4RDKA

Crystal structure of norovirus boxer p domain in complex with lewis b tetrasaccharide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
297
structure length
293
Chain Sequence
KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGPQTLPINGVFVFISWVSRYYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
source organism Human calicivirus nlv/boxer/2001/us
total genus 70
structure length 293
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdkA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdkA01
4X7EA 2OBSA 3PA1A 4P25A 3SJPA 4RDKA 4P1VA 3ONUA 4OOVA 3BQJA 3ONYA 3R6JA 4X06A 5F4MA 5HZAA 5IYRA 5IYPA 5HZBA 5KW9A 3ASRA 3BY2A 2ZL5A 3D26A 3SLDA 4RDJA 3PVDA 5BSYA 4WZKA 5IYWA 3Q6RA 4RLZA 4Z4ZA 3Q38A 4X7CA 4OOXA 4WZTA 5F4OA 4RDLA 3PUMA 3LQEA 4OP7A 4ROXA 2OBRA 5E6TA 4OPSA 4Z4SA 3SLNA 4RM0A 3ASSA 4X07A 3ASTA 4X0CA 4Z4UA 4X7FA 4Z4TA 5IYNA 5BSXA 3V7AA 4P3IA 4QVAA 4Z4YA 4X05A 4QUZA 4Z4VA 2ZL6A 4Z4RA 3BY1A 4P2NA 4P26A 3PUNA 4Z4WA 3Q39A 2ZL7A 3Q6QA 4X7DA 4QV2A 5J35A 3LQ6A 4RPDA 3R6KA 4OOSA 3PA2A 4WZEA 4OPOA 4OPVA 4P12A 4RPBA 3ASPA 4QVJA 1IHMA 5J3OA 3ASQA 3Q3AA 3SKBA 4WZLA 3RY8A 5F4JA 3SEJA 5IYQA 2OBTA
chains in the Genus database with same CATH superfamily
4TMXA 2GQFA 4X7EA 4BPRA 2OBSA 2ZBVA 4PC6A 3OE7A 4L8JA 3SJPA 4JMQA 4P1VA 4XLEA 1W34A 2HMAA 3ZPNA 1D2EA 1I18A 1KD1D 1PJ7A 1T6YA 2QE7A 1UD4A 1QVFB 2ZXIA 2C5HA 1YX2A 1V0EA 3CRZA 2BVNA 3WBJA 2BN4A 5HZAA 1SKQA 4PC7A 2C78A 3GQBA 4XORA 1MABA 2CW5A 1KMHA 3BY2A 3OZVA 1OGJA 1T6XA 3E1YE 1VQPB 3GVJA 3SLDA 1EWYA 2V4DA 3JQRA 4RDJA 5DSZA 1K8AD 1K73D 1N8RD 5IYWA 4QHYA 3Q38A 1SKYB 1EP1B 4X7CA 4OOXA 1YLOA 5IK2A 1KC8D 1QGAA 1D1NA 3CCQB 1VQ8B 4ZCIA 4RDLA 5FO1A 2HDNB 3PUMA 2XGJA 2ZZEA 2NV4A 3ZZTA 4OP7A 2ZBUA 2C4TA 1CNEA 4XLAA 1TVCA 2Q6IA 3V76A 2JIZA 4Y9UA 5DS0A 1BMFA 3QSYA 3JQQA 2W6IA 2EIXA 4G1BA 2CK3A 4XR6A 4DNTB 4U9UA 4KKTA 3T51B 2CRVA 3CPWB 1YHQB 4Z4SA 3CPXA 3J81k 1F60A 2BSAA 1BX0A 4P6YA 3QE2A 3OZUA 2E1BA 1FNBA 3QFTA 4XN0A 1N05A 4N3GA 2XOKA 3VR6A 4TSFA 3VNUA 3QFCA 1FNDA 1GO2A 5BSXA 2GK6A 3V7AA 1T6ZA 4B47A 4LBYA 5KNLA 1FRNA 1H42A 2GPJA 2QTZA 3W2EA 4Z4YA 3I56B 1OB0A 2B7CA 