3OPOA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
296
structure length
296
Chain Sequence
QNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 34
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3opoA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3opoA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3opoA01
2PCFB 3QIAA 1BDOA 1H9RA 2BA0A 5A35A 5BN4A 1GUGA 4LJZC 3OPOA 2A6HD 2DNEA 2K33A 1FYCA 3PUXA 3KLRA 1H9SA 1OXXK 4G7ZC 2D5DA 3TZUA 3I4LA 2A69D 1O78A 1V43A 1E2VA 2DN8A 1IW7D 2YYZA 3L7ZC 3T51B 1Q1BA 1ONLA 2B8FA 4KKUA 1CTMA 2AWOA 3CRKC 4TQUS 5KNDA 2QF7A 1Y8PB 2D62A 1GJXA 1DXMA 2BE5D 3A8IE 4DK0A 3AB9A 2EJFC 1G291 4H0LC 3IKJA 2E76C 1YNJC 3FMCA 1DD2A 1OXUA 1A6XA 1K8OA 3T56B 1EWHA 2NN6H 2AUJD 2V4DA 1GUNA 2NN6I 1VF7A 3GD7A 3OOCA 3D31A 2F1MA 2Q8IB 1H9SB 4OO1H 5JEAG 5BN5A 3LNNA 2ZT9C 2A6ED 4KN7C 1HQMC 3QG1A 1H9JA 1GUOA 1VF5C 3A8KE 1TU2B 4GZYC 4RCNA 4G7HC 3IFTA 5C0XG 2O5JC 1Y8OB 1GHKA 1Q12A 1K8MA 1Z7TA 3LWUA 3GQBA 1H9MA 2K32A 1TKWB 3P20A 1VDZA 3M85A 1I6VC 4HR7B 3T53B 2KCCA 5K36G 3MXUA 4JK1C 3A7LA 1LABA 2DNCA 2LMCB 2L5TA 3DXJC 1CFMA 3PUZA 3U9SA 3M4YA 4BA1I 4KI0A 4KKTA 3M7NA 1GHJA 1HCZA 3FPPA 2E75C 4H44C 4I7ZC 1IYVA 2JEAI 2A68C 3VR6A 1PMRA 1Y69U 1E2ZA 1ZKOA 2EDGA 3D4RA 2B8GA 3ND9A 1GUSA 1Q1EA 3A7AB 1HPCA 3VR3A 3H94A 4L8JA 1H9KA 2D2CC 4IFDG 3N6RA 1B9MA 1T5EA 4DK1A 2BA1A 2O5IC 2JXMB 4OGQC 4OO1G 1Z6HA 5JEAH 2K7VA 3ND8A 2CW0C 3I72A 3BDOA 3SDZA 3BG3A 4XIGS 4LK1C 3VR4A 1SMYC 3VR2A 2R6GA 3SE0A 4KKSA 1V8QA 4JBWA 4KHZA 3RLFA 2JE6I 1VCIA 3VA7A 3EQLC 3VR5A 2EJMA 4G7OC 2A68D 4KN4C 4XTCS 3PUVA 2PPBC 4DNTB 4DNRB 2JEBI 1Q90A 3PUYA 2EJGC 1E2WA 3MFYA 5KNCA 3NE5B 2EVBA 2A6EC 5K36H 4IQZA 1DCZA 1Y8NB 2AUKA 2E74C 3A8JE 4PV1C 3HGBA 2IT1A 1IYUA 2A6HC 1QJOA 2NN6G 1ZYRC 5BN3A 1OXVA 1O7LA 3PV0A 1YNNC 4TKOB 2A69C 2BDOA 3QJYA 4BA2I 1OXTA 3I73A 1IW7C 5KNBA 1OXSC 2KA7A 1B9NA 3CRLC 4IFDH 1GUTA 2BE5C 4KMUC 1HTPA 3PUWA 1FR3A 3W3AA 1LACA 1CI3M 5C0XH 4H13C 3WDNA 2PNRC 3OW7A
chains in the Genus database with same CATH superfamily
1WTRA 3CKIB 3QIAA 4A3LG 1PKVA 1KK2A 5HXBA 4G7XA 3VNVA 5A2QE 4HMIA 4OIJA 4JPBW 1LO5D 3Q22A 2F43A 1F9PA 3ASRA 3BDLA 1RD9D 4AYBB 1VQMB 1SLJA 1UE6A 1RKNA 1Q9SA 1CTMA 1A8PA 2F0QA 2DERA 3KFUA 4POFA 1STAA 1HNXL 3T56B 4G1BA 1H85A 3D31A 4DV7L 4ZV4A 4OO1H 2IW3A 3ER0A 2IWHA 2ZXIA 1VQPA 2V31A 2J4XA 2NZOA 2F0HA 4Y7NH 2ICEC 5E7NA 5KYIA 1GUOA 3EJIA 4IUTA 3PO3G 3AEVA 5CV7A 1KXLA 1N07A 1HNZL 1KK3A 1V1OA 4XOPA 4S3SA 2ZBUA 1R5BA 3S15H 3I55A 3M4OB 3R2IA 3HOXH 1T9HA 1BBWA 5CORA 4FF1A 1TWCH 3KDFA 4EGVA 4QGUA 5JJIA 1NNXA 4OPSA 2NVXB 2E2IH 1EIHA 3PUZA 1AP0A 3U9SA 1EY5A 3IL8A 4DK6C 4KHPL 1VQJA 4H44C 2R61A 1YJNA 1ILPA 3HKZG 4DR3L 4Y7CA 3HOWH 3B78A 2K5NA 2I1LA 2VUMG 2EYOA 1A2TA 3DDYA 2D2CC 2FVGA 4P6YA 1CT1D 5IYBH 2K7VA 3Q3AA 1UUPA 1SYEA 2JJ2A 1IBKQ 2VNJA 1CNEA 4G1VA 5HKKA 4HE5A 2IHFA 2D3NA 4C3HH 3L9AX 3HOZH 1IXRA 4PZ6A 4JI5L 4GKJQ 2VNKA 5EQ0A 5M3FG 4LC0A 2PW5A 1FNBA 2X69A 1EQQA 4ACBA 5IYRA 4IO9A 4G7OC 2DYIA 2KEDA 1HH2P 2ZXRA 3PMFA 5IT9E 5KNCA 4A3FG 1AN8A 1F9SA 2GREA 3FPKA 3AYHB 4B9XA 3HGBA 4Y9RA 3RD4A 2HD3A 1RF2D 1HZCA 1K8AC 5BN3A 1PH2A 3S16B 1BF4A 1S3OA 1ZEQX 1W6KA 2UU9Q 4IOAA 1TS5A 4LBWA 5IGGA 1HQRD 1QVGA 1LT3D 3JQPA 3K80C 2KHSA 4A3GH 3UI2A 2G5DA 1PZJD 5IGEA 2XOKA 2CHBD 4A3IH 3OJXA 3A0JA 4PAAA 2Z4IA 1W0JA 2L4NA 2Q6LA 1WP6A 4YHBA 4M1UB 5DM63 2SOBA 3I4OA 3MWYW 1W35A 2H5XA 5E4XA 4M8AA 1G2TA 3VYTA 2YV5A 4YXWA 4PG3A 5J3BA 3PUXA 3TDQA 1YJWB 2F0IA 3G6EA 1KDCA 1T5XD 3TZUA 4DUYQ 3CD6B 4LF6Q 4APVA 2DN8A 3FHWA 2XNDA 3NK9A 4C2MB 5LMUQ 2RSNA 4YHHL 2JK8A 2JIZA 2OBRA 1WCMB 3Q0AA 4DV5L 2B2WC 1NB9A 5CBEE 2TSSA 1I50H 1G7CA 3CC4B 1KRTA 5C44H 3BS1A 1SSOA 1G7SA 5J1ZA 4DV2Q 2X6WA 5BN5A 1N8RD 4DV6Q 2RBMA 1MABA 3U9OA 3GTPB 3D4WA 1RDPD 3DUZA 1JOQA 1IYJB 1UD4A 5CV5A 3ZBUA 4UHVA 3W5OA 2FHTA 2B2TC 3W5UA 1A62A 4GLVB 3MHBA 3KJPA 5C4HA 1P4MA 2QN6A 2F0GA 2BGJA 1H9MA 3PENA 1N0VC 4O2DA 3W2DA 3KK7A 3QFRA 4LF8L 3I56A 2LMCB 4ZQ3A 1W34A 2RHSB 3I4MH 4X3KA 2UXBL 3EN2A 4ZKBB 1EOVA 1X3FA 1Q8IA 3WY9A 3CCJB 2ZXOA 1J9OA 1VQIA 2I07B 3VR3A 4V190 3FKIB 1LTSD 2WV6D 1VQ7B 4DK1A 2K05A 4Z4UA 1A15A 1KZLA 5TY0A 2JXMB 1WTQA 2JA8B 3S17B 1I8DA 1S0UA 1Q86D 4XIGS 1EY9A 4HIDA 2YWFA 3VR2A 4DQKA 5F2DA 1PH4A 1HNXQ 1HZ9A 4NB3A 4AIMA 1PFNA 3DEPA 4DV7Q 3MZ5A 4LW1A 4K2KA 4M0LA 4DNRB 1K0RA 2G9DA 1IBMQ 5C4XG 1K0SA 2B63G 2CFMA 5IY0A 5FLXc 4K2LA 2XNCA 2JQOA 4UP8A 1HA3A 2ZL7A 1DOKA 2NBFA 3GTJB 1ZXTA 3MVVA 4LF9Q 2IT1A 2WKCA 1N36L 2L1BA 4POGA 3BYTB 4XYOA 3SK4A 1L1OB 4A3MG 1SMYD 1WTXA 3CQZB 4XN3A 5IYPA 4A3BH 3V7AA 2K5HA 5J39A 2RSOA 4TMWA 2F3WA 2OTLA 1DOMA 1BBUA 4QHYA 4QY7A 3CCVA 4KHPQ 1CI3M 1F77A 1H8HA 1X56A 3GSIA 1SNOA 3OWFA 5ELFA 2QDBA 3ULLA 3WDNA 1VQEA 2RC5A 4DR3Q 2VNUD 1CKNA 1G7RA 1MBYA 2R92H 1EOTA 2RKSA 5KSWB 1EZ8A 1C0AA 3OW2B 3KLRA 1D8TA 3ZBTA 5G3LF 5M5XB 3TBIB 3KYHC 1ZM2A 3GTQB 3SXHA 1KK1A 3ERQA 4LF4L 1WVLA 4WORA 3J7AV 1PRTF 3Q6RA 3BVZA 1X65A 3KF8B 2F4IA 4IURA 5FLMH 1WYDA 3DM3A 4YAOA 4OHJA 4WFN3 3HRZC 2DGYA 4DAMA 4JI5Q 4UAIA 1GXDC 1BMFA 3HKSA 1OXUA 4OONA 2MHVA 1LV9A 2P3MA 2J7KA 3AGQA 3TP7A 1KQSB 4DUZL 4CJ0B 4HJ9A 1WTWA 4BY1B 4AYBE 1I18A 1DOLA 1RODA 3CCQB 1TY0A 1SMXA 1VF5C 1KK0A 1PXUA 4K8JA 1FNWA 2O4XA 5C3EB 3E6ZX 3CPWB 2SEBD 2VNHA 3IFTA 5B6IA 4DF7A 2IX1A 3A3BA 1GKHA 3HOVH 5EAYA 2Q2IA 2UXDL 4L5RC 1ENCA 1F2LA 4ZUIA 1QG7A 2XTIA 2E1RA 4DR1L 2KCCA 3M4OH 1QE6A 2V7VA 2Z4HA 4J6HA 1GR1A 1SNDA 4B9WA 3NBHA 3M7NA 1S5BD 1NAPA 3HOYB 4TMVA 2ZXHA 4EH1A 3CCLB 1W9XA 3OIQA 1W87A 4XLHA 1M1KD 1TWHB 4NXNL 3VNUA 2RQXA 4GN4B 1SJHD 1QILA 3K58A 2VQEL 1EYAA 1UE5A 2B2WA 1SM4A 2IX3A 4JI4L 1N33L 4A3DG 3CC7A 3ASSA 3BQJA 2RDGA 4B08A 3W1BA 5FOBB 3K81C 5DAUA 3W2FA 2KCNA 2Z8LA 1LTLA 3CW2A 1Y0RA 3CC2B 1CZWA 1WD1A 2A68D 4IPCA 3MEHA 5F4JA 1PYSB 3Q38A 1OTCA 3OEEA 3CCUB 2JA6B 1Y1WB 5CR3A 3QOLA 2K6AA 4WJ3M 2AUKA 2EYMA 4OOXA 4P1VA 4FP5D 4PMWA 3SLDA 2E1BA 2WB1B 1PTOH 5EPKA 4DFAA 1QCBD 4DN4M 4KY5A 2BDOA 2F52A 1PLFA 2C78A 1MIUA 1EXMA 4R4QA 4LF8Q 3QFSA 4XD7A 4F88A 2Z9HA 4ME5A 2YWGA 3BH4A 1VQMA 2UXBQ 4A3JG 1AZQA 1SYGA 3HOUH 2MGSA 4ZUJA 3ONYA 1JWUD 1SYDA 2X85A 4O42A 4LBZA 1A3UA 3H0GB 4QUCA 4P26A 2R9VA 3NUCA 4P22A 2D5DA 4B3SL 1B3QA 1XTCD 1O78A 4BBSB 4A75A 2AMCB 1SKYB 2WKDA 3WNBA 4DR4L 3CRKC 5KNDA 2PNHA 2QKIC 1MRZA 2QCPX 1V5VA 4TVAB 1UD8A 2E76C 3IKJA 4KV6A 3WWVA 4DK3C 4EVOA 1EWHA 2ZTNA 2GVBA 4ZRZA 1CHQD 3HEJA 4X66L 1EU3A 2F0EA 2BF4A 5JEAG 3JAMi 4OO1I 4RDJA 4H02A 2K03A 2VBUA 2A6ED 1HQMC 1B4OA 3QG1A 2TMPA 2ZITA 3P1HA 1G91A 4PC3A 1N36Q 1FJGL 3SLNA 3AFPA 3I3CA 1F9QA 2O5JC 5GAGC 3SEBA 1EZ6A 3HG9A 4IUUA 1YZ6A 1QOHA 4OWXB 5FLXE 1Q86C 1VDZA 4QUZA 4JBKA 2UXCQ 3T53B 3HAGA 2DNCA 3S1NB 4RCOA 5HURA 2Q8RE 1WD0A 3I7FA 4RA8A 4A93H 3HS0C 3Q6SA 1IYVA 2JDIA 1RTOA 1L0YB 3S15B 1ZKOA 1WTOA 1H95A 1OGJA 1VJSA 1JORA 1A3VA 2UUAL 3F2CA 4PC6A 3K7UC 4RHSA 4CDFC 3JAML 1H9KA 4KJNA 1YBYA 4LF4Q 2C5BA 1TWCB 2M2LA 3N6RA 1MJCA 1VQOB 2PO4A 5JBQA 5NUCA 2WFWA 4PZ7A 1KRHA 3KLSX 4E0FA 3FKIH 1SMYC 3UDFA 2PIAA 1PTOF 4OL7A 2QTZA 1X6OA 3OKXA 1E1RA 3JC66 1NJIC 2JA8H 2HCCA 3S17H 1LTGD 4DUZQ 1JT8A 2QEJC 4XMYA 3AU7A 1CQFA 4L6TB 4YWLA 2DEUA 2F0JA 3H15A 1WTHA 1EEFD 4TMZA 1KD1D 3MXPA 1E64A 3AVVA 4JYAL 3HOZB 5BR8L 5LMNL 2SDFA 4C3HB 5I4DA 5D14A 1HA6A 4I7AA 3WOFA 3KLWA 1YJWA 2YTVA 3CD6A 4N9TA 4DR1Q 2R93H 1D1KA 1TQOA 2K5WA 1MJEA 3WQZA 4YEJA 1SNMA 1JWSD 2F0DA 3ZZUA 1RIPA 1EIFA 2ZJQA 3CQZH 3W3AA 2V7QA 2MO0A 4H13C 1PHJA 3PO2H 2MNAA 3CC4A 3OW7A 2PCFB 2XRSD 1BDOA 5G3LD 5A35A 5DM73 1RCVD 4CJ1B 4DGZA 1S5FD 5KW9A 2VQEQ 4K0KQ 3SEJA 2NUCA 2Z6BA 1KMHA 4C3IB 3J7YW 4JI4Q 4A3GB 1GVPA 4P73A 3V76A 2WYRA 4X64Q 1LM0A 5A88A 3DM1A 1QUQB 2DETA 1HA5A 1XX8A 1VQBA 5GADC 4RPBA 1G291 3RNUA 1K8OA 4ZCIA 4C3JG 4Z4WA 2VY3A 3STBC 1ZM9A 3CCMB 5BSXA 1EWIA 4JVZA 3CP2A 1YHBA 3LNNA 3QOJA 3D4DA 1XE1A 2B2VC 4JG2A 2VB3X 3MEFA 3R8BA 4BY1H 1SE4A 3R93A 3CCJA 1DYQA 3J7A5 3GVLA 4DAPA 1B3AA 4BBRH 1VQKB 2E2DC 5C44B 5J3OA 5IT9c 2BN4A 1KAAA 3J7AF 4GKKL 1KNEA 3SGIA 1BPLA 5LHY1 1VQ7A 4DR7Q 4IPDA 4NKLA 5C3EH 1TWAB 3H6MA 2QE7A 1CFMA 3A55A 1JQYD 1TTTA 3EFXD 2B3GA 2QDXA 1VQ6B 4KKTA 1PRTB 4TSFA 1EFUA 2D0PA 3FDTA 2BPOA 4WJWA 2A68C 4E6IA 1N32L 1E3XA 2EDGA 2A8VA 1Y1VG 2IL8A 4B3SQ 4IFDG 1CQVA 3F2DA 5BSYA 2XN9C 2GN5A 4AQYQ 1D8LA 1QG0A 4DR4Q 2E2HB 1ET9A 1TWHH 2IJ0A 4LWCA 1CHPD 3A35A 3N52A 1L1OA 2EYPA 2E8GA 2Q8TA 2Y0SE 3VR5A 4XQJA 1G7TA 4IUNA 4C43A 1SXTA 4HEDA 4ZGNB 2FINB 2EJGC 2VL6A 5M3MH 1X9NA 1K3BC 1IBLL 2F0MA 2CH4W 3H9NA 1KJZA 4R4OA 2ZZFA 3MFGA 1S72B 1OB2A 3OHXC 1O7LA 2JA6H 1ZUNB 1Y1WH 3I1FA 3OW2A 1G2SA 2B7CA 3GIRA 1D5ZC 3SHLA 5IYNA 1OB5A 1JJGA 2GK7A 5I2YA 1J9ZA 3NBHB 4N9PA 2DCUA 4LUOA 3Q24A 3KF8A 4HJ5A 1QZHA 1WOCA 2EYJA 3CMEB 3G4SB 2K04A 5FO1A 4KMUC 2WB1E 1FGBD 1VQAA 2EY1A 1DG1G 1H42A 3ES9A 5I9OA 4BY7G 4LFBQ 3S1RH 2NVYH 2RC6A 3VA5A 2J0TD 2A6HD 2ZM6L 3B82A 2DNEA 4HJ7A 1KQSA 2B63B 4ZGQB 2SNMA 3I4LA 4A3BB 3AQQA 3CCQA 2K50A 3W2HA 2XEXA 3L7ZC 2NWGA 5E3FA 3OFNA 2AWOA 5IWAL 2ZZGA 2D62A 1QFYA 4OXPA 3CPWA 4A3EG 3A8IE 5FJ8G 5LL6S 1ESFA 3K5LA 1QWYA 4EQOA 2R92B 5J22A 4RGMA 3U4VA 5I9PA 1A63A 1NDHA 1CSPA 1XYIA 4Z4RA 5H1SE 2NTTA 3VDYA 1B44D 4IUQA 3J7ZC 3IRBA 3CXCB 3A8KE 3CCLA 4JYAQ 5BR8Q 5LMNQ 2L12A 4RDLA 4DV4L 3PA2A 1WTVA 1STYA 1STNA 3VO2A 4LNQA 2P5ZX 4WJ4A 1Z7TA 2IHEA 1WDTA 4OEMB 5IGFA 4DV1Q 4CDEC 4A3LH 4Q0FA 3OZUA 4ZK9B 1D1IA 1O80A 3I8ZA 5T1GA 3QB3A 2X8KA 5M9OA 4Z4TA 1JE4A 2PZUA 3EBEA 4NCNA 4P72A 3C1FA 2LFNA 2V7TA 2PZTA 3CC2A 3K57A 4QV2A 5DS0A 3S1NH 2VXWA 1E62A 4IJHA 3HOVB 1OGIA 3J80E 1R4QB 3LO8A 2AQ3B 2QW7A 1PZKD 3CCUA 1KD1C 5FA6A 3WOEA 3F2BA 2ASBA 4OO1G 4K6LA 2E2JH 3BG3A 4LK1C 3D26A 1DDIA 3F2UA 4FO2A 1IJFA 4TT3A 1C8CA 1NE3A 1EY0A 1CA6A 4X6AH 3VA7A 2ZZEA 2SNSA 1XPRA 2B2VA 3KOJA 3RN5A 4DNTB 3W1GA 3HOXG 2F0NA 1N0UA 2MO1A 1ENFA 4JI3L 2MFIA 3C1EA 1BCPF 1DCZA 3SK5A 3OYYA 2BM1A 3BC9A 2NN6G 3GV6A 1NTGA 1OXVA 1D6EC 1PRTC 4LAAA 3A8IA 3NTHA 4Y9UA 5EKKA 1B2RA 1OXTA 3J81i 4GKKQ 1PJ7A 3NQTA 3HOWG 4ASUA 2VUMH 1FDRA 1G8ZD 3HKZE 4JBMA 3U6BA 5JJZA 2AKWB 1WOPA 4OP7A 2PNRC 1JB7A 2NVTH 5KEEA 1LTTD 4RCYA 1N32Q 3A8KA 1PTOB 1WSVA 1LTBD 1NSNS 1FYCA 2LY7A 1EUJA 4G7ZC 1E1OA 2QGQA 3R6JA 4P6VF 2Z6BD 1K9MD 1VQDA 1ONLA 2KUMA 3T1YL 1VQ9B 4KKUA 1U0LA 2BVNA 2OF1A 4TQUS 2VYQA 2QF7A 2V7WA 3BYYB 3TREA 3HOUB 1HXYD 1EEID 1E43A 4YWKA 4C3IH 1O7YA 3L2PA 4YWMA 1R5OA 3J81L 4DR5Q 4GLXA 1HZEA 1HFNA 2C4TA 1H9SB 1D5MC 1I6HH 3PQIA 4X8IA 3NTIA 1IBLQ 5C4JH 1SYFA 2DJFC 4A3IG 3MMPA 1COWA 3JQQA 2XZOA 3MXNB 1Q12A 1KNAA 4TRDA 4CDCC 