4RDKA

Crystal structure of norovirus boxer p domain in complex with lewis b tetrasaccharide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
297
structure length
293
Chain Sequence
KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGPQTLPINGVFVFISWVSRYYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
source organism Human calicivirus nlv/boxer/2001/us
molecule tags Viral protein
total genus 70
structure length 293
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdkA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdkA01
3PA1A 2OBTA 3RY8A 4P26A 4QVJA 3ASTA 4X7CA 1IHMA 4RLZA 3ASQA 5J35A 4QUZA 3SLDA 4ROXA 4RDLA 4RM0A 3ONUA 2OBSA 3ASPA 5F4OA 4OP7A 4RPBA 4WZKA 5IYWA 4Z4WA 3SJPA 5BSXA 2ZL7A 3SEJA 4Z4VA 4OPVA 4QVAA 4Z4ZA 4RPDA 4X7FA 3LQ6A 3BY2A 4WZTA 5BSYA 4QV2A 4P3IA 3ONYA 3Q6QA 5F4MA 4RDJA 3PUNA 4Z4SA 3V7AA 4P25A 4Z4TA 4Z4YA 5KW9A 3PA2A 5HZAA 3Q38A 3R6KA 2ZL6A 5J3OA 4OPOA 5HZBA 3PUMA 3SLNA 3SKBA 4RDKA 4P12A 5IYQA 4OPSA 4X06A 4P1VA 5IYNA 4X0CA 3Q3AA 3BY1A 4OOXA 4X7EA 5IYPA 2ZL5A 3D26A 5IYRA 4Z4UA 4X7DA 3Q6RA 4Z4RA 3ASSA 4X05A 3LQEA 3BQJA 3ASRA 4P2NA 4X07A 3PVDA 2OBRA 5F4JA 4WZLA 3R6JA 4WZEA 3Q39A 5E6TA 4OOSA 4OOVA
chains in the Genus database with same CATH superfamily
1PKVA 1KK1A 1GR1A 3T51B 1QGYA 1E1RA 3MCAA 3LO8A 1N06A 1WP6A 1W35A 2W6IA 3RY8A 3WBJA 2PMDA 1Q7YD 1KTVA 1FNCA 4ZGNB 4QVJA 2QA4B 3A8IA 1EFTA 3CB4A 1YJNB 2XNJA 1U2RA 2XGJA 2ZTGA 1NB0A 1YI2B 1DARA 4RLZA 5LMZA 1T5EA 3AVTA 5J35A 1JNYA 3GSIA 1W0JA 2C5BA 2GREA 2DIEA 3FPKA 1CNFA 1G7SA 4Y7CA 1JJ2B 3WQZA 3ONUA 1BPLA 3ASPA 4EH1A 3SJZA 3CMEB 4B3FX 1QFZA 3U2QA 1UMKA 1W87A 2WJYA 3ZZUA 1ZM4A 4NCNA 1A8PA 3J81k 1OGIA 5TV2A 2I1LA 5AN9A 4J0QA 3SEJA 2VBTA 3FJOA 1E64A 2PLFA 4YAWA 5A89A 4NBSA 4Z4ZA 2EIXA 4RPDA 3LQ6A 4RD2A 3ISXA 3CMMA 2V7WA 4WZTA 5BSYA 3CC2B 4DQKA 4QV2A 1D8TA 4P3IA 2QE7A 5F4MA 1FNBA 2ZXIA 1GO2A 2V7TA 3KEWA 3V7AA 1QGZA 2CNDA 5TY0A 5KW9A 2BM1A 1S4MA 3CP2A 1TVCA 4RD6A 1E1QA 3OEHA 1E63A 5J3OA 4HE5A 1WOPA 5HZBA 2FVGA 3PUMA 1KRHA 1YJ9B 2FX3A 4RD4A 3LNNA 2ZBVA 3CC4B 4M2LA 4GQNA 1KK0A 1F20A 4XQFA 4TMTA 1UD5A 5IYQA 2J7KA 1W0KA 4OPSA 1QGAA 4XM3A 