4RDKA

Crystal structure of norovirus boxer p domain in complex with lewis b tetrasaccharide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
297
structure length
293
Chain Sequence
KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGPQTLPINGVFVFISWVSRYYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
source organism Human calicivirus nlv/boxer/2001/us
molecule tags Viral protein
molecule keywords Capsid
total genus 70
structure length 293
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdkA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdkA01
3ASRA 4WZEA 4OOXA 5F4OA 4RM0A 2ZL5A 4X0CA 4QUZA 4RDJA 4QVJA 2OBTA 4Z4RA 3Q38A 3PA1A 3PUMA 4OPVA 4X7FA 3ASQA 4X7EA 4OPOA 4X7DA 3Q6QA 5IYNA 4RLZA 5IYQA 4Z4YA 4P25A 5J3OA 3PVDA 5BSYA 3BQJA 3ONYA 5KW9A 4WZKA 4RDKA 4P2NA 3ASPA 3Q6RA 4RPDA 4Z4ZA 4P12A 5HZAA 4Z4SA 4RPBA 2ZL7A 5BSXA 4X7CA 3ASTA 3SKBA 5IYPA 4OP7A 4WZTA 4QV2A 3SJPA 4WZLA 3SLDA 4P3IA 4RDLA 4Z4UA 3BY1A 2OBRA 3Q39A 4X05A 3R6KA 4OOSA 3SEJA 4OOVA 3PA2A 3Q3AA 3V7AA 3BY2A 4QVAA 3RY8A 5F4JA 3D26A 5F4MA 3PUNA 5J35A 5E6TA 4X07A 4P1VA 4ROXA 3LQEA 3ONUA 3SLNA 3R6JA 4Z4VA 3LQ6A 4X06A 4OPSA 5IYWA 2ZL6A 4P26A 3ASSA 5IYRA 4Z4WA 5HZBA 1IHMA 4Z4TA 2OBSA
chains in the Genus database with same CATH superfamily
2VBVA 3W2EA 1QH0A 4RCZA 2PLFA 4RD1A 3CMAB 1R5OA 3G6EB 1QUEA 2BM0A 4RM0A 1PJ6A 4MYTA 4G1VA 4QUZA 2DY1A 4QVJA 5DSZA 2BPOA 2ZXHA 1JA0A 1YX2A 3OOCA 3OE7A 2XNJA 4OPVA 3WXMA 3ASQA 1WOPA 2OTLB 1JJ2B 4N3NA 2C4UA 2QN6A 3Q6QA 2JJ1A 1QFJA 2V7QA 5IYQA 1E79A 4BPRA 4Z4YA 3CTAA 3QE2A 1KJZA 3JQPA 1WOSA 2WZPP 3WNBA 2ZTNA 2GJKA 2QTLA 3PENA 4HE6A 2JIZA 2GK7A 2QGGA 2C77A 3CCQB 1SKQA 1GAQA 2ZZGA 2WYRA 3OFNA 2Z6BD 3CCEB 4RCYA 2E1RA 2J7KA 3BC9A 5BSYA 4YAWA 4B4DA 1R5NA 3U2QA 2VNJA 1BJKA 4ZCIA 3LNNA 4RD6A 4UZUA 4WZKA 2XNCA 1HA3A 4ZCMA 3WY9A 3GVKA 4P2NA 1M1KD 3CB4A 1IHMA 3U6KA 2DIEA 5L46A 4P12A 1KD1D 4Z4SA 2VBTA 1H42A 3CMEB 2OTJB 1YJNB 4PC1A 5BSXA 3OKXA 3LVBA 4G7XA 3SKBA 4Y7CA 5IYPA 1BX1A 1FNBA 4XMYA 1VLOA 5A88A 1IB0A 3MMPA 2RC6A 1PJ7A 1N0VC 2WZNA 3SJPA 3OW2B 2VYQA 2DEUA 5FO0A 1NB9A 2CK3A 1J9ZA 3FKSA 4ASUA 1Q7YD 3AVUA 2C5HA 4ZV4A 1N08A 