2CC2A

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
290
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGAGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Substrate specificity in enzymatic fluorination. The fluorinase from Streptomyces cattleya accepts 2'-deoxyadenosine substrates.
pubmed doi rcsb
source organism Streptomyces cattleya
total genus 75
structure length 290
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2cc2A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2cc2A01
2C5BA 2ZBUA 2C4TA 2C5HA 2C2WA 2C4UA 2CW5A 2V7TA 2V7VA 2WR8A 1RQPA 2Q6LA 2V7XA 4CQJA 2Q6IA 2Q6OA 2CC2A 2Q6KA 2ZBVA 5FIUA 5B6IA 2F4NA 1WU8A 1RQRA 2V7WA 2V7UA 5LMZA 2CBXA
chains in the Genus database with same CATH superfamily
1QO7A 3R77A 1IBKB 1M33A 2XW6A 4QEZA 2NYUA 5LQAA 2YZ2A 3P0IA 3GZ4A 3WRVA 3QKRA 1H6BA 3L84A 3RANA 1LK5A 1GCUA 4Z4YA 2OD9A 5E8JA 3WB2A 2RDMA 4RVNA 2XVAA 4NE2A 4YRSA 1CB0A 1N3LA 1E20A 1NW7A 2QYHA 5ARDA 4EB0A 4ZOQI 1KORA 4F93B 2I3AA 2WV7A 2GF2A 4W9NC 1AKMA 4GMKA 2EFYA 4GBGA 5LU9A 2YYYA 1O96B 4V02A 4PN7A 1ODIA 4AJ9A 2UVDA 2QYTA 3DV0B 4PSCA 1X1SA 2V96A 4ML3A 2LZJA 1Q82D 1IZ9A 2PKYX 5GPBA 4DYVA 2A0YA 1N2SA 1P0MA 1NONA 2F1IA 3C0KA 3K6RA 3KK0A 3UYLA 3HXOA 1JEQB 3CX6A 3RVDA 4JHLA 1X0XA 3P9RA 4RPJA 4H0CA 1O08A 1VRWA 3TIFA 2ZZNA 4LNUB 4YRJA 2X5JO 3E2PA 3VKUA 4JQZA 2EX1A 2IKSA 1XMPA 3UMGA 3WGQA 4M1YA 4DUPA 3TD9A 5AKGA 4H27A 2X9GA 4WNYA 1ODKA 1QWSA 2F8LA 2PCLA 3OQPA 5DYGA 1B7GO 4ZEXA 1WETA 1N8TA 3IP7A 4U7HA 3MWEB 2A4MA 4YK7A 1G4HA 4B09A 4G25A 2D3WA 1AF4A 1Z36A 4UNSA 4AO6A 1Z5NA 3W5CA 5BXYA 3VSDA 1T8TA 3GUCA 4R8RA 4L08A 3SU8A 5KSZA 3K9HA 5CFQA 4MMZB 2FX3A 5SZIA 4V0NA 5BRAA 2WQ6A 1IM2A 1SUPA 3C6BA 4KXFB 1G19A 3KJQA 1L6IA 2PMCA 5ABPA 2VH5R 4Y18A 4BGUA 2WYOA 1U0RA 2FTKE 4RHCA 5JANA 6ADHA 1XPOA 4KE7A 3DE2X 3IAAA 1JSCA 5A7HA 3DULA 1KMHB 1N2XA 2GB4A 5IKOA 2Z3ZA 3GJYA 4O2BA 5JU6A 2OO7A 4XYMA 5IYZB 3EEYA 3RG2A 3FGOA 3ENNA 3V33A 3PXAA 3AIMA 4HI0E 1CZUA 3L06A 5THKA 2R8XA 3M1AA 5JWOA 2VP9A 4RHEA 3SZOA 4L8GA 2FG6C 5CT6A 1M72A 2GZDA 5D5QA 2WSSD 3HVRA 5M34A 3U2QA 1WLYA 4OOSA 1E92A 2BIFA 4W6QA 5DF1A 1GQ2A 2NN3C 1T0HB 3D59A 4XARA 2YXNA 3ZBQA 1IZYA 3ZVMA 2GK7A 4GVPA 5LZ2A 2HJSA 3THXB 4BXOB 3GNLA 1B42A 5JMOA 2F00A 4G41A 1ZNWA 1Z38A 3PE6A 5TPWB 4FDMA 1NOJA 2VZLA 2C8LA 3SKYA 5KTKA 5JD5A 2HNBA 1HDXA 2FPLA 4R2LA 1A4IA 4HQFA 5AHWA 4HAUA 5E4FA 3V8MA 2O5RA 3E1GA 2IZZA 3R3YA 221PA 4G0QA 4KXVA 3DLTA 3PQ7A 1PW5A 3DLPX 3U48A 5AI5A 1HEUA 4NOMA 4G56A 1FXWA 4ZK2A 1MX1A 1WG8A 3T9EA 3WYEA 4BWFB 1NWHA 3FHLA 1P80A 1VHQA 2QN6A 2FPPB 3AEQB 3PC3A 3I05A 3NATA 4FHGA 4P84A 2VK4A 2BI8A 4DQVA 4UNRA 2OCXA 1JR4A 2QPOA 1TB4A 3LO8A 2QJTA 1ONOA 3HB0A 4MUHA 3CPXA 5HILA 4I50F 3SS9X 2JI8A 1X7DA 4KIGA 3T95A 2C99A 2D3TA 2GJPA 2HA4A 1GPKA 1KI7A 4N6OA 3OPNA 1LV7A 2B5VA 1EQ2A 5A9SB 1Q12A 4LDPA 1K27A 3T34A 1R3UA 3H94A 3DUFA 2V7XA 4HO1X 3MTGA 4JLOA 3WDMA 1PHPA 1Y5MA 4I2NA 3IOMA 5JS2A 3Q38A 1YL7A 1D7OA 1W85B 1GA1A 3BFJA 4KODA 3TRJA 5MGBA 2EU8A 2AZ4A 2JI4A 4JDUA 2YVLA 3LCCA 4L9AA 3PXCX 4MR8B 1K5HA 1LPMA 1I1OA 4FR0A 4GPIB 5H81A 3UAXA 5M3BA 3SWWA 4ROTA 1F38A 5BNTA 1N2IA 1D9XA 3WAGA 2XE6A 1VL0A 3O6VA 1SBIA 3LBIA 1ZS9A 2YN2A 3RC8A 1A5SB 3CJTA 1CWUA 2M6RA 3JQBA 3UGJA 1QYWA 8ADHA 2O54A 1UIRA 4PNHA 4GWLA 2X0KA 2A30A 1P2FA 3NYQA 1RNLA 1YBHA 2HX1A 1I13A 3WKEA 1PRYA 2CFCA 5K3OA 2GOYA 4F4JA 1G59A 1CJCA 4JYAB 4AIRA 1JA1A 1PG2A 2ZATA 5C51B 2CLHB 1P91A 1SA0A 4BVHA 5BSKA 4YCSA 4LWQA 3DC7A 4L02A 5D2CA 2PSDA 4RQTA 4MRRA 1K0UA 1YIJB 3OZUA 2ZGVA 1FSSA 2MWMA 3EA5A 4GR9A 4R6WA 3ZU2A 1PZNA 3O1IC 1ZSYA 4EYEA 3FB1A 2H31A 3MFYA 2QU8A 1QCYA 3OUZA 3HKEB 1B6RA 4OXQA 4QYTA 3OF5A 1V47A 3QTBA 5CT9A 1XKTA 3T61A 3L1VA 2QN1A 2A59A 3I53A 4W5NA 4WN9A 3OOEA 2PT6A 3HJRA 3MB8A 3NKFA 3OCXA 2P35A 1Z16A 3UWMA 4CGYA 1YVEI 2G9RA 1U2PA 4O4IA 2AL7A 4ID9A 3WL4A 4XVCA 5AI4A 1UR5A 2HD4A 2O57A 2R3SA 4EPTA 1U4OA 1NTOA 2ST1A 4MB0A 3JASB 3LDUA 2AE2A 2AFIB 4RTNA 3H8JA 3I58A 4NYMQ 5CXXA 1OX6A 5K99A 2PE5A 2R8YA 1NT4A 3BYZA 1Q81D 2G1KA 1OI3A 1BQEA 2BHRA 3FLBA 4FXUA 1IMOA 3QMVA 1GTL1 5AK6A 3O1JC 1S2GA 4CI9A 4D1YA 1OJLA 1MBZA 3U7RA 1CQIA 3OM0A 2W2XA 3RC1A 2R6GA 1I9GA 3ZE0B 5FX2A 3R7WA 1JAYA 5L40A 1MPTA 3LNNA 1U02A 2XA1A 1EE1A 2AN9A 3TB6A 4PAOA 1FFGA 2ZJ5A 3STUA 3TLZA 3NALA 4HY3A 3U49A 6CHYA 4ZZIA 2VPIA 1JQEA 3ZTYA 5IUNC 3BRWD 1L1QA 4KGDA 4IXNA 5LXTA 4QU8A 3L8CA 1GZSA 4JLJA 5J3JA 1EVEA 4R68A 3PTAA 1RHKA 2C9DA 2Y93A 3IR6A 1UBNA 4YALA 1XXHB 5DYNA 4UPEA 4TXNA 2IIVA 2CLFB 4FOLA 1R0KA 2YIDA 5F4JA 4XCXA 2DCMA 5IAJA 4P4LA 1IXZA 2H59A 1JV2B 2FH5B 4ZVNA 5FWYA 1YRYE 4UBNA 3SMQA 5JXJA 2WSSA 3OZTA 4IIJB 3EPHA 4K9SA 4YIKA 5AOVA 2YWRA 5E7QA 4FI3C 4U7WA 5AI9A 3HRIA 3QE4A 1BC5A 1KZ7B 1SXJC 2WFMA 4PLCA 3ORSA 3RWBA 1WW2A 4A2PA 1XAIA 3HKCB 4NE7A 4LY9A 4UHJA 2VTVA 4C78A 1LUAA 4PLVA 1CBUA 1IVNA 1X9HA 3R40A 4XQGA 3I8SA 1SPXA 1R6VA 2NU8B 1G291 3O3OB 5IYPA 1V3VA 1JILA 1QYDA 3AGPA 3AH8A 4KUHA 3W79A 5CCXA 1QFSA 3X1KA 4GPBA 4MS3B 3I8XA 2GGSA 1NXSA 3WGMA 3RIYA 1SCNE 3DL0A 3EEOA 3ANLA 5A2GA 4R05A 3KDAA 4RIHA 4QYWA 1ZC4A 1XJ5A 3MTAA 2RHMA 3KBBA 3R76A 3SQNA 4RVFA 