3A8KA 1VF7A 1G7RA 3E1YE 3CCJB 4P1VA 2GJPA 1EP1B 1XQBA 2V7UA 1MABA 1VQ7B 1D1NA 3MHPA 3CC7B 1Q9SA 4X0CA 3OEEA 4R71A 1WOSA 4X7EA 1NDHA 2OTLB 1GVHA 5TR9A 4XLEA 3W5UA 4B3XA 4M0LA 4XLAA 4WQMA 4Z4UA 4IW3B 4ZV4A 4X7DA 3VO2A 1UD6A 1KQSB 3AVUA 4ZCLA 2PIAA 5FL7A 1GJRA 2X6YA 1QUFA 3CTAA 4B43A 2HCJB 3ASSA 3W5HA 4X05A 1FRNA 1VLYA 2VNIA 2F1LA 1S0UA 4II3A 1F60A 5TRDA 1IJFA 2X53S 3ZUGA 3BCFA 4XOTA 1FNMA 2EFGA 4ZGQB 2OBRA 3WYAA 4XLHA 3OFNA 4WZEA 5E6TA 4OOSA 1VQPB 1FX0A 1VLOA 5FA6A 1YIJB 2ZITA 2RC5A 2HLDA 4YALA 1TTTA 2BGIA 2P3MA 1KK3A 4P26A 4XN3A 4QHYA 1VQ6B 1B2RA 4UZFA 2OK8A 4II2A 1KD1D 1QFJA 3BC9A 3GIRA 3H9NA 2JJ2A 4X7CA 2QDXA 1IHMA 1IJEA 1WDTA 5A88A 2X6XA 3U6KA 4XR6A 4QUZA 2BPOA 1QG0A 3AVVA 4G7WA 3SLDA 2XZOA 2VYQA 1E3ZA 4WWVA 2D3NA 2ZXHA 2DCUA 3CP8A 3CPXA 1T6YA 3A3BA 4P6VF 3CW2A 1QVGB 2R9VA 1E3XA 2VBUA 5F4OA 2QEXB 2B7CA 2WYRA 1GAQA 1AIPA 4OP7A 1S72B 4PC2A 1VJSA 1DDGA 2M5SA 4RD3A 4PC3A 1K73D 2CW5A 1BJKA 2VBSA 2YWEA 2X0KA 4M4SA 2ZZQA 2CBXA 2BVNA 4DK0A 1YX2A 1W9XA 4XKVA 2BMWA 2E1RA 5IK2A 3NE5B 4RD1A 3CCMB 3CD6B 1XFOA 3PUNA 4UAJA 3CXCB 4P25A 2QTLA 4Z4TA 3CESA 3LVBA 4P6YA 4LC0A 1Q86D 3R6KA 1TLLA 4OPOA 4AVZA 3JQQA 3QFSA 1K9MD 3OOCA 4Q7JB 1QFYA 3BCDA 4G1VA 4LBWA 2KVOA 3OW2B 1UD2A 4P12A 5B6IA 1G7TA 4XKWA 3G71B 3AVYA 3P26A 2E1BA 2B7BA 3CMAB 3BNWA 1EFUA 4ACBA 4JMQA 1UD3A 2BV3A 2X8KA 4P9SA 5FO0A 2XNCA 1FRQA 3VMFA 3VR6A 2VJIA 2D9RA 2CC2A 4CQJA 1BLIA 1BQEA 3B82A 5FO1A 5GV7A 4RCZA 3OP1A 2X3UA 2GJKA 3WNCA 1ELOA 1VHEA 5THXA 1Q82D 4TMXA 2BGJA 1WORA 1XB2A 3AVXA 3JU4A 3G05A 4YHBA 3BQJA 3ZIAA 3CCRB 1UD8A 4ZCIA 4P2NA 4X07A 2DEUA 1WU8A 2GPJA 4LBZA 5F4JA 1E62A 3R6JA 3OZWA 1M1KD 4B4DA 3Q39A 4XNFA 1N0VC 1VQ5B 1NBMA 4B48A 1YLOA 2GK6A 1N0UA 3FPPA 4YAUA 2OBTA 4YAOA 1CNEA 4ACAA 1T6XA 2ZZGA 2AHOA 1HVXA 3DDYA 2XZLA 2V4DA 4P22A 1SM4A 1H8EA 1NRKA 1YITB 2C5HA 4YXWA 3ASTA 1EFRA 2JIZA 3QFTA 2Z6BD 3ASQA 3OPOA 3VNUA 4MYUA 1VQMB 1AMOA 4PC6A 1EFCA 4DNRB 5HKKA 3V76A 2PE3A 2YWFA 1QH0A 1K28D 2NV4A 2CF4A 3CCUB 3WNBA 3ZBUA 4XL9A 1COWA 1PJ6A 3CCLB 4RDLA 4RM0A 3ZZTA 1HZEA 1ZM2A 1WSVA 2HMAA 2ZBUA 1K8AD 4Y9RA 2ZTNA 1YHQB 4WZKA 5IYWA 2JDIA 3SJPA 3A8JA 2Q6IA 1ZM9A 5H59A 2ZL7A 