1VQ8B 2GPJA 2DETA 2RC5A 2YWHA 4P3YA 4AVZA 3Q39A 4J0QA 3GVJA 2X6XA 1QVFB 3R6KA 4OOSA 1V0EA 1G7CA 1SM4A 2LZJA 2VNIA 3Q3AA 4TMVA 1UD6A 1T5EA 3JQRA 3CXCB 3W2IA 3WBKA 4L8JA 4XLEA 1VQ7B 5F4MA 4QFMA 3CCJB 5J35A 4X07A 2AHOA 2Q6KA 3ZUGA 1VQ4B 1W2BB 2W6IA 3GIRA 4P1VA 5CDFA 1M90D 1VQPB 3QFRA 2EFGA 2VJIA 3OEHA 4TMXA 4WWVA 4YALA 3LQ6A 2BV3A 1EWYA 1T6XA 5IYWA 2P3MA 2JJ2A 2X85A 1TTTA 3WNDA 2YWGA 4ZCLA 5IYRA 4LBWA 4PC3A 3GSIA 5HZBA 3B82A 1YLOA 3B8HA 2I1LA 2YWEA 3P27A 1A8PA 2XZOA 3ASRA 2WJYA 5FL7A 2B7BA 4OOXA 1W87A 4B3GA 2FX3A 1FX0A 5GV7A 2ZL5A 1OGIA 3G05A 3W2HA 1P4MA 3W2GA 2ZXIA 4E0FA 3PUMA 4P9SA 1FNMA 4RD0A 3U6BA 4Y9RA 4LBZA 1EP2B 2V31A 4YAFA 4XOTA 1BPLA 2ZZQA 4X7DA 3ZIAA 4RLZA 3OW7A 2HCJB 1AIPA 1NB0A 1E63A 4PGOA 4XLCA 3ZBTA 4RD3A 4YELA 4F7DA 3CCLB 2HDNB 1Q82D 3B78A 4ACBA 1F20A 3CCSB 1XFOA 3CPXA 3QFTA 2BVNA 1ZUNB 5A89A 4G6IA 5KW9A 4RDKA 2D74A 3ZBUA 5AN9A 3CP8A 1E43A 3H94A 1NJID 5H59A 4P22A 2BSAA 3ASPA 3Q6RA 1VQNB 4Z4ZA 2X6YA 3NE5B 1MRZA 4N3GA 1EFUA 3E1YE 1HVXA 4M1KA 4NNJA 1YI2B 3VR6A 1FRQA 3QSYA 1G7TA 1KK1A 1FRNA 1UD2A 4JMQA 3AVXA 2NPFA 2WPDA 1QFZA 1F60A 4QV2A 2M5SA 1E62A 1BLIA 3G71B 1E64A 1GR1A 5TR9A 1GAWA 5KNLA 4DK1A 3WYAA 4LBVA 1JNYA 1W35A 4M4SA 1WSVA 1DDGA 4B3XA 1KMHA 3BH4A 2JN9A 3CC7B 2VNHA 3ZZ0A 2OK7A 1S72B 4DNRB 3T53B 3JU4A 2B7CA 1QX4A 4QHYA 4ACAA 3SEJA 1YJWB 4FN5A 4OOVA 4XLFA 2DOGA 3AGPA 1H8HA 2V7UA 3V7AA 1G7RA 4WQMA 5DN6A 3RY8A 3ES9A 3OP1A 4HIZA 5H5JA 1KK2A 1EFCA 2D9RA 1K28D 2X0KA 1JB9A 4YEJA 3DDYA 3LQEA 2X53S 1S0UA 3ONUA 4M2LA 3A8IA 5HXBA 1VQMB 3QFSA 3VNUA 4XN0A 1YJ9B 4X06A 1VF7A 3AVWA 1KRHA 1VQ5B 4FXUA 1I7PA 5DS0A 1I18A 4AF6A 1VJSA 2QMUA 3CCUB 2CW5A 3A8KA 4Z4TA 3KL9A 2ZTGA 3OZWA 2OBSA 3VO2A 3ZZTA 2R9VA 3LO8A 1GO2A 3W5VA 1D1NA 4XN3A 4WZEA 2GREA 1T6YA 1QVGB 3W2FA 1OB0A 4RDJA 1PKVA 4B3FX 3CD6B 1GVHA 1OGJA 4Z4RA 3PA1A 4NBSA 1VQOB 1KTVA 1UD5A 4R71A 4X7EA 3CCMB 2V7WA 1N0UA 1YHQB 2XOKA 5TY0A 4C0SA 1KK3A 1Q86D 1TVCA 1KK0A 2XZPA 4LC0A 1W34A 2QEXB 2F4NA 2ZITA 1VQ6B 1W9XA 1VQ9B 1UD3A 1ELOA 1PJ5A 3WNCA 3I55B 3PVDA 3A1PA 1KZLA 4YHBA 1OB5A 1ZM2A 2GJPA 1H85A 1QUFA 1NBMA 3VMFA 4B44A 5B6IA 1FNCA 4PABA 3ZZUA 1V0FA 1KQSB 4M0LA 4XQFA 