1EVKA 1GGEA 2R87A 5CCDA 5IAOA 1GPH1 4HQLA 2CCJA 1RLJA 1F7UA 2WLTA 4G0ZA 1W6RA 2H0QA 3EEFA 4NFHA 4KIWA 4XVUA 1FLVA 3N2LA 3RU3A 2NT3A 2IPXA 4QTXA 3KVNA 2I4IA 3GUYA 4TPKA 3ZBPA 3MJVA 1AUQA 1U0JA 3VYRB 1X2EA 1DUVG 1Z45A 4FDLA 2VCEA 4K5QA 4NZMA 2QJOA 3ZLJA 1ZVKA 3ZJVA 4KXUA 5DK6A 1U9JA 1PKEA 3BEOA 1P1BA 3BJRA 5AOCA 3NKLA 4YP6A 4C0AC 4E0FA 2QLMA 4A8JA 2QRUA 4MV9A 5DGXA 3EHEA 3QLEA 5A71A 1JNXX 5DHSA 1Z07A 3AR7A 4MQEA 1ODCA 3LYLA 4NCAA 2VHYA 3WSTA 1DAFA 5AM3A 3WP1B 2P5SA 4AQYB 1YHQB 5HG0A 5DLPA 3Q40A 2JJ2D 3FNQA 1J06A 1QTNA 2V9ZA 3EVFA 3DMTA 3KBOA 1TYEB 5LMUB 1K2VN 1S7GA 1PJ3A 1T2VA 3ZHQA 1Z6YA 1OAAA 3ZGYA 1W4CA 4ZREA 4R9UC 3P5BA 3T9DA 3GEHA 1KGSA 3C5CA 2QSYA 2IP1A 2I4NA 1F0NA 3VDRA 4U3JB 2AT1A 3N2IA 2HU5A 1E2FA 1IRXA 3IDZA 3RE1A 5LQRA 4OVKA 3B1FA 1H69A 3W34A 1DT5A 2QMOA 3L1IA 1P1RA 2FN4A 3JZIA 2ZIAA 4K9NA 3VSCA 1A95A 1ZGJA 3KX2A 4Q3AA 2IOHA 3RHFA 2I6GA 4E22A 1WSDA 1E0KA 2CV0A 1DFHA 4BNWA 2Q99A 3KJEA 2XUPA 5B5SA 5AKJA 1ACMA 1WW8A 4G09A 4KOEC 3X1DA 3HV0A 1Z5PA 3IR5A 2P9CA 4ZVKA 3SSNA 3RU2A 1MJ5A 3ANSA 1TXGA 2FUNB 4KLNA 2FCAA 2G5TA 5DTMA 3UJBA 5IC6A 3ZDQA 3ZV4A 5TR9A 1IXRC 1SN7A 3SZMA 3MZ0A 1RSZA 4B5LA 4E2WA 2V4MA 3B9QA 3QU9A 1QGUB 4XDYA 3NM5A 1KF0A 2KHZA 5A6SA 3KTAB 4YONB 4WASA 4JL5A 3MCZA 4IDGA 4COKA 2J3DA 3T52A 4F97A 1IUKA 3M6UA 2H52A 3N28A 3MCWA 3NIDB 4TRRA 5CDTA 3D3WA 1EJ2A 4OP7A 1C9NA 3CPEA 3EFOA 3HKBB 3P32A 2WFLA 3UHPA 4BVKA 1Z4MA 2XUZA 1QOQB 5B1IA 5ELLA 1BQ4A 2VKQA 4BE7B 5DIZA 1C2YA 4CXMA 1EZ4A 2DJIA 3BH6A 3CF4A 3IPAA 4HH3C 4OCZA 3PC8A 4L9RA 2OBTA 1RDFA 1NC3A 4J0JA 1VQKB 3GRPA 2GD2A 3A1PA 2HDWA 4PAQA 4N76A 3BRWA 1G3QA 3VPHA 4HAOA 1JP7A 2OCGA 1V45E 3F97A 4DMLA 1U94A 5AM1A 3RUCA 4UFNA 4YCLA 1I01A 3GBSA 3TXXA 3SJ7A 1F51E 1JIKA 2ABWA 1BE0A 3U4DA 2APJA 3G0IA 5F77A 4Q1VA 1N2CE 1HWYA 2C0CA 2ES4A 3ETHA 4NBKA 5DGHA 1YKFA 2R5FA 4I1OA 4ZCLA 2C9CA 2FOIA 3ASYA 5BWMA 4G4GA 4I4TA 1HG0A 2PWZA 4XGNA 1XDSA 3MBIA 4W5TA 3OEYA 2VDLB 3COVA 1N06A 2UUOA 5H16A 1J0DA 1LZKA 4E4RA 1CRLA 4RTMA 4UPVA 3WBFA 3AIIA 1HRKA 2FJUA 3RSFA 4ETMA 1NLUA 3ZCUA 1JDUA 4G67A 3HJCA 1NSTA 3PYXA 4MQMA 1DMRA 2IS6A 1RABA 5HF6A 3D8TA 3EWAA 2CLEB 3UMJA 2P4UA 4NJEB 5FEMA 3ND6A 4OAQA 5KSYA 2A5DA 5LDDC 5AW0A 2PTHA 2Y2VA 5DOVA 3Q98A 2X2EA 3PCTA 1DIAA 4QE3A 4RQBA 1LI5A 3PG5A 4MYHA 4PLGA 3E1KA 1MH1A 5AKEA 4EW1A 3HXMA 1Q0LA 2GSDA 3D7LA 2XTZA 3JSXA 4C7JA 2WB2A 4JEMA 3GO4A 3DLCA 1EP3B 1UBLS 2Q46A 3I2HA 1AA6A 1I5RA 1W4AA 5JJCA 2NUPA 3O8QA 1FCJA 2YUTA 3PZRA 4FZVA 4TTPA 1DKMA 4WFJA 4ZAZA 2QRZA 3VPDA 2C03A 3ZXUB 5FT9A 3UPTA 5L6LB 1PEDA 3MUNA 4JGBA 4L4YA 1SRQA 1F0KA 2MSCB 4AG5A 1XQWA 3PA1A 5I47A 1AQ6A 1XDWA 3K1JA 2WD8A 4KU4A 4M1MA 4BFLA 4E32A 6GPBA 3K7EA 3GRRA 3PJEA 3TW8B 3I9JA 1L9KA 1E9EA 1U8EA 2XUGA 4H7FA 3OLCX 3P45A 2JL1A 1G7RA 3QU2A 4HBZA 4ITUA 4OQLA 1Z5ZA 5AQ1A 1TMYA 4GPAA 4J94A 1NNLA 4S1TA 2BMVA 3ZTTA 4D9MA 3VDNB 1R16A 2D59A 4JVMA 4KFUA 4KWCA 4ZO8A 1KRHA 3KJXA 3F7MA 1RP7A 2JJ2A 2QTAA 2H63A 3B7WA 5DTEA 3PNKA 4DAOA 1J8DA 4PQYA 3T1VA 5CFZA 1DUSA 4TYMA 2C5LA 1FZQA 3RODA 1DZ3A 3SZGA 4Y9SA 2OV4A 3AKDA 1H6AA 3NGMA 1O4WA 2YZGA 4NNJA 1GEEA 2ZU0C 2CXPA 2DHCA 2JPDA 4HSEA 3JU4A 3BHNA 1D09A 4OEHA 1IEXA 5CK4A 2YVUA 2G63A 3DO6A 3CUVA 4I46A 5DX8A 3RUAA 3U1BA 2VH1A 2COKA 1UXHA 3UXMA 5L4SA 3HPQA 2OGSA 3A1VA 3STTA 4BKQA 3MMNA 3ZGXA 1XA4A 1T4CB 4X9XA 1VKRA 2R1VB 3AHCA 1OQAA 1X1BA 2C04A 3QY9A 4KI7A 5IDXA 4UM5A 1IUNA 2C1ZA 1ES9A 4WK6A 4BGIA 1Z0IA 4JQYA 2RONA 2VBFA 2W2TA 3V55A 1ZIPA 4N7JA 1OC4A 3X1WA 1E2DA 2Q2VA 2VVTA 4K6FA 1SH7A 2Y1XA 4LVUA 2N9UA 1RRGA 1DKLA 1II0A 2YJTD 3C1TA 4MB6A 4RIGA 3PNSA 5A0VA 5BYBA 2COUA 3CZ9A 4G2NA 4JBGA 2NU9A 2JAUA 3FBTA 1TJ4A 1TMKA 3N2YA 4PO1A 4RYDA 5JNRA 1C8KA 1JJ7A 4UAUA 4ZCSA 4CMEA 1Z8FA 3BKXA 3PIIA 3WWDA 2ZXHA 2P8JA 5CK5A 3ZWVA 2VJKA 3AM3A 1XZLA 3WNCA 2C4KA 2PZBA 2WJ3A 3HGQA 4LISA 4Q9AA 3IYLW 3PP8A 3H2HA 2X85A 3V8BA 4PCAA 4B45A 2HJWA 1B73A 3P4UA 4RJJA 5JASA 2VK1A 3QV1A 4C0KA 3IKTA 4GDFA 2VNHA 3CMEB 1DKRA 5DW3A 3HNOA 4N3BA 1E9AA 3DEZA 2PXAA 1QUFA 2IHVA 3PFFA 4Q05A 4ARIA 4PYOA 4HPWA 2YWGA 4MRVA 1S9DA 2R65A 3IIMA 4HPJB 2WF7A 2GEKA 1ZVMA 2KB0A 3GRAA 1JUDA 4ZT3A 5LUBA 1VJ1A 4DQ0A 4GO1A 2REBA 1VE3A 3TSYA 3U56A 4N5MA 4OQZA 4X90A 5E6RA 1I2BA 1QB7A 1WPQA 2EW2A 2XUAA 3RFXA 5M2QA 3IVRA 2A86A 3QW2A 1M1YE 5AT1A 2ECQA 5BN3B 3MEQA 3P2MA 1BS1A 3KAKA 1N5RA 1RRMA 4DLXA 1UAYA 3L8FA 3O21A 3HUDA 1KC8D 4EHDA 2R8EA 7GPBA 2OXCA 3GMSA 2JBAA 1O5TA 2ZIEA 3ORHA 1QV7A 4N5HX 1P9RA 4P4GA 1NDHA 4BNMA 2OLJA 1CVLA 3F49S 3I28A 4D80A 1K0FA 1J9EA 3MCVA 3NOQA 2PSEA 2YJNA 1WQ3A 5JAPA 5FI1B 1ZNZA 3DVQX 5CT4A 3UWKA 4ZMRA 5B7QA 1XJ0A 5BW4A 2O5EA 3T1OA 2I5PO 1FVXA 4BTVA 2IHKA 4KFRA 4F4CA 3J7AC 2VHQA 1U8YA 1GITA 3PUWA 2ZIXA 2WKWA 1XVVA 3FYUA 5LJIA 4CCAA 3CX8A 4O25A 1EXVA 4M60A 2IZOA 4REQA 3KKEA 1PX2A 2NM0A 1N4AA 3L5KA 2FVGA 2F8MA 3R3UA 4UE6A 5CNJA 1T9AA 3C6MA 2CZCA 5HGXA 3LKDA 3AKZA 2P4HX 3DM9B 4OA8A 4EJSB 4DJDC 2HGSA 2IGTA 5D84A 3AV0B 1OBCA 1F1JA 4OL0A 2PKRA 4P5EA 1UDAA 2X9NA 2RGNC 4NEGA 3V1MA 2PKXA 2JGRA 4FBLA 4GPZA 3FROA 4H0FA 3I6BA 4XIIA 3TVTA 3L7JA 4BWYA 4URXR 1NY5A 1VF7A 3FFWA 1PIWA 2W2NA 1DOHA 2YHIA 3ME5A 