2PMDA 4Z4VA 1TWFH 2ZTCA 1BVSA 1YHAA 3T13A 2OXPA 1VQOA 2XWBB 3CU7A 1AE3A 1V9PA 4QJFA 1STEA 4DXGA 4L5SA 4LMQD 2NZHA 1KAWA 5CBAE 1I4GA 3OIPA 3CW2C 4I7ZC 2JEAI 3BY2A 5F4OA 5J35A 1TWAH 3OTOQ 4JOIA 3K0XA 3FVQA 1QVFB 1HPCA 2X53S 3HZXA 4R8IA 3CB4A 3TSSA 4A3KB 3CAMA 3PUMA 3ULJA 1NCVA 5IWAQ 1STHA 3OZVA 1W2BB 3GTKB 2EXDA 4A93B 2R6GA 2CH4A 3SE0A 4KKSA 3CCSB 2CK3A 4B3GA 3GV3A 3TQYA 5JJKA 2E2HH 4IPGA 4NPSA 2WIIB 1MSHA 4JI6L 1NBMA 3GTOB 1NUCA 3DEOA 3WBKA 1ZM3A 3K0YA 3GO5A 3MFYA 3TMEA 2EVBA 2NB0A 4LF7L 2ALYB 1SR3A 2E74C 4XQNA 4HSPA 2A6HC 1F9RA 3I4MG 4R71A 4RAUC 2IX0A 4MYTA 3D3RA 1SBBB 4RHRA 1OXSC 2C35B 1XFOA 2C2WA 4IOCA 5K5PA 2JA7G 3DHQA 2R3ZA 4R4TA 3LVBA 4ULLA 1QUQA 4P3IA 3CCRB 1LT5D 3X3NA 1IL2A 1ENAA 1A6XA 4RJLA 2NPFA 2X6YA 4K1XA 5ELEA 5C3XA 1EIYB 2I5LX 4LJZC 4RPDA 3MXGA 3CCMA 2K75A 4FXDA 5EKIA 4FWTA 1N9WA 2NYZD 1S5DD 4JI1L 4X7CA 1HNZQ 4ZAIA 4XKWA 1B23P 1KIXA 1N06A 3MCAA 3RUZA 1X3GA 2JA5B 2R93B 1TR5A 4UP7A 4LFCL 1W0KA 2XNAC 1VS0A 5C4XH 4II3A 2WJVA 3ZZTA 1K83H 1SAPA 2B63H 3AMUA 2QDLA 4FN5A 5M5YB 1NJID 3GTMB 3PO2B 2EJFC 4RMFA 1MGSA 1VQKA 2F4VL 3WNDA 3H91A 1ZM4A 2JP1A 2V4DA 3ZC3A 2Q6KA 2QGGA 2R7DA 4OWTB 3TZDA 4EQNA 5IYDG 4LF5L 3W2EA 1N34L 1PFMA 4JI3Q 2L0CA 2JSOA 2HMAA 4HCSA 2GVAA 1VQ6A 1M4VA 5IP7H 1Q8KA 4HE6A 4RKBA 4EX5A 1UE1A 1QH0A 3P27A 1IHMA 3I4NG 3S2DB 4LBVA 4P3YA 4B3XA 4YELA 1ASZA 1NR2A 1XMOL 2L55A 4B47A 5EPJA 2UUCL 2A19A 3U4ZA 2YTYA 4HTHA 1PTOC 2WINB 3P20A 1I3QB 3NBIA 1FNMA 5K36G 2PLFA 4OX9L 2HDNB 4XLCA 2OQ0A 3HFZB 1GHJA 4N3NA 2X6XA 2RA4A 4GNXB 2OBSA 3P26A 1PMRA 2F0WA 4BBRB 2I5HA 1Q1EA 2WAQB 3PUNA 1STGA 3VMFA 4AYBG 4DV0L 2A1AA 1E3ZA 4A3CH 2JJ1A 2O5IC 2B7BA 4PMCA 2JA9A 3T1YQ 1B8AA 3BDOA 1I94L 4R9WA 3FJOA 1S72A 2OCEA 3EA6A 5ELOA 2Q2UA 3STBD 3ASTA 4OPOA 2EXZA 3UE1A 4XTCS 4R4CA 5C0XI 3PGZA 1XWEA 2Z0SA 3AVWA 1E2WA 3G4SA 2ZL6A 3CMEA 2VBVA 2HLDA 2YWEA 2BV3A 4NBSA 1Y8NB 4GN3B 1KHIA 1FRNA 1SDFA 4IQZA 4DR2L 1PYWD 1V0FA 4IPHA 2Y0SB 3NWSA 4CKEA 3NENA 1A0IA 4TKOB 3ZPNA 1Y0YA 4YHHQ 3LQEA 4DV5Q 1K9MC 1XMQL 1MI2A 5M5WH 1B9NA 4RDKA 2HQEA 5M3MB 2CW5A 1CKMA 4XNFA 1QX4A 4A3DH 4M4SA 5KIXA 1PH9A 1L2FA 1VQLA 4G6IA 1H9RA 3WXMA 1GUGA 2M9VA 1IZ6A 2OK7A 4FF2A 1BUVT 1ZYRD 2A73B 2W6IA 1LUZA 4IUPA 3H3VH 1JJ2B 4LFAL 4RCZA 1L0WA 3WBJA 2EFGA 4PC2A 4BS9A 1GAWA 5IK2A 1D7QA 3A5UA 4QIWB 1JA0A 3CXCA 1D1NA 2R7ZB 2XZPA 5JVH3 1ICWA 1BCPB 4CHTB 5FLXL 4UZUA 3S1RB 2NVYB 2AUJD 3LWEA 1RQPA 2ENBA 2VS1A 4JI6Q 4QQBX 3AGPA 3JQRA 1STBA 2EZVA 1JB3A 1F2ZA 2CQAA 3RZOB 4RD6A 3KF6B 4G5GA 1TS3A 4LF7Q 4P9SA 5AN9A 1YVCA 4UZEA 2L9HA 4UP9A 1UD6A 2B5OA 1LTRD 2ID0A 3P75A 4GS3A 4QVAA 4X3TA 5FIUA 1VQ8B 4CKCA 4HIKA 1R4PB 3E20A 1A3TA 1M8AA 2WJYA 4P25A 2L5TA 5GV8A 2X0KA 1BOSA 2YTXA 1FNUA 2VB2X 4ABNA 1L1OC 4DQLA 3U58A 2FMMA 4GLAC 4HN7A 1EFID 2B8GA 2KEEA 4JI1Q 1ELOA 4MTNA 3DWPA 1MKHA 2VJIA 1SYBA 4LFCQ 4H9GA 3ZIAA 1WCMG 4J0QA 5JEAH 2VQFL 1CQXA 3DLLA 5C5LA 3M3YB 2XVSA 5LMNW 4XONA 4L5TA 3S9WA 3G7LA 4X3UA 4C56C 4A3KH 2N88A 3K5NA 2KCMA 2V7UA 2B29A 1XXGA 2EJMA 3MTSA 4KY6A 5IGDA 2O2LD 3KBGA 1LTAD 2AHOB 1V1PB 2HDMA 3GTKH 3R6KA 4L5QA 3U2QA 1AW7A 1SE8A 4UPAA 1W6JA 3PF5A 4RLZA 1FVIA 1LLRD 3BCFA 3A8JE 3GP7A 2E2JB 2GJKA 1IYUA 3GTOH 4IUVA 3X3MA 2YU9H 3CF5A 3PO3B 1HR0L 5ISRA 4WZKA 1TIID 5E1FA 3I73A 3SJZA 4I65A 4TMXA 1Q82C 1GO2A 3S2HH 2VJJA 2CVRA 4CKBA 5CV6A 2RF4A 1VQ9A 2ZJPA 1GD7A 2UUBL 4QVJA 1C48A 5F4MA 2I0QA 4FDBA 1SROA 3BZKA 1SE3A 1I5FA 3FKIG 4ZKCB 4JI0L 1U5KA 2B2UA 4YAFA 2H1EA 1KLGD 3C2PA 2VZAA 1H9SA 1JCKB 3HKZB 3I90A 4DV0Q 2JA8G 3GTGH 3TP6A 2HQLA 4XQQA 2VUMB 2XZLA 4RD3A 1YJ9B 2RCNA 1S40A 1I94Q 4RD1A 4TSSA 2UXDQ 1PA6A 1WI5A 4KJOA 1KLUD 2NVTB 1UD5A 2JA5H 4MHEA 3J80c 3IAYA 3FMCA 3MXNA 3C2QA 2CCZA 4M1KA 4RM0A 2K01A 5GV7A 3OOCA 4OOVA 4FNFA 4FXGC 5IGBA 5M5YH 1JMCA 1G51A 2Z1CA 4Z9CB 3SKBA 5M3FB 4QF4A 3E0JA 4XYQA 3GTMH 4PNYA 3S14B 4KN7C 2MQHA 3CP8A 4MTKA 4NXNQ 4DR2Q 5JEAJ 3A1PA 4JBJA 1TU2B 1IJEA 1A8VA 3EROA 1PRTD 4A3FB 4GZYC 4RD2A 4G7HC 4XT3B 1FGUA 5KYLA 2BGIA 1GHKA 4RD0A 1N33Q 4JMQA 1QVFA 1ASYA 3T1HL 1SFOB 1UD3A 1UNSA 3G48A 3J81k 2K32A 1XJVA 3S2DH 1TLLA 1DARA 3ONAB 4HR7B 5HGQA 4L63B 4KD3A 3DXJC 1I6HB 2F0FA 4ILWA 4ODGA 4QL5A 1W2BA 1V0EA 4BA1I 4HIZA 1AIPA 4KI0A 4U9UA 3CMAB 1HCZA 3CCSA 2E75C 1I3QH 5EJWA 5C4JB 4X0CA 1FRQA 1QNUA 2KENA 1Y69U 3CMMA 1WOSA 4B48A 1BCPC 3BDCA 1PH3A 1RL2A 1YITB 3U50C 4C3JH 3W5HA 2K4KA 5IIFA 3G71B 1B9MA 1TWFB 1YI2B 1VQHA 2CWAA 1Z6HA 5IYCG 2CW0C 5EGTA 2HIVA 2DUDA 2KHIA 3A74A 2H4OA 1X32A 2YWHA 3WYAA 1I4PA 1E1TA 1IL8A 2WAQE 4R8NA 1JOOA 3RLFA 4BY1G 1BX1A 4M53A 2LSSA 1Q46A 2F0OA 4DKAC 3Q6QA 3CCEB 3AVTA 1HFGA 1PH5A 5C3EG 4XDXA 1J8IA 3CCRA 2QILA 1XNRL 5A8AA 2F4NA 1QJOA 1EP2B 1AEXA 2ES2A 1ZYRC 1Q3LA 3BU2A 4J15A 1YNNC 3QJYA 4P75A 1M90D 1OHHA 4CDDC 4BA2I 3NSWA 3KBXA 4FK8A 1WPCA 4JC0A 1YX2A 1LT6D 1EP1B 3NELA 1Y1VH 2C77A 4GKJL 3KL9A 4XORA 3HOYG 4IFDH 4NNJA 2CKZB 2EY2A 2EY6A 4X66Q 3RMHA 5IE8A 5C0XH 2KCTA 3PF4A 5AFWA 1SJED 1YIJB 4R1JA 1WSRA 5H59A 2BA0A 2K1BA 2PMZB 2W6JA 2K33A 5EBCA 1U4MA 4Z4SA 2N78A 4Q7JB 1FJGQ 1SYCA 5GROA 5A2QL 2HCIA 3ZZ0A 1E2VA 4XLFA 2VQFQ 5DEHA 4HJAA 1BQEA 4BPRA 2YYZA 3T51B 3OP1A 4NMZA 2IPKD 4PZ8A 2B8FA 2UU9L 4PGOA 1N08A 5KNLA 1DXMA 4AH6A 1VQFA 1EY7A 4O1NA 1IKMA 1DD2A 3FEWX 1BQQT 1ET6A 3GD7A 1VF7A 2LXKA 2JA6G 2CF4A 1Y1WG 2R7ZH 2BCOA 1KABA 3ASQA 4QIWE 3V96A 5ELNA 3V2TA 2WB1G 5C4XB 2UUAQ 1K83B 2KVOA 3B8HA 4DUYL 4ALPA 1HR0Q 1JICA 4GNXA 2PZWA 3RZOH 3TN2A 1KDAA 2I5MX 4JOIC 5LMUL 4BXXH 1E0BA 1YHQB 2RDHA 4ZCLA 2XIWA 2A74C 1PFBA 3M4PA 4A3MB 1CZGA 1B70B 1QGYA 3MHPA 2OYNA 2JN4A 4JK1C 1HHVA 2X6LA 5COYA 2OTJA 1QFJA 2UUBQ 1JB9A 2QEXB 1VQLB 2K5DA 3H0GG 4DV2L 5EMNA 1KL9A 2XGJA 1L0XB 2I46A 5IP9H 2VZLA 4TMTA 3O13A 2NTSA 4YY3L 4JI0Q 5D3DA 4DV6L 3S1QH 4H7BA 3ASPA 1WFQA 1NMGA 1EY4A 2F3VA 4A3EH 1WTPA 5FJ8H 1EYDA 4BBSG 2HCJB 3SK8A 2OBTA 1BNZA 4L8JA 1U9RA 3TP5A 4JV5L 1XPUA 2XRQD 2B2YA 4Y52H 5CDFA 3I72A 5JOBA 1AFPA 1EFTA 2V7XA 3OZWA 1GVHA 4IFDJ 3MA2B 4DAYB 1PJ5A 1NY4A 5C0XJ 4II2A 2JYOA 4KHVA 3M3YH 1QVCA 2PPBC 4CJ2C 2JEBI 4DPGA 5ELBA 4CBVA 5IT9L 4XOTA 4DV3L 4X06A 1PYBA 1S5CD 1VHOA 2KJXA 5CC4A 2DY7A 2ZZQA 3K5MA 4NDXA 1UAPA 2QA4B 3T1HQ 1PTOD 3J81j 1JJ2A 3W2GA 2IY5B 3H09A 3QFCA 3TEHB 2KA7A 1VQ4B 5HZBA 3PO3H 4LUZA 1JC7A 4OPVA 4WZEA 2Q2TA 5TV2A 1IBML 2OK8A 3BJUA 1PJ6A 3OAAA 3QE2A 3AVXA 4UDUC 3W5VA 1OXXK 4LF9L 1TWGB 1MHWC 3ULPA 3H3VI 1WTHD 2FX3A 3KF6A 3MC0B 2K14A 4P74A 2GA4B 4F8MA 5M5WB 3D0FA 1PH7A 5DSZA 1BLIA 4A3DB 3AB9A 3A54A 4H0LC 1YNJC 3K7AB 2BM0A 1X3QA 2NN6H 3AVYA 1VQ8A 5IYBG 5GAHC 3RZDH 1AH9A 4XKVA 2WZNA 2PQAB 3M7GA 1AZPA 1E3PA 1JWMD 3F8TA 2EY5A 3HOZG 3PIPA 4C3HG 1XNRQ 3NXWA 4JI8L 2BOSA 5M3FH 1T6ZA 1DGSA 4R4IA 3S14H 1BXTA 4J8QA 3BVMA 4P71A 3E5SA 4ACAA 5ELCA 1VLYA 4X62L 3LWUA 3OMCA 3R2TA 1T6YA 4Z4ZA 4A3FH 1J5EL 1SN8A 5D3IB 2F1LA 3D8GA 3BNWA 4WZLA 5CV4A 4ROXA 1AMOA 4IJLA 3GTLB 4OOSA 4KK7A 3AFQA 2HT1A 4RGOS 1NR4A 4A76A 1SFOH 1FX0A 2GJRA 3EIVA 2K52A 2V1CC 1MSGA 2CNDA 3Q39A 3VR6A 5AJ3L 4A3JB 5JJLA 3NEMA 4WZTA 3CPFA 4C3IG 1VQ5B 5C3WA 1SNPA 4A3GG 2AHOA 1EP3B 1QUFA 1V1PA 2KQ3A 3A7AB 1KDBA 1FNCA 1XPOA 1JR0D 3E9HA 2X6GA 2DIEA 3SJPA 2MP1A 3D6CA 3PIP3 1UEBA 2XNJA 1M90C 4JBWA 2RVLA 1Y14B 3SK6A 2GPJA 5HY6A 3PUVA 1KC8D 2ZXPA 3ZUGA 1Q81D 1PH8A 4MYUA 1UMKA 2EYFA 4Q5VA 2CRVA 4DU9A 1IHZA 3S1MH 3NE5B 4WQMA 2ZM6Q 1X3PA 1BR9A 1TS4A 3K5OA 5C44G 1GAQA 1EWCA 2ZBVA 3NTKA 5FKAC 3FPUB 1TUIA 4F7XA 4DA2A 3RN2A 1I4HA 4RKLA 1JA1A 1Q7YC 1YJ9A 3I91A 1HTPA 3ICEA 3M4QA 1F20A 3UDXA 2BSAA 4YY3Q 3OMGA 1PZID 2YU9B 2M00A 1DONA 4LUVA 4JV5Q 4P2NA 1VLOA 1V43A 4DV4Q 3S2HB 5TRDA 2N55A 5EKLA 1IW7D 1QFZA 1KTKA 3P7JA 4JI7L 1ESRA 1WORA 3E0EA 3W2IA 2CWPA 4G4KA 3UDGA 2PMZE 3CPXA 2DY8A 3M9BA 4DNIA 2D9RA 1TS2A 2BE5D 2PQEA 4GOPB 1GJXA 2Z6KA 3J81E 1SE2A 3RLOA 1C9OA 1GUNA 1VMCA 1X3EA 4N8X1 3GTGB 2PYKA 2LZJA 1HZAA 5KRUA 2ZT9C 4X7DA 4UZFA 3MAQA 4DV3Q 1P8LA 1PH6A 3TS2A 3CMAA 4XQFA 2JA7H 2RCFA 2MPMA 4MN3A 2BH2A 1DDGA 2F0LA 2OQKA 4ID6A 5JVG3 1YITA 1E22A 1Q82D 3FP9A 3G71A 1F60A 2EYLA 3M85A 2BMWA 1YI2A 1N05A 4PMBA 4IW3B 1LABA 1K8GA 3BCDA 5I2XA 4FF3A 1NBWA 4A3MH 2LXJA 3FPPA 5C6AA 1T6XA 1EQVA 1S4ZA 4OELB 1HTLD 5LMZA 4A3BG 3D4RA 4XL9A 1FL0A 5C4ZA 2HIXA 3CCEA 3ONUA 3T4AC 2QMUA 5IYDH 4ZCMA 1NRKA 4OGQC 2FFKB 5JAVA 3SDZA 5E6TA 5IYWA 3PIOA 3H3VC 3I70A 1FNDA 3VR4A 3U6KA 2R92G 5DN6A 2UXCL 4DAVA 5IP7G 2ZTEA 1FD7D 1B2TA 1V8QA 3TP8A 1JOKA 1XTDA 4KHZA 3I4NH 4MIUA 4RGTA 1VQNB 3GVKA 3L0OA 2ICIA 2J7ZA 5I6YA 4C3JB 5IOCA 1Q90A 1HVXA 3F1ZA 3PUYA 5FLMG 2C9OA 2L15A 3E9IA 4JI8Q 3VYRA 5K36H 3OE7A 2F0KA 4K5VA 2AQ2B 1YIJA 4K14A 5ELDA 4AF6A 3QSYA 2C4UA 1ILQA 2B2UC 1GM5A 5DLQE 4DR6L 1G6ZA 2ZL5A 2KBNA 3VYSA 3QWNA 4X62Q 1BJKA 2K5VA 2OTJB 2EIFA 3UDIA 2OWOA 1J5EQ 1HNWL 5E4WC 4XLEA 3Q8DA 5JPNC 2VBTA 1P16A 1WU8A 1GUTA 4IFDI 3PIO3 1E63A 4A3CG 1MD2D 1Z9FA 2DOGA 3E1YE 2L11A 3DWAA 4JI2L 1GUWA 3K6OA 1WOOA 5AJ3Q 3HOVG 1NB0A 4BWGB 5BN4A 1BCPD 4K5XA 1EYGA 3Q23A 1IB0A 2NV4A 1HJPA 2XWJB 5FO9B 1B50A 1CK1A 2A69D 1S4MA 2BH8A 2HUGA 2CW0D 1Y1VB 4C1NI 2XGTA 5IGCA 3OWEB 4NW2A 1TWGH 1Y8PB 2FJ2A 5I6WA 3JAMc 3FRPB 1HUMA 4PQXA 1D2BA 2R7FA 2GK6A 4NXML 1YHQA 1UWVA 5CV9A 3C3LA 1JE5A 2Q8IB 3WNCA 1HUNA 2NVXH 2QEXA 1JJCB 4Z1MA 3K7AH 3OJWA 1F2YA 1H9JA 1VHEA 4C1NK 2R6HA 1U4PA 2EYHA 4C0SA 3G05A 2N8NA 2KECA 4YAWA 4K0KL 5A89A 4K6DA 4RCNA 1YNND 1R9TB 1Y8OB 1K28A 1VMPA 4RGNA 1II3A 2E5LL 1B53A 2A5HA 5TSSA 3NQIA 4X64L 1TVCA 4B4DA 4JW0A 5EBDA 1XB2A 1I6VC 1VQPB 1EIGA 1U4RA 3NWTA 1F2MA 4AF7A 1LT4D 4ZLTF 3LGJA 1EFWA 4PC7A 4DAYA 4TN1A 1I7PA 4RG1A 4YCWA 1VQGA 1SRUA 2B2TA 3S24A 4EQ5A 1KC8C 3GTLH 2JN9A 1Q81C 4MNOA 1UD2A 3GVJA 3I55B 3T16A 4GOPC 3ND9A 3QO2A 4BY7B 4KY7A 4HIOA 5FNZA 3OEHA 4HAEA 3CESA 2NZ1D 4XR6A 3KDFB 4JI7Q 2BA1A 4WWVA 4A3JH 3HOUG 1V1QA 5FO8B 2NVQB 3GDEA 4B3RL 1C7YA 3G6JB 4DR7L 1K73D 2C5CA 1HR0W 1SNCA 2EOTA 3S16H 4O0AA 1YJNB 2QA4A 1DM0B 3EQLC 2ZTGA 4X65L 3S1QB 4A3EB 4UAJA 1DJRD 5EPLA 1VQ4A 1EY8A 1ICFB 4HJ8A 1FNVA 2WPDA 3A5ZB 1SNQA 4HCEA 4JCVE 3VYUA 3HP3A 2MJ8A 1N8RC 2FMCA 2F0TA 3I2ZA 3TRZA 2WZPP 2ATWA 5FO7B 2GQFA 3K59A 1PH1A 2PI2E 4AQYL 3DWQA 1RHPA 4XT1B 3TS0A 1KRSA 1IW7C 2MUYA 1CM9A 5FL7A 1NMFA 1I4RA 3V05A 4G7WA 2F3IA 1RQRA 4C2MH 2F4VQ 3FKSA 3LQ6A 2BE5C 2D9UA 1WCMH 4LF5Q 2HHHL 1LACA 4YCUA 2VBSA 3ISXA 2VNIA 4QB4A 4WRDA 1N34Q 4B3ML 1O7ZA 3SR1A 1HRJA 4A3KG 1TT2A 2PQAA 1U2RA 1SKQA 4X7FA 1E1QA 5C5MA 1QVGB 4DXFA 4CQJA 4A93G 4CGYB 3BVGA 1XMOQ 2UUCQ 3GTPH 4LBYA 5TR9A 4KTAA 4X05A 4GNXC 1E7ZA 4OX9Q 4Y7NB 4B43A 2NN6I 1QZGA 4PC1A 3A56A 3G6EB 3CP0A 5THXA 