2QGGA 2V7XA 4HIZA 4Z4VA 1I7PA 4TMVA 4BPRA 2WJVA 1VQNB 4QVAA 3W2GA 4B3GA 1Y0YA 1EXMA 3T53B 4X7FA 3BY2A 4G6IA 2DETA 4DK1A 5KNLA 2V7VA 3OZUA 4TMWA 2Q6LA 3ZBTA 4KKUA 2VZLA 3Q6QA 2F43A 2WR8A 4G1BA 3OZVA 4Z4SA 4Z4YA 3W2EA 3ZC3A 5HZAA 3QFRA 3ES9A 3Q38A 4UZEA 1VQKB 4XLFA 3W2IA 3AGQA 1JA0A 1WTHD 1H8HA 1JB9A 2C4TA 2W6JA 4QFMA 4RD0A 4RDKA 2NPFA 4X8IA 4FWTA 1SKYB 1OGJA 3OE7A 1ZM3A 4KKTA 4XONA 1IB0A 4XMYA 1BMFA 4TT3A 1KZLA 2C78A 5JBQA 5IYNA 4FN5A 1MRZA 3BH4A 2BSAA 3JQPA 1OB5A 2D3LA 5EMNA 2DYIA 2VNJA 3Q3AA 3WXMA 1FDRA 4PABA 4B44A 1TUIA 3KL9A 3AVWA 1GAWA 1QUEA 2GK7A 3QSYA 1Q81D 2DERA 4K1XA 1KK2A 1EP2B 2X85A 4B47A 4P3YA 2OTJB 2C2WA 2LZJA 3I1FA 1QVFB 4C0SA 2BF4A 3MMPA 2BN4A 2YWGA 3CPWB 1B23P 4F7DA 1N08A 1P4MA 3ASRA 4AC9A 2GJRA 2WZPP 2Q6KA 4HE6A 4UZUA 4WZLA 1XE1A 3ZPNA 4AF6A 1V0FA 1FNDA 3P27A 1N8RD 1SKQA 4TSFA 1QX4A 4G5GA 2R6HA 3I55B 1JA1A 3OAAA 3T56B 3PA1A 4N3GA 1WOOA 5HXBA 4MYTA 2C4UA 1RQRA 3JQRA 4LBVA 3A3GA 2VJJA 1DG1G 1YJWB 2ZZEA 1VHOA 2RC6A 1VQOB 2QMUA 3WY9A 3QE2A 1BX0A 3GVLA 3CCQB 1KJZA 3PENA 1Y0RA 4TN1A 2V7QA 2WPDA 2HDNB 2JJ1A 1RQPA 3B78A 3CRZA 4PC7A 5CDFA 2DY1A 3A35A 3WNDA 1EP3B 1OHHA 2XEXA 1WPCA 1VQ8B 4ROXA 2OYNA 2X6WA 1N05A 2OBSA 2ZZFA 1I8DA 3FKSA 5DS0A 4FK8A 4C43A 2V31A 1UD4A 2DOGA 4RCYA 2JN9A 4RPBA 4XOPA 3W2FA 1R5OA 4RJLA 4Z4WA 2VBVA 1D2EA 3GQBA 1WSRA 2D74A 4AF7A 4DNTB 2F1MA 5BSXA 5FIUA 1EWYA 5FNZA 4DQLA 4OPVA 1R5BA 2XNDA 4G7XA 4Z1MA 3U6BA 3CCVB 2B5OA 1VQLB 4N3NA 5H5JA 4ZCMA 2VNHA 1H42A 2WZNA 4XORA 3ONYA 2QN6A 5GV8A 1NB9A 1BX1A 2XZPA 1VQ9B 4RDJA 1M90D 3B8HA 3CCSB 4YELA 3PA2A 4NNJA 4PAAA 2C77A 3AGPA 2ZL6A 1W2BB 3VO1A 2BM0A 5KSWB 4H9GA 3SLNA 2XOKA 3SKBA 3I56B 4XD7A 3QFCA 4E0FA 3W2HA 3HAGA 3GVJA 4M53A 1W34A 1E43A 2WSSA 4X06A 1CQXA 3ZZ0A 1H85A 2F4NA 3VNVA 3GVKA 3E20A 2QTZA 4M1KA 2YWHA 3OKXA 1PJ5A 1N07A 1PJ7A 4FXUA 4LBYA 1J9ZA 3BY1A 4OOXA 4PGOA 1G7CA 4TKOB 5IYPA 3G4SB 5DN6A 2OK7A 2ZL5A 3CCEB 3D26A 1E79A 5IYRA 4YAFA 1NJID 1T6ZA 1KC8D 3W5VA 4L8JA 2Q6OA 3Q6RA 2VNKA 4YEJA 4Z4RA 1OB0A 3WBKA 3OJXA 1R5NA 5L46A 4PC1A 3LQEA 2CRVA 1OB2A 4XLCA 3OW7A 5A8AA 1ZUNB 3H94A 1DDIA 4Y9UA 3OJWA 2CK3A 4XN0A 1HA3A 3PVDA 4TMZA 4KKSA 1KMHA 1V5VA 1V0EA 3G6EB 2GQFA 5DSZA 4ASUA 4OOVA 4U9UA 1I18A 3A1PA 1VQ4B
