A 1D0SA 1E3IA 2ZEJA 5IMBA 3N07A 4PS0A 3G8DA 5KNBH 4QODA 4DLKA 3QHPA 3LD9A 3RKSA 4ENRA 5BV0A 3ZBTA 4A8HA 4I99A 2PLNA 2Q8NA 2B2XA 3PUJA 3OPMA 1JHXA 4ZYWA 1NR1A 1R0BA 2R4TA 4WECA 4QX6A 2CE7A 4RC9A 1VJRA 2VJYA 5ILQA 3O8CA 3G1WA 5CH3A 5LOVF 3BK1A 1FLNA 4J0FA 5K4AA 3VSDA 1NVMB 4TLEA 4OM8A 3DKIA 3R5XA 1SHTX 16PKA 1NBWB 2VAXA 4WSOA 3L4BC 3VZSA 5KYXB 1VQPB 1OREA 1ZKMA 3D4OA 4IHKA 4EYKA 5IW8A 5BV1A 3U7GA 2QIPA 1NAHA 4XR9A 3JZMA 3MTAA 2QNBA 4KWEA 4DZZA 3EXFB 4H3KB 4BO8A 2AKYA 1TC2A 2BISA 2W8ZA 2J6BA 4NYIQ 1NF9A 1O3YA 4V0SA 4DLZA 4V0QA 2V0CA 1XRJA 3F8TA 3NPAA 1OIWA 3N3AC 5IYZB 4E31A 1M2OB 1IUNA 5DXFA 5JLAA 1W5FA 1PT5A 2V7BA 2D7CA 2WYVA 1FMLA 2VZ0A 2A4KA 1LQUA 4GX2A 1JJAA 1IG3A 1WOSA 4R54A 1TZ2A 2NZJA 3QQ5A 3A4VA 3PFIA 1YZQA 1TF7A 1HDRA 1JPJA 1R4MB 3Q4GA 3ZHOA 3VR6H 4TSKA 4K8OA 4Y2GA 4AJKA 4CL8A 4GKKB 1O95D 2PH5A 2ZDQA 1PS8A 1RE1A 1NYLA 4L95C 4NE9A 1M6EX 2O0LA 5CNIA 3RHSA 2JFNA 5IWAB 1AQUA 4RYLA 4GWLA 1UADA 2ZIXB 2H5LA 1KFKB 3C6QA 5JCPA 1E6LA 3GU3A 1DJOA 3VPXA 2FMIA 1G3QA 4ADSG 4EA8A 3IT0A 5CLHA 2I66A 1EVLA 1X7HA 1TCBA 2VYFA 3EXEB 3GEEA 3I58A 1DAKA 3A8TA 3IVMA 3LKZA 4D9EA 1UD2A 3ISJA 3W05A 1JAXA 1KJZA 1OIXA 3QELB 1OH6A 3TI9A 3T7IA 3ICEA 1DMRA 5HTOA 1ADBA 2G9VA 4PZZA 3TZCA 3DZBA 2DTEA 3RU3A 2R62A 3FVQA 4D8TA 3EF0A 1I4EB 2IE0A 1KH3A 2RGBA 4UCQA 4YECA 5FWNA 4XGQA 2TRSB 1FA9A 3LXMA 2XXAB 4B3FX 5FWAA 4E21A 1RPTA 3KLBA 4E5YA 1MW8X 2D62A 1P6QA 2DR0A 3GARA 2L19A 4MKGA 4NTZA 1E5LA 3PKJA 4QRDA 2E0IA 3ZDYB 3KL9A 1MX9A 3VGPA 4CQMD 1HFKA 1ZH4A 2C4VA 3QE2A 2AZDA 3FBGA 3EH1A 4JY7A 1LY1A 1CR1A 2RJOA 3HYCA 3GUZA 3SSNA 4PPQA 3RVRA 4N6GA 1OVGA 2PGAA 3WWYA 1KPGA 1V8OA 4MMZB 1Z26A 2VJIA 4H7FA 2ZK7A 1I33A 4FEGA 4QUZA 2QVLA 4N0EA 4AXBA 4L8FA 3EDYA 4PYLA 4YRFA 5M29A 3PA2A 2YICA 4NJMA 1VQ7B 4S2UA 4LZZA 1V25A 4BWFB 1N2CE 5DS0A 4IIJA 1X8LA 4RLZA 4IOMA 4LRXA 4FGLA 5IYRA 4MWEA 3S4YA 4OPOA 3Q5DA 3SJ7A 4D4JA 4REQB 4PRZA 1BSVA 1CEQA 4ZDWA 4P4SB 3BY2A 2D1SA 3G5LA 3IL2A 1QG4A 1Q0HA 2ORVA 1YOVB 1TADA 2C0QA 3F6PA 2HGSA 1DQPA 2ZS8A 3R7SA 1EMDA 5GONF 2ZIVB 3KQVA 4NYMR 3WRWA 4GG1A 5KBYA 1R0XA 1SAYA 2B5WA 1SG6A 2H1WA 4BPBA 3DAFA 3Q15C 4UC0A 2GDZA 2BI7A 2B37A 1A9PA 1JHYA 5EUQB 2ZBVA 4Q5IA 2F1LA 1CY0A 1RQ7A 5JYCA 5JATA 4AJPA 2BM1A 3BGDA 4FLMA 4LFAB 5CHEA 4O2BB 4FFOA 4IXNA 3VAYA 3LDGA 4KE9A 1SVSA 3M83A 4RACA 3ZWPA 4BLVA 4D02A 5HE9A 4PZYA 4ZD6A 4LJLA 4UFOA 3UW1A 2RG7A 1YJCA 3TPCA 2QSZA 9LDTA 5JNSA 1YFJA 3S2SA 2O59A 3ZDXB 3PV0A 1HMYA 3GFFA 3QYFA 4QUDA 1T25A 3H5VA 5KX5F 4DR6B 2AR7A 2OSVA 3PIIA 3UTCA 1FX0A 3K8OE 3QPUA 3P7MA 3UICA 3W5VA 2ON6A 1ZEMA 3PC8C 1ZK4A 1I8DA 1KVRA 2OECA 3G79A 4P5PA 2VZ8A 2QR3A 1Y9DA 2FU5C 1KHHA 3ZWWA 1VP3A 1GUZA 1EP1B 2QENA 3GRCA 3INTA 2X6RA 4D45A 3NJ8A 2VATA 1VPEA 3B85A 4P34A 3BRQA 3HZOA 2ZM5A 3JQ7B 4RGVA 2BL4A 1YVDA 2PQMA 2QM3A 5C3MA 1B2LA 2GJRA 3F78A 5TQ2A 3ELDA 4OGWA 4GX1A 4Q1VA 4BGUA 1BXGA 4R9RA 1GPBA 4DG5A 4C7OB 3I9LA 5MFPA 4HCJA 1BVHA 1D2EA 3W6NA 4P7KA 4LW8A 1T34A 2HSEA 3H0EA 3Q9LA 4IH1A 5A89A 1AN9A 1IJFA 2EYUA 2HJWA 2VRBA 4NH4A 4P98A 4QELA 2YIVX 5LB4A 4FKMA 2UVPA 4GH5A 5F2KA 4ZT5A 5IH7A 3ZD7A 4EHBA 3DAPA 4OP7A 4EDFA 5K99A 4OHOA 5JXWA 3GPLA 1UDRA 4GL4A 5C52B 3QFHA 2A5GA 4DRYA 3SKBA 1L1RA 1ZONA 2FK7A 3G5TA 1Z16A 4JP8A 2A67A 1C8LA 5D5HA 1N92A 3JWEA 1Y8QB 3JRWA 1DKMA 5L3QB 1ZR2A 3LLSA 3ZY5A 3Q3AA 2DFTA 3F4BA 3P0HA 1XFOA 3LS2A 1YRLA 4I1PA 2IE8A 2FSFA 4PGGA 1RFLA 4ALKA 5EEGA 4UVIA 1N7GA 1W47A 2YN2A 3GZJA 1G7TA 4IW3B 4WOCA 1K6EA 1ZCBA 1I01A 5CB0A 2IX3A 3ZZMA 4NEQA 3OKXA 1A9RA 4GI3A 5FFMA 2Q4EA 5IZ4A 1GNVA 1EDOA 1GVNB 1MPTA 3FOAA 4IEEA 2WM3A 4D42A 1BVUA 3FKQA 4RPJA 5A9RA 3KKNA 3HCFA 3HDYA 3A3PA 3MF4A 4IJ5A 2POQX 5E3HA 1RJWA 1NONA 2QW0X 5ALVA 4PC6A 1QFSA 2PFGA 3ACCA 1TYZA 1XDZA 2DBYA 2H54A 4MH0R 4OQNA 4C4AA 3EY4A 3FUVA 1K98A 3BIXA 4MITA 4QU9A 4QBKA 3QUTA 4PRKA 4DIDA 4HDRA 2H0QA 1JR3D 1SUAA 3M5DA 1NQVA 4A1OA 5DNCA 1JLSA 2I6QA 4TV8F 3GLKA 4RKWA 4TVKA 3IOMA 1IEWA 4KITB 2PKEA 4NMWA 2BEVA 1G8AA 4LE1A 1LPOA 1XALA 1SCKA 2J0UA 2LXNA 2XYRA 2UKDA 1VECA 3T0FA 2BKUA 4O02B 1SHLA 3TDKA 3HXTA 1GTJ1 2EBUA 5IAAA 1QDLB 2ZSFA 4M1TA 2FWAA 3L4KA 3DF7A 4IJMA 2C8LA 5CVUA 2X40A 3NMUF 1I0IA 4KV7A 5D7BA 1BZYA 4WXYB 5K8TA 5KX5A 3PQ4A 4PQFA 1Y4DE 3M81A 1M90D 2G9RA 3AVWA 