3NPPA 4LFBL 3CRZA 3IFDA 2RHQB 5CYUA 1E79A 1BO0A 1QB5D 3HOXB 4GN5A 3BZDB 4QCLA 1XNQL 1EU4A 1D5XC 4DR6Q 3PCOB 1VQ5A 2E2IB 1EQTA 1EY6A 1J6QA 1K8MA 3D6WA 1HNWQ 1PVOA 4ZCKA 1C4QA 3GQBA 4RD4A 1QUEA 3RZDB 1W3SA 2ZTDA 4FXUA 4U68A 1ML0D 2D74A 2PE3A 2B2YC 2LS01 4NP5A 3MXUA 4QMGA 3A7LA 3E3XA 4XM3A 3HOWB 1VQCA 2N49A 3M4YA 2QTLA 4YIJA 1D2EA 1IKLA 4JI2Q 4UY8C 1SEBD 3CHBD 1OO9B 4B3TL 4N3GA 3K8AA 2F0PA 1EYCA 1E2ZA 4RH6A 2AWNA 2PI2A 2JA5G 4FYDA 2R93G 2Q2HA 3PSIA 3BY1A 4KLKA 3H94A 2Q6OA 5L37A 4B44A 3URYA 1T5EA 1PDQA 2B39A 4X7EA 5HZAA 3I56B 3ND8A 4ME3A 3PO2G 3GTJH 4DV1L 1XMQQ 1YNJD 1U4LA 2XSCA 4X3SA 3QR8A 4NXMQ 3PA1A 1VCIA 2K5QA 4KN4C 3LX0A 5FK9C 3CTAA 4HIMA 2K28A 3A8JA 2BDNA 2OT2A 2OEOA 3JAME 3RY8A 1TY2A 5T1IA 3L3OC 2KVMA 1AE2A 5GQOA 1BX0A 2HDLA 1KTVA 4LFAQ 1BBXC 2E5LQ 5DNFA 2WR8A 5H5JA 4Z4YA 2A69C 2D0OA 2EE1A 2G9HD 4GQNA 5M5XH 4A3IB 3OSOA 3EVQA 1UEAB 3GTQH 4P12A 1K3RA 4XLAA 4K5WA 3CRLC 2EPBA 2JJQA 3KLSA 3R3OA 4B3FX 2F0SA 2LKVA 1FR3A 4QUFA 3NHHA 3S1MB 4GOPA 4QFMA 2D3LA 1PFSA 1X54A 5IYCH 4BBRG 4U673 4IZ8A 2WAQG 1CKOA 2F0VA 1JNYA 5L46A 3KUPA 4EQPA 1H8EA 4PABA 3OPOA 2KHJA 3JU4A 3A3GA 1K8AD 1M1KC 2M5SA 3NP8A 2GJPA 4RWSC 4MZ9A 1I50B 2PW7A 2OTLB 3PVDA 5D65A 1Q1BA 4B3RQ 3CCVB 2EQSA 1B1ZA 2VW9A 4OIKA 1IBKL 1XQBA 1QGAA 1CUKA 4DK0A 1EFCA 4KD4A 4X65Q 2F03A 1I4XA 1CKNB 3AVUA 3QFTA 1CSQA 4ZYSA 2F1MA 1YLOA 1O7IA 4YALA 3J80i 2WSSA 2WP8J 1RJTA 2Q6IA 2Y0SG 4V0BA 1EL0A 3HOYH 4A4IA 5CMDA 4YAUA 4G57A 4YCVA 2FXQA 5C0XG 5GAEC 5FO0A 4IN3A 1S5ED 4FVMA 2CBXA 3I4MB 4J1MA 1K28D 1LTID 5M3MG 1Q7YD 1TKWB 4P2CB 3ZYYX 1R9TH 2KOLA 3BZCA 5KGUA 4N8FA 1K73C 1TVXA 2X3UA 5CV8A 4XN0A 4DR5L 2HHHQ 4AVZA 4HMJA 3UE0A 4B3MQ 2JA7B 3C46A 4F87A 1Z47A 1VQNA 2CC2A 2N3SA 1GUSA 3DMUA 1EFRA 3RLNA 1DZ1A 3J80L 1YEZA 1R5NA 1GO3E 4LF6L 2R7ZG 1CA5A 4FXKC 5JPMC 1PV4A 3KEWA 2CQOA 4BY7H 1A2UA 2DJGC 2AQ1B 2RDFA 1CNFA 3B6YA 2JE6I 2EIXA 1TXYA 2WACA 1WJJA 3ZJYC 5HGTA 2NVQH 1G6PA 3RR5A 4BXXG 5CGKA 4XXEA 1B7YB 4OWWB 3OTOL 4AC9A 5IYQA 1E24A 3J81c 1HZBA 2A6EC 3CC7B 2ZJRA 1UE7A 4PV1C 1XNQQ 3H0GH 4X07A 1X55A 1EWYA 3PV0A 5IP9G 5IODA 1GOZA 2C5HA 4K8IA 3I4NB 5LL6X 4IALA 1OB0A 1GJRA 1LYLA 5KNBA 1YNXA 3KJOA 2DY1A 4BBSH 3VO1A 1QGZA 2F0UA 1EQRA 3SVMA 4FF4A 1QNKA 3ERSX 3PUWA 4F7DA 3ITPA 4HSVA 1I4QA 4M2LA 4B3TQ 4RFBA 2Z6KC 1BKBA 1RTNA
chains in the Genus database with same CATH topology
1WTRA 3CKIB 3QIAA 1PKVA 4G7XA 5A2QE 4HMIA 4OIJA 1LO5D 3Q22A 2F43A 1F9PA 3BDLA 1RD9D 4AYBB 1RKNA 1CTMA 2F0QA 1STAA 3T56B 3D31A 4OO1H 2IW3A 2IWHA 2ZXIA 2V31A 2J4XA 2F0HA 2ICEC 5KYIA 1GUOA 3EJIA 4IUTA 5CV7A 1V1OA 4XOPA 4S3SA 3M4OB 3R2IA 4FF1A 5CORA 4EGVA 2NVXB 1EIHA 3PUZA 1AP0A 3U9SA 1EY5A 3IL8A 4H44C 2R61A 1ILPA 2EYOA 1A2TA 3DDYA 2D2CC 1CT1D 2K7VA 1UUPA 1SYEA 2JJ2A 5HKKA 2D3NA 3L9AX 5EQ0A 2PW5A 2X69A 4G7OC 2KEDA 2ZXRA 3PMFA 5IT9E 5KNCA 1AN8A 1F9SA 4B9XA 3HGBA 3RD4A 1RF2D 5BN3A 3S16B 1BF4A 1ZEQX 1W6KA 1TS5A 5IGGA 1HQRD 1LT3D 2KHSA 3UI2A 1PZJD 5IGEA 2XOKA 2CHBD 2Z4IA 1W0JA 2L4NA 1WP6A 4M1UB 5DM63 2SOBA 3MWYW 5E4XA 4M8AA 1G2TA 3VYTA 4YXWA 3PUXA 3TDQA 2F0IA 1KDCA 1T5XD 3TZUA 2DN8A 2XNDA 3NK9A 4C2MB 2RSNA 2JIZA 1WCMB 3Q0AA 2B2WC 5CBEE 2TSSA 3BS1A 1SSOA 5J1ZA 2X6WA 5BN5A 2RBMA 1MABA 3U9OA 3GTPB 3D4WA 1RDPD 3DUZA 1JOQA 1UD4A 5CV5A 2FHTA 2B2TC 3MHBA 5C4HA 2F0GA 1H9MA 3W2DA 3KK7A 2LMCB 4ZQ3A 4X3KA 4ZKBB 1Q8IA 2ZXOA 1J9OA 2I07B 3VR3A 4V190 3FKIB 1LTSD 2WV6D 4DK1A 2K05A 1A15A 1KZLA 1WTQA 2JXMB 2JA8B 3S17B 1I8DA 4XIGS 1EY9A 3VR2A 5F2DA 1PFNA 3DEPA 3MZ5A 4K2KA 4DNRB 2G9DA 4K2LA 2NBFA 1DOKA 3GTJB 1ZXTA 3MVVA 2IT1A 2WKCA 2L1BA 3BYTB 4XYOA 3SK4A 1SMYD 1WTXA 3CQZB 4XN3A 5J39A 2RSOA 2F3WA 1DOMA 1CI3M 1F77A 1H8HA 3OWFA 1SNOA 5ELFA 2QDBA 3WDNA 1MBYA 1EOTA 2RKSA 1EZ8A 3KLRA 5G3LF 5M5XB 3TBIB 3GTQB 3SXHA 3ERQA 1WVLA 4WORA 3J7AV 1PRTF 3BVZA 2F4IA 4IURA 4OHJA 4WFN3 3HRZC 4UAIA 1GXDC 1BMFA 1OXUA 2MHVA 1LV9A 3TP7A 4CJ0B 1WTWA 4BY1B 1I18A 1DOLA 1RODA 1TY0A 1VF5C 1PXUA 4K8JA 1FNWA 2O4XA 5C3EB 3E6ZX 2SEBD 3IFTA 4DF7A 2IX1A 3A3BA 1ENCA 1F2LA 4ZUIA 1QG7A 2KCCA 1QE6A 2Z4HA 4J6HA 1SNDA 4B9WA 3NBHA 3M7NA 1NAPA 1S5BD 3HOYB 2ZXHA 3OIQA 1W9XA 4XLHA 1TWHB 2RQXA 1SJHD 1QILA 3K58A 1EYAA 2B2WA 2IX3A 2RDGA 4B08A 5FOBB 5DAUA 2KCNA 2Z8LA 1CZWA 1WD1A 2A68D 3MEHA 3OEEA 2JA6B 1Y1WB 5CR3A 3QOLA 2K6AA 2AUKA 2EYMA 4FP5D 4PMWA 2E1BA 2WB1B 1PTOH 5EPKA 4DFAA 1QCBD 4DN4M 4KY5A 2BDOA 1PLFA 4F88A 4XD7A 4ME5A 3BH4A 1AZQA 1SYGA 2MGSA 4ZUJA 4O42A 1JWUD 1SYDA 2X85A 1A3UA 3H0GB 4QUCA 2R9VA 3NUCA 4P22A 2D5DA 1XTCD 1O78A 4BBSB 1SKYB 2WKDA 3CRKC 5KNDA 2QKIC 2QCPX 4KV6A 1UD8A 2E76C 3IKJA 4EVOA 1EWHA 2ZTNA 4ZRZA 1CHQD 3HEJA 1EU3A 2F0EA 5JEAG 4OO1I 2K03A 2A6ED 1HQMC 1B4OA 3QG1A 2TMPA 3P1HA 1G91A 3I3CA 1F9QA 2O5JC 3SEBA 1EZ6A 3HG9A 4IUUA 1QOHA 5FLXE 1VDZA 3T53B 3HAGA 2DNCA 3S1NB 4RCOA 5HURA 2Q8RE 1WD0A 4RA8A 3HS0C 3Q6SA 1IYVA 2JDIA 1RTOA 1L0YB 3S15B 1ZKOA 1WTOA 1VJSA 1JORA 1A3VA 4RHSA 3JAML 1H9KA 4KJNA 2M2LA 1TWCB 3N6RA 2PO4A 5NUCA 3KLSX 4E0FA 1SMYC 1PTOF 4OL7A 1E1RA 2HCCA 1LTGD 2QEJC 4XMYA 3AU7A 1CQFA 4L6TB 2F0JA 1EEFD 3MXPA 3HOZB 2SDFA 4C3HB 5I4DA 5D14A 1HA6A 3WOFA 4N9TA 1D1KA 1TQOA 2K5WA 3WQZA 4YEJA 1JWSD 1SNMA 2F0DA 3W3AA 2V7QA 4H13C 3OW7A 2PCFB 2XRSD 1BDOA 5G3LD 5A35A 5DM73 1RCVD 4CJ1B 4DGZA 1S5FD 2NUCA 1KMHA 4C3IB 3J7YW 4A3GB 3DM1A 1HA5A 1XX8A 1G291 1K8OA 4C3JG 3CP2A 3LNNA 3QOJA 3D4DA 2B2VC 2VB3X 3R8BA 1SE4A 3R93A 1DYQA 3GVLA 4DAPA 1B3AA 2E2DC 5C44B 1KAAA 3J7AF 1KNEA 1BPLA 5LHY1 4NKLA 1TWAB 3H6MA 2QE7A 1CFMA 3A55A 1JQYD 3EFXD 4KKTA 1PRTB 4TSFA 3FDTA 4WJWA 2A68C 4E6IA 1E3XA 2EDGA 2IL8A 4IFDG 1CQVA 2XN9C 2E2HB 1ET9A 2IJ0A 1CHPD 3A35A 3N52A 2EYPA 2Q8TA 3VR5A 4XQJA 4IUNA 1SXTA 4HEDA 2FINB 2EJGC 2F0MA 2ZZFA 3MFGA 3OHXC 1O7LA 1G2SA 3SHLA 1D5ZC 2GK7A 5I2YA 4N9PA 3Q24A 3KF8A 2EYJA 2K04A 4KMUC 1FGBD 2EY1A 5I9OA 3VA5A 2J0TD 2A6HD 2DNEA 2B63B 2SNMA 3I4LA 4A3BB 3L7ZC 2NWGA 5E3FA 3OFNA 2AWOA 2ZZGA 2D62A 3A8IE 5LL6S 1ESFA 3K5LA 1QWYA 4EQOA 2R92B 5J22A 4RGMA 5I9PA 1XYIA 2NTTA 1B44D 4IUQA 3A8KE 2L12A 1WTVA 1STYA 1STNA 1Z7TA 5IGFA 4Q0FA 4ZK9B 1D1IA 1O80A 3I8ZA 5T1GA 3QB3A 2X8KA 5M9OA 1JE4A 2PZUA 3C1FA 2LFNA 2PZTA 3K57A 2VXWA 3HOVB 3J80E 1R4QB 2AQ3B 1PZKD 3WOEA 4OO1G 4K6LA 3BG3A 4LK1C 3F2UA 4FO2A 4TT3A 1C8CA 1EY0A 1CA6A 3VA7A 2ZZEA 2SNSA 2B2VA 4DNTB 2F0NA 1ENFA 3C1EA 1BCPF 1DCZA 3SK5A 3BC9A 2NN6G 3GV6A 1OXVA 4LAAA 1D6EC 1PRTC 3NTHA 5EKKA 1OXTA 3NQTA 4ASUA 1G8ZD 5JJZA 5KEEA 1LTTD 1PTOB 1LTBD 1NSNS 1FYCA 2LY7A 4G7ZC 2Z6BD 1ONLA 2KUMA 4KKUA 2OF1A 4TQUS 2QF7A 3BYYB 3HOUB 1HXYD 1EEID 1E43A 1O7YA 3J81L 1HZEA 1HFNA 1H9SB 1D5MC 3NTIA 1SYFA 1COWA 2XZOA 1Q12A 1KNAA 4TRDA 3T13A 2OXPA 2XWBB 3CU7A 1STEA 4DXGA 4LMQD 5CBAE 1I4GA 3OIPA 4I7ZC 2JEAI 3FVQA 1HPCA 2X53S 3HZXA 4R8IA 3TSSA 4A3KB 1NCVA 1STHA 3GTKB 4A93B 2R6GA 3SE0A 4KKSA 2CK3A 4B3GA 3GV3A 2WIIB 1MSHA 1NBMA 3GTOB 1NUCA 3DEOA 3K0YA 3GO5A 3MFYA 3TMEA 2EVBA 2NB0A 2E74C 4XQNA 4HSPA 2A6HC 1F9RA 4RAUC 2IX0A 3D3RA 1SBBB 4RHRA 1OXSC 5K5PA 3DHQA 2R3ZA 4ULLA 1LT5D 3X3NA 1A6XA 1ENAA 2X6YA 5ELEA 5C3XA 4LJZC 3MXGA 4FXDA 5EKIA 2NYZD 1S5DD 4ZAIA 4XKWA 3RUZA 2JA5B 2R93B 1TR5A 1W0KA 2XNAC 4II3A 2WJVA 1SAPA 3AMUA 5M5YB 3GTMB 3PO2B 2EJFC 1MGSA 3H91A 2JP1A 2V4DA 3TZDA 4EQNA 1PFMA 2L0CA 2JSOA 4HCSA 1M4VA 4RKBA 3S2DB 4YELA 1NR2A 2L55A 5EPJA 4HTHA 1PTOC 2WINB 3P20A 1I3QB 3NBIA 5K36G 4XLCA 1GHJA 2X6XA 2RA4A 1PMRA 2F0WA 4BBRB 1Q1EA 2WAQB 1STGA 1E3ZA 2JJ1A 2O5IC 4PMCA 3BDOA 4R9WA 3EA6A 2EXZA 4XTCS 5C0XI 1XWEA 1E2WA 2HLDA 4IQZA 1Y8NB 1SDFA 1PYWD 1V0FA 2Y0SB 3NWSA 4CKEA 4TKOB 3ZPNA 1MI2A 1B9NA 2HQEA 5M3MB 4XNFA 5KIXA 4G6IA 1H9RA 1GUGA 2M9VA 4FF2A 1BUVT 1ZYRD 2A73B 2W6IA 4IUPA 4BS9A 5IK2A 4QIWB 2R7ZB 2XZPA 5JVH3 1ICWA 1BCPB 4CHTB 5FLXL 4UZUA 3S1RB 2NVYB 2AUJD 3LWEA 2ENBA 1STBA 2EZVA 1JB3A 1F2ZA 2CQAA 3RZOB 1TS3A 2L9HA 1UD6A 1LTRD 3P75A 2ID0A 4X3TA 4CKCA 1R4PB 1A3TA 1M8AA 2WJYA 2L5TA 1BOSA 1FNUA 2VB2X 4ABNA 2FMMA 4HN7A 1EFID 2B8GA 2KEEA 3DWPA 2VJIA 1SYBA 3ZIAA 5JEAH 5C5LA 3M3YB 2XVSA 4XONA 3S9WA 3G7LA 4X3UA 4C56C 2N88A 3K5NA 2EJMA 1XXGA 3MTSA 4KY6A 5IGDA 2O2LD 3KBGA 1LTAD 1V1PB 2HDMA 1AW7A 1W6JA 1LLRD 3BCFA 3A8JE 3GP7A 2E2JB 2GJKA 1IYUA 4IUVA 3X3MA 3PO3B 5ISRA 1TIID 5E1FA 3I73A 4I65A 2VJJA 2CVRA 4CKBA 5CV6A 1C48A 1SE3A 4ZKCB 2B2UA 2H1EA 1KLGD 3C2PA 3HKZB 1H9SA 1JCKB 3I90A 3TP6A 4XQQA 2VUMB 2XZLA 4TSSA 4KJOA 1KLUD 2NVTB 1UD5A 4MHEA 3IAYA 3FMCA 3MXNA 2K01A 3OOCA 4FNFA 4FXGC 5IGBA 2Z1CA 4Z9CB 5M3FB 4QF4A 3E0JA 4XYQA 3S14B 4PNYA 4KN7C 3CP8A 5JEAJ 1TU2B 3EROA 4A3FB 4GZYC 1PRTD 4G7HC 4XT3B 5KYLA 1GHKA 4JMQA 1SFOB 1UD3A 1UNSA 2K32A 3ONAB 4HR7B 4L63B 4KD3A 3DXJC 1I6HB 2F0FA 4ILWA 4ODGA 1V0EA 4BA1I 4HIZA 4KI0A 1HCZA 2E75C 5EJWA 5C4JB 1QNUA 1Y69U 3CMMA 3BDCA 1BCPC 5IIFA 1B9MA 1TWFB 1Z6HA 2CW0C 5EGTA 2H4OA 1X32A 1I4PA 1IL8A 4R8NA 1JOOA 3RLFA 2F0OA 1HFGA 4XDXA 1J8IA 2QILA 1QJOA 1AEXA 1ZYRC 1Q3LA 1YNNC 3QJYA 4BA2I 1OHHA 3NSWA 3KBXA 1WPCA 1LT6D 4XORA 4IFDH 4NNJA 2EY6A 2EY2A 3RMHA 5C0XH 5AFWA 1SJED 2BA0A 2K1BA 2PMZB 2W6JA 2K33A 5EBCA 1U4MA 1SYCA 5A2QL 2HCIA 1E2VA 4XLFA 5DEHA 2YYZA 3T51B 4NMZA 2IPKD 2B8FA 5KNLA 1DXMA 1EY7A 4O1NA 1IKMA 1DD2A 3FEWX 1BQQT 1ET6A 3GD7A 1VF7A 2BCOA 1KABA 3V96A 3V2TA 5C4XB 1K83B 2KVOA 1JICA 2PZWA 3TN2A 1KDAA 1E0BA 2RDHA 2XIWA 2A74C 1PFBA 4A3MB 1CZGA 4JK1C 1HHVA 2X6LA 5COYA 2K5DA 2XGJA 1L0XB 2I46A 3O13A 2NTSA 5D3DA 4H7BA 2F3VA 1EY4A 1WTPA 1EYDA 3SK8A 1BNZA 4L8JA 1U9RA 3TP5A 2XRQD 2B2YA 5CDFA 3I72A 5JOBA 1AFPA 4IFDJ 3MA2B 5C0XJ 4II2A 2JYOA 4KHVA 2PPBC 4CJ2C 2JEBI 5ELBA 4CBVA 5IT9L 4XOTA 1S5CD 2KJXA 5CC4A 2DY7A 2ZZQA 3K5MA 4NDXA 1UAPA 1PTOD 3H09A 2KA7A 1JC7A 3OAAA 4UDUC 1OXXK 1TWGB 1WTHD 3MC0B 4F8MA 2GA4B 5M5WB 1BLIA 4A3DB 3AB9A 3A54A 4H0LC 1YNJC 3K7AB 1X3QA 2NN6H 4XKVA 3M7GA 1AZPA 1JWMD 2EY5A 4C3HG 3NXWA 2BOSA 1BXTA 4J8QA 3BVMA 3E5SA 5ELCA 1VLYA 3LWUA 3OMCA 3R2TA 5D3IB 3D8GA 5CV4A 3GTLB 4KK7A 4RGOS 1NR4A 1FX0A 2GJRA 1MSGA 4A3JB 3VR6A 4C3IG 5C3WA 1SNPA 2KQ3A 1V1PA 3A7AB 1KDBA 1JR0D 2X6GA 2DIEA 2MP1A 3D6CA 3PIP3 4JBWA 2RVLA 3SK6A 3PUVA 2ZXPA 2EYFA 4Q5VA 4DU9A 1IHZA 3NE5B 1X3PA 1BR9A 1TS4A 3K5OA 1EWCA 3NTKA 5FKAC 3FPUB 4F7XA 4DA2A 1I4HA 4RKLA 3I91A 1HTPA 3OMGA 1PZID 2YU9B 2M00A 1DONA 1V43A 3S2HB 5EKLA 2N55A 1IW7D 1KTKA 3P7JA 1ESRA 4G4KA 2DY8A 1GJXA 1TS2A 2BE5D 2PQEA 3J81E 1SE2A 1GUNA 1VMCA 3GTGB 2PYKA 2LZJA 5KRUA 2ZT9C 3MAQA 4XQFA 2MPMA 4MN3A 2F0LA 4ID6A 5JVG3 2EYLA 3M85A 4PMBA 1LABA 3BCDA 5I2XA 4FF3A 3FPPA 5C6AA 1EQVA 1S4ZA 1HTLD 3D4RA 4XL9A 5C4ZA 3T4AC 1NRKA 4OGQC 2FFKB 5JAVA 3SDZA 3H3VC 3I70A 