chains in the Genus database with same CATH topology
3PA1A 2OBTA 3RY8A 4P26A 4QVJA 3ASTA 4X7CA 1IHMA 4RLZA 3ASQA 5J35A 4QUZA 3SLDA 4ROXA 4RDLA 4RM0A 3ONUA 2OBSA 3ASPA 5F4OA 4OP7A 4RPBA 4WZKA 5IYWA 4Z4WA 3SJPA 5BSXA 2ZL7A 3SEJA 4Z4VA 4OPVA 4QVAA 4Z4ZA 4RPDA 4X7FA 3LQ6A 3BY2A 4WZTA 5BSYA 4QV2A 4P3IA 3ONYA 3Q6QA 5F4MA 4RDJA 3PUNA 4Z4SA 3V7AA 4P25A 4Z4TA 4Z4YA 5KW9A 3PA2A 5HZAA 3Q38A 3R6KA 2ZL6A 5J3OA 4OPOA 5HZBA 3PUMA 3SLNA 3SKBA 4RDKA 4P12A 5IYQA 4OPSA 4X06A 4P1VA 5IYNA 4X0CA 3Q3AA 3BY1A 4OOXA 4X7EA 5IYPA 2ZL5A 3D26A 5IYRA 4Z4UA 4X7DA 3Q6RA 4Z4RA 3ASSA 4X05A 3LQEA 3BQJA 3ASRA 4P2NA 4X07A 3PVDA 2OBRA 5F4JA 4WZLA 3R6JA 4WZEA 3Q39A 5E6TA 4OOSA 4OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PA1 A;  2OBT A;  3RY8 A;  4P26 A;  4QVJ A;  3AST A;  4X7C A;  1IHM A;  4RLZ A;  3ASQ A;  5J35 A;  4QUZ A;  3SLD A;  4ROX A;  4RDL A;  4RM0 A;  3ONU A;  2OBS A;  3ASP A;  5F4O A;  4OP7 A;  4RPB A;  4WZK A;  5IYW A;  4Z4W A;  3SJP A;  5BSX A;  2ZL7 A;  3SEJ A;  4Z4V A;  4OPV A;  4QVA A;  4Z4Z A;  4RPD A;  4X7F A;  3LQ6 A;  3BY2 A;  4WZT A;  5BSY A;  4QV2 A;  4P3I A;  3ONY A;  3Q6Q A;  5F4M A;  4RDJ A;  3PUN A;  4Z4S A;  3V7A A;  4P25 A;  4Z4T A;  4Z4Y A;  5KW9 A;  3PA2 A;  5HZA A;  3Q38 A;  3R6K A;  2ZL6 A;  5J3O A;  4OPO A;  5HZB A;  3PUM A;  3SLN A;  3SKB A;  4RDK A;  4P12 A;  5IYQ A;  4OPS A;  4X06 A;  4P1V A;  5IYN A;  4X0C A;  3Q3A A;  3BY1 A;  4OOX A;  4X7E A;  5IYP A;  2ZL5 A;  3D26 A;  5IYR A;  4Z4U A;  4X7D A;  3Q6R A;  4Z4R A;  3ASS A;  4X05 A;  3LQE A;  3BQJ A;  3ASR A;  4P2N A;  4X07 A;  3PVD A;  2OBR A;  5F4J A;  4WZL A;  3R6J A;  4WZE A;  3Q39 A;  5E6T A;  4OOS A;  4OOV A; 
#chains in the Genus database with same CATH topology
 1PKV A;  1KK1 A;  1GR1 A;  3T51 B;  1QGY A;  1E1R A;  3MCA A;  3LO8 A;  1N06 A;  1WP6 A;  1W35 A;  2W6I A;  3RY8 A;  3WBJ A;  2PMD A;  1Q7Y D;  1KTV A;  1FNC A;  4ZGN B;  4QVJ A;  2QA4 B;  3A8I A;  1EFT A;  3CB4 A;  1YJN B;  2XNJ A;  1U2R A;  2XGJ A;  2ZTG A;  1NB0 A;  1YI2 B;  1DAR A;  4RLZ A;  5LMZ A;  1T5E A;  3AVT