5ICEA 5H5JA 2P9GA 3EGWA 1VJ0A 5ECYA 4AJNA 5ITZB 4JI8B 4Q7LA 2P6MA 3M5PA 1O95C 3DP7A 2QRVB 3P19A 4ZZ1A 1JQJC 3WNBA 4HQFA 4F4UA 3OP1A 1KF0A 1DXOA 1EFRD 5IKOA 4PBRA 4B83A 5K8JB 1P31A 2PZKA 4XUDA 2VBGA 4DQXA 5AW1A 1EK1A 1DB3A 2D54A 1ZNZA 3CEHA 3UYLA 1P1RA 2NO9A 4TS4A 1SUEA 1OX6A 3V00A 4LYAA 4Y7CA 4YYEA 2KBFA 1J0EA 4XASA 5TJHA 1EHCA 4RIFA 4ZOBA 1J2TA 821PA 4KKUA 3DT6A 6PFKA 2C7QA 4Y18A 2RGRA 2Q2NA 1L2TA 2OMKA 1N5DA 3FNIA 5EHNA 4G84A 2XWBF 4EG5A 2J6IA 4HTFB 4LXHA 2O6LA 4W1SA 4KZKA 1YHYA 4G0PA 4DT1B 1QU3A 5C18A 3SJBA 5FWYA 1YJ8A 2BFNA 3EEYA 4JJIA 2CV1A 1PCXA 4HVTA 4AYTA 3SF0A 3CC7B 2ECOA 2OYRA 1JECA 3P97A 3A9VA 3QY0A 1XJQA 2K6GA 4I8XA 5KJ6A 2WSBA 2GAOA 2HA6A 2ZRGA 4XSHA 4YDQA 5KNDA 1SQ0A 1NJ6A 4I4LA 3OX2A 1A5BB 2FR1A 2OM2A 4B46A 3TCXB 1EVJA 1FMTA 1TC1A 2NPOA 3BMNA 3G6KA 4PCVA 3TVYA 1JG2A 3OQMA 2VCEA 3H1FA 2HUPA 3UWDA 1G4UR 2EU8A 2VSYA 3A2NA 2ZJ4A 5H3LA 3RDPA 3SZRA 1B3RA 1NVBA 4E5PA 3J7AC 3FY4A 4FFPA 4OXQA 1GTRA 3PFFA 4GVXA 1U9YA 1IMOA 3Q38A 1TW2A 1RLIA 2WJHA 7MDHA 2P4QA 3L7NA 3OIDA 4HNAB 1KJIA 1M2KA 4YUWA 1W2WB 1R9MA 3U4CA 5EJIA 2RHWA 3RE1A 1TAHA 1SXGA 2QAGA 3TLXA 3ZU6A 2B8WA 5JAMA 4XKJA 2HEGA 1XA4A 4Z2YA 3PGVA 3FMIA 1GYRA 1DWQA 1RAEA 2Q1XA 4ARCA 3DT8A 4WWVA 1LZKA 3STHA 3O3CA 3W3ZB 2H92A 4MYUA 5REQB 4E46A 1YRAA 2JIZA 1TD9A 3DTVA 5AKKA 3LT5A 5K3BA 5F5NA 4CKXA 2W43A 3ZZTA 1UM8A 1Z8DA 1SVMA 1T6ZA 3CJQA 3IAM6 3KDSE 1D4ZA 3FVRA 5U4QA 4EG8A 3MRSA 2DQYA 3WMEA 3C16C 2QVBA 1UP6A 2PYZA 3OOEA 1IIRA 1LQ2A 2F7SA 1NQ5A 2A0YA 1ZUNB 1DTSA 5LDDC 1E1DA 3JVVA 4IG4A 3B2QA 1RM4A 1IDN1 1G16A 3C6BA 3N2IA 4LYEA 3R5JA 3DMGA 2Z9CA 3OEEA 1PSZA 1XZKA 3PA6A 4B40A 1E5XA 1NXOA 1UXGA 3ZDQA 1Z38A 1JQ3A 3GV0A 4Q00A 4G0WA 2H8KA 3BAFA 1RCUA 1G64A 4M60A 3L0SA 4XGIA 4JI3B 4BVJA 4MW7A 2BI4A 1WM1A 3QPAA 4DY4A 3L7IA 5BRJA 2B82A 3TX6A 4GKBA 4IZHA 2P0YA 1RRKA 3U9TA 4H7PA 1G98A 1IHPA 5KQSA 4EEZA 3E9EA 3DBLA 4ETWA 1SC3A 1RWWA 3R7LA 1IZYA 3NDPA 1WBDA 4C7JA 3EMKA 1C9YA 1L4NA 1OA1A 3AT1A 2IU3A 3NBKA 3RPEA 1E4VA 2CXTA 4FCVA 1I6WA 4QATA 1FX0B 3B1KA 5DYYA 1PYDA 3K9CA 1KY5A 3FHJA 2CUTA 2YHAA 1FRQA 2OXEA 2YNMA 5IAJA 4YYZA 4TT3A 2HOQA 1B43A 3GRAA 3G2NA 4R8MA 5DGDA 4H08A 2XTNA 4U5XA 1XMXA 4UASA 3BSFA 3O83A 4I1IA 3I39X 1IWBB 1QYVA 2WU0A 2ZSAA 3HKBA 4J7CA 3WQZA 1XZGA 5B3JA 2QTLA 1HZJA 4CODB 2XNDA 2FX5A 4I1UA 4JI2B 1AS0A 2VUSA 3IDSA 4XMYA 3UV7A 5FYDA 1FMJA 4ZI2A 3SSAA 1IY2A 4F7DA 1IFXA 1FPMA 3IILA 3N2KB 4YV1A 4Y6GB 2JC3A 1RC8A 1UQTA 4LXIA 1XUOA 1RKBA 2XGGA 4C76A 2GCEA 1S8FA 2IRWA 6LDHA 3FOFC 2GARA 2UVPB 5IJZA 1X87A 1XP5A 1J22A 3BMQA 3IUPA 5FBKA 3QXJA 3O1LA 4KSCA 3SQLA 3PUNA 3DBIA 6ABPA 4IUDS 4U7GA 4ZO7A 2CL7X 2LCIA 1YBFA 3UUWA 1GGJA 2GM3A 1GPDG 3W4JA 4Z4CA 5J5AA 1F7UA 2GNOA 5FOSA 4BQPA 2C2HA 1FVOA 4DB4A 5H80A 4Y67A 4LX0A 2MT9A 2CFTA 2GX6A 1XXHA 1N5LA 1XRLA 2I3GA 4BZZA 2VPWA 3TD9A 3LMKA 3LWBA 2SHKA 2A0FA 3A6FA 3C39A 5TRTA 2VYVD 2VAVA 3FUTA 3S2FA 4DPKA 3N74A 4IMIB 3IJRA 4GGOA 3LA8A 3JASA 2BFBA 3NWEA 1EH5A 4CWAA 4Q1FA 5T57A 3KVYA 2WYRA 4NHOA 3JQDA 4FEEA 4DNQA 3OIGA 4C22A 3QVSA 1C3JA 2QLTA 1BEEA 1W2HA 1D4AA 1L9KA 1ZINA 4XJXA 2B4TO 3B7WA 4N39A 2EERA 2QTBA 1SUDA 3L3BA 4HEJA 4CR6A 4K9LA 5CU7A 4BQNA 5DX0A 1RI4A 4DM7A 1D3AA 3H1PA 1ABEA 5BN3A 1EDBA 3R23A 1FOEB 4HAVA 5CXQA 2NUTA 2ZITA 5IK2A 5IBCA 4AJOA 4MB2A 4P82A 2VBVA 3HA3A 5CIQA 3UQYS 3A35A 4RMHA 2Y9PB 3K9QO 4ZK6A 2BEVB 3USCS 2FX3A 2ZL6A 2C5HA 1DPFA 2J0UB 2WU3A 3W77A 2VH5R 4C30A 3NATA 4EUFA 2VP5A 2ZJAA 5AW2A 1IHDA 4Q66C 2JGNA 1KGDA 5A4AA 1IB0A 5AW8A 5K3FB 3TR0A 3GELA 3JWPA 1U0RA 1IUOA 1DTWA 5TNXA 8AT1A 2X58A 3HYNA 3G59A 2EWMA 3F7NA 4KAAA 2QI9F 1B74A 2HYIC 3P2YA 1UKVY 3VOSA 3ZWCA 3C4VA 3EUWA 1KOGA 2ODPA 1DV1A 1UJNA 2P0AA 3DHNA 2RHTA 1H42A 4XONA 3OOYA 2B1QA 1PAUA 2PXHA 4HPWA 4XNFA 2X2FA 4X8LA 5EJMA 2J33A 2WPDD 2GZAA 3HFJA 3T38A 4WJZA 4K9NA 3TFWA 1VB3A 3WZMA 3JX9A 4F91B 3VPBA 3U7HB 2F64A 2JA2A 4H0CA 4R81A 3FYCA 4RIHA 4RTSA 1IM8A 5TVGA 5JCXA 4JI0B 4RCYA 3KPJA 3T95A 2WG0A 3ZV3A 1I5RA 1ZIOA 4WFJA 1WE2A 5DGHA 3VRHA 4WCFA 3JQBC 3WFIA 1MFZA 1P8JA 4TQ9A 3LUJA 3UBMA 1H6DA 2A92A 2VTEA 5PNTA 3EBLA 3WLPA 2XGSA 1ZLXA 2R7MA 4IH9A 4X9XA 4CR8A 2GBIA 3IUMA 3SEAA 3ESRA 3E20A 4LJ4A 2Q29A 2BYTA 1YTUA 2EJWA 2H3EA 4JVSB 2HK9A 3MT9A 2AYZA 4PC2A 1D9ZA 