4X05A 3W5HA 3GVKA 2HCJB 2BV3A 1OHHA 4P6VF 3AGPA 4F7DA 2V7TA 4AC9A 2X6WA 4AF7A 2RC5A 1B23P 1JB9A 1MRZA 4B3XA 2DYIA 1AIPA 2GREA 4X7DA 2F1LA 3U6KA 1VQNB 2XNDA 4RD3A 3GSIA 4IW3B 1YJWB 4XN3A 3CCJB 2VBSA 3LQ6A 1EP2B 2PLFA 3PA2A 1N07A 1H85A 2LZJA 4WZEA 4RD1A 1QGYA 4OPVA 5LMZA 3ZUGA 5H59A 3T56B 1BPLA 2WJYA 3CCSB 1GAWA 2X8KA 1OB2A 1PKVA 2DETA 4RD2A 1HA3A 4H9GA 1VQ6B 1ZM2A 5FO0A 1WDTA 1B2RA 1M90D 3Q3AA 4GQNA 4NNJA 4DQKA 4FN5A 1JJ2B 2BPOA 3AVXA 1N08A 1W0KA 1WOOA 1E3XA 3QFRA 5GV8A 2ZZFA 1QUFA 2D9RA 2C2WA 2B5OA 5JBQA 4G5GA 2ZTNA 4RDKA 1KK3A 3OJXA 3OKXA 4XMYA 1E1RA 4HE5A 4YAUA 2V7VA 4DNRB 2CNDA 4DK0A 4KKSA 3A8JA 4KKUA 1P4MA 2BGJA 2BMWA 2GK7A 3R6JA 2V31A 2DIEA 4XNFA 1G7RA 4G7XA 5IYRA 1YIJB 3CP2A 1QH0A 1FRQA 3BC9A 1NRKA 4B3GA 1DG1G 3D26A 3FJOA 1ELOA 1EFRA 2D3NA 2ZTGA 4ACAA 4WQMA 4RLZA 1NJID 3H9NA 4G7WA 2F43A 2XNCA 4AF6A 2VNIA 1EXMA 1WPCA 2YWHA 2GJPA 5FA6A 4XL9A 1VHOA 3CC4B 5L46A 3AVWA 3OJWA 1NBMA 3DDYA 1VQMB 4K1XA 2OBRA 1KK0A 1ZM4A 1S0UA 4LC0A 1JNYA 4C43A 4EH1A 1KTVA 1HZEA 3WY9A 3CC7B 3OOCA 3ZZ0A 3LVBA 1I8DA 1SM4A 4G1VA 4RM0A 4X07A 4YHBA 1G7SA 4ZGNB 1EP3B 1N0VC 2W6JA 4FK8A 4E0FA 2V7XA 1ZM3A 3A8IA 2PE3A 4P3IA 2C4UA 5TRDA 3G6EB 3I55B 2AHOA 2JJ1A 3LO8A 1NDHA 2Q6LA 3CMEB 1D8TA 4NCNA 4Z4VA 1A8PA 2ZL6A 3AVTA 1OB5A 4UZFA 4P2NA 2RC6A 4G6IA 4YAFA 1W87A 2VBVA 1DARA 2D3LA 3PUNA 2V7QA 2OTLB 2DOGA 4M0LA 3I1FA 3ZC3A 2VJJA 1WP6A 4R71A 1Q82D 1YJNB 1EFUA 1H8HA 2WZNA 1CNFA 4RD6A 5FL7A 1K28D 3VO2A 3CC2B 3QFSA 3R6KA 4RD4A 3WXMA 2BGIA 3B8HA 3BNWA 3FKSA 3A8KA 4HE6A 2WR8A 1JA1A 2Q6OA 1DDIA 1UD5A 3P27A 1W9XA 4MYTA 5FIUA 4C0SA 4P12A 1E63A 1KZLA 2F1MA 4DK1A 2X53S 4AVZA 3OW2B 1QGZA 2ZZGA 3ASPA 3BCFA 2V7WA 5TV2A 1IHMA 3CCLB 1WSVA 5FNZA 4Z1MA 1N0UA 1QFYA 1R5BA 1UD8A 1TUIA 2VJIA 1E3ZA 3RY8A 4QFMA 2Z6BD 5HXBA 5CDFA 5F4JA 1VQ4B 1QFZA 1Q9SA 5TR9A 1VQ9B 1IJFA 3WNCA 1E79A 1NB0A 2QDXA 3AVYA 2PMDA 2DERA 4PC3A 1GVHA 1QFJA 1KRHA 2DCUA 4CQJA 4LBVA 3ISXA 3JQPA 3OAAA 1V5VA 1VJSA 1U2RA 3W2IA 3NE5B 3WYAA 4X06A 5GV7A 2GJKA 1R5OA 4XONA 3OP1A 2B7BA 3W2FA 5HZBA 2JN9A 2V7UA 2VBTA 1S72B 3CCMB 3ASRA 2QMUA 1VHEA 2ZL5A 3AGQA 1UD3A 3U2QA 3OPOA 1QX4A 1T5EA 4II3A 4XD7A 4DQLA 