3AVYA 3A3GA 1W0KA 4DNTB 4RJLA 1T6ZA 3MCAA 3FPPA 3GQBA 5EMNA 2OK8A 4Z1MA 1E1RA 1W0JA 4X7CA 2WSSA 2C5BA 4TMTA 1D2EA 3ASTA 4B48A 2XEXA 1WTHD 4G5GA 1DARA 1FNDA 2D3NA 2YWFA 1G7SA 2Q6IA 2ZZFA 4OP7A 3AVTA 2VZLA 2VJJA 4TSFA 2CF4A 4G1BA 1Q9SA 1ZM4A 3P26A 4TMWA 2V7TA 4WZLA 1N07A 4PC2A 2QDXA 4P3IA 3SLDA 2XZLA 1RQRA 4X8IA 3BY1A 4XOPA 2CRVA 4EH1A 3AVVA 1BX0A 3GVLA 4DK0A 2PIAA 1K9MD 2HMAA 1VHEA 2BF4A 4CQJA 3V76A 1Q81D 4P6VF 3PA2A 4TKOB 3CRZA 1XE1A 3BY2A 1IJEA 3BCFA 1V5VA 3H9NA 2OYNA 2VBUA 5F4JA 1WP6A 3A3BA 3PUNA 4PC7A 3G4SB 1CNFA 5E6TA 1OHHA 3CCRB 3FJOA 4ROXA 5A8AA 1QGZA 2BGIA 2PE3A 1DDIA 3MHPA 4ZGNB 3SLNA 2C2WA 1B2RA 2KVOA 3CESA 1D8TA 3R6JA 4Z4VA 1K73D 3OJXA 1Y0YA 3FPKA 2ZL6A 1CQXA 1EP3B 1UD8A 1WDTA 2E1BA 1E1QA 5FNZA 1WSRA 2DYIA 2Q6LA 4Z4WA 3OZUA 3OEEA 1CNEA 4XNFA 1GJRA 1OB2A 2X6WA 4RD2A 1MABA 2BMWA 3BCDA 3OZVA 4NCNA 4B47A 4U9UA 1EFRA 2FVGA 4K1XA 5FIUA 2CBXA 2JDIA 2XNDA 3QFCA 3T51B 1YITB 4DQKA 4XKVA 5F4OA 4UAJA 4G7WA 1WOOA 4X0CA 1N8RD 2BN4A 2OBTA 3OPOA 1EP1B 3CMMA 3Q38A 1VLYA 2C4TA 4X7FA 1QFYA 1XB2A 1N06A 2HLDA 3CC4B 4OPOA 5IYNA 4KKTA 4FWTA 2GQFA 2GJRA 2XGJA 4XONA 1SKYB 2BM1A 3VO1A 1JA1A 2V7VA 3I1FA 3W5UA 4B43A 3CC2B 4MYUA 1FDRA 2V4DA 5FO1A 2VBSA 4XORA 4TMZA 4TT3A 4P25A 2QA4B 5J3OA 1EFTA 4IW3B 4XKWA 1VHOA 5FA6A 4RD4A 2WJVA 4AF7A 4HE5A 1YIJB 2EIXA 1VQLB 3KEWA 1H8EA 1HZEA 3SJZA 3BQJA 3ONYA 1COWA 4YAUA 4II2A 1IJFA 3JQQA 2NV4A 1UMKA 5THXA 2CC2A 5TRDA 4RPDA 3CPWB 2Q6OA 4XR6A 5HZAA 3WBJA 3OAAA 4LBYA 1RQPA 4RPBA 4AC9A 1R5BA 2DCUA 2ZL7A 1N05A 4Y9UA 4DQLA 3J81k 3ZC3A 1NDHA 2GK6A 4UZFA 3BNWA 4KKSA 5TV2A 1AMOA 1ZM3A 5IK2A 4Q7JB 1EXMA 4WZTA 4YXWA 2B5OA 3CW2A 5JBQA 1E3ZA 1QGYA 3ZPNA 4M53A 2QE7A 2C78A 1S4MA 1B23P 2QTZA 2BGJA 3CP2A 4GQNA 4ZGQB 1QGAA 3E20A 4RDLA 3T56B 4Z4UA 3OJWA 5HKKA 2VNKA 3HAGA 2OBRA 1BQEA 4X05A 1XQBA 4FK8A 1QG0A 1WU8A 1Y0RA 2CNDA 4XLAA 4H9GA 3A35A 4PC6A 4P6YA 4QVAA 2WR8A 4XLHA 3CCVB 1UD4A 1U2RA 2F43A 2R6HA 4II3A 3VNVA 3D26A 4YAOA 2F1LA 1K8AD 4XM3A 4C43A 1WORA 1DG1G 2V7XA 1E3XA 5LMZA 2PMDA 1NRKA 3A8JA 4PAAA 5GV8A 4KKUA 1ZM9A 2ZZEA 2DERA 1BMFA 2W6JA 3AGQA 3I56B 4TN1A 1I8DA 2ZBUA 4OPSA 1TLLA 1WPCA 4P26A 1VQKB 3ASSA 3ISXA 1TUIA 2X3UA 3W5HA 2X8KA 4XL9A 4UZEA 5KSWB 2F1MA 2D3LA 4XD7A 2ZBVA 1KC8D 3WQZA
