2CC2A

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
290
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGAGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate specificity in enzymatic fluorination. The fluorinase from Streptomyces cattleya accepts 2'-deoxyadenosine substrates.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
total genus 75
structure length 290
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2cc2A02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2cc2A01
2V7WA 2CBXA 5LMZA 2ZBVA 2C4UA 1WU8A 1RQRA 2C4TA 2Q6OA 2C5HA 2Q6LA 4CQJA 2Q6IA 2F4NA 2V7XA 2C2WA 2CC2A 2Q6KA 2V7TA 5FIUA 5B6IA 2CW5A 2V7VA 2WR8A 1RQPA 2C5BA 2V7UA 2ZBUA
chains in the Genus database with same CATH superfamily
4I1PA 2IF0A 4RCVA 1GO2A 5K0BA 4HGZA 2DH5A 3S6JA 4TX1A 2E85A 2G9UA 1Z7EA 3V3KA 1UFRA 1R8SA 3OW2B 1GGVA 3JQ8B 2C7RA 4FYJA 2AZTA 1UKZA 3QU9A 4BWFB 4ZEXA 1GQRA 1RWKA 1VLJA 3FTCA 4G1CA 3W90A 4DHEA 2P3MA 1VQ1A 3KDPA 4MVJI 2O23A 1UC8A 4ML3A 1KHHA 4YP9A 1MENA 5B1EA 4JT4A 1LF5A 3GRRA 2XQIA 5CNKA 5AKIA 3KUDA 5DK4A 1CT9A 1N2XA 2X6QA 5EP4A 3RGGA 3VC1A 1MC4A 1RWWA 5H5JA 1WMBA 1O03A 1QIEA 2A1TS 3AKDA 4ZPJA 1GM5A 1E2UA 1BD3A 2IYYA 221PA 4FE4A 2XMGA 3WLFA 1F2DA 2I3BA 1WXDA 1L8QA 4QTTB 3DC7A 3PP8A 2CF4A 4IHJF 2F90A 1K2VN 3E7DA 2ZI7A 1YOBA 5AYVA 2YZKA 4MAAA 3WGYA 3ZIAD 4XN3A 3PLNA 3K6SB 3ELBA 4LVCA 1ZUIA 3TUZC 1TU4A 4FFRA 3DE5X 4X95A 3M5PA 1M1KD 1DBSA 4KYUA 4TT3D 5EE5B 3T6KA 3ZV5A 4LF6B 1OFHA 2CDAA 1Z6YA 3KVOA 5JEDA 3OO1A 2A58A 3BXOA 2FVGA 1L7AA 1JPNA 5JBQA 1X2BA 2RC5A 3HHEA 1P73A 3MERA 1SB9A 3PUZA 4JL5A 4LTDA 5F33A 1IN5A 4CQMB 4OHRA 4DWVA 4YAEA 2H07A 4ZJZA 2O8CA 3K7EA 2F1KA 2WF9A 3F4BA 3K73O 3COYA 3M34A 3ORSA 3A37A 3PIDA 4U2BA 4Z8XA 2V7QA 1QHHB 2BCGY 1SUAA 2MDTA 5TJHA 2DLDA 5KHLB 1PRYA 3OH8A 5EMMA 4E12A 4HE5A 3CW9A 3PGMA 1P62B 4MUIA 2X2FA 4P2GA 1QAQA 1JDUA 1TVEA 3ZBQA 1L9XA 4D9EA 5J47A 1E1YA 4OQMA 3RIXA 4LW8A 4XWGA 5E3JA 3TCXB 4AKEA 1TQ2A 1U2GA 2BGWA 5AUOB 4NHEA 4QRDA 1ABFA 4LRQA 4O1HA 5ETJA 5KNDD 1SHKA 3DG9A 1OWMA 3B1JA 3G0IA 4XSHA 4XVCA 3RYCA 1AHNA 4WT7A 2O1SA 3B53X 5BRAA 3EIEA 5EMHA 5JXWA 2Q9UA 3FTEA 3BL8A 5FF9A 3CCCA 4NRDA 5IN4A 1EWQA 4INOA 5CAEB 3SC2B 3NTRA 3VVCA 2DEUA 2V1UA 2H16A 1FYVA 2O7QA 4Q1BA 5HNKA 3ZEAA 1P72A 2XQKA 1RBQA 3C3KA 3D8SA 1BC5A 4FHCA 2RMKA 3TNYA 4CQLB 3IB3A 4F60A 5JSQA 2ZSJA 5L3SA 2AF3C 3N87A 2JJ2D 4MW0A 5H4GA 3R8FA 5J3JA 4PAMA 1O8BA 1U7DA 3JAKB 1RLUA 4H27A 5EE1A 5TQ2B 3BHJA 2QU7A 3UXEA 1WVMA 5AVOA 4CV2A 1B0AA 2PLFA 3OEHD 2P2DA 4FHEA 3FRHA 5REQB 2D1YA 3OC6A 2AQHA 3EQ7A 4DJDC 2HA4A 5BSFA 4PXAA 3U3ZA 2JGLA 4QVKA 3V3TA 2YHAA 3DC2A 5IX8A 3GA7A 1PN3A 2QLJA 3JQPA 4G1MB 3LUKA 3MWGA 4YS6A 1XMJA 2GSDA 4P36A 3TAUA 1TQHA 3DR5A 1PK9A 5JSZB 4GZLA 4IJMA 4I3FA 1JQBA 1Z6QA 16PKA 2WWWA 4NCKA 5CXXA 4BCDA 2GM3A 3I5YA 2FE1A 3G17A 4JZYA 5F21A 3CLTD 4IF6A 4C78A 4IJ6A 1I6LA 4X8HA 3NDBB 1TMYA 1GPLA 1U04A 4EG6A 2B30A 2ZI6A 3PZBA 2EG9A 3DPSA 1SC9A 1V0EA 1P80A 1Z5GA 2QLTA 1E3JA 3BEOA 4O29A 2VF2A 1P4JA 4OHKA 1I7DA 4YP1A 2RGGA 1GTSA 3Q0TA 1EJ6A 1I1OA 1P18A 1R0RE 2H1LA 3P8ZA 1WEHA 2NTNA 2Q2WA 4G0ZA 4R2XA 1HORA 5AK4A 4B9AA 4DMUB 1X14A 3PKZA 4GBED 4LQCA 5KNCA 1HZZA 3PQFA 3P9NA 1O6ZA 2ARKA 1L2TA 5AHKA 1W73A 2YMMA 1UKEA 3SJCA 3IHKA 3LX5A 4I50F 5BMOA 1YVDA 3FHJA 4XMYA 1S89A 3IELA 4Z9BA 3MTQA 2JIQA 2H2GA 3CR8A 4POOA 3ZW9A 4P4UA 4RJTA 1F6WA 4DIDA 4KL8S 1T2NA 3VTAA 3FM9A 2R6R1 1QZZA 3AU9A 3FNGA 1H4TA 3E0QA 2FZEA 2SKDA 1B15A 2H1WA 3MINB 4UE6A 1Q0LA 3HM9A 1YQDA 1IJBA 2AEFA 1VHDA 4IQ0A 5D1HA 4ALNA 4INAA 3STUA 5IBQA 5KCMA 2NU9B 4ZHQA 2VTKA 3OTGA 3GRZA 3VAAA 5IFKA 1O5TA 1N6RA 3EIWA 3ENVA 2WR8A 2XYHA 4F3YA 5B4VA 2GZSA 3DQPA 4HYYA 2BKVA 1G6OA 2H6EA 2O06A 3WGHA 3WY9A 4O1IA 4HNAB 3TKLA 2VJJA 2M2IA 4GO1A 4Z0NA 4CIYA 1WOMA 1MOSA 3D2CA 2CMKA 4YCBA 4P08A 4X5OA 3QF4A 5A3QA 2Y0DA 1EFUA 3IDFA 4YO8A 5G0TA 2MCFA 4V0QA 4CQJA 2QRPA 3PQ4A 4TS3A 5G4LA 3HVUA 2DY1A 1UM8A 2VJNA 1V35A 1E3WA 1I3MA 1UDRA 1Z2EA 3KK0A 3OE1A 3FIJA 1LK7A 4QWMA 2WWRA 2YS6A 1ZCFA 1UJNA 1C9KA 1T24A 4UXIA 3WYBA 4X07A 3N0VA 4CYMA 1XU9A 4QLBA 7REQA 3U80A 4MKFA 3KAJA 1NYQA 5I51A 5FPPA 4B6EA 1YTUA 3C3EA 3N05A 4H7PA 1YZ3A 3X1MA 3GEMA 4M55A 2CNLA 1VXOA 4MR7A 3UAYA 3GGJA 1XCBA 2XNSA 3OLVA 4XWAA 2O5VA 3T5GA 5E8RA 4K05A 2QE6A 1NN1A 3PTZA 1VBMA 2D3LA 2FN7A 4HYQA 2D06A 2GPWA 3DKVA 3WHLA 4DLTA 5B5SA 1QDUA 2EIXA 1YZHA 4D41A 5DLQC 4X97A 3IOBA 3ASPA 1UFKA 5JUWA 5A5EA 1Y1QA 5LQUA 3WLJA 3RS8A 2V0GA 1M1YB 1M0EA 4HVTA 1J8QA 3Q6IA 5LDDC 2CV1A 4OAQA 3ROXA 4TTPA 2Q1SA 1BX0A 4FOLA 1OTXA 2I8AA 2VDMB 2EWVA 1M34A 4HBZA 4KUEA 4UTOA 1E1MA 2QAJA 1ZXBA 3QFSA 1XBTA 2G4VA 2LUOA 2Q7XA 3AU8A 2WIAA 1TVKB 2IHVA 1QWSA 2QTRA 1OU4A 5LDHA 1WQ1R 1X3SA 1YS4A 4Y2JA 2IOYA 5CA1F 5JIBA 1IB0A 1CUVA 2GYWA 2X1VA 3PHIA 4KQCA 1AV7A 5HDQA 1MJFA 4DDUA 3RHFA 3EEBA 4BFCA 3WB9A 2VYQA 1J7KA 5BRJA 3AUTA 2G1PA 4OHUA 4FC7A 4H6PA 4J90A 2CXPA 2R4UA 1ZH8A 4NS1A 3ZQ4A 3GYGA 1XCLA 2IV2X 1E59A 4HLDA 5J2TF 5TSDA 1AK2A 2PE3A 3WWYA 3MUEA 2FRDA 2TMGA 1ZUHA 2W93A 3T61A 1B2RA 1ULSA 2WD9A 1UKYA 2PMWB 1UPAA 2PBZA 2F3UA 5FNZA 4YFYA 2UKDA 1EA7A 5E38A 2C83A 