1W2BB 1KK1A 4UAJA 4WZKA 3CTAA 1XE1A 3A35A 1VQKB 3T53B 4M2LA 2QA4B 4YEJA 3A1PA 3B78A 2HLDA 4WZTA 5HKKA 5F4OA 2CBXA 4XM3A 2P3MA 2VBUA 4HIZA 4YAWA 1YJ9B 4FXUA 4M4SA 3P26A 1VLOA 5EMNA 1QVGB 4YXWA 2J7KA 3MCAA 5THXA 4PC1A 4PGOA 4P9SA 3WBKA 1W35A 4XLCA 1KQSB 2WZPP 3FPPA 2ZXHA 3ASSA 2C77A 1COWA 2ZZQA 4Y7CA 2ZITA 1AMOA 3CW2A 4Z4UA 5A88A 3ZIAA 4Z4TA 4ZGQB 1PJ5A 1IB0A 2OK8A 2NPFA 1Q7YD 1J9ZA 3OEHA 4QVAA 1WOSA 2CC2A 4LBZA 3AVVA 4N3NA 2YWFA 2M5SA 4QUZA 2DEUA 3BY1A 5TY0A 2DY1A 2XNJA 3GVLA 4XOTA 1BLIA 1EFCA 2Q6KA 4WWVA 1RQRA 4Z4WA 2R9VA 2WJVA 3Q6QA 1IJEA 2VZLA 1OGIA 4QV2A 1BX1A 4ZCMA 3MMPA 4TN1A 1Q86D 1WTHD 3WNBA 1FDRA 2D74A 1UD6A 4TMVA 1UD2A 1EFTA 1GAQA 4PC2A 3HAGA 4P22A 4OPOA 4J0QA 4II2A 3CXCB 1VLYA 1TTTA 2F4NA 2PIAA 3KL9A 2X6YA 4PABA 4RPBA 4RCZA 4XLFA 2JJ2A 1VF7A 4QVJA 4TMZA 3CCEB 3GIRA 5J3OA 4XKVA 2XZLA 3ASQA 2YWGA 3SKBA 2WPDA 4RJLA 4WZLA 4YELA 4P3YA 3ES9A 2X85A 4LBWA 5IYQA 2BM1A 4YALA 1TLLA 4M1KA 3JU4A 3CESA 3PA1A 4P25A 4B3FX 3U6BA 1NB9A 1S4MA 3A3BA 3W5VA 3VO1A 4RD0A 3CCUB 1WSRA 3ONUA 1RQPA 2FX3A 2X6XA 4OOVA 5A89A 4ZV4A 1G7TA 1E43A 3BQJA 1K9MD 2WSSA 4B44A 3ONYA 1FX0A 4XKWA 2VYQA 5F4MA 4B4DA 3B82A 4TMTA 1FNCA 5IYPA 2FVGA 3VMFA 5KW9A 1XQBA 5B6IA 1CQXA 3WQZA 3G4SB 2VNHA 1QUEA 3PVDA 4TT3A 5BSYA 3CMAB 1BJKA 3KEWA 3Q6RA 2XEXA 1YITB 4Q7JB 1E62A 4Z4ZA 1XFOA 2WYRA 4Y9RA 3CP8A 4TKOB 1PJ6A 2C5BA 2QTLA 2VNJA 4XQFA 3LQEA 1JA0A 1Y0RA 5A8AA 1KK2A 1QG0A 2QEXB 1VQOB 4ROXA 4B43A 5E6TA 1VQ7B 4OPSA 1XB2A 3CD6B 2XZPA 4UZUA 4RCYA 4ZCLA 3SJZA 1GR1A 3OZWA 1Y0YA 4YAOA 1HVXA 2OK7A 2QN6A 2YWEA 3SLNA 3LNNA 3PENA 3ASTA 4ACBA 3G71B 3OFNA 4PAAA 4ASUA 4FWTA 4X0CA 5DN6A 1DDGA 3A3GA 5H5JA 4X7FA 1M1KD 1N06A 5IYNA 3W2GA 4XOPA 4X8IA 3AVUA 1F20A 2CF4A 1VQ5B 1KJZA 1V0FA 2X3UA 4TMWA 2JDIA 1R5NA 1Q81D 1I7PA 4Z4RA 4NBSA 3WNDA 3OW7A 1GJRA 1WU8A 1YI2B 1FNMA 3BCDA 2KVOA 2VNKA 4P26A 1WORA 3W2HA 3VNVA 1WOPA 2X0KA 1E64A 3Q39A 2EFGA 2I1LA 2XZOA 2ZL7A 2OTJB 5KSWB 1G7CA 2BM0A 3G05A 3W5UA 3ZZUA 4XLHA 3E20A 1W0JA 3MHPA 5J35A 3BH4A 4RPDA 3FPKA 2GJRA 4OOSA 3CCRB 5AN9A 2OYNA 1E1QA 3OEEA 3CCVB 1BQEA 1VQLB 1UMKA 2BF4A 3ZBUA 1ZUNB 3CB4A 4MYUA 3ZBTA 2R6HA 4UZEA 1ZM9A 2QGGA 4M53A 3H94A 3SEJA 4B48A 2OBTA 1H8EA 3CMMA 2E1RA
