3OPOA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
296
structure length
296
Chain Sequence
b'QNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 34
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3opoA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3opoA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3opoA01
1Q12A 3AB9A 3LWUA 2L5TA 4XTCS 3SDZA 3VR3A 4G7OC 3PUZA 2JEAI 1H9RA 4OGQC 1EWHA 3A8KE 1OXXK 5C0XH 2O5IC 1Y8NB 2DNCA 4DNRB 2KCCA 4DNTB 1ZYRC 1DCZA 2CW0C 3FMCA 4KHZA 2A6HC 1CFMA 3ND8A 2PCFB 3P20A 3PV0A 1QJOA 1GUNA 1HPCA 3VR5A 1Q90A 2EJFC 3PUXA 4RCNA 1V8QA 1HQMC 4DK1A 2E74C 3H94A 3N6RA 4DK0A 3DXJC 3T56B 1ONLA 3KLRA 2D2CC 2JEBI 5KNBA 1VF5C 5KNDA 1GHJA 1LABA 4KKUA 3D31A 3QJYA 4KN7C 1ZKOA 1VCIA 2PNRC 1HCZA 1Y8PB 1GUTA 3NE5B 2V4DA 4KKTA 2A68C 2BE5C 1I6VC 1IYUA 5JEAG 3HGBA 2NN6G 3MFYA 3PUVA 2B8FA 1YNJC 1VDZA 2E75C 1TU2B 1G291 3TZUA 3D4RA 1HTPA 1E2ZA 3I4LA 3OOCA 1OXVA 2AUKA 1Y69U 1Z6HA 1E2WA 1E2VA 1A6XA 2AUJD 2IT1A 1T5EA 3M4YA 1FYCA 2LMCB 2EVBA 2PPBC 4GZYC 3W3AA 5BN5A 1H9JA 3IFTA 1GUOA 1Z7TA 2Q8IB 1K8MA 3RLFA 4PV1C 1SMYC 4H44C 1IYVA 1GJXA 3BDOA 4JBWA 1B9NA 2A6HD 1Q1EA 2EJGC 1IW7C 3I72A 2NN6H 5JEAH 2AWOA 4JK1C 2K33A 2DN8A 3I73A 5KNCA 1O78A 1Y8OB 3T51B 3VR6A 2A69C 3A8JE 5BN4A 2BA0A 1YNNC 3U9SA 1Q1BA 2D62A 1GUSA 1O7LA 1IW7D 4OO1G 1VF7A 3PUYA 3GQBA 1DD2A 2ZT9C 1TKWB 2BDOA 2DNEA 2E76C 4IQZA 2A68D 2BE5D 3OPOA 2F1MA 3LNNA 3OW7A 1H9SB 1CTMA 4LJZC 2KA7A 2A6EC 1FR3A 3WDNA 3A7LA 3CRKC 3A7AB 3EQLC 4I7ZC 3BG3A 1GHKA 2JXMB 2NN6I 2B8GA 1B9MA 4BA1I 4G7ZC 2JE6I 1CI3M 4OO1H 4L8JA 5A35A 5K36H 4TKOB 1OXUA 2A6ED 4H13C 3VR2A 3T53B 1OXTA 4KN4C 3M7NA 1PMRA 4TQUS 1H9SA 3L7ZC 1BDOA 4G7HC 2BA1A 2YYZA 4KKSA 3M85A 5K36G 4H0LC 2O5JC 1H9MA 3VA7A 1DXMA 1OXSC 5C0XG 3CRLC 3IKJA 2D5DA 2K7VA 4IFDH 2R6GA 3A8IE 2A69D 1H9KA 3QIAA 4LK1C 2K32A 3FPPA 2QF7A 4KMUC 4BA2I 4HR7B 4KI0A 3SE0A 5BN3A 4XIGS 3QG1A 3MXUA 2EDGA 2EJMA 3VR4A 3PUWA 1V43A 3GD7A 1GUGA 4IFDG 3ND9A 1LACA 1K8OA
chains in the Genus database with same CATH superfamily
3DUZA 5D3DA 3VR3A 2CBXA 2YWFA 1DOKA 2RA4A 2KUMA 2PI2E 2JEAI 1B2RA 2R7ZG 4K8IA 2B63H 1OTCA 4DF7A 2CW0C 1VQNB 2YV5A 2K14A 4PMBA 1KDAA 1F77A 3MCAA 4ZRZA 2KBNA 5LMUL 1QJOA 3J7A5 4OX9Q 4GKKL 3H3VI 2X6YA 4KY7A 4P6VF 3PO3B 1B4OA 1QH0A 2AWNA 4X64L 4DK0A 2UXDL 3KLWA 5CDFA 1DM0B 5IYBH 1HNXQ 1ZYRD 3CP0A 1FVIA 2ENBA 5JVH3 5DLQE 5GQOA 1LABA 1AEXA 4B9XA 1VQNA 5JAVA 3CCEA 1GUTA 3S1NH 2YU9H 1UWVA 2UXCL 4B3XA 1B44D 1RJTA 1AE3A 1DOLA 1TQOA 2NN6G 1TT2A 2K50A 1EUJA 4B3SL 4QQBX 3WXMA 2Z1CA 1FJGQ 1KTVA 3CCLB 1FNWA 2Q6OA 2IL8A 4CDDC 5KW9A 1N36Q 1Y69U 1EFID 2B63B 1Y0RA 2BPOA 1SKYB 1JB7A 4XYOA 1JWSD 1MBYA 1N34Q 4OPOA 2QDLA 5THXA 1KK1A 2I1LA 1YHBA 1LTLA 4TSFA 4AF6A 2K4KA 4FN5A 1GUOA 2K1BA 5I9PA 1BO0A 1RF2D 2A6HD 4PQXA 2GA4B 4NDXA 3NTHA 4ABNA 4X65Q 3CCLA 3ICEA 5IP9G 3WNCA 4II3A 4Z4ZA 1Y8OB 2XGJA 3ASRA 1BBUA 1F2ZA 4G6IA 4HE5A 3S1NB 2YU9B 4JYAQ 5I4DA 2EZVA 3R6KA 1SE8A 3A8IA 3QSYA 2R93G 3PUYA 4IPCA 2QCPX 4FXDA 3GTLH 2ZJQA 2DNEA 3UE1A 4DV7L 4X7EA 1EFWA 1I7PA 2K01A 3PUNA 1I4HA 4DR4L 5T1GA 1H9SB 4XNFA 2K5QA 2Q2HA 4LJZC 5IT9L 5H5JA 1KNAA 4WZLA 1QNKA 1G6ZA 4L6TB 1X6OA 3K6OA 5IIFA 3GVKA 3HFZB 1WVLA 4UP7A 1GR1A 4ZGQB 4HIMA 3S15H 4TKOB 3QFSA 2ZZEA 1F2LA 3MHBA 1VLYA 2VBTA 1EY7A 3A54A 1H42A 1H9SA 3PA2A 1BDOA 5AFWA 2ZXPA 1SNQA 4Z4TA 3OIQA 2KCNA 2L55A 1OXSC 3K80C 4JI2L 3BZKA 4OL7A 1I6HH 3GTLB 3J80E 4LFAL 1N33Q 4BA2I 4IZ8A 1HRJA 4IUQA 5IWAQ 4DUZQ 4GN5A 5HURA 3CW2A 1DGSA 3B82A 5EKIA 4B3RL 2G5DA 4Z4SA 1B3QA 1BCPF 1OXXK 2F0VA 2IHFA 2GPJA 4MTNA 3S15B 4RHRA 5C3XA 2DETA 4RD4A 3J81j 1KLUD 4B43A 2JA7H 4EGVA 5C3EG 2NZHA 2XRSD 2EYLA 2Y0SB 1PH5A 5CV5A 3CMMA 1HNZQ 3AFPA 2J4XA 1EQVA 2SNSA 5IGFA 1I6HB 4O0AA 4OWTB 4A3GG 3JAML 3B6YA 1AH9A 3R3OA 3GTOH 2VXWA 4ZV4A 4CKBA 3HRZC 1EY6A 1EEFD 4K0KL 2NVXH 2D0PA 2F0LA 4AYBG 4RA8A 1RQPA 2JIZA 4X62Q 5JEAG 1K8AC 5I2YA 4QL5A 3MFGA 4LNQA 2B8FA 2FMMA 2XTIA 5LL6S 2MUYA 2YTXA 4C1NK 5C4HA 1E64A 5FLXE 2FXQA 3ULPA 3CRZA 3G71A 3KLSA 1PH6A 2VBSA 2RHQB 1BR9A 2AQ2B 1MSGA 1VQOB 4Q0FA 4DV3Q 4RCZA 4HCSA 4XL9A 1FYCA 4DQLA 2JA7B 1G7SA 2ZXHA 4AIMA 1R5BA 1BQQT 1H9JA 5M3MG 3CCRB 1BBWA 1K8MA 2EYMA 2OWOA 4Y7CA 1JOQA 5C4XG 1WSRA 2AKWB 3S14H 2B2UC 2X3UA 1JB9A 1U4PA 1LTGD 1EQRA 1EYGA 3ZC3A 2E5LL 3MEHA 3GTOB 3T51B 2A69C 4FYDA 1H8HA 1GO2A 2PYKA 2NVXB 4HJ9A 1YNNC 2D0OA 4B3GA 2SEBD 4HMIA 1O7LA 1AZQA 1E22A 1OB0A 4B3TL 1KXLA 2ZT9C 5M3FH 4CQJA 1SNMA 1TS3A 4PZ7A 4A75A 1VQDA 5KEEA 3K57A 3OPOA 3M9BA 3LNNA 4K1XA 2DCUA 3OW7A 3KL9A 5E6TA 3CMAB 5KGUA 2PI2A 1SE3A 3AEVA 5TR9A 1AW7A 2DOGA 4IJHA 2PZUA 2N8NA 2HHHL 3S14B 2D3NA 1VQBA 5F4JA 3T53B 1TY2A 2F0PA 4TQUS 2Q6IA 2GJPA 2XWBB 3GVLA 2F0QA 1H85A 3HKZG 2YYZA 3CMAA 1FNDA 4YCVA 3TEHB 3UI2A 4FDBA 2C78A 5ISRA 1J6QA 4GKJL 3D6CA 3KYHC 5HGQA 2R3ZA 5M3FB 1Q8KA 3QIAA 1JNYA 4HIOA 1VQPB 2JN4A 4KI0A 3SE0A 4YIJA 2E1RA 3KDFB 1C8CA 3VR4A 2F03A 4RHSA 4B3FX 4YHHL 5DAUA 3TDQA 3GTJH 4PC1A 4POGA 4ZLTF 3VDYA 1LUZA 3J81i 1KD1C 1M1KC 4UZEA 4HAEA 3A8KE 3NTKA 4NPSA 1IBLQ 1QVGB 1J9OA 4AQYL 4TMZA 3BDCA 4POFA 1VQPA 2UU9L 4DAPA 4PG3A 4RDJA 1HUNA 1UE6A 4DV4Q 5KSWB 2FHTA 2AHOB 3HOYH 2JYOA 4IUVA 4LF6L 4G1VA 3W2EA 1RCVD 2G9HD 1QUQB 1WJJA 2Z4HA 1VCIA 1U9RA 2Q8RE 3OW2B 4DQKA 5JPMC 1S40A 3I4MG 1JT8A 2V4DA 3BS1A 2VZAA 1PYSB 2HDMA 4K6DA 1I4RA 4JI6L 4HJAA 4XXEA 2Z8LA 4ZUIA 5C44G 4NCNA 2R92H 1E43A 1QUQA 4YAOA 3T1HQ 4LF7L 5IYCG 2E1BA 3U4ZA 1SSOA 3OW2A 1S72B 1TTTA 2LMCB 4DN4M 3HOYB 1V5VA 2BN4A 3CCMB 2F4IA 1PTOH 3G4SB 2H5XA 3K7UC 4YXWA 4BY7G 1HFNA 5GAHC 1WORA 2GK7A 1JCKB 1EIGA 4JBWA 2Z4IA 4GLAC 2K5HA 3I73A 4FXGC 1W6KA 4Q5VA 5FJ8H 5A2QL 4HJ7A 1EL0A 1EFCA 4OWXB 4BBSH 5E4XA 1S72A 1WI5A 2ZTNA 1PFBA 3VYTA 3U9SA 1G91A 3MWYW 3FP9A 3ITPA 3CCMA 3G4SA 1IW7D 2GVAA 1GAWA 2P5ZX 4XT3B 1CZGA 4X3TA 4XT1B 2R92B 4A3FH 3OFNA 2MPMA 4P2CB 1R4PB 1I4QA 1EQQA 1TS2A 2OQ0A 3KBXA 4PNYA 2EXZA 4ZQ3A 3WDNA 3KEWA 1V1PA 2KCMA 4L5QA 1PTOB 1MSHA 3A5ZB 5TV2A 4RGMA 3UDXA 1D7QA 2QW7A 1SRUA 4QFMA 4NW2A 5CBEE 3CMEB 2NVQH 2EY6A 1NBWA 1OXUA 3VR2A 3GTKH 3H6MA 1HHVA 2IX3A 1SM4A 1YNXA 3VO2A 1B3AA 3W2HA 2FVGA 1E3XA 4BBSB 3A1PA 1EY8A 3A74A 1O80A 1IL2A 1PJ6A 3VA7A 1JJGA 4ULLA 3Q6RA 4YHBA 3KUPA 1XMQL 3TS0A 1E1QA 2I0QA 3VNVA 1PKVA 2F0MA 4A3FB 3CMEA 1N32Q 4DUYL 1SR3A 2F1LA 5G3LD 1YHQB 2EJMA 2F0EA 5EPLA 1KNEA 1Q82C 4L5SA 3HOZH 3DM3A 1EY0A 3TP8A 4DGZA 4APVA 4K5XA 4LF9L 4G5GA 3NENA 1TWCH 1STGA 1F2MA 4Z9CB 2B2WC 1H9RA 2F0NA 4JI0L 3ZJYC 3PENA 3AVXA 1Q7YD 2NVQB 3TREA 1VQ7B 2ZTEA 3OHXC 4H7BA 2N49A 3GTKB 2VNJA 4B9WA 1JJ2A 3LO8A 1SYDA 1YHQA 3K0YA 4XN0A 2MFIA 3CHBD 1QFZA 1SNPA 4NKLA 1G7RA 4G7WA 3I55B 2XWJB 1TWAH 1I4PA 3QFRA 1GVHA 1EY4A 2JEBI 1PLFA 4BS9A 5KNDA 1EOTA 1SROA 1LM0A 1HUMA 1SFOH 2F0UA 1VQ7A 1PRTD 2NWGA 4OX9L 3HOZB 2A68C 3DEPA 1IB0A 1IYUA 1CQFA 1RIPA 1TWCB 2LXKA 4DR3Q 1G291 3PSIA 3Q38A 3I55A 1HNXL 2L0CA 3F1ZA 2K52A 1I50H 3E0EA 1PH9A 4C1NI 4LUVA 4XQFA 1JR0D 4XLHA 2J7KA 2SDFA 4EQPA 5FO7B 1WTPA 2BV3A 1KJZA 1D1NA 2K5DA 5C6AA 1X3PA 5CV6A 4XQJA 1GJXA 1BVSA 3X3MA 1TWAB 4K2LA 2ZL7A 3WY9A 3ZPNA 2Q6KA 