4DV4B 4JSYA 1LS6A 3CRQA 3LLCA 1MFPA 3WWZA 4EHAA 1Z0JA 3ET4A 5T7BA 1VSTA 2W11A 3N3AC 4ZAYA 3BN3A 4C0HA 1GAEO 1ZINA 3Q3VA 1BIFA 4GZ5A 1O5OA 4PG7A 3B8HA 5T5QA 2INGX 2PY6A 3C45A 5EWLA 1YBFA 2PIDA 5EMLA 3EXG1 1LDNA 1IQUA 3O84A 4KVFA 5JLAA 3WIVA 2D5BA 1O7JA 2Z83A 1NF9A 1OV6A 2HZBA 2WUDA 3JY6A 1O6CA 1NRKA 1YQDA 3GUUA 5K0BA 2UXDB 4FFNA 2NUTB 4ZQFA 2CDBA 4MITA 4MJ3A 4JB0A 4BBZA 1M74A 5HQTA 2FHPA 3LA8A 4FHDA 3PI6A 5EWMA 1ADFA 4QVGA 1Y3AA 2PA3A 4LXTA 4F5EA 2GEUA 5BOVA 1E3IA 5KMGB 4TXJA 3LOPA 2LCIA 3BWVA 4C4ZA 5SZJA 2EHDA 1J8QA 1C9YA 1YA8A 3ANTA 5BN5A 1DTEA 3GPDG 3UK6A 5FR1A 4PPFA 4URUR 4B7AA 2FSUA 5INTA 2Z30A 1Q86D 1NE7A 2BP7A 3UHOA 1G55A 3ZDEA 4XWWA 3DZBA 1SY7A 4INAA 4X97A 4X0CA 1MQSA 3VAZA 5F23A 2FRXA 3JAKA 2QLBA 4QLOA 4BXOA 2EGHA 2A84A 1HT3A 5DLYA 4GBED 3ZVRA 1P74A 1YDFA 3ETCA 3H1AA 1DBPA 3NC0C 1Y82A 3ZHVA 3MT9A 1RQXA 1XVUA 2P2DA 2VDQB 4H59A 1KQNA 3ZCRA 1C9MA 3MRVA 5IWAB 2JJ1D 1TVEA 5K3FA 4E0BA 1I3LA 3MELA 4EOGA 4I6GA 1SCJA 2VP3A 5G40A 2E21A 2VQ3A 2XNSA 2WAYA 2YUIA 3B9BA 5FR2A 4OHCA 2EJTA 2PSHA 1CLUA 3EXFA 3GQBB 3KT6A 1MC8A 4XLLA 4L75A 4Z4HA 5TRDA 1BWRA 4JJ4A 5HEKA 4OPMA 1QS0B 5FFNA 2PMWB 1UFRA 4FXPA 3QVKA 4HX9A 4BV3A 2YYAA 3S55A 3WK5A 3SM9A 4PGOA 1P1CA 3I3OA 3V4VB 5JJLA 3C1OA 3BJZA 4RTOA 2HMWA 2ZB2A 1LSJA 2I6TA 4KMOA 2RKBA 4RF2A 4WPGA 1QG6A 3MM4A 1X7YB 3AJDA 2OB1A 1TUIA 4ZOLF 5IAAA 2IYLD 3JVIA 1QF6A 4I4IA 4BNJA 3AY3A 4F2WA 2J48A 1NJFA 2HBQA 1RHRA 1U5BA 2VJLA 5U4XA 1QVVA 4KR6A 2AG5A 2VNJA 4ZRNA 4LQDA 4Q3DA 1YJXA 1RS0A 4KV9A 2GZMA 2O07A 3LA6A 4CM4B 4DCPA 2ZZMA 2IITA 1G0OA 4XSVA 3ZDZB 3T06B 1ZBQA 4WLUA 7AT1A 2PE3A 2H2IA 2YRWA 4HLCA 4Q1EA 3L7CA 2OPBA 5JSFA 3BEDA 4ZYTA 3ND5A 1XDDA 2SBTA 1ML4A 4QSMA 3H18A 2RKWA 3DOJA 5DX0A 1L8OA 5G2OA 3VJMA 1YGPA 1E98A 4HWRA 5DCUA 4EHHA 4I81A 2DQYA 3ABQB 1IU9A 2ZUDA 3GVIA 2D0IA 3CRNA 3QE0A 5AMXA 1UMKA 1KEPA 1AKYA 1J22A 1X80B 2GAFA 1YT5A 1BDMA 1J9ZA 3QF4A 4PAMA 2I2FA 4FYKA 5U1PA 3KHUA 2C96A 5I45A 3NPMA 3J81A 2X6QA 3P94A 4KWTA 1AU9A 3OX2A 2QD4A 2J6CA 2KYRA 2Q41A 3M81A 1P61B 3WFJA 3D0KA 1TEVA 3EVZA 4LCEA 2VYVA 5J2UB 4IHJF 3RU7A 3DDYA 2NAFA 4PVCA 4FD3A 1M1NB 2AKAB 3PK0A 4YJ2B 1VQNB 1DKQA 1KDVA 2XTMA 1UPTA 4A0GA 3UMMA 5KYUB 5I3ZA 3QEMB 3A1TA 4GOOD 2EFGA 3OF2A 4RPDA 4JCOA 3N3BC 4FOTA 2C8KA 3EDCA 5JDCC 2C5BA 1GGNA 2FN8A 4UTZA 1DBWA 5CR9A 5CAEA 6REQA 4NYMR 3Q9NA 2Q7XA 1AN9A 2BGUA 2ZANA 1W93A 5EOVA 1U9IA 2XCLA 5GY7A 4EYOA 2XE4A 2AUTA 5P8WA 1ZJJA 5IP5A 4Z3DA 3DVAA 5KYXA 1T43A 1USIA 3I4LA 3M33A 2FE4A 5I51A 1DWQA 3FPLA 3OBBA 1KDZA 2YJ5A 4CKWB 4OHPA 3KV3O 4JV5B 2NV6A 3SD7A 4Y9RA 1M76A 2CNKA 3JYHA 1A8QA 2LPMA 1YZQA 3FUVA 4RY0A 3FOEC 1SCAA 1QCDA 4ZRMA 5G3ZA 3RBXA 2IDMA 3O8NA 4TS3A 5TE9A 2HNKA 3MJHA 2YX1A 4TRJA 1CCWA 4KMRA 4FFOA 3FNEA 3GLUA 2A9RA 2V6JA 4NECA 4MHSA 1XO1A 3LCUA 3QBTA 4IIVA 1ZVVA 3R6GA 1UBCA 1AHPA 3A1WA 3ETEA 1UZMA 1V8BA 3R3XA 3ASRA 2XYRA 4LRXA 1UMDB 1W9MA 4P38A 3BC9A 1K5PA 5F5LA 2V7VA 1B14A 1QIIA 3M9WA 4R2IA 4ZV7A 2G77B 1DEKA 5CX1B 4FIDA 5THQA 1M83A 1PSWA 2JC3A 3BM5A 3D7RA 3ELUA 1AY0A 3QFFA 4Q37A 4TKZA 5FNVA 1E2MA 1VJRA 4D3YA 4J1QA 2I7XA 3CEPB 2WWWA 3KZOA 4MV7A 3I0NA 2WEKA 4XB2A 5LOVF 5GIOE 4MKIA 1WCWA 2GAIA 1A9SA 4MJLA 1KQFA 1MLDA 5C1IA 5AW1A 1Z39A 2DU8A 1KI9A 3QH4A 4WKCA 4RLHA 3HZRA 1X8KA 4Z7NB 2H1OA 3QX3A 3MJFA 3PE4A 2BFCA 2GPJA 4KE6A 2VA9A 5CA0F 1UJBA 4BVJA 4C4XA 1Q7CA 5C8DA 2FA9A 3FDIA 2C7GA 1TZJA 2LR0A 3U3XA 1RT9A 1U31A 3VV3A 4XN0A 1WCV1 1M6YA 4KDFA 4XX1A 1XTZA 2X0DA 1RBMA 2PTGA 4PPYA 2E7ZA 1RXCA 1V96A 4HJXA 2QVXX 4FLFA 5BUQA 2DLDA 3GSIA 1SQGA 2GK3A 2N75A 3BXPA 2QZ9A 5JXIA 5KNDD 4D6YA 4G8CA 1IHPA 1UJ6A 3A25A 3RYIB 1U2RA 1I4EB 1B0AA 1GGVA 2FMHA 1CG6A 1MVOA 4C6TA 1RRVA 1SKAA 4KYUA 1EM8B 1N1MA 5JCOA 3MINB 2HRZA 2FWAA 2CE2X 3QLUC 1J1IA 4ZU6X 1A9ZA 1K89A 5DKFA 4C0SA 4IX1A 1VG9B 5JCPA 3CC4B 4U9UA 1TKAA 1VM6A 2ZDGA 3VR3D 2FJPA 3AOEC 2X9LA 1HI9A 2C88A 2VHEA 4LDAA 3KUXA 4ZVTA 1AVTA 2VJQA 3A6GA 3O38A 5EIAA 4GUAA 2NVUA 4KBGA 1FOEB 3WXMA 4YWJA 2ICAA 2GHRA 1HF3A 1WHSB 3LLMA 4P12A 1RJWA 2GN0A 4NPHA 3R7DA 1HE1C 2F6RA 2G4VA 4W5JA 2I66A 5CFRA 1EFCA 3M9LA 1O6ZA 3V4ZA 3OCCA 4QVAA 1ZK2A 2R00C 1YRAA 5BR8B 1TD9A 3IULA 5D6NA 5EXXA 4BZQA 5F98A 2NU7B 3LL4A 3EEIA 4KAFA 4ODIA 3H8SA 3EXHC 2Y92A 1C3OB 3PLRA 1LQUA 4LNHA 4AAYA 5LKRA 3V8RA 4KIJA 2XZDA 1I2DA 3V32A 2BEWB 3DV2A 3EASA 4DL9A 4IS3A 4JKOA 3Q9UA 2NZYA 1GPMA 4IMRA 2B1IA 2NUBA 1OTHA 3N9IA 5BV8A 3A06A 4RPBA 2Q6LA 1AUXA 1ZDMA 3WL5A 4ZWNA 1F48A 3KYDA 4YASA 5HW0A 2FLWA 4RXUA 1FRQA 3U5ZB 1DKUA 1H8HD 1NDQA 2EDAA 4IFIA 2B92A 5IT5A 1C7EA 1PT6A 2R7NA 1YJQA 3LV8A 4BP3A 1ENZA 4BZXA 4DA0A 4ZKDA 5CD1A 2DWCA 1R0XA 2WAAA 3AF2A 4PLPA 1P9OA 5DK4A 1S3GA 3O90A 3X2EA 4EPYA 4CN9A 1E9DA 4XLZA 4O1IA 4BNGA 4ZCMA 5E6TA 5LZ9A 2QT0A 4C29A 4IIXA 4CQLB 5E4TA 4TKVA 1ZR4A 3OMXA 1WP6A 4UVEA 3JWEA 5EJ7A 1SCUA 4FBGA 3BXXA 3LC0A 3O31A 1Z4QA 2HPZA 3QX9A 4EKDA 2C20A 4Q1AA 2FDXA 3UMSA 3ZNNA 3MK31 2HBZA 3HI6A 3IA2A 2W6OA 4YACA 5CTJA 3TLGA 1AURA 4S35A 4DZRA 1KMQA 3AZQA 4Z6KA 2BL4A 4YJGA 3KCNA 4RD2A 4AZTA 2FZKA 3JALB 1UFKA 2I1LA 4GYYA 3DAFA 4M7OA 4I50B 4HEQA 2BCJQ 1QYXA 1BD3A 1DAPA 1DAGA 2ZYRA 2IELA 4DR3B 2WIAA 