1XVVA 2XHEA 5L7WA 3MWJA 3ZDAA 2P91A 1S3SA 3GJYA 1UBOS 4K7JA 2R47A 4OYHA 3L7CA 3D0KA 2QN1A 3CSUA 6NULA 2AN9A 1NP6A 4NLLA 5C9ZA 3QEJA 1KDRA 1NLUA 1D4OA 3HB4X 1H2AS 2P2ZA 4R7ZA 1AF4A 2BRUC 3BL5A 3WADA 3LGXA 1FTYA 1Y4ZA 4WACA 1JX6A 4BB9A 3SN6A 2ZUUA 1JLKA 3UF0A 1IJFA 1Q44A 3HKDA 3VMFA 1KAEA 1OX6A 1M2KA 2RJ3A 2VXYA 3DGEC 3P0HA 4UBMA 5JNWA 4O2AB 1UDWA 1EUDB 4MI1A 3DEAA 1U1FA 5JYDA 4EJ2A 5A7GA 1RBYA 2UUBB 3KEOA 4UULA 1FNCA 5LZ7A 4K6OA 4KDRA 2VL7A 4XRRA 1OFTA 3VAYA 1WB6A 3ABRB 5COAA 3X1KA 3AESB 4ND8B 1J8MF 4WINA 5K0GA 5AI8A 4J6EA 4H59A 3E22B 4XE5A 5I7EA 3BXHA 3PNVA 2J5BA 2QX4A 2CLSA 2C5AA 3BGOS 4LS3A 3IV7A 1KGDA 1NV8A 2ZGVA 4M37A 3R0VA 4AY2A 1LSOA 1RYYA 3A31A 1CEYA 1RM4A 3HO1A 1UEXC 1DPGA 5AW5A 3T15A 4LYJA 4XN0A 4XASA 4PHGA 1QOQB 3MQ4A 3EB9A 1QF6A 3KOOA 1HX7A 3CEMA 3C7KA 4EQ6B 2CJPA 4PO3X 5ALTA 1SPBS 4LZLA 1U2ZA 1L7OA 4DCOA 2YASA 4MPRA 1MR3F 3G5UA 3GLHA 1AKNA 1MIOA 3G9XA 3LBIA 3O93A 1YA6A 4B3JA 5JJLA 3H1FA 4LV5B 1AQJA 1QKJA 4CMIA 4OQXA 3OWOA 2LWIA 3QUQA 2DQYA 3AVOA 1BE1A 1GSIA 1ZA1A 4O2BB 1S3IA 3TLJA 5A03A 4FKZA 1NQUA 5DEIA 1KWKA 3GMIA 4UEOA 4JBXA 1IRXA 1M1UA 1OREA 4JHXA 3ZDEA 3DBLA 2C2WA 3X1DA 1AK1A 2Q0HA 2ZPAA 1SA0B 4MGHA 1BZYA 4B40A 4BN0A 3BEDA 4V0OA 3UAGA 2IYPA 4NOLA 4TUYB 5JYEA 4MVCA 3K16A 1ZRHA 2CLHB 2GEUA 1OKKA 5HE8A 2DBQA 2JVJA 3KQSA 2OCBA 3W34A 2BBOA 4HEA6 1VJGA 5EYPB 3UA3A 5TB5A 2ZRPA 4YPOA 1K97A 2OXIA 2UYYA 1A4RA 4P4SB 2PZKA 1DJPA 3FSGA 1T5LA 3HB9A 4LYEA 3SDSA 2G9VA 4WZBE 3V1KA 4ZYLA 4R6XA 3GVPA 3ZE8A 2JI6A 4OMFG 2VWHA 4Z4GA 1MNAA 3A35A 4DDWA 2I6GA 3BFKA 3MWLA 3GP5A 4HUQB 5CG2A 1TJ4A 3R7DA 3NATA 4YO7A 5JYCA 4JUIA 4RZUA 3TEFA 3DXFA 2HMYB 1ANKA 4JQSA 2EEPA 1XFOA 1G4UR 5KJCA 2ESRA 3QX8A 4IYRA 4Q4AB 4UPVA 2ZRMA 3MLBA 2A9PA 5HMLA 5L53A 2I4OA 4QICA 1YHZA 2I65A 1L5ZA 4IDQA 3OURA 4GXNA 9GPBA 2EG5A 2TYSB 4HS9A 5ALFA 3ZGLA 2H31A 2Q5HA 3FOAA 5JNSA 3H6KA 3L82B 2PUBA 2YFYA 1Y6RA 4XJVA 1UP7A 2GN1A 3IDOA 4LHWA 1BH2A 3T4PA 2A3RA 3VPSA 4LYFA 4F6LA 3CGGA 2MIIA 2RSLA 3ADKA 4UEJA 3DAFA 1EZZA 1G8GA 2WHPA 2GAJA 3T5TA 5DGCA 1ISMA 2ZYDA 2QN3A 5BW6B 1RI5A 1TYAE 1ORDA 1ISPA 1OGIA 1JYSA 2VJBA 4K9QA 4JP2A 3UC5A 2X9GA 2XRYA 4JNCA 1JHMA 1NI3A 3SX4A 4A9AA 4BVKA 1C4KA 1NW4A 4OQYA 2VJOA 1JIKA 4Q9LA 4BO9A 2VPTA 4S05A 1YE3A 4L8WB 4L75A 1KJYA 1AG9A 3KFVA 1UH5A 1K1EA 3BE8A 2PUWA 4HJXA 3E15A 2UZIR 1PKVA 3JQGB 2ZT8A 4UOEA 4CF3A 4RLHA 1BWPA 4ZMBA 4EABA 1CVIA 3C6YA 2ZKIA 3AVTA 2FZCA 2P1RA 3G79A 1QIFA 4JLNA 4RH1A 1J9GA 1QCYA 2XUOA 5LWQA 3DBLB 3G2QA 3GT0A 4UMDA 1ZOPA 3GB9A 5DBIA 4IIJF 5F76A 2WYVA 1GTL1 1N6HA 3ZWQA 4LFAB 2Q46A 3B1VA 1BWRA 2YDYA 1P60A 4HX5A 1F17A 1JZTA 3MILA 3LUBA 3CE9A 2H7CA 2ZI9A 3WBJA 2A0UA 2FQQA 4GP6A 2XA2A 2HRQA 4NKRA 2VG8A 3RRJA 4DC1A 4I8DA 1PJCA 2PZMA 3VO2A 2X8KA 3R5SA 5IG2A 2IUFA 5JDIC 4ZVMA 1FUIA 1ZRNA 2PR7A 1WZCA 1DI0A 2II6A 2Q9BA 3KT0A 5G1OA 1IN6A 3LGAA 4BBAA 2NOAA 4RTRA 5CVTA 2HU8A 2VR1A 3C2QA 4YJDA 1YZLA 1M0WA 5DRYA 5FOXA 5LUBA 4DNOA 3UJHA 3GLQA 3WNZA 1P2BA 4PZDA 1KMCA 2JANA 3NBXX 1L6IA 1G8KA 1K8YB 1C8BA 2YKGA 1R7RA 2GHTA 2R751 3SXUB 2Z6UA 1DMSA 3UMSA 4H7DA 2HA0A 3ZWAA 3F4KA 3FCUB 3ZQUA 4XONA 4L0CA 4BAZA 5KTMA 3U1VA 1OOEA 1Q0PA 1Q50A 3KU1A 4FWBA 4X85A 3MIZA 1A97A 5IZCC 5KOYA 2W6MA 3IHLA 3FNRA 4H1HA 1UAAA 5IBCA 2NW6A 1E5DA 1SKAA 5ALHA 2P30A 3V4LA 4EMBA 1DELA 2CVFA 2BEVA 4JT2A 4O4HF 4B2YA 1R16A 1ORHA 1MEEA 4E6PA 1JKIA 2XXJA 2PO5A 4EFMA 1SCJA 3F3YA 3OX2A 1CQJA 1S2IA 1WSRA 2OQIA 3B5EA 5J4HA 3O4RA 1LPNA 2XUGA 2V55B 5I4CA 3PVCA 2IPXA 4P3KA 3TFWA 2ZSBA 1NTRA 3QLEA 1OWNA 2ANBA 2AVDA 4IH1A 3WLPA 1KRHA 5C8YA 5LXTB 4ZREA 5TARA 2AR7A 2Z2YA 2FAXA 4OX9B 2X4LA 3Q7EA 1C2YA 1TLTA 5AKKA 5HFJA 4AS3A 2FMUA 3D26A 2R8RA 5C8XA 2QR5A 1KK0A 3Q0IA 2FW9A 2Z08A 5E7QA 4MGEA 1JR4A 2AJBA 3OQHA 1VTKA 1NUHA 4OB8A 3V6MA 1RRGA 2P0YA 4NQZA 1KY5A 4NYJQ 4B32A 1W581 4ENRA 4HDMA 1H4QA 2ZAMA 1L8LA 1O57A 1N9GB 1YZVA 3EVAA 1WV0A 3QENA 4K6GA 3KETA 2J3IA 3I2YX 2IXGA 4LXXA 4CDMA 6LDHA 1QOZA 4M7RA 3NWJA 4RYLA 1DO8A 1MVOA 3ZZ0A 1V6AA 3NS7A 4QJ5A 1MZPA 3C5EA 2BMWA 3RUCA 1P8JA 3GBPA 3PKIA 1YRLA 1BX3A 3SZLA 5H70A 5EFZA 1U98A 3I92A 4M1TA 1ZFNA 1O89A 4O02B 3SHWA 3TLYA 4DNQA 2X3YA 2JJ2A 2YXEA 1A7AA 3VKFA 1L8AA 4GS5A 1G6HA 5LP6F 5FYQA 1NF8A 2PS1A 1KSJA 3HGMA 4DSAA 3GLKA 5K0TA 1M1NB 4Z9FA 5CB6A 1B1CA 1VJ0A 2K2WA 5KMGA 3GEEA 1EP9A 2OSBA 4WLNA 3WNBA 3CN7A 5YASA 1UBGA 4Q9AA 3T7AA 3WLRA 2YRXA 4ZI7F 1E1RA 2ATVA 5E3IA 3WO1A 3JV7A 3CESA 1F9EA 2I6XA 4IIBA 3UYKA 4AFNA 4CV3A 4TV8B 3K30A 4BQOA 4BFZA 4Z8YA 2PUFA 4AZVA 3DCIA 5IH7A 3DAGA 4FKBA 2P0EA 1E2EA 1EBFA 1FNNA 2VATA 3LLCA 3HKCB 5D3ZA 3UQZA 1VP9A 3VC7A 5KNBA 2HJ9A 3D59A 4DDKA 2ZBEA 1ZN7A 1WA5A 1CUXA 3FHTA 3NAQA 3SZ3A 2Y0BA 2YYYA 3K9CA 5K3OA 1U0JA 1KORA 1DG1G 1IUKA 3BRSA 4V03A 2VDPB 5ENDA 3SBOA 2PWBA 2J0UB 3G8DA 3GDFA 5DRTA 4RSHA 5BQFA 1T2VA 1GSOA 2VDQB 3UWSA 3ZYZA 3LQRA 4K9RA 3VOTA 1N2JA 4X8MA 5I9TA 3TOSA 2EFGA 1Z4PX 3CUWA 5IPFA 1JJBA 2RB4A 3MJRA 3QYFA 1JFTA 4YWHA 1K6JA 2XNKA 1I8TA 2VPQA 1RZUA 5E9WA 4WY5A 4C2TA 4MTLA 1KMNA 1H0SA 1K8RA 1LDBA 1F5NA 1RVV1 2CB0A 2VOJA 3EH2A 4FEGA 2V6JA 1GUYA 4X0CA 4DABA 1HE3A 2QUZA 3PNMA 1AO3A 1J22A 3QKUA 2ZRAA 3OJCA 