chains in the Genus database with same CATH topology
3ASRA 4WZEA 4OOXA 5F4OA 4RM0A 2ZL5A 4X0CA 4QUZA 4RDJA 4QVJA 2OBTA 4Z4RA 3Q38A 3PA1A 3PUMA 4OPVA 4X7FA 3ASQA 4X7EA 4OPOA 4X7DA 3Q6QA 5IYNA 4RLZA 5IYQA 4Z4YA 4P25A 5J3OA 3PVDA 5BSYA 3BQJA 3ONYA 5KW9A 4WZKA 4RDKA 4P2NA 3ASPA 3Q6RA 4RPDA 4Z4ZA 4P12A 5HZAA 4Z4SA 4RPBA 2ZL7A 5BSXA 4X7CA 3ASTA 3SKBA 5IYPA 4OP7A 4WZTA 4QV2A 3SJPA 4WZLA 3SLDA 4P3IA 4RDLA 4Z4UA 3BY1A 2OBRA 3Q39A 4X05A 3R6KA 4OOSA 3SEJA 4OOVA 3PA2A 3Q3AA 3V7AA 3BY2A 4QVAA 3RY8A 5F4JA 3D26A 5F4MA 3PUNA 5J35A 5E6TA 4X07A 4P1VA 4ROXA 3LQEA 3ONUA 3SLNA 3R6JA 4Z4VA 3LQ6A 4X06A 4OPSA 5IYWA 2ZL6A 4P26A 3ASSA 5IYRA 4Z4WA 5HZBA 1IHMA 4Z4TA 2OBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASR A;  4WZE A;  4OOX A;  5F4O A;  4RM0 A;  2ZL5 A;  4X0C A;  4QUZ A;  4RDJ A;  4QVJ A;  2OBT A;  4Z4R A;  3Q38 A;  3PA1 A;  3PUM A;  4OPV A;  4X7F A;  3ASQ A;  4X7E A;  4OPO A;  4X7D A;  3Q6Q A;  5IYN A;  4RLZ A;  5IYQ A;  4Z4Y A;  4P25 A;  5J3O A;  3PVD A;  5BSY A;  3BQJ A;  3ONY A;  5KW9 A;  4WZK A;  4RDK A;  4P2N A;  3ASP A;  3Q6R A;  4RPD A;  4Z4Z A;  4P12 A;  5HZA A;  4Z4S A;  4RPB A;  2ZL7 A;  5BSX A;  4X7C A;  3AST A;  3SKB A;  5IYP A;  4OP7 A;  4WZT A;  4QV2 A;  3SJP A;  4WZL A;  3SLD A;  4P3I A;  4RDL A;  4Z4U A;  3BY1 A;  2OBR A;  3Q39 A;  4X05 A;  3R6K A;  4OOS A;  3SEJ A;  4OOV A;  3PA2 A;  3Q3A A;  3V7A A;  3BY2 A;  4QVA A;  3RY8 A;  5F4J A;  3D26 A;  5F4M A;  3PUN A;  5J35 A;  5E6T A;  4X07 A;  4P1V A;  4ROX A;  3LQE A;  3ONU A;  3SLN A;  3R6J A;  4Z4V A;  3LQ6 A;  4X06 A;  4OPS A;  5IYW A;  2ZL6 A;  4P26 A;  3ASS A;  5IYR A;  4Z4W A;  5HZB A;  1IHM A;  4Z4T A;  2OBS A; 
#chains in the Genus database with same CATH topology
 2VBV A;  3W2E A;  1QH0 A;  4RCZ A;  2PLF A;  4RD1 A;  3CMA B;  1R5O A;  3G6E B;  1QUE A;  2BM0 A;  4RM0 A;  1PJ6 A;  4MYT A;  4G1V A;  4QUZ A;  2DY1 A;  4QVJ A;  5DSZ A;  2BPO A;  2ZXH A;  1JA0 A;  1YX2 A;  3OOC A;  3OE7 A;  2XNJ A;  4OPV A;  3WXM A;  3ASQ A;  1WOP A;  2OTL B;  1JJ2 B;  4N3N A;  2C4U A;  