3P27A 1Q1EA 5HZBA 2EY5A 3BYTB 4C3HG 1IKMA 1PTOD 4N3GA 5DEHA 1N36L 1QGZA 4YAFA 3LX0A 2ZXOA 2MHVA 3DWAA 1N34L 1SFOB 1WTWA 3VR6A 4H02A 3NBHB 1C48A 1VLOA 2O2LD 3H3VC 3OZUA 2PO4A 4V0BA 5I6WA 1LT3D 4A3EG 4A3MG 1NSNS 2PE3A 3SK6A 4X65L 1Q46A 1JICA 2CWPA 1I50B 1JB3A 1A0IA 1G51A 3KBGA 4RMFA 2LS01 5LHY1 1VQKB 2M2LA 4ZYSA 4XM3A 2JN9A 2VJIA 4P3IA 3T4AC 3I91A 4X07A 4JYAL 1HA6A 3NBHA 1SEBD 3KFUA 4YAUA 2JDIA 3BG3A 4WZTA 3D6WA 2RQXA 3TZDA 3S9WA 4GS3A 3D4WA 3NXWA 3F2UA 4XKWA 2KVOA 4PC2A 4LUOA 3SK5A 3VO1A 1E3ZA 1LTAD 1VQKA 1SMYD 1D2EA 1WOSA 3HOVG 1A2TA 1NE3A 1Y14B 3OTOQ 1P8LA 5JJZA 4JG2A 2Z6KC 4JOIA 3CCJB 1PYWD 5IODA 2ZXRA 1H9KA 1PJ7A 2QF7A 3EJIA 4KTAA 4A3LG 1AIPA 2WZPP 2ZZQA 1JWUD 1Q8IA 2WAQG 5HGTA 3NWTA 1LACA 3JAMi 1V9PA 3MEFA 2PMDA 3OZWA 1JA0A 3CCJA 1N33L 2DNCA 1PV4A 1EZ6A 1N05A 2M00A 4HSVA 2UUCQ 5JBQA 2A6HC 3P20A 1BQEA 1R5OA 1Y0YA 5IWAL 4DUZL 1JE4A 4PAAA 4IOAA 4FP5D 2JA5G 1TS5A 1X65A 2VBUA 4JVZA 2CFMA 4ALPA 1X3FA 4O2DA 4DV1Q 3Q39A 4J8QA 3CPWB 1VQGA 4J0QA 1WOCA 3NQTA 4ME5A 4XOPA 1T5XD 1LTTD 5D3IB 4K6LA 3J80c 3ZZ0A 1PFMA 3A56A 3IAYA 2BM0A 5FK9C 1L1OA 3KLSX 4IUPA 3WBKA 4K8JA 2QDBA 4ME3A 1SDFA 4A93G 1B7YB 4Y9UA 3OE7A 2E2JH 4OIJA 2HCIA 1HNZL 3ASQA 3CPWA 5I9OA 2H4OA 4NXMQ 3U2QA 3L2PA 2HMAA 1F9QA 2HDNB 1XTCD 1N0UA 3JQRA 3M4YA 4J15A 5HZAA 3BVGA 1NR4A 3D0FA 4X62L 2OBTA 5IGBA 1CUKA 5M5WH 2E2HH 3CCQB 5IP9H 2VQEQ 1IYVA 2NUCA 2WZNA 5E1FA 3CD6B 2C9OA 2NYZD 3HAGA 2VY3A 2DGYA 1WFQA 2RC5A 4NXNQ 2DN8A 4YCWA 4DV3L 4A3IG 3HKZE 3EROA 1K8GA 4HE6A 2WB1G 4DR7Q 5DM73 5JOBA 2MJ8A 1VQ4B 3CCQA 1XWEA 1MJEA 4DPGA 1BBXC 1EU3A 1Q9SA 3P75A 3TN2A 2E2JB 1SAPA 1YLOA 3HOWH 1DD2A 2L12A 3CD6A 2EYJA 5LMNW 1FNVA 3NUCA 4KK7A 3PF4A 1P16A 1KK0A 3V05A 2HQLA 2JK8A 4ZCIA 3QFTA 1GO3E 3GTQH 4Z4WA 2E2HB 5M5WB 3EQLC 1VQ4A 5IP7G 1SYGA 3GDEA 4P71A 2B2TC 3PO2G 5A35A 1U2RA 4JBJA 2XZPA 3E9HA 3RD4A 2EYHA 1OO9B 1KDCA 4NB3A 5C5MA 3BCDA 1D5ZC 4KKSA 4QB4A 4P6YA 4IO9A 2RSNA 1H9MA 2AQ1B 3T13A 3HOWB 5EPKA 1PH4A 1T6YA 2K05A 1HH2P 3CCSB 3MXUA 4DR5Q 3GTQB 2D9UA 3CAMA 4LW1A 5F4OA 1LTID 5KYIA 2NZOA 3GTPH 4GOPB 4MHEA 5FOBB 5C0XI 3PUMA 2O5IC 3ASTA 1K28D 1I8DA 3STBD 4KHZA 1NNXA 4CKEA 1CFMA 4DU9A 1S5ED 1GKHA 1QE6A 1T6XA 3ND8A 1STBA 3CCSA 4RDKA 1XB2A 2F4VQ 2IY5B 1CSQA 4B44A 3K5OA 4KD3A 1G2TA 3JC66 4RCNA 2L15A 1U5KA 3TP6A 4A3GH 4X05A 2MP1A 4IUNA 4G4KA 4DR1Q 4GOPA 1ZM4A 2BH2A 3OP1A 2D2CC 2LKVA 1IBLL 1BLIA 2YWEA 1OGJA 1LLRD 1X55A 2B7BA 2DUDA 1JWMD 2ASBA 1WD0A 4DV4L 1UE5A 4C43A 1UD8A 4C3IG 3H91A 3GIRA 3BY1A 1SYFA 3G05A 4LAAA 4DK6C 1VQEA 2EYFA 3GTPB 1JE5A 1SMXA 3PCOB 2E2IH 1MKHA 3FKIG 1WYDA 4B3MQ 4OPSA 3CCEB 1J8IA 5M3MH 1KABA 2HD3A 4WJ4A 3OEHA 1ENAA 4A3CH 3W2IA 3ULJA 5C4XH 1EYAA 4A3GB 2BDNA 3K5MA 5C4ZA 4HMJA 4UZFA 3S1QH 1UEAB 1IYJB 2E8GA 4AYBB 3T1HL 1ILPA 2GREA 3I2ZA 2CQOA 1BF4A 1TWHH 3ERSX 1CKNA 1HA3A 2EOTA 2PNHA 2E2IB 3WBJA 3H0GG 5ELDA 3E0JA 5M3MB 1BCPD 2C2WA 5A88A 2F1MA 2AMCB 2N88A 5EPJA 2D74A 2NV4A 5C4XB 2W6JA 4Y52H 4RKLA 5TSSA 1GM5A 5AN9A 1HR0W 3OSOA 1ICWA 4TMVA 1NR2A 2JXMB 5M5XH 1TVXA 4BA1I 3S1QB 3HOXG 2V7UA 5DNFA 2PQAB 1Y1WG 4E6IA 3F2CA 2B2TA 1STEA 4H13C 2RCNA 5ELNA 4WJWA 4RKBA 2QKIC 1YIJB 4X0CA 3ZBTA 1PDQA 1Q81D 1PZJD 4LBYA 4QMGA 1TWHB 3SXHA 4V190 2IX0A 1F9SA 2D9RA 2R6GA 4R4TA 4CJ1B 2PQAA 1A63A 2EQSA 4XR6A 4BBRG 4XD7A 3LQ6A 5HY6A 3P26A 3AQQA 4ZCKA 4IFDG 2QTLA 2ZTGA 1K8OA 2ZZGA 1YIJA 3RZOH 3QOLA 2YWGA 5M5XB 3CCUB 3HKZB 3R2IA 1A8PA 1IXRA 1W2BA 3FMCA 3U58A 4OONA 2NTTA 1WD1A 5DS0A 1N32L 2QA4B 1XNQQ 1EQTA 1QG0A 4F7DA 3U6KA 4OWWB 1Q90A 2XNCA 1ZEQX 4BXXG 2K75A 1SN8A 3G7LA 5JPNC 3K58A 2UXBQ 5D14A 3ZBUA 4XLEA 4LFBQ 3I4MH 4JI5Q 2BGJA 3B8HA 3CCUA 4N8X1 4XQNA 5JJLA 4UHVA 4U9UA 2B29A 3QJYA 3AU7A 4TVAB 4RLZA 1KK3A 4JBMA 5C44H 2QA4A 1W6JA 1EZ8A 1SKQA 1S3OA 3P1HA 4JI3Q 1ZM9A 1G7CA 2ZM6Q 1UUPA 2VL6A 4PZ6A 4QJFA 3RZOB 1H95A 1XPUA 4L5RC 4BY7H 2XSCA 2KHJA 2IT1A 2C77A 3FJOA 1QFJA 4RD6A 1KC8D 3QO2A 5KIXA 2PPBC 2BM1A 2LZJA 4ZGNB 1ET6A 2N55A 2KCTA 4DR3L 3G71B 1WTOA 1D5XC 5CV4A 3I4MB 5K5PA 2EJGC 4OOVA 1E62A 1OHHA 4C56C 4DXFA 3TQYA 3FKSA 4XN3A 1KLGD 1O78A 5C44B 3S1RH 1IBMQ 1JORA 3DM1A 3DWQA 5J3OA 3AGPA 5EAYA 3NK9A 3GQBA 4UP9A 4JI8Q 2BDOA 2DJFC 2ZL5A 5GADC 2R6HA 2F0OA 1YHAA 3D26A 1FRQA 4I65A 4BY7B 2F4NA 3QOJA 1YNJD 4Z4YA 1A3VA 3M3YH 1Q7YC 3R2TA 2ZJRA 2OYNA 2A74C 2EYPA 2XNJA 1AE2A 4A3KG 5ELEA 2ICIA 4X3UA 4A3JG 2F0SA 5FKAC 4OO1H 4M8AA 2SNMA 3K5LA 1PH3A 2VNKA 2K28A 1K73D 5J35A 1NRKA 3S1RB 2HLDA 4TRDA 1L0WA 1FNUA 2MQHA 3GP7A 4XOTA 4IPGA 5CORA 5DSZA 1WTHD 3V96A 4LF5Q 2XOKA 3A8JA 1TR5A 2FINB 2WKDA 4IOCA 4GNXB 4DR6Q 1OGIA 1V43A 3M4QA 1GUGA 4CDEC 3ND9A 3M3YB 2WYRA 2IX1A 3OTOL 1A8VA 1VQMA 2ZL6A 3J7ZC 4XMYA 4XQQA 5H1SE 4RM0A 1B1ZA 2GJRA 3J81k 1PTOC 2EJFC 3Q3AA 2FJ2A 2HCCA 5ELOA 2EPBA 4UAIA 4J6HA 3K8AA 4GNXA 1HZBA 1TVCA 1D8LA 2E74C 2GN5A 4CBVA 3N6RA 3DXJC 1Q3LA 2CW0D 2RSOA 3CQZH 3NQIA 4RGOS 1E1OA 3L3OC 2FFKB 2UUCL 1EU4A 2OQKA 1I94Q 2PMZE 3J81c 1HCZA 1Y8PB 4HN7A 1ZUNB 4P3YA 1EWYA 1L0XB 2WB1E 2WFWA 1EIYB 2RHSB 2F0FA 3U6BA 3A55A 4WORA 2GK6A 4DV1L 4DA2A 4WRDA 4R8IA 4DV0Q 2CCZA 3M4OH 2F0GA 3I4LA 1OXVA 1WSVA 1D8TA 4PABA 1WCMG 5FLXL 2NVTH 3VYUA 4F87A 4UAJA 3I4NG 4DNIA 1EP3B 4PC7A 2CC2A 1IJEA 3M4PA 1SMYC 1C7YA 1RQRA 3I7FA 1N8RC 4JV5Q 5EJWA 2RDGA 4NXML 3CQZB 2AWOA 3SLDA 1YJWB 3RLNA 4A3EH 2F52A 4A3MH 3R6JA 3JU4A 1UE7A 5BN4A 3GTJB 2OK7A 1QCBD 2BA0A 2VQEL 1FD7D 2D62A 1I3QH 3TS2A 1W0KA 2W6IA 4MNOA 2C4TA 4P74A 1VQJA 4NXNL 3UDFA 1VMCA 5IYQA 3LQEA 3M4OB 1XQBA 1ASZA 4R4IA 4LF8Q 1BX1A 1YJWA 4YEJA 1A3UA 3SK4A 5C4JH 3FDTA 2A6EC 4JI4Q 1X3GA 2C4UA 1VQ5B 3TBIB 4DR7L 1MJCA 1NJID 2NVTB 1ESRA 2R9VA 1GVPA 4LF4Q 1PRTB 1C4QA 3SR1A 2JSOA 1MI2A 3HOVH 4WWVA 1OB2A 4RCOA 4II2A 5H59A 3T16A 1N0VC 2WJYA 4A3EB 4A3MB 1V1PB 2QN6A 2I5LX 3L7ZC 4G7HC 1VQ5A 1V0FA 3MZ5A 3SK8A 5K36G 1O7IA 3CU7A 3OYYA 3RN5A 1I3QB 4A3LH 4TN1A 1STNA 1HVXA 4R4OA 2CH4W 3NWSA 1V1OA 4PC6A 5IGEA 5C4JB 4XORA 4YWMA 4RWSC 5ELBA 1B70B 4KV6A 3ASSA 1LTBD 1QVCA 2RDHA 3LVBA 2EIXA 1B50A 1B23P 4OO1I 1UD3A 2JA5H 3HOVB 3BH4A 4XKVA 4XONA 4UP8A 1ZM3A 4Z1MA 2PCFB 1HPCA 3VR5A 1LTRD 4DR5L 4RAUC 1RTOA 1F60A 5FNZA 4JOIC 5KNLA 1QWYA 2F0TA 4JI7Q 1TIID 3H94A 1KRHA 2PQEA 5FA6A 2HT1A 3AVVA 4GN3B 2WAQB 4A3DH 2RDFA 3OEEA 4A93H 4DV2Q 1JJ2B 2QEXB 3K5NA 2F4VL 2J7ZA 3CC4A 3UDIA 3BQJA 4FXUA 3U50C 1X32A 1FNBA 4I7AA 1EFTA 5C0XJ 2WKCA 3PF5A 4DR1L 1BX0A 3L9AX 3TSSA 4NP5A 5GV7A 2DERA 1BOSA 2JA5B 1GUWA 3WQZA 3U9OA 2QEXA 4LFCQ 1K8AD 3UDGA 4HIZA 4P2NA 1LO5D 4Z4VA 2ES2A 2I5HA 1M8AA 2V7QA 5M3FG 4A3IH 4H44C 2VBVA 1B9NA 4B3ML 3E20A 1Y1VH 4A3DB 1L1OC 4A93B 1XTDA 4MN3A 1K9MC 2X8KA 4JMQA 5E7NA 1HZAA 2WPDA 4QVAA 1XPRA 1WTXA 3ER0A 3O13A 5FLMG 1GUSA 3NSWA 1VF7A 1HQRD 4X06A 1JOOA 3ES9A 5D65A 4X6AH 1QUEA 2XIWA 3FPUB 1O7ZA 2ZBVA 5COYA 3E3XA 4ROXA 2LSSA 1VQ6B 1PXUA 4KLKA 1XE1A 5IGDA 5IP7H 3WYAA 3KF6B 3OAAA 3I90A 4MIUA 3STBC 5HKKA 3RR5A 4A3IB 3VMFA 1WP6A 2PMZB 1SYCA 2TMPA 3BZDB 2WB1B 4BY1H 1CI3M 1Y1VB 4L8JA 1NB9A 1CHPD 3S24A 1VQ6A 1PMRA 2NTSA 3VNUA 3KF6A 3UE0A 2YWHA 2BA1A 2V7VA 3CESA 4S3SA 5GV8A 4RGTA 1E1RA 4ZK9B 3W2GA 2F43A 1SLJA 