A;  5J35 A;  1JNY A;  3GSI A;  1W0J A;  2C5B A;  2GRE A;  2DIE A;  3FPK A;  1CNF A;  1G7S A;  4Y7C A;  1JJ2 B;  3WQZ A;  3ONU A;  1BPL A;  3ASP A;  4EH1 A;  3SJZ A;  3CME B;  4B3F X;  1QFZ A;  3U2Q A;  1UMK A;  1W87 A;  2WJY A;  3ZZU A;  1ZM4 A;  4NCN A;  1A8P A;  3J81 k;  1OGI A;  5TV2 A;  2I1L A;  5AN9 A;  4J0Q A;  3SEJ A;  2VBT A;  3FJO A;  1E64 A;  2PLF A;  4YAW A;  5A89 A;  4NBS A;  4Z4Z A;  2EIX A;  4RPD A;  3LQ6 A;  4RD2 A;  3ISX A;  3CMM A;  2V7W A;  4WZT A;  5BSY A;  3CC2 B;  4DQK A;  4QV2 A;  1D8T A;  4P3I A;  2QE7 A;  5F4M A;  1FNB A;  2ZXI A;  1GO2 A;  2V7T A;  3KEW A;  3V7A A;  1QGZ A;  2CND A;  5TY0 A;  5KW9 A;  2BM1 A;  1S4M A;  3CP2 A;  1TVC A;  4RD6 A;  1E1Q A;  3OEH A;  1E63 A;  5J3O A;  4HE5 A;  1WOP A;  5HZB A;  2FVG A;  3PUM A;  1KRH A;  1YJ9 B;  2FX3 A;  4RD4 A;  3LNN A;  2ZBV A;  3CC4 B;  4M2L A;  4GQN A;  1KK0 A;  1F20 A;  4XQF A;  4TMT A;  1UD5 A;  5IYQ A;  2J7K A;  1W0K A;  4OPS A;  1QGA A;  4XM3 A;  3A8K A;  1VF7 A;  1G7R A;  3E1Y E;  3CCJ B;  4P1V A;  2GJP A;  1EP1 B;  1XQB A;  2V7U A;  1MAB A;  1VQ7 B;  1D1N A;  3MHP A;  3CC7 B;  1Q9S A;  4X0C A;  3OEE A;  4R71 A;  1WOS A;  4X7E A;  1NDH A;  2OTL B;  1GVH A;  5TR9 A;  4XLE A;  3W5U A;  4B3X A;  4M0L A;  4XLA A;  4WQM A;  4Z4U A;  4IW3 B;  4ZV4 A;  4X7D A;  3VO2 A;  1UD6 A;  1KQS B;  3AVU A;  4ZCL A;  2PIA A;  5FL7 A;  1GJR A;  2X6Y A;  1QUF A;  3CTA A;  4B43 A;  2HCJ B;  3ASS A;  3W5H A;  4X05 A;  1FRN A;  1VLY A;  2VNI A;  2F1L A;  1S0U A;  4II3 A;  1F60 A;  5TRD A;  1IJF A;  2X53 S;  3ZUG A;  3BCF A;  4XOT A;  1FNM A;  2EFG A;  4ZGQ B;  2OBR A;  3WYA A;  4XLH A;  3OFN A;  4WZE A;  5E6T A;  4OOS A;  1VQP B;  1FX0 A;  1VLO A;  5FA6 A;  1YIJ B;  2ZIT A;  2RC5 A;  2HLD A;  4YAL A;  1TTT A;  2BGI A;  2P3M A;  1KK3 A;  4P26 A;  4XN3 A;  4QHY A;  1VQ6 B;  1B2R A;  4UZF A;  2OK8 A;  4II2 A;  1KD1 D;  1QFJ A;  3BC9 A;  3GIR A;  3H9N A;  2JJ2 A;  4X7C A;  2QDX A;  1IHM A;  1IJE A;  1WDT A;  5A88 A;  2X6X A;  3U6K A;  4XR6 A;  4QUZ A;  2BPO A;  1QG0 A;  3AVV A;  4G7W A;  3SLD A;  2XZO A;  2VYQ A;  1E3Z A;  4WWV A;  2D3N A;  2ZXH A;  2DCU