2QN6 A;  3Q6Q A;  2JJ1 A;  1QFJ A;  2V7Q A;  5IYQ A;  1E79 A;  4BPR A;  4Z4Y A;  3CTA A;  3QE2 A;  1KJZ A;  3JQP A;  1WOS A;  2WZP P;  3WNB A;  2ZTN A;  2GJK A;  2QTL A;  3PEN A;  4HE6 A;  2JIZ A;  2GK7 A;  2QGG A;  2C77 A;  3CCQ B;  1SKQ A;  1GAQ A;  2ZZG A;  2WYR A;  3OFN A;  2Z6B D;  3CCE B;  4RCY A;  2E1R A;  2J7K A;  3BC9 A;  5BSY A;  4YAW A;  4B4D A;  1R5N A;  3U2Q A;  2VNJ A;  1BJK A;  4ZCI A;  3LNN A;  4RD6 A;  4UZU A;  4WZK A;  2XNC A;  1HA3 A;  4ZCM A;  3WY9 A;  3GVK A;  4P2N A;  1M1K D;  3CB4 A;  1IHM A;  3U6K A;  2DIE A;  5L46 A;  4P12 A;  1KD1 D;  4Z4S A;  2VBT A;  1H42 A;  3CME B;  2OTJ B;  1YJN B;  4PC1 A;  5BSX A;  3OKX A;  3LVB A;  4G7X A;  3SKB A;  4Y7C A;  5IYP A;  1BX1 A;  1FNB A;  4XMY A;  1VLO A;  5A88 A;  1IB0 A;  3MMP A;  2RC6 A;  1PJ7 A;  1N0V C;  2WZN A;  3SJP A;  3OW2 B;  2VYQ A;  2DEU A;  5FO0 A;  1NB9 A;  2CK3 A;  1J9Z A;  3FKS A;  4ASU A;  1Q7Y D;  3AVU A;  2C5H A;  4ZV4 A;  1N08 A;  1VQ8 B;  2GPJ A;  2DET A;  2RC5 A;  2YWH A;  4P3Y A;  4AVZ A;  3Q39 A;  4J0Q A;  3GVJ A;  2X6X A;  1QVF B;  3R6K A;  4OOS A;  1V0E A;  1G7C A;  1SM4 A;  2LZJ A;  2VNI A;  3Q3A A;  4TMV A;  1UD6 A;  1T5E A;  3JQR A;  3CXC B;  3W2I A;  3WBK A;  4L8J A;  4XLE A;  1VQ7 B;  5F4M A;  4QFM A;  3CCJ B;  5J35 A;  4X07 A;  2AHO A;  2Q6K A;  3ZUG A;  1VQ4 B;  1W2B B;  2W6I A;  3GIR A;  4P1V A;  5CDF A;  1M90 D;  1VQP B;  3QFR A;  2EFG A;  2VJI A;  3OEH A;  4TMX A;  4WWV A;  4YAL A;  3LQ6 A;  2BV3 A;  1EWY A;  1T6X A;  5IYW A;  2P3M A;  2JJ2 A;  2X85 A;  1TTT A;  3WND A;  2YWG A;  4ZCL A;  5IYR A;  4LBW A;  4PC3 A;  3GSI A;  5HZB A;  3B82 A;  1YLO A;  3B8H A;  2I1L A;  2YWE A;  3P27 A;  1A8P A;  2XZO A;  3ASR A;  2WJY A;  5FL7 A;  2B7B A;  4OOX A;  1W87 A;  4B3G A;  2FX3 A;  1FX0 A;  5GV7 A;  2ZL5 A;  1OGI A;  3G05 A;  3W2H A;  1P4M A;  3W2G A;  2ZXI A;  4E0F A;  3PUM A;  4P9S A;  1FNM A;  4RD0 A;  3U6B A;  4Y9R A;  4LBZ A;  1EP2 B;  2V31 A;  4YAF A;  4XOT A;  1BPL A;  2ZZQ A;  4X7D A;  3ZIA A;  4RLZ A;  3OW7 A;  2HCJ B;  1AIP A;  1NB0 A;  1E63 A;  4PGO A;  4XLC A;  3ZBT A;  4RD3 A;  4YEL A;  4F7D A;  3CCL B;  2HDN