4RDKA

Crystal structure of norovirus boxer p domain in complex with lewis b tetrasaccharide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
297
structure length
293
Chain Sequence
KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGPQTLPINGVFVFISWVSRYYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
source organism Human calicivirus nlv/boxer/2001/us
molecule tags Viral protein
total genus 70
structure length 293
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdkA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdkA01
4QUZA 3PUMA 2ZL5A 5BSXA 5J35A 2ZL6A 4RPBA 4X7EA 4RPDA 3BY1A 4OOXA 4X7DA 4X0CA 4OPOA 4QV2A 5F4JA 3Q39A 4X7CA 4OOVA 4ROXA 3SKBA 4P1VA 3BQJA 4RLZA 3ASSA 3Q3AA 4Z4RA 3PUNA 3PVDA 4X05A 3SJPA 4Z4WA 5HZBA 3LQEA 4OPVA 4QVAA 3ASQA 4X06A 5BSYA 3SEJA 5IYPA 5KW9A 4WZKA 4RM0A 4P3IA 3Q6RA 4RDJA 5IYNA 4Z4YA 4RDLA 4X07A 4P12A 4RDKA 3ASPA 4P26A 5F4OA 3Q38A 3RY8A 4Z4SA 4P25A 2OBTA 1IHMA 3LQ6A 3SLNA 5IYQA 5E6TA 3BY2A 4WZTA 3PA1A 5F4MA 3ASTA 4OPSA 3ASRA 4OP7A 3V7AA 4WZEA 4Z4VA 3ONUA 2ZL7A 3R6JA 4Z4UA 5IYWA 2OBRA 2OBSA 4X7FA 3ONYA 5IYRA 4P2NA 5HZAA 5J3OA 3Q6QA 4OOSA 3R6KA 4QVJA 3D26A 3SLDA 4WZLA 4Z4ZA 4Z4TA 3PA2A
chains in the Genus database with same CATH superfamily
3KL9A 4M1KA 3P26A 1G7RA 2D9RA 4UAJA 1TLLA 1KQSB 4Q7JB 1N05A 4RD4A 4WQMA 3AVWA 1CQXA 1VJSA 4PAAA 1XQBA 1W2BB 3OW2B 1JJ2B 4Z1MA 3W5VA 4RPBA 2C5BA 3CP2A 3WNCA 2JIZA 5GV7A 3VNVA 4OOXA 2WZPP 2VJIA 2QMUA 1M90D 4TT3A 3ZIAA 4QV2A 1G7SA 2R6HA 5A89A 3AGQA 3SKBA 1IB0A 4CQJA 1EP1B 1KJZA 1H8HA 1E43A 2OK8A 3W2FA 5GV8A 1VHOA 1S72B 3G05A 1GVHA 3CCUB 1FNDA 2W6JA 3CPXA 3SJPA 3E1YE 4M4SA 3ZZTA 1VQ8B 2V7XA 5HZBA 3LQEA 2Q6IA 4QVAA 1KK3A 3ASQA 3ES9A 4UZEA 3CMAB 4X06A 2ZXIA 3CMMA 1D2EA 3FKSA 3CMEB 2X3UA 5IYNA 3W5UA 1EP3B 1YX2A 3QFRA 2BVNA 3VMFA 2HDNB 3A8JA 3B8HA 3GVJA 2GJPA 1BLIA 3RY8A 4AVZA 3G4SB 3OEHA 1DG1G 2DIEA 4P25A 1OB2A 1K8AD 1BMFA 1D8TA 2BPOA 4KKSA 1KTVA 3SLNA 1E79A 3I56B 2Q6OA 3CCSB 3CCVB 3VNUA 2I1LA 1S0UA 2PLFA 2FVGA 5IK2A 5L46A 1RQPA 4QHYA 2WR8A 3ZPNA 3G6EB 2F1MA 4WZTA 3J81k 2C4UA 5TV2A 2J7KA 1NDHA 4OPSA 1VQPB 3ASRA 4OP7A 3A1PA 1FRQA 2PIAA 