2F3SA 3OICA 3WSVA 3LL7A 2RGAA 4FMCB 2C96A 2XTZA 1EI9A 4ETIA 2R86A 5ALEA 3B9PA 2VA9A 4R9SA 2JAWA 2JBAA 1XTBA 3TTYA 3NDBB 1G9TA 3EXG1 4HJXA 4P9NA 3PHIA 1W93A 2BGKA 2G1UA 4XDGA 4JXKA 4DG9A 2IX9A 5B12A 1J1UA 1IQ0A 1NW4A 4FC6A 4DREA 1JXOA 1NVKA 2GN9A 2WB4A 1QYDA 4DV7B 5KWEA 2IH2A 1I2CA 3DD1A 3KJIA 3H4TA 2GKSA 3B1ZA 1XPUA 2C5SA 2EL9A 2AG0A 2G8NA 2JFYA 3GRVA 1R74A 1W0JD 5LYYA 1E7YA 5CA0A 4N0PA 4NG4A 3RUDA 1XVIA 1YS1X 2O14A 3D4PA 1R50A 4UBKA 5C1PA 2I2CA 1UKAA 3G2LA 3OQHA 1RHJA 1ZD2P 4WUTA 2NP6A 1SBTA 3N05A 1V5EA 4CEIA 1G6KA 1Q82D 2A5JA 1KA9H 2FE4A 3NT2A 4ZYXA 1HLFA 1VJDA 3PR3A 2JFQA 3MWYW 1ZMBA 1D07A 2LBPA 4HAZA 4R1LA 2WQZA 4C6TA 3MLAA 3NOQA 1A4RA 2AX4A 2QAGB 1M7HA 4GQAA 3QWBA 2RD2A 2D7JA 4TGLA 1GGMA 3KPYA 4IHAA 4NMHA 1G0NA 3T1NA 4IGIA 4BNUA 1SCDA 3ZJUA 5B2ZA 1ZK3A 4N9QA 3U3ZA 1R4ZA 4JBYA 3TQQA 4GE3A 4RMJA 4RK4A 2NOAA 1DAIA 3DH0A 1ZGBA 5IAOA 2F8SA 4LXTA 3EGXB 3PXBA 1QV6A 2V3VA 4MHTA 4C43A 1JR3E 3JQEA 4IBOA 1UOOA 5A4IS 5I7EA 3MCZA 2H4YA 3OIVA 3AM4A 4PNZA 4LDJA 2DBQA 2YR0A 3DTVB 3Q72A 1K97A 3ZU4A 2P2GA 4BTLA 1BMFD 3P9ZA 1UBKS 3HDHA 4QDOA 3NHZA 2Q28A 2X9NA 4PZ0A 3RVLA 2GTIA 1NVVR 2CLCX 1SUSA 3A6GA 3NNNA 2WBLC 2GAJA 4GPD1 3DZIA 5G3YA 3W1WA 2P11A 2QJRA 3N0WA 1YR3A 1KEWA 2O2HA 2PU5A 3ETHA 3EXAA 1PK8A 4XQ0A 2DOGA 3H3XA 3J81k 3DQPA 5ALPA 4CKYA 2VRCD 2E1PA 1N34B 1J9ZA 4Q1EA 4FWTA 4EMBA 3S29A 5BQFA 1V7ZA 1T0UA 3GQBB 1YFLA 2JFHA 3URMA 4O0LA 3IXLA 4LZWA 1XCPA 1K7EB 2CYAA 2Y9MB 2CJYA 1A82A 4EIWA 1BH6A 2G36A 1E2BA 5I7RA 2JIMA 2NVBA 1Q15A 1TQDA 2CF6A 3LCJA 4IIHA 1AOXA 4KWIA 4J8PA 1AM4D 4MCHA 1SU7A 3CU5A 5E6SB 3HWRA 4Q39A 4CKWA 3PD1A 2IEZA 4QJ4A 1O6GA 3FFWA 4XWAA 4JLMA 5HF6A 3T3PB 2Z04A 4JGIA 4G26A 3NZEA 1GZSA 3PFKA 1H2EA 1L7QA 2UXDB 3AJEA 3K7EA 1DINA 2GGSA 2XYHA 3DMPA 1E6WA 5IBQA 3Q3JB 2ZYRA 3TIVA 4AWXA 2X8JB 4LHEA 3M4ZA 3V80A 2NNLD 2PL1A 2WHEA 1YQXA 1CQZA 3C6XA 4OHRA 4L2IB 2VWHA 2BD0A 4ZVOA 3OQPA 1M2GA 1OX5A 2JA1A 2JI6A 5HKAA 1N6RA 4YRAA 1QWSA 4UJ5A 4UW9A 3OU2A 3R74A 3OTHA 3ZDEA 4C3OB 5CA0F 2GK4A 2P8SA 1J2EA 1DC5A 4XYMA 4OB6A 2XDWA 3VHXA 4QG3A 2JD1A 3VQTA 2ZIUB 4L3OA 2ECFA 3WLAA 3PQFA 4INAA 2AYYA 4UVDA 3QEAZ 1LDYA 1BKSB 2BPOA 2W2LA 3A9RA 1X3SA 3A9TA 3FUCA 3HLYA 3MBOA 4WASA 1S2MA 1R8SA 1ABFA 1PZMA 2NU9B 4DLXA 2DY0A 2CNNA 3WLIA 1E2IA 3BMQB 1FDSA 1MW9X 3GRRA 4H3HB 4JASB 1H6CA 4IR7A 2ZIZA 4BQRA 2IIVA 2O8VA 1I18A 1UOQA 1QP8A 1W48A 2VWGA 4PTYA 3ASPA 3QVWA 4OHBA 2IYLD 5EQTA 2XCUA 1P4GA 2ZJ5A 3C3DA 4MUJA 4MP3A 3RSLA 3Q3VA 3S3TA 5MFZA 3F71A 2R87A 1E9VA 1PD0A 3KBOA 1E3SA 2K87A 1PX2A 2W6CX 2Q6OA 1KMCA 2HLNA 1XXHB 4CW7A 4WZTA 1R5BA 2O4CA 2WQ6A 3OM0A 4MVJF 4QBHA 2VG8A 5I9BA 3DNPA 3TZHA 1L8LA 2E48A 2TMGA 2HU8A 1WR8A 3KKQA 2WWFA 4O4LB 2PT6A 2QV0A 5DB4A 1ZC3A 3Q8KA 2DUNA 4YDHB 3QW4B 5HKOA 1HZEA 1URPA 1W9MA 2FEWB 2I4MA 3IQDB 1UZUA 1BE1A 1RPJA 3AI3A 1ZOSA 2AW3A 2PHZA 3LP6A 3FVVA 5FUQA 2EF1A 3OA0A 4IFEA 4WV3A 3MCWA 1NR5A 3D43A 2F8MA 4W1QA 5AJXA 5AK4A 2GJKA 2YWEA 4NP6A 3GGSA 1T1RA 2V65A 3WB0A 2GJ8A 4AP9A 1I7LA 2BP7B 3LFUA 4BNTA 1RRFA 1TFUA 3L0IB 4IINA 2OZKA 3G17A 2ZVDA 3IC5A 1T3HA 2H3HA 4WNCA 3UG6A 5K8LA 3ELYA 2QMOA 1RMQA 2DT5A 3BSYA 4GSKA 1IK4A 3M2PA 3PT9A 4OPMA 3SKXA 2GVNA 3B3AA 4BCBA 3FRJA 4HNGA 2C3YA 1GEEA 3JQGB 4IV8A 4A92A 4TMWA 3L4SO 1A72A 1PKEA 2B4KA 3FSEA 1ZD3A 1CDDA 1EUCB 3IURA 5BSWA 3VU0A 1A8UA 2D3LA 1CJVC 1DELA 1Y3HA 3BGOS 2Z1DA 4RVDA 3NP7A 2HJ9A 4QSHA 4QSMA 1T1SA 2DERA 3OO1A 3FRHA 2UVQA 3DO8A 4U6NA 4KC0A 4DLNA 4ESVA 3FHLA 1HDOA 1OI2A 1QSGA 1SHZA 2ZSBA 4WHMA 1WHTB 3HDVA 5CLGA 4IDCA 1EFHA 5HBRA 2YXEA 2HC9A 1P0CA 3SMQA 2JIOA 3RSOA 2VN8A 1S5PA 1CW2B 5DHUA 4B6FA 1GZDA 3WTCA 4LDAA 4YRDA 3L2OB 3ROFA 2PGNA 3B38A 3HBJA 2IFTA 4YXWA 1CULC 3DVRX 3CQ9A 4I55A 4DCGA 2QTVA 3T5PA 1P74A 3QMWA 4KP7A 4B1FA 5DEOA 1GAXA 1PGQA 4DEXA 3GHYA 3OOWA 5J59A 3FI0A 1OAAA 4I1SA 5A2GA 4OX9B 3L7YA 4BATA 5FJJA 4DY6A 1O6ZA 1ZWKA 4E3WA 2DBZA 1XVUA 3BXXA 4R05A 2GFHA 3KFVA 2RGWA 2JI7A 1QGDA 2VZ9A 2A1UB 1IZZA 4EHDA 4JJZA 621PA 2H1OA 1E9EA 3B51X 3PXGA 2NYVA 3GVXA 4GF5A 1VHJA 1YB4A 3R3ZA 2P9FA 4PBTA 3JQ8B 5IWCA 3HJBA 2F1MA 2CK3D 3DE5X 2YJ5A 5DHQA 4QKQA 4RS4A 4S0ZA 4W5OA 1LBHA 4C7BA 3GP8A 1SXJD 5JSHA 2CXHA 1EB9A 2OHHA 2VOEA 3JQ9A 1PQUA 1Q1BA 4Z86A 5K6TA 2J9GA 2XIQA 1WV0A 4Y2TA 