B;  1Q82 D;  3B78 A;  4ACB A;  1F20 A;  3CCS B;  1XFO A;  3CPX A;  3QFT A;  2BVN A;  1ZUN B;  5A89 A;  4G6I A;  5KW9 A;  4RDK A;  2D74 A;  3ZBU A;  5AN9 A;  3CP8 A;  1E43 A;  3H94 A;  1NJI D;  5H59 A;  4P22 A;  2BSA A;  3ASP A;  3Q6R A;  1VQN B;  4Z4Z A;  2X6Y A;  3NE5 B;  1MRZ A;  4N3G A;  1EFU A;  3E1Y E;  1HVX A;  4M1K A;  4NNJ A;  1YI2 B;  3VR6 A;  1FRQ A;  3QSY A;  1G7T A;  1KK1 A;  1FRN A;  1UD2 A;  4JMQ A;  3AVX A;  2NPF A;  2WPD A;  1QFZ A;  1F60 A;  4QV2 A;  2M5S A;  1E62 A;  1BLI A;  3G71 B;  1E64 A;  1GR1 A;  5TR9 A;  1GAW A;  5KNL A;  4DK1 A;  3WYA A;  4LBV A;  1JNY A;  1W35 A;  4M4S A;  1WSV A;  1DDG A;  4B3X A;  1KMH A;  3BH4 A;  2JN9 A;  3CC7 B;  2VNH A;  3ZZ0 A;  2OK7 A;  1S72 B;  4DNR B;  3T53 B;  3JU4 A;  2B7C A;  1QX4 A;  4QHY A;  4ACA A;  3SEJ A;  1YJW B;  4FN5 A;  4OOV A;  4XLF A;  2DOG A;  3AGP A;  1H8H A;  2V7U A;  3V7A A;  1G7R A;  4WQM A;  5DN6 A;  3RY8 A;  3ES9 A;  3OP1 A;  4HIZ A;  5H5J A;  1KK2 A;  1EFC A;  2D9R A;  1K28 D;  2X0K A;  1JB9 A;  4YEJ A;  3DDY A;  3LQE A;  2X53 S;  1S0U A;  3ONU A;  4M2L A;  3A8I A;  5HXB A;  1VQM B;  3QFS A;  3VNU A;  4XN0 A;  1YJ9 B;  4X06 A;  1VF7 A;  3AVW A;  1KRH A;  1VQ5 B;  4FXU A;  1I7P A;  5DS0 A;  1I18 A;  4AF6 A;  1VJS A;  2QMU A;  3CCU B;  2CW5 A;  3A8K A;  4Z4T A;  3KL9 A;  2ZTG A;  3OZW A;  2OBS A;  3VO2 A;  3ZZT A;  2R9V A;  3LO8 A;  1GO2 A;  3W5V A;  1D1N A;  4XN3 A;  4WZE A;  2GRE A;  1T6Y A;  1QVG B;  3W2F A;  1OB0 A;  4RDJ A;  1PKV A;  4B3F X;  3CD6 B;  1GVH A;  1OGJ A;  4Z4R A;  3PA1 A;  4NBS A;  1VQO B;  1KTV A;  1UD5 A;  4R71 A;  4X7E A;  3CCM B;  2V7W A;  1N0U A;  1YHQ B;  2XOK A;  5TY0 A;  4C0S A;  1KK3 A;  1Q86 D;  1TVC A;  1KK0 A;  2XZP A;  4LC0 A;  1W34 A;  2QEX B;  2F4N A;  2ZIT A;  1VQ6 B;  1W9X A;  1VQ9 B;  1UD3 A;  1ELO A;  1PJ5 A;  3WNC A;  3I55 B;  3PVD A;  3A1P A;  1KZL A;  4YHB A;  1OB5 A;  1ZM2 A;  2GJP A;  1H85 A;  1QUF A;  1NBM A;  3VMF A;  4B44 A;  5B6I A;  1FNC A;  4PAB A;  3ZZU A;  1V0F A;  1KQS B;  4M0L A;  4XQF A;  3AVY A;  3A3G A;  1W0K A;  4DNT B;  4RJL A;  1T6Z A;  3MCA A;  3FPP A;  3GQB A;  5EMN A;  2OK8 A;  