3CESA 3GIRA 4WZEA 2VBUA 1VLOA 3GVKA 1FX0A 4HE6A 1B23P 2ZZQA 3T53B 4Z4UA 3ZC3A 2CK3A 5IYWA 1Q82D 3W2GA 3T56B 3KEWA 1W35A 2V7QA 2GK6A 3CC7B 5KNLA 2OBRA 1JA1A 1WSVA 1Y0RA 1YJNB 2BM0A 3B82A 3AVYA 2DOGA 2X6WA 4XD7A 1QX4A 3JQQA 4PC1A 1MABA 3CCJB 4ACBA 5J3OA 4FK8A 1EFCA 5TRDA 1QFYA 2V4DA 4QVJA 4B47A 3E20A 1ZUNB 3U2QA 1NB9A 2ZBVA 3LNNA 1KMHA 1NB0A 3G71B 3PUMA 1W0KA 1XE1A 2ZL5A 4G7XA 2BV3A 1N0UA 5BSXA 3QSYA 5J35A 1SKYB 4YAWA 5FA6A 2QN6A 3SJZA 3WYAA 3ZUGA 2V7UA 4ZCIA 5LMZA 1R5OA 4RPDA 2B7BA 2RC5A 4KKTA 1VQNB 4X7DA 4X0CA 4OPOA 4DQKA 3OJXA 2CBXA 4PGOA 1WORA 3GVLA 1N8RD 4ROXA 1Q7YD 2DEUA 2VYQA 1WOPA 1YI2B 1VQ4B 1H85A 2E1RA 2RC6A 4P1VA 4R71A 1VLYA 1ELOA 3BQJA 3MMPA 2XGJA 3W2EA 2JDIA 3PUNA 3QFTA 2OTLB 5FNZA 1VQ9B 1HVXA 1PJ5A 2WJYA 5KSWB 4XNFA 1FRNA 2FX3A 1EXMA 2VNKA 4Z4WA 1VQKB 2E1BA 1B2RA 2X8KA 4OPVA 1T6XA 4ZGQB 1V0EA 3FJOA 4H9GA 1N08A 1T6ZA 1UD3A 1E1QA 4XLAA 5A8AA 1COWA 3CCRB 2F43A 1VQ6B 5BSYA 3SEJA 2XZPA 2HCJB 5FO0A 5KW9A 1V5VA 4G1VA 2C78A 1ZM9A 2YWEA 1PKVA 1UD6A 2CF4A 2XEXA 1K9MD 1KRHA 2JN9A 3CD6B 1GAWA 1KK1A 1GJRA 2M5SA 4G5GA 4P6VF 1G7TA 1FNMA 1S4MA 2D3NA 2XNJA 2X6YA 4Y9UA 1TTTA 2OBTA 4YHBA 4UZFA 2BGIA 3OJWA 3LQ6A 1JA0A 3OZUA 5DN6A 2X85A 3H94A 1YLOA 2NPFA 2C2WA 2B5OA 2V7WA 2OTJB 2GK7A 3ISXA 5E6TA 1ZM3A 4N3NA 3BC9A 1E62A 2XNCA 4B3GA 3ZBTA 4BPRA 1EP2B 1JNYA 4ACAA 1HZEA 1UD5A 3ONUA 1WSRA 3PENA 2CNDA 3WQZA 1E3XA 2W6IA 1WOSA 4HIZA 4GQNA 1BX1A 3FPPA 5THXA 4ZCMA 2PE3A 3OW7A 2CW5A 4YELA 4DK0A 1QGAA 1QVGB 1QFJA 4X7FA 1VQMB 1VQ5B 4N3GA 1TVCA 5JBQA 3VO2A 4TMXA 5DS0A 2V7VA 2YWHA 1UMKA 1WPCA 2R9VA 5HXBA 1GR1A 3T51B 1BJKA 1YIJB 4RCYA 1QH0A 4C0SA 1BQEA 1YITB 1UD8A 2WPDA 4B4DA 4OOSA 3BNWA 5H59A 3D26A 1E63A 1T6YA 3OE7A 3CCEB 4WZLA 3BCDA 4EH1A 3PA2A 3WXMA 3OFNA 4XR6A 2OK7A 1AMOA 3OOCA 1BX0A 3W5HA 2GREA 1FNCA 2DCUA 1IJEA 1YHQB 4DNRB 2AHOA 4XORA 2Q6KA 4AF6A 4TKOB 4M2LA 4AF7A 3BY1A 2C5HA 1GO2A 2DY1A 4LBWA 5HKKA 4M0LA 4TSFA 4RD2A 4ZCLA 3VR6A 2XZLA 4II3A 4LBYA 4B43A 5F4JA 2XOKA 4X7CA 1RQRA 4B3FX 4XKVA 3CPWB 2X0KA 1P4MA 2OYNA 4UZUA 1WU8A 2GJKA 1VF7A 4RLZA 3DDYA 2D3LA 4G7WA 1F60A 4YAOA 3LVBA 2V7TA 3PVDA 4X05A 5FO1A 3CC2B 1OB5A 1N07A 3OPOA 2WZNA 