3ZPNA 4DC0A 1X1RA 3E2MA 3SM3A 5JCJA 3DKVA 2DCMA 3RB8A 4RD6A 4HLQB 1SURA 4ASUD 3ELUA 1Q7EA 5DHAA 3P94A 3RSQA 2W6IA 1PK9A 3L7JA 3LC1O 1QCDA 2TMKA 3GEMA 4MUKA 3P9IA 3MS4A 2X6WA 3PVCA 3UOGA 4MA0A 3GLIA 3BH0A 4Q4JA 3TFOA 4KR9A 4E11A 3WGGA 1N4AA 3SZOA 4CEIB 3N39C 4HLUC 3HG7A 5IYPA 2R7LA 2BT4A 3X1JA 2RH5A 3C8DA 2PGIA 1GLNA 4MUAA 1P2BA 2QG4A 4ZARA 4IUBS 1AVTA 4Q7QA 2DU8A 3DW3X 3H05A 4A1FA 3CH7A 4QUKA 5ICGA 2H52A 5KVVA 3R6KA 4P12A 1QVVA 4NNJA 1NV8A 5C1IA 1WZEA 4Y6OA 4OQFA 3BJIC 1CVIA 3IPLA 3TBHA 3DTTA 3HJFA 3VZQA 1H2HA 3NIWA 3RJ9A 3OWHA 7YASA 2EJVA 2WA1A 2ATEA 4LV6A 3U4QA 4F3YA 4BIIA 4N0DA 3X1XA 5BNIA 2AZXA 1N2JA 1R0ZA 4HXYA 1Z0DA 3V1NA 2BFEA 2II6A 3EIOA 1ATIA 2BDTA 2FFJA 1WXGA 4B9AA 3M1IA 3U4DA 1V45E 1GTMA 3BKXA 2ZYSA 5EVCA 1KWKA 4X92A 2MOKA 4NCAA 1BW9A 3NQ41 1X14A 1L4YA 3KT8A 3L43A 4TXLA 1Z2CA 3HGQA 4JWKA 3TRDA 4F3CA 2BEJA 3FPBA 1AQLA 3MJRA 2OQRA 2WJJA 4AQDA 1KJ9A 2COKA 4CTOA 2E7ZA 2XUQA 4QICA 1QU2A 5I8PA 4L7QA 1C2TA 1Z4KA 3U56A 3OSUA 2I8AA 3R24A 3ZHQA 3SKYA 1PFYA 2PY6A 4MR9A 1RXSA 4IP0A 4IWXA 2P2NA 2R97A 5A3JA 5CT6A 4BFYA 1VA4A 3L9WA 4QRHA 3CRQA 5BYKA 1H0HA 2IA5A 2ILTA 1BH2A 4FFDA 1MC4A 3Q8MA 2OOSA 3ZJ4A 1Z4MA 4PWYA 2HGZA 1MB9A 4RY2A 2D4AA 5DF1A 3DDYA 2X1VA 3HPQA 1RI1A 2J9ZB 3DKPA 2DQKA 3C41J 1M8JA 3QXHA 4N5HX 4NJEA 1I30A 4ROSA 5TARA 1UPBA 1BLIA 2O05A 2YHIA 1ODFA 3E9MA 4W9NC 1MNQA 4RJTA 4Z1OA 2WIBA 4Z9AA 3PX3A 3VNUA 3BCRA 1SXQA 2QWXA 1AQIA 4KGDA 1UQUA 1M8FA 2XA9A 3SOZA 3KTAA 1MG0A 1OLXB 3PC2A 4BNWA 1K5GA 2ETVA 3FVWA 2LD4A 1XVLA 5TR9A 2VF7A 4LY3A 4LRTB 1YBMA 2BR4A 2VJMA 4R0NA 3SYTA 1G5TA 3EXHB 2IYQA 5C8YB 3T3NA 1NOJA 3OX3A 3LW7A 3ASVA 4XFJA 4F86A 2ZS7A 2GEBA 3ANYB 2OGWA 3N2GB 2D3NA 1NE2A 4R1TA 2I0FA 3BL8A 1XL1A 2FPRA 1NNEA 2BN4A 1MDFA 1YJAA 4IH4A 2B61A 1A5AB 1L8QA 1XX6A 3A10A 2PX8A 4EI7A 2HW8A 1BHO1 2C88A 1UJ4A 1ZX1A 3KE8A 5KEIA 2XWQA 3NTVA 4QDXA 1WOPA 4A8TA 2ZCJA 2C5FA 3F4LA 2D1YA 4YJ3B 2PBRA 3AQ4A 2WZNA 1A76A 2QD5A 2A35A 2CXOA 5HIKA 3TZLA 5TRDA 2WSYB 4G1MB 2OAP1 2V4UA 4GUAA 5BOVA 2DIEA 1UL1X 2AYXA 1R3DA 1WA5A 3C74A 4GDMA 2POCA 4L57A 4ZPXA 5DXAA 3GDHA 3NV7A 4DUPA 2UV8A 2X3FA 3RVNA 4QM7A 3FPEA 1QDEA 3TB4A 4RIIA 5DE3A 4J0QA 3Q2KA 4KYUA 4UDYX 3M6UA 1J8QA 1GQOA 1PR6A 3T9CA 1NMEA 1NI4A 1J90A 1JU4A 4I4IA 1L6IA 1VE7A 4I3HA 1TCUA 1E7MA 3D3EA 3HDJA 4Q82A 1QH8A 1Z88A 2LKDA 4FYJA 2GASA 2PGJA 4OBXA 4ZVRA 1KU0A 5DN6D 1LVUA 1R9GA 2I4RA 4FDUA 3WZ2A 1EB8A 3SD7A 2V7WA 1HFEL 2YVQA 3L0BA 9MHTA 1IN5A 1CK4A 1R6AA 2I6UA 2XD4A 4GSYA 1V47A 1FDUA 2JRLA 4NEGA 1NPTO 3AR2A 1KQGA 2RCYA 2QMQA 1DBSA 2YJ3A 3LT4A 4CLOA 3VMMA 3Q1KA 3ZJVA 2P9TA 1W85B 4NCIA 3AFNA 1WZUA 3X2FA 1OB0A 521PA 3WB1A 4F5YA 1EINA 2OXRA 3T1HB 4TX1A 4BMVA 1V7PC 2HT6A 3A4YA 4CM4B 5CB4F 1YVPA 3U0BA 1OKKD 4LV5B 1VL0A 3CLRD 5JU6A 5BVHA 3WGYA 1R6BX 3DAOA 3QBVA 4ZMRA 2QE7A 1TUGA 1MEJA 2ZL7A 1YE8A 4CV2A 1CFJA 1QHIA 1N7IA 3A2MA 4BDTA 2A9FA 4ZQCB 5DK6A 4DCCA 3UG7A 3FKJA 3OD5A 1G7SA 4L7VA 2XVMA 1BFKA 3AH8A 4OL9A 4QDUA 3A37A 5J5VA 3SXJA 5H82A 4PCUA 2NO7A 4F4HA 4OOFA 1G3IA 2C58A 4KQ9A 5FOVA 1YZ3A 1GCGA 3D6AA 1P6UA 1FW8A 3TW4A 4Y2YA 1NVWQ 4MV0A 1U04A 2V5AA 4HX5A 3FIUA 1V9LA 4DQVA 1JQAA 1RZ3A 1Q7CA 2D59A 4QLBA 4ESOA 4O4IA 4FQ8A 3G9UA 3H84A 2B2CA 2IBMA 1I2MA 4YLEA 2HA4A 2JZCA 1MLDA 4OSEA 4K28A 3ZV4A 5C8VA 3AP3A 2QQGA 2Z2ZA 4JI1B 1PJLA 1CY7A 3CM0A 4I55B 4PAGA 4FT4A 1SA0A 1SXJC 4YMTA 1L3BA 2IKSA 3ILVA 1XLVA 3CPEA 3E4CA 5H7XA 3AVYA 4ENTA 3AFOA 1MAVA 3ZCTA 4WESA 5C2JB 5A5GA 3KYBA 4I1YA 3PWKA 1MO6A 1DFHA 5KJCA 3B3GA 4RE6A 4G0UA 1UBUS 5FPPA 3V8EA 3OKAA 4AURA 2VCYA 1FE8A 2A0KA 5LLTA 2J46A 3PUMA 3LY7A 1THTA 3E23A 4JFRA 3E7DA 4Q02A 4K6OA 3KU4A 2JI8A 4TPKA 2EZTA 5D87A 3W5AA 1C3EA 2D6FA 2ID7A 1QH0A 2Q1WA 4DF3A 5C1OA 3K1YA 4U2DA 1B26A 3EWNA 4TLBA 4P2BA 4BN5A 2HZBA 1KDOA 2UZ3A 5L3SA 4WDQA 2BSAA 5JDCC 2BDUA 2OGZA 3BK7A 3OE7A 2FW9A 4IPTA 2LWIA 4WK0B 5K05A 1A8IA 1I3MA 3C7CB 3PUHA 2ZIEA 4WAUA 3E8SA 4YP0A 1E9AA 3UJHA 1NHGA 3CONA 1Z0FA 2YV4A 3I30X 3MG9A 4B81A 3PU6A 1P2TA 1QTNA 4L8YA 3HXPA 3M4NA 4G6ZA 3IUEA 4J7AA 2KPOA 1QBGA 2IEDA 4M1SA 4NLLA 2YIDA 2HJSA 4L50A 5F7JA 2ZG6A 1JILA 5ALXA 3BILA 3RNLA 3IKVA 3QUCA 2FFRA 3LZCA 5LLDA 3THOA 2CVZA 2AL7A 5JBIA 4KHPB 2GXUA 2IUFA 2IF2A 4LA4A 4ND2A 3W2TA 5ALRA 1AURA 2G9ZA 1ORHA 