3VR4A 5DN6A 4DAVA 1B2TA 1FD7D 1V8QA 3TP8A 1JOKA 4KHZA 4MIUA 4RGTA 3GVKA 2ICIA 2J7ZA 5I6YA 4C3JB 5IOCA 1Q90A 1HVXA 3PUYA 2C9OA 3VYRA 5K36H 3OE7A 2F0KA 4K5VA 2AQ2B 4K14A 5ELDA 1ILQA 1G6ZA 2B2UC 3VYSA 3QWNA 5E4WC 4XLEA 5JPNC 1GUTA 4IFDI 3PIO3 1MD2D 2L11A 3DWAA 1GUWA 3K6OA 4BWGB 5BN4A 1BCPD 4K5XA 3Q23A 2XWJB 5FO9B 1B50A 1CK1A 2A69D 2HUGA 2CW0D 1Y1VB 4C1NI 5IGCA 3OWEB 4NW2A 1Y8PB 2FJ2A 5I6WA 3FRPB 1HUMA 4PQXA 1D2BA 2GK6A 5CV9A 3C3LA 2Q8IB 1HUNA 4Z1MA 1F2YA 1H9JA 4C1NK 1U4PA 2EYHA 3G05A 2KECA 4K6DA 4RCNA 1YNND 1R9TB 1Y8OB 1VMPA 4RGNA 1II3A 1B53A 2A5HA 5TSSA 3NQIA 5EBDA 1I6VC 1EIGA 1U4RA 3NWTA 1F2MA 1LT4D 4ZLTF 4DAYA 2B2TA 1UD2A 3GVJA 3T16A 3ND9A 3QO2A 4BY7B 4KY7A 3OEHA 4HAEA 3CESA 2NZ1D 4XR6A 2BA1A 5FO8B 2NVQB 3G6JB 2C5CA 1SNCA 2EOTA 1DM0B 3EQLC 2ZTGA 3S1QB 4A3EB 1DJRD 5EPLA 1EY8A 1FNVA 2WPDA 4HCEA 1SNQA 3VYUA 3HP3A 2MJ8A 2FMCA 2F0TA 2WZPP 5FO7B 3K59A 3DWQA 1RHPA 4XT1B 2MUYA 1IW7C 1CM9A 5FL7A 3V05A 1I4RA 4G7WA 3FKSA 2BE5C 2D9UA 1LACA 4QB4A 4WRDA 1O7ZA 3SR1A 1HRJA 1TT2A 1E1QA 5C5MA 4DXFA 4CGYB 3BVGA 4KTAA 4Y7NB 2NN6I 3A56A 3NPPA 3IFDA 5CYUA 1E79A 1BO0A 1QB5D 3HOXB 3BZDB 4QCLA 1EU4A 1D5XC 2E2IB 1EQTA 1EY6A 3D6WA 1K8MA 1C4QA 3GQBA 3RZDB 4FXUA 4U68A 1ML0D 2B2YC 4NP5A 4QMGA 2LS01 3MXUA 3A7LA 4XM3A 3HOWB 3M4YA 4YIJA 1IKLA 1SEBD 3CHBD 1OO9B 2F0PA 1EYCA 1E2ZA 4RH6A 2AWNA 4FYDA 3H94A 3URYA 1T5EA 1PDQA 2B39A 3ND8A 1YNJD 1U4LA 2XSCA 4X3SA 1VCIA 2K5QA 4KN4C 3LX0A 5FK9C 2K28A 2BDNA 2OT2A 2OEOA 3JAME 1TY2A 5T1IA 3L3OC 2KVMA 2HDLA 1BBXC 5DNFA 2A69C 2G9HD 2EE1A 4GQNA 4A3IB 3OSOA 3EVQA 1UEAB 4XLAA 4K5WA 3CRLC 2EPBA 3KLSA 3R3OA 4B3FX 2F0SA 2LKVA 1FR3A 4QUFA 3NHHA 3S1MB 2D3LA 4U673 4IZ8A 2F0VA 3KUPA 4EQPA 1H8EA 3OPOA 3JU4A 3A3GA 2M5SA 3NP8A 2GJPA 4RWSC 1I50B 2PW7A 5D65A 1Q1BA 1B1ZA 4OIKA 4DK0A 4KD4A 2F03A 1I4XA 4ZYSA 2F1MA 2WSSA 2WP8J 1RJTA 4V0BA 1EL0A 5CMDA 4G57A 5C0XG 4IN3A 1S5ED 4FVMA 3I4MB 4J1MA 1K28D 1LTID 1TKWB 4P2CB 3ZYYX 2KOLA 5KGUA 1TVXA 5CV8A 4XN0A 4AVZA 4HMJA 2JA7B 3C46A 4F87A 1Z47A 3DMUA 1GUSA 1EFRA 1DZ1A 3J80L 1CA5A 4FXKC 5JPMC 3KEWA 1A2UA 2AQ1B 2RDFA 2JE6I 5HGTA 2WACA 5CGKA 4XXEA 2A6EC 4PV1C 3PV0A 5IODA 1GOZA 4K8IA 3I4NB 5LL6X 4IALA 1OB0A 5KNBA 2VNUD 2F0UA 3SVMA 4FF4A 1QNKA 3PUWA 3ITPA 4HSVA 1I4QA 4RFBA 2PNRC 1RTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCF B;  3QIA A;  1BDO A;  1H9R A;  2BA0 A;  5A35 A;  5BN4 A;  1GUG A;  4LJZ C;  3OPO A;  2A6H D;  2DNE A;  2K33 A;  1FYC A;  3PUX A;  3KLR A;  1H9S A;  1OXX K;  4G7Z C;  2D5D A;  3TZU A;  3I4L A;  2A69 D;  1O78 A;  1V43 A;  1E2V A;  2DN8 A;  1IW7 D;  2YYZ A;  3L7Z C;  3T51 B;  1Q1B A;  1ONL A;  2B8F A;  4KKU A;  1CTM A;  2AWO A;  3CRK C;  4TQU S;  5KND A;  2QF7 A;  1Y8P B;  2D62 A;  1GJX A;  1DXM A;  2BE5 D;  3A8I E;  4DK0 A;  3AB9 A;  2EJF C;  1G29 1;  4H0L C;  3IKJ A;  2E76 C;  1YNJ C;  3FMC A;  1DD2 A;  1OXU A;  1A6X A;  1K8O A;  3T56 B;  1EWH A;  2NN6 H;  2AUJ D;  2V4D A;  1GUN A;  2NN6 I;  1VF7 A;  3GD7 A;  3OOC A;  3D31 A;  2F1M A;  2Q8I B;  1H9S B;  4OO1 H;  5JEA G;  5BN5 A;  3LNN A;  2ZT9 C;  2A6E D;  4KN7 C;  1HQM C;  3QG1 A;  1H9J A;  1GUO A;  1VF5 C;  3A8K E;  1TU2 B;  4GZY C;  4RCN A;  4G7H C;  3IFT A;  5C0X G;  2O5J C;  1Y8O B;  1GHK A;  1Q12 A;  1K8M A;  1Z7T A;  3LWU A;  3GQB A;  1H9M A;  2K32 A;  1TKW B;  3P20 A;  1VDZ A;  3M85 A;  1I6V C;  4HR7 B;  3T53 B;  2KCC A;  5K36 G;  3MXU A;  4JK1 C;  3A7L A;  1LAB A;  2DNC A;  2LMC B;  2L5T A;  3DXJ C;  1CFM A;  3PUZ A;  3U9S A;  3M4Y A;  4BA1 I;  4KI0 A;  4KKT A;  3M7N A;  1GHJ A;  1HCZ A;  3FPP A;  2E75 C;  4H44 C;  4I7Z C;  1IYV A;  2JEA I;  2A68 C;  3VR6 A;  1PMR A;  1Y69 U;  1E2Z A;  1ZKO A;  2EDG A;  3D4R A;  2B8G A;  3ND9 A;  1GUS A;  1Q1E A;  3A7A B;  1HPC A;  3VR3 A;  3H94 A;  4L8J A;  1H9K A;  2D2C C;  4IFD G;  3N6R A;  1B9M A;  1T5E A;  4DK1 A;  2BA1 A;  2O5I C;  2JXM B;  4OGQ C;  4OO1 G;  1Z6H A;  5JEA H;  2K7V A;  3ND8 A;  2CW0 C;  3I72 A;  3BDO A;  3SDZ A;  3BG3 A;  4XIG S;  4LK1 C;  3VR4 A;  1SMY C;  3VR2 A;  2R6G A;  3SE0 A;  4KKS A;  1V8Q A;  4JBW A;  4KHZ A;  3RLF A;  2JE6 I;  1VCI A;  3VA7 A;  3EQL C;  3VR5 A;  2EJM A;  4G7O C;  2A68 D;  4KN4 C;  4XTC S;  3PUV A;  2PPB C;  4DNT B;  4DNR B;  2JEB I;  1Q90 A;  3PUY A;  2EJG C;  1E2W A;  3MFY A;  5KNC A;  3NE5 B;  2EVB A;  2A6E C;  5K36 H;  4IQZ A;  1DCZ A;  1Y8N B;  2AUK A;  2E74 C;  3A8J E;  4PV1 C;  3HGB A;  2IT1 A;  1IYU A;  2A6H C;  1QJO A;  2NN6 G;  1ZYR C;  5BN3 A;  1OXV A;  1O7L A;  3PV0 A;  1YNN C;  4TKO B;  2A69 C;  2BDO A;  3QJY A;  4BA2 I;  1OXT A;  3I73 A;  1IW7 C;  5KNB A;  1OXS C;  2KA7 A;  1B9N A;  3CRL C;  4IFD H;  1GUT A;  2BE5 C;  4KMU C;  1HTP A;  3PUW A;  1FR3 A;  3W3A A;  1LAC A;  1CI3 M;  5C0X H;  4H13 C;  3WDN A;  2PNR C;  3OW7 A; 
#chains in the Genus database with same CATH topology
 1WTR A;  3CKI B;  3QIA A;  4A3L G;  1PKV A;  1KK2 A;  5HXB A;  4G7X A;  3VNV A;  5A2Q E;  4HMI A;  4OIJ A;  4JPB W;  1LO5 D;  3Q22 A;  2F43 A;  1F9P A;  3ASR A;  3BDL A;  1RD9 D;  4AYB B;  1VQM B;  1SLJ A;  1UE6 A;  1RKN A;  1Q9S A;  1CTM A;  1A8P A;  2F0Q A;  2DER A;  3KFU A;  4POF A;  1STA A;  1HNX L;  3T56 B;  4G1B A;  1H85 A;  3D31 A;  4DV7 L;  4ZV4 A;  4OO1 H;  2IW3 A;  3ER0 A;  2IWH A;  2ZXI A;  1VQP A;  2V31 A;  2J4X A;  2NZO A;  2F0H A;  4Y7N H;  2ICE C;  5E7N A;  5KYI A;  1GUO A;  3EJI A;  4IUT A;  3PO3 G;  3AEV A;  5CV7 A;  1KXL A;  1N07 A;  1HNZ L;  1KK3 A;  1V1O A;  4XOP A;  4S3S A;  2ZBU A;  1R5B A;  3S15 H;  3I55 A;  3M4O B;  3R2I A;  3HOX H;  1T9H A;  1BBW A;  5COR A;  4FF1 A;  1TWC H;  3KDF A;  4EGV A;  4QGU A;  5JJI A;  1NNX A;  4OPS A;  2NVX B;  2E2I H;  1EIH A;  3PUZ A;  1AP0 A;  3U9S A;  1EY5 A;  3IL8 A;  4DK6 C;  4KHP L;  1VQJ A;  4H44 C;  2R61 A;  1YJN A;  1ILP A;  3HKZ G;  4DR3 L;  4Y7C A;  3HOW H;  3B78 A;  2K5N A;  2I1L A;  2VUM G;  2EYO A;  1A2T A;  3DDY A;  2D2C C;  2FVG A;  4P6Y A;  1CT1 D;  5IYB H;  2K7V A;  3Q3A A;  1UUP A;  1SYE A;  2JJ2 A;  1IBK Q;  2VNJ A;  1CNE A;  4G1V A;  5HKK A;  4HE5 A;  2IHF A;  2D3N A;  4C3H H;  3L9A X;  3HOZ H;  1IXR A;  4PZ6 A;  4JI5 L;  4GKJ Q;  2VNK A;  5EQ0 A;  5M3F G;  4LC0 A;  2PW5 A;  1FNB A;  2X69 A;  1EQQ A;  4ACB A;  5IYR A;  4IO9 A;  4G7O C;  2DYI A;  2KED A;  1HH2 P;  2ZXR A;  3PMF A;  5IT9 E;  5KNC A;  4A3F G;  1AN8 A;  1F9S A;  2GRE A;  3FPK A;  3AYH B;  4B9X A;  3HGB A;  4Y9R A;  3RD4 A;  2HD3 A;  1RF2 D;  1HZC A;  1K8A C;  5BN3 A;  1PH2 A;  3S16 B;  1BF4 A;  1S3O A;  1ZEQ X;  1W6K A;  2UU9 Q;  4IOA A;  1TS5 A;  4LBW A;  5IGG A;  1HQR D;  1QVG A;  1LT3 D;  3JQP A;  3K80 C;  2KHS A;  4A3G H;  3UI2 A;  2G5D A;  1PZJ D;  5IGE A;  2XOK A;  2CHB D;  4A3I H;  3OJX A;  3A0J A;  4PAA A;  2Z4I A;  1W0J A;  2L4N A;  2Q6L A;  1WP6 A;  4YHB A;  4M1U B;  5DM6 3;  2SOB A;  3I4O A;  3MWY W;  1W35 A;  2H5X A;  5E4X A;  4M8A A;  1G2T A;  3VYT A;  2YV5 A;  4YXW A;  4PG3 A;  5J3B A;  3PUX A;  3TDQ A;  1YJW B;  2F0I A;  3G6E A;  1KDC A;  1T5X D;  3TZU A;  4DUY Q;  3CD6 B;  4LF6 Q;  4APV A;  2DN8 A;  3FHW A;  2XND A;  3NK9 A;  4C2M B;  5LMU Q;  2RSN A;  4YHH L;  2JK8 A;  2JIZ A;  2OBR A;  1WCM B;  3Q0A A;  4DV5 L;  2B2W C;  1NB9 A;  5CBE E;  2TSS A;  1I50 H;  1G7C A;  3CC4 B;  1KRT A;  5C44 H;  3BS1 A;  1SSO A;  1G7S A;  5J1Z A;  4DV2 Q;  2X6W A;  5BN5 A;  1N8R D;  4DV6 Q;  2RBM A;  1MAB A;  3U9O A;  3GTP B;  3D4W A;  1RDP D;  3DUZ A;  1JOQ A;  1IYJ B;  1UD4 A;  5CV5 A;  3ZBU A;  4UHV A;  3W5O A;  2FHT A;  2B2T C;  3W5U A;  1A62 A;  4GLV B;  3MHB A;  3KJP A;  5C4H A;  1P4M A;  2QN6 A;  2F0G A;  2BGJ A;  1H9M A;  3PEN A;  1N0V C;  4O2D A;  3W2D A;  3KK7 A;  3QFR A;  4LF8 L;  3I56 A;  2LMC B;  4ZQ3 A;  1W34 A;  2RHS B;  3I4M H;  4X3K A;  2UXB L;  3EN2 A;  4ZKB B;  1EOV A;  1X3F A;  1Q8I A;  3WY9 A;  3CCJ B;  2ZXO A;  1J9O A;  1VQI A;  2I07 B;  3VR3 A;  4V19 0;  3FKI B;  1LTS D;  2WV6 D;  1VQ7 B;  4DK1 A;  2K05 A;  4Z4U A;  1A15 A;  1KZL A;  5TY0 A;  2JXM B;  1WTQ A;  2JA8 B;  3S17 B;  1I8D A;  1S0U A;  1Q86 D;  4XIG S;  1EY9 A;  4HID A;  2YWF A;  3VR2 A;  4DQK A;  5F2D A;  1PH4 A;  1HNX Q;  1HZ9 A;  4NB3 A;  4AIM A;  1PFN A;  3DEP A;  4DV7 Q;  3MZ5 A;  4LW1 A;  4K2K A;  4M0L A;  4DNR B;  1K0R A;  2G9D A;  1IBM Q;  5C4X G;  1K0S A;  2B63 G;  2CFM A;  5IY0 A;  5FLX c;  4K2L A;  2XNC A;  2JQO A;  4UP8 A;  1HA3 A;  2ZL7 A;  1DOK A;  2NBF A;  3GTJ B;  1ZXT A;  3MVV A;  4LF9 Q;  2IT1 A;  2WKC A;  1N36 L;  2L1B A;  4POG A;  3BYT B;  4XYO A;  3SK4 A;  1L1O B;  4A3M G;  1SMY D;  1WTX A;  3CQZ B;  4XN3 A;  5IYP A;  4A3B H;  3V7A A;  2K5H A;  5J39 A;  2RSO A;  4TMW A;  2F3W A;  2OTL A;  1DOM A;  1BBU A;  4QHY A;  4QY7 A;  3CCV A;  4KHP Q;  1CI3 M;  1F77 A;  1H8H A;  1X56 A;  3GSI A;  1SNO A;  3OWF A;  5ELF A;  2QDB A;  3ULL A;  3WDN A;  1VQE A;  2RC5 A;  4DR3 Q;  2VNU D;  1CKN A;  1G7R A;  1MBY A;  2R92 H;  1EOT A;  2RKS A;  5KSW B;  1EZ8 A;  1C0A A;  3OW2 B;  3KLR A;  1D8T A;  3ZBT A;  5G3L F;  5M5X B;  3TBI B;  3KYH C;  1ZM2 A;  3GTQ B;  3SXH A;  1KK1 A;  3ERQ A;  4LF4 L;  1WVL A;  4WOR A;  3J7A V;  1PRT F;  3Q6R A;  3BVZ A;  1X65 A;  3KF8 B;  2F4I A;  4IUR A;  5FLM H;  1WYD A;  3DM3 A;  4YAO A;  4OHJ A;  4WFN 3;  3HRZ C;  2DGY A;  4DAM A;  4JI5 Q;  4UAI A;  1GXD C;  1BMF A;  3HKS A;  1OXU A;  4OON A;  2MHV A;  1LV9 A;  2P3M A;  2J7K A;  3AGQ A;  3TP7 A;  1KQS B;  4DUZ L;  4CJ0 B;  4HJ9 A;  1WTW A;  4BY1 B;  4AYB E;  1I18 A;  1DOL A;  1ROD A;  3CCQ B;  1TY0 A;  1SMX A;  1VF5 C;  1KK0 A;  1PXU A;  4K8J A;  1FNW A;  2O4X A;  5C3E B;  3E6Z X;  3CPW B;  2SEB D;  2VNH A;  3IFT A;  5B6I A;  4DF7 A;  2IX1 A;  3A3B A;  1GKH A;  3HOV H;  5EAY A;  2Q2I A;  2UXD L;  4L5R C;  1ENC A;  1F2L A;  4ZUI A;  1QG7 A;  2XTI A;  2E1R A;  4DR1 L;  2KCC A;  3M4O H;  1QE6 A;  2V7V A;  2Z4H A;  4J6H A;  1GR1 A;  1SND A;  4B9W A;  3NBH A;  3M7N A;  1S5B D;  1NAP A;  3HOY B;  4TMV A;  2ZXH A;  4EH1 A;  3CCL B;  1W9X A;  3OIQ A;  1W87 A;  4XLH A;  1M1K D;  1TWH B;  4NXN L;  3VNU A;  2RQX A;  4GN4 B;  1SJH D;  1QIL A;  3K58 A;  2VQE L;  1EYA A;  1UE5 A;  2B2W A;  1SM4 A;  2IX3 A;  4JI4 L;  1N33 L;  4A3D G;  3CC7 A;  3ASS A;  3BQJ A;  2RDG A;  4B08 A;  3W1B A;  5FOB B;  3K81 C;  5DAU A;  3W2F A;  2KCN A;  2Z8L A;  1LTL A;  3CW2 A;  1Y0R A;  3CC2 B;  1CZW A;  1WD1 A;  2A68 D;  4IPC A;  3MEH A;  5F4J A;  1PYS B;  3Q38 A;  1OTC A;  