4DNTB 5AN9A 3LO8A 1K73D 2VNJA 2NV4A 1EFTA 4M53A 1QG0A 1EWYA 5IYPA 3CB4A 3CRZA 4JMQA 4WZKA 4Y7CA 4P3IA 1BPLA 3Q6RA 2QTZA 4LC0A 1QUFA 5B6IA 4XKWA 4Z4YA 4XN0A 2VBSA 2D74A 4P12A 4RDKA 4X07A 2QTLA 1U2RA 4NBSA 2ZXHA 4LBVA 3Q38A 4P26A 5F4OA 3CW2A 1OGJA 2WYRA 1E3ZA 3OZWA 2Q6LA 4II2A 3ZZ0A 1KZLA 2JJ2A 1T5EA 3B78A 3W2HA 2EFGA 3VO1A 5H5JA 1NJID 3WBKA 3WNDA 4E0FA 4YAFA 3BY2A 4Y9RA 4RJLA 3ZBUA 4DQLA 3ASTA 1SKQA 2WSSA 1R5BA 2VZLA 1YJ9B 3V7AA 4Z4VA 4MYTA 3WBJA 2YWFA 2ZL7A 3R6JA 2P3MA 2QGGA 4ZV4A 4YXWA 4RD3A 1A8PA 4RD0A 4QFMA 3OZVA 4XM3A 4TN1A 1HA3A 1MRZA 2X6XA 1XFOA 2OBSA 2CC2A 1I18A 1GAQA 1DARA 3OAAA 3A8IA 1Y0YA 4P6YA 5CDFA 2C4TA 2XNDA 4B48A 1JB9A 4WWVA 1KC8D 2ZTNA 3A8KA 1I8DA 1QGZA 2YWGA 5TY0A 2BF4A 4B3XA 1PJ6A 2ZBUA 1QGYA 5TR9A 2BGJA 2C77A 2PMDA 2ZZGA 1Q9SA 4PC7A 3SLDA 4X8IA 1YJWB 4PC6A 2ZITA 4Z4ZA 3CTAA 3OP1A 4C43A 1DDIA 1PJ7A 2DERA 4KKUA 4QUZA 3A35A 2WJVA 3A3GA 4FWTA 1QVFB 2ZL6A 1UD4A 1VHEA 4RD6A 3I1FA 1N06A 1R5NA 2HLDA 4FN5A 4L8JA 4X7EA 4U9UA 2VNIA 1QFZA 3GSIA 1E1RA 5FIUA 1VQOB 4XL9A 2V31A 2KVOA 1QUEA 1Q86D 1KD1D 3BH4A 5DSZA 3Q39A 3QFSA 2F4NA 2VNHA 4OOVA 1M1KD 1TUIA 3OEEA 2XZOA 1G7CA 3CP8A 1Q81D 3CCMB 3FPKA 4Z4RA 3ASSA 3Q3AA 1WOOA 4NNJA 1EFUA 4RD1A 1OHHA 3AVUA 1K28D 3CC4B 4XLFA 3P27A 4YALA 4XQFA 2LZJA 1V0FA 1FDRA 1H8EA 5A88A 4P9SA 4PABA 1FNBA 1W0JA 2F1LA 2QDXA 1VQLB 1SM4A 4HE5A 3JQPA 4XLCA 2DYIA 4P3YA 1W87A 3JU4A 3AVTA 1CNFA 3A3BA 4RM0A 1AIPA 4RDJA 4XLHA 3CXCB 4XMYA 3MCAA 3BCFA 4ZGNB 1J9ZA 4RDLA 4AC9A 3ASPA 4XONA 4XN3A 3V76A 1H42A 3OKXA 1OB0A 2BMWA 4TMZA 1KK2A 2ZZFA 4Z4SA 1F20A 4K1XA 4XLEA 1D1NA 4RCZA 2GQFA 3I55B 3U6BA 4P22A 1IHMA 1XB2A 4XOTA 4DK1A 4F7DA 1CNEA 5EMNA 2VBVA 3AVXA 1KK0A 2BM1A 3AGPA 3WY9A 5IYQA 3W2IA 4LBZA 4ASUA 3QFCA 3PA1A 2Z6BD 3ZZUA 1ZM4A 5F4MA 2X53S 2B7CA 4MYUA 1NBMA 2QA4B 4TMVA 3AVVA 4YAUA 2JJ1A 4FXUA 2ZZEA 4PC3A 3CCQB 1WP6A 3JQRA 3CCLB 2ZTGA 3HAGA 2EIXA 3U6KA 2BN4A 2VJJA 1I7PA 2BSAA 1UD2A 2GJRA 1IJFA 1ZM2A 3ONYA 2CRVA 1N0VC 3MHPA 4B44A 1WDTA 1DDGA 2QEXB 1WTHD 1W34A 2QE7A 1OGIA 2DETA 2VBTA 2GPJA 2HMAA 1NRKA 1W9XA 3H9NA 4YEJA 4G1BA 3WNBA 5IYRA 4P2NA 5FL7A 1EFRA 5HZAA 4IW3B 3Q6QA 4NCNA 1E64A 4G6IA 4TMTA 3QE2A 3R6KA 3NE5B 4PC2A 1VQ7B 3GQBA 4J0QA 4TMWA 4XOPA 4Z4TA