4OK5A 1MAHA 4Q21A 4CMGA 1EESA 2LUOA 1OYOA 1CDOA 1QAMA 5IN4A 3MHPA 1YASA 5CW1A 2O2EA 4J49A 3OZBA 1KI6B 3RNOA 2ENWA 3IRVA 4FI3F 2ZYAA 2JAQA 4GKVA 4O2AA 2GXSA 1A95A 1NYQA 2HY7A 4WEQA 3DDUA 1QHYA 4XARA 5EWMB 1YGYA 5FX2A 1BD4A 4B2PA 4I5IA 1VG8A 1CJTC 1ICIA 1J1ZA 1XELA 2F9FA 3HYSA 1IEXA 1Z35A 4H4DA 4HEQA 3G9TA 4AMVA 2WHYA 2ZDHA 1YITB 2ZROA 3P8ZA 1E2KA 4J4BA 2IYOA 2X77A 3RYFA 4AU1A 3PQ7A 4IMJB 4JJFA 4LGVA 3A05A 3EZFA 4LHSA 1LTHR 2IDZA 3ASUA 4IV5A 1ESMA 4YS6A 3LUCA 4TKUB 4YQEA 1GSHA 2HUNA 1K4MA 2HBZA 4D0LB 3KZXA 3GL9A 1IB6A 4BAUA 1BJRE 3LLMA 4QULA 4TQAA 3CZPA 5EIAA 4ACAA 3CH5A 2HSJA 5EPUA 5BNTA 4G24A 1MNAA 4BLUA 1EVIA 2JLSA 3OJOA 2GYUA 4JELA 5L95A 2RE8A 1BW9B 3QVTA 4Y1RB 4FNMA 4POOA 1CZRA 4MIYA 8GPBA 5JNWA 4HX2A 1E5TA 3NH9A 1VCOA 1ZBDA 4IX9A 4EYEA 2E5LB 2FK8A 2VRWA 4I19A 3TUIC 2WZQA 1AQ6A 2ESRA 1CC1S 4KQKA 2EDCA 3BJMA 3U4IA 1OXKB 4MR9B 4OQZA 3IDFA 4K05A 3BCFA 4ZEWA 2OG2A 3CCCA 2H11A 4GZMA 3SS8A 1E1LA 3QJGA 4QGHA 5LXTA 4AG5A 1IC6A 3GVIA 1GITA 4BNFA 4O1HA 3CWCA 3TRHA 4KVAA 2CJWB 1I3NA 4GKAA 4NJEB 1UBMS 4OQDA 1N8KA 5EHXA 1XMPA 2BGWA 1NLYA 1L7AA 4L75A 4ARIA 4LCEA 1N2CA 3A9WA 1ZW6A 3H11A 4OYRA 4QECA 1G60A 1WKVA 4NOJA 5L9AA 5LZ8A 2GHQA 2O2CA 4EMTA 1EUZA 1SH7A 2HNAA 5L8VA 1R0LA 1XLUA 2DFDA 2JJ1A 1QX4A 1X15A 3OZEA 1JLKA 3ZLTA 3TLGA 1D2MA 1M34B 3MWGA 4PC3A 2QY6A 3ZH2A 4KDFA 4CEHA 4HPJB 3OCXA 1SXJE 1GZUA 4G0MA 3NOOA 4WZBB 2V3WA 1KZYC 4P4GA 3R7WA 4D81A 2IU4A 2HHAA 3AW8A 1HT3A 1EZ1A 2GSWA 1TTQB 1JB9A 1L8OA 1SUPA 2Z0MA 1TI7A 1CP2A 1NMXA 2O2YA 3ETCA 4WUVA 3VR4A 3W5DA 2R6FA 3EGDA 3QNWA 2V7GA 3DV0A 3CSSA 5IG2A 5GZ1A 1B16A 1MD9A 1XEFA 4NZZA 2BGNA 3CH6A 3ROTA 3A6HA 1YNSA 2NZYA 4AY4A 3GJQA 3L8GA 1XCMA 3OOCA 4QDKA 4URUR 4AZ3B 3HU2A 3SG0A 2DH6A 5JE8A 1QGUB 4BVGA 3DDOA 1SCNE 3UVEA 3X2EA 2Z9DA 2X6YA 4OHKA 3GYBA 3UFXA 3GGPA 2WMNB 4OU4A 3C43A 3I52A 3K1AA 1DJNA 1JJBA 4I6EA 4WINA 4UZEA 3DEAA 1QH8B 4BQIA 4NKRA 3GJ8A 3PLNA 1JR4A 3ZE6A 1ATZA 2IKQA 4X7EA 3LBAA 4GLLA 3KPVA 4TTAA 3KCQA 2JLUA 2N0SA 4XDYA 2J3IA 4URXR 4GNKA 3L46A 4K9PA 4Q4HB 3VPFA 4EI9A 2O19A 2HRZA 2OILA 3L4BA 1AZWA 5BRNA 1VLMA 2W93A 2P9HA 3NOXA 4N7RA 2VDPB 1Y5MA 1PWZA 1IHOA 1BMTA 1SIBE 4LJSA 4F85A 3GDGA 1UPXA 4Q4DA 4CFZA 4YMWA 5B55A 2PBLA 3OPXA 4UARA 3LBFA 2XUZA 4F8JA 4PAAA 2EWWA 3GMSA 5BVHB 3HCEA 2WV9A 3GLFE 2GTHA 5B3AA 4HRYA 1CQXA 4RV9A 3BG5A 3DO5A 1RAGA 4C0HA 1RAAA 5L3RA 3PL5A 1OWMA 3DD5A 3HZZA 5EWLB 1E6EA 5LXTF 2AVDA 3FPJA 4NV3A 3WLFA 1S89A 2VP6A 2Y0PA 1QRSA 2HCTA 1BGXT 3DDNA 4XE5A 1BHSA 2HXYA 1F2TA 5DNUA 1KSHA 4J3FA 1U7OA 4MRNA 1PR3A 4M86A 4GKJB 2XZOA 5ED4A 4NECA 3BXPA 2VDMB 4ZMSA 5COAA 3DPIA 3R6LA 4PFSA 2ZR0A 1NVAA 1U0LA 4OLBA 4CT4B 1JSRA 4IUYA 3RUIA 3F98A 5HF5A 1ORTA 1Z37A 2JKZA 2JCXA 4F3NA 3I76A 5MF6A 2N75A 1KMHB 2JFXA 1WSRA 4LJAA 2NM0A 4KXWA 2YUTA 4B74A 1A5TA 1F0PA 1LCIA 1E9SA 1PVDA 1TT5A 2W0MA 1IAQA 1YS2X 3R20A 4GW3A 5JSZB 2B1JA 2HF8A 1L4MA 1R5JA 1W5TA 2YZKA 4BMXA 1NW8A 4RULA 2I1WA 2E4AA 2YV2A 2BBWA 3A4MA 4FTWA 5T5QA 1D6NA 3EG5A 3WJAA 2G0TA 3DL0A 4M99A 1CVRA 2JGDB 2QYTA 4EFKA 1AO3A 4YASA 4E2XA 1BJKA 3PWZA 4E88A 4D92A 3FCOA 1NQXA 4KV9A 2WI8A 3IUYA 3CGGA 5BN5A 2IYRA 2C2MA 3F5QA 4ZQBA 1OIVA 2NVUB 5IJXA 1U9CA 4CETA 2FSVC 3SQMA 1IBSA 1L5LA 3JD3A 3K2BA 2V7PA 3S27A 4UM9B 2AMJA 4K87A 3G02A 1F1BA 1T8SA 2AR0A 3B7GA 3W3AA 3M6FA 4JIMA 5DTRA 5ESDA 5JO9A 1XA3A 4P5DA 3LYHA 4TS1A 4XLEA 2I99A 2ZQYA 4D97A 4EF4A 3IAS6 2BSQA 3LFHA 2HJVA 2Q9AA 5AM4A 1W29A 2B21A 4AG3A 4CPDA 1JG3A 1B2RA 9ABPA 1UBFA 3KKOA 3GAMA 1PYGA 2J3DA 5IJ9A 2PD6A 4EB6A 4BRZA 1EJ2A 2FNAA 1JMKC 1F6WA 1W7AA 1ECCA 2SKDA 3DC7A 5EHIA 3F9IA 4U2BA 2PM8A 4OI4A 3TGWA 4NBNA 1CUGA 1G8KA 1MQ8B 3PICA 4G86A 4PYRA 3RIHA 3SN6A 4YUXA 5K9ZA 5A5DA 3T51B 1GTG1 1VYTA 2WAOA 1MCZA 3H17A 2BCEA 4MPPA 2JI9A 3TG2A 1H3EA 4X5OA 1DXHA 1PJCA 1Q83A 3T1VA 4B2IA 2GN2A 3FD8A 3O4IA 3D6TB 4DLPA 2Q5LA 3KKMA 3GJRA 2X7JA 5C1DA 5U9CA 3COSA 3M49A 4F60A 4JLPA 1HL3A 2A1TS 4WCDA 2NPIA 1R64A 3HL0A 4ME6A 2C77A 2Q5QA 4IDOA 1DX9A 1DPGA 1RR6A 2HA0A 3L79A 4Y9TA 4HH0A 1SUIA 2I91A 2EEZA 2Q9CA 1GD1O 1W19A 1E4EB 2HMUA 2PX3A 4MJ7A 1H3NA 2PPVA 3TNLA 1MABB 3U3XA 2C99A 2JBWA 4UU0A 2AZTA 1YR7A 3PC8A 1XOIA 4M83A 4PPNA 3IKLA 3NIBA 1F2UA 2Q3HA 3KAPA 5AW6A 3H2IA 4MV4A 3WWDA 3ETLA 2R0QC 