chains in the Genus database with same CATH topology
4X7EA 2OBSA 3PA1A 4P25A 3SJPA 4RDKA 4P1VA 3ONUA 4OOVA 3BQJA 3ONYA 3R6JA 4X06A 5F4MA 5HZAA 5IYRA 5IYPA 5HZBA 5KW9A 3ASRA 3BY2A 2ZL5A 3D26A 3SLDA 4RDJA 3PVDA 5BSYA 4WZKA 5IYWA 3Q6RA 4RLZA 4Z4ZA 3Q38A 4X7CA 4OOXA 4WZTA 5F4OA 4RDLA 3PUMA 3LQEA 4OP7A 4ROXA 2OBRA 5E6TA 4OPSA 4Z4SA 3SLNA 4RM0A 3ASSA 4X07A 3ASTA 4X0CA 4Z4UA 4X7FA 4Z4TA 5IYNA 5BSXA 3V7AA 4P3IA 4QVAA 4Z4YA 4X05A 4QUZA 4Z4VA 2ZL6A 4Z4RA 3BY1A 4P2NA 4P26A 3PUNA 4Z4WA 3Q39A 2ZL7A 3Q6QA 4X7DA 4QV2A 5J35A 3LQ6A 4RPDA 3R6KA 4OOSA 3PA2A 4WZEA 4OPOA 4OPVA 4P12A 4RPBA 3ASPA 4QVJA 1IHMA 5J3OA 3ASQA 3Q3AA 3SKBA 4WZLA 3RY8A 5F4JA 3SEJA 5IYQA 2OBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X7E A;  2OBS A;  3PA1 A;  4P25 A;  3SJP A;  4RDK A;  4P1V A;  3ONU A;  4OOV A;  3BQJ A;  3ONY A;  3R6J A;  4X06 A;  5F4M A;  5HZA A;  5IYR A;  5IYP A;  5HZB A;  5KW9 A;  3ASR A;  3BY2 A;  2ZL5 A;  3D26 A;  3SLD A;  4RDJ A;  3PVD A;  5BSY A;  4WZK A;  5IYW A;  3Q6R A;  4RLZ A;  4Z4Z A;  3Q38 A;  4X7C A;  4OOX A;  4WZT A;  5F4O A;  4RDL A;  3PUM A;  3LQE A;  4OP7 A;  4ROX A;  2OBR A;  5E6T A;  4OPS A;  4Z4S A;  3SLN A;  4RM0 A;  3ASS A;  4X07 A;  3AST A;  4X0C A;  4Z4U A;  4X7F A;  4Z4T A;  5IYN A;  5BSX A;  3V7A A;  4P3I A;  4QVA A;  4Z4Y A;  4X05 A;  4QUZ A;  4Z4V A;  2ZL6 A;  4Z4R A;  3BY1 A;  4P2N A;  4P26 A;  3PUN A;  4Z4W A;  3Q39 A;  2ZL7 A;  3Q6Q A;  4X7D A;  4QV2 A;  5J35 A;  3LQ6 A;  4RPD A;  3R6K A;  4OOS A;  3PA2 A;  4WZE A;  4OPO A;  4OPV A;  4P12 A;  4RPB A;  3ASP A;  4QVJ A;  1IHM A;  5J3O A;  3ASQ A;  3Q3A A;  3SKB A;  4WZL A;  3RY8 A;  5F4J A;  3SEJ A;  5IYQ A;  2OBT A; 
#chains in the Genus database with same CATH topology
 4TMX A;  2GQF A;  4X7E A;  4BPR A;  2OBS A;  2ZBV A;  4PC6 A;  3OE7 A;  4L8J A;  3SJP A;  4JMQ A;  4P1V A;  4XLE A;  1W34 A;  2HMA A;  3ZPN A;  1D2E A;  1I18 A;  1KD1 D;  1PJ7 A;  1T6Y A;  2QE7 A;  1UD4 A;  1QVF B;  2ZXI A;  2C5H A;  1YX2 A;  1V0E A;  3CRZ A;  2BVN A;  3WBJ A;  2BN4 A;  5HZA A;  1SKQ A;  4PC7 A;  2C78 A;  3GQB A;  