chains in the Genus database with same CATH topology
4QUZA 3PUMA 2ZL5A 5BSXA 5J35A 2ZL6A 4RPBA 4X7EA 4RPDA 3BY1A 4OOXA 4X7DA 4X0CA 4OPOA 4QV2A 5F4JA 3Q39A 4X7CA 4OOVA 4ROXA 3SKBA 4P1VA 3BQJA 4RLZA 3ASSA 3Q3AA 4Z4RA 3PUNA 3PVDA 4X05A 3SJPA 4Z4WA 5HZBA 3LQEA 4OPVA 4QVAA 3ASQA 4X06A 5BSYA 3SEJA 5IYPA 5KW9A 4WZKA 4RM0A 4P3IA 3Q6RA 4RDJA 5IYNA 4Z4YA 4RDLA 4X07A 4P12A 4RDKA 3ASPA 4P26A 5F4OA 3Q38A 3RY8A 4Z4SA 4P25A 2OBTA 1IHMA 3LQ6A 3SLNA 5IYQA 5E6TA 3BY2A 4WZTA 3PA1A 5F4MA 3ASTA 4OPSA 3ASRA 4OP7A 3V7AA 4WZEA 4Z4VA 3ONUA 2ZL7A 3R6JA 4Z4UA 5IYWA 2OBRA 2OBSA 4X7FA 3ONYA 5IYRA 4P2NA 5HZAA 5J3OA 3Q6QA 4OOSA 3R6KA 4QVJA 3D26A 3SLDA 4WZLA 4Z4ZA 4Z4TA 3PA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUZ A;  3PUM A;  2ZL5 A;  5BSX A;  5J35 A;  2ZL6 A;  4RPB A;  4X7E A;  4RPD A;  3BY1 A;  4OOX A;  4X7D A;  4X0C A;  4OPO A;  4QV2 A;  5F4J A;  3Q39 A;  4X7C A;  4OOV A;  4ROX A;  3SKB A;  4P1V A;  3BQJ A;  4RLZ A;  3ASS A;  3Q3A A;  4Z4R A;  3PUN A;  3PVD A;  4X05 A;  3SJP A;  4Z4W A;  5HZB A;  3LQE A;  4OPV A;  4QVA A;  3ASQ A;  4X06 A;  5BSY A;  3SEJ A;  5IYP A;  5KW9 A;  4WZK A;  4RM0 A;  4P3I A;  3Q6R A;  4RDJ A;  5IYN A;  4Z4Y A;  4RDL A;  4X07 A;  4P12 A;  4RDK A;  3ASP A;  4P26 A;  5F4O A;  3Q38 A;  3RY8 A;  4Z4S A;  4P25 A;  2OBT A;  1IHM A;  3LQ6 A;  3SLN A;  5IYQ A;  5E6T A;  3BY2 A;  4WZT A;  3PA1 A;  5F4M A;  3AST A;  4OPS A;  3ASR A;  4OP7 A;  3V7A A;  4WZE A;  4Z4V A;  3ONU A;  2ZL7 A;  3R6J A;  4Z4U A;  5IYW A;  2OBR A;  2OBS A;  4X7F A;  3ONY A;  5IYR A;  4P2N A;  5HZA A;  5J3O A;  3Q6Q A;  4OOS A;  3R6K A;  4QVJ A;  3D26 A;  3SLD A;  4WZL A;  4Z4Z A;  4Z4T A;  3PA2 A; 
#chains in the Genus database with same CATH topology
 3KL9 A;  4M1K A;  3P26 A;  1G7R A;  2D9R A;  4UAJ A;  1TLL A;  1KQS B;  4Q7J B;  1N05 A;  4RD4 A;  4WQM A;  3AVW A;  1CQX A;  1VJS A;  4PAA A;  1XQB A;  1W2B B;  3OW2 B;  1JJ2 B;  4Z1M A;  3W5V A;  4RPB A;  2C5B A;  3CP2 A;  3WNC A;  2JIZ A;  5GV7 A;  3VNV A;  4OOX A;  2WZP P;  2VJI A;  2QMU A;  1M90 D;  4TT3 A;  3ZIA