3OEE A;  3CCU B;  2JA6 B;  1Y1W B;  5CR3 A;  3QOL A;  2K6A A;  4WJ3 M;  2AUK A;  2EYM A;  4OOX A;  4P1V A;  4FP5 D;  4PMW A;  3SLD A;  2E1B A;  2WB1 B;  1PTO H;  5EPK A;  4DFA A;  1QCB D;  4DN4 M;  4KY5 A;  2BDO A;  2F52 A;  1PLF A;  2C78 A;  1MIU A;  1EXM A;  4R4Q A;  4LF8 Q;  3QFS A;  4XD7 A;  4F88 A;  2Z9H A;  4ME5 A;  2YWG A;  3BH4 A;  1VQM A;  2UXB Q;  4A3J G;  1AZQ A;  1SYG A;  3HOU H;  2MGS A;  4ZUJ A;  3ONY A;  1JWU D;  1SYD A;  2X85 A;  4O42 A;  4LBZ A;  1A3U A;  3H0G B;  4QUC A;  4P26 A;  2R9V A;  3NUC A;  4P22 A;  2D5D A;  4B3S L;  1B3Q A;  1XTC D;  1O78 A;  4BBS B;  4A75 A;  2AMC B;  1SKY B;  2WKD A;  3WNB A;  4DR4 L;  3CRK C;  5KND A;  2PNH A;  2QKI C;  1MRZ A;  2QCP X;  1V5V A;  4TVA B;  1UD8 A;  2E76 C;  3IKJ A;  4KV6 A;  3WWV A;  4DK3 C;  4EVO A;  1EWH A;  2ZTN A;  2GVB A;  4ZRZ A;  1CHQ D;  3HEJ A;  4X66 L;  1EU3 A;  2F0E A;  2BF4 A;  5JEA G;  3JAM i;  4OO1 I;  4RDJ A;  4H02 A;  2K03 A;  2VBU A;  2A6E D;  1HQM C;  1B4O A;  3QG1 A;  2TMP A;  2ZIT A;  3P1H A;  1G91 A;  4PC3 A;  1N36 Q;  1FJG L;  3SLN A;  3AFP A;  3I3C A;  1F9Q A;  2O5J C;  5GAG C;  3SEB A;  1EZ6 A;  3HG9 A;  4IUU A;  1YZ6 A;  1QOH A;  4OWX B;  5FLX E;  1Q86 C;  1VDZ A;  4QUZ A;  4JBK A;  2UXC Q;  3T53 B;  3HAG A;  2DNC A;  3S1N B;  4RCO A;  5HUR A;  2Q8R E;  1WD0 A;  3I7F A;  4RA8 A;  4A93 H;  3HS0 C;  3Q6S A;  1IYV A;  2JDI A;  1RTO A;  1L0Y B;  3S15 B;  1ZKO A;  1WTO A;  1H95 A;  1OGJ A;  1VJS A;  1JOR A;  1A3V A;  2UUA L;  3F2C A;  4PC6 A;  3K7U C;  4RHS A;  4CDF C;  3JAM L;  1H9K A;  4KJN A;  1YBY A;  4LF4 Q;  2C5B A;  1TWC B;  2M2L A;  3N6R A;  1MJC A;  1VQO B;  2PO4 A;  5JBQ A;  5NUC A;  2WFW A;  4PZ7 A;  1KRH A;  3KLS X;  4E0F A;  3FKI H;  1SMY C;  3UDF A;  2PIA A;  1PTO F;  4OL7 A;  2QTZ A;  1X6O A;  3OKX A;  1E1R A;  3JC6 6;  1NJI C;  2JA8 H;  2HCC A;  3S17 H;  1LTG D;  4DUZ Q;  1JT8 A;  2QEJ C;  4XMY A;  3AU7 A;  1CQF A;  4L6T B;  4YWL A;  2DEU A;  2F0J A;  3H15 A;  1WTH A;  1EEF D;  4TMZ A;  1KD1 D;  3MXP A;  1E64 A;  3AVV A;  4JYA L;  3HOZ B;  5BR8 L;  5LMN L;  2SDF A;  4C3H B;  5I4D A;  5D14 A;  1HA6 A;  4I7A A;  3WOF A;  3KLW A;  1YJW A;  2YTV A;  3CD6 A;  4N9T A;  4DR1 Q;  2R93 H;  1D1K A;  1TQO A;  2K5W A;  1MJE A;  3WQZ A;  4YEJ A;  1SNM A;  1JWS D;  2F0D A;  3ZZU A;  1RIP A;  1EIF A;  2ZJQ A;  3CQZ H;  3W3A A;  2V7Q A;  2MO0 A;  4H13 C;  1PHJ A;  3PO2 H;  2MNA A;  3CC4 A;  3OW7 A;  2PCF B;  2XRS D;  1BDO A;  5G3L D;  5A35 A;  5DM7 3;  1RCV D;  4CJ1 B;  4DGZ A;  1S5F D;  5KW9 A;  2VQE Q;  4K0K Q;  3SEJ A;  2NUC A;  2Z6B A;  1KMH A;  4C3I B;  3J7Y W;  4JI4 Q;  4A3G B;  1GVP A;  4P73 A;  3V76 A;  2WYR A;  4X64 Q;  1LM0 A;  5A88 A;  3DM1 A;  1QUQ B;  2DET A;  1HA5 A;  1XX8 A;  1VQB A;  5GAD C;  4RPB A;  1G29 1;  3RNU A;  1K8O A;  4ZCI A;  4C3J G;  4Z4W A;  2VY3 A;  3STB C;  1ZM9 A;  3CCM B;  5BSX A;  1EWI A;  4JVZ A;  3CP2 A;  1YHB A;  3LNN A;  3QOJ A;  3D4D A;  1XE1 A;  2B2V C;  4JG2 A;  2VB3 X;  3MEF A;  3R8B A;  4BY1 H;  1SE4 A;  3R93 A;  3CCJ A;  1DYQ A;  3J7A 5;  3GVL A;  4DAP A;  1B3A A;  4BBR H;  1VQK B;  2E2D C;  5C44 B;  5J3O A;  5IT9 c;  2BN4 A;  1KAA A;  3J7A F;  4GKK L;  1KNE A;  3SGI A;  1BPL A;  5LHY 1;  1VQ7 A;  4DR7 Q;  4IPD A;  4NKL A;  5C3E H;  1TWA B;  3H6M A;  2QE7 A;  1CFM A;  3A55 A;  1JQY D;  1TTT A;  3EFX D;  2B3G A;  2QDX A;  1VQ6 B;  4KKT A;  1PRT B;  4TSF A;  1EFU A;  2D0P A;  3FDT A;  2BPO A;  4WJW A;  2A68 C;  4E6I A;  1N32 L;  1E3X A;  2EDG A;  2A8V A;  1Y1V G;  2IL8 A;  4B3S Q;  4IFD G;  1CQV A;  3F2D A;  5BSY A;  2XN9 C;  2GN5 A;  4AQY Q;  1D8L A;  1QG0 A;  4DR4 Q;  2E2H B;  1ET9 A;  1TWH H;  2IJ0 A;  4LWC A;  1CHP D;  3A35 A;  3N52 A;  1L1O A;  2EYP A;  2E8G A;  2Q8T A;  2Y0S E;  3VR5 A;  4XQJ A;  1G7T A;  4IUN A;  4C43 A;  1SXT A;  4HED A;  4ZGN B;  2FIN B;  2EJG C;  2VL6 A;  5M3M H;  1X9N A;  1K3B C;  1IBL L;  2F0M A;  2CH4 W;  3H9N A;  1KJZ A;  4R4O A;  2ZZF A;  3MFG A;  1S72 B;  1OB2 A;  3OHX C;  1O7L A;  2JA6 H;  1ZUN B;  1Y1W H;  3I1F A;  3OW2 A;  1G2S A;  2B7C A;  3GIR A;  1D5Z C;  3SHL A;  5IYN A;  1OB5 A;  1JJG A;  2GK7 A;  5I2Y A;  1J9Z A;  3NBH B;  4N9P A;  2DCU A;  4LUO A;  3Q24 A;  3KF8 A;  4HJ5 A;  1QZH A;  1WOC A;  2EYJ A;  3CME B;  3G4S B;  2K04 A;  5FO1 A;  4KMU C;  2WB1 E;  1FGB D;  1VQA A;  2EY1 A;  1DG1 G;  1H42 A;  3ES9 A;  5I9O A;  4BY7 G;  4LFB Q;  3S1R H;  2NVY H;  2RC6 A;  3VA5 A;  2J0T D;  2A6H D;  2ZM6 L;  3B82 A;  2DNE A;  4HJ7 A;  1KQS A;  2B63 B;  4ZGQ B;  2SNM A;  3I4L A;  4A3B B;  3AQQ A;  3CCQ A;  2K50 A;  3W2H A;  2XEX A;  3L7Z C;  2NWG A;  5E3F A;  3OFN A;  2AWO A;  5IWA L;  2ZZG A;  2D62 A;  1QFY A;  4OXP A;  3CPW A;  4A3E G;  3A8I E;  5FJ8 G;  5LL6 S;  1ESF A;  3K5L A;  1QWY A;  4EQO A;  2R92 B;  5J22 A;  4RGM A;  3U4V A;  5I9P A;  1A63 A;  1NDH A;  1CSP A;  1XYI A;  4Z4R A;  5H1S E;  2NTT A;  3VDY A;  1B44 D;  4IUQ A;  3J7Z C;  3IRB A;  3CXC B;  3A8K E;  3CCL A;  4JYA Q;  5BR8 Q;  5LMN Q;  2L12 A;  4RDL A;  4DV4 L;  3PA2 A;  1WTV A;  1STY A;  1STN A;  3VO2 A;  4LNQ A;  2P5Z X;  4WJ4 A;  1Z7T A;  2IHE A;  1WDT A;  4OEM B;  5IGF A;  4DV1 Q;  4CDE C;  4A3L H;  4Q0F A;  3OZU A;  4ZK9 B;  1D1I A;  1O80 A;  3I8Z A;  5T1G A;  3QB3 A;  2X8K A;  5M9O A;  4Z4T A;  1JE4 A;  2PZU A;  3EBE A;  4NCN A;  4P72 A;  3C1F A;  2LFN A;  2V7T A;  2PZT A;  3CC2 A;  3K57 A;  4QV2 A;  5DS0 A;  3S1N H;  2VXW A;  1E62 A;  4IJH A;  3HOV B;  1OGI A;  3J80 E;  1R4Q B;  3LO8 A;  2AQ3 B;  2QW7 A;  1PZK D;  3CCU A;  1KD1 C;  5FA6 A;  3WOE A;  3F2B A;  2ASB A;  4OO1 G;  4K6L A;  2E2J H;  3BG3 A;  4LK1 C;  3D26 A;  1DDI A;  3F2U A;  4FO2 A;  1IJF A;  4TT3 A;  1C8C A;  1NE3 A;  1EY0 A;  1CA6 A;  4X6A H;  3VA7 A;  2ZZE A;  2SNS A;  1XPR A;  2B2V A;  3KOJ A;  3RN5 A;  4DNT B;  3W1G A;  3HOX G;  2F0N A;  1N0U A;  2MO1 A;  1ENF A;  4JI3 L;  2MFI A;  3C1E A;  1BCP F;  1DCZ A;  3SK5 A;  3OYY A;  2BM1 A;  3BC9 A;  2NN6 G;  3GV6 A;  1NTG A;  1OXV A;  1D6E C;  1PRT C;  4LAA A;  3A8I A;  3NTH A;  4Y9U A;  5EKK A;  1B2R A;  1OXT A;  3J81 i;  4GKK Q;  1PJ7 A;  3NQT A;  3HOW G;  4ASU A;  2VUM H;  1FDR A;  1G8Z D;  3HKZ E;  4JBM A;  3U6B A;  5JJZ A;  2AKW B;  1WOP A;  4OP7 A;  2PNR C;  1JB7 A;  2NVT H;  5KEE A;  1LTT D;  4RCY A;  1N32 Q;  3A8K A;  1PTO B;  1WSV A;  1LTB D;  1NSN S;  1FYC A;  2LY7 A;  1EUJ A;  4G7Z C;  1E1O A;  2QGQ A;  3R6J A;  4P6V F;  2Z6B D;  1K9M D;  1VQD A;  1ONL A;  2KUM A;  3T1Y L;  1VQ9 B;  4KKU A;  1U0L A;  2BVN A;  2OF1 A;  4TQU S;  2VYQ A;  2QF7 A;  2V7W A;  3BYY B;  3TRE A;  3HOU B;  1HXY D;  1EEI D;  1E43 A;  4YWK A;  4C3I H;  1O7Y A;  3L2P A;  4YWM A;  1R5O A;  3J81 L;  4DR5 Q;  4GLX A;  1HZE A;  1HFN A;  2C4T A;  1H9S B;  1D5M C;  1I6H H;  3PQI A;  4X8I A;  3NTI A;  1IBL Q;  5C4J H;  1SYF A;  2DJF C;  4A3I G;  3MMP A;  1COW A;  3JQQ A;  2XZO A;  3MXN B;  1Q12 A;  1KNA A;  4TRD A;  4CDC C;  2PMD A;  4Z4V A;  1TWF H;  2ZTC A;  1BVS A;  1YHA A;  3T13 A;  2OXP A;  1VQO A;  2XWB B;  3CU7 A;  1AE3 A;  1V9P A;  4QJF A;  1STE A;  4DXG A;  4L5S A;  4LMQ D;  2NZH A;  1KAW A;  5CBA E;  1I4G A;  3OIP A;  3CW2 C;  4I7Z C;  2JEA I;  3BY2 A;  5F4O A;  5J35 A;  1TWA H;  3OTO Q;  4JOI A;  3K0X A;  3FVQ A;  1QVF B;  1HPC A;  2X53 S;  3HZX A;  4R8I A;  3CB4 A;  3TSS A;  4A3K B;  3CAM A;  3PUM A;  3ULJ A;  1NCV A;  5IWA Q;  1STH A;  3OZV A;  1W2B B;  3GTK B;  2EXD A;  4A93 B;  2R6G A;  2CH4 A;  3SE0 A;  4KKS A;  3CCS B;  2CK3 A;  4B3G A;  3GV3 A;  3TQY A;  5JJK A;  2E2H H;  4IPG A;  4NPS A;  2WII B;  1MSH A;  4JI6 L;  1NBM A;  3GTO B;  1NUC A;  3DEO A;  3WBK A;  1ZM3 A;  3K0Y A;  3GO5 A;  3MFY A;  3TME A;  2EVB A;  2NB0 A;  4LF7 L;  2ALY B;  1SR3 A;  2E74 C;  4XQN A;  4HSP A;  2A6H C;  1F9R A;  3I4M G;  4R71 A;  4RAU C;  2IX0 A;  4MYT A;  3D3R A;  1SBB B;  4RHR A;  1OXS C;  2C35 B;  1XFO A;  2C2W A;  4IOC A;  5K5P A;  2JA7 G;  3DHQ A;  2R3Z A;  4R4T A;  3LVB A;  4ULL A;  1QUQ A;  4P3I A;  3CCR B;  1LT5 D;  3X3N A;  1IL2 A;  1ENA A;  1A6X A;  4RJL A;  2NPF A;  2X6Y A;  4K1X A;  5ELE A;  5C3X A;  1EIY B;  2I5L X;  4LJZ C;  4RPD A;  3MXG A;  3CCM A;  2K75 A;  4FXD A;  5EKI A;  4FWT A;  1N9W A;  2NYZ D;  1S5D D;  4JI1 L;  4X7C A;  1HNZ Q;  4ZAI A;  4XKW A;  1B23 P;  1KIX A;  1N06 A;  3MCA A;  3RUZ A;  1X3G A;  2JA5 B;  2R93 B;  1TR5 A;  4UP7 A;  4LFC L;  1W0K A;  2XNA C;  1VS0 A;  5C4X H;  4II3 A;  2WJV A;  3ZZT A;  1K83 H;  1SAP A;  2B63 H;  3AMU A;  2QDL A;  4FN5 A;  5M5Y B;  1NJI D;  3GTM B;  3PO2 B;  2EJF C;  4RMF A;  1MGS A;  1VQK A;  2F4V L;  3WND A;  3H91 A;  1ZM4 A;  2JP1 A;  2V4D A;  3ZC3 A;  2Q6K A;  2QGG A;  2R7D A;  4OWT B;  3TZD A;  4EQN A;  5IYD G;  4LF5 L;  3W2E A;  1N34 L;  1PFM A;  4JI3 Q;  2L0C A;  2JSO A;  2HMA A;  4HCS A;  2GVA A;  1VQ6 A;  1M4V A;  5IP7 H;  1Q8K A;  4HE6 A;  4RKB A;  4EX5 A;  1UE1 A;  1QH0 A;  3P27 A;  1IHM A;  3I4N G;  3S2D B;  4LBV A;  4P3Y A;  4B3X A;  4YEL A;  1ASZ A;  1NR2 A;  1XMO L;  2L55 A;  4B47 A;  5EPJ A;  2UUC L;  2A19 A;  3U4Z A;  2YTY A;  4HTH A;  1PTO C;  2WIN B;  3P20 A;  1I3Q B;  3NBI A;  1FNM A;  5K36 G;  2PLF A;  4OX9 L;  2HDN B;  4XLC A;  2OQ0 A;  3HFZ B;  1GHJ A;  4N3N A;  2X6X A;  2RA4 A;  4GNX B;  2OBS A;  3P26 A;  1PMR A;  2F0W A;  4BBR B;  2I5H A;  1Q1E A;  2WAQ B;  3PUN A;  1STG A;  3VMF A;  4AYB G;  4DV0 L;  2A1A A;  1E3Z A;  4A3C H;  2JJ1 A;  2O5I C;  2B7B A;  4PMC A;  2JA9 A;  3T1Y Q;  1B8A A;  3BDO A;  1I94 L;  4R9W A;  3FJO A;  1S72 A;  2OCE A;  3EA6 A;  5ELO A;  2Q2U A;  3STB D;  3AST A;  4OPO A;  2EXZ A;  3UE1 A;  4XTC S;  4R4C A;  5C0X I;  3PGZ A;  1XWE A;  2Z0S A;  3AVW A;  1E2W A;  3G4S A;  2ZL6 A;  3CME A;  2VBV A;  2HLD A;  2YWE A;  2BV3 A;  4NBS A;  1Y8N B;  4GN3 B;  1KHI A;  1FRN A;  1SDF A;  4IQZ A;  4DR2 L;  1PYW D;  1V0F A;  4IPH A;  2Y0S B;  3NWS A;  4CKE A;  3NEN A;  1A0I A;  4TKO B;  3ZPN A;  1Y0Y A;  4YHH Q;  3LQE A;  4DV5 Q;  1K9M C;  1XMQ L;  1MI2 A;  5M5W H;  1B9N A;  4RDK A;  2HQE A;  5M3M B;  2CW5 A;  1CKM A;  4XNF A;  1QX4 A;  4A3D H;  4M4S A;  5KIX A;  1PH9 A;  1L2F A;  1VQL A;  4G6I A;  1H9R A;  3WXM A;  1GUG A;  2M9V A;  1IZ6 A;  2OK7 A;  4FF2 A;  1BUV T;  1ZYR D;  2A73 B;  2W6I A;  1LUZ A;  4IUP A;  3H3V H;  1JJ2 B;  4LFA L;  4RCZ A;  1L0W A;  3WBJ A;  2EFG A;  4PC2 A;  4BS9 A;  1GAW A;  5IK2 A;  1D7Q