1VJSA 1ICFB 1KAWA 2HCJB 1TWFH 4TSSA 1HXYD 4KMUC 3CKIB 3RLOA 1W35A 5IY0A 2ZZFA 4P25A 3IRBA 2ZTDA 3E9IA 1ILQA 4UZUA 1DG1G 2XEXA 1NUCA 3I56A 3OWEB 2KECA 2JJ2A 4KHPQ 4DV6Q 4OGQC 1CKMA 2JJ1A 4X66Q 5C0XH 4BY1B 1QUFA 1ZYRC 3FVQA 1FDRA 4YCUA 1HJPA 4KD4A 5G3LF 1CNFA 1CSPA 3Q6QA 2DJGC 5GAEC 2B5OA 3BYYB 2C5BA 5F4MA 1M1KD 3D3RA 1LT5D 4A3BG 1S5CD 5E3FA 1TWFB 3J81E 2UUAQ 5KNBA 3JAMc 2SOBA 4ACBA 3I70A 3FPKA 4ILWA 1XNQL 2R7ZH 3W5UA 4AYBE 2KEEA 2VW9A 3A35A 4QGUA 4HJ5A 1W87A 2XZOA 3MA2B 1QFYA 2CHBD 2UXBL 3W1BA 2JA9A 2E75C 4LFBL 3Q22A 1DARA 4IN3A 2VJJA 4JI5L 4DXGA 1UEBA 3N52A 4P9SA 2AUKA 3SGIA 4EVOA 1L1OB 1IKLA 1E2VA 1AN8A 1RHPA 1IHZA 2OTJA 1QZHA 4JI3L 3B78A 4GOPC 3DEOA 1YJNB 2ZM6L 1KTKA 1AP0A 1LT6D 3A5UA 1S4MA 5CV7A 1PFNA 2IHEA 2NN6H 5DN6A 4LWCA 4J1MA 1N07A 2OBRA 4CDCC 5TRDA 2DY7A 2PZTA 2R7ZB 1S5FD 4FF4A 2OTLB 2X0KA 1A15A 3H0GH 4B48A 2QDXA 1YJNA 3WNDA 4F7XA 1KRSA 2VNHA 1N08A 4IJLA 4X7FA 1PTOF 3GO5A 5NUCA 1NDHA 2VNUD 2BH8A 5LMZA 1QB5D 5E4WC 1YITB 1E0BA 2XNAC 1IBML 1DDIA 3AFQA 1PH7A 2CQAA 2NBFA 4MTKA 2OTLA 2I07B 1QOHA 1Y1WH 1CNEA 5JEAJ 1K28A 2K5NA 1AZPA 1K3RA 4JBKA 1I4GA 2KEDA 3MC0B 4JI8L 4U68A 3J80i 3A3GA 5I2XA 2R93H 4FO2A 5T1IA 2Z6BD 1OXTA 4Z4UA 1NCVA 1YITA 3MXNB 1F9PA 3H0GB 2BOSA 3C2QA 1RDPD 2X6XA 4QUFA 4FK8A 4BBRH 4IFDH 4PC3A 4MYTA 1D1IA 4LK1C 2C5HA 2OCEA 1UD5A 4LBWA 5BR8Q 2F3IA 4IW3B 4ID6A 5EMNA 2ZITA 1EWCA 2DY1A 1Y1WB 3MXNA 1Q12A 2F0DA 1JOKA 3T1YQ 3QR8A 4RPDA 1EY9A 4QUZA 4BXXH 5F2DA 2R93B 1CT1D 4DNTB 4IURA 1Q82D 1DCZA 4LF5L 1VQ9B 3DLLA 3EFXD 1KQSB 5BSYA 1PJ5A 4DR6L 1X3EA 3OKXA 4ZKCB 4PGOA 4EH1A 1V8QA 1H8EA 1BCPB 5ELFA 2XGTA 2YTYA 4BBRB 2ZBUA 3S2HH 4QV2A 3OJXA 3T56B 1SBBB 3ASPA 1VQLA 2V7TA 1HFGA 1TWGH 4EQOA 1VF5C 2IJ0A 1I4XA 1S5BD 3URYA 1ELOA 1DONA 1G2SA 1K0RA 2R61A 3G6EB 5CYUA 1VQ9A 3BCFA 1KQSA 4LUZA 2F3WA 5I6YA 4OIKA 2CRVA 3AVWA 1YNJC 3EA6A 5C3EH 2F0JA 1PYBA 2XZLA 1I5FA 5CGKA 1HTPA 1E2ZA 2X6GA 3DDYA 4CDFC 1I94L 3WOEA 1R4QB 4R9WA 1SJED 3G6EA 2PW5A 4QIWE 2WR8A 3LWEA 4DV5Q 1HTLD 1KIXA 3RLFA 1Z7TA 2LY7A 2Q8IB 1K73C 2FX3A 3RUZA 4OXPA 4ZUJA 5IE8A 3S2HB 4UDUC 4DV0L 5JEAH 1TWGB 3ERQA 4RJLA 2QGQA 1W3SA 1XYIA 4LBVA 2A5HA 4C3JG 3A8JE 5IOCA 4DKAC 1KAAA 4AF7A 1VQIA 5C3EB 3KJPA 1WU8A 3CB4A 2Z9HA 5JVG3 5IT9E 4JV5L 4QVJA 1N9WA 2EFGA 1YI2B 1EWIA 2Q2UA 1M90D 2BE5D 2HUGA 4R1JA 1JMCA 4YELA 2RVLA 4QY7A 4A3KH 2KHIA 4ZCLA 4A3JH 3H15A 4RPBA 1CKNB 2L4NA 5LMNQ 1STAA 2NN6I 5IYWA 4IPDA 1IJFA 4TMTA 3FRPB 2Q2IA 4FVMA 4LF8L 1YI2A 4ZCMA 4KN4C 1BPLA 1IBKQ 3AMUA 3QFCA 4JI4L 3CPXA 4JCVE 1J9ZA 3LGJA 1U0LA 3F8TA 1X54A 4B08A 4LF4L 1CQVA 1LT4D 2RC6A 5AJ3Q 5IK2A 4YY3Q 2OT2A 3U4VA 1VQHA 4X3KA 1W34A 2VQFQ 2B7CA 2MGSA 2A73B 3I3CA 2F0KA 4RCYA 5FO8B 5C5LA 4A3KB 1BXTA 4A3JB 3S16H 1T6ZA 4WZKA 4IUUA 4OEMB 1O7YA 1V1QA 1EWHA 1TUIA 1Q86D 1RODA 2HIXA 2KOLA 2G9DA 4RG1A 2OXPA 4O42A 4RD2A 1VMPA 4NBSA 3JAME 2JA6G 1U4MA 1JJCB 4IFDI 2V7WA 1W2BB 4IPHA 4XLAA 3FHWA 4XYQA 1GHJA 3D8GA 4Y7NH 1ESFA 2PNRC 4JI1Q 1HNWQ 1WOPA 3S16B 1P4MA 5TY0A 1I6VC 2B2VA 2CVRA 1EOVA 2Z0SA 4JI7L 1NTGA 1G6PA 1WCMH 1NJIC 4KJNA 1ENFA 2TSSA 4ACAA 1QG7A 3I4NH 3NBIA 4DV2L 1KHIA 4GNXC 1KMHA 1Z6HA 1E2WA 1QNUA 1NMGA 3W2FA 4A4IA 4PZ8A 5LL6X 2B2YA 5BN5A 1PH2A 3HOWG 1DOMA 3IFTA 2J0TD 1J5EQ 2F3VA 3NELA 4X8IA 3QE2A 1NB0A 2GJKA 3ZIAA 1AMOA 2C5CA 1IW7C 4RFBA 3HOUG 1VQFA 5KNCA 4Y7NB 4DAYB 4X3SA 4LFCL 4DR2Q 4Y9RA 3V76A 1YZ6A 2JA8G 3A3BA 4XLFA 3ZUGA 1EYDA 1SE2A 3HS0C 2GVBA 5IYCH 1WTHA 2WSSA 1U4RA 3X3NA 2DYIA 1WCMB 4O1NA 1WTQA 3CC2B 1TKWB 1VS0A 2EE1A 3I4NB 1A62A 3RZDH 1XNRQ 2CF4A 4TT3A 4DAYA 1EIHA 4BWGB 1PA6A 5FIUA 4E0FA 1FR3A 3CRKC 1YX2A 4I7ZC 1GAQA 3V7AA 2V7XA 2VUMG 2JE6I 1ASYA 2FMCA 5CBAE 1VQ8B 3CC2A 4Q7JB 1X9NA 5K36H 1ZM2A 3BDLA 2DEUA 1COWA 1HR0Q 2UUBQ 4G7XA 3M7NA 2EY2A 2CWAA 1UD6A 2BF4A 2CKZB 4HJ8A 3L0OA 1K0SA 4N8FA 4UY8C 3M85A 4H0LC 2O5JC 2N78A 2JQOA 4RD1A 3IKJA 4A76A 2D5DA 4WZEA 1NY4A 2OK8A 5CV8A 4GN4B 2OF1A 4OP7A 4QIWB 3RZDB 1VQ8A 2PIAA 3PO3G 2WAQE 2VYQA 4UPAA 3QG1A 2X85A 4XIGS 1STYA 3MMPA 2PW7A 4YWLA 4TMWA 5IYDG 5EQ0A 3SDZA 4U673 1KRTA 1UD4A 1KZLA 2QEJC 4JW0A 4P75A 3PGZA 1DZ1A 3G6JB 2BMWA 3SHLA 1FX0A 4PMCA 3KK7A 1GUNA 3QB3A 3AYHB 1G8ZD 2B39A 1VQMB 3BC9A 3C46A 1PRTC 2QTZA 2B63G 1HQMC 3BJUA 4OHJA 4P73A 3HEJA 1SXTA 2H1EA 4KHPL 1N06A 3E5SA 4YWKA 1DDGA 4DV6L 4B4DA 4A3CG 4X66L 1NBMA 3CCVB 1BKBA 2L11A 4P72A 4FXKC 3S2DH 5FL7A 3W5VA 3TP5A 3HP3A 1UE1A 3NP8A 5IYBG 3J80L 3K59A 1SNDA 1VQOA 5FO0A 3HG9A 3PUVA 1ZXTA 5HXBA 3OIPA 1TU2B 1X56A 1R9TH 4HCEA 3CCRA 2UUAL 1S4ZA 4RGNA 3SEJA 3R93A 2WJVA 3CCVA 3NHHA 1CHQD 5CC4A 1FL0A 2VS1A 1WDTA 4X7DA 4RDLA 2AUJD 1T5EA 1FJGL 4M2LA 2EVBA 1K3BC 2WIIB 4EX5A 4F8MA 3ZZTA 5A2QE 3BDOA 1FGBD 1IL8A 1EIFA 3GTMH 3I72A 1BMFA 1SJHD 2F0IA 1RKNA 5FLMH 3E1YE 4YALA 1JQYD 1PFSA 5CR3A 3S2DB 5BSXA 4QUCA 1XJVA 3K81C 2P3MA 1AFPA 1C0AA 4M1KA 2DY8A 1Q1BA 3K7AH 2CW5A 1EXMA 1R9TB 4K2KA 2ALYB 1NMFA 1GXDC 1UMKA 2ICEC 3ULLA 4HEDA 4QF4A 4NNJA 4C3HH 3KJOA 4K14A 2PZWA 5EGTA 1W9XA 1ML0D 3W2DA 1UD2A 4RH6A 2CH4A 2ZXIA 4K5WA 3P7JA 4JPBW 3WNBA 3GTMB 1RD9D 3DMUA 3EVQA 4RD0A 3BZCA 1CA5A 4GQNA 2CNDA 1MRZA 1QGYA 4C2MH 3ONYA 3KDFA 1YVCA 3TMEA 4AVZA 1M4VA 1T9HA 2RBMA 1DXMA 3EN2A 1E3PA 3K7AB 3CF5A 4MZ9A 1EFRA 1FRNA 2K32A 3FPPA 5L37A 2Y0SG 1GD7A 4C3HB 5GROA 5LMUQ 1MIUA 1QVGA 3AVUA 4H9GA 3IFDA 2QMUA 3GD7A 3WWVA 4GKKQ 4R4CA 3AB9A 2AHOA 2OEOA 4XTCS 5KYLA 4G7OC 2M9VA 3VA5A 4X64Q 3PUZA 2UXDQ 2VZLA 2EIFA 3Q6SA 2A1AA 4LC0A 2WACA 4DAMA 1EP1B 1EFUA 3S1MH 3RMHA 4A3BH 5BR8L 2VNIA 4GLVB 5ELCA 1A3TA 4NMZA 3PUXA 4K5VA 4C2MB 2UXCQ 3VYSA 1S5DD 2C35B 2NB0A 1WTRA 3T1YL 1ONLA 4B3SQ 2JA7G 3KLRA 2RCFA 3EIVA 4CJ0B 1D5MC 4KN7C 1ZKOA 2B2UA 3MVVA 3H9NA 3QWNA 4KKTA 4R71A 3AVTA 3SLNA 3HGBA 3MFYA 4B47A 2BGIA 1V0EA 3CC7B 1XMOL 3PIOA 2QE7A 3R8BA 4EQNA 4IALA 1HA5A 3CC4B 3C1FA 3S1MB 1E24A 4A3BB 2R7FA 2L9HA 2NZ1D 2KJXA 4ASUA 4CGYB 4HSPA 3IL8A 4YAWA 1LTSD 5FO1A 4PV1C 1LYLA 3MAQA 3CC7A 3GVJA 2X53S 2A19A 3OMCA 4DV7Q 3Q0AA 2K03A 1U4LA 4DR4Q 2VB3X 5JJKA 1KK2A 2X6LA 4DV5L 2BSAA 3J7AF 4OO1G 4LMQD 2EY1A 4LBZA 2A8VA 4XLCA 4N3NA 4N9PA 3MHPA 1KL9A 5J3BA 4DK3C 1VQCA 3OZVA 1DYQA 2JP1A 2IWHA 1PHJA 1CTMA 2KA7A 3SJZA 2IW3A 1MD2D 2HDLA 2XRQD 4C0SA 3VYRA 1ENCA 1I18A 3G48A 1GHKA 2NVYH 2B8GA 1B9MA 4JI2Q 3KOJA 3BVMA 3I1FA 4LFAQ 1SNOA 3HKSA 2GQFA 1XFOA 2XNDA 3OMGA 4L63B 4ZAIA 1HZEA 4CKCA 5LMNL 4TMXA 3M7GA 3CRLC 3EBEA 4L5TA 5IGGA 4WFN3 3MTSA 4B3RQ 3W5HA 2VB2X 2A69D 1E1TA 5IT9c 1KDBA 5IYRA 1OB5A 1Z47A 5M9OA 2K5WA 1CA6A 5BN3A 1IBKL 1YNND 3BY2A 3PO2H 4CHTB 3RNUA 3JQPA 5IYNA 2E2DC 4QCLA 2PLFA 3LWUA 2L5TA 5AJ3L 4YY3L 2NVYB 3PIO3 4RD3A 1B2TA 2VQFL 2V31A 1CZWA 3ONUA 1MABA 4OOXA 1Y8NB 3DHQA 3I8ZA 4FF1A 4FNFA 3PV0A 2I46A 2RKSA 3AGQA 1D2BA 3HZXA 4K0KQ 3I56B 4DK1A 2MO1A 3BNWA 3KF8B 5GAGC 2JJQA 3C3LA 4P1VA 1PZKD 3A0JA 3HOYG 3GTGH 1FGUA 2CK3A 1YEZA 3F2DA 3F2BA 3S17H 3TP7A 3PO2B 3D4DA 3CTAA 4Z4RA 3ZYYX 2BE5C 1M90C 4GLXA 3Q24A 4OELB 4KJOA 4FWTA 3TZUA 2L1BA 3KF8A 3FEWX 3C2PA 5L46A 1NAPA 2RF4A 3D4RA 3BU2A 2K5VA 2BCOA 1F9RA 2Q6LA 1HZCA 4JI1L 5J22A 5J39A 5DM63 1PH1A 1HNWL 2E5LQ 1A6XA 1QGAA 4P12A 