A;  4QV2 A;  1G7S A;  2R6H A;  5A89 A;  3AGQ A;  3SKB A;  1IB0 A;  4CQJ A;  1EP1 B;  1KJZ A;  1H8H A;  1E43 A;  2OK8 A;  3W2F A;  5GV8 A;  1VHO A;  1S72 B;  3G05 A;  1GVH A;  3CCU B;  1FND A;  2W6J A;  3CPX A;  3SJP A;  3E1Y E;  4M4S A;  3ZZT A;  1VQ8 B;  2V7X A;  5HZB A;  3LQE A;  2Q6I A;  4QVA A;  1KK3 A;  3ASQ A;  3ES9 A;  4UZE A;  3CMA B;  4X06 A;  2ZXI A;  3CMM A;  1D2E A;  3FKS A;  3CME B;  2X3U A;  5IYN A;  3W5U A;  1EP3 B;  1YX2 A;  3QFR A;  2BVN A;  3VMF A;  2HDN B;  3A8J A;  3B8H A;  3GVJ A;  2GJP A;  1BLI A;  3RY8 A;  4AVZ A;  3G4S B;  3OEH A;  1DG1 G;  2DIE A;  4P25 A;  1OB2 A;  1K8A D;  1BMF A;  1D8T A;  2BPO A;  4KKS A;  1KTV A;  3SLN A;  1E79 A;  3I56 B;  2Q6O A;  3CCS B;  3CCV B;  3VNU A;  2I1L A;  1S0U A;  2PLF A;  2FVG A;  5IK2 A;  5L46 A;  1RQP A;  4QHY A;  2WR8 A;  3ZPN A;  3G6E B;  2F1M A;  4WZT A;  3J81 k;  2C4U A;  5TV2 A;  2J7K A;  1NDH A;  4OPS A;  1VQP B;  3ASR A;  4OP7 A;  3A1P A;  1FRQ A;  2PIA A;  3CES A;  3GIR A;  4WZE A;  2VBU A;  1VLO A;  3GVK A;  1FX0 A;  4HE6 A;  1B23 P;  2ZZQ A;  3T53 B;  4Z4U A;  3ZC3 A;  2CK3 A;  5IYW A;  1Q82 D;  3W2G A;  3T56 B;  3KEW A;  1W35 A;  2V7Q A;  2GK6 A;  3CC7 B;  5KNL A;  2OBR A;  1JA1 A;  1WSV A;  1Y0R A;  1YJN B;  2BM0 A;  3B82 A;  3AVY A;  2DOG A;  2X6W A;  4XD7 A;  1QX4 A;  3JQQ A;  4PC1 A;  1MAB A;  3CCJ B;  4ACB A;  5J3O A;  4FK8 A;  1EFC A;  5TRD A;  1QFY A;  2V4D A;  4QVJ A;  4B47 A;  3E20 A;  1ZUN B;  3U2Q A;  1NB9 A;  2ZBV A;  3LNN A;  1KMH A;  1NB0 A;  3G71 B;  3PUM A;  1W0K A;  1XE1 A;  2ZL5 A;  4G7X A;  2BV3 A;  1N0U A;  5BSX A;  3QSY A;  5J35 A;  1SKY B;  4YAW A;  5FA6 A;  2QN6 A;  3SJZ A;  3WYA A;  3ZUG A;  2V7U A;  4ZCI A;  5LMZ A;  1R5O A;  4RPD A;  2B7B A;  2RC5 A;  4KKT A;  1VQN B;  4X7D A;  4X0C A;  4OPO A;  4DQK A;  3OJX A;  2CBX A;  4PGO A;  1WOR A;  3GVL A;  1N8R D;  4ROX A;  1Q7Y D;  2DEU A;  2VYQ A;  1WOP A;  1YI2 B;  1VQ4 B;  1H85 A;  2E1R A;  2RC6 A;  4P1V A;  4R71 A;  1VLY A;  1ELO A;  3BQJ A;  3MMP A;  2XGJ A;  3W2E A;  2JDI A;  3PUN A;  3QFT A;  2OTL B;  5FNZ A;  1VQ9 B;  1HVX A;  1PJ5 A;  2WJY A;  5KSW B;  4XNF