4XOR A;  1MAB A;  2CW5 A;  1KMH A;  3BY2 A;  3OZV A;  1OGJ A;  1T6X A;  3E1Y E;  1VQP B;  3GVJ A;  3SLD A;  1EWY A;  2V4D A;  3JQR A;  4RDJ A;  5DSZ A;  1K8A D;  1K73 D;  1N8R D;  5IYW A;  4QHY A;  3Q38 A;  1SKY B;  1EP1 B;  4X7C A;  4OOX A;  1YLO A;  5IK2 A;  1KC8 D;  1QGA A;  1D1N A;  3CCQ B;  1VQ8 B;  4ZCI A;  4RDL A;  5FO1 A;  2HDN B;  3PUM A;  2XGJ A;  2ZZE A;  2NV4 A;  3ZZT A;  4OP7 A;  2ZBU A;  2C4T A;  1CNE A;  4XLA A;  1TVC A;  2Q6I A;  3V76 A;  2JIZ A;  4Y9U A;  5DS0 A;  1BMF A;  3QSY A;  3JQQ A;  2W6I A;  2EIX A;  4G1B A;  2CK3 A;  4XR6 A;  4DNT B;  4U9U A;  4KKT A;  3T51 B;  2CRV A;  3CPW B;  1YHQ B;  4Z4S A;  3CPX A;  3J81 k;  1F60 A;  2BSA A;  1BX0 A;  4P6Y A;  3QE2 A;  3OZU A;  2E1B A;  1FNB A;  3QFT A;  4XN0 A;  1N05 A;  4N3G A;  2XOK A;  3VR6 A;  4TSF A;  3VNU A;  3QFC A;  1FND A;  1GO2 A;  5BSX A;  2GK6 A;  3V7A A;  1T6Z A;  4B47 A;  4LBY A;  5KNL A;  1FRN A;  1H42 A;  2GPJ A;  2QTZ A;  3W2E A;  4Z4Y A;  3I56 B;  1OB0 A;  2B7C A;  4X05 A;  3W5H A;  3GVK A;  2HCJ B;  2BV3 A;  1OHH A;  4P6V F;  3AGP A;  4F7D A;  2V7T A;  4AC9 A;  2X6W A;  4AF7 A;  2RC5 A;  1B23 P;  1JB9 A;  1MRZ A;  4B3X A;  2DYI A;  1AIP A;  2GRE A;  4X7D A;  2F1L A;  3U6K A;  1VQN B;  2XND A;  4RD3 A;  3GSI A;  4IW3 B;  1YJW B;  4XN3 A;  3CCJ B;  2VBS A;  3LQ6 A;  1EP2 B;  2PLF A;  3PA2 A;  1N07 A;  1H85 A;  2LZJ A;  4WZE A;  4RD1 A;  1QGY A;  4OPV A;  5LMZ A;  3ZUG A;  5H59 A;  3T56 B;  1BPL A;  2WJY A;  3CCS B;  1GAW A;  2X8K A;  1OB2 A;  1PKV A;  2DET A;  4RD2 A;  1HA3 A;  4H9G A;  1VQ6 B;  1ZM2 A;  5FO0 A;  1WDT A;  1B2R A;  1M90 D;  3Q3A A;  4GQN A;  4NNJ A;  4DQK A;  4FN5 A;  1JJ2 B;  2BPO A;  3AVX A;  1N08 A;  1W0K A;  1WOO A;  1E3X A;  3QFR A;  5GV8 A;  2ZZF A;  1QUF A;  2D9R A;  2C2W A;  2B5O A;  5JBQ A;  4G5G A;  2ZTN A;  4RDK A;  1KK3 A;  3OJX A;  3OKX A;  4XMY A;  1E1R A;  4HE5 A;  4YAU A;  2V7V A;  4DNR B;  2CND A;  4DK0 A;  4KKS A;  3A8J A;  4KKU A;  1P4M A;  2BGJ A;  2BMW A;  2GK7 A;  3R6J A;  2V31 A;  2DIE A;  4XNF A;  1G7R A;  4G7X A;  5IYR A;  1YIJ B;  3CP2 A;  1QH0 A;  1FRQ A;  3BC9 A;  1NRK A;  4B3G A;  