A;  3CP8 A;  3CPX A;  1T6Y A;  3A3B A;  4P6V F;  3CW2 A;  1QVG B;  2R9V A;  1E3X A;  2VBU A;  5F4O A;  2QEX B;  2B7C A;  2WYR A;  1GAQ A;  1AIP A;  4OP7 A;  1S72 B;  4PC2 A;  1VJS A;  1DDG A;  2M5S A;  4RD3 A;  4PC3 A;  1K73 D;  2CW5 A;  1BJK A;  2VBS A;  2YWE A;  2X0K A;  4M4S A;  2ZZQ A;  2CBX A;  2BVN A;  4DK0 A;  1YX2 A;  1W9X A;  4XKV A;  2BMW A;  2E1R A;  5IK2 A;  3NE5 B;  4RD1 A;  3CCM B;  3CD6 B;  1XFO A;  3PUN A;  4UAJ A;  3CXC B;  4P25 A;  2QTL A;  4Z4T A;  3CES A;  3LVB A;  4P6Y A;  4LC0 A;  1Q86 D;  3R6K A;  1TLL A;  4OPO A;  4AVZ A;  3JQQ A;  3QFS A;  1K9M D;  3OOC A;  4Q7J B;  1QFY A;  3BCD A;  4G1V A;  4LBW A;  2KVO A;  3OW2 B;  1UD2 A;  4P12 A;  5B6I A;  1G7T A;  4XKW A;  3G71 B;  3AVY A;  3P26 A;  2E1B A;  2B7B A;  3CMA B;  3BNW A;  1EFU A;  4ACB A;  4JMQ A;  1UD3 A;  2BV3 A;  2X8K A;  4P9S A;  5FO0 A;  2XNC A;  1FRQ A;  3VMF A;  3VR6 A;  2VJI A;  2D9R A;  2CC2 A;  4CQJ A;  1BLI A;  1BQE A;  3B82 A;  5FO1 A;  5GV7 A;  4RCZ A;  3OP1 A;  2X3U A;  2GJK A;  3WNC A;  1ELO A;  1VHE A;  5THX A;  1Q82 D;  4TMX A;  2BGJ A;  1WOR A;  1XB2 A;  3AVX A;  3JU4 A;  3G05 A;  4YHB A;  3BQJ A;  3ZIA A;  3CCR B;  1UD8 A;  4ZCI A;  4P2N A;  4X07 A;  2DEU A;  1WU8 A;  2GPJ A;  4LBZ A;  5F4J A;  1E62 A;  3R6J A;  3OZW A;  1M1K D;  4B4D A;  3Q39 A;  4XNF A;  1N0V C;  1VQ5 B;  1NBM A;  4B48 A;  1YLO A;  2GK6 A;  1N0U A;  3FPP A;  4YAU A;  2OBT A;  4YAO A;  1CNE A;  4ACA A;  1T6X A;  2ZZG A;  2AHO A;  1HVX A;  3DDY A;  2XZL A;  2V4D A;  4P22 A;  1SM4 A;  1H8E A;  1NRK A;  1YIT B;  2C5H A;  4YXW A;  3AST A;  1EFR A;  2JIZ A;  3QFT A;  2Z6B D;  3ASQ A;  3OPO A;  3VNU A;  4MYU A;  1VQM B;  1AMO A;  4PC6 A;  1EFC A;  4DNR B;  5HKK A;  3V76 A;  2PE3 A;  2YWF A;  1QH0 A;  1K28 D;  2NV4 A;  2CF4 A;  3CCU B;  3WNB A;  3ZBU A;  4XL9 A;  1COW A;  1PJ6 A;  3CCL B;  4RDL A;  4RM0 A;  3ZZT A;  1HZE A;  1ZM2 A;  1WSV A;  2HMA A;  2ZBU A;  1K8A D;  4Y9R A;  2ZTN A;  1YHQ B;  4WZK A;  5IYW A;  2JDI A;  3SJP A;  3A8J A;  2Q6I A;  1ZM9 A;  5H59 A;  2ZL7 A;  2QGG A;  2V7X A;  4HIZ A;  4Z4V A;  1I7P A;  4TMV A;  4BPR A;  2WJV A;  1VQN