1I5EA 1O9HA 2FEXA 2PJUA 4KXFB 4O59O 1X8XA 1XVTA 2A0XA 4B7ZA 1OH7A 2M5SA 1XI2A 3VBEA 4KR2A 3NFRA 1L5WA 1BS1A 4V1CB 1DIBA 1FDIA 1NJ2A 1LSUA 1OT5A 3NYRA 2XUFA 4K88A 5DBGA 3RC3A 3TW8B 5AIBA 2CJFA 1GUYA 3BORA 1E60A 3JYPA 4U2FA 1QYCA 5TF0A 5LP6B 2DPMA 5CEFA 5LWHA 3H99A 1OPRA 4HNTA 4PLWA 5F52A 3IQIX 4L0QA 1JFFA 1KOJA 4WW0A 3ASYA 4R8VA 1GEGA 4BO4A 1F38A 5TGDA 2A58A 3JQQA 4N5LA 5K0FA 5G4KB 3H9EO 1VDMA 4V2IA 3A8IA 3GGDA 3DZJA 4ACBA 3PXDA 4XFKA 3UUGA 2CLFB 4KPYA 1N2CB 1ZRNA 1QLHA 2O7NA 3G5AA 3GMDA 3GH1A 4OGGA 4UNPA 3PZRA 2VNJA 3DXFA 3WKAA 5KJEA 4KE8A 4B5KA 5DSTA 3ND8A 3PDIA 1JWLA 3P9KA 3TGLA 4AUMA 4F8YA 1I7NA 1WY7A 3M89A 4D0NA 2BUAA 3TLGB 4MS1A 1IVNA 3CZ9A 4RK7A 4UJ3A 3TYXA 2IVFA 2QX9A 3UGJA 1RE0A 3FVTA 4BNZA 1UUFA 1A2KC 1Y3IA 2V6GA 3IKJA 3AG5A 1U31A 4CR7A 2ZBGA 1RM0A 1U99A 3CRW1 8ATCA 1SU4A 4MA4A 5JD4A 1U1FA 1KR5A 4BFUA 2ZRBA 3GSIA 1YMVA 3TLJA 1X77A 1VYVA 3FWZA 4YELA 3X1WA 4EFDA 2OZLB 3VZBA 2QYSA 1GFZA 4MWDA 4IMPA 1QIIA 2HQOA 3R3HA 1HE1C 1SVIA 3HDGA 4L6IA 2J3KA 4MROA 4D4GA 4DIBA 3R7DA 1MZPA 4IZOA 1HNZB 1VSQA 2QGZA 1NBHA 2AV6A 2ES4A 1SO8A 2YMQA 3EOAI 4HNSA 4W4TA 5FLKA 2NZUG 3V9AA 1R6XA 3RADC 2NUAA 3G85A 3VYSB 3U7FB 3WA6A 5TT0A 2R6DA 4JIGA 1GTZA 2P3OA 2Y05A 3UQZA 4NPCA 1KP3A 1P5RA 4RF3A 3VC7A 2O8EB 1FW6A 3PA1A 1NRWA 5KU7A 3TIXB 2H2FA 2EX1A 1HX7A 4XORA 2FAXA 1AKMA 1INLA 3B9QA 1UXKA 3O9ZA 4KE6A 5KQGA 3HEAA 4G5SA 1ONBA 1H1LA 3IUJA 5AVRA 2PUJA 2ZYIA 4KDRA 2JHCA 4FHEA 4TL7A 4JZYA 4ONEA 4U9IS 1Z0IA 4ZQEA 3RGWS 3U60B 3F4KA 3QV1A 5C3UA 1JKMA 4OPVA 1NUSA 3UJBA 3DWFA 1VPVA 1OB2A 3VC2A 1J70A 1X1TA 4UTXA 4H1WA 1E2QA 5CCBA 4YO8A 4GZLA 4PSAA 2AQHA 4RHCA 5LL6P 2QN9A 3O2JA 4RPBA 1DBRA 2Q2VA 4MPDA 4RGBA 2UZIR 2C8KA 1CF2O 1DAMA 3KM0A 4JUCA 5F33A 1AHIA 2VJJA 1NGSA 4Q1CA 4X20A 4KXVA 2Y4NA 1XKLA 2PGOA 4YDRA 1EWTA 3O1HB 3P1JA 4P4NA 3QSGA 4Z9BA 4DZRA 5FLXA 2R00C 4WFKA 1KMMA 3QM1A 3R5SA 5FA8A 4Y6LA 5BXYA 1MJGA 2OD2A 3OIWA 3LQ1A 1KJ8A 2QOEA 1TM2A 4RD3A 4JL6A 2VJNA 5BSGA 4LC0A 3P2JA 1KEEB 2ANCA 1ND5A 4B4OA 2R6AA 1B8NA 4BX2A 1Q3HA 1F2TB 2QA4B 1C30B 3K5HA 5FTJA 5IULC 2FPGA 2JGIA 3KQWA 5LOVB 1OV4A 4BKOA 2CXNA 1US8A 1G20B 1EP9A 2PXAA 1ZJZA 2DETA 1M6VA 3VR2D 4CQMA 4MVJM 4UE3S 4DL9A 3R44A 4YJGA 1UMDA 3EZYA 5J1TB 3EUAA 1JZTA 4HVLA 3K4QA 3L8HA 2H5EA 4GZ3A 4HH3C 1A8HA 2H7XA 2OYSA 1FP4A 3GT0A 4YI5A 4BQEA 3WFJA 1XTJA 2WHPA 4YMLA 1N9KA 2EL7A 2QD4A 4X63A 5A71A 3CCJB 1TZJA 2I2FA 1CT9A 2ODNA 2I3AA 3LZDA 3VU3A 3ZHRA 3AVTA 1E58A 1UPAA 2GEUA 4GLBA 1TXGA 1Q6YA 4JQSA 3ZIUA 2ZIGA 4D9GA 3VSEA 3P4UA 1X1DA 3TH5A 1W5BA 2VDWA 3NT4A 4HDKA 4ZALA 4G5QA 1EFPB 4UD2A 5IMSA 3PD0A 3R0XA 4AK9A 2Y1CA 3X1YA 2X0JA 1WUYA 4DS3A 2WHRA 2ZB7A 2W70A 1QQBA 1IZ0A 1B73A 1SK9A 3OMXA 4MUNA 3RR2A 2KE5A 2QAJA 3HC7A 2IZ0A 1NLUA 2OR3A 1DAPA 1OSNA 3HL4A 1HEUA 1TIBA 4K6HA 4RPKA 1L7XA 2ATXA 2VNIA 2LKCA 4LIPD 4A03A 4D46A 3D6NB 3T1TA 1AGYA 4LTMA 4V2UA 5IEJA 2RHBA 5GGXA 4UDNA 3RIGA 2XZTA 1DLIA 1ZGCA 3NBAA 5TMPA 2P27A 2IS4A 1NF2A 3RSCA 5HIMA 2ATIA 5CD1A 3MWJA 3MJSA 1GAJA 4MW1A 4X85A 4AJ2A 1XRPA 4CM5A 3MS2A 8MHTA 1ZU4A 2IUYA 5E2IA 3I83A 2QEQA 3JWHA 4FR2A 5LQUA 2XUAA 3HUEA 4RJIA 3KSDO 1A50B 1CZHA 8LDHA 2HLDA 1JHOA 4KPUB 4BB9A 3SNKA 1ZXLA 3HB7A 4BRUA 1XZCA 4MUGA 6CHYA 2O5CA 4PZEA 2ZVJA 4F2WA 1BCRA 3DZKA 4KRGA 2V55B 2GBLC 3N86A 3VKGA 1AMUA 4S24A 2OL4A 4RH3A 2XADA 1TGVA 3GROA 3CCQB 4YGXB 4J3NA 3T4PA 3NM5A 4DKXA 5B37A 5KNDH 3NBFA 2ZZMA 2OTLB 1II9A 3LLVA 4C4SA 1U8EA 2ICAA 4EDHA 4S1TA 3KVRA 1ZOPA 5DT2A 1PEDA 3IXMA 4JUIA 2HRCA 2Q46A 4F4CA 5KYYB 4M7WA 4H0NA 1DIRA 2C2XA 1JB1A 3H8WA 5JHHB 1D5CA 2UZ4A 3C87A 4NBSA 3LW8A 3LX4A 3KRTA 4YCNA 1AKNA 2X15A 1GL6A 2QMUA 3G13A 3LK7A 5EIFA 5BMOA 3DLIA 5DNDA 4ZC1A 1Y9EA 4NPHA 4O5AA 3N2ZB 4U63A 4FS8A 4Q9JA 5GONB 4AO8A 1A5SB 4J4TA 1SBNE 1QTQA 1XV5A 4DCVA 1MGOA 1E9FA 3PTAA 5G0SA 1DC6A 3BWVA 3R5FA 4RDXA 1DFIA 3LNCA 4L8JA 2PX5A 1VIAA 2ZSHA 5THKA 4CFYA 5J43A 1P91A 2ODAA 1FSFA 2KI5A 1E63A 1UWLA 2EC5A 3C3WA 1X7XA 1B0UA 1PDOA 2XOKA 3RSFA 5D3KA 3GRZA 1GU1A 4WN3A 3KU1A 4BO9A 3SKVA 1O5IA 4KMRA 3C7DB 1D2CA 1QS0B 2AJTA 4R8RA 1QOQB 3NHUA 4GP6A 4LN1A 3VKHA 1EFDN 4BJ3A 4PYQA 1VKNA 4YALA 5J47A 3N1UA 3H0KA 1LBEA 1Z6QA 5B30A 1P5HA 5EP3A 1C7EA 3WIEA 2WQ7A 4ZK2A 4S3MA 4OKSA 1F12A 4DLTA 2ZCUA 4W5QA 