1DG1 G;  3D26 A;  3FJO A;  1ELO A;  1EFR A;  2D3N A;  2ZTG A;  4ACA A;  4WQM A;  4RLZ A;  1NJI D;  3H9N A;  4G7W A;  2F43 A;  2XNC A;  4AF6 A;  2VNI A;  1EXM A;  1WPC A;  2YWH A;  2GJP A;  5FA6 A;  4XL9 A;  1VHO A;  3CC4 B;  5L46 A;  3AVW A;  3OJW A;  1NBM A;  3DDY A;  1VQM B;  4K1X A;  2OBR A;  1KK0 A;  1ZM4 A;  1S0U A;  4LC0 A;  1JNY A;  4C43 A;  4EH1 A;  1KTV A;  1HZE A;  3WY9 A;  3CC7 B;  3OOC A;  3ZZ0 A;  3LVB A;  1I8D A;  1SM4 A;  4G1V A;  4RM0 A;  4X07 A;  4YHB A;  1G7S A;  4ZGN B;  1EP3 B;  1N0V C;  2W6J A;  4FK8 A;  4E0F A;  2V7X A;  1ZM3 A;  3A8I A;  2PE3 A;  4P3I A;  2C4U A;  5TRD A;  3G6E B;  3I55 B;  2AHO A;  2JJ1 A;  3LO8 A;  1NDH A;  2Q6L A;  3CME B;  1D8T A;  4NCN A;  4Z4V A;  1A8P A;  2ZL6 A;  3AVT A;  1OB5 A;  4UZF A;  4P2N A;  2RC6 A;  4G6I A;  4YAF A;  1W87 A;  2VBV A;  1DAR A;  2D3L A;  3PUN A;  2V7Q A;  2OTL B;  2DOG A;  4M0L A;  3I1F A;  3ZC3 A;  2VJJ A;  1WP6 A;  4R71 A;  1Q82 D;  1YJN B;  1EFU A;  1H8H A;  2WZN A;  1CNF A;  4RD6 A;  5FL7 A;  1K28 D;  3VO2 A;  3CC2 B;  3QFS A;  3R6K A;  4RD4 A;  3WXM A;  2BGI A;  3B8H A;  3BNW A;  3FKS A;  3A8K A;  4HE6 A;  2WR8 A;  1JA1 A;  2Q6O A;  1DDI A;  1UD5 A;  3P27 A;  1W9X A;  4MYT A;  5FIU A;  4C0S A;  4P12 A;  1E63 A;  1KZL A;  2F1M A;  4DK1 A;  2X53 S;  4AVZ A;  3OW2 B;  1QGZ A;  2ZZG A;  3ASP A;  3BCF A;  2V7W A;  5TV2 A;  1IHM A;  3CCL B;  1WSV A;  5FNZ A;  4Z1M A;  1N0U A;  1QFY A;  1R5B A;  1UD8 A;  1TUI A;  2VJI A;  1E3Z A;  3RY8 A;  4QFM A;  2Z6B D;  5HXB A;  5CDF A;  5F4J A;  1VQ4 B;  1QFZ A;  1Q9S A;  5TR9 A;  1VQ9 B;  1IJF A;  3WNC A;  1E79 A;  1NB0 A;  2QDX A;  3AVY A;  2PMD A;  2DER A;  4PC3 A;  1GVH A;  1QFJ A;  1KRH A;  2DCU A;  4CQJ A;  4LBV A;  3ISX A;  3JQP A;  3OAA A;  1V5V A;  1VJS A;  1U2R A;  3W2I A;  3NE5 B;  3WYA A;  4X06 A;  5GV7 A;  2GJK A;  1R5O A;  4XON A;  3OP1 A;  2B7B A;  3W2F A;  5HZB A;  2JN9 A;  2V7U A;  2VBT A;  1S72 B;  3CCM B;  3ASR A;  2QMU A;  1VHE A;  2ZL5 A;  3AGQ A;  1UD3 A;  3U2Q A;  3OPO A;  1QX4 A;  1T5E A;  4II3 A;  4XD7 A;  4DQL A;  1W2B B;  1KK1 A;  4UAJ A;  4WZK A;  3CTA A;  1XE1 A;  3A35 