3IRVA 4CM8A 3RB8A 2VTBA 1HL3A 1YQWA 1HY3A 3MLBA 1SXQA 1QONA 2X19A 3HO1A 3S0JA 3B3QA 3F5DA 2XUIA 4BUJA 5CGZA 3T7SA 4Q66C 1KI2A 2V8OA 3ABZA 5ERGB 5K8VA 1XRRA 4QRDA 1NRIA 3UFBA 2FP3A 4ZI7A 2LXNA 1G64A 1JFFA 1BH2A 2QX4A 2JFGA 3HYNA 1GTJ1 3HUEA 1PVDA 5A3JA 5DT2A 3VAAA 4JVLA 3ZU6A 5FJJA 2CV1A 1MO3A 3IAS6 1EQAA 2X41A 4FHZA 5KREA 1L5VA 1QYVA 3LXRA 1JLLB 3ZHSA 1Q1AA 1JMYA 1SXJB 4LS3A 2WLSA 3BXZA 1VQ6B 2DQ4A 4TQAA 4DA4A 1TU3A 4NFLA 1Q2XA 2IBMA 3PQ8A 2QE7A 3QJ5A 1TVMA 5AM4A 3TLAA 4CJXA 3J80A 5AK0A 1YFKA 2PZGA 4LYGA 2I7CA 4D4IA 5ALIA 2BBTA 2DHEA 3MMPA 3DBIA 1JR3E 2H17A 4U9HS 3DMGA 4FE4A 3V4SA 2GX6A 4RF5A 5I5GA 4YAGA 5HBRA 1J2JA 3L0DA 5DLDA 2RK3A 1WHTB 2WT4A 1WB9A 2JLQA 4AF7A 1KPHA 2DFKB 2WSMA 3GOHA 5E2IA 2DULA 3P2EA 3EGWA 4UVIA 4HNHA 5A3VA 1VL1A 3GDFA 3ZZNA 3MJSA 1AX9A 5KKNB 4EUHA 3R9IA 2A88A 5IXJA 4HWSA 3HPRA 1JDTA 4HXFB 5KNDA 1X1AA 2D62A 2WUEA 4MRMB 5EJ5A 1P72A 1T15A 3SYLA 5EXPA 2ZWAA 3DWFA 3E8MA 2C83A 3S8YA 1ZN9A 4K9RA 4G9BA 4GQIA 1L7XA 4AP6A 1FX0B 1FRNA 2YJ3A 4V2IA 4CTJA 4DA8A 3A7DA 4RE6A 1RJDA 4ZQIA 2B9EA 3A27A 4N7MA 5FTWA 3UCFA 5KQRA 3QELA 4G1FA 4FEEA 4BNHA 2MOKA 3VR3A 4DV0B 3BULA 2NACA 1FMCA 4X1IB 4RMNA 1RC1A 1QHEA 4NCJA 4L8YA 5I7SA 2AXEA 3U3KA 5CTAA 2PN1A 3ED5A 4Z4GA 1NXVA 2MSEB 4AY6A 3N6XA 4HRXA 5TDHA 2QI9C 1T1EA 3A1UA 2FSGA 1RQ7A 3EVNA 4GLFA 3LP8A 4R2HA 4R9RA 4XIGS 3RPEA 3E9YA 2Z8ZA 3LFUA 1RLIA 3IDQA 4XQEA 4Z51A 2Q50A 2IEAA 3QYJA 4JJZA 1EX7A 1O87A 4ZOCA 3KXLA 4JH0A 3VM6A 1JIVA 2GAOA 2H1RA 2ZSKA 5AJTA 4F2DA 3PUIA 2BSQA 4G9GA 1N7HA 4XQCA 1EVJA 3UH1A 3KEWA 3PEVA 2ZJ4A 3FSGD 4JODA 5IPFA 5JJ5A 1JJIA 4V0ME 4OHRA 3S1AA 3I52A 1LRLA 2W58A 1PR0A 4YAUA 4INOA 1PFYA 5ITZA 3VJRA 1EUDA 1OWPA 3W8RA 3BIOA 4LVOA 4I36A 5F4ZA 1VMKA 3OCVA 1YAJA 1A77A 4B84A 1T91A 4NZZA 4CHTA 1TIBA 1USUA 4DMMA 4IJ6A 3DOCA 2X0JA 1QIJA 1DX4A 3JS5A 1IFXA 2IYAA 2BKUA 3ILVA 1H8HA 2OHVA 3OT4A 2IE0A 5CVUA 1XVAA 1P9LA 2CLOB 3R74A 3TLMA 5HRCA 5JRDS 3AILA 4R3WA 2PS3A 3AETB 3ASSA 3K31A 2J4CA 3GIWA 5I9LA 1WSBA 5SV2A 2NO4A 1CW2B 1F6WA 1PLKA 2C82A 3EPPA 2B2NA 4WHMA 3VZSA 3MD0A 1D1NA 2VG8A 4GNKA 3NS7A 3OKFA 4P2BA 3KEMA 5FXMA 4B1FA 4R7ZA 2XEXA 5EMMA 2JNWA 3K6SB 1J8YF 4P98A 3CTAA 3G5MA 2WIFA 3GD7A 3ECAA 1ZUNA 5CLQA 1JE1A 2NVOA 3SEFA 4KPEC 1JZQA 4MA0A 5BV7A 1EG7A 1RWWA 1ZJ4A 1XLTA 1PT7A 1TEHA 2ORVA 3H2GA 1B0ZA 2AZMA 2HIAA 4KO4S 1MD9A 3G8AA 3EPKA 1Z4JA 2WWXA 3IUQA 2HDNB 1OLUA 1H2XA 2GM3A 3V6MA 4M4SA 1JLKA 1ONBA 3DBHB 3RS8A 4MDEA 4Y6QA 4WI1A 3R7FA 2IT1A 5LBIA 1RRCA 4D4HA 2FCRA 1CDZA 5E9AA 4ZC8A 4JC8A 4Q4HB 3MCUA 5EMJA 2O2DA 3V9AA 2C3PA 1KY3A 2HMYB 3ZLUA 3R8CA 5C9ZA 1PT5A 5I7UA 1X94A 4HWGA 1FQJA 2V98A 4ZARA 3UC5A 2NQ8A 2OMKA 3DTNA 5JARA 3EGXB 3HDYA 5IANA 2DFLA 3ZZMA 4Z49A 1MA0A 5EIFA 1IB6A 4HRVA 2JAHA 3T7DA 1UEIA 3KQPA 5DHPA 3HH8A 4RH1A 3TLKA 1EEHA 3HDJA 3DVSX 1AF7A 1F2DA 3EJWA 4CIAA 3PEWA 1E7YA 5J40A 4LQ4A 3GGJA 2JGJA 5BSRA 5JZSA 2NZJA 1SVKA 2HLDD 3G8BA 3P52A 4NI5A 1NQ5A 2M6SA 2UV8A 1D2EA 1W1IA 3HXTA 3KO8A 1V11A 2NXCA 2GREA 2AI1A 3OY2A 3A28A 1Z74A 2WP8J 4RS3A 2Q4OA 1NRJB 3MYYA 2IV3A 4EGJA 3B48A 3G2PA 3N0VA 5JAHA 4NSNA 2PZ8A 3PPVA 4D74A 2PRKA 5THXA 2BRUC 3HG7A 5LJLA 5CFLA 1QOPB 4TT8A 4QWWA 1IVSA 4J9VA 1E3ZA 2ZZFA 4IMPA 4JNCA 1M34B 1RE1A 3I12A 4NU8X 3UJAA 2O4CA 4CETA 3RJZA 2GETA 4DDUA 1QIGA 4RX1A 1GV0A 1Z0DA 1ZIXA 2BJVA 1RJ9A 2CLCX 3R6TA 5HF8A 3T9CA 5U4QA 4ARZB 4QV2A 3B9RA 4ZXPA 4CKZA 2X23A 1MC5A 2L2QA 1S8FA 3QXHA 4CR7A 2P2ZA 5KW9A 2NU6B 4XOIA 2Y99A 3GNTA 4TM7A 4URHA 5LYYA 3DZJA 3PT5A 1TM4E 4W5QA 2JAOA 4W6ZA 2W6PA 1ZQ1A 3IGFA 2ZXIA 3QG5A 3KYJB 1V0EA 2VYND 3RNLA 1JEAA 1W0KA 3KVYA 3K20A 1IBLB 4X8IA 2H2AA 3VSAA 4B7ZA 1H3FA 4EH1A 3A2MA 2AUNA 3GYBA 2IP2A 4KWHA 4QG3A 3B2NA 1GTRA 3EDOA 2IOFA 1FX1A 1P6XA 2ZTSA 3O4JA 1W36C 1RMYA 1RTTA 5IT0A 1EIWA 4PYNA 2X1LA 4GLJA 3LT0A 3H65A 4RAQA 1WP4A 1ZD4A 4W7HA 1OWOA 1QFXA 2FR8A 3BB4A 3G0BA 1EM6A 3V3TA 1R6BX 2O50A 3R20A 4F8YA 4Z99A 2WYUA 3PC4A 4BNIA 4H7PA 4Z1OA 1HTWA 3ADDA 3LE8A 3C3BA 1RWMA 1P0IA 3O9ZA 4GP9A 121PA 2C3OA 4GFDA 2EP5A 1S3IA 2XCSB 3UC9A 4L76A 3HFRA 4Z4WA 1NW4A 2XECA 2EKLA 3C8ZA 5KNBD 3VKVA 2B7LA 4BNDA 3CJQA 4P0PB 2PT5A 3KFLA 1MHPA 4C7VA 1WULS 3I72A 1XROA 1ISHA 1VRVA 1UJ5A 3GGSA 3KFXA 3DL4A 3H6GA 4LGYA 1MIHA 3MTDA 4M0KA 4WBNF 3SY8A 3O8DA 2JJMA 1O54A 3IAUA 3MJTA 4N5NA 8ATCA 1SJ9A 2Q28A 1VJ0A 4OXXA 5H8WA 3I04M 3VGPA 1U7TA 1J6UA 6ABPA 4IJWA 2RKOA 2HHAA 2ZYIA 1WMSA 1CUFA 2MMCA 1TE2A 3NPAA 5DB4A 5EHQA 3EIHA 1ZICA 3ILXA 2F2TA 5I4CA 4GNRA 4OGFA 1O6FA 2HHCA 5EYPA 4DQKA 4E6EA 1ZU5A 3TUJC 1NFQA 2XA9A 9ATCA 2FPIA 1C9DB 4PW0A 4DVGA 1AMNA 3NC1C 2YRXA 3AU8A 3CT4A 1T3SA 3ONNA 1XP8A 3QX8A 4I1IA 3SEJA 3L77A 2UUCB 3QVSA 5I8PA 1S8AA 4D3ZA 4MEJA 5DI3A 1BFDA 4Q9HA 5E38A 1NXPA 2XMGA 3O7MA 5K3EA 2SICE 3QOYA 3B2QA 3IIKA 1Y1KE 2IRWA 5LM3A 1GPYA 2RHTA 1J1UA 5K5EA 3DE3X 1SAYA 3ITKA 3OIDA 2E87A 4WOKA 4Q6WA 3SDSA 1WVGA 5JD6A 4C6TB 7REQA 5FULA 1LPBB 3NU1A 3VTKA 2XI4A 1RXSA 4QASA 1M2JA 1X2BA 1UD8A 3LVQE 1GL6A 1M6VB 1OASA 2VJYA 4HGQA 3I6IA 4DV7B 4EI8A 4PO9A 5IN5A 5FTLA 4MCHA 5EA2A 2ZR0A 2FSVA 2N3ZA 5CM8B 1RHMA 1XZKA 4GHWA 2QDXA 4FNMA 1HFEL 2XDQB 2YY7A 1V6SA 1C41A 1EFRD 