A;  3A5U A;  4QIW B;  1JA0 A;  3CXC A;  1D1N A;  2R7Z B;  2XZP A;  5JVH 3;  1ICW A;  1BCP B;  4CHT B;  5FLX L;  4UZU A;  3S1R B;  2NVY B;  2AUJ D;  3LWE A;  1RQP A;  2ENB A;  2VS1 A;  4JI6 Q;  4QQB X;  3AGP A;  3JQR A;  1STB A;  2EZV A;  1JB3 A;  1F2Z A;  2CQA A;  3RZO B;  4RD6 A;  3KF6 B;  4G5G A;  1TS3 A;  4LF7 Q;  4P9S A;  5AN9 A;  1YVC A;  4UZE A;  2L9H A;  4UP9 A;  1UD6 A;  2B5O A;  1LTR D;  2ID0 A;  3P75 A;  4GS3 A;  4QVA A;  4X3T A;  5FIU A;  1VQ8 B;  4CKC A;  4HIK A;  1R4P B;  3E20 A;  1A3T A;  1M8A A;  2WJY A;  4P25 A;  2L5T A;  5GV8 A;  2X0K A;  1BOS A;  2YTX A;  1FNU A;  2VB2 X;  4ABN A;  1L1O C;  4DQL A;  3U58 A;  2FMM A;  4GLA C;  4HN7 A;  1EFI D;  2B8G A;  2KEE A;  4JI1 Q;  1ELO A;  4MTN A;  3DWP A;  1MKH A;  2VJI A;  1SYB A;  4LFC Q;  4H9G A;  3ZIA A;  1WCM G;  4J0Q A;  5JEA H;  2VQF L;  1CQX A;  3DLL A;  5C5L A;  3M3Y B;  2XVS A;  5LMN W;  4XON A;  4L5T A;  3S9W A;  3G7L A;  4X3U A;  4C56 C;  4A3K H;  2N88 A;  3K5N A;  2KCM A;  2V7U A;  2B29 A;  1XXG A;  2EJM A;  3MTS A;  4KY6 A;  5IGD A;  2O2L D;  3KBG A;  1LTA D;  2AHO B;  1V1P B;  2HDM A;  3GTK H;  3R6K A;  4L5Q A;  3U2Q A;  1AW7 A;  1SE8 A;  4UPA A;  1W6J A;  3PF5 A;  4RLZ A;  1FVI A;  1LLR D;  3BCF A;  3A8J E;  3GP7 A;  2E2J B;  2GJK A;  1IYU A;  3GTO H;  4IUV A;  3X3M A;  2YU9 H;  3CF5 A;  3PO3 B;  1HR0 L;  5ISR A;  4WZK A;  1TII D;  5E1F A;  3I73 A;  3SJZ A;  4I65 A;  4TMX A;  1Q82 C;  1GO2 A;  3S2H H;  2VJJ A;  2CVR A;  4CKB A;  5CV6 A;  2RF4 A;  1VQ9 A;  2ZJP A;  1GD7 A;  2UUB L;  4QVJ A;  1C48 A;  5F4M A;  2I0Q A;  4FDB A;  1SRO A;  3BZK A;  1SE3 A;  1I5F A;  3FKI G;  4ZKC B;  4JI0 L;  1U5K A;  2B2U A;  4YAF A;  2H1E A;  1KLG D;  3C2P A;  2VZA A;  1H9S A;  1JCK B;  3HKZ B;  3I90 A;  4DV0 Q;  2JA8 G;  3GTG H;  3TP6 A;  2HQL A;  4XQQ A;  2VUM B;  2XZL A;  4RD3 A;  1YJ9 B;  2RCN A;  1S40 A;  1I94 Q;  4RD1 A;  4TSS A;  2UXD Q;  1PA6 A;  1WI5 A;  4KJO A;  1KLU D;  2NVT B;  1UD5 A;  2JA5 H;  4MHE A;  3J80 c;  3IAY A;  3FMC A;  3MXN A;  3C2Q A;  2CCZ A;  4M1K A;  4RM0 A;  2K01 A;  5GV7 A;  3OOC A;  4OOV A;  4FNF A;  4FXG C;  5IGB A;  5M5Y H;  1JMC A;  1G51 A;  2Z1C A;  4Z9C B;  3SKB A;  5M3F B;  4QF4 A;  3E0J A;  4XYQ A;  3GTM H;  4PNY A;  3S14 B;  4KN7 C;  2MQH A;  3CP8 A;  4MTK A;  4NXN Q;  4DR2 Q;  5JEA J;  3A1P A;  4JBJ A;  1TU2 B;  1IJE A;  1A8V A;  3ERO A;  1PRT D;  4A3F B;  4GZY C;  4RD2 A;  4G7H C;  4XT3 B;  1FGU A;  5KYL A;  2BGI A;  1GHK A;  4RD0 A;  1N33 Q;  4JMQ A;  1QVF A;  1ASY A;  3T1H L;  1SFO B;  1UD3 A;  1UNS A;  3G48 A;  3J81 k;  2K32 A;  1XJV A;  3S2D H;  1TLL A;  1DAR A;  3ONA B;  4HR7 B;  5HGQ A;  4L63 B;  4KD3 A;  3DXJ C;  1I6H B;  2F0F A;  4ILW A;  4ODG A;  4QL5 A;  1W2B A;  1V0E A;  4BA1 I;  4HIZ A;  1AIP A;  4KI0 A;  4U9U A;  3CMA B;  1HCZ A;  3CCS A;  2E75 C;  1I3Q H;  5EJW A;  5C4J B;  4X0C A;  1FRQ A;  1QNU A;  2KEN A;  1Y69 U;  3CMM A;  1WOS A;  4B48 A;  1BCP C;  3BDC A;  1PH3 A;  1RL2 A;  1YIT B;  3U50 C;  4C3J H;  3W5H A;  2K4K A;  5IIF A;  3G71 B;  1B9M A;  1TWF B;  1YI2 B;  1VQH A;  2CWA A;  1Z6H A;  5IYC G;  2CW0 C;  5EGT A;  2HIV A;  2DUD A;  2KHI A;  3A74 A;  2H4O A;  1X32 A;  2YWH A;  3WYA A;  1I4P A;  1E1T A;  1IL8 A;  2WAQ E;  4R8N A;  1JOO A;  3RLF A;  4BY1 G;  1BX1 A;  4M53 A;  2LSS A;  1Q46 A;  2F0O A;  4DKA C;  3Q6Q A;  3CCE B;  3AVT A;  1HFG A;  1PH5 A;  5C3E G;  4XDX A;  1J8I A;  3CCR A;  2QIL A;  1XNR L;  5A8A A;  2F4N A;  1QJO A;  1EP2 B;  1AEX A;  2ES2 A;  1ZYR C;  1Q3L A;  3BU2 A;  4J15 A;  1YNN C;  3QJY A;  4P75 A;  1M90 D;  1OHH A;  4CDD C;  4BA2 I;  3NSW A;  3KBX A;  4FK8 A;  1WPC A;  4JC0 A;  1YX2 A;  1LT6 D;  1EP1 B;  3NEL A;  1Y1V H;  2C77 A;  4GKJ L;  3KL9 A;  4XOR A;  3HOY G;  4IFD H;  4NNJ A;  2CKZ B;  2EY2 A;  2EY6 A;  4X66 Q;  3RMH A;  5IE8 A;  5C0X H;  2KCT A;  3PF4 A;  5AFW A;  1SJE D;  1YIJ B;  4R1J A;  1WSR A;  5H59 A;  2BA0 A;  2K1B A;  2PMZ B;  2W6J A;  2K33 A;  5EBC A;  1U4M A;  4Z4S A;  2N78 A;  4Q7J B;  1FJG Q;  1SYC A;  5GRO A;  5A2Q L;  2HCI A;  3ZZ0 A;  1E2V A;  4XLF A;  2VQF Q;  5DEH A;  4HJA A;  1BQE A;  4BPR A;  2YYZ A;  3T51 B;  3OP1 A;  4NMZ A;  2IPK D;  4PZ8 A;  2B8F A;  2UU9 L;  4PGO A;  1N08 A;  5KNL A;  1DXM A;  4AH6 A;  1VQF A;  1EY7 A;  4O1N A;  1IKM A;  1DD2 A;  3FEW X;  1BQQ T;  1ET6 A;  3GD7 A;  1VF7 A;  2LXK A;  2JA6 G;  2CF4 A;  1Y1W G;  2R7Z H;  2BCO A;  1KAB A;  3ASQ A;  4QIW E;  3V96 A;  5ELN A;  3V2T A;  2WB1 G;  5C4X B;  2UUA Q;  1K83 B;  2KVO A;  3B8H A;  4DUY L;  4ALP A;  1HR0 Q;  1JIC A;  4GNX A;  2PZW A;  3RZO H;  3TN2 A;  1KDA A;  2I5M X;  4JOI C;  5LMU L;  4BXX H;  1E0B A;  1YHQ B;  2RDH A;  4ZCL A;  2XIW A;  2A74 C;  1PFB A;  3M4P A;  4A3M B;  1CZG A;  1B70 B;  1QGY A;  3MHP A;  2OYN A;  2JN4 A;  4JK1 C;  1HHV A;  2X6L A;  5COY A;  2OTJ A;  1QFJ A;  2UUB Q;  1JB9 A;  2QEX B;  1VQL B;  2K5D A;  3H0G G;  4DV2 L;  5EMN A;  1KL9 A;  2XGJ A;  1L0X B;  2I46 A;  5IP9 H;  2VZL A;  4TMT A;  3O13 A;  2NTS A;  4YY3 L;  4JI0 Q;  5D3D A;  4DV6 L;  3S1Q H;  4H7B A;  3ASP A;  1WFQ A;  1NMG A;  1EY4 A;  2F3V A;  4A3E H;  1WTP A;  5FJ8 H;  1EYD A;  4BBS G;  2HCJ B;  3SK8 A;  2OBT A;  1BNZ A;  4L8J A;  1U9R A;  3TP5 A;  4JV5 L;  1XPU A;  2XRQ D;  2B2Y A;  4Y52 H;  5CDF A;  3I72 A;  5JOB A;  1AFP A;  1EFT A;  2V7X A;  3OZW A;  1GVH A;  4IFD J;  3MA2 B;  4DAY B;  1PJ5 A;  1NY4 A;  5C0X J;  4II2 A;  2JYO A;  4KHV A;  3M3Y H;  1QVC A;  2PPB C;  4CJ2 C;  2JEB I;  4DPG A;  5ELB A;  4CBV A;  5IT9 L;  4XOT A;  4DV3 L;  4X06 A;  1PYB A;  1S5C D;  1VHO A;  2KJX A;  5CC4 A;  2DY7 A;  2ZZQ A;  3K5M A;  4NDX A;  1UAP A;  2QA4 B;  3T1H Q;  1PTO D;  3J81 j;  1JJ2 A;  3W2G A;  2IY5 B;  3H09 A;  3QFC A;  3TEH B;  2KA7 A;  1VQ4 B;  5HZB A;  3PO3 H;  4LUZ A;  1JC7 A;  4OPV A;  4WZE A;  2Q2T A;  5TV2 A;  1IBM L;  2OK8 A;  3BJU A;  1PJ6 A;  3OAA A;  3QE2 A;  3AVX A;  4UDU C;  3W5V A;  1OXX K;  4LF9 L;  1TWG B;  1MHW C;  3ULP A;  3H3V I;  1WTH D;  2FX3 A;  3KF6 A;  3MC0 B;  2K14 A;  4P74 A;  2GA4 B;  4F8M A;  5M5W B;  3D0F A;  1PH7 A;  5DSZ A;  1BLI A;  4A3D B;  3AB9 A;  3A54 A;  4H0L C;  1YNJ C;  3K7A B;  2BM0 A;  1X3Q A;  2NN6 H;  3AVY A;  1VQ8 A;  5IYB G;  5GAH C;  3RZD H;  1AH9 A;  4XKV A;  2WZN A;  2PQA B;  3M7G A;  1AZP A;  1E3P A;  1JWM D;  3F8T A;  2EY5 A;  3HOZ G;  3PIP A;  4C3H G;  1XNR Q;  3NXW A;  4JI8 L;  2BOS A;  5M3F H;  1T6Z A;  1DGS A;  4R4I A;  3S14 H;  1BXT A;  4J8Q A;  3BVM A;  4P71 A;  3E5S A;  4ACA A;  5ELC A;  1VLY A;  4X62 L;  3LWU A;  3OMC A;  3R2T A;  1T6Y A;  4Z4Z A;  4A3F H;  1J5E L;  1SN8 A;  5D3I B;  2F1L A;  3D8G A;  3BNW A;  4WZL A;  5CV4 A;  4ROX A;  1AMO A;  4IJL A;  3GTL B;  4OOS A;  4KK7 A;  3AFQ A;  2HT1 A;  4RGO S;  1NR4 A;  4A76 A;  1SFO H;  1FX0 A;  2GJR A;  3EIV A;  2K52 A;  2V1C C;  1MSG A;  2CND A;  3Q39 A;  3VR6 A;  5AJ3 L;  4A3J B;  5JJL A;  3NEM A;  4WZT A;  3CPF A;  4C3I G;  1VQ5 B;  5C3W A;  1SNP A;  4A3G G;  2AHO A;  1EP3 B;  1QUF A;  1V1P A;  2KQ3 A;  3A7A B;  1KDB A;  1FNC A;  1XPO A;  1JR0 D;  3E9H A;  2X6G A;  2DIE A;  3SJP A;  2MP1 A;  3D6C A;  3PIP 3;  1UEB A;  2XNJ A;  1M90 C;  4JBW A;  2RVL A;  1Y14 B;  3SK6 A;  2GPJ A;  5HY6 A;  3PUV A;  1KC8 D;  2ZXP A;  3ZUG A;  1Q81 D;  1PH8 A;  4MYU A;  1UMK A;  2EYF A;  4Q5V A;  2CRV A;  4DU9 A;  1IHZ A;  3S1M H;  3NE5 B;  4WQM A;  2ZM6 Q;  1X3P A;  1BR9 A;  1TS4 A;  3K5O A;  5C44 G;  1GAQ A;  1EWC A;  2ZBV A;  3NTK A;  5FKA C;  3FPU B;  1TUI A;  4F7X A;  4DA2 A;  3RN2 A;  1I4H A;  4RKL A;  1JA1 A;  1Q7Y C;  1YJ9 A;  3I91 A;  1HTP A;  3ICE A;  3M4Q A;  1F20 A;  3UDX A;  2BSA A;  4YY3 Q;  3OMG A;  1PZI D;  2YU9 B;  2M00 A;  1DON A;  4LUV A;  4JV5 Q;  4P2N A;  1VLO A;  1V43 A;  4DV4 Q;  3S2H B;  5TRD A;  2N55 A;  5EKL A;  1IW7 D;  1QFZ A;  1KTK A;  3P7J A;  4JI7 L;  1ESR A;  1WOR A;  3E0E A;  3W2I A;  2CWP A;  4G4K A;  3UDG A;  2PMZ E;  3CPX A;  2DY8 A;  3M9B A;  4DNI A;  2D9R A;  1TS2 A;  2BE5 D;  2PQE A;  4GOP B;  1GJX A;  2Z6K A;  3J81 E;  1SE2 A;  3RLO A;  1C9O A;  1GUN A;  1VMC A;  1X3E A;  4N8X 1;  3GTG B;  2PYK A;  2LZJ A;  1HZA A;  5KRU A;  2ZT9 C;  4X7D A;  4UZF A;  3MAQ A;  4DV3 Q;  1P8L A;  1PH6 A;  3TS2 A;  3CMA A;  4XQF A;  2JA7 H;  2RCF A;  2MPM A;  4MN3 A;  2BH2 A;  1DDG A;  2F0L A;  2OQK A;  4ID6 A;  5JVG 3;  1YIT A;  1E22 A;  1Q82 D;  3FP9 A;  3G71 A;  1F60 A;  2EYL A;  3M85 A;  2BMW A;  1YI2 A;  1N05 A;  4PMB A;  4IW3 B;  1LAB A;  1K8G A;  3BCD A;  5I2X A;  4FF3 A;  1NBW A;  4A3M H;  2LXJ A;  3FPP A;  5C6A A;  1T6X A;  1EQV A;  1S4Z A;  4OEL B;  1HTL D;  5LMZ A;  4A3B G;  3D4R A;  4XL9 A;  1FL0 A;  5C4Z A;  2HIX A;  3CCE A;  3ONU A;  3T4A C;  2QMU A;  5IYD H;  4ZCM A;  1NRK A;  4OGQ C;  2FFK B;  5JAV A;  3SDZ A;  5E6T A;  5IYW A;  3PIO A;  3H3V C;  3I70 A;  1FND A;  3VR4 A;  3U6K A;  2R92 G;  5DN6 A;  2UXC L;  4DAV A;  5IP7 G;  2ZTE A;  1FD7 D;  1B2T A;  1V8Q A;  3TP8 A;  1JOK A;  1XTD A;  4KHZ A;  3I4N H;  4MIU A;  4RGT A;  1VQN B;  3GVK A;  3L0O A;  2ICI A;  2J7Z A;  5I6Y A;  4C3J B;  5IOC A;  1Q90 A;  1HVX A;  3F1Z A;  3PUY A;  5FLM G;  2C9O A;  2L15 A;  3E9I A;  4JI8 Q;  3VYR A;  5K36 H;  3OE7 A;  2F0K A;  4K5V A;  2AQ2 B;  1YIJ A;  4K14 A;  5ELD A;  4AF6 A;  3QSY A;  2C4U A;  1ILQ A;  2B2U C;  1GM5 A;  5DLQ E;  4DR6 L;  1G6Z A;  2ZL5 A;  2KBN A;  3VYS A;  3QWN A;  4X62 Q;  1BJK A;  2K5V A;  2OTJ B;  2EIF A;  3UDI A;  2OWO A;  1J5E Q;  1HNW L;  5E4W C;  4XLE A;  3Q8D A;  5JPN C;  2VBT A;  1P16 A;  1WU8 A;  1GUT A;  4IFD I;  3PIO 3;  1E63 A;  4A3C G;  1MD2 D;  1Z9F A;  2DOG A;  3E1Y E;  2L11 A;  3DWA A;  4JI2 L;  1GUW A;  3K6O A;  1WOO A;  5AJ3 Q;  3HOV G;  1NB0 A;  4BWG B;  5BN4 A;  1BCP D;  4K5X A;  1EYG A;  3Q23 A;  1IB0 A;  2NV4 A;  1HJP A;  2XWJ B;  5FO9 B;  1B50 A;  1CK1 A;  2A69 D;  1S4M A;  2BH8 A;  2HUG A;  2CW0 D;  1Y1V B;  4C1N I;  2XGT A;  5IGC A;  3OWE B;  4NW2 A;  1TWG H;  1Y8P B;  2FJ2 A;  5I6W A;  3JAM c;  3FRP B;  1HUM A;  4PQX A;  1D2B A;  2R7F A;  2GK6 A;  4NXM L;  1YHQ A;  1UWV A;  5CV9 A;  3C3L A;  1JE5 A;  2Q8I B;  3WNC A;  1HUN A;  2NVX H;  2QEX A;  1JJC B;  4Z1M A;  3K7A H;  3OJW A;  1F2Y A;  1H9J A;  1VHE A;  4C1N K;  2R6H A;  1U4P A;  2EYH A;  4C0S A;  3G05 A;  2N8N A;  2KEC A;  4YAW A;  4K0K L;  5A89 A;  4K6D A;  4RCN A;  1YNN D;  1R9T B;  1Y8O B;  1K28 