3NUGA 1K75A 4GOOD 4X63A 4BX8A 3M6UA 2PJUA 4CMEA 1L4NA 3KT6A 2E5WA 1QIMA 2OR3A 2B6HA 1Q7GA 3IO3A 3L84A 4G0QA 2AK2A 4JCOA 4MVJH 4D4LA 2XMRA 5HKOA 3UJ9A 1GWNA 5TIIA 1NBME 2GPJA 2Z58A 4G5QA 4Q93A 2LCIA 4WI1A 5EXDA 2J0UA 3W3AH 1FRZA 4B3CA 4CF6A 2XITA 3CBGA 3CMEB 5D87A 5JY1A 4FUTA 4XSGA 5DYNA 2EGUA 3JATA 1AC5A 5EJAA 5T64A 4EKNB 1DC5A 5B55A 4EMSA 4JA0A 5FEMA 10MHA 4TYWA 5ALNA 4Y6PA 5H59A 5D6NA 3VR2A 3WLSA 5LU8A 2W00A 4N3CA 3CCJB 2YVKA 5AW2A 1HY3A 1XTKA 5F9MA 2HU7A 1UJCA 3EDRA 5E0KB 3VNRA 4EHNA 1PVVA 1L4UA 1Z6AA 2BIFA 4MR8A 4RMIA 3PEEA 2XZOA 3AG6A 4BFLA 1XPOA 1XZBA 1NDHA 2IH5A 1K88A 1G4HA 3L0BA 2RG7A 1BDJA 3D4PA 5A7HA 1H2FA 2BYTA 4F7DA 2HFJA 2LDXA 3AI3A 3EIQA 2V03A 3HCRA 4EL5A 1TQ6A 1YS2X 2IDMA 3QU2A 4L0QA 3DE0X 3U26A 1JWBB 4E46A 2IKQA 4E2YA 1VF7A 3DT9A 3NT4A 1SC4A 4MI9A 4ZAFA 3RT1A 2W2NA 2HD4A 1ORIA 3D6TB 4WY8A 1VMEA 1SOMA 1KFEB 2RGBA 4KH1A 4BNXA 4BV9A 2IQ5A 3IUMA 2PZAA 4BNKA 2HW8A 2OWDA 5H4HA 2LIVA 5CFRA 1G18A 4TVSA 3TLEA 3ES9A 4AMUA 1DX9A 3B60A 5U4QA 2ZYHA 4FBLA 3NR2A 4W7IA 4FX2A 1BXRB 4UPEA 4UEQA 2OT3B 5KHOC 4XOTA 3U5TA 5IAJA 3RVSA 3C3PA 3ZXUB 4EG5A 1DEXA 1E5LA 2NXCA 1UXHA 3CZQA 5KYKA 1QTNA 4FYXA 3SQNA 1OGYA 4G8DA 1MABB 3JVUA 2IXAA 2ABWA 4NBTA 4RY9A 2AZXA 3CLSC 2AFHA 4FHDA 1QHFA 1X8KA 1JALA 3MMXA 3IUQA 3Q5DA 4KMSA 4NR0A 3CC4B 3PFNA 4BTLA 4AURA 4YRNA 3UO8B 1X7HA 4KXQA 2ZZKA 4PSDA 2CXNA 4XX1A 4FCTA 4RD4A 3OX4A 4LPSA 1CYEA 1A5SB 2GBFA 2POQX 1TM1E 3SX2A 3F49S 5IDQA 2AXQA 5JAPA 1VCOA 2A5DA 4KBYA 1RIIA 2XOKA 1GUBA 2JI7A 1DS6A 2ZIFA 4JJAA 3V9PA 1CKEA 1FYDA 1YI8A 1X1QA 3EEFA 4JLAA 4LF4B 2GEBA 3R6JA 2IEZA 3IQGX 3NWOA 2AN5A 3D7KA 1TW2A 5JS6A 4V1CB 2PRSA 4OGWA 4A92A 1QLJA 4NAVA 4TWRA 4ZYVA 5BOSA 2XIQA 1RJEA 4Y2QA 4Q9NA 3WK9A 5L7TA 4KOEC 4Q0MA 3DH0A 2PN1A 3UMRA 5B7NA 3TVTA 2FPPA 4RZSA 3ST7A 4Y6OA 2V4ZA 4YMLA 2IS2A 3ELUA 5LMCA 3QLUC 1IMOA 3KL4A 2K7FA 2YV4A 1A9SA 4H7JA 4H7HA 3O9MA 2JJ1D 4A0FA 2BFNA 2YQZA 1DKQA 3NHRA 1M1XB 3GCDA 4P7FA 4KSBA 1FDUA 3WMGA 2W7TA 3S68A 2B2NA 4QJ3A 1VG0B 2VBUA 2ZTNA 1V8BA 4C7OB 4QASA 1D5CA 4ZQHA 3LKVA 3HCPA 1KD1D 3LQFA 2BUAA 3KDSE 4BJHB 1C9DB 3BD6A 5KNCH 4Y1FA 4IM7A 1LD3A 3JRWA 3W0LB 2IXBA 1GNVA 1XMOB 2JZNA 2JJMA 3E9MA 2GJKA 1GL9B 1FFXA 4M98A 4MKHA 3KAKA 5DKFA 3RDPA 2C84A 1A0OA 2XRMA 2YWJA 3KQOA 1CBUA 4H3VA 4TQ9A 5FFFA 1UC5B 1K8XB 1ZA2A 2O2ZA 4XUEA 1K5PA 4AJEA 4B8YA 4MW5A 2D1QA 3QX9A 3UK1A 2HA3A 1SOUA 2XW6A 1E4YA 1ZOSA 2O3TA 2AB0A 2OV4A 3ABIA 3CUYA 3NIFB 5FUWA 3CNEA 4Q7EA 2PGDA 3JVEA 1ORRA 1NONA 3I4CA 1IM8A 1AKTA 2AFIE 1EKXA 1SEVA 2OKGA 3H5WA 3UWPA 1ZR4A 1Q0TA 4BO2A 2XWJI 4F0JA 1OXXK 1OAOA 1ORVA 4HEHA 4DM4A 4KJZA 4C21A 5K0FA 1UMCA 3TSOA 5AIBA 2EXXA 1ZHFA 3T12A 1UXJA 1WORA 1R10A 2IRWA 2ZAYA 4PLGA 1SQGA 5E6UA 5D01A 1SA0A 3TQQA 2Y6VA 4YXWA 2P3QA 4DQUA 5I48A 5ICEA 1G63A 3I42A 2UYOA 1Q1AA 1USVA 1Z56C 4GM1A 2OCKA 4HQFA 1YC5A 3FNHA 4K6FA 1GCIA 2UXCB 1UPXA 3MCVA 4J7AA 3V8PA 4LNHA 5KDDA 3Q7PA 5D1NA 1H2EA 3NGXA 2O3UA 1DQZA 3PFFA 1WHSA 4LVUA 3SJUA 3TTSA 3KKEA 4FEAA 1VLVA 2HFKA 3ZX4A 2G1UA 4FB5A 1H1LA 1GTMA 2BP7B 2J5XA 2LVBA 4WUTA 4BVGA 4E22A 4M21A 1CF4A 1NR1A 2O8CB 2X8JB 2YZNA 4UAGA 3I9OA 4L0MA 2GBCA 2RIPA 1ADGA 1R8YA 2QDXA 4RD1A 2E9SA 2P4EA 2PLNA 2Z09A 3IPRA 1WEKA 5LDGA 3L8HA 1L4HA 1LY1A 4Z4EA 4BLSA 3OIUA 2ZVQX 3GHYA 4Q15A 4WOJA 1ILEA 1E6EA 3VR4D 1U8UA 2UZ1A 5NLLA 1QPZA 1UK9A 4M1OA 3LQKA 4F4DA 4IXTA 2UAGA 4M99A 3UMYA 4HLQB 1R0LA 1TX4B 4O1MA 2CK3D 3TGPA 4D3FA 3GX1A 4PPQA 5GGYA 5TV2A 3M9LA 2ASEA 1LH0A 4KH0A 3C5WP 2J45A 3OE7A 2C9ZA 4FGSA 4XJSA 4B0PA 3F9CA 4MIKA 1NMSA 4YAJA 2X86A 1PV4A 1ZYUA 3DEYX 1U7UA 3VYTB 3IS3A 1XZLA 1JQKA 4A7PA 4ND4A 1SCUB 3ROTA 1WVGA 2YWCA 1X39A 1XQ9A 1KI3A 2CL6X 3BGSA 4H0CA 4IOMA 3V1UA 1ZWLA 4W7HA 1VJTA 5A9SA 2VJLA 4AN4A 1IOLA 4OM7A 3EVZA 3RTDA 1TM2A 4BP8A 3LCRA 3TS1A 2VT3A 4MJ7A 2VTDA 5DGDA 4B2IA 5IJ0A 3X2EA 2QT0A 3CC2B 1JG2A 1XZAA 2GXAA 1DWOA 1ZGAA 4JC5A 5KYNA 2PJDA 3EMVA 4PYNA 5K09A 3UGJA 1IXZA 3I4FA 4BO3A 3GUZA 1PZFA 1T6YA 1V4NA 2WUFA 3IO5A 4MVJA 4Q4HB 4CLEA 1Z3CA 1YGPA 4OQQA 1JEDA 4DXHA 1KRXA 2R6HA 3JQ7B 1U90A 3EWNA 5CVEA 5I7AA 4AD8A 5C3UA 2F3TA 3VHQA 2I87A 2YMLA 3QHQA 2XNCA 3ZHRA 5L45A 4NBSA 1OFGA 5DM2A 3RSOA 2GK7A 3R0QA 1U3DA 4GVXA 4PLFA 2J0QA 2QJFA 2AUMA 4BNWA 1VCIA 3L6OO 4WESA 1PJ5A 2I1WA 2XTAA 3MIIA 4QDKA 1ODJA 4MMZB 3F71A 4LHEA 4IXWA 2C98A 1PT8A 3IMCA 1G0OA 2ZS7A 4L3WA 3R7SA 3WYAA 3SKXA 1M6HA 5L3VA 1HO3A 3OE7D 5K4HA 3REQB 1J23A 2BAGA 4DQVA 4PC6A 1N5IA 3TPZA 1JS1X 1D4ZA 1FFBA 1II8A 2G72A 2WIBA 3AEKA 4BQPA 4BBJA 1DFHA 1A27A 2IEIA 1E2LA 1YB4A 4EYKA 4H7KA 3UJDA 4D4IA 1XLVA 2NZJA 2Z56A 2X42A 2Y1FA 3QELB 1EXWA 1XB2A 4MPJA 5K5EA 4DS3A 1XRQA 2ID8A 4Z99A 3ZY2A 4HZIA 4UE3S 1YIOA 2ST1A 1EFPA 3SLRA 3WYEA 4NEHB 5LB2A 1ZJWA 3DEKA 2GZAA 3EBOA 3IE2A 3RS4A 3U3OA 2VH1A 5SV2A 5A5DA 3R5JA 3EPKA 4WESB 1OXUA 5EWMA 3AFOA 5KYWB 4DV3B 2WQ7A 6REQB 2BM9A 3KXDA 3M6IA 4O4IA 1U1DA 4QHTA 4II2A 4Y2YA 2ODEA 3DNMA 3WGIA 2CVOA 5GVSA 3PS9A 4PANA 3KU4A 3JQDA 4QUAA 3RFVA 4GBJA 3HU3A 5KQPA 5FUVA 3SICE 3BFVA 4WAUA 2DHQA 1DQYA 1EZ4A 3W8DA 2J3HA 3E9QA 1SWWA 2J4CA 4JFRA 1YFKA 3BUSA 4L9RA 3NFRA 3CA8A 3JXEA 2CNDA 4I4NA 3UWOA 1V8PA 