1QH1A 2R97A 1W48A 1YRLA 4Z9YA 4MLZA 1I18A 1GARA 1SOWA 2AFIE 4XE5A 5DDIP 5F78A 1ANKA 4UOZA 4HDMB 4ZGBA 4WEQA 1ATZA 2ZG6A 1BDIA 3PVCA 3HK2A 1E6WA 4B9AA 3ESQA 1T6ZA 3AI2A 2WMYA 3TL3A 3MGGA 1Q14A 2G6TA 3TW4A 2H0RA 2JKYA 1YB2A 1FW8A 3QTTA 5BQ3A 2VNIA 1LDBA 1RLOA 2MR6A 2Z9CA 1BFKA 1MJGA 1LF0A 1GSHA 3DKIA 3G0CA 2W0MA 1XOIA 3HKDA 1GZVA 2HLPA 4I14A 3F3MA 1UXIA 3C6YA 1YQTA 3HFGA 1V8ZA 4RFVA 4X1YB 4Y2QA 4JUDX 5AVKA 3QHAA 2ZUTA 4B32A 5F35A 1ZC3A 1OWMA 2AD1A 4F2PA 4HNTA 1PWHA 2HEIA 3MSXA 2HLDA 5I7RA 4XLCA 1YD7A 3WA6A 1CUAA 4DLAA 3MXTA 4KQJA 4DTIA 1FS5A 4YEDA 4C88A 4CEIA 1G2QA 3OFSA 4AZVA 3TECE 2IYEA 2ZJ7A 1SCDA 4A3SA 2VPTA 2XAUA 1K7YA 3ISXA 1BN7A 1QG2A 3LWBA 2K6GA 1KSGA 1QTQA 4OXIA 5CA1B 2HMVA 3JD4A 3A9UA 4FUTA 1F5SA 2ZR8A 1P45A 4KMSA 1XXHE 2XWJI 2IXAA 4LMRA 1TFRA 5FBWB 4I66A 4KXNA 2BFBA 2IKQA 1M0SA 2LGJA 1CUCA 2ZK7A 2VP2A 3DO8A 4IDFA 4MVJF 5AI8A 3TG8A 3LT2A 4BQIA 4LE1A 4ARAA 4AKEA 4ER7A 2AX4A 2GO1A 2C5HA 3E9QA 5AXDA 4DARA 3WNDA 2XRMA 4DBLE 1DC8A 1KAGA 2YXDA 2HNAA 3BJMA 2OTJB 1J2RA 4QDJA 4YFYA 2ZB4A 3TVDA 1L7BA 4RABA 1ZK1A 5ESRA 2FN7A 3ZEAA 4M1SA 3PC7A 4I1VA 4KZKA 4KNVA 1J8FA 2VYNA 4MVJH 4BO6A 5KYGA 3K9QO 2FV8A 1GYPA 1Z4IA 1TCUA 3H4MA 3IALA 3FNHA 1ONNA 2ZSJA 4L8WB 3MUEA 5DLEA 5B3JA 5L45A 2BTEA 1NQWA 5DI9A 4MPDA 4B5KA 1JXQA 1OZGA 2C31A 4QZVA 3RUFA 1XN4A 3ZGNA 4BFYA 3H2SA 1C0KA 2KPOA 4JS0A 4ZCPA 3TF5A 3FNRA 3ZN2A 3MT8A 2WQ7A 2YMPA 3P4XA 5TJHA 5KCMA 2CFRA 1NVMB 1R6XA 3TZLA 3D7NA 3O8OA 5AKKA 5KDOA 3O2JA 2ZP1A 1QZZA 2QN2A 3HZOA 1IMJA 2C58A 1SBCA 4EI2A 2XYQA 1G8FA 4FYPA 3WISA 1NP6A 2H1VA 4IKEA 5EE3A 3K1AB 2R66A 4KHZA 1CY8A 4ROXA 3CF6R 3IMEA 3U26A 1OFUX 1X1DA 3MJDA 2V97A 4EB6B 2IS4A 3P5SA 5CM9C 2DC1A 4ZEVA 5KNBA 1KVUA 5KTSA 3LPNA 5GINE 4GE3A 2QTFA 1FC0A 4QJ3A 1BXZA 3UMFA 5EAIA 2C2HA 4MUMA 1ZSNA 2JA2A 5FWAA 1P0CA 5KYWB 4TYNA 4JBYA 4M1KA 4I5EA 3DLIA 2VRCD 2FK8A 3O7WA 5JXGA 4ERNA 5JVDF 2O8VA 1K8AD 1PG5A 2O3QA 4E08A 1LS1A 4FFBA 5EXEA 5CFOA 1HT2E 4RV9A 1Z0ZA 5KZMB 2WM3A 1G8PA 2E3JA 1R3DA 4KUGA 4LKRA 1BU8A 3ZE9A 1XEAA 3KWFA 3ZU3A 3OX3A 1IHOA 2OECA 4TXMA 2QD5A 1OXTA 4OMUA 2I71A 5BNZA 2Y9PB 2CMFA 3KSMA 1K7SN 4FP9A 1L4BA 1Z0KA 1LJ8A 4G4SP 2BZ1A 4QHSA 4UASA 4DUGA 4LRQA 2EJWA 1VMAA 1XEXA 3HUFA 5G4KB 5HHTA 5KOIA 2JIMA 2CFOA 5CLJA 2EG9A 1H1LA 2PJZA 3CUTA 3JZMA 4RZ2A 4AJLA 3ZVKA 4LCJA 4ZTZB 1ZCAA 5DOZA 4AJEA 5ADHA 1REQA 3UJHA 4LWOA 1YR3A 5I7WA 5ICGA 3P4YA 3I2YX 3GJ4A 5C1PA 5E4JA 4FZ3A 3THXA 4BPBA 1Y8QB 4WXPA 3KKNA 3LC1O 3KOWA 4ZHQA 1NYTA 1WX1A 1AKQA 3D9QX 3DP9A 2ALJA 4LY0A 3IQEA 1YOVB 1EFHA 2REOA 3P9NA 1W4BA 3FG9A 3AG5A 1D2CA 5FYDA 2OGTA 3CBQA 3D6VA 1XEFA 4E33A 3E53A 3ZG6A 1GTMA 2JGDB 2HA7A 2AQKA 1HQKA 3ES9A 4NCNA 3GLHB 3I01A 4EF4A 2XXAA 1SKYB 2ECOA 1Z08A 2IEDA 1BH6A 3FPKA 2BGJA 2LVBA 4GSYA 4V2UA 7ABPA 1HXHA 5F51A 3WGUA 3NHYA 1DQNA 3F98A 8MHTA 2Q1XA 4TGLA 3IUSA 1MC1A 1JIJA 4DV2B 3C3CA 1P31A 3CVVA 2CHGA 3FR8A 4V39A 4CL2A 5JNUA 2NO7A 5F52A 4YXWD 4HDKA 3WRYC 2HSWA 3FHCB 1KI6B 2VDMB 1QX4A 2PL5A 2J3MA 2Q3LA 1HORA 5FO1A 3IT2A 4GRIA 3RRJA 3G5UA 5LQMA 4D4LA 2P4EA 4F8EA 4NX2A 1EYZA 4G0VA 1JKJA 2GBIA 3R4VA 4PXSA 5I4BA 3KZ1E 4GZLA 4B3SB 3IAEA 1T10A 1CRZA 3DFIA 2HGZA 4IQGA 4R1UA 3RQSA 3VPSA 5AUNB 5MGNA 3OWXA 4UOQA 3FTQA 4Q1BA 4MEAA 1A9RA 5I9TA 1KFBB 2JIBA 3SFVA 3SFZA 2FFHA 1AA9A 1JALA 1WXFA 5JS1A 2EX0A 4MYUA 2ETXA 3OAAD 3H2BA 3L4EA 4HFJA 4KEAA 2PX5A 1ONPA 1OLOA 1XU4A 2KW5A 5KYVA 3Q8MA 2BUAA 5K03A 5CB4A 3ZNPA 1GDDA 1Z25A 3IIJA 1LNZA 4N1AA 1QJ4A 3EYWA 3OPYB 4WZAE 5T57A 5J63A 4D4JA 3N8KA 2AHRA 3COPA 2QLTA 1YI0A 3LIPA 2Q5HA 2X9QA 4P3PA 4QJ4A 2MYNA 4YJHA 4D0NA 5C8XA 1M2OA 3EGCA 4FEYA 1X1CA 1PL7A 1WLSA 3DF9A 3K2QA 1UM8A 1PSZA 3VV2A 3ZE6A 2IVZA 3H9NA 2JHAA 2XWQA 3B3AA 4L0DA 5JMPA 4JLDA 4YLGA 1KJYA 5BSMA 4J16C 1M7GA 4QGHA 1CJKC 4HTFA 3PF8A 3SC2A 3WO0A 1Y8RA 2B82A 2FLVA 4UVGA 2CBZA 3AZOA 4D8VA 1QFJA 4CKBA 3TR5A 1J0XO 1WTAA 5CBPA 3L7DA 1CUXA 3NHZA 1A1VA 1N7IA 1ND5A 2HCRA 3R44A 4O02B 1OLSA 5CDFA 2YHBA 5DHQA 2QQ5A 1CFJA 4LGVA 3ONUA 2BOVA 2I4TA 3U31A 2Y1GA 3RUPA 1FYFA 1IM8A 2B2XA 5IVHA 3U4CA 1VGQA 4Z1MA 4N8SA 1KP9A 4URWR 4W63A 5AKLA 5JWHA 4F4HA 2HQBA 3AB8A 3CH7A 3H2KA 4G0MA 2OB2A 3RDPA 3TN7A 3X1XA 5K7SA 3HQ4O 1I0ZA 4H1UA 2EARA 1XNQB 2JARA 3U4AA 1Z06A 1JIUA 4FGZA 1N0HA 3DZIA 5K09A 2PG3A 3TQSA 2EATA 3EXEB 1I0LA 1ZH4A 1K6EA 2XUOA 2GVDC 2XBUA 4LYFA 3EMKA 1URPA 3Q15C 4OXKA 3UATA 1SU6A 3ICOA 2VHTA 1SU4A 2V3WA 4QYMA 4B35A 1EBBA 2X7HA 2XB4A 1F2VA 1RAIA 3EDQA 1R5NA 3MHTA 2QZZA 4UDNA 1Z18A 1RLTA 3U4GA 1RE0A 2WHEA 3IL2A 4RDJA 3A8KA 4Z0TA 1VQPB 1ISRA 5IX8A 3G68A 4I6JA 5HNKA 4Y7DA 1M2GA 3V4RA 1CEEA 4CMCA 2JLYA 1ZD5A 5LR6A 2CL0X 2VRCA 3PUJA 4TVKA 1G8YA 1NI4A 2HXGA 2PPLA 4Q1FA 5KOJA 3A1FA 5B3KA 1Y5NA 2POCA 2JHGA 3IO5A 1KBZA 4Q7KA 3U44A 4K88A 3PL1A 4J0IA 4ZYVA 1Z75A 3DDUA 5L3SA 4NMLA 2IHUA 3L0IB 1QC5B 1TU0A 2CJWA 2CB9A 3F6BX 2CWWA 3ZNQA 4BDTA 4JU8A 4P6VF 5SY9A 3MFQA 2I4LA 1EGVB 5K05A 2C7PA 1ZN2A 1AUPA 1GR0A 1PUIA 2F64A 2E6KA 1IJBA 4H1VA 3ZX5A 1AS2A 2AQ8A 3GARA 2EHJA 4WWVA 2HT6A 3OECA 4DRXB 3FDXA 1YCGA 5E8RA 1UPBA 1DT3A 2IV7A 5LZ5A 3CF0A 3OU6A 5ENVA 4ZVOA 3MERA 1SXPA 1LPPA 1NM5C 5HZAA 1FTNA 3DE5X 