A;  1VMP A;  4RGN A;  1II3 A;  2E5L L;  1B53 A;  2A5H A;  5TSS A;  3NQI A;  4X64 L;  1TVC A;  4B4D A;  4JW0 A;  5EBD A;  1XB2 A;  1I6V C;  1VQP B;  1EIG A;  1U4R A;  3NWT A;  1F2M A;  4AF7 A;  1LT4 D;  4ZLT F;  3LGJ A;  1EFW A;  4PC7 A;  4DAY A;  4TN1 A;  1I7P A;  4RG1 A;  4YCW A;  1VQG A;  1SRU A;  2B2T A;  3S24 A;  4EQ5 A;  1KC8 C;  3GTL H;  2JN9 A;  1Q81 C;  4MNO A;  1UD2 A;  3GVJ A;  3I55 B;  3T16 A;  4GOP C;  3ND9 A;  3QO2 A;  4BY7 B;  4KY7 A;  4HIO A;  5FNZ A;  3OEH A;  4HAE A;  3CES A;  2NZ1 D;  4XR6 A;  3KDF B;  4JI7 Q;  2BA1 A;  4WWV A;  4A3J H;  3HOU G;  1V1Q A;  5FO8 B;  2NVQ B;  3GDE A;  4B3R L;  1C7Y A;  3G6J B;  4DR7 L;  1K73 D;  2C5C A;  1HR0 W;  1SNC A;  2EOT A;  3S16 H;  4O0A A;  1YJN B;  2QA4 A;  1DM0 B;  3EQL C;  2ZTG A;  4X65 L;  3S1Q B;  4A3E B;  4UAJ A;  1DJR D;  5EPL A;  1VQ4 A;  1EY8 A;  1ICF B;  4HJ8 A;  1FNV A;  2WPD A;  3A5Z B;  1SNQ A;  4HCE A;  4JCV E;  3VYU A;  3HP3 A;  2MJ8 A;  1N8R C;  2FMC A;  2F0T A;  3I2Z A;  3TRZ A;  2WZP P;  2ATW A;  5FO7 B;  2GQF A;  3K59 A;  1PH1 A;  2PI2 E;  4AQY L;  3DWQ A;  1RHP A;  4XT1 B;  3TS0 A;  1KRS A;  1IW7 C;  2MUY A;  1CM9 A;  5FL7 A;  1NMF A;  1I4R A;  3V05 A;  4G7W A;  2F3I A;  1RQR A;  4C2M H;  2F4V Q;  3FKS A;  3LQ6 A;  2BE5 C;  2D9U A;  1WCM H;  4LF5 Q;  2HHH L;  1LAC A;  4YCU A;  2VBS A;  3ISX A;  2VNI A;  4QB4 A;  4WRD A;  1N34 Q;  4B3M L;  1O7Z A;  3SR1 A;  1HRJ A;  4A3K G;  1TT2 A;  2PQA A;  1U2R A;  1SKQ A;  4X7F A;  1E1Q A;  5C5M A;  1QVG B;  4DXF A;  4CQJ A;  4A93 G;  4CGY B;  3BVG A;  1XMO Q;  2UUC Q;  3GTP H;  4LBY A;  5TR9 A;  4KTA A;  4X05 A;  4GNX C;  1E7Z A;  4OX9 Q;  4Y7N B;  4B43 A;  2NN6 I;  1QZG A;  4PC1 A;  3A56 A;  3G6E B;  3CP0 A;  5THX A;  3NPP A;  4LFB L;  3CRZ A;  3IFD A;  2RHQ B;  5CYU A;  1E79 A;  1BO0 A;  1QB5 D;  3HOX B;  4GN5 A;  3BZD B;  4QCL A;  1XNQ L;  1EU4 A;  1D5X C;  4DR6 Q;  3PCO B;  1VQ5 A;  2E2I B;  1EQT A;  1EY6 A;  1J6Q A;  1K8M A;  3D6W A;  1HNW Q;  1PVO A;  4ZCK A;  1C4Q A;  3GQB A;  4RD4 A;  1QUE A;  3RZD B;  1W3S A;  2ZTD A;  4FXU A;  4U68 A;  1ML0 D;  2D74 A;  2PE3 A;  2B2Y C;  2LS0 1;  4NP5 A;  3MXU A;  4QMG A;  3A7L A;  3E3X A;  4XM3 A;  3HOW B;  1VQC A;  2N49 A;  3M4Y A;  2QTL A;  4YIJ A;  1D2E A;  1IKL A;  4JI2 Q;  4UY8 C;  1SEB D;  3CHB D;  1OO9 B;  4B3T L;  4N3G A;  3K8A A;  2F0P A;  1EYC A;  1E2Z A;  4RH6 A;  2AWN A;  2PI2 A;  2JA5 G;  4FYD A;  2R93 G;  2Q2H A;  3PSI A;  3BY1 A;  4KLK A;  3H94 A;  2Q6O A;  5L37 A;  4B44 A;  3URY A;  1T5E A;  1PDQ A;  2B39 A;  4X7E A;  5HZA A;  3I56 B;  3ND8 A;  4ME3 A;  3PO2 G;  3GTJ H;  4DV1 L;  1XMQ Q;  1YNJ D;  1U4L A;  2XSC A;  4X3S A;  3QR8 A;  4NXM Q;  3PA1 A;  1VCI A;  2K5Q A;  4KN4 C;  3LX0 A;  5FK9 C;  3CTA A;  4HIM A;  2K28 A;  3A8J A;  2BDN A;  2OT2 A;  2OEO A;  3JAM E;  3RY8 A;  1TY2 A;  5T1I A;  3L3O C;  2KVM A;  1AE2 A;  5GQO A;  1BX0 A;  2HDL A;  1KTV A;  4LFA Q;  1BBX C;  2E5L Q;  5DNF A;  2WR8 A;  5H5J A;  4Z4Y A;  2A69 C;  2D0O A;  2EE1 A;  2G9H D;  4GQN A;  5M5X H;  4A3I B;  3OSO A;  3EVQ A;  1UEA B;  3GTQ H;  4P12 A;  1K3R A;  4XLA A;  4K5W A;  3CRL C;  2EPB A;  2JJQ A;  3KLS A;  3R3O A;  4B3F X;  2F0S A;  2LKV A;  1FR3 A;  4QUF A;  3NHH A;  3S1M B;  4GOP A;  4QFM A;  2D3L A;  1PFS A;  1X54 A;  5IYC H;  4BBR G;  4U67 3;  4IZ8 A;  2WAQ G;  1CKO A;  2F0V A;  1JNY A;  5L46 A;  3KUP A;  4EQP A;  1H8E A;  4PAB A;  3OPO A;  2KHJ A;  3JU4 A;  3A3G A;  1K8A D;  1M1K C;  2M5S A;  3NP8 A;  2GJP A;  4RWS C;  4MZ9 A;  1I50 B;  2PW7 A;  2OTL B;  3PVD A;  5D65 A;  1Q1B A;  4B3R Q;  3CCV B;  2EQS A;  1B1Z A;  2VW9 A;  4OIK A;  1IBK L;  1XQB A;  1QGA A;  1CUK A;  4DK0 A;  1EFC A;  4KD4 A;  4X65 Q;  2F03 A;  1I4X A;  1CKN B;  3AVU A;  3QFT A;  1CSQ A;  4ZYS A;  2F1M A;  1YLO A;  1O7I A;  4YAL A;  3J80 i;  2WSS A;  2WP8 J;  1RJT A;  2Q6I A;  2Y0S G;  4V0B A;  1EL0 A;  3HOY H;  4A4I A;  5CMD A;  4YAU A;  4G57 A;  4YCV A;  2FXQ A;  5C0X G;  5GAE C;  5FO0 A;  4IN3 A;  1S5E D;  4FVM A;  2CBX A;  3I4M B;  4J1M A;  1K28 D;  1LTI D;  5M3M G;  1Q7Y D;  1TKW B;  4P2C B;  3ZYY X;  1R9T H;  2KOL A;  3BZC A;  5KGU A;  4N8F A;  1K73 C;  1TVX A;  2X3U A;  5CV8 A;  4XN0 A;  4DR5 L;  2HHH Q;  4AVZ A;  4HMJ A;  3UE0 A;  4B3M Q;  2JA7 B;  3C46 A;  4F87 A;  1Z47 A;  1VQN A;  2CC2 A;  2N3S A;  1GUS A;  3DMU A;  1EFR A;  3RLN A;  1DZ1 A;  3J80 L;  1YEZ A;  1R5N A;  1GO3 E;  4LF6 L;  2R7Z G;  1CA5 A;  4FXK C;  5JPM C;  1PV4 A;  3KEW A;  2CQO A;  4BY7 H;  1A2U A;  2DJG C;  2AQ1 B;  2RDF A;  1CNF A;  3B6Y A;  2JE6 I;  2EIX A;  1TXY A;  2WAC A;  1WJJ A;  3ZJY C;  5HGT A;  2NVQ H;  1G6P A;  3RR5 A;  4BXX G;  5CGK A;  4XXE A;  1B7Y B;  4OWW B;  3OTO L;  4AC9 A;  5IYQ A;  1E24 A;  3J81 c;  1HZB A;  2A6E C;  3CC7 B;  2ZJR A;  1UE7 A;  4PV1 C;  1XNQ Q;  3H0G H;  4X07 A;  1X55 A;  1EWY A;  3PV0 A;  5IP9 G;  5IOD A;  1GOZ A;  2C5H A;  4K8I A;  3I4N B;  5LL6 X;  4IAL A;  1OB0 A;  1GJR A;  1LYL A;  5KNB A;  1YNX A;  3KJO A;  2DY1 A;  4BBS H;  3VO1 A;  1QGZ A;  2F0U A;  1EQR A;  3SVM A;  4FF4 A;  1QNK A;  3ERS X;  3PUW A;  4F7D A;  3ITP A;  4HSV A;  1I4Q A;  4M2L A;  4B3T Q;  4RFB A;  2Z6K C;  1BKB A;  1RTN A; 
#chains in the Genus database with same CATH homology
 1WTR A;  3CKI B;  3QIA A;  1PKV A;  4G7X A;  5A2Q E;  4HMI A;  4OIJ A;  1LO5 D;  3Q22 A;  2F43 A;  1F9P A;  3BDL A;  1RD9 D;  4AYB B;  1RKN A;  1CTM A;  2F0Q A;  1STA A;  3T56 B;  3D31 A;  4OO1 H;  2IW3 A;  2IWH A;  2ZXI A;  2V31 A;  2J4X A;  2F0H A;  2ICE C;  5KYI A;  1GUO A;  3EJI A;  4IUT A;  5CV7 A;  1V1O A;  4XOP A;  4S3S A;  3M4O B;  3R2I A;  4FF1 A;  5COR A;  4EGV A;  2NVX B;  1EIH A;  3PUZ A;  1AP0 A;  3U9S A;  1EY5 A;  3IL8 A;  4H44 C;  2R61 A;  1ILP A;  2EYO A;  1A2T A;  3DDY A;  2D2C C;  1CT1 D;  2K7V A;  1UUP A;  1SYE A;  2JJ2 A;  5HKK A;  2D3N A;  3L9A X;  5EQ0 A;  2PW5 A;  2X69 A;  4G7O C;  2KED A;  2ZXR A;  3PMF A;  5IT9 E;  5KNC A;  1AN8 A;  1F9S A;  4B9X A;  3HGB A;  3RD4 A;  1RF2 D;  5BN3 A;  3S16 B;  1BF4 A;  1ZEQ X;  1W6K A;  1TS5 A;  5IGG A;  1HQR D;  1LT3 D;  2KHS A;  3UI2 A;  1PZJ D;  5IGE A;  2XOK A;  2CHB D;  2Z4I A;  1W0J A;  2L4N A;  1WP6 A;  4M1U B;  5DM6 3;  2SOB A;  3MWY W;  5E4X A;  4M8A A;  1G2T A;  3VYT A;  4YXW A;  3PUX A;  3TDQ A;  2F0I A;  1KDC A;  1T5X D;  3TZU A;  2DN8 A;  2XND A;  3NK9 A;  4C2M B;  2RSN A;  2JIZ A;  1WCM B;  3Q0A A;  2B2W C;  5CBE E;  2TSS A;  3BS1 A;  1SSO A;  5J1Z A;  2X6W A;  5BN5 A;  2RBM A;  1MAB A;  3U9O A;  3GTP B;  3D4W A;  1RDP D;  3DUZ A;  1JOQ A;  1UD4 A;  5CV5 A;  2FHT A;  2B2T C;  3MHB A;  5C4H A;  2F0G A;  1H9M A;  3W2D A;  3KK7 A;  2LMC B;  4ZQ3 A;  4X3K A;  4ZKB B;  1Q8I A;  2ZXO A;  1J9O A;  2I07 B;  3VR3 A;  4V19 0;  3FKI B;  1LTS D;  2WV6 D;  4DK1 A;  2K05 A;  1A15 A;  1KZL A;  1WTQ A;  2JXM B;  2JA8 B;  3S17 B;  1I8D A;  4XIG S;  1EY9 A;  3VR2 A;  5F2D A;  1PFN A;  3DEP A;  3MZ5 A;  4K2K A;  4DNR B;  2G9D A;  4K2L A;  2NBF A;  1DOK A;  3GTJ B;  1ZXT A;  3MVV A;  2IT1 A;  2WKC A;  2L1B A;  3BYT B;  4XYO A;  3SK4 A;  1SMY D;  1WTX A;  3CQZ B;  4XN3 A;  5J39 A;  2RSO A;  2F3W A;  1DOM A;  1CI3 M;  1F77 A;  1H8H A;  3OWF A;  1SNO A;  5ELF A;  2QDB A;  3WDN A;  1MBY A;  1EOT A;  2RKS A;  1EZ8 A;  3KLR A;  5G3L F;  5M5X B;  3TBI B;  3GTQ B;  3SXH A;  3ERQ A;  1WVL A;  4WOR A;  3J7A V;  1PRT F;  3BVZ A;  2F4I A;  4IUR A;  4OHJ A;  4WFN 3;  3HRZ C;  4UAI A;  1GXD C;  1BMF A;  1OXU A;  2MHV A;  1LV9 A;  3TP7 A;  4CJ0 B;  1WTW A;  4BY1 B;  1I18 A;  1DOL A;  1ROD A;  1TY0 A;  1VF5 C;  1PXU A;  4K8J A;  1FNW A;  2O4X A;  5C3E B;  3E6Z X;  2SEB D;  3IFT A;  4DF7 A;  2IX1 A;  3A3B A;  1ENC A;  1F2L A;  4ZUI A;  1QG7 A;  2KCC A;  1QE6 A;  2Z4H A;  4J6H A;  1SND A;  4B9W A;  3NBH A;  3M7N A;  1NAP A;  1S5B D;  3HOY B;  2ZXH A;  3OIQ A;  1W9X A;  4XLH A;  1TWH B;  2RQX A;  1SJH D;  1QIL A;  3K58 A;  1EYA A;  2B2W A;  2IX3 A;  2RDG A;  4B08 A;  5FOB B;  5DAU A;  2KCN A;  2Z8L A;  1CZW A;  1WD1 A;  2A68 D;  3MEH A;  3OEE A;  2JA6 B;  1Y1W B;  5CR3 A;  3QOL A;  2K6A A;  2AUK A;  2EYM A;  4FP5 D;  4PMW A;  2E1B A;  2WB1 B;  1PTO H;  5EPK A;  4DFA A;  1QCB D;  4DN4 M;  4KY5 A;  2BDO A;  1PLF A;  4F88 A;  4XD7 A;  4ME5 A;  3BH4 A;  1AZQ A;  1SYG A;  2MGS A;  4ZUJ A;  4O42 A;  1JWU D;  1SYD A;  2X85 A;  1A3U A;  3H0G B;  4QUC A;  2R9V A;  3NUC A;  4P22 A;  2D5D A;  1XTC D;  1O78 A;  4BBS B;  1SKY B;  2WKD A;  3CRK C;  5KND A;  2QKI C;  2QCP X;  4KV6 A;  1UD8 A;  2E76 C;  3IKJ A;  4EVO A;  1EWH A;  2ZTN A;  4ZRZ A;  1CHQ D;  3HEJ A;  1EU3 A;  2F0E A;  5JEA G;  4OO1 I;  2K03 A;  2A6E D;  1HQM C;  1B4O A;  3QG1 A;  2TMP A;  3P1H A;  1G91 A;  3I3C A;  1F9Q A;  2O5J C;  3SEB A;  1EZ6 A;  3HG9 A;  4IUU A;  1QOH A;  5FLX E;  1VDZ A;  3T53 B;  3HAG A;  2DNC A;  3S1N B;  4RCO A;  5HUR A;  2Q8R E;  1WD0 A;  4RA8 A;  3HS0 C;  3Q6S A;  1IYV A;  2JDI A;  1RTO A;  1L0Y B;  3S15 B;  1ZKO A;  1WTO A;  1VJS A;  1JOR A;  1A3V A;  4RHS A;  3JAM L;  1H9K A;  4KJN A;  2M2L A;  1TWC B;  3N6R A;  2PO4 A;  5NUC A;  3KLS X;  4E0F A;  1SMY C;  1PTO F;  4OL7 A;  1E1R A;  2HCC A;  1LTG D;  2QEJ C;  4XMY A;  3AU7 A;  1CQF A;  4L6T B;  2F0J A;  1EEF D;  3MXP A;  3HOZ B;  2SDF A;  4C3H B;  5I4D A;  5D14 A;  1HA6 A;  3WOF A;  4N9T A;  1D1K A;  1TQO A;  2K5W A;  3WQZ A;  4YEJ A;  1JWS D;  1SNM A;  2F0D A;  3W3A A;  2V7Q A;  4H13 C;  3OW7 A;  2PCF B;  2XRS D;  1BDO A;  5G3L D;  5A35 A;  5DM7 3;  1RCV D;  4CJ1 B;  4DGZ A;  1S5F D;  2NUC A;  1KMH A;  4C3I B;  3J7Y W;  4A3G B;  3DM1 A;  1HA5 A;  1XX8 A;  1G29 1;  1K8O A;  4C3J G;  3CP2 A;  3LNN A;  3QOJ A;  3D4D A;  2B2V C;  2VB3 X;  3R8B A;  1SE4 A;  3R93 A;  1DYQ A;  3GVL A;  4DAP A;  1B3A A;  2E2D C;  5C44 B;  1KAA A;  3J7A F;  1KNE A;  1BPL A;  5LHY 1;  4NKL A;  1TWA B;  3H6M A;  2QE7 A;  1CFM A;  3A55 A;  1JQY D;  3EFX D;  4KKT A;  1PRT B;  4TSF A;  3FDT A;  4WJW A;  2A68 C;  4E6I A;  1E3X A;  2EDG A;  2IL8 A;  4IFD G;  1CQV A;  2XN9 C;  2E2H B;  1ET9 A;  2IJ0 A;  1CHP D;  3A35 A;  3N52 A;  2EYP A;  2Q8T A;  3VR5 A;  4XQJ A;  4IUN A;  1SXT A;  4HED A;  2FIN B;  2EJG C;  2F0M A;  2ZZF A;  3MFG A;  3OHX C;  1O7L A;  1G2S A;  3SHL A;  1D5Z C;  2GK7 A;  5I2Y A;  4N9P A;  3Q24 A;  3KF8 A;  2EYJ A;  2K04 A;  4KMU C;  1FGB D;  2EY1 A;  5I9O A;  3VA5 A;  2J0T D;  2A6H D;  