A;  1VQK B;  3T53 B;  4M2L A;  2QA4 B;  4YEJ A;  3A1P A;  3B78 A;  2HLD A;  4WZT A;  5HKK A;  5F4O A;  2CBX A;  4XM3 A;  2P3M A;  2VBU A;  4HIZ A;  4YAW A;  1YJ9 B;  4FXU A;  4M4S A;  3P26 A;  1VLO A;  5EMN A;  1QVG B;  4YXW A;  2J7K A;  3MCA A;  5THX A;  4PC1 A;  4PGO A;  4P9S A;  3WBK A;  1W35 A;  4XLC A;  1KQS B;  2WZP P;  3FPP A;  2ZXH A;  3ASS A;  2C77 A;  1COW A;  2ZZQ A;  4Y7C A;  2ZIT A;  1AMO A;  3CW2 A;  4Z4U A;  5A88 A;  3ZIA A;  4Z4T A;  4ZGQ B;  1PJ5 A;  1IB0 A;  2OK8 A;  2NPF A;  1Q7Y D;  1J9Z A;  3OEH A;  4QVA A;  1WOS A;  2CC2 A;  4LBZ A;  3AVV A;  4N3N A;  2YWF A;  2M5S A;  4QUZ A;  2DEU A;  3BY1 A;  5TY0 A;  2DY1 A;  2XNJ A;  3GVL A;  4XOT A;  1BLI A;  1EFC A;  2Q6K A;  4WWV A;  1RQR A;  4Z4W A;  2R9V A;  2WJV A;  3Q6Q A;  1IJE A;  2VZL A;  1OGI A;  4QV2 A;  1BX1 A;  4ZCM A;  3MMP A;  4TN1 A;  1Q86 D;  1WTH D;  3WNB A;  1FDR A;  2D74 A;  1UD6 A;  4TMV A;  1UD2 A;  1EFT A;  1GAQ A;  4PC2 A;  3HAG A;  4P22 A;  4OPO A;  4J0Q A;  4II2 A;  3CXC B;  1VLY A;  1TTT A;  2F4N A;  2PIA A;  3KL9 A;  2X6Y A;  4PAB A;  4RPB A;  4RCZ A;  4XLF A;  2JJ2 A;  1VF7 A;  4QVJ A;  4TMZ A;  3CCE B;  3GIR A;  5J3O A;  4XKV A;  2XZL A;  3ASQ A;  2YWG A;  3SKB A;  2WPD A;  4RJL A;  4WZL A;  4YEL A;  4P3Y A;  3ES9 A;  2X85 A;  4LBW A;  5IYQ A;  2BM1 A;  4YAL A;  1TLL A;  4M1K A;  3JU4 A;  3CES A;  3PA1 A;  4P25 A;  4B3F X;  3U6B A;  1NB9 A;  1S4M A;  3A3B A;  3W5V A;  3VO1 A;  4RD0 A;  3CCU B;  1WSR A;  3ONU A;  1RQP A;  2FX3 A;  2X6X A;  4OOV A;  5A89 A;  4ZV4 A;  1G7T A;  1E43 A;  3BQJ A;  1K9M D;  2WSS A;  4B44 A;  3ONY A;  1FX0 A;  4XKW A;  2VYQ A;  5F4M A;  4B4D A;  3B82 A;  4TMT A;  1FNC A;  5IYP A;  2FVG A;  3VMF A;  5KW9 A;  1XQB A;  5B6I A;  1CQX A;  3WQZ A;  3G4S B;  2VNH A;  1QUE A;  3PVD A;  4TT3 A;  5BSY A;  3CMA B;  1BJK A;  3KEW A;  3Q6R A;  2XEX A;  1YIT B;  4Q7J B;  1E62 A;  4Z4Z A;  1XFO A;  2WYR A;  4Y9R A;  3CP8 A;  4TKO B;  1PJ6 A;  2C5B A;  2QTL A;  2VNJ A;  4XQF A;  3LQE A;  1JA0 A;  1Y0R A;  5A8A A;  1KK2 A;  1QG0 A;  2QEX B;  1VQO B;  4ROX A;  4B43 A;  5E6T A;  1VQ7 B;  4OPS A;  1XB2 A;  