4WCFA 2G5PA 4XVQA 2O2ZA 2F1MA 2Y1EA 4M89A 1F06A 4IHJB 3U9SA 5BVHA 3DMRA 3BMOB 1PR1A 4P26A 2JCYA 4DWOA 3L6RA 3TFOA 4BB0A 4RKEA 3MJEA 2CZGA 2OO5C 4E11A 1A9YA 3SBXA 4GGMX 4CF4A 3GA5A 4JY7A 3DZ8A 5DNUA 1JLHA 8OHMA 2AOUB 1KWGA 3TJZA 1P62B 4M53A 1LBEA 1MT3A 3W8NA 4EUSA 1FEZA 1U9CA 1I5EA 1WPXA 5LBTA 4EDFA 2V5UA 3HE3A 3O92A 4ZQBA 1UK9A 1EK5A 2VJBA 3KJIA 3TZHA 4ZICA 1WUTA 1LPNA 2FWJA 1RWXA 1SQ6A 2YCBA 1TADA 2Z1DA 2XAAA 3EQ7A 4WESB 4XTCS 4A0HA 2PGOA 2WKQA 3MWYW 4FMCF 3TYXA 3ZWKA 4HQ0A 2VS1A 3LKVA 4AKIA 4F04A 3DLHA 2HSDA 4G0PA 1UEXC 3B1KA 2O0KA 3FRJA 1PGJA 3P2KA 3KUUA 4YXWA 2JEOA 2JLBA 2WRZA 4KQ6A 2WJYA 1ZXBA 3PNMA 3QKTA 1WF6A 1SIWA 4H08A 1J5PA 1MW8X 1LPAB 4NAUA 4NOKA 1U0FA 4Y9TA 3NNNA 4BO4A 3WWCA 3B6EA 5HP4A 1ZXLA 2RBEA 1UK8A 2ZBGA 4P3YA 2WMNB 4IWNA 4QXRA 2CBGA 5EJIA 4C6HA 4NENA 2P41A 4U7GA 3WK4A 2EWMA 3CYFA 1CIJA 2QMZA 1GZUA 3VOAA 1Q7RA 2FGKA 3U37A 5KQLA 1KU6A 4X7PA 4F71A 1BCSB 1TC1A 3GRZA 4E5YA 4Q4DA 2EWVA 2QSZA 3EG9B 2DQKA 4LXUA 4ZO4A 3EXIA 2FSPA 5FADA 3OO0A 3O0DA 4GPEA 1CZOA 1ZL0A 3D2LA 3OAAA 4WKOA 2ZSFA 3AFIA 3KTDA 1ZZEA 1NVVR 3WMXA 2J9XB 1Y37A 4RQUA 1MFZA 3T41A 3N07A 1K7FB 2MYPA 1EA7A 1ECFA 1V1MB 1DV2A 2YFHA 2ZREA 3K4QA 3SYTA 1TA4A 3LRXA 4M7RA 4UULA 5T4BA 1QH0A 4FDVA 5B6PA 5B3AA 3IVCA 4JWKA 4LRUA 4OI1A 4COOA 1O89A 4J43A 4H7IA 2B34A 2OCIA 1XLWA 5CA0B 1JHZA 3K09C 2EGUA 2VDRB 3JXEA 1VKHA 4ETWA 1YX2A 4FU0A 5BWNA 4Q02A 2GBLC 3CE9A 5CMLA 3DP7A 5HF9A 1CV2A 3R8FA 3V9PA 4O4JA 3E3AA 1GKKA 1VLZA 1WEHA 1R0CA 1ISPA 2ZM5A 1YWGO 1FFHA 2IPNA 1L4KA 5AIBA 2GA8A 1H3NA 3D4BA 4FFRA 4OP1A 1U8UA 3OZIA 2V4UA 3GJ8A 2W2LD 4ETIA 2VHZA 2AMLA 1TC2A 1ZH6A 2SNIE 2VAPA 1VYUA 2BTOA 1GNVA 2JG3A 4S1OA 1GTG1 3BNWA 3CP2A 2W4IA 3K9WA 1WDLA 5K4GA 3NHMA 1JQDA 4DCVA 2V59A 1C3VA 3HCOA 3ONWA 1OI4A 1KEKA 1ULSA 2PHZA 2GN9A 2OOKA 3T5TA 1CUWA 1FY2A 1ORTA 3ZKWA 4J75A 3QWIA 3GA7A 2VBTA 4RF3A 4XVHA 5AWFC 1L4LA 3FSJX 3STVA 3KQWA 2XKBA 4M1TA 1V1RB 2DYKA 4NJMB 1L7AA 2PUHA 5E6UA 4V0LA 1QYRA 4KLRA 5AKYA 4JUCA 1USVA 3BD6A 3PQCA 1PFUA 3HM2A 2W5UA 3B6KA 5CD9A 1K6JA 1H42A 3LBHA 4NOLA 4OQMA 4D9FA 1ID8A 1YDEA 2XR1A 5DBGA 2V0GA 3UV6A 1E5VA 3ILHA 4G8JA 3VR2A 1P60A 4TMVA 2OHXA 3IUNA 3FCYA 4HDOB 3T4PA 4RWEA 1FTYA 3OLZA 2VUSA 1U7UA 4JC4A 1TK2A 1JR3A 2Y05A 2XLCA 1YKSA 2ZT7A 4B2LA 3WLTA 2BC9A 5EP2A 3OCZA 1XCGB 2HK8A 2HO4A 4IJ5A 5IJ0A 2ZRAA 4D5GA 1DQYA 5FLXA 1Y7TA 1GHTA 1NP3A 4MCJA 4A82A 1PLJA 3EH1A 3JYQA 4LSMA 4AY5A 1NYRA 4HUQB 2AZTA 1FFDA 1RPNA 3SSAA 1OH6A 3ETNA 4Y2RA 1TECE 5KQMA 3B60A 3G2NA 4X44A 4N0DA 1SZJG 2HL6A 2QA4B 4BU0A 2OV6A 4HQNA 1FFWA 4WW0A 2HA3A 3AOGA 5LXTB 2LTAA 1AV6A 2XODA 2EYQA 4F4UA 1CVIA 3TTSA 5BNIA 1T9DA 3NV9A 1JLMA 5L51A 4LJ5A 5COAA 1N5KA 4TLEA 1DTWB 4OTZA 1P2TA 1SUBA 5JSYA 1S1MA 1L7OA 4C2UA 4LHWA 5FLYA 4BFUA 4EHKA 2BJHA 2NOAA 3G1UA 3MW8A 3MWDA 3UJ6A 1A50B 1TYDE 3IJPA 3SLGA 3SQMA 4NU0A 2AOTA 4EA8A 1PV4A 1AQLA 4QJIA 4WZBB 4IXDA 2QX8A 4JLKA 1X77A 3CX7A 3OC0A 4QYIA 3SF8A 4ZYWA 2CXRA 3B38A 1Z17A 3CNBA 2R68A 4DE5A 3PPXA 4URYR 2QZPA 2ZI6A 4P32A 3FTFA 3G88A 4N6NA 2BR4A 3VHRA 2EZ9A 3GF4A 4YYEA 1NFRA 1YR2A 4C0LA 3ZKAA 4MI9A 1M1UA 4UTXA 3T0GA 1RYHA 3IELA 4PAAA 1A8UA 1GZHB 3C39A 2C2OA 4CEHA 4KN5A 1PYDA 2ZWIA 1MT0A 3H17A 3EZYA 1N0VC 1UDRA 3L0SA 3RSHA 1KERA 4F4FA 4CUJA 3LWZA 2O1EA 1FFSA 4M1ZA 4AY3A 1I9CA 3QOFA 1IY8A 3AJ8A 4OLBA 4F9FA 1JAXA 3JD2A 4V0MA 1LU9A 4OQDA 1XVLA 4O3FA 3D43A 3FRIA 1NQXA 4GLOA 1L4MA 8ABPA 1OLXA 1OU0A 1K75A 2QIOA 3CWCA 2ISSD 4J0CA 1O97C 1D1SA 3FIJA 3EGIA 3NCHA 4PC1A 3ZXSA 4CQJA 5JBNA 2TSYB 1T6XA 1LSUA 2ZKLA 2QNIA 2ZUBA 1QFMA 3FYHA 4P5DA 1S89A 3BFXA 5AHXA 3WJAA 4DC9A 1YHZA 4NOJA 3W9SA 3EVTA 3MBKA 3WB0A 1YZUA 3D64A 4ZT2A 5A05A 4AMGA 3G49A 2FEMA 2G72A 4YRQA 1W25A 4HH4A 1EK0A 1L8XA 1J39A 1C9JA 1FB5A 2CF6A 2RARA 2RG1A 2R5WA 2XQJA 3COYA 1T2NA 4TKUB 1LLCA 1XRQA 2YZ7A 5AKHA 3L0BA 2W71A 1T29A 4ZJYA 1Q20A 4U6SA 4RMJA 3L6UA 3P9ZA 3E15A 3G8CA 5C4GB 5K0JA 4FSHA 2RGDA 1O96A 1XZ8A 4PS0A 3DEHA 3G0GA 1U9YA 4IYRA 5JCJD 1T34A 3T3MB 4K6MA 1VBKA 2B0JA 3GG9A 4BNNA 1M5UA 2FPGB 2P3QA 1PKVA 2GNPA 3BHIA 1SCQA 1MN6A 3TDNA 3UA4A 1JEQA 2B37A 1WOYA 1JLRA 3AWDA 1OIVA 5LUAA 2GVNA 3KPYA 1U90A 5EP4A 2PV0A 4LNUA 3SE7A 2SHKA 2YW9A 3T94A 2WYVA 5ALYA 1A0OA 1WOOA 4NONA 2X0IA 5HVNA 2JLRA 2VP4A 3OC6A 2X3UA 5KWIA 5FA6A 4B3XA 2CLLB 1HFKA 2P0EA 2R6ZA 3ITNA 3DVLA 1T8SA 4I1SA 2G06A 1XK7A 3Q8XB 4AZSA 3MWEA 5HCUA 4IQFA 5EQJB 1DAMA 1W96A 2CDAA 1ZGZA 3G85A 5BURA 4XKVA 2W0SA 4XWAA 5C53B 2VJAA 2FXIA 5F5XA 4LBVA 2RCYA 3EIUA 4PBRA 3K1YA 2R5NA 2ODBA 1I3CA 2QP3A 2IZ0A 4LDZA 2QROA 3E5NA 4MIYA 4P7KA 4UNPA 4BFSA 4BO0A 4EGQA 3S2ZA 2IW1A 5JZ9A 3EZGA 4XASA 4HFMA 3K5PA 1PTJA 2C5SA 2OFWA 3F73A 3I5MA 4Q7JB 1JXOA 4G5XA 4OBEA 1ZMRA 3UMRA 5ALOA 5TY0A 3AF5A 4TL9A 1YDGA 4EGSA 2KM1A 1HDEA 3EFOB 1UXOA 1KMHA 2W43A 2WFLB 1O94C 2YZNA 3DJFA 3FUUA 1V5IA 4FJ2A 4R1OA 4RV4A 4BU1A 5IYZA 1U3CA 2P91A 3JQCA 3OOCA 3JYLA 1B76A 4MRAA 4O4HF 4Q3CA 4QAJA 2HCTA 2EL7A 2JD1A 1BGXT 3IE0A 5FFFA 1M6NA 1EJ0A 2CLSA 2RSLA 1ZD2P 4GQBA 2VDKB 4OYLA 2O3SA 3D8SA 3RR2A 3EZXA 1KSFX 2AMJA 5BUZA 1HE3A 4HPXB 4DSAA 3KHSA 5BT8A 5IBRA 4YCCA 5J58A 3QUQA 1T4MA 1UFOA 1YIDA 