1GOZA 1S0UA 3E6ZX 1PVOA 4IFDJ 2R92G 1KD1D 3J7AV 2K04A 3NPPA 3J7YW 2Z6BA 4C3IH 3ZZUA 3A8KA 5EKKA 4FF2A 3C1EA 1EEID 4C3JH 4B3TQ 3ISXA 3GTGB 2OTJB 2HIVA 2K33A 3CPFA 3RY8A 1E63A 3K0XA 3FKIH 2MNAA 3PMFA 1SYBA 1WPCA 1BCPC 3S17B 2QILA 1N8RD 2ZTCA 5CMDA 1J5EL 2ATWA 5FJ8G 5IYPA 4BBSG 1QILA 5EBCA 2HHHQ 3CP2A 1R5NA 1UAPA 2LFNA 4IQZA 1PRTF 1F20A 1E7ZA 4F88A 1L0YB 4DR2L 4G1BA 2D3LA 2OBSA 1WTVA 2WV6D 2AQ3B 3GV3A 1VQAA 3A7LA 4A3FG 1Q86C 1ET9A 4BPRA 1MHWC 2F0WA 2KENA 1E79A 3Q23A 4EQ5A 4C3IB 4GKJQ 1STHA 4M4SA 3H09A 4C3JB 1Q81C 1BUVT 4JC0A 1D6EC 1XNRL 1XPOA 2A6ED 2B2WA 3FKIB 5A8AA 2KQ3A 5FO9B 5M5YH 3AVYA 4YHHQ 1TY0A 1IHMA 3H3VH 1EY5A 3SJPA 4OPVA 3CXCB 3A8IE 1SE4A 3NEMA 3PIPA 1WOOA 2KHSA 1HR0L 1QVFB 5CV9A 4HR7B 5J1ZA 2UUBL 4AQYQ 2UU9Q 3HOXH 5KRUA 2EDGA 3PUWA 5IGCA 2X6WA 3OJWA 2B3GA 3SKBA 1FNCA 2K6AA 4M53A 4MYUA 5C3WA 4A3DG 3CP8A 2O4XA 3PQIA 4LF6Q 1YJ9B 3HOZG 1G7TA 3CXCA 4M1UB 4M0LA 4DNRB 2KCCA 1D1KA 1YBYA 2WINB 2JA6H 5JJIA 1JC7A 4QHYA 1QVFA 4HIKA 2EYOA 4AC9A 2ZJPA 3DWPA 1L2FA 5M5YB 2NPFA 2N3SA 4JI6Q 2KVMA 1BNZA 4R8NA 4DAVA 3OWFA 3I4OA 1YJ9A 3JQQA 4KKUA 3D31A 3HOXB 4LF7Q 2XVSA 3NE5B 4HIDA 4KY5A 3J81L 3BVZA 1KC8C 1Y1VG 1VQLB 2QGGA 1VDZA 1QZGA 2WP8J 1B8AA 4DFAA 3NTIA 3V2TA 1SYEA 3RN2A 3OOCA 5FLXc 2JA6B 1CQXA 1IZ6A 3SVMA 1W0JA 3W3AA 4GZYC 4WJ3M 1GJRA 1K83H 5A89A 1TLLA 3HOUH 5B6IA 3MXGA 2IPKD 2V1CC 1XMOQ 1LV9A 2I5MX 2JA8H 2Q8TA 4AH6A 1VHEA 1RL2A 3SEBA 1XXGA 4ZKBB 4FF3A 1CK1A 4JK1C 2B2VC 4ODGA 4IUTA 1II3A 4X7CA 2XN9C 4BY1G 1PH8A 3Q8DA 2EXDA 3MXPA 3ONAB 1VHOA 1BJKA 2X69A 3PIP3 2Y0SE 1K9MD 3PVDA 2E76C 3GV6A 2M5SA 4PMWA 2A68D 2Z6KA 2B2YC 1HZ9A 1EYCA 1JA1A 1A2UA 1RTNA 4P22A 2VUMH 1K83B 3HOUB 1PZID 1TXYA 1F2YA 3A7AB 1TS4A 1CM9A 3TRZA 4HTHA 4G7ZC 2BVNA 1SNCA 5EBDA 4CJ2C 2JA8B 1DJRD 1XMQQ 1X3QA 3W5OA 1Z9FA 4N9TA 4WQMA 1QX4A 2R7DA 3PA1A 4DUYQ 4P26A 2ID0A 1EP2B 3GSIA 1XX8A 2DIEA 3W1GA 4LF9Q 2YTVA 3PO3H 1FNMA 1CKOA 5C0XG 4R4QA 4KY6A 5EKLA 1B53A 2Q2TA 4OOSA 2K7VA 4JI0Q 2HQEA 2LXJA 5IYDH 3WOFA 1MGSA 1C9OA 4G57A 4KHVA 2VUMB 3CW2C 1UNSA 2F0HA 2MO0A 4XDXA
chains in the Genus database with same CATH topology
3DUZA 5D3DA 3VR3A 1DOKA 2RA4A 2KUMA 2JEAI 4K8IA 4DF7A 2CW0C 4PMBA 1KDAA 1F77A 4ZRZA 1QJOA 2X6YA 4KY7A 3PO3B 1B4OA 2AWNA 4DK0A 5CDFA 1DM0B 1ZYRD 2ENBA 5JVH3 1LABA 1AEXA 4B9XA 5JAVA 1GUTA 1B44D 1RJTA 1DOLA 1TQOA 2NN6G 1TT2A 2Z1CA 1FNWA 2IL8A 2B63B 1Y69U 1EFID 1SKYB 4XYOA 1JWSD 1MBYA 4TSFA 1GUOA 2K1BA 5I9PA 1BO0A 4PQXA 1RF2D 2A6HD 2GA4B 4NDXA 3NTHA 4ABNA 4II3A 1Y8OB 2XGJA 1F2ZA 3S1NB 4G6IA 2YU9B 5I4DA 2EZVA 3PUYA 2QCPX 4FXDA 2DNEA 2K01A 1I4HA 5T1GA 1H9SB 4XNFA 2K5QA 4LJZC 5IT9L 1KNAA 1G6ZA 1QNKA 4L6TB 3K6OA 5IIFA 3GVKA 1WVLA 4TKOB 2ZZEA 1F2LA 3MHBA 1VLYA 1EY7A 3A54A 1H9SA 1BDOA 5AFWA 2ZXPA 1SNQA 3OIQA 2KCNA 2L55A 1OXSC 4OL7A 3GTLB 3J80E 4BA2I 4IZ8A 1HRJA 4IUQA 5HURA 5EKIA 1BCPF 1OXXK 2F0VA 3S15B 4RHRA 5C3XA 1KLUD 4EGVA 2XRSD 2EYLA 2Y0SB 5CV5A 3CMMA 5IGFA 2J4XA 1EQVA 2SNSA 1I6HB 3JAML 3R3OA 2VXWA 4CKBA 3HRZC 1EY6A 1EEFD 2F0LA 4RA8A 2JIZA 5JEAG 5I2YA 3MFGA 2B8FA 2FMMA 5LL6S 2MUYA 4C1NK 5C4HA 5FLXE 3KLSA 1BR9A 2AQ2B 1MSGA 4Q0FA 4HCSA 4XL9A 1FYCA 2JA7B 2ZXHA 1BQQT 1H9JA 2EYMA 1K8MA 1JOQA 2B2UC 1U4PA 1LTGD 3MEHA 3GTOB 3T51B 2A69C 4FYDA 1H8HA 2PYKA 2NVXB 1YNNC 4B3GA 2SEBD 4HMIA 1O7LA 1AZQA 1OB0A 2ZT9C 1SNMA 1TS3A 5KEEA 3K57A 3OPOA 3LNNA 3OW7A 5KGUA 1SE3A 1AW7A 2PZUA 3S14B 2D3NA 3T53B 1TY2A 2F0PA 4TQUS 2GJPA 2XWBB 3GVLA 2F0QA 2YYZA 3UI2A 5ISRA 3D6CA 2R3ZA 5M3FB 3QIAA 3SE0A 4KI0A 4YIJA 1C8CA 3VR4A 2F03A 4RHSA 4B3FX 5DAUA 3TDQA 4ZLTF 4HAEA 3A8KE 3NTKA 1J9OA 3BDCA 4DAPA 1HUNA 2FHTA 2JYOA 4IUVA 1RCVD 2G9HD 2Z4HA 1VCIA 1U9RA 2Q8RE 5JPMC 2V4DA 3BS1A 4K6DA 2HDMA 1I4RA 4XXEA 2Z8LA 4ZUIA 1E43A 2E1BA 1SSOA 4DN4M 2LMCB 3HOYB 2F4IA 1PTOH 4YXWA 1HFNA 1JCKB 2GK7A 1EIGA 4JBWA 2Z4IA 3I73A 4FXGC 1W6KA 4Q5VA 5A2QL 1EL0A 5E4XA 2ZTNA 1PFBA 3VYTA 3U9SA 1G91A 3MWYW 3ITPA 1IW7D 4XT3B 1CZGA 4X3TA 4XT1B 2R92B 4P2CB 3OFNA 2MPMA 1R4PB 1I4QA 1TS2A 3KBXA 4PNYA 2EXZA 4ZQ3A 3WDNA 3KEWA 1V1PA 1PTOB 1MSHA 4RGMA 4NW2A 5CBEE 2EY6A 1OXUA 3VR2A 1HHVA 3H6MA 2IX3A 1B3AA 4BBSB 1E3XA 1EY8A 1O80A 3VA7A 4ULLA 3KUPA 1E1QA 1PKVA 2F0MA 4A3FB 5G3LD 2EJMA 2F0EA 5EPLA 1KNEA 1EY0A 3TP8A 4DGZA 4K5XA 1STGA 1F2MA 4Z9CB 2B2WC 1H9RA 2F0NA 2NVQB 3OHXC 4H7BA 3GTKB 4B9WA 1SYDA 3K0YA 4XN0A 3CHBD 4NKLA 1SNPA 4G7WA 2XWJB 1I4PA 1EY4A 2JEBI 1PLFA 4BS9A 5KNDA 1EOTA 1HUMA 2F0UA 1PRTD 2NWGA 3HOZB 2A68C 3DEPA 1IYUA 1CQFA 1TWCB 1G291 2L0CA 4C1NI 4XQFA 1JR0D 4XLHA 2SDFA 4EQPA 5FO7B 1WTPA 2K5DA 5C6AA 1X3PA 5CV6A 4XQJA 1GJXA 3X3MA 1TWAB 4K2LA 4C3HG 3ZPNA 1Q1EA 3BYTB 2EY5A 1IKMA 1PTOD 5DEHA 3LX0A 2ZXOA 2MHVA 3DWAA 1SFOB 1WTWA 3VR6A 1C48A 2O2LD 3H3VC 2PO4A 4V0BA 5I6WA 1LT3D 1NSNS 3SK6A 1JICA 1I50B 1JB3A 3KBGA 2LS01 5LHY1 2M2LA 4ZYSA 4XM3A 2VJIA 3T4AC 3I91A 1HA6A 3NBHA 1SEBD 2JDIA 3BG3A 3D6WA 2RQXA 3TZDA 3S9WA 3D4WA 3NXWA 3F2UA 4XKWA 2KVOA 3SK5A 1E3ZA 1LTAD 1SMYD 1A2TA 5JJZA 1PYWD 5IODA 2ZXRA 1H9KA 2QF7A 3EJIA 4KTAA 2WZPP 2ZZQA 1JWUD 1Q8IA 5HGTA 3NWTA 1LACA 2DNCA 1EZ6A 2M00A 4HSVA 2A6HC 3P20A 1JE4A 4FP5D 1TS5A 4J8QA 3NQTA 4ME5A 4XOPA 1T5XD 1LTTD 5D3IB 4K6LA 1PFMA 3A56A 3IAYA 5FK9C 3KLSX 4IUPA 4K8JA 2QDBA 1SDFA 3OE7A 4OIJA 2HCIA 5I9OA 2H4OA 1F9QA 1XTCD 3M4YA 3BVGA 1NR4A 5IGBA 1IYVA 2NUCA 5E1FA 2C9OA 2NYZD 3HAGA 2DN8A 3EROA 5DM73 5JOBA 2MJ8A 1XWEA 1BBXC 1EU3A 3P75A 3TN2A 2E2JB 1SAPA 1DD2A 2L12A 2EYJA 1FNVA 3NUCA 4KK7A 3V05A 2E2HB 5M5WB 3EQLC 1SYGA 2B2TC 5A35A 2XZPA 3RD4A 2EYHA 1OO9B 1KDCA 5C5MA 3BCDA 1D5ZC 4KKSA 4QB4A 2RSNA 1H9MA 2AQ1B 3T13A 3HOWB 5EPKA 2K05A 3MXUA 3GTQB 2D9UA 1LTID 5KYIA 4MHEA 5FOBB 5C0XI 2O5IC 1K28D 1I8DA 4KHZA 4CKEA 4DU9A 1CFMA 1S5ED 3ND8A 1QE6A 1STBA 3K5OA 4KD3A 1G2TA 4RCNA 3TP6A 2MP1A 4IUNA 4G4KA 2D2CC 2LKVA 1BLIA 1LLRD 1JWMD 1WD0A 1UD8A 4C3IG 3H91A 1SYFA 3G05A 4LAAA 2EYFA 3GTPB 1J8IA 1KABA 3OEHA 1ENAA 1EYAA 4A3GB 2BDNA 3K5MA 5C4ZA 4HMJA 1UEAB 4AYBB 1ILPA 1BF4A 2EOTA 2E2IB 5ELDA 3E0JA 5M3MB 1BCPD 2N88A 2F1MA 5EPJA 5C4XB 2W6JA 4RKLA 5TSSA 3OSOA 1ICWA 1NR2A 2JXMB 1TVXA 4BA1I 3S1QB 5DNFA 4E6IA 2B2TA 1STEA 4H13C 4WJWA 4RKBA 2QKIC 1PZJD 1PDQA 4QMGA 1TWHB 3SXHA 4V190 2IX0A 1F9SA 2R6GA 4CJ1B 4XR6A 4XD7A 4IFDG 2ZTGA 1K8OA 2ZZGA 3QOLA 5M5XB 3HKZB 3R2IA 3FMCA 1WD1A 2NTTA 1EQTA 1Q90A 1ZEQX 3G7LA 5JPNC 3K58A 5D14A 4XLEA 4XQNA 3QJYA 3AU7A 1W6JA 1EZ8A 3P1HA 1UUPA 3RZOB 2XSCA 2IT1A 3QO2A 5KIXA 2PPBC 2LZJA 1ET6A 2N55A 1WTOA 1D5XC 5CV4A 3I4MB 5K5PA 2EJGC 1OHHA 4C56C 4DXFA 3FKSA 4XN3A 1KLGD 1O78A 5C44B 1JORA 3DM1A 3DWQA 3NK9A 3GQBA 2BDOA 2F0OA 4BY7B 4I65A 3QOJA 1YNJD 1A3VA 3R2TA 2A74C 2EYPA 5ELEA 2ICIA 4X3UA 2F0SA 5FKAC 4OO1H 4M8AA 2SNMA 3K5LA 2K28A 1NRKA 3S1RB 2HLDA 4TRDA 1FNUA 3GP7A 4XOTA 5CORA 1WTHD 3V96A 2XOKA 2WKDA 1TR5A 2FINB 3M3YB 1V43A 1GUGA 3ND9A 2IX1A 4XMYA 4XQQA 1B1ZA 2GJRA 1PTOC 2EJFC 2FJ2A 2HCCA 2EPBA 4UAIA 4J6HA 2E74C 4CBVA 3N6RA 3DXJC 1Q3LA 2CW0D 2RSOA 3NQIA 4RGOS 3L3OC 2FFKB 1EU4A 1HCZA 1Y8PB 4HN7A 1L0XB 2F0FA 3A55A 4WORA 2GK6A 4DA2A 4WRDA 4R8IA 2F0GA 3I4LA 1OXVA 5FLXL 3VYUA 4F87A 1SMYC 