A;  1FRN A;  2FX3 A;  1EXM A;  2VNK A;  4Z4W A;  1VQK B;  2E1B A;  1B2R A;  2X8K A;  4OPV A;  1T6X A;  4ZGQ B;  1V0E A;  3FJO A;  4H9G A;  1N08 A;  1T6Z A;  1UD3 A;  1E1Q A;  4XLA A;  5A8A A;  1COW A;  3CCR B;  2F43 A;  1VQ6 B;  5BSY A;  3SEJ A;  2XZP A;  2HCJ B;  5FO0 A;  5KW9 A;  1V5V A;  4G1V A;  2C78 A;  1ZM9 A;  2YWE A;  1PKV A;  1UD6 A;  2CF4 A;  2XEX A;  1K9M D;  1KRH A;  2JN9 A;  3CD6 B;  1GAW A;  1KK1 A;  1GJR A;  2M5S A;  4G5G A;  4P6V F;  1G7T A;  1FNM A;  1S4M A;  2D3N A;  2XNJ A;  2X6Y A;  4Y9U A;  1TTT A;  2OBT A;  4YHB A;  4UZF A;  2BGI A;  3OJW A;  3LQ6 A;  1JA0 A;  3OZU A;  5DN6 A;  2X85 A;  3H94 A;  1YLO A;  2NPF A;  2C2W A;  2B5O A;  2V7W A;  2OTJ B;  2GK7 A;  3ISX A;  5E6T A;  1ZM3 A;  4N3N A;  3BC9 A;  1E62 A;  2XNC A;  4B3G A;  3ZBT A;  4BPR A;  1EP2 B;  1JNY A;  4ACA A;  1HZE A;  1UD5 A;  3ONU A;  1WSR A;  3PEN A;  2CND A;  3WQZ A;  1E3X A;  2W6I A;  1WOS A;  4HIZ A;  4GQN A;  1BX1 A;  3FPP A;  5THX A;  4ZCM A;  2PE3 A;  3OW7 A;  2CW5 A;  4YEL A;  4DK0 A;  1QGA A;  1QVG B;  1QFJ A;  4X7F A;  1VQM B;  1VQ5 B;  4N3G A;  1TVC A;  5JBQ A;  3VO2 A;  4TMX A;  5DS0 A;  2V7V A;  2YWH A;  1UMK A;  1WPC A;  2R9V A;  5HXB A;  1GR1 A;  3T51 B;  1BJK A;  1YIJ B;  4RCY A;  1QH0 A;  4C0S A;  1BQE A;  1YIT B;  1UD8 A;  2WPD A;  4B4D A;  4OOS A;  3BNW A;  5H59 A;  3D26 A;  1E63 A;  1T6Y A;  3OE7 A;  3CCE B;  4WZL A;  3BCD A;  4EH1 A;  3PA2 A;  3WXM A;  3OFN A;  4XR6 A;  2OK7 A;  1AMO A;  3OOC A;  1BX0 A;  3W5H A;  2GRE A;  1FNC A;  2DCU A;  1IJE A;  1YHQ B;  4DNR B;  2AHO A;  4XOR A;  2Q6K A;  4AF6 A;  4TKO B;  4M2L A;  4AF7 A;  3BY1 A;  2C5H A;  1GO2 A;  2DY1 A;  4LBW A;  5HKK A;  4M0L A;  4TSF A;  4RD2 A;  4ZCL A;  3VR6 A;  2XZL A;  4II3 A;  4LBY A;  4B43 A;  5F4J A;  2XOK A;  4X7C A;  1RQR A;  4B3F X;  4XKV A;  3CPW B;  2X0K A;  1P4M A;  2OYN A;  4UZU A;  1WU8 A;  2GJK A;  1VF7 A;  4RLZ A;  3DDY A;  2D3L A;  4G7W A;  1F60 A;  4YAO A;  3LVB A;  2V7T A;  3PVD A;  4X05 A;  5FO1 A;  3CC2 B;  1OB5 A;  1N07 A;  3OPO A;  2WZN A;  4DNT B;  5AN9 A;  3LO8 A;  1K73 D;  2VNJ A;  2NV4 A;  1EFT A;  4M53 A;  1QG0 