3C7TA 4U2GA 2VKQA 1JMKC 1IXKA 4HI0E 1MC5A 3GA0A 1ZZGA 4PVCA 4AU1A 2VSOA 1XQVA 4IAOA 1J21A 4K9KA 5B4UA 4Z4YA 1PR4A 1V71A 2IIQA 4HG2A 3K1ZA 2P3OA 1RTKA 1TK3A 3H75A 3N6RA 2Y99A 2BM0A 2YS7A 2GM9A 2GNAA 4RFLA 2B1QA 3MMZA 4HNGA 4P7JA 3USZA 2G04A 1YDFA 4ALMA 1HDXA 1K5DA 4HB3A 2R4QA 4KQHA 4EHHA 3AHCA 2RK6A 4L8GA 2C2XA 5BMVA 3AUYA 3GCXA 4XZ3A 3LTNC 4AY6A 1R4ZA 4BP9A 2BF4A 5JD6A 4CPDA 4R81A 3CX8A 4NCNA 4Q3BA 1P0MA 3OOCA 2IGBA 5F4ZA 2PT9A 5T67A 3E9YA 3VU9B 1ZOOA 4UTNA 5ILOA 1GU0A 2PXXA 3TQIA 2G1KA 4EHLA 4F3RA 1FDWA 3L92A 5JZBA 1E5TA 3Q87B 3QTBA 3U16A 1U0LA 1M67A 5B3JA 3ECSA 1P74A 3VX3A 4XOPA 2IY7A 2ZDGA 2BM8A 3WKDA 1A9PA 3FZQA 5BQ5A 5K05A 1Z2NX 2V7GA 1E3SA 1QV6A 2WUDA 1N0WA 3RK4A 2PZGA 2XVAA 3KX2A 4DY4A 1VHWA 3QBVA 5BWBA 4JP1A 1EFCA 1IN8A 1E2MA 3OCJA 1J0BA 3BE5A 3ZPNA 5HA5A 5DCUA 3RROA 1HG1A 3SVZA 4A0QA 3HUUA 1H1LB 2R60A 4FXUA 3BYZA 2YHUA 4LJ7A 5CM2Z 1CDEA 2E4UA 1C3OB 2QA5A 4LWQA 1GSHA 4PN7A 5CDFE 4QTYA 1G9XA 1WCXA 2GLXA 1NXVA 1PP4A 4MEBA 1KMQA 4HAYA 3VYRB 4ZD6A 1E2JA 2V5UA 4G7XA 1JAYA 1SBCA 4IS2A 3QVVA 5FT9A 2BDUA 3R76A 1J8YF 1VLZA 2ZS9A 4H6VA 4RKQA 1DAFA 4F8YA 1OFUX 1CB0A 5G4KB 1N05A 2HGZA 1RLIA 3HVRA 1WXQA 4LZPA 5AO9A 1RACA 2F8LA 4ILKA 1PX2A 5L3RA 2XYGA 3ILHA 1J0XO 2JKYA 3OM9A 2GDZA 1Q9SA 2V1XA 3PA8A 3RJTA 1EUCA 3UG6A 2RHCA 3USCS 4D9IA 3DA8A 4JVLA 2FW0A 3VTZA 2PKRA 2W11A 2CLKB 2JD0A 3K09C 4JLUA 2ZBRA 4N0PA 1T8SA 1Q19A 1ZI9A 1GTVA 3F0TA 3OOJA 5I6DA 4TWIA 2X76A 4ARZB 2IOHA 2P5TB 5DNUA 4I9HA 4E13A 3L8MA 1Z82A 3ONNA 1T5TA 4HNHA 4HRXA 4KAAA 3MOSA 4B17A 1F60A 2Z1NA 3SZGA 3ZPXA 4ZDKA 1UFOA 2ZIWB 1WLYA 4ZT2A 3E61A 3EOBI 2QBYB 1XTJA 4GX0A 2GN8A 4WZKA 2IPNA 4DSOA 1H23A 3CRNA 5LSAA 2B8EA 1I4LD 5JQGB 3K2BA 3KKLA 1EP3B 3UM9A 3WTBA 4FQ7A 1W9MA 4L4XA 1A8IA 4DV1B 3O8LA 2HA5A 1E2FA 2F00A 3RBZA 2IS1A 2MYTA 3DVLA 1OWPA 5CA0A 3KWLA 4WQMA 2QX9A 5EXPA 1P29A 2DBRA 3G6EB 3RTEA 1LDYA 3HB0A 2BFMA 3U40A 4AP9A 2OE2A 3CZ4A 1QFJA 2OZPA 2SECE 3P4YA 5M7EA 2F17A 3L5KA 2A86A 2FEPA 1Q15A 1Q22A 2Z1DA 1QC5B 3T7IA 2J4DA 2HI0A 1IHPA 1IPEA 3FCEA 4GYJA 4I55F 4D42A 4ER3A 3WGTA 4UFNA 1C3XA 2WYOA 1N2EA 1BQ4A 2XR1A 5DHFA 2JCBA 4KQKA 4BEJA 4QVJA 2DAPA 3JZIA 2XYQA 1CDOA 4MV8A 1O0BA 3GUYA 4CV1A 1SIBE 1T9KA 3H5TA 3ICCA 4H4DA 4MAMA 1RYFA 1HPLA 4MVYA 4G9GA 1BN6A 5BNIA 2ZWAA 1WBBA 3GLFB 1LQUA 3OZGA 3KALA 4G0YA 1EUCB 4MK4A 1ZQ1A 1SJ9A 2G7MC 2R7KA 1QZ3A 3RJMA 4OJYA 3TZHA 1GAWA 1KI6B 1OMOA 1L5SA 1CJSA 3I2KA 3WGUA 3BDAA 1KJ8A 3QXSA 2YRFA 1M76A 2FFQA 3H5LA 4DWWA 2O1XA 4EB8A 4B4UA 4YDRA 4NECA 4HH3C 4LGVA 4QBIA 3L0DA 3QHAA 4Q1VA 3DZGA 4P92A 2OKCA 3HCDA 4RELA 5B3AA 3QFFA 2HX1A 3I01M 3URMA 3AIOA 2E4XA 2HZ7A 2C97A 3EXEB 3NYWA 8AT1A 3FGPA 3IBSA 4PC2A 1Q12A 2MU1A 1GXSB 3FG9A 5BSXA 3L6CA 4UREA 4XYMA 3RH0A 1GPBA 4BJ6A 1MJNA 4FZ3A 2QL7A 4LXGA 2PG3A 3G8CA 1R8JA 3E27A 3O1LA 1YB5A 1POWA 3KV3O 4Q9IA 3S2IA 3HBAA 4ANFA 2WWYA 2EBFX 4PLHA 5EJ8A 3PHLA 3KJQA 1C50A 2A1IA 5MGNA 1HOXA 1U0FA 2H1IA 1L8XA 3FVVA 3SDBA 3CWZA 3HC7A 4DV4B 4XUCA 5AK0A 2NZVG 3F9IA 3NM5A 1KC3A 3NC1C 4NX2A 1G291 3IIEA 3E6AA 5DTMA 2JCXA 4BNJA 1ZGCA 1DIGA 5IH3A 4J43A 1DKOA 1NSTA 1CV2A 3B7WA 3M1YA 5LIRA 1PEYA 3NHMA 2DB3A 4MV7A 3QFCA 1PK8A 3AL0C 1JQ5A 4ITUA 4KW7A 2OFFA 1OBVA 2J32A 2O2SA 1O94A 3V8EA 4WKBA 3T9CA 3FNQA 4EGSA 1M8FA 2QN9A 1ECBA 3HP4A 4XYBA 4CBVA 5DTIA 3KSRA 3QVXA 3CP8A 4ZV9A 4YUZA 4WNAB 3CRVA 2WIJA 1J9ZA 1WNFA 1D9ZA 4EWLA 5AVJA 1YE8A 2Z5FA 3WB2A 5BORA 4F5ZA 3DL0A 1KO4A 3FUCA 2H1SA 2OBSA 1ZVJA 3ESQA 2VHCA 1M5RA 4E7OA 3CNLA 1Z5NA 2ZANA 2X3UA 2HK8A 3NALA 1PGNA 3IESA 3QLUA 1GTG1 2V7QD 3PKJA 4JLMA 4TLMB 1JRLA 4D0RA 2CD7A 3ZW8A 4PM4A 2RI0A 3A1DA 1TQ8A 1CJVC 3EDMA 2KVOA 4FI3F 4MQ4A 4ARUA 1KDVA 3GVIA 5AM0A 2ZCJA 4BVLA 3QOYA 4EYQA 1CVRA 2I4IA 4BWYA 3WK8A 5HPYB 2ZK7A 1ZK2A 2EQ5A 4WBXC 1WP9A 2EIHA 5ELXA 4HTAA 1ZNQO 1Z26A 1NPTO 4M0KA 2B7LA 4LZAA 5C1OA 3SMVA 1L8OA 4NMLA 4FOOA 4RGBA 4F3KA 1PV1A 3MJVA 1L5WA 5L9AA 2GCEA 1K3FA 2ZUBA 4B2PA 4BYMA 1CJUC 4HDCA 4DIOA 5JZSA 4J0IA 4J03A 2JFZA 4U2KA 3VJLA 1I0LA 4PO9A 2V6GA 2CNOA 2GAAA 4X90A 3UB2A 2PTHA 1OT5A 2Q1YA 3JD4A 2GPNA 3FBWA 4OHWA 1XLTA 1A9RA 2DQ4A 2RGWA 5ISMA 4DVGA 4QATA 4YJ2F 4GUDA 3CZ5A 3HKEA 3NH9A 3OZCA 2VP9A 1KOJA 4LXHA 1KAOA 5BOVA 2JAOA 5IYQA 4R2WA 3SQOA 5A62A 2GBLC 1N75A 2FMHA 2FDXA 3D6HA 4MCAA 1GEEA 1ZAYA 3FCSB 1FVOA 1KIAA 2B7BA 2CUKA 3F5SA 4IDOA 3Q85A 4R4JA 3W7AA 2J9FB 4IDDA 4BMXA 3QLVC 4M7WA 4S1OA 3V4VB 3OCYA 3CCQB 4F5YA 3ILXA 5GM2A 4C6TA 1XX6A 2AK3A 2LKDA 2HMWA 2Q3MA 2R8OA 1M66A 2NVOA 3GDGA 5JRZA 1XE1A 2A5GA 2OXRA 2NU7A 2X5KO 4F5WA 4X44A 4I9UA 4ZCLA 3RYFB 3OZIA 3T95A 4NG4A 3I64A 1ABEA 1W2WB 3A3BA 4FBMA 4PPNA 3EY4A 1B14A 3AF6A 5JXGA 1B6SA 3Q5EA 1FFSA 1Q7TA 4NULA 4UDOA 4HN9A 2D5AA 4IP0A 1JVBA 5B6PA 1XZPA 1G0NA 5CT4A 4G2NA 4BMOB 1E2BA 4X06A 2O0KA 1XCGB 1FU4A 2J6IA 1TK2A 4M9XA 1M7GA 5SY9A 1KTIA 2IBSA 1G66A 2NXWA 3L01A 1IULA 3K9QO 5E6SB 1YKSA 3T9AA 4FINA 4S0XA 4D4JA 1RRMA 4FMBB 4RPBA 5CDHA 4D4MA 3ADBA 2JAWA 2VXBA 1H6BA 4MUFA 4TRNA 5AJZA 3R6WA 4IHKA 1SO8A 5THQA 3GVLA 4XNFA 3DXXA 2XD4A 4DQDA 3A9RA 4QXOA 5FBHA 4UHKA 1I7SB 3AHGA 2V3CC 4FD2A 1I1NA 5BVHA 2GBPA 5AUQA 5JU6A 2EJWA 3B5JA 1W5EA 