5EJWA 2RDGA 3CQZB 2AWOA 3JU4A 5BN4A 3GTJB 1QCBD 2BA0A 1FD7D 2D62A 1W0KA 2W6IA 1VMCA 3M4OB 4YEJA 1A3UA 3SK4A 3FDTA 2A6EC 2NVTB 3TBIB 1ESRA 2R9VA 1PRTB 1C4QA 3SR1A 2JSOA 1MI2A 4RCOA 4II2A 3T16A 2WJYA 4A3EB 4A3MB 1V1PB 3L7ZC 4G7HC 1V0FA 3MZ5A 3SK8A 5K36G 3CU7A 1I3QB 1STNA 1HVXA 3NWSA 1V1OA 5IGEA 5C4JB 4XORA 4RWSC 5ELBA 4KV6A 1LTBD 2RDHA 1B50A 4OO1I 1UD3A 3HOVB 3BH4A 4XKVA 4XONA 4Z1MA 2PCFB 1HPCA 3VR5A 1LTRD 4RAUC 1RTOA 5KNLA 1QWYA 2F0TA 1TIID 3H94A 2PQEA 2WAQB 2RDFA 3OEEA 3K5NA 2J7ZA 4FXUA 1X32A 5C0XJ 2WKCA 3L9AX 3TSSA 4NP5A 1BOSA 2JA5B 1GUWA 3WQZA 3U9OA 4HIZA 1LO5D 1M8AA 2V7QA 4H44C 1B9NA 4A3DB 4A93B 4MN3A 2X8KA 4JMQA 2WPDA 1WTXA 3O13A 1GUSA 3NSWA 1VF7A 1HQRD 1JOOA 5D65A 2XIWA 3FPUB 1O7ZA 5COYA 1PXUA 5IGDA 3OAAA 3I90A 4MIUA 5HKKA 4A3IB 2PMZB 1WP6A 1SYCA 2TMPA 3BZDB 2WB1B 1CI3M 1Y1VB 4L8JA 1CHPD 1PMRA 2NTSA 2BA1A 3CESA 4S3SA 4RGTA 1E1RA 4ZK9B 2F43A 1VJSA 4TSSA 1HXYD 4KMUC 3CKIB 2ZZFA 1ILQA 4UZUA 1NUCA 3OWEB 2KECA 2JJ2A 4OGQC 2JJ1A 5C0XH 4BY1B 1ZYRC 3FVQA 4KD4A 5G3LF 3BYYB 3D3RA 1LT5D 1S5CD 5E3FA 1TWFB 3J81E 5KNBA 2SOBA 3I70A 4ILWA 2KEEA 3A35A 2XZOA 3MA2B 2CHBD 2E75C 3Q22A 4IN3A 2VJJA 4DXGA 3N52A 4EVOA 2AUKA 1IKLA 1E2VA 1AN8A 1RHPA 1IHZA 3DEOA 1KTKA 1AP0A 1LT6D 5CV7A 1PFNA 2NN6H 5DN6A 4J1MA 2DY7A 2PZTA 2R7ZB 1S5FD 4FF4A 1A15A 4F7XA 3GO5A 1PTOF 5NUCA 2VNUD 5E4WC 1QB5D 1E0BA 2XNAC 2CQAA 2NBFA 2I07B 1QOHA 5JEAJ 1AZPA 1I4GA 2KEDA 3MC0B 4U68A 3A3GA 5I2XA 4FO2A 5T1IA 2Z6BD 1OXTA 1NCVA 1F9PA 3H0GB 2BOSA 1RDPD 2X6XA 4QUFA 4IFDH 1D1IA 4LK1C 1UD5A 4ID6A 1EWCA 1Y1WB 3MXNA 1Q12A 2F0DA 1JOKA 1EY9A 5F2DA 2R93B 1CT1D 4DNTB 4IURA 1DCZA 3EFXD 4ZKCB 1V8QA 1H8EA 1BCPB 5ELFA 4BBRB 3T56B 1SBBB 1HFGA 4EQOA 1VF5C 2IJ0A 1I4XA 1S5BD 3URYA 1DONA 1G2SA 2R61A 5CYUA 3BCFA 2F3WA 5I6YA 4OIKA 3EA6A 1YNJC 2F0JA 2XZLA 5CGKA 1HTPA 1E2ZA 2X6GA 3DDYA 3WOEA 1R4QB 4R9WA 1SJED 2PW5A 3LWEA 1HTLD 3RLFA 1Z7TA 2LY7A 2Q8IB 3RUZA 4ZUJA 3S2HB 4UDUC 5JEAH 1TWGB 3ERQA 1XYIA 2A5HA 4C3JG 3A8JE 5IOCA 1KAAA 5C3EB 5IT9E 5JVG3 2BE5D 2HUGA 4YELA 2RVLA 2L4NA 1STAA 2NN6I 3FRPB 4FVMA 4KN4C 1BPLA 3AMUA 4B08A 1CQVA 1LT4D 5IK2A 2OT2A 4X3KA 2MGSA 2A73B 3I3CA 2F0KA 5FO8B 5C5LA 4A3KB 1BXTA 4A3JB 4IUUA 1O7YA 1EWHA 1RODA 2KOLA 2G9DA 2OXPA 4O42A 1VMPA 3JAME 1U4MA 4IFDI 4XLAA 4XYQA 1GHJA 3D8GA 1ESFA 2PNRC 3S16B 1I6VC 2B2VA 2CVRA 4KJNA 1ENFA 2TSSA 1QG7A 3NBIA 1KMHA 1Z6HA 1E2WA 1QNUA 5LL6X 2B2YA 5BN5A 1DOMA 3IFTA 2J0TD 2F3VA 4RFBA 3ZIAA 2GJKA 2C5CA 1IW7C 5KNCA 4Y7NB 4X3SA 3A3BA 4XLFA 1EYDA 1SE2A 3HS0C 2WSSA 1U4RA 3X3NA 1WCMB 4O1NA 1WTQA 1TKWB 2EE1A 3I4NB 4TT3A 4DAYA 1EIHA 4BWGB 4E0FA 1FR3A 3CRKC 4I7ZC 2JE6I 2FMCA 5CBAE 5K36H 3BDLA 1COWA 4G7XA 3M7NA 2EY2A 1UD6A 3M85A 4H0LC 2O5JC 3IKJA 2D5DA 5CV8A 3RZDB 2OF1A 4QIWB 4XIGS 3QG1A 2X85A 1STYA 2PW7A 5EQ0A 3SDZA 4U673 1UD4A 1KZLA 2QEJC 1DZ1A 3G6JB 3SHLA 1FX0A 4PMCA 3KK7A 1GUNA 3QB3A 1G8ZD 2B39A 3BC9A 3C46A 1PRTC 1HQMC 4OHJA 3HEJA 1SXTA 2H1EA 3E5SA 1NBMA 2L11A 4FXKC 5FL7A 3TP5A 3HP3A 3NP8A 3J80L 3K59A 1SNDA 3HG9A 3PUVA 1ZXTA 3OIPA 1TU2B 4HCEA 1S4ZA 4RGNA 3R93A 2WJVA 3NHHA 1CHQD 5CC4A 2AUJD 1T5EA 2EVBA 2WIIB 4F8MA 5A2QE 3BDOA 1FGBD 1IL8A 3I72A 1BMFA 1SJHD 2F0IA 1RKNA 1JQYD 5CR3A 3S2DB 4QUCA 1AFPA 2DY8A 1Q1BA 1R9TB 4K2KA 1GXDC 2ICEC 4HEDA 4QF4A 4NNJA 4K14A 2PZWA 5EGTA 1W9XA 1ML0D 3W2DA 1UD2A 4RH6A 2ZXIA 4K5WA 3P7JA 3GTMB 1RD9D 3DMUA 3EVQA 1CA5A 4GQNA 3TMEA 4AVZA 1M4VA 2RBMA 1DXMA 3K7AB 1EFRA 2K32A 3FPPA 4C3HB 3IFDA 3GD7A 3AB9A 4XTCS 2OEOA 5KYLA 4G7OC 2M9VA 3VA5A 3PUZA 3Q6SA 2WACA 3RMHA 5ELCA 1A3TA 4NMZA 3PUXA 4K5VA 4C2MB 3VYSA 1S5DD 2NB0A 1WTRA 1ONLA 3KLRA 4CJ0B 1D5MC 4KN7C 1ZKOA 2B2UA 3MVVA 3QWNA 4KKTA 3HGBA 3MFYA 1V0EA 2QE7A 3R8BA 4EQNA 4IALA 1HA5A 3C1FA 3S1MB 4A3BB 2L9HA 2NZ1D 2KJXA 4ASUA 4CGYB 4HSPA 3IL8A 1LTSD 4PV1C 3MAQA 3GVJA 2X53S 3OMCA 3Q0AA 2K03A 1U4LA 2VB3X 2X6LA 3J7AF 4OO1G 4LMQD 2EY1A 4XLCA 4N9PA 1DYQA 2JP1A 2IWHA 1CTMA 2KA7A 2IW3A 1MD2D 2HDLA 2XRQD 3VYRA 1ENCA 1I18A 1GHKA 2B8GA 1B9MA 3BVMA 1SNOA 2XNDA 3OMGA 4L63B 4ZAIA 1HZEA 4CKCA 3M7GA 3CRLC 4WFN3 5IGGA 3MTSA 2VB2X 2A69D 1KDBA 1CA6A 1Z47A 5M9OA 2K5WA 5BN3A 1YNND 4CHTB 2E2DC 4QCLA 3LWUA 2L5TA 2NVYB 3PIO3 1B2TA 2V31A 1CZWA 1Y8NB 1MABA 3DHQA 3I8ZA 4FF1A 4FNFA 3PV0A 2I46A 2RKSA 1D2BA 3HZXA 4DK1A 3C3LA 1PZKD 2CK3A 3PO2B 3TP7A 3D4DA 3ZYYX 2BE5C 3Q24A 4KJOA 3TZUA 2L1BA 3KF8A 3FEWX 3C2PA 1NAPA 3D4RA 2BCOA 1F9RA 5J22A 5J39A 1A6XA 5DM63 1GOZA 3E6ZX 4IFDJ 3J7AV 2K04A 3NPPA 3J7YW 5EKKA 4FF2A 3C1EA 1EEID 3GTGB 2K33A 3PMFA 1SYBA 1WPCA 1BCPC 3S17B 2QILA 5CMDA 1QILA 5EBCA 3CP2A 4IQZA 1UAPA 2LFNA 1PRTF 4F88A 1L0YB 2D3LA 1WTVA 2WV6D 2AQ3B 3GV3A 3A7LA 1ET9A 2F0WA 3Q23A 1E79A 4C3IB 1STHA 3H09A 4C3JB 1BUVT 1D6EC 2A6ED 2B2WA 3FKIB 2KQ3A 5FO9B 1TY0A 1EY5A 3A8IE 1SE4A 2KHSA 5CV9A 4HR7B 5J1ZA 5KRUA 2EDGA 3PUWA 5IGCA 2X6WA 2K6AA 5C3WA 3CP8A 2O4XA 4M1UB 4DNRB 2KCCA 2WINB 1D1KA 1JC7A 2EYOA 3DWPA 5M5YB 2KVMA 1BNZA 4R8NA 4DAVA 3OWFA 4KKUA 3D31A 3HOXB 2XVSA 3NE5B 4KY5A 3J81L 3BVZA 1VDZA 2WP8J 4DFAA 3NTIA 3V2TA 1SYEA 3OOCA 2JA6B 3SVMA 1W0JA 3W3AA 4GZYC 3MXGA 2IPKD 1LV9A 2Q8TA 3SEBA 1XXGA 4ZKBB 4FF3A 1CK1A 4JK1C 2B2VC 4ODGA 4IUTA 1II3A 2XN9C 3MXPA 3ONAB 2X69A 3PIP3 4PMWA 2E76C 3GV6A 2M5SA 2A68D 2B2YC 1EYCA 1A2UA 4P22A 1RTNA 1K83B 3HOUB 1PZID 3A7AB 1F2YA 1TS4A 1CM9A 4HTHA 4G7ZC 1SNCA 4CJ2C 5EBDA 2JA8B 1DJRD 1X3QA 4N9TA 2ID0A 1XX8A 2DIEA 5C0XG 4KY6A 5EKLA 1B53A 2K7VA 2HQEA 3WOFA 1MGSA 4G57A 4KHVA 2VUMB 1UNSA 2F0HA 4XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q12 A;  3AB9 A;  3LWU A;  2L5T A;  4XTC S;  3SDZ A;  3VR3 A;  4G7O C;  3PUZ A;  2JEA I;  1H9R A;  4OGQ C;  1EWH A;  3A8K E;  1OXX K;  5C0X H;  2O5I C;  1Y8N B;  2DNC A;  4DNR B;  2KCC A;  4DNT B;  1ZYR C;  1DCZ A;  2CW0 C;  3FMC A;  4KHZ A;  2A6H C;  1CFM A;  3ND8 A;  2PCF B;  3P20 A;  3PV0 A;  1QJO A;  1GUN A;  1HPC A;  3VR5 A;  1Q90 A;  2EJF C;  3PUX A;  4RCN A;  1V8Q A;  1HQM C;  4DK1 A;  2E74 C;  3H94 A;  3N6R A;  4DK0 A;  3DXJ C;  3T56 B;  1ONL A;  3KLR A;  2D2C C;  2JEB I;  5KNB A;  1VF5 C;  5KND A;  1GHJ A;  1LAB A;  4KKU A;  3D31 A;  3QJY A;  4KN7 C;  1ZKO A;  1VCI A;  2PNR C;  1HCZ A;  1Y8P B;  1GUT A;  3NE5 B;  2V4D A;  4KKT A;  2A68 C;  2BE5 C;  1I6V C;  1IYU A;  5JEA G;  3HGB A;  2NN6 G;  3MFY A;  3PUV A;  2B8F A;  1YNJ C;  1VDZ A;  2E75 C;  1TU2 B;  1G29 1;  3TZU A;  3D4R A;  1HTP A;  1E2Z A;  3I4L A;  3OOC A;  1OXV A;  2AUK A;  1Y69 U;  1Z6H A;  1E2W A;  1E2V A;  1A6X A;  2AUJ D;  2IT1 A;  1T5E A;  3M4Y A;  1FYC A;  2LMC B;  2EVB A;  2PPB C;  4GZY C;  3W3A A;  5BN5 A;  1H9J A;  3IFT A;  1GUO A;  1Z7T A;  2Q8I B;  1K8M A;  3RLF A;  4PV1 C;  1SMY C;  4H44 C;  1IYV A;  1GJX A;  3BDO A;  4JBW A;  1B9N A;  2A6H D;  1Q1E A;  2EJG C;  1IW7 C;  3I72 A;  2NN6 H;  5JEA H;  2AWO A;  4JK1 C;  2K33 A;  2DN8 A;  3I73 A;  5KNC A;  1O78 A;  1Y8O B;  3T51 B;  3VR6 A;  2A69 C;  3A8J E;  5BN4 A;  2BA0 A;  1YNN C;  3U9S A;  1Q1B A;  2D62 A;  1GUS A;  1O7L A;  1IW7 D;  4OO1 G;  1VF7 A;  3PUY A;  3GQB A;  1DD2 A;  2ZT9 C;  1TKW B;  2BDO A;  2DNE A;  2E76 C;  4IQZ A;  2A68 D;  2BE5 D;  3OPO A;  2F1M A;  3LNN A;  3OW7 A;  1H9S B;  1CTM A;  4LJZ C;  2KA7 A;  2A6E C;  1FR3 A;  3WDN A;  3A7L A;  3CRK C;  3A7A B;  3EQL C;  4I7Z C;  3BG3 A;  1GHK A;  2JXM B;  2NN6 I;  2B8G A;  1B9M A;  4BA1 I;  4G7Z C;  2JE6 I;  1CI3 M;  4OO1 H;  4L8J A;  5A35 A;  5K36 H;  4TKO B;  1OXU A;  2A6E D;  4H13 C;  3VR2 A;  3T53 B;  1OXT A;  4KN4 C;  3M7N A;  1PMR A;  4TQU S;  1H9S A;  3L7Z C;  1BDO A;  4G7H C;  2BA1 A;  2YYZ A;  4KKS A;  3M85 A;  5K36 G;  4H0L C;  2O5J C;  1H9M A;  3VA7 A;  1DXM A;  1OXS C;  5C0X G;  3CRL C;  3IKJ A;  2D5D A;  2K7V A;  4IFD H;  2R6G A;  3A8I E;  2A69 D;  1H9K A;  3QIA A;  4LK1 C;  2K32 A;  3FPP A;  2QF7 A;  4KMU C;  4BA2 I;  4HR7 B;  4KI0 A;  3SE0 A;  5BN3 A;  4XIG S;  3QG1 A;  3MXU A;  2EDG A;  2EJM A;  3VR4 A;  3PUW A;  1V43 A;  3GD7 A;  1GUG A;  4IFD G;  3ND9 A;  1LAC A;  1K8O A; 