4QOJA 3AGQA 1NVBA 4A2WA 1VJTA 1ZBDA 5TPWA 5JC8A 4OGWA 1M2FA 5DW0A 1PL0A 4EG0A 5KBYA 1JDBB 4WMLA 5JO0A 3OURA 3FW1A 4RHUA 2HBRA 2GJSA 3BDAA 1T5BA 3KJHA 1DB3A 3F96A 1RRFA 4RAOA 5FEUA 2ONJA 1MAWA 2PX4A 4DJTA 4P8RA 5H3LA 4OB7A 4W82A 3WQHA 4H4EA 3AEQA 4FC6A 2XDYA 4BFTA 3GLRA 3GLVA 4MSUA 1GLNA 1GPAA 1VYHA 1FP2A 1PYGA 1TZ2A 4KMMA 5LDGA 4KSYA 1RCUA 4GMGA 3OW2B 4PF1A 1ACJA 2I9KA 1UJCA 2BR3A 1YDMA 5JHHB 3F78A 2FZCA 4MVCA 2RC6A 4DNPA 4B6GA 2YWXA 2F62A 1JAIA 1H2HA 1JZSA 2A2ZA 2ZE7A 2ZYSA 3ABSB 3N05A 4TMKA 2BEUA 2XRYA 3K53A 1JVNA 3FDFA 3IO3A 3I2IA 4PEVA 4R69A 5TVKA 3HSYA 3DE1X 2R7KA 2YZKA 5BQXA 1GADO 4U8GA 4YR7A 5KVSA 5A03A 1W85A 1A8PA 5B37A 2ZS8A 1KH3A 1M8GA 4AFNA 3L8EA 1X87A 5HUHA 4MR8A 1DRJA 1SOAA 5ILOA 1EDDA 1G6KA 4RVCA 4ESVA 1FUEA 2A1UB 3OBIA 4CM6A 1HT0A 1RP1A 4RADA 3RK1A 2ZUUA 2YN4A 5F7OA 5FA5A 2CUKA 4OFZA 3D3QA 3IJEB 3GGOA 4K3VA 5LU8A 3O8QB 4UATA 3MRSA 4HCJA 5JLJA 1QO9A 4MQ5A 2WM2A 3K30A 4QDTA 4JR1A 1EINA 1X14A 2AN5A 3CINA 2AYXA 4IICA 2JGLA 5LQSA 5TB5A 1GAXA 1T5SA 3HXQA 3CUWA 3OUTA 5ALMA 3R6KA 2ZBPA 4HYEA 2Q5IA 2RI0A 4UBJA 1SG9A 3L4BA 2HJRA 3ZWNA 3GH3A 3OE1A 5DMXA 2QMUA 1U7OA 1E6KA 4CQMD 4X94A 4M9ZA 3E9ZA 1E8NA 2PKWA 3R0ZA 3K6JA 1Z73A 2X5KO 2QTMA 4RLSA 4ZVQA 4ZK6A 3KL9A 1Q0HA 2ERCA 1L1EA 3HKEA 1NJGA 1ABFA 1XZNA 5ITZB 4K8OA 5KHAA 1H2AS 1D4ZA 1U7WA 1WQ4A 4IDOA 1TO2E 1VMIA 2IHJA 4WKBA 1CZHA 3U7GA 3LC2O 5JCJA 3TIGA 3H75A 1PR6A 1Y81A 2QXTA 3GDHA 4XDHA 3G02A 3PUNA 3L8MA 2Z3WA 5HOEA 1L3BA 1J99A 4B46A 4DN6A 1GKLA 2ZIVB 3NI2A 3CEHA 4HSGA 3JASA 2RHLA 4JP3A 3LOUA 3ROGA 1ZKDA 3A4VA 1Q1NA 1A7UA 1DKNA 2VT7A 4LJ7A 4UU0A 4BMSA 4Z3OA 1U3WA 4LZLA 2IFTA 3Q1KA 3OZ7A 2MYUA 3WLIA 2FUG1 2J31A 1Z4LA 1V9SA 2AKEA 4CIYA 1IG0A 1ESNA 5IFKA 3PCRB 3NG1A 3ZJTA 4NDAA 2C3MA 1N05A 3HB1A 3Q4GA 2QRPA 1LDGA 2OORC 3CRRA 4S1PA 3SC4A 3BMQB 5HFAA 2EFHB 4BVEA 1QK3A 3TLBA 3OD5A 3S68A 2ZS9A 3CCCA 3ESBA 4G65A 3SQOA 1W8DA 5AR1A 2YHAA 2P65A 3IIIA 2IJGX 4MWEA 4QQFA 3ZHZA 1PDWA 5F7JA 1UC8A 1I6WA 1MOSA 4ZMSA 2GBPA 2DUJA 1LDMA 2E4VA 3FB4A 3M5PA 4XPZA 2FPXA 4IW3B 1TMOA 2GZSA 1XZEA 2O06A 3E7FA 3MOIA 4G81A 4INPA 4OMDA 4KR2A 1IK6A 4RK7A 1ZK4A 5EZSA 2RI6A 3CH4B 4LZWA 4RPIA 1Z6ZA 1XXHA 1AZLA 1YONA 1C29B 5F3DA 5I7HA 3L8HA 4HATA 3STYA 3M83A 1BS2A 3GVXA 5HE9A 4DFDA 3B52X 3RS9A 3VZQA 1SXJE 4AF8A 3KQTA 2OD7A 1YFJA 4LF6B 1CYEA 2CVQA 4JUIA 3I55B 1JLSA 2VJPA 3M70A 3GPCA 3HI4A 4IIJA 4QIHA 4G5SA 1E3EA 5E1BA 2J32A 4BBAA 1A2QA 1KKMA 1VSVA 3OA0A 5ISMA 4GEGA 4MVJP 3CO5A 5KYYB 2AOWA 3H7AA 1US8B 4BKUA 1S2LA 1PP4A 3R5FA 3HKCA 2V3CC 4Y1EA 4A6PA 5EJAA 2FQQA 1F20A 5E6RB 2BGWA 1C0PA 2G5CA 4TTRA 2NU8A 3TM5A 5JMTA 3O4HA 3KXPA 1KY4A 1W2WB 1N1EA 2Q1YA 2IIQA 4PG4A 1UEJA 3I2FA 4RD1A 5TQJA 3AHDA 4ETNA 4MULA 1IHDA 4GWKA 4MS3A 4Y2GA 4TZ0A 3O75A 2JKZA 2ZB3A 1NSFA 5B7PA 5JATA 2I3BA 4JI8B 5CVJA 1TLFA 1N5LA 3JQQA 4DNXA 3H84A 1EDZA 2P2CA 1IN1A 1OSNA 2Q5LA 1U3DA 5F4OA 3FXAA 1GRCA 1ZG3A 1UK6A 3IKVA 4R6XA 3RJ9A 1JRLA 5EZ6B 4X6YA 3H87A 1QK5A 3CBGA 3N2KB 3E8XA 2UXBB 1WKBA 4LQLA 4F84A 1E4EB 1E2GA 2FB9A 1P1KA 2VC2B 3VR4A 3B85A 3UO8B 3DOEA 4FTWA 3SQXA 3SJZA 1GLGA 1ST3A 4XFJA 2Z1NA 3RASA 2UZ4A 3P9IA 4DMGA 4ZQEA 3T12A 4YI3A 3L7MA 2XYPA 5TV2A 3M4XA 4UHEA 4CL8A 5JNVA 4YUYA 5G1PA 3BIXA 2B1QA 3H4VA 5A4KA 4QPPA 3Q1LA 4DA9A 5TQ2B 4F1KA 1DXOA 1E9VA 1OXXK 2UDPA 3AUUA 2I8AA 2Y68A 4YCDA 2CLKB 3OZRA 4P80A 3BH7A 2YHIB 3Q9LA 3TI9A 5DN6D 3CSUA 4I9UA 4FSDA 3HB9A 5HXBA 1TJNA 3O95A 3WBBA 2JD2A 1E6UA 2KLHA 1PL6A 5FTNA 3T7AA 1K8XB 1U8AA 2G5GX 1MX3A 4KI0A 5EWLB 1PD0A 1LZLA 1M5TA 4MW9A 3V4OA 6PFKA 1SKUA 3IEXA 3W3AA 4J7XA 4DUZB 4PZEA 5F2KA 2R7AA 5F9MA 4P22A 4U3JA 5HZBA 1U0NA 3AF1A 4RPGA 5J9FA 1T3LA 1QJCA 2AF3C 3RO7A 3D5EA 2GKGA 4CM3A 4E3ZA 5B3LA 5CEEA 5FL3A 3I34X 3QA3E 3OLVA 2V5VA 3THOA 4A0RA 721PA 2I3ZA 3A1SA 3I09A 4X6XA 2DXIA 3OE4A 4QC2A 2NNLD 4G89A 4IWXA 4QGAA 4Z9BA 4CDRA 3IQDB 2WIKA 4TQGA 4C05A 4DSNA 1SB9A 3JQDA 4D0GA 3KQHA 2H6EA 1RACA 4NPCA 3UAWA 1JSRA 2HR1A 4UAVA 4B17A 4BLTA 2PVCA 2QD2A 2QZ4A 2HIMA 1MNQA 2JHPA 5AW5A 5JH7F 2Z98A 1P0FA 2WJ6A 2BP7B 4TTVA 4PGFA 1OXKB 4B3FX 5EHGA 3EPRA 2F3TA 4GI5A 4YQZA 3AONB 3JAKB 4NYIR 4WH0A 4MI1A 1QGUA 1S2NA 2PFGA 2ZXEA 3KFVA 3N0XA 4K1XA 4WA7A 5CDYA 1EBFA 4UU1A 1M2VA 3WGLA 2X8BA 5BWCA 3LX6A 3NYRA 4I9FA 2ERXA 3QFHA 3RI3A 4BBPA 1VCOA 3S1SA 3PUYA 4NBLA 4XH9B 3ASPA 2UZAA 5K3FB 1OT5A 3LGSA 1PDVA 2AJCA 3HKBA 3QPUA 5C0OE 2YS6A 4PLYA 2IYYA 5HRAA 3G7UA 1T8PA 4JN6B 5JISA 2H2DA 2NTYC 3PRJA 1ZGCA 4TQ9A 2B6NA 3IUPA 5M5BA 3ZR4B 2IS2A 1HZEA 3B1WA 4OQYA 4WXMA 4C4TA 1GNTA 1VBNA 4YJKA 3CD6B 4ALLA 4JOQA 1Q6ZA 3FWKA 1SBYA 4PC6A 3RK4A 1OXUA 1U8ZA 3D7SA 3U4MA 5IF3A 1KOGA 3AKEA 4LECA 1G0NA 1RWBA 3FWYA 5ADUS 3E9NA 3OEHD 4BFZA 3BSFA 4JAVC 5JO9A 4P53A 3BSYA 1GAWA 4R01A 2XA2A 1E6CA 3ZCQA 1U5AA 3BE8A 1UH5A 4HQKA 5JVDB 1IDN1 1LWNA 3EE6A 4NTZA 1BW9B 3WFZA 5AVTA 4B83A 10MHA 4CKCB 1L9XA 4RANA 3CLVA 3PPIA 3W5IA 4ZV9A 1OFUA 4P5PA 4X45A 1NMXA 2X9VA 2RK4A 1L3IA 3BD8A 1NU8A 2EV9A 2F1HA 3GG2A 1B6TA 1M34E 1QQ6A 1OBFO 2PT7A 1N3YA 4R81A 1B00A 3ZWBA 3ADCA 4EO7A 5T8KC 2C77A 1QDEA 5IDYA 5HZMA 1VL6A 1DWOA 1E6EA 1R0BA 4FGJA 1VSQA 3EF3A 2ZTGA 5DHAA 3UJPA 