2R7AA 4P2NA 4PIPA 5JCOA 1DBQA 1YCHA 2R00A 2QNBA 3M6XA 3OHSX 2VZ0A 3VDRA 5IZ4A 2NV4A 4LAFA 4GRAA 4I1YA 4X60A 3H5VA 2QTGA 3MTAA 4DUGA 1QFYA 1O4VA 2LNDA 3AZQA 1PS9A 5FLXA 4JMLA 2V31A 4URFA 3RJZA 5AW9A 3ONFA 1DIAA 1FB5A 4JJEA 4L27A 3DV2A 3OIYA 1NNEA 1V1RB 1YQ9A 3PYLA 5JSFA 1EIZA 1P9NA 2WZBA 4MKRA 4JI0B 4IKPA 4WECA 2GFQA 2J31A 2JF0A 2I33A 1BPLA 1Z63A 3QFRA 3R7LA 3M3HA 3O92A 4EA8A 1DDOA 4OBEA 3KHSA 1FFEA 3EVBA 3SJAA 1O2DA 3BH7A 4AJ1A 1B4DA 1M73E 3TD6A 5KKCA 3KB2A 5CT9A 1G5FA 3M6AA 3PSAA 2JD2A 4F71A 3UAVA 1GPMA 1Z68A 2A5YB 3Q10A 3PZRA 2Z5GA 5K2MA 4MDYA 2OBBA 1W4RA 1ATIA 1RNLA 4PZ0A 3T7EA 2JLRA 5KC8A 1GG5A 4QYWA 4YPVA 3RANA 5EUMA 1F8FA 4MR7B 4QPPA 2O3JA 1VE3A 1BDHA 3FCXA 4LE0A 2FW7A 2PSSA 3IBTA 3AJAA 1UWVA 3DEJA 3DO8A 3KJHA 2BGKA 2FK7A 3G7UA 4B84A 4LOLA 3T7DA 3KQWA 2QGZA 2PFGA 3AOEA 4UUPA 4RSRA 1N06A 4MX8A 4DIBA 2VTEA 3D3JA 1HDIA 1ZGBA 4OPVA 3ANYB 1L3BA 1F3LA 1JR3E 2W6QA 2XZLA 5A2GA 3L7MA 4PXYA 4GMHA 2Y1KA 3QQ5A 3RSLA 4BMVA 3TECE 5HGXA 2A59A 2HMTA 1TZCA 1V7PC 2H63A 2ZIUB 3SI7A 1GZVA 5JWHA 3HKBB 5A4IS 1B3RA 3MS2A 4U7FA 4AKTA 2HL6A 4Y2HA 4IKOA 1AT1A 4C7KA 4TLBA 3UCEA 3HCNA 2AZ4A 5BSGA 1OV4A 1GGJA 3BXXA 2RGAA 5KEIA 4J3JA 3CLKA 4MUKA 5B3JC 4HC4A 3NHWA 1AQ6A 3WG9A 3LUGA 2QR3A 4OA5A 5F12A 1XXLA 4BCBA 1AUOA 4B83A 4H2DA 2Q6LA 1LQ2A 1G60A 3L7YA 1WBJB 2BONA 4RA6B 3ZHSA 3ORRA 1IWBB 4DUYB 1ADJA 1RPZA 4Z6KA 3UCFA 4NTZA 4PY2A 3B7GA 4GT1A 5CA1A 3RUPA 5I7WA 2AX4A 1KJQA 1VOTA 1GOTA 1NVDA 2JFGA 5ABPA 4BLQA 3HEBA 4CM9D 5JYBA 2B8TA 2V58A 4F4UA 2PSFA 5LL6P 4Q3KA 4HPWA 1GL6A 3II6X 3KP1A 2I3GA 4F96A 2UUAB 1AJEA 3E81A 4EHAA 2Q5JA 1ZD4A 5J40A 2O0JA 4A73A 3FE2A 1FRFS 3P9IA 5LXTF 1KYYA 2BFOA 1DGQA 3PRJA 3I9JA 3JVDA 4OAPA 4HFMA 4OP2A 4RPCA 3WLLA 1YK1A 4N5DA 4F04A 3SEQA 3AFGA 4LC9A 2QK4A 5AJTA 4MDEA 1PI3A 2BEUA 4OSPA 1MT0A 4PU0A 3R6KA 2B3TA 2GAFA 3VPBA 1PJTA 2KSQA 1CZKA 4R1SA 3TIVA 5JRJA 1Y9JA 3OICA 2WAYA 2ZUDA 3VU0A 4WFIA 2VH5R 1X19A 3QNMA 1KZLA 5E1MA 1PG5A 1SG0A 2WV9A 1MIHA 1WUYA 4DR1B 3DF9A 4TMKA 4GPTA 5EP2A 2WTAA 4JOBA 3ZQ6A 2EYQA 3HV0A 3L9XA 1KIFA 4GP7A 5JFTA 4Q6WA 1TZMA 2HV9A 3S7ZA 3LWNA 4DCPA 1VLYA 4AG3A 2CN1A 2PKCA 3SY8A 2IHUA 2V6FA 5E3HA 4DLZA 4XVUA 1LPMA 4Y9UA 1G20A 1Z15A 4HAZA 5JCXA 5TMEA 2AFIB 3KYDA 3MOGA 3NGLA 4D9JA 1NXQA 5HBGA 2OOSA 4MQFA 3CWQA 1DDIA 4QTUB 2BTOA 2D8MA 3ZD8A 3TLAA 2NVUB 5LMUB 1C3LA 2R25B 3WHIA 2UVPB 1Z4KA 1P75A 1XAJA 1HURA 3PFKA 4BFUA 1W1WA 2PH5A 2DKOA 2JEOA 1VLOA 3FMVA 3HFGA 4FK8A 2V8OA 5EYPA 4AUKA 3FKSD 5DLYA 4P82A 1BGXT 1AXGA 5GQSA 3PFIA 5GJWC 3AFMA 1YE5A 1IOZA 5LC1A 1QVAA 4M8KA 1PJSA 2VSNA 1CJTC 3FX2A 1A2QA 4N47A 3CCLB 3L6DA 3RSSA 4LSWA 1CZRA 1UM9A 1Q86D 3AL2A 4QT0A 3BB1A 2W6NA 3JRXA 5IARA 5JPIA 1NKSA 3VI3B 1HFEL 3RC3A 3TTTA 3KEMA 4L3OA 1Y6QA 3WAKA 1MEJA 4D45A 2OORC 5I8PA 1B16A 2R97A 3WLNA 4CG1A 4XWWA 4FMPA 1NVKA 3T0FA 4OMDA 1VHEA 1XTTA 1D4AA 1XZHA 3BGVA 3QMWA 4NMWA 1X7WA 2GEFA 3VPCA 3KSBC 3PNLA 1ORTA 1V6SA 4KQGA 4UFOA 3ZWYA 3PE3A 2XHZA 4L7VA 3NHZA 2QENA 1QQAA 2HRBA 2ZRCA 1A7KA 1JDPA 1JJFA 5FNVB 5K99A 4OQNA 1QGDA 2QPTA 4FZJA 2UVDA 1GVHA 1NQ5A 2CL5A 1QK4A 3OECA 4URYR 1DL5A 1WXHA 2R8ZA 2QYOA 2V0NA 3ETCA 2GVNA 1RKUA 3A2NA 3TYXA 2IUTA 4HBGA 2SNIE 3VO8A 3ZBPA 1P2FA 3AP2A 2QRVA 5BN3A 1P9LA 1Q82D 4PNHA 4PZCA 2ZWMA 3H3XA 5IJ9B 3IQDB 3AUAA 3LUAA 4L73A 1TGVA 3EZ2A 3W7BA 4DR7B 3SIWA 5CHYA 2XSZA 1VL5A 3K3PA 1THMA 3FLEA 1C1DA 3CEPB 3G0BA 4MIEA 4KVZA 1RQPA 1E9BA 2OYCA 3NANA 3EHEA 1CQWA 3VR5H 3EH1A 1NUPA 2ZPUA 1MQAA 1DINA 3NC4A 2P8SA 4UHHA 4R8SA 1NJ6A 2GZRA 2DUNA 2XUAA 3SQMA 1GQQA 3TKYA 2Q3DA 1CW2B 2R1UA 4M8LA 1FOEB 1FYXA 2PA3A 4MIOA 4NNPA 3ZZTA 1DXQA 2Z8YA 1V1JA 2G71A 3PF8A 4H6WA 3CPJB 2WPDA 4IO0A 1NFRA 2VQEB 5EVJA 3L1IA 3U31A 2VAMA 4NXNB 2EDAA 4XKVA 2A5JA 3TDKA 1UOOA 5BY2A 4ER5A 1CY1A 4K87A 1SCNE 2ZRBA 2XNJA 4EZEA 1DHRA 1XD9A 2ZB2A 4PAWA 1Z2DA 5CMLA 3ZDBA 2I7DA 1K7CA 3OC0A 1B76A 3ESDA 3ZCUA 3GDHA 1BMQA 4JP3A 4XOIA 3K9HA 1IVNA 4AKSA 4CF4A 3CCRB 1DHTA 1U80A 4U0KA 5JCJD 3V55A 1J07A 1KZ4A 4LFBB 3DWGA 1L5RA 4W5WA 5FOSA 2WPDD 4UNQA 4XD2A 4AP5A 3UH0A 2BHRA 2OZLB 2O3SA 3K2IA 4CF7A 1X1EA 4F2DA 5KX5B 1Z33A 3U5ZB 3V7NA 2PX0A 2WHRA 5LYJB 1G9TA 3KE9A 2JFYA 1PK7A 2Q49A 4CM6A 1PW7A 2DWPA 3BHIA 4EAAA 3FSGD 3IYLW 3I6YA 2VF5X 1E98A 1F9AA 3F7MA 1IJKA 2BEKA 1CUHA 1E4EA 2B21A 3GJZA 2B1GA 1A76A 5AJVB 4H0NA 1GGNA 2ATIA 4FDUA 4K1LA 4YIKA 4CN8A 2ECPA 4YR7A 3KQNA 3GD5A 4R2HA 1X1RA 3S8EA 1IRIA 4NJOA 4DJTA 1TMGE 1SVIA 3Q2IA 1FQOA 3ZV3A 2DJ5A 1GZHB 1BCSA 1UC4B 5D84A 3Q38A 1ZU4A 2JIDA 1X80B 2VP5A 3J80A 3H11A 4XTRA 1GPUA 1J0EA 2VP0A 5BYBA 1TYZA 4U7WA 4KODA 2JJ1A 4YELA 2IA5A 4M1MA 5EZSA 3VH1A 4ENPA 1M1YA 2IU0A 1S9DA 1RWNA 4M0LA 1I2MA 1LBIA 4LMRA 3UAXA 3NU1A 1DV1A 1IOVA 3CCUB 2MSLA 3OUUA 4GOJA 4V0ME 2BEWB 2IWRA 2HA6A 1VYUA 1U9CA 4L2IA 2UZ4A 1F8YA 3USES 1B93A 3UMJA 3K0AA 4V24A 3D6UA 2JKZA 2QTCA 5F5LA 4NE9A 4F45A 1XE3A 4KNYA 1GY8A 3KT8A 3B1FA 3R6LA 2IP4A 3RQSA 2P9CA 4HH0A 1J2TA 1TEHA 1DSSG 2ZU0C 1P5ZB 4LSMA 4GP9A 1BDBA 1CEQA 3R3SA 4JYCA 4EPXA 2XZTA 3DLCA 1UP6A 1OI3A 1R88A 4IL5A 1KDOA 3ZCQA 1BVHA 1C9NA 1AS0A 1DNPA 2WAOA 4GPD1 5H1YA 3UYLA 4Q3NA 3TCKA 4UQOA 4CKBB 4DV0B 4MQFB 