A;  1EWY A;  5IYP A;  3CB4 A;  3CRZ A;  4JMQ A;  4WZK A;  4Y7C A;  4P3I A;  1BPL A;  3Q6R A;  2QTZ A;  4LC0 A;  1QUF A;  5B6I A;  4XKW A;  4Z4Y A;  4XN0 A;  2VBS A;  2D74 A;  4P12 A;  4RDK A;  4X07 A;  2QTL A;  1U2R A;  4NBS A;  2ZXH A;  4LBV A;  3Q38 A;  4P26 A;  5F4O A;  3CW2 A;  1OGJ A;  2WYR A;  1E3Z A;  3OZW A;  2Q6L A;  4II2 A;  3ZZ0 A;  1KZL A;  2JJ2 A;  1T5E A;  3B78 A;  3W2H A;  2EFG A;  3VO1 A;  5H5J A;  1NJI D;  3WBK A;  3WND A;  4E0F A;  4YAF A;  3BY2 A;  4Y9R A;  4RJL A;  3ZBU A;  4DQL A;  3AST A;  1SKQ A;  2WSS A;  1R5B A;  2VZL A;  1YJ9 B;  3V7A A;  4Z4V A;  4MYT A;  3WBJ A;  2YWF A;  2ZL7 A;  3R6J A;  2P3M A;  2QGG A;  4ZV4 A;  4YXW A;  4RD3 A;  1A8P A;  4RD0 A;  4QFM A;  3OZV A;  4XM3 A;  4TN1 A;  1HA3 A;  1MRZ A;  2X6X A;  1XFO A;  2OBS A;  2CC2 A;  1I18 A;  1GAQ A;  1DAR A;  3OAA A;  3A8I A;  1Y0Y A;  4P6Y A;  5CDF A;  2C4T A;  2XND A;  4B48 A;  1JB9 A;  4WWV A;  1KC8 D;  2ZTN A;  3A8K A;  1I8D A;  1QGZ A;  2YWG A;  5TY0 A;  2BF4 A;  4B3X A;  1PJ6 A;  2ZBU A;  1QGY A;  5TR9 A;  2BGJ A;  2C77 A;  2PMD A;  2ZZG A;  1Q9S A;  4PC7 A;  3SLD A;  4X8I A;  1YJW B;  4PC6 A;  2ZIT A;  4Z4Z A;  3CTA A;  3OP1 A;  4C43 A;  1DDI A;  1PJ7 A;  2DER A;  4KKU A;  4QUZ A;  3A35 A;  2WJV A;  3A3G A;  4FWT A;  1QVF B;  2ZL6 A;  1UD4 A;  1VHE A;  4RD6 A;  3I1F A;  1N06 A;  1R5N A;  2HLD A;  4FN5 A;  4L8J A;  4X7E A;  4U9U A;  2VNI A;  1QFZ A;  3GSI A;  1E1R A;  5FIU A;  1VQO B;  4XL9 A;  2V31 A;  2KVO A;  1QUE A;  1Q86 D;  1KD1 D;  3BH4 A;  5DSZ A;  3Q39 A;  3QFS A;  2F4N A;  2VNH A;  4OOV A;  1M1K D;  1TUI A;  3OEE A;  2XZO A;  1G7C A;  3CP8 A;  1Q81 D;  3CCM B;  3FPK A;  4Z4R A;  3ASS A;  3Q3A A;  1WOO A;  4NNJ A;  1EFU A;  4RD1 A;  1OHH A;  3AVU A;  1K28 D;  3CC4 B;  4XLF A;  3P27 A;  4YAL A;  4XQF A;  2LZJ A;  1V0F A;  1FDR A;  1H8E A;  5A88 A;  4P9S A;  4PAB A;  1FNB A;  1W0J A;  2F1L A;  2QDX A;  1VQL B;  1SM4 A;  4HE5 A;  3JQP A;  4XLC A;  2DYI A;  4P3Y A;  1W87 A;  3JU4 A;  3AVT A;  1CNF A;  3A3B A;  4RM0 A;  1AIP A;  4RDJ A;  4XLH A;  3CXC B;  4XMY A;  3MCA A;  3BCF A;  4ZGN B;  1J9Z A;  4RDL A;  4AC9 