#chains in the Genus database with same CATH topology
 3DUZ A;  5D3D A;  3VR3 A;  2CBX A;  2YWF A;  1DOK A;  2RA4 A;  2KUM A;  2PI2 E;  2JEA I;  1B2R A;  2R7Z G;  4K8I A;  2B63 H;  1OTC A;  4DF7 A;  2CW0 C;  1VQN B;  2YV5 A;  2K14 A;  4PMB A;  1KDA A;  1F77 A;  3MCA A;  4ZRZ A;  2KBN A;  5LMU L;  1QJO A;  3J7A 5;  4OX9 Q;  4GKK L;  3H3V I;  2X6Y A;  4KY7 A;  4P6V F;  3PO3 B;  1B4O A;  1QH0 A;  2AWN A;  4X64 L;  4DK0 A;  2UXD L;  3KLW A;  5CDF A;  1DM0 B;  5IYB H;  1HNX Q;  1ZYR D;  3CP0 A;  1FVI A;  2ENB A;  5JVH 3;  5DLQ E;  5GQO A;  1LAB A;  1AEX A;  4B9X A;  1VQN A;  5JAV A;  3CCE A;  1GUT A;  3S1N H;  2YU9 H;  1UWV A;  2UXC L;  4B3X A;  1B44 D;  1RJT A;  1AE3 A;  1DOL A;  1TQO A;  2NN6 G;  1TT2 A;  2K50 A;  1EUJ A;  4B3S L;  4QQB X;  3WXM A;  2Z1C A;  1FJG Q;  1KTV A;  3CCL B;  1FNW A;  2Q6O A;  2IL8 A;  4CDD C;  5KW9 A;  1N36 Q;  1Y69 U;  1EFI D;  2B63 B;  1Y0R A;  2BPO A;  1SKY B;  1JB7 A;  4XYO A;  1JWS D;  1MBY A;  1N34 Q;  4OPO A;  2QDL A;  5THX A;  1KK1 A;  2I1L A;  1YHB A;  1LTL A;  4TSF A;  4AF6 A;  2K4K A;  4FN5 A;  1GUO A;  2K1B A;  5I9P A;  1BO0 A;  1RF2 D;  2A6H D;  4PQX A;  2GA4 B;  4NDX A;  3NTH A;  4ABN A;  4X65 Q;  3CCL A;  3ICE A;  5IP9 G;  3WNC A;  4II3 A;  4Z4Z A;  1Y8O B;  2XGJ A;  3ASR A;  1BBU A;  1F2Z A;  4G6I A;  4HE5 A;  3S1N B;  2YU9 B;  4JYA Q;  5I4D A;  2EZV A;  3R6K A;  1SE8 A;  3A8I A;  3QSY A;  2R93 G;  3PUY A;  4IPC A;  2QCP X;  4FXD A;  3GTL H;  2ZJQ A;  2DNE A;  3UE1 A;  4DV7 L;  4X7E A;  1EFW A;  1I7P A;  2K01 A;  3PUN A;  1I4H A;  4DR4 L;  5T1G A;  1H9S B;  4XNF A;  2K5Q A;  2Q2H A;  4LJZ C;  5IT9 L;  5H5J A;  1KNA A;  4WZL A;  1QNK A;  1G6Z A;  4L6T B;  1X6O A;  3K6O A;  5IIF A;  3GVK A;  3HFZ B;  1WVL A;  4UP7 A;  1GR1 A;  4ZGQ B;  4HIM A;  3S15 H;  4TKO B;  3QFS A;  2ZZE A;  1F2L A;  3MHB A;  1VLY A;  2VBT A;  1EY7 A;  3A54 A;  1H42 A;  1H9S A;  3PA2 A;  1BDO A;  5AFW A;  2ZXP A;  1SNQ A;  4Z4T A;  3OIQ A;  2KCN A;  2L55 A;  1OXS C;  3K80 C;  4JI2 L;  3BZK A;  4OL7 A;  1I6H H;  3GTL B;  3J80 E;  4LFA L;  1N33 Q;  4BA2 I;  4IZ8 A;  1HRJ A;  4IUQ A;  5IWA Q;  4DUZ Q;  4GN5 A;  5HUR A;  3CW2 A;  1DGS A;  3B82 A;  5EKI A;  4B3R L;  2G5D A;  4Z4S A;  1B3Q A;  1BCP F;  1OXX K;  2F0V A;  2IHF A;  2GPJ A;  4MTN A;  3S15 B;  4RHR A;  5C3X A;  2DET A;  4RD4 A;  3J81 j;  1KLU D;  4B43 A;  2JA7 H;  4EGV A;  5C3E G;  2NZH A;  2XRS D;  2EYL A;  2Y0S B;  1PH5 A;  5CV5 A;  3CMM A;  1HNZ Q;  3AFP A;  2J4X A;  1EQV A;  2SNS A;  5IGF A;  1I6H B;  4O0A A;  4OWT B;  4A3G G;  3JAM L;  3B6Y A;  1AH9 A;  3R3O A;  3GTO H;  2VXW A;  4ZV4 A;  4CKB A;  3HRZ C;  1EY6 A;  1EEF D;  4K0K L;  2NVX H;  2D0P A;  2F0L A;  4AYB G;  4RA8 A;  1RQP A;  2JIZ A;  4X62 Q;  5JEA G;  1K8A C;  5I2Y A;  4QL5 A;  3MFG A;  4LNQ A;  2B8F A;  2FMM A;  2XTI A;  5LL6 S;  2MUY A;  2YTX A;  4C1N K;  5C4H A;  1E64 A;  5FLX E;  2FXQ A;  3ULP A;  3CRZ A;  3G71 A;  3KLS A;  1PH6 A;  2VBS A;  2RHQ B;  1BR9 A;  2AQ2 B;  1MSG A;  1VQO B;  4Q0F A;  4DV3 Q;  4RCZ A;  4HCS A;  4XL9 A;  1FYC A;  4DQL A;  2JA7 B;  1G7S A;  2ZXH A;  4AIM A;  1R5B A;  1BQQ T;  1H9J A;  5M3M G;  3CCR B;  1BBW A;  1K8M A;  2EYM A;  2OWO A;  4Y7C A;  1JOQ A;  5C4X G;  1WSR A;  2AKW B;  3S14 H;  2B2U C;  2X3U A;  1JB9 A;  1U4P A;  1LTG D;  1EQR A;  1EYG A;  3ZC3 A;  2E5L L;  3MEH A;  3GTO B;  3T51 B;  2A69 C;  4FYD A;  1H8H A;  1GO2 A;  2PYK A;  2NVX B;  4HJ9 A;  1YNN C;  2D0O A;  4B3G A;  2SEB D;  4HMI A;  1O7L A;  1AZQ A;  1E22 A;  1OB0 A;  4B3T L;  1KXL A;  2ZT9 C;  5M3F H;  4CQJ A;  1SNM A;  1TS3 A;  4PZ7 A;  4A75 A;  1VQD A;  5KEE A;  3K57 A;  3OPO A;  3M9B A;  3LNN A;  4K1X A;  2DCU A;  3OW7 A;  3KL9 A;  5E6T A;  3CMA B;  5KGU A;  2PI2 A;  1SE3 A;  3AEV A;  5TR9 A;  1AW7 A;  2DOG A;  4IJH A;  2PZU A;  2N8N A;  2HHH L;  3S14 B;  2D3N A;  1VQB A;  5F4J A;  3T53 B;  1TY2 A;  2F0P A;  4TQU S;  2Q6I A;  2GJP A;  2XWB B;  3GVL A;  2F0Q A;  1H85 A;  3HKZ G;  2YYZ A;  3CMA A;  1FND A;  4YCV A;  3TEH B;  3UI2 A;  4FDB A;  2C78 A;  5ISR A;  1J6Q A;  4GKJ L;  3D6C A;  3KYH C;  5HGQ A;  2R3Z A;  5M3F B;  1Q8K A;  3QIA A;  1JNY A;  4HIO A;  1VQP B;  2JN4 A;  4KI0 A;  3SE0 A;  4YIJ A;  2E1R A;  3KDF B;  1C8C A;  3VR4 A;  2F03 A;  4RHS A;  4B3F X;  4YHH L;  5DAU A;  3TDQ A;  3GTJ H;  4PC1 A;  4POG A;  4ZLT F;  3VDY A;  1LUZ A;  3J81 i;  1KD1 C;  1M1K C;  4UZE A;  4HAE A;  3A8K E;  3NTK A;  4NPS A;  1IBL Q;  1QVG B;  1J9O A;  4AQY L;  4TMZ A;  3BDC A;  4POF A;  1VQP A;  2UU9 L;  4DAP A;  4PG3 A;  4RDJ A;  1HUN A;  1UE6 A;  4DV4 Q;  5KSW B;  2FHT A;  2AHO B;  3HOY H;  2JYO A;  4IUV A;  4LF6 L;  4G1V A;  3W2E A;  1RCV D;  2G9H D;  1QUQ B;  1WJJ A;  2Z4H A;  1VCI A;  1U9R A;  2Q8R E;  3OW2 B;  4DQK A;  5JPM C;  1S40 A;  3I4M G;  1JT8 A;  2V4D A;  3BS1 A;  2VZA A;  1PYS B;  2HDM A;  4K6D A;  1I4R A;  4JI6 L;  4HJA A;  4XXE A;  2Z8L A;  4ZUI A;  5C44 G;  4NCN A;  2R92 H;  1E43 A;  1QUQ A;  4YAO A;  3T1H Q;  4LF7 L;  5IYC G;  2E1B A;  3U4Z A;  1SSO A;  3OW2 A;  1S72 B;  1TTT A;  2LMC B;  4DN4 M;  3HOY B;  1V5V A;  2BN4 A;  3CCM B;  2F4I A;  1PTO H;  3G4S B;  2H5X A;  3K7U C;  4YXW A;  4BY7 G;  1HFN A;  5GAH C;  1WOR A;  2GK7 A;  1JCK B;  1EIG A;  4JBW A;  2Z4I A;  4GLA C;  2K5H A;  3I73 A;  4FXG C;  1W6K A;  4Q5V A;  5FJ8 H;  5A2Q L;  4HJ7 A;  1EL0 A;  1EFC A;  4OWX B;  4BBS H;  5E4X A;  1S72 A;  1WI5 A;  2ZTN A;  1PFB A;  3VYT A;  3U9S A;  1G91 A;  3MWY W;  3FP9 A;  3ITP A;  3CCM A;  3G4S A;  1IW7 D;  2GVA A;  1GAW A;  2P5Z X;  4XT3 B;  1CZG A;  4X3T A;  4XT1 B;  2R92 B;  4A3F H;  3OFN A;  2MPM A;  4P2C B;  1R4P B;  1I4Q A;  1EQQ A;  1TS2 A;  2OQ0 A;  3KBX A;  4PNY A;  2EXZ A;  4ZQ3 A;  3WDN A;  3KEW A;  1V1P A;  2KCM A;  4L5Q A;  1PTO B;  1MSH A;  3A5Z B;  5TV2 A;  4RGM A;  3UDX A;  1D7Q A;  2QW7 A;  1SRU A;  4QFM A;  4NW2 A;  5CBE E;  3CME B;  2NVQ H;  2EY6 A;  1NBW A;  1OXU A;  3VR2 A;  3GTK H;  3H6M A;  1HHV A;  2IX3 A;  1SM4 A;  1YNX A;  3VO2 A;  1B3A A;  3W2H A;  2FVG A;  1E3X A;  4BBS B;  3A1P