3HVRA 5JHGB 4I9HA 2ZUVA 2ZRCA 1S01A 4NWIA 2VT6A 2D5LA 1IY1A 3BYZA 4EOGA 3BSWA 1JR3A 4QAJA 4ZVUA 3RWMB 4L16A 5JFGA 2P65A 4OATA 3OZIA 5EERA 2A9JA 5EKXA 2O3QA 3HRHA 2OVFA 3ENQA 1XZQA 3JYLA 4ND3A 3U0VA 3UMSA 4JB0A 3UB2A 3RHFA 2IELA 2ZRDA 4HJRA 3W5CA 4LF6B 5JS1A 3W2GA 2PS0A 2KBEA 3Q0TA 2BBSA 2FH5B 3T12A 3M3PA 2Z57A 5KTNA 2Y99A 5CPFA 4II3A 1L4BA 2AQKA 4R1SA 4C0QC 2VF2A 4WZAE 3U4MA 3NPMA 2A8YA 1FDOA 3RJZA 2QXYA 3SQXA 1JIJA 2HMYB 3NYWA 3F7TA 1R27A 5SYAA 2E1RA 1G1AA 4DE5A 2P79A 3DOFA 4PXYA 1TQ8A 5H3HA 3UKJA 2X7XA 4MQBA 4C05A 3VSBA 4OQPA 1GL7A 5C7YA 3TM5A 1Z56C 2ZTHA 3WADA 4KVZA 2LTAA 3L0DA 4ZEOA 1J4AA 1YR1A 4CF3A 1ST2A 4MGEA 2Q6VA 3WHLA 1ESNA 2QN7A 3ZCSA 3GZ4A 3KOWA 5BQXA 2YDYA 2F48A 3R3UA 5CIWA 4EB0A 1QNFA 3G5UA 1GL9B 2JJ2D 4XRGA 5IP5A 1HRDA 1JMVA 4BE4A 1MIHA 3WNDA 1YI0A 3V8VA 4CMHA 3ZW9A 1E1QD 5SY6A 2XEXA 1T8PA 1C1DB 3COVA 1PR4A 1LXCA 1P4SA 3PEYA 1GHTA 3W90A 3EVAA 1V16B 1HQYE 4MW5A 5SZIA 1RKXA 3IEIA 2ZUCA 1E1RA 3DDZX 3VO2A 3TSWA 2PFKA 4HNQA 5HQ3A 2FN8A 3SVZA 1SKQA 3C24A 3FTEA 5EMJA 4DCMA 4DR3B 1S4MA 2RHOA 1DGQA 1BX1A 1Y8CA 2J3HA 2YN4A 1H85A 2BTQB 4LY6A 4OXKA 5TQVA 1WOMA 2OCIA 3AUAA 2X6QA 3RFFA 3RIEA 1XEXA 4B48A 3VPDA 3KTFA 3O8DA 3X43A 2H6EA 3K35A 3WZLA 3LVBA 4ZCQA 1V0FA 1AO0A 1N1DA 1Q6ZA 1VJ5A 1XA0A 4TV8B 3V55A 3VBCA 1PL0A 5E3JA 4E7OA 2O8FB 2Q3JA 1DFGA 1NY6A 2WUDA 5J3JA 4S05A 4CG1A 1PT8A 4GOMD 4X97A 3TRKA 3IUQA 3JQBA 5HJ2A 1PJ8A 2MYNA 3DMNA 1Z2NX 4RLHA 1I10A 3M0EA 5DN9A 3OQJA 3MQ2A 2NO1A 3PHHA 1OVMA 5D51S 4XVRA 2F00A 4AJHA 3KVVA 4YUYA 4J29A 1RM5A 3UM9A 3EWIA 5ER6A 5P8WA 3N8GA 2VLBA 5ERXA 2VJDA 2FW7A 1VI6A 1ZJ6A 4XYBA 3RK0A 2XIJA 3MHTA 1AMOA 2YH2A 1LNSA 3DLTA 4LY0A 3QP9A 4Q01A 4XPIB 1OI7A 5HF8A 2PX0A 4IQ4A 1VHDA 1NKSA 1V8BA 2Q6IA 1SBZA 2CFCA 2IHBA 2Z58A 3NHFA 4OLJA 4QVIA 1Y7PA 2ZKLA 4NU8X 1EDDA 1KWGA 4LPKA 3QXXA 1E32A 1ZZEA 2W11A 1YC2A 2GKOA 4BWVA 4MYCA 3K30A 3ZEIA 1XFDA 2WHPB 1PJBA 4I7EA 1EE9A 3DQZA 4X95A 1XVAA 2B6NA 3WQSB 3HRIA 3U62A 2VIIA 1PLKA 2ZUTA 5C8DA 4I0WB 4PINA 2D1TA 2ZJZA 3RWBA 4FDLA 1PN3A 2H8GA 4K9RA 2VDWB 4HDKB 3C3PA 3K1TA 2C4WA 2MSKA 4KSBA 1OXSC 1XNGA 1A4XA 3QI2A 4JDPA 1QM5A 4QYIA 1TL7C 3BE4A 4IQ8A 2DFKB 2XRZA 4ECEA 4RSHA 4YCLA 3UK0A 3W79A 5A4JA 3ET4A 4E2WA 3LQ2A 2NO6A 3OOSA 5CVJA 4J94A 2XMZA 4RFSA 5DZSA 3VVCA 5AI5A 1AZTA 2BM8A 3RFTA 1SC1A 1ZC4A 2WVGA 3SC3A 1HNWB 2ZCVA 3IP5A 3OJFA 2O8BB 1BS9A 1KRXA 5ECGC 3IUSA 4IGEA 4H15A 3GNSA 1BEZA 2ZIFA 3AU8A 1MO2A 4F9GA 5HE8A 3VTFA 4OLAA 1ZL0A 1P17A 4EPYA 1AX9A 1T1JA 3ESZA 4ROTA 1Y82A 1TEVA 4TTSA 5D3QA 2IXBA 5FBQB 3UENA 1X7ZB 1CXZA 1OI3A 1U98A 1SD1A 3PEUA 3N8DA 1DJQA 2XDYA 3JY6A 3X2SA 2I80A 4Q1BA 5AKGA 3N5KA 1IRIA 4MWOA 3JVDA 1CUZA 2AOUA 2CHUA 2MYTA 5D7NA 4FZ5A 3SICE 4TLDA 4CTMA 2DY1A 1P80A 3TNFA 4BNIA 5J2UF 1BMQA 2Q6TA 1G6OA 2B8NA 2D2XA 2I4LA 2QK4A 2QMYA 3A6JA 3NYIA 4EMUA 1D7AA 1BAPA 5EGNA 2C82A 4WY5A 5EI5A 1X7DA 3COYA 3NV9A 3T9AA 3W9UA 3QU5A 1Y8RA 1ODJA 5AM2A 4WA8A 1JHUA 4LX8A 1C0IA 4O1IA 1E2HA 1TYAE 2AWNA 2AVNA 4M9CA 3NAGA 1GR0A 3NWJA 5EAIA 5BUSA 2VPIA 4NMLA 4DABA 1TKRA 2WD9A 1NJ8A 1RWNA 4TZKA 3EZ2A 4RQBA 1JA1A 1W34A 2FTKE 4P22A 2O20A 4OH7A 2HCBA 5A6SA 5C80A 2YC4C 3COJA 3E1YE 1SWWA 2KYRA 4WBNF 1CRLA 1VKJA 3BF7A 1VGRA 3MT8A 3EVDA 5AKIA 4XKVA 2BMEA 2H31A 4P6VF 2P7HA 1R1DA 2WD8A 3N0VA 4G1FA 4BO3A 2BMAA 4EGCB 2GN0A 4IFIA 1XBTA 3KHTA 1Z0AA 5HOQA 2HKIA 3OZXA 3C1OA 1AC5A 1EUDB 2R68A 2Z5LA 4IAOA 3ZWAA 3F47A 4YRKA 2I1LA 1D04A 2CXRA 3KKPA 2P2SA 3LI2A 3T5TA 4NBTA 5GTDA 5AH0A 1CZOA 5D5PA 1E5DA 1JLHA 4RPDA 2VRNA 1IQPA 3CO5A 3IKTA 1ES9A 1KSFX 3F6EX 4LJ9A 1N2ZA 2VHCA 2FHPA 1E0AA 4HQNA 2IDJA 1GGKA 4OBBA 3AF0A 2VYVA 3PYXA 4B85A 2QP9X 2VXBA 3VDRA 1BA2A 1G4HA 3C5EA 3U26A 4BQQA 2ZB2A 1WMAA 2A5FA 2C7BA 3B1JA 2IV2X 1W9HA 3GJSA 1OJLA 4IFTA 3UMYA 2ZTSA 4KQEA 4RYDA 1V6SA 5TGZA 2X0FA 3S70A 2P1RA 3K0SA 1EGQA 2UZ0A 3ETJA 3DS8A 4LK2A 3ZBQA 3FJYA 4KL8S 3QUQA 4KNVA 1GL3A 4GXRA 1I13A 3AU9A 4MUXA 2CV2A 2YWGA 1BDJA 4B44A 2YWCA 3LIIA 3O8OB 4BN4A 3AI1A 1C3OA 2Q5HA 2YFKA 1Z7YA 2ZU0C 2HMVA 2RHLA 4FFWA 3GLSA 3G2MA 2VQFB 2R1UA 4QQRA 2G76A 3AGQA 1DG3A 1GU7A 1W9XA 1DBWA 1L8XA 2VPTA 3FDIA 3KSMA 3ZU5A 5L45A 2VDUE 4CEJB 4R7GA 2JLCA 3KR2A 5AQEA 3QE9Y 1OTHA 4ODIA 1TA4A 2VHEA 5A62A 3PLRA 2ODBA 4D3ZA 2PL9A 3CSDA 