1G19A 2D9RA 2ZRJA 3D2BA 4JIMA 3KQPA 1U9YA 1XWFA 2PEZA 4M8IA 1PWXA 5B36A 3LXUX 3QHPA 4Y1RB 3GELA 4OXYA 2BV3A 4FOTA 5I01A 3PLRA 2QGNA 2V7PA 4DSUA 4BLPA 3PT9A 1DCMA 4YMGA 3TCNA 3BFXA 4GI2A 4I9NA 3D3QA 3B12A 1QSGA 2ODWA 4FOPA 4OQLA 4Y2GA 4DANA 3LOQA 4WZBA 4ZAZA 4D6PA 2HREA 2XECA 3DE7X 4FLEA 3OG9A 4G0OA 4KFUA 2W98A 1V7ZA 3ZVLA 2NUPB 3UUEA 2Z0MA 3L6RA 4TVKA 1DJQA 1YUMA 5DXFA 2DE0X 2B7CA 1IK4A 3AI7A 5A4KA 1HDGO 1F1JA 4WDRA 1D2HA 2GPSA 3A6PC 1XTRA 2C94A 1WXFA 5IWAB 5KTOA 1IWPB 3S44A 4RTQA 4P2BA 5J5AA 2EFCB 3TRJA 2QZSA 2P6PA 1HXHA 3CO5A 1UT8A 4DC9A 4QV2A 1SVOA 1FMCA 2NZ8A 1LSJA 3ZDQA 1DAHA 1RSZA 5IMSA 5EC8A 1PJ3A 4A5OA 1UODA 4F3CA 3D5EA 2WV7A 1JEAA 4IEEA 4UBKA 4ESVA 1E7SA 3U7HB 1NVVQ 4GAEA 4KQWA 5CLHA 5F4JA 2AW3A 3T1OA 1JKXA 3S2YA 1JT9A 3ZHTA 4QEZA 4C4XA 2EGGA 5LQDA 4RAQA 1KDTA 2IDZA 1L4EA 3T5PA 1L5VA 3DHNA 4UMFA 4LIPD 3MTEA 3U4QA 1WXIA 2ZVPX 3WI7A 5JNRA 2FEMA 2Q2OA 5K3CA 3HM2A 4URZR 5I47A 4V0MA 3P2IA 3FMPB 5DZSA 4OPOA 2M6KA 3IUSA 4H1WA 1R12A 3DTVA 4DNRB 4CXMA 2P75A 4H31A 3O8DA 4PS0A 3KQUA 3AERA 5ARCA 4NMXB 4TXNA 4V3CA 3VH2A 5K8VA 1ECFA 4XPZA 3WNVA 1JAIA 2XE7A 1TFUA 4OBBA 4KQJA 1O95D 1AUVA 1PFWA 4RF2A 3QUTA 3PFGA 2Q99A 5KSYA 2PH3A 4PX3A 4X8OA 1R9NA 3KXLA 2EC5A 2H5EA 3FA2A 2V97A 3ONDA 1EBUA 1YJ5A 3P9KA 3BTOA 5FWAA 1I94B 2HY7A 4H1UA 5A8AA 1HUQA 2VBTA 3L7IA 4OK5A 2NUTB 4PLPA 1QYDA 1W1IA 2LKCA 2OBLA 5IHXA 3K6SA 4B3SB 2WNSA 2GEKA 1W4BA 3R5HA 4WJZA 1H8ED 1U0EA 1VQNB 1L1FA 1GGHA 2YN0A 4CMEC 4YHHB 4XR4A 4LBYA 4FDLA 5J1TB 2H2WA 1HVXA 3KCNA 5ALQA 4F56A 4LGCA 1LX6A 1BU5A 1LS6A 1UKCA 3VRHA 5JRDS 1ACMA 4MV0A 1BEEA 4Q4LA 3V34A 3A1CA 1JLLB 3T9EA 1N5JA 1AGNA 4IFTA 1ESCA 5C1BA 1VIVA 2GFIA 3A7EA 3S29A 4KYVA 3BX1A 4TKZA 1DAIA 5F64A 3WGNA 2DUMA 5TX7A 2FEAA 2O8BA 5BWOA 5C5EA 2Q5OA 1X8LA 1T5BA 5F4OA 1QCCA 4ZK6A 3I04A 4XUGB 3SJ7A 5AW8A 1A69A 4DUZB 2HADA 3K1TA 1M10A 4L5JA 2C5LA 4DPLA 2Z3WA 1Y33E 4H4CA 3HU2A 5JAHA 5KTYA 3L1UA 3N2GB 1CCWA 5HJ2A 2H2DA 3HO6A 1NBOA 4V0KA 3HDQA 3TJRA 5JI2E 1SQ0A 1H94A 2VUIB 3GFOA 1FU7A 1N6LA 2RONA 2YICA 4J0GA 1U9IA 3W5BA 2QA4B 2VC2B 3O90A 1PGQA 2N75A 2XT6A 1FUUA 2GCIA 3JWPA 4CMKA 2WKPA 1DKUA 2AUNA 2G17A 3ESZA 5HKAA 4IYJA 4B80A 2AI3A 3HGQA 5E4JA 4M0PA 1NX6A 4MJLA 4OG2A 3HXQA 4AQ7A 1VJSA 1W0CA 4L8FA 3WLMA 4E2XA 1P0CA 4GSYA 3V5NA 4ARCA 3IMKA 3NUZA 5DS0A 4FR2A 2ZBDA 4FSXA 3MWEB 3OD1A 4HEJA 4MUAA 4BO1A 5HZKA 3KYCA 3EJ6A 1NT4A 2BPOA 4EEZA 3JQBA 1JEOA 3GK3A 1GCOA 5KNBD 1XU4A 1XQXA 2O2DA 1VQ7B 3B85A 3W6OA 5JASA 2RK3A 1VKNA 1WAMA 4IIJB 2OGUA 4P6YA 3GL9A 3TSWA 4E3WA 4I0WB 3VYUB 4KC0A 1FSFA 3E5MA 3EODA 4G4SO 2FX2A 1N9KA 3OZXA 3PQ8A 2C5BA 3PRHA 3E7WA 1TQ4A 3CZMA 1E1RD 3FRJA 4KYTA 1QQ5A 2G4CA 4M9UA 2ONJA 2I99A 3VDMA 2FX3A 4R69A 3A04A 5HEKA 2IOFA 3O91A 2D00A 4B7XA 3OU7A 4PONA 1JE0A 1T3HA 2D59A 2ZZMA 4RNCA 1CZLA 4QYXA 1SVKA 1QE5A 3IEUA 3LZ6A 3NONA 1AKWA 2BZSA 1XWWA 3LTEA 4L6CA 3BJRA 1IBSA 1XA0A 3ND6A 1K8QA 1Q7BA 4IOLA 4QOFA 3AIIA 2JI8A 4UNSA 5DNVA 3DVAA 1VHJA 1U3CA 1WUIS 1MX1A 3DW1X 4J4TA 2ORED 2XE8A 3IVRA 5JNVA 3UXMA 2IYTA 2P6NA 4IIHA 4ZOQI 4PSKA 5EKUA 3OLWA 1X92A 3NWEA 4JFAA 4FDAA 1XN4A 5K3EA 1RCFA 1TDJA 3IGFA 3NHYA 3P45A 1G8FA 5KYXB 2GWRA 2H85A 4BPRA 1Z07A 3PNOA 1DJNA 3ZX5A 4B87A 1E1NA 3SGLA 1T8YA 3NBKA 1SXIA 3WS7A 2VJIA 3O4VA 2X22A 5EXXA 3RRZA 3CPEA 1TI7A 1Q16A 3WLOA 1ZBDA 3IEPA 1P7VA 4P4LA 4TWZA 4RIIA 1RWXA 1XLUA 4X94A 3MJFA 1RPJA 1NLZA 3EXG1 1MOPA 3Q6NA 4KXXA 1W88A 1FTNA 1Y3AA 3GRAA 3MGGA 1MAWA 1RPNA 4FDMA 2WZPP 2OV3A 2FLKA 1W75A 1ISFA 1U2TA 4MDHA 4Q3LA 2RHLA 3FPCA 3OM1A 1J24A 3BDVA 4OQEA 2AVNA 4PFKA 4BLTA 1NVWQ 4DC0A 4US2R 3ONEA 5JZOA 3AVPA 3C3WA 4MW4A 2UXBB 4I50B 2QSJA 1FIUA 2WUEA 2Z3ZA 3KZ1E 2ASVA 4HZUB 4IY1A 4N49A 2X8LA 3FTFA 4TT8A 5BXYA 1I3LA 5KU7A 1P61B 3L8EA 3W1VA 4Z1OA 3X2SA 3MLEA 4XA8A 2AKAB 1O9GA 1KZYC 2PH1A 2AG8A 3OT5A 1D1SA 1SD5A 2B35A 2WNIA 4UAUA 3SLKA 4H7FA 2CUTA 3C16C 4HIZA 3QEKA 4RY8A 5TQVA 4E94A 4MIYA 5JROA 5A5GA 3HDTA 3KR0A 4X62B 4GDFA 1LU9A 5AVKA 4I9FA 3WDMA 1DVRA 1ZUNB 2WMOB 3BSSA 2ZB4A 2G0AA 4FWIB 4PLVA 4KSCA 3RTAA 4EECA 1EINA 3O0DA 1APBA 3O21A 5J4KA 3R4CA 4AT1A 3CVWA 3VKVA 2UZ1B 4WADA 3FFBA 1EK0A 3WYDA 4DYHA 5AFSA 2PK3A 1HA3A 4RDLA 2E1BA 3ZDYB 1IBRA 2AOTB 3EGXB 1A5BB 2GB4A 4KO4S 2FN8A 3A0UA 2UXDB 2ZM6B 3KTFA 2K5UA 4GMDA 4R2KA 2C2YA 1XEFA 5G53C 4D79A 3JYHA 4A3SA 4EW3A 2SHKA 1P7CA 3G23A 1XTZA 4DA4A 3OZWA 1CRZA 1U81A 5EIFA 1S1CA 1BMTA 4CEJB 3F96A 1Y4UA 2JIMA 1YOVB 3DWEX 1NVGA 2W6ZA 1UKBA 3HYLA 1F48A 2YN2A 3CF2A 1NBMA 4WLFA 1TF2A 5F4BA 1F7UA 4KTVE 1T5DX 1PWEA 3ZIAA 1AB5A 1IL0A 3W2HA 3LBFA 3PCRB 4HFRA 4ISCA 5LUAA 3R4VA 1NJSA 3U39A 5KAMA 4KE9A 1G41A 3IMGA 4LCJA 1QGED 1PQ4A 5JZMA 2CY0A 4LBWA 3V48A 2C78A 2DSTA 1MO2A 5CX1B 4NAHA 2P9FA 1VYHA 2NP6A 1RADA 1NU6A 4PIVA 1HV8A 2VNHA 3G6KA 1ID8A 3FH0A 4XH9B 1BQ3A 2FEWB 4WCDA 2F1RA 2CWDA 2FMXA 3DBOB 2I2CA 4PQRA 3UZUA 3KEGA 2JCGA 4J0QA 3OIWA 3ZCTA 1C9EA 1L5OA 1Z4NA 4YP5A 4DLPA 3V00A 2OECA 3K0BA 2VBCA 1UBFA 3LUDA 1DE0A 1RE1A 2BD0A 3DZIA 5K6TA 2VK2A 2WJHA 4KFTA 1UXGA 1WB9A 1UPFA 2G40A 1NL3A 2ZIXA 3DGFC 4ND6A 4RPDA 2CHGA 5ERYA 4Z0TA 1G1AA 3NP7A 1XQWA 2W9XA 2FPUA 4W1QA 3EPHA 1VE7A 