4Z1M A;  1E1R A;  1W0J A;  4X7C A;  2WSS A;  2C5B A;  4TMT A;  1D2E A;  3AST A;  4B48 A;  2XEX A;  1WTH D;  4G5G A;  1DAR A;  1FND A;  2D3N A;  2YWF A;  1G7S A;  2Q6I A;  2ZZF A;  4OP7 A;  3AVT A;  2VZL A;  2VJJ A;  4TSF A;  2CF4 A;  4G1B A;  1Q9S A;  1ZM4 A;  3P26 A;  4TMW A;  2V7T A;  4WZL A;  1N07 A;  4PC2 A;  2QDX A;  4P3I A;  3SLD A;  2XZL A;  1RQR A;  4X8I A;  3BY1 A;  4XOP A;  2CRV A;  4EH1 A;  3AVV A;  1BX0 A;  3GVL A;  4DK0 A;  2PIA A;  1K9M D;  2HMA A;  1VHE A;  2BF4 A;  4CQJ A;  3V76 A;  1Q81 D;  4P6V F;  3PA2 A;  4TKO B;  3CRZ A;  1XE1 A;  3BY2 A;  1IJE A;  3BCF A;  1V5V A;  3H9N A;  2OYN A;  2VBU A;  5F4J A;  1WP6 A;  3A3B A;  3PUN A;  4PC7 A;  3G4S B;  1CNF A;  5E6T A;  1OHH A;  3CCR B;  3FJO A;  4ROX A;  5A8A A;  1QGZ A;  2BGI A;  2PE3 A;  1DDI A;  3MHP A;  4ZGN B;  3SLN A;  2C2W A;  1B2R A;  2KVO A;  3CES A;  1D8T A;  3R6J A;  4Z4V A;  1K73 D;  3OJX A;  1Y0Y A;  3FPK A;  2ZL6 A;  1CQX A;  1EP3 B;  1UD8 A;  1WDT A;  2E1B A;  1E1Q A;  5FNZ A;  1WSR A;  2DYI A;  2Q6L A;  4Z4W A;  3OZU A;  3OEE A;  1CNE A;  4XNF A;  1GJR A;  1OB2 A;  2X6W A;  4RD2 A;  1MAB A;  2BMW A;  3BCD A;  3OZV A;  4NCN A;  4B47 A;  4U9U A;  1EFR A;  2FVG A;  4K1X A;  5FIU A;  2CBX A;  2JDI A;  2XND A;  3QFC A;  3T51 B;  1YIT B;  4DQK A;  4XKV A;  5F4O A;  4UAJ A;  4G7W A;  1WOO A;  4X0C A;  1N8R D;  2BN4 A;  2OBT A;  3OPO A;  1EP1 B;  3CMM A;  3Q38 A;  1VLY A;  2C4T A;  4X7F A;  1QFY A;  1XB2 A;  1N06 A;  2HLD A;  3CC4 B;  4OPO A;  5IYN A;  4KKT A;  4FWT A;  2GQF A;  2GJR A;  2XGJ A;  4XON A;  1SKY B;  2BM1 A;  3VO1 A;  1JA1 A;  2V7V A;  3I1F A;  3W5U A;  4B43 A;  3CC2 B;  4MYU A;  1FDR A;  2V4D A;  5FO1 A;  2VBS A;  4XOR A;  4TMZ A;  4TT3 A;  4P25 A;  2QA4 B;  5J3O A;  1EFT A;  4IW3 B;  4XKW A;  1VHO A;  5FA6 A;  4RD4 A;  2WJV A;  4AF7 A;  4HE5 A;  1YIJ B;  2EIX A;  1VQL B;  3KEW A;  1H8E A;  1HZE A;  3SJZ A;  3BQJ A;  3ONY A;  1COW A;  4YAU A;  4II2 A;  1IJF A;  3JQQ A;  2NV4 A;  1UMK A;  5THX A;  2CC2 A;  5TRD A;  4RPD A;  3CPW B;  2Q6O A;  4XR6 A;  5HZA A;  3WBJ A;  3OAA A;  4LBY A;  1RQP A;  4RPB A;  4AC9 A;  1R5B A;  2DCU