1JQ5A 4ZQCB 2RI1A 4Q9JA 2Z8YM 3GRUA 3VPAA 1GLVA 3BWYA 2VPPA 1SG6A 1X8LA 2GZRA 2WF9A 3NHLA 4X7RA 3VO8A 3VYSB 2JVJA 3TQOA 1E7QA 4GGPA 2WJJA 1KYZA 4TL6A 4K2AA 2WZBA 3FMGA 1AGXA 3EQZA 5DXAA 3AERB 3J7TA 3I92A 2XIJA 3L82B 4NJEA 3NC4A 4BYMA 2ONZA 3THYB 1YUNA 3T3OA 2H4WA 1UPAA 1GN9A 2QGGA 1V48A 1OXSC 3H19A 4UXHA 4RKQA 3OEWA 4MVJG 3OHPA 3II6X 1F9AA 1ODSA 3EF1A 4E5KA 4Z4IA 1BVYF 2CL6X 4PSUA 1E3LA 1DMSA 4B3MB 4NYJR 1ISSA 1ZMOA 2GLTA 4IUDS 3QVUA 4KRGA 3BCRA 2XMCA 1G5QA 3JQ9A 1GGKA 1USGA 3CE6A 4HF7A 3P96A 1QGZA 2VA8A 2QOEA 2XWBF 1CY0A 1O95A 2WF6A 2Z04A 3DVAB 4DLUA 5EERA 1G63A 2IX9A 4WQMA 2ZRKA 4G1CA 1CSEE 1KJ9A 2VCYA 4JJFA 1EHCA 2WPNA 4P4NA 3TW8A 4K46A 4Z5XA 5KKCA 4BWGA 4DQXA 5ITVA 1FFXB 1XZGA 3MRTA 1Z47A 3LQQA 5MHTA 1ISFA 2GXUA 1V8OA 4I8DA 4LTMA 5DN6A 1KI3A 4LYDA 3SOPA 3LHIA 3NWJA 1RI5A 5HJ5A 3SSMA 3PQDA 3CA8A 3VAYA 4LZNA 1H6DA 3PBKA 1ZNQO 3VH2A 4FW9A 5BUCA 3CEAA 4OPVA 3A0RB 4ED9A 2DT8A 2J3HA 1AV7A 4O8CA 4DR4B 4G1EB 1RKVA 3Q7PA 5AXCA 3WRXC 1I14A 4DDHA 4MUFA 1Z63A 3R6JA 3T5BA 1RADA 4AL4A 1N9KA 1NUQA 3NYIA 3FZNA 1T3GA 2BFPA 1Q16A 4GX2A 4L2IB 5G4LA 4BJ1A 5LZ4A 3UBTA 1UXJA 1U7HA 4AO8A 3IEMA 3KE8A 4QUAA 1HYHA 2G1UA 4K03A 3FPGA 1CIPA 1Y9AA 4BY9E 2R1VA 4IOJA 1WMFA 4KR7A 6AT1A 3OIFA 3G0HA 5AVZA 1T1IA 1V8PA 4NAHA 3TSOA 3SAJA 2E82A 3HFSA 1LEHA 5H9VA 1E2KA 1YU9A 2BF7A 2ZRIA 4RC9A 1KTIA 3CLUC 1NF3A 2W6JD 4F8JA 1V3UA 2CUNA 1N2GA 1JH8A 5JFTA 4QX6A 3EOAI 3T38A 3CUUA 4Z0PA 3DNPA 3BDVA 2DKNA 2GNOA 4OXRA 5H4HA 2HRCA 2WD9A 1ODTC 1UOEA 1D5WA 1C8VB 2XCRB 2HBYA 1QLWA 2BZGA 1NW5A 1PWYE 4N41A 1I4WA 5CURA 4CFZA 3DW1X 3NXKA 1TCBA 3F7OA 2F4VB 4EARA 4D0LB 3K0FB 3WJ7A 1YCDA 3GJ3A 1IBCA 2PO5A 4I1UA 3PEFA 2EZUA 3G5TA 3X0DA 2GEFA 1X92A 3DTTA 3KP1A 3T15A 2EIHA 5C8ZA 3S7TA 1CUZA 2ZVDA 4FYJA 1T4GA 1BVHA 1H94A 5MN6A 3S6JA 4BRSA 2BSAA 3BB3A 1OKKD 4ISCA 1PGQA 1EWYA 2J59A 1H0HA 4CODB 1S4QA 3G9ZA 2YASA 4FNOA 4EUFA 3OEHA 1U1EA 4C7BA 1GU0A 1RKBA 2FRDC 3P27A 1DTSA 2I54A 3KQOA 5FOTA 5MDHA 1C3LA 2EKBA 4HHEA 2WZDA 3ZE8A 3O3MB 3M6FA 4UTPA 2OFFA 2FQ1A 3IAFA 2CE7A 3FH0A 3O8LA 2EQ5A 3UG6A 2W8BA 1QRTA 4AJKA 4Y0NA 3RS4A 1GG5A 4UNNA 4CR6A 1JN0A 1Z2OX 3EJ6A 2ECPA 4RK1A 2C9YA 4Q9DA 4A8JC 4NBWA 4DSZA 1N3BA 5TF0A 3A1DA 3GUVA 1HH4A 2I3DA 2JBHA 2OZPA 3C1AA 5D5HA 4BCCA 4C06A 1E4YA 4WBNB 3PDHA 2WBLC 2ZJBA 3A3NA 1TCVA 3KYDB 2FQXA 1IY9A 3MAGA 3N74A 1L0BA 4MR7B 3MNFA 2GS9A 1NR1A 2OBBA 4J9UE 3H5WA 2ZCUA 3TNLA 2ANCA 3ZW8A 1GNLA 1YJBA 2RCNA 2ZT5A 3DMTC 3IAHA 4CG3A 4XNFA 3RT9A 2YWHA 3AR2A 3PHGA 2BT4A 3TSAA 3EULA 1DPFA 1UBFA 4YAOA 1N5MA 2QORA 1PJZA 4MUJA 3EB9A 3BWMA 1JIQA 1NNSA 3IBYA 4L5IA 7ADHA 3LHDA 4H77A 2FFRA 4TZKA 1ZMXA 4HGRA 5IRCD 4B9EA 1UDWA 1E1MA 1JEEA 3WVNA 1JG2A 3TO5A 3BWXA 1Y7IA 4A10A 1IIBA 3C6QA 4A4DA 4YLEA 1JIXA 1XQXA 1SCUB 2DWQA 4IDAA 1FDWA 1T13A 2FEWB 3HXKA 3K3PA 3R6WA 4QGBA 4YJ3B 5GP1A 3FOFC 4B7UA 1FTQA 4RVDA 1ZUHA 4RE5A 2IYQA 1EZ1A 3AR3A 3IDAA 1RJEA 2OQIA 1C81A 4EO9A 5K20A 3GLGE 2PUBA 3HHPA 3DH0A 4LTDA 4Q16A 3OOHA 3RIMA 4X71A 4G1VA 1IM5A 5BYAA 3DEYX 3GT3A 4FMCB 3ZWXA 1NQOA 4EMTA 4KKSA 3KVOA 4C4PA 4FN5A 4OMCA 5CVEA 3N8DA 1G5HA 2V74B 2QAGB 1Z2AA 2YNMA 2ZSUA 3S8MA 4WIAA 1Q0UA 2AC4A 2UYYA 3AR6A 4P1VA 3FCSB 2NUTA 4YH1A 4JOCA 4I4NA 4GS5A 4WUVA 1GTVA 2HQ1A 2GDZA 2X0RA 5FIUA 1TJPB 4CM7A 3WGIA 1RZRD 3ZS8A 1OZHA 3LT1A 4IVRA 2QTRA 4D0RA 2GCOA 3OH8A 3EBLA 4FKZA 2FF5A 2XHZA 1K97A 4RTJA 2Z4RA 1ISGA 4PRKA 5JAUA 2HFKA 1JKFA 2WVGA 1EBUA 4PZLA 3JQ8A 5F2NA 1AN0A 1KAHA 1Q5PA 2QRHA 4RGYA 1KE1A 3X1ZA 3LUFA 3NBMA 2HWKA 2QT1A 4OHVA 3AYZB 1ESZA 2HU8A 2OMEA 1GCGA 2TS1A 3BWEA 3STXA 3FCCA 2Y0PA 3NFYA 3CTMA 2GTIA 3NBQA 5L3SB 5BVGB 2HUNA 1V8FA 2G9NA 2RGEA 1RM5A 4IVQA 4EGCB 1A7AA 4PZAA 4AYTA 4N9QA 3G1TA 4R5MA 3ZW9A 4EHFA 3SPXA 3EODA 2WTUA 3BAFA 4JIGA 4D79A 2QPAA 5LWQA 4CLHA 4H35A 2VJNA 4F6CA 2V7WA 3RJTA 4OBXA 3HY6A 1YRQA 2L42A 4BKPA 4EFKA 3GQBA 1WRBA 1DO2A 5IVDA 4Q4CA 4X66B 1ZJWA 3ZV6A 1TNDA 3W9YA 3FPJA 4JJ8A 2GYYA 1Z6AA 2RGXA 1XQYA 3GN2A 1QS0A 2W6JA 3MCAA 3IUJA 4OHZA 4DB4A 4CGZA 2KMLA 1R6TA 3N7UA 2D2FA 1LLQA 3R4CA 3GLHE 4LXQA 4EITA 4RXMA 5BW5A 5KUTA 3I4FA 3BE5A 3E5HA 1SKYE 4C4AA 2D3NA 4N3GA 2P2NA 5EZ5A 4CF5A 2F17A 4UU8A 4UUPA 2Z2IA 4X54A 4X1KA 2QV0A 1GGHA 2RD2A 1N9GB 3KETA 1X7YA 1JKXA 1CTQA 1MG5A 3A3GA 2Q9BA 4JA0A 3QI2A 1XT6A 2H85A 3DT8A 3IMKA 2H2HA 3ZDFA 3X44A 2JDID 2FXVA 5AW3A 3CVXA 1RYDA 2B4TO 2ZL6A 2A5LA 4WBXC 3V7WA 4UCQA 2ZBUA 2WVHA 4U8HA 1X7ZA 2VZ8A 4HDNA 3F67A 4JA2A 2OM2A 4WACA 4L72A 1Z56C 3EUWA 3DXFA 3ON5A 1JHRA 4GQAA 5F1KA 1MKYA 2CJYA 4QFCA 3A4YA 4HZIA 5ARCA 2W70A 3VR6H 1O5IA 4OOXA 4YNBA 4Y67A 4W9NA 4IILA 2Q2NA 2CN1A 4LXIA 3T5DA 1EVYA 1GUFA 1QH9A 2D5LA 1JSLA 4RMGA 3CPWB 3E3NA 2HDOA 1GUBA 2XQFA 3H13A 3IT3A 1LFAA 2A92A 4A0FA 1ZIYA 3JQAB 3K4HA 1C4XA 1Q0TA 3DKKA 3M34A 4KW7A 2EX4A 5FBQB 1SWVA 1XWFA 4CCSA 3I32A 1X80A 3HUTA 2FMTA 4HC4A 1YJCA 2O3RA 2JLCA 1GR1A 4O29A 2CDCA 4JL6A 4YRGA 3CNNA 4BV8A 2CUZA 1NBEA 2QPTA 2I2XB 4MPRA 4F45A 4RTKA 1MB9A 3CF2A 1C1HA 2FHSA 1Z3IX 4I6EA 1GNQA 3KLBA 1EUDB 2Y9MB 3IUEA 3SN6A 2FVYA 3UAZA 4ZZ3A 1Y6QA 3MQ2A 3PITA 3BE4A 1P39A 1WXIA 1MF7A 5J2UA 4OHMA 4YJ2A 1M1NA 1P7CA 1SHJA 3TBHA 2H8KA