3CD6 B;  2XZP A;  4UZU A;  4RCY A;  4ZCL A;  3SJZ A;  1GR1 A;  3OZW A;  1Y0Y A;  4YAO A;  1HVX A;  2OK7 A;  2QN6 A;  2YWE A;  3SLN A;  3LNN A;  3PEN A;  3AST A;  4ACB A;  3G71 B;  3OFN A;  4PAA A;  4ASU A;  4FWT A;  4X0C A;  5DN6 A;  1DDG A;  3A3G A;  5H5J A;  4X7F A;  1M1K D;  1N06 A;  5IYN A;  3W2G A;  4XOP A;  4X8I A;  3AVU A;  1F20 A;  2CF4 A;  1VQ5 B;  1KJZ A;  1V0F A;  2X3U A;  4TMW A;  2JDI A;  1R5N A;  1Q81 D;  1I7P A;  4Z4R A;  4NBS A;  3WND A;  3OW7 A;  1GJR A;  1WU8 A;  1YI2 B;  1FNM A;  3BCD A;  2KVO A;  2VNK A;  4P26 A;  1WOR A;  3W2H A;  3VNV A;  1WOP A;  2X0K A;  1E64 A;  3Q39 A;  2EFG A;  2I1L A;  2XZO A;  2ZL7 A;  2OTJ B;  5KSW B;  1G7C A;  2BM0 A;  3G05 A;  3W5U A;  3ZZU A;  4XLH A;  3E20 A;  1W0J A;  3MHP A;  5J35 A;  3BH4 A;  4RPD A;  3FPK A;  2GJR A;  4OOS A;  3CCR B;  5AN9 A;  2OYN A;  1E1Q A;  3OEE A;  3CCV B;  1BQE A;  1VQL B;  1UMK A;  2BF4 A;  3ZBU A;  1ZUN B;  3CB4 A;  4MYU A;  3ZBT A;  2R6H A;  4UZE A;  1ZM9 A;  2QGG A;  4M53 A;  3H94 A;  3SEJ A;  4B48 A;  2OBT A;  1H8E A;  3CMM A;  2E1R A; 
#chains in the Genus database with same CATH homology
 4X7E A;  2OBS A;  3PA1 A;  4P25 A;  3SJP A;  4RDK A;  4P1V A;  3ONU A;  4OOV A;  3BQJ A;  3ONY A;  3R6J A;  4X06 A;  5F4M A;  5HZA A;  5IYR A;  5IYP A;  5HZB A;  5KW9 A;  3ASR A;  3BY2 A;  2ZL5 A;  3D26 A;  3SLD A;  4RDJ A;  3PVD A;  5BSY A;  4WZK A;  5IYW A;  3Q6R A;  4RLZ A;  4Z4Z A;  3Q38 A;  4X7C A;  4OOX A;  4WZT A;  5F4O A;  4RDL A;  3PUM A;  3LQE A;  4OP7 A;  4ROX A;  2OBR A;  5E6T A;  4OPS A;  4Z4S A;  3SLN A;  4RM0 A;  3ASS A;  4X07 A;  3AST A;  4X0C A;  4Z4U A;  4X7F A;  4Z4T A;  5IYN A;  5BSX A;  3V7A A;  4P3I A;  4QVA A;  4Z4Y A;  4X05 A;  4QUZ A;  4Z4V A;  2ZL6 A;  4Z4R A;  3BY1 A;  4P2N A;  4P26 A;  3PUN A;  4Z4W A;  3Q39 A;  2ZL7 A;  3Q6Q A;  4X7D A;  4QV2 A;  5J35 A;  3LQ6 A;  4RPD A;  3R6K A;  4OOS A;  3PA2 A;  4WZE A;  4OPO A;  4OPV A;  4P12 A;  4RPB A;  3ASP A;  4QVJ A;  1IHM A;  5J3O A;  3ASQ A;  3Q3A A;  3SKB A;  4WZL A;  3RY8 A;  5F4J A;  3SEJ A;  5IYQ A;  2OBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...