A;  1EY8 A;  3A74 A;  1O80 A;  1IL2 A;  1PJ6 A;  3VA7 A;  1JJG A;  4ULL A;  3Q6R A;  4YHB A;  3KUP A;  1XMQ L;  3TS0 A;  1E1Q A;  2I0Q A;  3VNV A;  1PKV A;  2F0M A;  4A3F B;  3CME A;  1N32 Q;  4DUY L;  1SR3 A;  2F1L A;  5G3L D;  1YHQ B;  2EJM A;  2F0E A;  5EPL A;  1KNE A;  1Q82 C;  4L5S A;  3HOZ H;  3DM3 A;  1EY0 A;  3TP8 A;  4DGZ A;  4APV A;  4K5X A;  4LF9 L;  4G5G A;  3NEN A;  1TWC H;  1STG A;  1F2M A;  4Z9C B;  2B2W C;  1H9R A;  2F0N A;  4JI0 L;  3ZJY C;  3PEN A;  3AVX A;  1Q7Y D;  2NVQ B;  3TRE A;  1VQ7 B;  2ZTE A;  3OHX C;  4H7B A;  2N49 A;  3GTK B;  2VNJ A;  4B9W A;  1JJ2 A;  3LO8 A;  1SYD A;  1YHQ A;  3K0Y A;  4XN0 A;  2MFI A;  3CHB D;  1QFZ A;  1SNP A;  4NKL A;  1G7R A;  4G7W A;  3I55 B;  2XWJ B;  1TWA H;  1I4P A;  3QFR A;  1GVH A;  1EY4 A;  2JEB I;  1PLF A;  4BS9 A;  5KND A;  1EOT A;  1SRO A;  1LM0 A;  1HUM A;  1SFO H;  2F0U A;  1VQ7 A;  1PRT D;  2NWG A;  4OX9 L;  3HOZ B;  2A68 C;  3DEP A;  1IB0 A;  1IYU A;  1CQF A;  1RIP A;  1TWC B;  2LXK A;  4DR3 Q;  1G29 1;  3PSI A;  3Q38 A;  3I55 A;  1HNX L;  2L0C A;  3F1Z A;  2K52 A;  1I50 H;  3E0E A;  1PH9 A;  4C1N I;  4LUV A;  4XQF A;  1JR0 D;  4XLH A;  2J7K A;  2SDF A;  4EQP A;  5FO7 B;  1WTP A;  2BV3 A;  1KJZ A;  1D1N A;  2K5D A;  5C6A A;  1X3P A;  5CV6 A;  4XQJ A;  1GJX A;  1BVS A;  3X3M A;  1TWA B;  4K2L A;  2ZL7 A;  3WY9 A;  3ZPN A;  2Q6K A;  3P27 A;  1Q1E A;  5HZB A;  2EY5 A;  3BYT B;  4C3H G;  1IKM A;  1PTO D;  4N3G A;  5DEH A;  1N36 L;  1QGZ A;  4YAF A;  3LX0 A;  2ZXO A;  2MHV A;  3DWA A;  1N34 L;  1SFO B;  1WTW A;  3VR6 A;  4H02 A;  3NBH B;  1C48 A;  1VLO A;  2O2L D;  3H3V C;  3OZU A;  2PO4 A;  4V0B A;  5I6W A;  1LT3 D;  4A3E G;  4A3M G;  1NSN S;  2PE3 A;  3SK6 A;  4X65 L;  1Q46 A;  1JIC A;  2CWP A;  1I50 B;  1JB3 A;  1A0I A;  1G51 A;  3KBG A;  4RMF A;  2LS0 1;  5LHY 1;  1VQK B;  2M2L A;  4ZYS A;  4XM3 A;  2JN9 A;  2VJI A;  4P3I A;  3T4A C;  3I91 A;  4X07 A;  4JYA L;  1HA6 A;  3NBH A;  1SEB D;  3KFU A;  4YAU A;  2JDI A;  3BG3 A;  4WZT A;  3D6W A;  2RQX A;  3TZD A;  3S9W A;  4GS3 A;  3D4W A;  3NXW A;  3F2U A;  4XKW A;  2KVO A;  4PC2 A;  4LUO A;  3SK5 A;  3VO1 A;  1E3Z A;  1LTA D;  1VQK A;  1SMY D;  1D2E A;  1WOS A;  3HOV G;  1A2T A;  1NE3 A;  1Y14 B;  3OTO Q;  1P8L A;  5JJZ A;  4JG2 A;  2Z6K C;  4JOI A;  3CCJ B;  1PYW D;  5IOD A;  2ZXR A;  1H9K A;  1PJ7 A;  2QF7 A;  3EJI A;  4KTA A;  4A3L G;  1AIP A;  2WZP P;  2ZZQ A;  1JWU D;  1Q8I A;  2WAQ G;  5HGT A;  3NWT A;  1LAC A;  3JAM i;  1V9P A;  3MEF A;  2PMD A;  3OZW A;  1JA0 A;  3CCJ A;  1N33 L;  2DNC A;  1PV4 A;  1EZ6 A;  1N05 A;  2M00 A;  4HSV A;  2UUC Q;  5JBQ A;  2A6H C;  3P20 A;  1BQE A;  1R5O A;  1Y0Y A;  5IWA L;  4DUZ L;  1JE4 A;  4PAA A;  4IOA A;  4FP5 D;  2JA5 G;  1TS5 A;  1X65 A;  2VBU A;  4JVZ A;  2CFM A;  4ALP A;  1X3F A;  4O2D A;  4DV1 Q;  3Q39 A;  4J8Q A;  3CPW B;  1VQG A;  4J0Q A;  1WOC A;  3NQT A;  4ME5 A;  4XOP A;  1T5X D;  1LTT D;  5D3I B;  4K6L A;  3J80 c;  3ZZ0 A;  1PFM A;  3A56 A;  3IAY A;  2BM0 A;  5FK9 C;  1L1O A;  3KLS X;  4IUP A;  3WBK A;  4K8J A;  2QDB A;  4ME3 A;  1SDF A;  4A93 G;  1B7Y B;  4Y9U A;  3OE7 A;  2E2J H;  4OIJ A;  2HCI A;  1HNZ L;  3ASQ A;  3CPW A;  5I9O A;  2H4O A;  4NXM Q;  3U2Q A;  3L2P A;  2HMA A;  1F9Q A;  2HDN B;  1XTC D;  1N0U A;  3JQR A;  3M4Y A;  4J15 A;  5HZA A;  3BVG A;  1NR4 A;  3D0F A;  4X62 L;  2OBT A;  5IGB A;  1CUK A;  5M5W H;  2E2H H;  3CCQ B;  5IP9 H;  2VQE Q;  1IYV A;  2NUC A;  2WZN A;  5E1F A;  3CD6 B;  2C9O A;  2NYZ D;  3HAG A;  2VY3 A;  2DGY A;  1WFQ A;  2RC5 A;  4NXN Q;  2DN8 A;  4YCW A;  4DV3 L;  4A3I G;  3HKZ E;  3ERO A;  1K8G A;  4HE6 A;  2WB1 G;  4DR7 Q;  5DM7 3;  5JOB A;  2MJ8 A;  1VQ4 B;  3CCQ A;  1XWE A;  1MJE A;  4DPG A;  1BBX C;  1EU3 A;  1Q9S A;  3P75 A;  3TN2 A;  2E2J B;  1SAP A;  1YLO A;  3HOW H;  1DD2 A;  2L12 A;  3CD6 A;  2EYJ A;  5LMN W;  1FNV A;  3NUC A;  4KK7 A;  3PF4 A;  1P16 A;  1KK0 A;  3V05 A;  2HQL A;  2JK8 A;  4ZCI A;  3QFT A;  1GO3 E;  3GTQ H;  4Z4W A;  2E2H B;  5M5W B;  3EQL C;  1VQ4 A;  5IP7 G;  1SYG A;  3GDE A;  4P71 A;  2B2T C;  3PO2 G;  5A35 A;  1U2R A;  4JBJ A;  2XZP A;  3E9H A;  3RD4 A;  2EYH A;  1OO9 B;  1KDC A;  4NB3 A;  5C5M A;  3BCD A;  1D5Z C;  4KKS A;  4QB4 A;  4P6Y A;  4IO9 A;  2RSN A;  1H9M A;  2AQ1 B;  3T13 A;  3HOW B;  5EPK A;  1PH4 A;  1T6Y A;  2K05 A;  1HH2 P;  3CCS B;  3MXU A;  4DR5 Q;  3GTQ B;  2D9U A;  3CAM A;  4LW1 A;  5F4O A;  1LTI D;  5KYI A;  2NZO A;  3GTP H;  4GOP B;  4MHE A;  5FOB B;  5C0X I;  3PUM A;  2O5I C;  3AST A;  1K28 D;  1I8D A;  3STB D;  4KHZ A;  1NNX A;  4CKE A;  1CFM A;  4DU9 A;  1S5E D;  1GKH A;  1QE6 A;  1T6X A;  3ND8 A;  1STB A;  3CCS A;  4RDK A;  1XB2 A;  2F4V Q;  2IY5 B;  1CSQ A;  4B44 A;  3K5O A;  4KD3 A;  1G2T A;  3JC6 6;  4RCN A;  2L15 A;  1U5K A;  3TP6 A;  4A3G H;  4X05 A;  2MP1 A;  4IUN A;  4G4K A;  4DR1 Q;  4GOP A;  1ZM4 A;  2BH2 A;  3OP1 A;  2D2C C;  2LKV A;  1IBL L;  1BLI A;  2YWE A;  1OGJ A;  1LLR D;  1X55 A;  2B7B A;  2DUD A;  1JWM D;  2ASB A;  1WD0 A;  4DV4 L;  1UE5 A;  4C43 A;  1UD8 A;  4C3I G;  3H91 A;  3GIR A;  3BY1 A;  1SYF A;  3G05 A;  4LAA A;  4DK6 C;  1VQE A;  2EYF A;  3GTP B;  1JE5 A;  1SMX A;  3PCO B;  2E2I H;  1MKH A;  3FKI G;  1WYD A;  4B3M Q;  4OPS A;  3CCE B;  1J8I A;  5M3M H;  1KAB A;  2HD3 A;  4WJ4 A;  3OEH A;  1ENA A;  4A3C H;  3W2I A;  3ULJ A;  5C4X H;  1EYA A;  4A3G B;  2BDN A;  3K5M A;  5C4Z A;  4HMJ A;  4UZF A;  3S1Q H;  1UEA B;  1IYJ B;  2E8G A;  4AYB B;  3T1H L;  1ILP A;  2GRE A;  3I2Z A;  2CQO A;  1BF4 A;  1TWH H;  3ERS X;  1CKN A;  1HA3 A;  2EOT A;  2PNH A;  2E2I B;  3WBJ A;  3H0G G;  5ELD A;  3E0J A;  5M3M B;  1BCP D;  2C2W A;  5A88 A;  2F1M A;  2AMC B;  2N88 A;  5EPJ A;  2D74 A;  2NV4 A;  5C4X B;  2W6J A;  4Y52 H;  4RKL A;  5TSS A;  1GM5 A;  5AN9 A;  1HR0 W;  3OSO A;  1ICW A;  4TMV A;  1NR2 A;  2JXM B;  5M5X H;  1TVX A;  4BA1 I;  3S1Q B;  3HOX G;  2V7U A;  5DNF A;  2PQA B;  1Y1W G;  4E6I A;  3F2C A;  2B2T A;  1STE A;  4H13 C;  2RCN A;  5ELN A;  4WJW A;  4RKB A;  2QKI C;  1YIJ B;  4X0C A;  3ZBT A;  1PDQ A;  1Q81 D;  1PZJ D;  4LBY A;  4QMG A;  1TWH B;  3SXH A;  4V19 0;  2IX0 A;  1F9S A;  2D9R A;  2R6G A;  4R4T A;  4CJ1 B;  2PQA A;  1A63 A;  2EQS A;  4XR6 A;  4BBR G;  4XD7 A;  3LQ6 A;  5HY6 A;  3P26 A;  3AQQ A;  4ZCK A;  4IFD G;  2QTL A;  2ZTG A;  1K8O A;  2ZZG A;  1YIJ A;  3RZO H;  3QOL A;  2YWG A;  5M5X B;  3CCU B;  3HKZ B;  3R2I A;  1A8P A;  1IXR A;  1W2B A;  3FMC A;  3U58 A;  4OON A;  2NTT A;  1WD1 A;  5DS0 A;  1N32 L;  2QA4 B;  1XNQ Q;  1EQT A;  1QG0 A;  4F7D A;  3U6K A;  4OWW B;  1Q90 A;  2XNC A;  1ZEQ X;  4BXX G;  2K75 A;  1SN8 A;  3G7L A;  5JPN C;  3K58 A;  2UXB Q;  5D14 A;  3ZBU A;  4XLE A;  4LFB Q;  3I4M H;  4JI5 Q;  2BGJ A;  3B8H A;  3CCU A;  4N8X 1;  4XQN A;  5JJL A;  4UHV A;  4U9U A;  2B29 A;  3QJY A;  3AU7 A;  4TVA B;  4RLZ A;  1KK3 A;  4JBM A;  5C44 H;  2QA4 A;  1W6J A;  1EZ8 A;  1SKQ A;  1S3O A;  3P1H A;  4JI3 