A;  3ASP A;  4XON A;  4XN3 A;  3V76 A;  1H42 A;  3OKX A;  1OB0 A;  2BMW A;  4TMZ A;  1KK2 A;  2ZZF A;  4Z4S A;  1F20 A;  4K1X A;  4XLE A;  1D1N A;  4RCZ A;  2GQF A;  3I55 B;  3U6B A;  4P22 A;  1IHM A;  1XB2 A;  4XOT A;  4DK1 A;  4F7D A;  1CNE A;  5EMN A;  2VBV A;  3AVX A;  1KK0 A;  2BM1 A;  3AGP A;  3WY9 A;  5IYQ A;  3W2I A;  4LBZ A;  4ASU A;  3QFC A;  3PA1 A;  2Z6B D;  3ZZU A;  1ZM4 A;  5F4M A;  2X53 S;  2B7C A;  4MYU A;  1NBM A;  2QA4 B;  4TMV A;  3AVV A;  4YAU A;  2JJ1 A;  4FXU A;  2ZZE A;  4PC3 A;  3CCQ B;  1WP6 A;  3JQR A;  3CCL B;  2ZTG A;  3HAG A;  2EIX A;  3U6K A;  2BN4 A;  2VJJ A;  1I7P A;  2BSA A;  1UD2 A;  2GJR A;  1IJF A;  1ZM2 A;  3ONY A;  2CRV A;  1N0V C;  3MHP A;  4B44 A;  1WDT A;  1DDG A;  2QEX B;  1WTH D;  1W34 A;  2QE7 A;  1OGI A;  2DET A;  2VBT A;  2GPJ A;  2HMA A;  1NRK A;  1W9X A;  3H9N A;  4YEJ A;  4G1B A;  3WNB A;  5IYR A;  4P2N A;  5FL7 A;  1EFR A;  5HZA A;  4IW3 B;  3Q6Q A;  4NCN A;  1E64 A;  4G6I A;  4TMT A;  3QE2 A;  3R6K A;  3NE5 B;  4PC2 A;  1VQ7 B;  3GQB A;  4J0Q A;  4TMW A;  4XOP A;  4Z4T A; 
#chains in the Genus database with same CATH homology
 4QUZ A;  3PUM A;  2ZL5 A;  5BSX A;  5J35 A;  2ZL6 A;  4RPB A;  4X7E A;  4RPD A;  3BY1 A;  4OOX A;  4X7D A;  4X0C A;  4OPO A;  4QV2 A;  5F4J A;  3Q39 A;  4X7C A;  4OOV A;  4ROX A;  3SKB A;  4P1V A;  3BQJ A;  4RLZ A;  3ASS A;  3Q3A A;  4Z4R A;  3PUN A;  3PVD A;  4X05 A;  3SJP A;  4Z4W A;  5HZB A;  3LQE A;  4OPV A;  4QVA A;  3ASQ A;  4X06 A;  5BSY A;  3SEJ A;  5IYP A;  5KW9 A;  4WZK A;  4RM0 A;  4P3I A;  3Q6R A;  4RDJ A;  5IYN A;  4Z4Y A;  4RDL A;  4X07 A;  4P12 A;  4RDK A;  3ASP A;  4P26 A;  5F4O A;  3Q38 A;  3RY8 A;  4Z4S A;  4P25 A;  2OBT A;  1IHM A;  3LQ6 A;  3SLN A;  5IYQ A;  5E6T A;  3BY2 A;  4WZT A;  3PA1 A;  5F4M A;  3AST A;  4OPS A;  3ASR A;  4OP7 A;  3V7A A;  4WZE A;  4Z4V A;  3ONU A;  2ZL7 A;  3R6J A;  4Z4U A;  5IYW A;  2OBR A;  2OBS A;  4X7F A;  3ONY A;  5IYR A;  4P2N A;  5HZA A;  5J3O A;  3Q6Q A;  4OOS A;  3R6K A;  4QVJ A;  3D26 A;  3SLD A;  4WZL A;  4Z4Z A;  4Z4T A;  3PA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...