2QG6A 2WW8A 1IHUA 3LPNA 4HGOA 5SICE 2IIVA 5K3DA 3ZE7A 1BO6A 1A82A 3PJGA 3T4UA 1J1IA 4JB0A 2RG1A 3U44A 1P1BA 3WDKA 3CXRA 3QE3A 5CR9A 5AI6A 3WKCA 4OXIA 5D51S 4EO7A 3N74A 2VF8A 3QXGA 3LMKA 2VJCA 5G2OA 5KO2A 4ZN6A 2GJ8A 3SVTA 1QRUA 4C07A 3G2JA 2ZSUA 1TKCA 5H68A 3GJ8A 1TL7C 2JIOA 1MFPA 4RUKA 3PWKA 1W44A 3EWAA 3VR0A 2CZQA 4C7OA 2Q8PA 3INRA 3IVAA 1ZCAA 1M8KA 2QUHA 3I6BA 3WL6A 2I4RA 2OHFA 2I2FA 4YJFB 1KO7A 5JI3E 1Y3IA 2YWFA 2CLCX 3UHOA 5J2TB 1VBKA 4KN6A 1MRNA 2ZTHA 1QHSA 5HUJA 2QPAA 5E7JA 4H60A 1TUBA 2X1MA 4BQRA 2OO5A 2OD2A 4M86A 3DWFA 4KQ9A 5ALLA 1V41E 1UPTA 4YN3A 4DUPA 1KHTA 4MLZA 2Y1LA 1E8DA 4NBKA 3OZAA 5LN1A 1I7LA 1P17A 5I9LA 2W8BB 1I5OA 3QY0A 5ULLA 1N5MA 2D13A 2D2VA 2X1HA 4MYCA 3EPLA 5EESA 5A9TA 4XQFA 3G5AA 4EAQA 7YASA 2ZE5A 3KZNA 2YMPA 5IS2A 3I4LA 2QIPA 3MD9A 4OBWA 3PEWA 3NDIA 2QUBA 3BXGA 4ZOEA 1TXGA 3GMTA 3HZOA 4AS2A 1CY4A 3EZ6A 5KNBH 1ISJA 2MYUA 1JHQA 1BGVA 1K8ZB 3A11A 2Z83A 4TL7A 2J3QA 3TSCA 5ADUS 3GVCA 4DLNA 4CG0A 2ATXA 2DX7A 1H2YA 4TVOA 4ZCSA 5T8KC 3H2GA 3N53A 5A2QA 2ZE6A 5JHHB 2HMVA 2QBYA 5KYGA 5B7PA 3FJ1A 2EZUA 2XUPA 3TQSA 4TT3A 4LV6A 3IP3A 5IVKA 1WUHS 1CR2A 3LDAA 5EEHA 4LRSB 4MUMA 3H2SA 2J0VA 3RVKA 3M7IA 1Y7TA 4X61A 2RIRA 3ZJVA 2PYZA 2XYVA 3S8MA 2I7XA 2IUEA 3D6VA 1JR3A 1YV9A 4OQZA 4G67A 1SOAA 4GU5A 4R31A 3I9LA 5E2AA 2PMEA 3ZEIA 4DPMA 4QUIA 4ER6A 2IHTA 5A4DA 5AXCA 1RYNA 1T5HX 1E2PA 1QP4A 4HE6A 4E4RA 2JCSA 3O0TA 1BKDR 4OMUA 2GQ0A 3EA4A 5J2TA 1BEZA 3VZDA 2FZLA 2JLUA 3O8BA 3PL5A 4MROA 4OYYA 1SC6A 4UBOA 4HWGA 3RFFA 1X86B 4U39A 1U2PA 1E3IA 2WT8A 2XDWA 3B52X 4JLWA 5FFNA 2C03A 5HFAA 5BSUA 2W70A 2WTNA 3M70A 5IVPA 3TTXA 1T1GA 1VCMA 4RM2A 4DR6B 3QSYA 4WFJA 1YBVA 5EIBD 5HF8A 1C0KA 2CE2X 2GO1A 3GH3A 1O54A 4OSEA 4RBNA 1JU9A 1M2FA 2Q2VA 3FGOA 4KPFC 3UT6A 4C3OB 2R6DA 3ND5A 3HJGA 3ZY4A 3DMFA 2HPHA 4QVAA 3D4IA 4DF3A 3C3CA 4YWJA 2NG1A 2RKOA 2DZDA 3C87A 4TTQA 2IKSA 1IHDA 1WXXA 4II3A 4RWEA 4LYYA 4NABA 1SIOA 4L8JA 3G5MA 5FBLB 5I7OA 1UPBA 5BT8A 4QXQA 4UVEA 3N2NA 4UDYX 3SF8B 2P2NA 2IYFA 4WERA 5DBGA 1ZVKA 3CQ9A 3Q40A 4YLEA 2WYHA 1SU4A 4KIJA 4LXTA 4V0NA 1CB7A 5CB4F 4QUHA 4AY4A 1NF9A 2KB0A 4MPPA 4MRSA 4BX0A 1QH8B 4RJLA 4JI4B 4RY2A 3OFND 3PWZA 4LWOA 1Y42X 5H9WA 3QVWA 3Q7TA 2NP7A 2C3OA 1WW2A 5JQGF 3AHEA 3WC4A 1ES9A 1PJZA 3UJNA 4P4TA 4UAVA 4QTZA 3P32A 4B3TB 3FYTA 1W52X 3V4PB 1WO8A 1JDBB 2SICE 1N4DA 2OWEA 3N0TA 1BFKA 1WKCA 3VHRA 1DUSA 4B5KA 2AG1A 3HCWA 5EINA 4JJKA 1QGUB 2A2ZA 3PITA 3PQ3A 1CP2A 1OFUA 1FP1D 4KXLA 1E18A 2B0CA 2FUNB 4L7QA 2WQ6A 1GFZA 2JFNA 3G6WA 3NAGA 5GONB 3DYVA 3D7SA 1MJGM 3HN2A 4MQMA 3IURA 2FPRA 4OHCA 2I9PA 1O87A 1A1SA 4X64B 1C5KA 1G21A 1TA9A 2AMVA 2VZEA 3GJRA 1LI4A 5I7RA 3W8NA 4U6NA 5T6BA 1UJBA 4B34A 3TGLA 2I2WA 1BMDA 3QPWA 2JGJA 2O0HA 5G40A 4V1CI 3L7JA 3EG5A 3E9DA 3KOUA 5BV2P 1WCWA 4OVKA 3ER6A 1K6MA 3WGJA 1SBTA 2PXHA 4AICA 5JJBA 1YJQA 3NQ41 3BGIA 1YSCA 4BQSA 4PGFA 3RO7A 2G9ZA 1BS1A 4CQNA 1A50B 2J9GA 3AV3A 3OAAD 4L8LA 2DPXA 2IQIA 3R7AA 2YIJA 4HCJA 1XNGA 4BKMA 2OB2A 2X8AA 4Z9YA 4QGHA 2C4WA 3MEQA 2FV8A 4F2GA 2JAXA 4HJRA 3PPVA 2CEKA 4DEVA 4UE2A 3F6PA 4E0BA 3K92A 1D1PA 3LSYA 3CLTC 4J2HA 5DCLA 4MVJE 1XOIA 1J70A 1QS0B 3LXRA 4HN2A 1ATZA 2ZDQA 2ZXEA 1J2EA 1V11B 2F1JA 3CIOA 4HDNA 3AHHA 3PDWA 4ZGNB 2QL9A 4A36A 2ZYAA 4BQIA 3VKGA 4YPFA 1ZITA 2NT4A 3T4XA 1LB1B 2F64A 1LVGA 2BT4A 4DSNA 1C14A 3VISA 5TVKA 3ZGXA 3QX7A 2OHXA 3T1NA 5TY0A 2HMSA 3O2NA 3MN1A 1OE0A 1AMNA 1TUIA 4FN5A 3NKFA 4P58A 5DXJA 2PQ6A 3QJYA 1NLMA 4PZAA 3GDWA 3ORHA 1VI5A 3IL2A 4CL0A 4JQCA 4LOJA 5FPYA 4LOAA 5K2OA 1K28D 3DZKA 1LFAA 4WGGA 4JKIA 3B8HA 1VQ5B 1M2OB 1LSUA 4KPUB 1PJ2A 4MZXA 3GJ6A 5AESA 1TMOA 1WKBA 1J9EA 4XYEA 5GM1A 1R27A 1YS1X 2XDQB 2ODTX 1EXMA 4GBGA 3ETLA 2W2XA 3RS5A 1QS0A 1YJAA 3D8RA 4CM8A 1P4SA 4BZQA 6ADHA 4F1KA 1NB9A 4G9BA 2ZRFA 4RV4A 1YR6A 3H7IA 2E3JA 2VO1A 3C70A 3D4BA 1Y5NA 5CK5A 5IM4A 2O19A 2ENUA 4YRKA 2EJCA 3QJ5A 1R5JA 1RXCA 4H4EA 4BO6A 5EHZA 4X54A 1GKLA 1U9IC 2PH7A 4IUYA 2P9BA 1HYGA 1JZQA 4RIEA 4PCUA 4UVDA 4E09A 4Y0AA 13PKA 3ZHOA 4V0SA 3K32A 4LXQA 1E79A 2ZJ7A 1NFFA 4K2AA 5D7BA 5DWDA 3VPDA 2XKBA 1E79D 1PLJA 1BWSA 2GO7A 3EF0A 1YQUA 1NVMB 4QQ8A 4OFXA 4OHFA 4QWWA 2GTPA 3N86A 4YT2A 2RHTA 1IFXA 3LE8A 3S55A 3SZUA 1YDWA 1E60A 3WKBA 3CV3A 3N9IA 5KJ1A 3L46A 2XXBA 1LRLA 1T8PA 1U3UA 3QVTA 3VSBA 3DLTA 4EEKA 2B5VA 2C9DA 5MFPA 1EGQA 2F1HA 1M90D 3L1HA 4B44A 3LNCA 2QU8A 3C0KA 2IEYA 2CLIB 2WJZB 3P9PA 2V9CA 2D3WA 2QDKA 3IVGA 1Q2XA 2J5QA 4DNFA 4XLLA 1AM4D 3NT2A 1DKLA 4BEBA 2O4CA 2PX6A 2OFXA 3NDJA 4ZU6X 3RC1A 1IDN1 4RZIA 1NSYA 1IUPA 1FJXA 2BGRA 2EARA 1ZJJA 1KR2A 2QMHA 1D1QA 2PNFA 3DFUA 4L4SA 3UUFA 3R7NA 1E3MA 3OHMA 1TVKA 1U2DC 1Z2AA 1PKEA 3P4XA 2JGDA 4UC0A 5JJCA 1Z8FA 1ZVQA 3LP5A 2H4HA 1D6JA 4NYMQ 1MXHA 4DLRA 5GIPE 3K4HA 5D3KA 4EGAA 3SLGA 1WHSB 4JXZA 1UPUA 4IVNA 4NBWA 5THXA 1SM4A 3UTDA 3ZDXB 3GP3A 4R7TA 1BJRE 4TUYF 3NRCA 2X5OA 4BRSA 5HZHA 2PT7A 3DUFB 3RUEA 5LOVA 3AHDA 4UOQA 4ZT3A 4O8CA 1M2GA 1Z45A 4C7JA 1S2OA 2DP4E 3H16A 3L9WA 2IYSA 4F3TA 3B2QA 1LKZA 2BKUA 3FROA 3I32A 1L7VC 4RMNA 1QG6A 1TUBB 3LY9A 1LC0A 4P86A 5JFGA 4HHEA 3LFHA 5HKKA 1TT5B 2XSZD 3GGSA 1W76A 3EQ9A 5C31A 3TTUA 1VCNA 