2DNE A;  2B63 B;  2SNM A;  3I4L A;  4A3B B;  3L7Z C;  2NWG A;  5E3F A;  3OFN A;  2AWO A;  2ZZG A;  2D62 A;  3A8I E;  5LL6 S;  1ESF A;  3K5L A;  1QWY A;  4EQO A;  2R92 B;  5J22 A;  4RGM A;  5I9P A;  1XYI A;  2NTT A;  1B44 D;  4IUQ A;  3A8K E;  2L12 A;  1WTV A;  1STY A;  1STN A;  1Z7T A;  5IGF A;  4Q0F A;  4ZK9 B;  1D1I A;  1O80 A;  3I8Z A;  5T1G A;  3QB3 A;  2X8K A;  5M9O A;  1JE4 A;  2PZU A;  3C1F A;  2LFN A;  2PZT A;  3K57 A;  2VXW A;  3HOV B;  3J80 E;  1R4Q B;  2AQ3 B;  1PZK D;  3WOE A;  4OO1 G;  4K6L A;  3BG3 A;  4LK1 C;  3F2U A;  4FO2 A;  4TT3 A;  1C8C A;  1EY0 A;  1CA6 A;  3VA7 A;  2ZZE A;  2SNS A;  2B2V A;  4DNT B;  2F0N A;  1ENF A;  3C1E A;  1BCP F;  1DCZ A;  3SK5 A;  3BC9 A;  2NN6 G;  3GV6 A;  1OXV A;  4LAA A;  1D6E C;  1PRT C;  3NTH A;  5EKK A;  1OXT A;  3NQT A;  4ASU A;  1G8Z D;  5JJZ A;  5KEE A;  1LTT D;  1PTO B;  1LTB D;  1NSN S;  1FYC A;  2LY7 A;  4G7Z C;  2Z6B D;  1ONL A;  2KUM A;  4KKU A;  2OF1 A;  4TQU S;  2QF7 A;  3BYY B;  3HOU B;  1HXY D;  1EEI D;  1E43 A;  1O7Y A;  3J81 L;  1HZE A;  1HFN A;  1H9S B;  1D5M C;  3NTI A;  1SYF A;  1COW A;  2XZO A;  1Q12 A;  1KNA A;  4TRD A;  3T13 A;  2OXP A;  2XWB B;  3CU7 A;  1STE A;  4DXG A;  4LMQ D;  5CBA E;  1I4G A;  3OIP A;  4I7Z C;  2JEA I;  3FVQ A;  1HPC A;  2X53 S;  3HZX A;  4R8I A;  3TSS A;  4A3K B;  1NCV A;  1STH A;  3GTK B;  4A93 B;  2R6G A;  3SE0 A;  4KKS A;  2CK3 A;  4B3G A;  3GV3 A;  2WII B;  1MSH A;  1NBM A;  3GTO B;  1NUC A;  3DEO A;  3K0Y A;  3GO5 A;  3MFY A;  3TME A;  2EVB A;  2NB0 A;  2E74 C;  4XQN A;  4HSP A;  2A6H C;  1F9R A;  4RAU C;  2IX0 A;  3D3R A;  1SBB B;  4RHR A;  1OXS C;  5K5P A;  3DHQ A;  2R3Z A;  4ULL A;  1LT5 D;  3X3N A;  1A6X A;  1ENA A;  2X6Y A;  5ELE A;  5C3X A;  4LJZ C;  3MXG A;  4FXD A;  5EKI A;  2NYZ D;  1S5D D;  4ZAI A;  4XKW A;  3RUZ A;  2JA5 B;  2R93 B;  1TR5 A;  1W0K A;  2XNA C;  4II3 A;  2WJV A;  1SAP A;  3AMU A;  5M5Y B;  3GTM B;  3PO2 B;  2EJF C;  1MGS A;  3H91 A;  2JP1 A;  2V4D A;  3TZD A;  4EQN A;  1PFM A;  2L0C A;  2JSO A;  4HCS A;  1M4V A;  4RKB A;  3S2D B;  4YEL A;  1NR2 A;  2L55 A;  5EPJ A;  4HTH A;  1PTO C;  2WIN B;  3P20 A;  1I3Q B;  3NBI A;  5K36 G;  4XLC A;  1GHJ A;  2X6X A;  2RA4 A;  1PMR A;  2F0W A;  4BBR B;  1Q1E A;  2WAQ B;  1STG A;  1E3Z A;  2JJ1 A;  2O5I C;  4PMC A;  3BDO A;  4R9W A;  3EA6 A;  2EXZ A;  4XTC S;  5C0X I;  1XWE A;  1E2W A;  2HLD A;  4IQZ A;  1Y8N B;  1SDF A;  1PYW D;  1V0F A;  2Y0S B;  3NWS A;  4CKE A;  4TKO B;  3ZPN A;  1MI2 A;  1B9N A;  2HQE A;  5M3M B;  4XNF A;  5KIX A;  4G6I A;  1H9R A;  1GUG A;  2M9V A;  4FF2 A;  1BUV T;  1ZYR D;  2A73 B;  2W6I A;  4IUP A;  4BS9 A;  5IK2 A;  4QIW B;  2R7Z B;  2XZP A;  5JVH 3;  1ICW A;  1BCP B;  4CHT B;  5FLX L;  4UZU A;  3S1R B;  2NVY B;  2AUJ D;  3LWE A;  2ENB A;  1STB A;  2EZV A;  1JB3 A;  1F2Z A;  2CQA A;  3RZO B;  1TS3 A;  2L9H A;  1UD6 A;  1LTR D;  3P75 A;  2ID0 A;  4X3T A;  4CKC A;  1R4P B;  1A3T A;  1M8A A;  2WJY A;  2L5T A;  1BOS A;  1FNU A;  2VB2 X;  4ABN A;  2FMM A;  4HN7 A;  1EFI D;  2B8G A;  2KEE A;  3DWP A;  2VJI A;  1SYB A;  3ZIA A;  5JEA H;  5C5L A;  3M3Y B;  2XVS A;  4XON A;  3S9W A;  3G7L A;  4X3U A;  4C56 C;  2N88 A;  3K5N A;  2EJM A;  1XXG A;  3MTS A;  4KY6 A;  5IGD A;  2O2L D;  3KBG A;  1LTA D;  1V1P B;  2HDM A;  1AW7 A;  1W6J A;  1LLR D;  3BCF A;  3A8J E;  3GP7 A;  2E2J B;  2GJK A;  1IYU A;  4IUV A;  3X3M A;  3PO3 B;  5ISR A;  1TII D;  5E1F A;  3I73 A;  4I65 A;  2VJJ A;  2CVR A;  4CKB A;  5CV6 A;  1C48 A;  1SE3 A;  4ZKC B;  2B2U A;  2H1E A;  1KLG D;  3C2P A;  3HKZ B;  1H9S A;  1JCK B;  3I90 A;  3TP6 A;  4XQQ A;  2VUM B;  2XZL A;  4TSS A;  4KJO A;  1KLU D;  2NVT B;  1UD5 A;  4MHE A;  3IAY A;  3FMC A;  3MXN A;  2K01 A;  3OOC A;  4FNF A;  4FXG C;  5IGB A;  2Z1C A;  4Z9C B;  5M3F B;  4QF4 A;  3E0J A;  4XYQ A;  3S14 B;  4PNY A;  4KN7 C;  3CP8 A;  5JEA J;  1TU2 B;  3ERO A;  4A3F B;  4GZY C;  1PRT D;  4G7H C;  4XT3 B;  5KYL A;  1GHK A;  4JMQ A;  1SFO B;  1UD3 A;  1UNS A;  2K32 A;  3ONA B;  4HR7 B;  4L63 B;  4KD3 A;  3DXJ C;  1I6H B;  2F0F A;  4ILW A;  4ODG A;  1V0E A;  4BA1 I;  4HIZ A;  4KI0 A;  1HCZ A;  2E75 C;  5EJW A;  5C4J B;  1QNU A;  1Y69 U;  3CMM A;  3BDC A;  1BCP C;  5IIF A;  1B9M A;  1TWF B;  1Z6H A;  2CW0 C;  5EGT A;  2H4O A;  1X32 A;  1I4P A;  1IL8 A;  4R8N A;  1JOO A;  3RLF A;  2F0O A;  1HFG A;  4XDX A;  1J8I A;  2QIL A;  1QJO A;  1AEX A;  1ZYR C;  1Q3L A;  1YNN C;  3QJY A;  4BA2 I;  1OHH A;  3NSW A;  3KBX A;  1WPC A;  1LT6 D;  4XOR A;  4IFD H;  4NNJ A;  2EY6 A;  2EY2 A;  3RMH A;  5C0X H;  5AFW A;  1SJE D;  2BA0 A;  2K1B A;  2PMZ B;  2W6J A;  2K33 A;  5EBC A;  1U4M A;  1SYC A;  5A2Q L;  2HCI A;  1E2V A;  4XLF A;  5DEH A;  2YYZ A;  3T51 B;  4NMZ A;  2IPK D;  2B8F A;  5KNL A;  1DXM A;  1EY7 A;  4O1N A;  1IKM A;  1DD2 A;  3FEW X;  1BQQ T;  1ET6 A;  3GD7 A;  1VF7 A;  2BCO A;  1KAB A;  3V96 A;  3V2T A;  5C4X B;  1K83 B;  2KVO A;  1JIC A;  2PZW A;  3TN2 A;  1KDA A;  1E0B A;  2RDH A;  2XIW A;  2A74 C;  1PFB A;  4A3M B;  1CZG A;  4JK1 C;  1HHV A;  2X6L A;  5COY A;  2K5D A;  2XGJ A;  1L0X B;  2I46 A;  3O13 A;  2NTS A;  5D3D A;  4H7B A;  2F3V A;  1EY4 A;  1WTP A;  1EYD A;  3SK8 A;  1BNZ A;  4L8J A;  1U9R A;  3TP5 A;  2XRQ D;  2B2Y A;  5CDF A;  3I72 A;  5JOB A;  1AFP A;  4IFD J;  3MA2 B;  5C0X J;  4II2 A;  2JYO A;  4KHV A;  2PPB C;  4CJ2 C;  2JEB I;  5ELB A;  4CBV A;  5IT9 L;  4XOT A;  1S5C D;  2KJX A;  5CC4 A;  2DY7 A;  2ZZQ A;  3K5M A;  4NDX A;  1UAP A;  1PTO D;  3H09 A;  2KA7 A;  1JC7 A;  3OAA A;  4UDU C;  1OXX K;  1TWG B;  1WTH D;  3MC0 B;  4F8M A;  2GA4 B;  5M5W B;  1BLI A;  4A3D B;  3AB9 A;  3A54 A;  4H0L C;  1YNJ C;  3K7A B;  1X3Q A;  2NN6 H;  4XKV A;  3M7G A;  1AZP A;  1JWM D;  2EY5 A;  4C3H G;  3NXW A;  2BOS A;  1BXT A;  4J8Q A;  3BVM A;  3E5S A;  5ELC A;  1VLY A;  3LWU A;  3OMC A;  3R2T A;  5D3I B;  3D8G A;  5CV4 A;  3GTL B;  4KK7 A;  4RGO S;  1NR4 A;  1FX0 A;  2GJR A;  1MSG A;  4A3J B;  3VR6 A;  4C3I G;  5C3W A;  1SNP A;  2KQ3 A;  1V1P A;  3A7A B;  1KDB A;  1JR0 D;  2X6G A;  2DIE A;  2MP1 A;  3D6C A;  3PIP 3;  4JBW A;  2RVL A;  3SK6 A;  3PUV A;  2ZXP A;  2EYF A;  4Q5V A;  4DU9 A;  1IHZ A;  3NE5 B;  1X3P A;  1BR9 A;  1TS4 A;  3K5O A;  1EWC A;  3NTK A;  5FKA C;  3FPU B;  4F7X A;  4DA2 A;  1I4H A;  4RKL A;  3I91 A;  1HTP A;  3OMG A;  1PZI D;  2YU9 B;  2M00 A;  1DON A;  1V43 A;  3S2H B;  5EKL A;  2N55 A;  1IW7 D;  1KTK A;  3P7J A;  1ESR A;  4G4K A;  2DY8 A;  1GJX A;  1TS2 A;  2BE5 D;  2PQE A;  3J81 E;  1SE2 A;  1GUN A;  1VMC A;  3GTG B;  2PYK A;  2LZJ A;  5KRU A;  2ZT9 C;  3MAQ A;  4XQF A;  2MPM A;  4MN3 A;  2F0L A;  4ID6 A;  5JVG 3;  2EYL A;  3M85 A;  4PMB A;  1LAB A;  3BCD A;  5I2X A;  4FF3 A;  3FPP A;  5C6A A;  1EQV A;  1S4Z A;  1HTL D;  3D4R A;  4XL9 A;  5C4Z A;  3T4A C;  1NRK A;  4OGQ C;  2FFK B;  5JAV A;  3SDZ A;  3H3V C;  3I70 A;  3VR4 A;  5DN6 A;  4DAV A;  1B2T A;  1FD7 D;  1V8Q A;  3TP8 A;  1JOK A;  4KHZ A;  4MIU A;  4RGT A;  3GVK A;  2ICI A;  2J7Z A;  5I6Y A;  4C3J B;  5IOC A;  1Q90 A;  1HVX A;  3PUY A;  2C9O A;  3VYR A;  5K36 H;  3OE7 A;  2F0K A;  4K5V A;  2AQ2 B;  4K14 A;  5ELD A;  1ILQ A;  1G6Z A;  2B2U C;  3VYS A;  3QWN A;  5E4W C;  4XLE A;  5JPN C;  1GUT A;  4IFD I;  3PIO 3;  1MD2 D;  2L11 A;  3DWA A;  1GUW A;  3K6O A;  4BWG B;  5BN4 A;  1BCP D;  4K5X A;  3Q23 A;  2XWJ B;  5FO9 B;  1B50 A;  1CK1 A;  2A69 D;  2HUG A;  2CW0 D;  1Y1V B;  4C1N I;  5IGC A;  3OWE B;  4NW2 A;  1Y8P B;  2FJ2 A;  5I6W A;  3FRP B;  1HUM A;  4PQX A;  1D2B A;  2GK6 A;  5CV9 A;  3C3L A;  2Q8I B;  1HUN A;  4Z1M A;  1F2Y A;  1H9J A;  4C1N K;  1U4P A;  2EYH A;  3G05 A;  2KEC A;  4K6D A;  4RCN A;  1YNN D;  1R9T B;  1Y8O B;  1VMP A;  4RGN A;  1II3 A;  1B53 A;  2A5H A;  5TSS A;  3NQI A;  5EBD A;  1I6V C;  1EIG A;  1U4R A;  3NWT A;  1F2M A;  1LT4 D;  4ZLT F;  4DAY A;  2B2T A;  1UD2 A;  3GVJ A;  3T16 A;  3ND9 A;  3QO2 A;  4BY7 B;  4KY7 A;  3OEH A;  4HAE A;  3CES A;  2NZ1 D;  4XR6 A;  2BA1 A;  5FO8 B;  2NVQ B;  3G6J B;  2C5C A;  1SNC A;  2EOT A;  1DM0 B;  3EQL C;  2ZTG A;  3S1Q B;  4A3E B;  1DJR D;  5EPL A;  1EY8 A;  1FNV A;  2WPD A;  4HCE A;  1SNQ A;  3VYU A;  3HP3 A;  2MJ8 A;  2FMC A;  2F0T A;  2WZP P;  5FO7 B;  3K59 A;  3DWQ A;  1RHP A;  4XT1 B;  2MUY A;  1IW7 C;  1CM9 A;  5FL7 A;  3V05 A;  1I4R A;  4G7W A;  3FKS A;  2BE5 C;  2D9U A;  1LAC A;  4QB4 A;  4WRD A;  1O7Z A;  3SR1 A;  1HRJ A;  1TT2 A;  1E1Q A;  5C5M A;  4DXF A;  4CGY B;  3BVG A;  4KTA A;  4Y7N B;  2NN6 I;  3A56 A;  3NPP A;  3IFD A;  5CYU A;  1E79 A;  1BO0 A;  1QB5 D;  3HOX B;  3BZD B;  4QCL A;  1EU4 A;  1D5X C;  2E2I B;  1EQT A;  1EY6 A;  3D6W A;  1K8M A;  1C4Q A;  3GQB A;  3RZD B;  4FXU A;  4U68 A;  1ML0 D;  2B2Y C;  4NP5 A;  4QMG A;  2LS0 1;  3MXU A;  3A7L A;  4XM3 A;  3HOW B;  3M4Y A;  4YIJ A;  1IKL A;  1SEB D;  3CHB D;  1OO9 B;  2F0P A;  1EYC A;  1E2Z A;  4RH6 A;  2AWN A;  4FYD A;  3H94 A;  3URY A;  1T5E A;  1PDQ A;  2B39 A;  3ND8 A;  1YNJ D;  1U4L A;  2XSC A;  4X3S A;  1VCI A;  2K5Q A;  4KN4 C;  3LX0 A;  5FK9 C;  2K28 A;  2BDN A;  2OT2 A;  2OEO A;  3JAM E;  1TY2 A;  5T1I A;  3L3O C;  2KVM A;  2HDL A;  1BBX C;  5DNF A;  2A69 C;  2G9H D;  2EE1 A;  4GQN A;  4A3I B;  3OSO A;  3EVQ A;  1UEA B;  4XLA A;  4K5W A;  3CRL C;  2EPB A;  3KLS A;  3R3O A;  4B3F X;  2F0S A;  2LKV A;  1FR3 A;  4QUF A;  3NHH A;  3S1M B;  2D3L A;  4U67 3;  4IZ8 A;  2F0V A;  3KUP A;  4EQP A;  1H8E A;  3OPO A;  3JU4 A;  3A3G A;  2M5S A;  3NP8 A;  2GJP A;  4RWS C;  1I50 B;  2PW7 A;  5D65 A;  1Q1B A;  1B1Z A;  4OIK A;  4DK0 A;  4KD4 A;  2F03 A;  1I4X A;  4ZYS A;  2F1M A;  2WSS A;  2WP8 J;  1RJT A;  4V0B A;  1EL0 A;  5CMD A;  4G57 A;  5C0X G;  4IN3 A;  1S5E D;  4FVM A;  3I4M B;  4J1M A;  1K28 D;  1LTI D;  1TKW B;  4P2C B;  3ZYY X;  2KOL A;  5KGU A;  1TVX A;  5CV8 A;  4XN0 A;  4AVZ A;  4HMJ A;  2JA7 B;  3C46 A;  4F87 A;  1Z47 A;  3DMU A;  1GUS A;  1EFR A;  1DZ1 A;  3J80 L;  1CA5 A;  4FXK C;  5JPM C;  3KEW A;  1A2U A;  2AQ1 B;  2RDF A;  2JE6 I;  5HGT A;  2WAC A;  5CGK A;  4XXE A;  2A6E C;  4PV1 C;  3PV0 A;  5IOD A;  1GOZ A;  4K8I A;  3I4N B;  5LL6 X;  4IAL A;  1OB0 A;  5KNB A;  2VNU D;  2F0U A;  3SVM A;  4FF4 A;  1QNK A;  3PUW A;  3ITP A;  4HSV A;  1I4Q A;  4RFB A;  2PNR C;  1RTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...