B;  4QVA A;  3W2G A;  4B3G A;  1Y0Y A;  1EXM A;  3T53 B;  4X7F A;  3BY2 A;  4G6I A;  2DET A;  4DK1 A;  5KNL A;  2V7V A;  3OZU A;  4TMW A;  2Q6L A;  3ZBT A;  4KKU A;  2VZL A;  3Q6Q A;  2F43 A;  2WR8 A;  4G1B A;  3OZV A;  4Z4S A;  4Z4Y A;  3W2E A;  3ZC3 A;  5HZA A;  3QFR A;  3ES9 A;  3Q38 A;  4UZE A;  1VQK B;  4XLF A;  3W2I A;  3AGQ A;  1JA0 A;  1WTH D;  1H8H A;  1JB9 A;  2C4T A;  2W6J A;  4QFM A;  4RD0 A;  4RDK A;  2NPF A;  4X8I A;  4FWT A;  1SKY B;  1OGJ A;  3OE7 A;  1ZM3 A;  4KKT A;  4XON A;  1IB0 A;  4XMY A;  1BMF A;  4TT3 A;  1KZL A;  2C78 A;  5JBQ A;  5IYN A;  4FN5 A;  1MRZ A;  3BH4 A;  2BSA A;  3JQP A;  1OB5 A;  2D3L A;  5EMN A;  2DYI A;  2VNJ A;  3Q3A A;  3WXM A;  1FDR A;  4PAB A;  4B44 A;  1TUI A;  3KL9 A;  3AVW A;  1GAW A;  1QUE A;  2GK7 A;  3QSY A;  1Q81 D;  2DER A;  4K1X A;  1KK2 A;  1EP2 B;  2X85 A;  4B47 A;  4P3Y A;  2OTJ B;  2C2W A;  2LZJ A;  3I1F A;  1QVF B;  4C0S A;  2BF4 A;  3MMP A;  2BN4 A;  2YWG A;  3CPW B;  1B23 P;  4F7D A;  1N08 A;  1P4M A;  3ASR A;  4AC9 A;  2GJR A;  2WZP P;  2Q6K A;  4HE6 A;  4UZU A;  4WZL A;  1XE1 A;  3ZPN A;  4AF6 A;  1V0F A;  1FND A;  3P27 A;  1N8R D;  1SKQ A;  4TSF A;  1QX4 A;  4G5G A;  2R6H A;  3I55 B;  1JA1 A;  3OAA A;  3T56 B;  3PA1 A;  4N3G A;  1WOO A;  5HXB A;  4MYT A;  2C4U A;  1RQR A;  3JQR A;  4LBV A;  3A3G A;  2VJJ A;  1DG1 G;  1YJW B;  2ZZE A;  1VHO A;  2RC6 A;  1VQO B;  2QMU A;  3WY9 A;  3QE2 A;  1BX0 A;  3GVL A;  3CCQ B;  1KJZ A;  3PEN A;  1Y0R A;  4TN1 A;  2V7Q A;  2WPD A;  2HDN B;  2JJ1 A;  1RQP A;  3B78 A;  3CRZ A;  4PC7 A;  5CDF A;  2DY1 A;  3A35 A;  3WND A;  1EP3 B;  1OHH A;  2XEX A;  1WPC A;  1VQ8 B;  4ROX A;  2OYN A;  2X6W A;  1N05 A;  2OBS A;  2ZZF A;  1I8D A;  3FKS A;  5DS0 A;  4FK8 A;  4C43 A;  2V31 A;  1UD4 A;  2DOG A;  4RCY A;  2JN9 A;  4RPB A;  4XOP A;  3W2F A;  1R5O A;  4RJL A;  4Z4W A;  2VBV A;  1D2E A;  3GQB A;  1WSR A;  2D74 A;  4AF7 A;  4DNT B;  2F1M A;  5BSX A;  5FIU A;  1EWY A;  5FNZ A;  4DQL A;  4OPV A;  1R5B A;  2XND A;  4G7X A;  4Z1M A;  3U6B A;  3CCV B;  2B5O A;  1VQL B;  4N3N A;  5H5J A;  4ZCM A;  2VNH A;  1H42 A;  2WZN A;  4XOR