5B2FA 3BJIC 3DB1A 1TCUA 4XVQA 5BUCA 2P67A 3LIPA 1WCYA 4KVFA 3JQFA 1N7GA 4DCSA 1LJLA 1NASA 1P77A 2P8JA 3L8DA 4WBSA 5EIAA 1T3GA 4L9SA 3U4IA 3RU9A 4QULA 3WLQA 4AO8A 1G3QA 4R9SA 1ZUD1 3NC0C 4IFBA 3W77A 3AGQA 3NTXA 2ZI4A 5LQKA 1V9LA 5ILGA 3RABA 2C92A 4C43A 3RLFA 4JVMA 3LY7A 4I08A 3IOMA 1MABA 1CIPA 2GN0A 1X1DA 2Q5FA 2IK8A 3VOBA 3Q12A 2GXSA 5SYAA 1NG9A 3I55B 3WRVA 6ABPA 3CC8A 4JR0A 2IELA 1GZ7A 4ZCIA 1WSDA 3LVQE 3QI2A 3VDQA 1QUFA 3I5XA 1IZZA 2PZBA 3B70A 1N0IA 3DT8A 3NM4A 2ZBUA 3IEXA 5LQCA 4KX5A 4NICA 3E58A 4L1KA 2QD1A 4XUDA 4BY9E 1I4EB 4BASA 1YACA 1XQBA 3ETGA 4DPKA 4G0MA 2O7NA 4L51A 4G24A 5A4FS 2WYRA 1JLSA 2ILVA 4YMVA 3WGOA 3AM1A 2HYDA 3K0FA 1VSQA 3FUVA 3MMPA 4ZI5A 3MINA 1UZLA 4LF7B 3LP8A 4CTJA 4CMBA 1FMLA 2FPLA 1A88A 3B7PA 3C1TA 3NKVA 2PVPA 3R9IA 4WE3A 2ILTA 3A4IA 4PRYA 5EKXA 2PUTA 5D6OA 4EYOA 5I3ZA 2XCTB 5EP1A 5H83A 4ON9A 5CXUA 4OQFA 1OAKA 2CXTA 2OCLA 2ZVJA 4PNEA 3IEVA 3I61A 1LLDA 4GWLA 1PL6A 3SS9X 2PX5A 1VFPA 2A1TR 3SX0A 3ZN2A 3Q5GA 1YS6A 4KIWA 3KD3A 2B4TO 1RPTA 4B85A 1P19A 1PWZA 2PLRA 4REQB 1IHYA 1OLUA 2VQSA 4D99A 1LVHA 1A04A 1EM8A 3MCTA 3RS2A 3O8QA 3VJKA 2VRWA 3U17A 1R4NA 1WDWB 2Q0SA 2FW8A 4N0MA 1D2CA 1LV7A 3QG5A 4YJKA 1XXHA 3BDIA 4ZVNA 4RAOA 4CL2A 2HA2A 2QUAA 2QJOA 5IUKC 4B33A 4RVFA 3VNQA 1NW3A 2C2KA 2PVSA 1B73A 4PSUA 1P1KA 2VPXA 3F8WA 3CUSA 3S8YA 3U6BA 2W2LA 4GSKA 4HH4A 4PWZA 4Q4AA 5LKAA 1B8VA 2OGZA 4MGZR 3NYRA 2GF9A 3HYRA 2HHCA 1ZD2P 3TDNA 1AGPA 3UH1A 3PUKA 2QTBA 1QB8A 3FNBA 3LVFO 3OU2A 4HB2A 1NBHA 4TZKA 1YBHA 4BGEA 1KRWA 1CU1A 1WULS 2DPLA 1T1EA 1R6XA 4MKIA 3TB6A 3UQYS 4AYWA 2UUCB 3V7UA 1KYVA 2B2CA 3LECA 2ZAIA 1NYTA 4ND2A 3GFPA 5EERA 4Q1CA 2YJZA 1BQEA 4YRZA 1LK0A 1Q6ZA 5EIBC 4U7GA 3ZK8A 5JY6A 1JAHA 4FFVA 1WSAA 3ZY6A 1EVLA 3AZPA 4UEWA 1JUDA 1Q1BA 2FZ4A 3T1YB 1U28C 4XW2A 2VWPA 3SBEA 2D5CA 2BBWA 2X8BA 4YRAA 1SC3A 2GD2A 3LBHA 2WIGA 3HCBA 4TV9F 4YECA 4URWR 1H0RA 1KF0A 4GXRA 3TRDA 1DLJA 3WQHA 2YWRA 1PHPA 3J81k 2GJRA 4G6IA 1CJBA 2C0CA 5DMHA 4GR5A 2D0OB 3FDZA 4R7GA 1YKGA 4Q39A 5LBIA 3TLGA 1EI9A 1XPJA 2H4JA 2RE8A 5FULA 1T1IA 1FSZA 1TKRA 4PGMA 4IX9A 3L40A 3L1KA 1SUDA 2P9JA 3NNNA 4L57A 4LG1A 1T2FA 4R8MA 4ZO4A 4PVDA 3ONVA 2X6WA 4I55B 5KOJB 3KOMA 3NDRA 1W85A 2WSBA 3JQEA 2O9JA 2BDTA 3Q8XB 1FP2A 4GOKA 3R2JA 5JAIA 3B2EA 2J4FA 2ZRIA 4JBYA 4B7AA 4R83A 4R5MA 3WLAA 4D8WA 1VIMA 3DP9A 4EG7A 2WNHA 5HIIA 4KI7A 2Z30A 4W63A 2XOKD 3F1KA 3PGJA 4URXR 3VZBA 4BKOA 1RHMA 2Q5QA 2WKQA 3K9LA 1L7EA 1DZIA 1M6YA 3DO6A 2ACWA 3NYQA 4PQYA 4OSOA 1NR7A 2REBA 1KQ3A 4J94A 2SKEA 1SK9A 4PAGA 4KOAA 1Q7CA 4Z4FA 4EO4A 4MI3A 3DCYA 4WL0A 2QHXA 3TPFA 4Z3KA 4L72A 1N8SA 1SXGA 3V2GA 1GV0A 1LBSA 1TJ5A 3H6HA 1NVTA 4LXYA 4MQ6A 3U4HA 1R00A 2AEJA 1BD4A 1XF9A 2Q4DA 3F3SA 5FOQA 1KERA 2FHPA 1ODKA 3B1XA 3EQZA 4RESA 3RVBA 1U4OA 5TRDA 2OZEA 2J5KA 4F1WA 1TM7E 2I6QA 2ZUCA 3ITEA 5BSTA 4AWXA 4BB5A 5CBPB 2NPOA 4LSGA 2QTZA 1YQXA 2A6PA 4Z5XA 3DB2A 5LA6A 1XZJA 1QIGA 2GCOB 1TOAA 3LA8A 3O7MA 4JXKA 2Z3VA 1KK1A 4DT1B 4A8HA 4I8IA 3HRIA 4O25A 2B4RO 3H17A 1MO5A 1SVWA 5EMKA 2C4UA 3QRWA 4GKVA 1DC6A 2GNOA 1BXGB 3C8MA 4AJ2A 1U8YA 3HCCA 1TO2E 3OCUA 1MO3A 1POXA 3OOWA 3KPYA 3AEYA 4GHWA 2AYZA 4X3PA 3O8OA 3W1EA 4OJQA 4MLPA 3DAOA 3RBAA 4YDHB 2QI9C 4P93A 3QXCA 1JEYB 4BO8A 2VSXA 2YBEA 4BMDA 2XCSB 1PBTA 1YBMA 3RT9A 1UD6A 3AETA 4CT5A 5FOVA 3DM5A 1H22A 4CCSA 5KNDA 3BIFA 3AVVA 4JV5B 5LYYA 3NV7A 4HVCA 2NTYC 2B83A 1K7EB 5LM3A 2XV1A 2YN4A 1D7OA 5C4IA 2WMNB 3EAGA 1N36B 3EEIA 4OQPA 2V45A 3TEMA 3DFMA 1Z4IA 5ECGC 5GP1A 1T9AA 2JB9A 3V97A 4EG3A 1RWPA 2ISQA 1T1RA 1UBHS 4ND5A 5KPJA 1QO7A 2CSUA 1W6RA 2HLPA 4MP3A 5J4LA 3RSFA 1RC8A 1M7BA 1R2QA 3SYTA 2C2HA 1E0KA 1MAUA 4QFBA 2X5JO 1E3EA 4RJIA 1QLWA 1SQ5A 2NV0A 2ZJ6A 4RQAA 1R6VA 3X0DA 5KWSA 4OD0A 3O9ZA 2NSDA 4LJAA 1D0VA 2RHMA 1TJNA 2RI1A 5DNWA 3TM4A 4C4ZA 2G0TA 3C3DA 3A70A 4BXOB 2CCJA 4NDNE 5MHTA 1T3TA 3IOYA 1J56A 1F06A 3C39A 2DHRA 1RJWA 3FPAA 1ONOA 1M6EX 3BD7A 5AHWA 3G0GA 1DAGA 2OBNA 1XZCA 2RHGB 3BRQA 4IX1A 4LQLA 4DREA 3S0JA 4CMJA 5AOCA 3DOIA 3OZEA 4K9NA 3S27A 1E64A 4M8SA 4PFSA 2P65A 3DOEA 4RPHA 4H7IA 4WA8A 5CJ2A 4Y2PA 5K0JA 2HC9A 4MITA 5M3BA 1YHYA 4GE3A 1ZRMA 2BZ0A 4EIWA 5HYVA 2FSVC 3FVQA 4D0SA 3ZW7A 3NM6B 4IS3A 3SJZA 5BW8A 1JAXA 1TCVA 4B76A 3HXMA 2G5PA 1YJ8A 2H2AA 1SZJG 3LP6A 1PTJC 1T4CB 2OV6A 1M8GA 4WKPA 3R7FA 5EJ9A 1TM3E 1DJMA 4L08A 1ZK1A 1G9SA 4TXHA 3Q15C 1EJBA 1EEXB 4PBTA 2WU1A 1IEQA 3R3JA 3P9RA 3GVKA 1OWOA 3KS9A 4FS8A 3FPSA 1NQOA 4BDSA 1V8FA 3ZGNA 4A0GA 3GROA 4GQNA 3H8VA 2HT6A 3M6FA 2OP0A 2PIDA 3LRTA 4O4LA 4CN9A 1Y0YA 1SCKA 2X5NA 4UQLA 5JHGB 3NO4A 1GP2A 4XJXA 3BRCA 3W1WA 1LW7A 4YP0A 4M0UA 2ERCA 1VM6A 3ELYA 4MUXA 2O1WA 2V7EA 1AXEA 2QUIA 1VSBA 4PFQA 4MR9A 4Y6LA 3HACA 3WP0A 3VSAA 4E5VA 2BBSA 1VIDA 2BFCB 2VNSA 2VJMB 5HCIA 2VBVA 2G9QA 1C8KA 3E3LA 1XROA 4Q12A 4XIIA 5LQSA 3VDNB 3ZE6A 4CUKA 1GADO 4DRYA 3CCVB 1N3YA 1YHNA 3NRBA 4ZKEA 2GREA 5DV9A 4HQRA 4L15A 5IUNC 4MJ3A 3FOBA 4J1TC 3L8YA 1RJDA 2VYFA 2NO7A 3LVBA 2BFFA 4QDJA 2BMJA 5AOBA 1I2AA 2GPAA 1MP0A 1UINA 2PLAA 4TYPA 4WZAE 5I9IA 3JQBC 1D7AA 2IT1A 1WXEA 4L6IA 3IAEA 2NUTA 2X58A 3G2PA 3OOYA 1UD4A 1C0EA 1UXOA 4JH0A 4TTJA 3SXJA 3VOSA 1JQLB