A;  2ZL7 A;  1N05 A;  4Y9U A;  4DQL A;  3J81 k;  3ZC3 A;  1NDH A;  2GK6 A;  4UZF A;  3BNW A;  4KKS A;  5TV2 A;  1AMO A;  1ZM3 A;  5IK2 A;  4Q7J B;  1EXM A;  4WZT A;  4YXW A;  2B5O A;  3CW2 A;  5JBQ A;  1E3Z A;  1QGY A;  3ZPN A;  4M53 A;  2QE7 A;  2C78 A;  1S4M A;  1B23 P;  2QTZ A;  2BGJ A;  3CP2 A;  4GQN A;  4ZGQ B;  1QGA A;  3E20 A;  4RDL A;  3T56 B;  4Z4U A;  3OJW A;  5HKK A;  2VNK A;  3HAG A;  2OBR A;  1BQE A;  4X05 A;  1XQB A;  4FK8 A;  1QG0 A;  1WU8 A;  1Y0R A;  2CND A;  4XLA A;  4H9G A;  3A35 A;  4PC6 A;  4P6Y A;  4QVA A;  2WR8 A;  4XLH A;  3CCV B;  1UD4 A;  1U2R A;  2F43 A;  2R6H A;  4II3 A;  3VNV A;  3D26 A;  4YAO A;  2F1L A;  1K8A D;  4XM3 A;  4C43 A;  1WOR A;  1DG1 G;  2V7X A;  1E3X A;  5LMZ A;  2PMD A;  1NRK A;  3A8J A;  4PAA A;  5GV8 A;  4KKU A;  1ZM9 A;  2ZZE A;  2DER A;  1BMF A;  2W6J A;  3AGQ A;  3I56 B;  4TN1 A;  1I8D A;  2ZBU A;  4OPS A;  1TLL A;  1WPC A;  4P26 A;  1VQK B;  3ASS A;  3ISX A;  1TUI A;  2X3U A;  3W5H A;  2X8K A;  4XL9 A;  4UZE A;  5KSW B;  2F1M A;  2D3L A;  4XD7 A;  2ZBV A;  1KC8 D;  3WQZ A; 
#chains in the Genus database with same CATH homology
 3ASR A;  4WZE A;  4OOX A;  5F4O A;  4RM0 A;  2ZL5 A;  4X0C A;  4QUZ A;  4RDJ A;  4QVJ A;  2OBT A;  4Z4R A;  3Q38 A;  3PA1 A;  3PUM A;  4OPV A;  4X7F A;  3ASQ A;  4X7E A;  4OPO A;  4X7D A;  3Q6Q A;  5IYN A;  4RLZ A;  5IYQ A;  4Z4Y A;  4P25 A;  5J3O A;  3PVD A;  5BSY A;  3BQJ A;  3ONY A;  5KW9 A;  4WZK A;  4RDK A;  4P2N A;  3ASP A;  3Q6R A;  4RPD A;  4Z4Z A;  4P12 A;  5HZA A;  4Z4S A;  4RPB A;  2ZL7 A;  5BSX A;  4X7C A;  3AST A;  3SKB A;  5IYP A;  4OP7 A;  4WZT A;  4QV2 A;  3SJP A;  4WZL A;  3SLD A;  4P3I A;  4RDL A;  4Z4U A;  3BY1 A;  2OBR A;  3Q39 A;  4X05 A;  3R6K A;  4OOS A;  3SEJ A;  4OOV A;  3PA2 A;  3Q3A A;  3V7A A;  3BY2 A;  4QVA A;  3RY8 A;  5F4J A;  3D26 A;  5F4M A;  3PUN A;  5J35 A;  5E6T A;  4X07 A;  4P1V A;  4ROX A;  3LQE A;  3ONU A;  3SLN A;  3R6J A;  4Z4V A;  3LQ6 A;  4X06 A;  4OPS A;  5IYW A;  2ZL6 A;  4P26 A;  3ASS A;  5IYR A;  4Z4W A;  5HZB A;  1IHM A;  4Z4T A;  2OBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...