A;  3ONY A;  2QN6 A;  5GV8 A;  1NB9 A;  1BX1 A;  2XZP A;  1VQ9 B;  4RDJ A;  1M90 D;  3B8H A;  3CCS B;  4YEL A;  3PA2 A;  4NNJ A;  4PAA A;  2C77 A;  3AGP A;  2ZL6 A;  1W2B B;  3VO1 A;  2BM0 A;  5KSW B;  4H9G A;  3SLN A;  2XOK A;  3SKB A;  3I56 B;  4XD7 A;  3QFC A;  4E0F A;  3W2H A;  3HAG A;  3GVJ A;  4M53 A;  1W34 A;  1E43 A;  2WSS A;  4X06 A;  1CQX A;  3ZZ0 A;  1H85 A;  2F4N A;  3VNV A;  3GVK A;  3E20 A;  2QTZ A;  4M1K A;  2YWH A;  3OKX A;  1PJ5 A;  1N07 A;  1PJ7 A;  4FXU A;  4LBY A;  1J9Z A;  3BY1 A;  4OOX A;  4PGO A;  1G7C A;  4TKO B;  5IYP A;  3G4S B;  5DN6 A;  2OK7 A;  2ZL5 A;  3CCE B;  3D26 A;  1E79 A;  5IYR A;  4YAF A;  1NJI D;  1T6Z A;  1KC8 D;  3W5V A;  4L8J A;  2Q6O A;  3Q6R A;  2VNK A;  4YEJ A;  4Z4R A;  1OB0 A;  3WBK A;  3OJX A;  1R5N A;  5L46 A;  4PC1 A;  3LQE A;  2CRV A;  1OB2 A;  4XLC A;  3OW7 A;  5A8A A;  1ZUN B;  3H94 A;  1DDI A;  4Y9U A;  3OJW A;  2CK3 A;  4XN0 A;  1HA3 A;  3PVD A;  4TMZ A;  4KKS A;  1KMH A;  1V5V A;  1V0E A;  3G6E B;  2GQF A;  5DSZ A;  4ASU A;  4OOV A;  4U9U A;  1I18 A;  3A1P A;  1VQ4 B; 
#chains in the Genus database with same CATH homology
 3PA1 A;  2OBT A;  3RY8 A;  4P26 A;  4QVJ A;  3AST A;  4X7C A;  1IHM A;  4RLZ A;  3ASQ A;  5J35 A;  4QUZ A;  3SLD A;  4ROX A;  4RDL A;  4RM0 A;  3ONU A;  2OBS A;  3ASP A;  5F4O A;  4OP7 A;  4RPB A;  4WZK A;  5IYW A;  4Z4W A;  3SJP A;  5BSX A;  2ZL7 A;  3SEJ A;  4Z4V A;  4OPV A;  4QVA A;  4Z4Z A;  4RPD A;  4X7F A;  3LQ6 A;  3BY2 A;  4WZT A;  5BSY A;  4QV2 A;  4P3I A;  3ONY A;  3Q6Q A;  5F4M A;  4RDJ A;  3PUN A;  4Z4S A;  3V7A A;  4P25 A;  4Z4T A;  4Z4Y A;  5KW9 A;  3PA2 A;  5HZA A;  3Q38 A;  3R6K A;  2ZL6 A;  5J3O A;  4OPO A;  5HZB A;  3PUM A;  3SLN A;  3SKB A;  4RDK A;  4P12 A;  5IYQ A;  4OPS A;  4X06 A;  4P1V A;  5IYN A;  4X0C A;  3Q3A A;  3BY1 A;  4OOX A;  4X7E A;  5IYP A;  2ZL5 A;  3D26 A;  5IYR A;  4Z4U A;  4X7D A;  3Q6R A;  4Z4R A;  3ASS A;  4X05 A;  3LQE A;  3BQJ A;  3ASR A;  4P2N A;  4X07 A;  3PVD A;  2OBR A;  5F4J A;  4WZL A;  3R6J A;  4WZE A;  3Q39 A;  5E6T A;  4OOS A;  4OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...