3KS9A 4ZT4A 4Y2SA 1ZVVA 2HYDA 1XAJA 1QFXA 4P80A 4CMAA 5I8ZA 1VQNB 3SIRA 1L7PA 4GWGA 3VPGA 4A6EA 4KO2S 5IXYA 1UK7A 1IULA 3BMOB 2O52A 2A9PA 1Y6FA 4D74A 2BUCA 1G291 5KVSA 3O2SB 1S8AA 5A3QA 3ADDA 1GLVA 2ZETA 3JWIA 4U7TB 1RFGE 2UU9B 2PSHA 4F2GA 4X65B 2AMFA 1U2QA 4OBEA 4FHZA 4X84A 1S0UA 3GFRA 4OV6B 2VTDA 4GECA 1N5OX 3O31A 1ZPDA 2WPDA 4YRMA 4PAMA 3AESB 1H9AA 3OQIA 5J23A 3BFJA 3AK4A 2UAGA 1B93A 3IMFA 4QNMA 3FFTA 2B3DA 4U8HA 4RNCA 5FAKA 4Z4GA 2R8YA 1NQTA 5JW6A 5LA6A 1YR6A 2YUIA 3Q6QA 3L4EA 4I9UA 1DJLA 1JKXA 3CLUD 4A6PA 2ZFUA 5HZMA 3ZX4A 2UUPA 5KTPA 3O6VA 1B7GO 4KR3A 1CUUA 4N7MA 1IBMB 4UE6A 1RWMA 2I03A 3L01A 4HDSA 2ABWA 4Y98A 2ZRQA 4A26A 1KVQA 4YWJA 2Q7XA 3V2GA 3KUXA 4OBWA 2IIBA 1VPTA 5A88A 3I6YA 1P18A 3TE7A 2PUAA 3EJWA 3QWHA 2MINB 2ZYHA 3C97A 1JJFA 1IJEA 2HK7A 3ELWA 3MLEA 2IC5A 3UFBA 4TMZA 2FPPA 2YZ2A 2AK3A 2W48A 2QAIA 3JAWB 1CJKC 1XEXB 3AB8A 3UJAA 1WUJS 3WX0A 1I2AA 2W6JD 2WOJA 5FBVB 4LSWA 3QU2A 1NDHA 3EBOA 3AFMA 1H2AS 1VL2A 2HWKA 3F9CA 2X22A 4V3BA 1T8YA 1COWD 2VH1A 2PG3A 3C6MA 1RADA 1PR2A 3L0ZA 3ZNNA 2VEOA 4OY3A 2W6ZA 3JAKA 2FP4B 3D7LA 4RHTA 3E9RA 3VUFA 1VIVA 1W0JA 3AEYA 3LQQA 3W04A 2J4FA 1P75A 3ZKAA 1BU5A 4Q16A 5DOVA 3AP1A 1IQRA 1J0AA 4JEMA 4B09A 5LUBA 2ZWMA 5KTMA 4Q24A 2NW6A 4HUQA 2J0SA 1ZM2A 4O3FA 4Y9SA 1N2OA 4EAQA 2GEDA 5AUNB 1CERA 7ABPA 1ULAA 3E7WA 1VSVA 2C54A 5JDIC 5JYEA 4HN9A 4F6CA 3GA7A 1IMJA 1J20A 4X00A 1KH1A 1UK6A 1Z8NA 3WSTA 3A25A 1T3TA 1XGKA 4HUTA 3HVUA 3ZWBA 1A9QA 4MW0A 4KU4A 3V7UA 1OXTA 4YJFB 1CY1A 1SCIA 1SZDA 4FP9A 1TMOA 4G23A 2OV2A 3NI2A 4GC9A 1Y81A 2AIRA 1TK3A 2E3JA 3CYFA 4QOEA 4XX1A 4BN0A 4ER5A 1YZYA 3CWZA 1R8YA 1X0VA 2HWWA 2ZBDA 2OWDA 3H65A 3ILSA 1WSWA 5DEIA 3EWAA 3GCXA 5EL0A 3BGSA 3DNMA 1C50A 1E1KA 5KTOA 5LD2B 1DHTA 2GXAA 2ZUUA 3AETA 3D4IA 4L6AA 4P54A 3TM4A 2X0KA 1BMFA 2VAWA 4GX0A 2OLEA 2PNJA 1AA6A 2GH1A 4KZPA 2DQZA 3NU1A 3WC4A 4B2YA 4EW6A 4B7XA 3K09C 4HLUA 3W5JA 1BWQA 1QIEA 4K0KB 2EG5A 1JTFA 2OPHA 1ZJ4A 5JNUA 5BSXA 2O48X 3AR9A 4L6CA 1L5HA 2YOHA 3U1TA 5JARA 3CLHA 1LA2A 3L1KA 4FONA 5DWVA 2VRCA 2OGSA 1YFZA 1PFWA 2P3SA 1WL8A 4QEKA 1AUVA 4JJEA 2XE8A 1NF3A 4QXRA 4S1WA 4F56A 2EIXA 2C2YA 3U13A 2CFRA 1YX2A 1VTKA 2E4ZA 2Y1LA 3DMHA 3G0GA 3Q3EA 4L72A 4EPRA 1BQ4A 5A6VA 2B7BA 4O3MA 1E2MA 4JQCA 1X3LA 4N5DA 4DWVA 5J4KA 1I94B 3BQMB 5FL7A 3E35A 1G63A 1BXRA 2WAYA 4GPAA 4X3OA 5EP2A 5LNK1 4HNHA 3E03A 4I50F 3MB8A 3R7BA 5KB3A 3PVZA 3EGEA 2ISCA 4KK3A 2FV8A 4YAIA 4RTPA 1QDUA 1DDGA 5HCIA 2AOUB 3KD2A 2ZE8A 4PPGA 1N2IA 2ZBUA 1JEJA 1KEZA 1PW7A 2R6HA 1RBMA 3F7OA 1UR5A 3GLHE 3PJGA 4GD3Q 3TAHA 2VDRB 2VVTA 1XT6A 4Z8XA 1XZHA 2YMLA 1YB7A 1B23P 4FCCA 4NR0A 1CF9A 1ISGA 3KR9A 4Q0MA 1N05A 4UKDA 2QUZA 1S3IA 2FPLA 2YVUA 3E61A 3P9XA 3ND7A 4FJ2A 4QARA 1QZUA 4TWJA 4J07A 5JQGF 4Y0NA 1TM7E 5KZMB 4WTOA 4D8XA 1YS4A 4KSYA 1UBHS 4F6RB 4R0VA 1ISSA 2WU1A 3ZGYA 1Y33E 2Z5VA 4A0RA 3T9BA 4AECA 3Q0EA 3QUSA 3AY7A 4LHXA 2VI5A 4G1CA 5CNKA 3ZJYA 5A6SB 2FN3A 1QVZA 4UM8B 4M36A 5I7UA 2YVLA 1Y4AE 3N5CA 5EIWA 4CGZA 4P81A 3EVNA 1AKVA 4TRJA 4W9NA 2FG7C 4FHGA 4G7XA 3UGKA 3VR6D 2M6SA 4LRWA 1LFAA 3ZN2A 3BIFA 1ULHA 1B1AA 3KFXA 4UUMA 4KUHA 5AKEA 1Z3CA 2DHDA 3RTCA 5FBHA 3AIOA 4L9SA 4BNDA 4KCGA 3RTDA 3NTLA 4YCSA 2O4UX 4QGFA 1YQDA 2H51A 2YCLA 3HYRA 1R10A 2J9RA 2Q5JA 5ENVA 3TW6A 4CCYB 3NDIA 4PICA 4DMGA 2EJUA 4GM0A 4DDVA 4KAFA 1XQVA 3N28A 1KHTA 2QJFA 4MQEA 2UXCB 3JXEA 4ZO4A 2EJBA 1THZA 1P6XA 2FR8C 1HLDA 3L49A 4U2CA 4ZHQF 5JBNA 1UBSB 5JSUA 3HP4A 4TQUS 4LG1A 3NC0C 1E69A 1I1NA 2XX3A 2Y71A 1L7MA 3IAFA 3NIFB 4FE3A 3DFZA 4GBGA 4XCXA 3NAZA 4OQYA 4CCSA 3KJNA 5IT4A 2XYVA 3KLNA 4GMFA 3FCXA 1ZA2A 3DM9B 4C0SA 2WNSA 3GT7A 4QGAA 1C3OB 1TO2E 2CDRA 1E1CB 2ONZA 3B9RA 1KY3A 1QONA 4XIYA 5CT8A 4ZV9A 5C0OE 1H69A 3TI7A 4CIVA 5HZHA 2ZRHA 3OT1A 3AVOA 4KN6A 1CS0B 3ETNA 4MVJI 3WK7A 4EBFA 2ZOSA 2C8VA 1RWQA 4C21A 3CD6B 4DA4A 3HS3A 1VE9A 1P60A 3ONDA 1GILA 1XDDA 2J87A 3AR5A 1KFBB 1V3QE 3E9QA 2ET6A 3U7RA 4KPEC 4OFZA 4EZBA 4EVSA 1QF6A 1XNJA 3A1CA 5IZCC 1JHAA 3CLUC 1FVFA 2R5NA 3GEIA 4AULA 4PV7A 3BWXA 2Q3BA 3I05A 5IM5A 3ZV5A 3CVYA 3NUGA 1NC3A 5EZ5A 3G0DA 4F12A 1QAQA 2DJIA 4UUPA 3L7BA 4BFVA 1NWHA 1MOQA 2FPXA 2GZHA 1GKKA 1MC1A 2X4GA 3D2AA 2QVXX 3MAAC 3IPXA 4O8ZA 4FBMA 4DRXA 4FKZA 1Q1ZA 5BQ3A 4G01B 3DDWA