Q;  1ZM9 A;  1G7C A;  2ZM6 Q;  1UUP A;  2VL6 A;  4PZ6 A;  4QJF A;  3RZO B;  1H95 A;  1XPU A;  4L5R C;  4BY7 H;  2XSC A;  2KHJ A;  2IT1 A;  2C77 A;  3FJO A;  1QFJ A;  4RD6 A;  1KC8 D;  3QO2 A;  5KIX A;  2PPB C;  2BM1 A;  2LZJ A;  4ZGN B;  1ET6 A;  2N55 A;  2KCT A;  4DR3 L;  3G71 B;  1WTO A;  1D5X C;  5CV4 A;  3I4M B;  5K5P A;  2EJG C;  4OOV A;  1E62 A;  1OHH A;  4C56 C;  4DXF A;  3TQY A;  3FKS A;  4XN3 A;  1KLG D;  1O78 A;  5C44 B;  3S1R H;  1IBM Q;  1JOR A;  3DM1 A;  3DWQ A;  5J3O A;  3AGP A;  5EAY A;  3NK9 A;  3GQB A;  4UP9 A;  4JI8 Q;  2BDO A;  2DJF C;  2ZL5 A;  5GAD C;  2R6H A;  2F0O A;  1YHA A;  3D26 A;  1FRQ A;  4I65 A;  4BY7 B;  2F4N A;  3QOJ A;  1YNJ D;  4Z4Y A;  1A3V A;  3M3Y H;  1Q7Y C;  3R2T A;  2ZJR A;  2OYN A;  2A74 C;  2EYP A;  2XNJ A;  1AE2 A;  4A3K G;  5ELE A;  2ICI A;  4X3U A;  4A3J G;  2F0S A;  5FKA C;  4OO1 H;  4M8A A;  2SNM A;  3K5L A;  1PH3 A;  2VNK A;  2K28 A;  1K73 D;  5J35 A;  1NRK A;  3S1R B;  2HLD A;  4TRD A;  1L0W A;  1FNU A;  2MQH A;  3GP7 A;  4XOT A;  4IPG A;  5COR A;  5DSZ A;  1WTH D;  3V96 A;  4LF5 Q;  2XOK A;  3A8J A;  1TR5 A;  2FIN B;  2WKD A;  4IOC A;  4GNX B;  4DR6 Q;  1OGI A;  1V43 A;  3M4Q A;  1GUG A;  4CDE C;  3ND9 A;  3M3Y B;  2WYR A;  2IX1 A;  3OTO L;  1A8V A;  1VQM A;  2ZL6 A;  3J7Z C;  4XMY A;  4XQQ A;  5H1S E;  4RM0 A;  1B1Z A;  2GJR A;  3J81 k;  1PTO C;  2EJF C;  3Q3A A;  2FJ2 A;  2HCC A;  5ELO A;  2EPB A;  4UAI A;  4J6H A;  3K8A A;  4GNX A;  1HZB A;  1TVC A;  1D8L A;  2E74 C;  2GN5 A;  4CBV A;  3N6R A;  3DXJ C;  1Q3L A;  2CW0 D;  2RSO A;  3CQZ H;  3NQI A;  4RGO S;  1E1O A;  3L3O C;  2FFK B;  2UUC L;  1EU4 A;  2OQK A;  1I94 Q;  2PMZ E;  3J81 c;  1HCZ A;  1Y8P B;  4HN7 A;  1ZUN B;  4P3Y A;  1EWY A;  1L0X B;  2WB1 E;  2WFW A;  1EIY B;  2RHS B;  2F0F A;  3U6B A;  3A55 A;  4WOR A;  2GK6 A;  4DV1 L;  4DA2 A;  4WRD A;  4R8I A;  4DV0 Q;  2CCZ A;  3M4O H;  2F0G A;  3I4L A;  1OXV A;  1WSV A;  1D8T A;  4PAB A;  1WCM G;  5FLX L;  2NVT H;  3VYU A;  4F87 A;  4UAJ A;  3I4N G;  4DNI A;  1EP3 B;  4PC7 A;  2CC2 A;  1IJE A;  3M4P A;  1SMY C;  1C7Y A;  1RQR A;  3I7F A;  1N8R C;  4JV5 Q;  5EJW A;  2RDG A;  4NXM L;  3CQZ B;  2AWO A;  3SLD A;  1YJW B;  3RLN A;  4A3E H;  2F52 A;  4A3M H;  3R6J A;  3JU4 A;  1UE7 A;  5BN4 A;  3GTJ B;  2OK7 A;  1QCB D;  2BA0 A;  2VQE L;  1FD7 D;  2D62 A;  1I3Q H;  3TS2 A;  1W0K A;  2W6I A;  4MNO A;  2C4T A;  4P74 A;  1VQJ A;  4NXN L;  3UDF A;  1VMC A;  5IYQ A;  3LQE A;  3M4O B;  1XQB A;  1ASZ A;  4R4I A;  4LF8 Q;  1BX1 A;  1YJW A;  4YEJ A;  1A3U A;  3SK4 A;  5C4J H;  3FDT A;  2A6E C;  4JI4 Q;  1X3G A;  2C4U A;  1VQ5 B;  3TBI B;  4DR7 L;  1MJC A;  1NJI D;  2NVT B;  1ESR A;  2R9V A;  1GVP A;  4LF4 Q;  1PRT B;  1C4Q A;  3SR1 A;  2JSO A;  1MI2 A;  3HOV H;  4WWV A;  1OB2 A;  4RCO A;  4II2 A;  5H59 A;  3T16 A;  1N0V C;  2WJY A;  4A3E B;  4A3M B;  1V1P B;  2QN6 A;  2I5L X;  3L7Z C;  4G7H C;  1VQ5 A;  1V0F A;  3MZ5 A;  3SK8 A;  5K36 G;  1O7I A;  3CU7 A;  3OYY A;  3RN5 A;  1I3Q B;  4A3L H;  4TN1 A;  1STN A;  1HVX A;  4R4O A;  2CH4 W;  3NWS A;  1V1O A;  4PC6 A;  5IGE A;  5C4J B;  4XOR A;  4YWM A;  4RWS C;  5ELB A;  1B70 B;  4KV6 A;  3ASS A;  1LTB D;  1QVC A;  2RDH A;  3LVB A;  2EIX A;  1B50 A;  1B23 P;  4OO1 I;  1UD3 A;  2JA5 H;  3HOV B;  3BH4 A;  4XKV A;  4XON A;  4UP8 A;  1ZM3 A;  4Z1M A;  2PCF B;  1HPC A;  3VR5 A;  1LTR D;  4DR5 L;  4RAU C;  1RTO A;  1F60 A;  5FNZ A;  4JOI C;  5KNL A;  1QWY A;  2F0T A;  4JI7 Q;  1TII D;  3H94 A;  1KRH A;  2PQE A;  5FA6 A;  2HT1 A;  3AVV A;  4GN3 B;  2WAQ B;  4A3D H;  2RDF A;  3OEE A;  4A93 H;  4DV2 Q;  1JJ2 B;  2QEX B;  3K5N A;  2F4V L;  2J7Z A;  3CC4 A;  3UDI A;  3BQJ A;  4FXU A;  3U50 C;  1X32 A;  1FNB A;  4I7A A;  1EFT A;  5C0X J;  2WKC A;  3PF5 A;  4DR1 L;  1BX0 A;  3L9A X;  3TSS A;  4NP5 A;  5GV7 A;  2DER A;  1BOS A;  2JA5 B;  1GUW A;  3WQZ A;  3U9O A;  2QEX A;  4LFC Q;  1K8A D;  3UDG A;  4HIZ A;  4P2N A;  1LO5 D;  4Z4V A;  2ES2 A;  2I5H A;  1M8A A;  2V7Q A;  5M3F G;  4A3I H;  4H44 C;  2VBV A;  1B9N A;  4B3M L;  3E20 A;  1Y1V H;  4A3D B;  1L1O C;  4A93 B;  1XTD A;  4MN3 A;  1K9M C;  2X8K A;  4JMQ A;  5E7N A;  1HZA A;  2WPD A;  4QVA A;  1XPR A;  1WTX A;  3ER0 A;  3O13 A;  5FLM G;  1GUS A;  3NSW A;  1VF7 A;  1HQR D;  4X06 A;  1JOO A;  3ES9 A;  5D65 A;  4X6A H;  1QUE A;  2XIW A;  3FPU B;  1O7Z A;  2ZBV A;  5COY A;  3E3X A;  4ROX A;  2LSS A;  1VQ6 B;  1PXU A;  4KLK A;  1XE1 A;  5IGD A;  5IP7 H;  3WYA A;  3KF6 B;  3OAA A;  3I90 A;  4MIU A;  3STB C;  5HKK A;  3RR5 A;  4A3I B;  3VMF A;  1WP6 A;  2PMZ B;  1SYC A;  2TMP A;  3BZD B;  2WB1 B;  4BY1 H;  1CI3 M;  1Y1V B;  4L8J A;  1NB9 A;  1CHP D;  3S24 A;  1VQ6 A;  1PMR A;  2NTS A;  3VNU A;  3KF6 A;  3UE0 A;  2YWH A;  2BA1 A;  2V7V A;  3CES A;  4S3S A;  5GV8 A;  4RGT A;  1E1R A;  4ZK9 B;  3W2G A;  2F43 A;  1SLJ A;  1VJS A;  1ICF B;  1KAW A;  2HCJ B;  1TWF H;  4TSS A;  1HXY D;  4KMU C;  3CKI B;  3RLO A;  1W35 A;  5IY0 A;  2ZZF A;  4P25 A;  3IRB A;  2ZTD A;  3E9I A;  1ILQ A;  4UZU A;  1DG1 G;  2XEX A;  1NUC A;  3I56 A;  3OWE B;  2KEC A;  2JJ2 A;  4KHP Q;  4DV6 Q;  4OGQ C;  1CKM A;  2JJ1 A;  4X66 Q;  5C0X H;  4BY1 B;  1QUF A;  1ZYR C;  3FVQ A;  1FDR A;  4YCU A;  1HJP A;  4KD4 A;  5G3L F;  1CNF A;  1CSP A;  3Q6Q A;  2DJG C;  5GAE C;  2B5O A;  3BYY B;  2C5B A;  5F4M A;  1M1K D;  3D3R A;  1LT5 D;  4A3B G;  1S5C D;  5E3F A;  1TWF B;  3J81 E;  2UUA Q;  5KNB A;  3JAM c;  2SOB A;  4ACB A;  3I70 A;  3FPK A;  4ILW A;  1XNQ L;  2R7Z H;  3W5U A;  4AYB E;  2KEE A;  2VW9 A;  3A35 A;  4QGU A;  4HJ5 A;  1W87 A;  2XZO A;  3MA2 B;  1QFY A;  2CHB D;  2UXB L;  3W1B A;  2JA9 A;  2E75 C;  4LFB L;  3Q22 A;  1DAR A;  4IN3 A;  2VJJ A;  4JI5 L;  4DXG A;  1UEB A;  3N52 A;  4P9S A;  2AUK A;  3SGI A;  4EVO A;  1L1O B;  1IKL A;  1E2V A;  1AN8 A;  1RHP A;  1IHZ A;  2OTJ A;  1QZH A;  4JI3 L;  3B78 A;  4GOP C;  3DEO A;  1YJN B;  2ZM6 L;  1KTK A;  1AP0 A;  1LT6 D;  3A5U A;  1S4M A;  5CV7 A;  1PFN A;  2IHE A;  2NN6 H;  5DN6 A;  4LWC A;  4J1M A;  1N07 A;  2OBR A;  4CDC C;  5TRD A;  2DY7 A;  2PZT A;  2R7Z B;  1S5F D;  4FF4 A;  2OTL B;  2X0K A;  1A15 A;  3H0G H;  4B48 A;  2QDX A;  1YJN A;  3WND A;  4F7X A;  1KRS A;  2VNH A;  1N08 A;  4IJL A;  4X7F A;  1PTO F;  3GO5 A;  5NUC A;  1NDH A;  2VNU D;  2BH8 A;  5LMZ A;  1QB5 D;  5E4W C;  1YIT B;  1E0B A;  2XNA C;  1IBM L;  1DDI A;  3AFQ A;  1PH7 A;  2CQA A;  2NBF A;  4MTK A;  2OTL A;  2I07 B;  1QOH A;  1Y1W H;  1CNE A;  5JEA J;  1K28 A;  2K5N A;  1AZP A;  1K3R A;  4JBK A;  1I4G A;  2KED A;  3MC0 B;  4JI8 L;  4U68 A;  3J80 i;  3A3G A;  5I2X A;  2R93 H;  4FO2 A;  5T1I A;  2Z6B D;  1OXT A;  4Z4U A;  1NCV A;  1YIT A;  3MXN B;  1F9P A;  3H0G B;  2BOS A;  3C2Q A;  1RDP D;  2X6X A;  4QUF A;  4FK8 A;  4BBR H;  4IFD H;  4PC3 A;  4MYT A;  1D1I A;  4LK1 C;  2C5H A;  2OCE A;  1UD5 A;  4LBW A;  5BR8 Q;  2F3I A;  4IW3 B;  4ID6 A;  5EMN A;  2ZIT A;  1EWC A;  2DY1 A;  1Y1W B;  3MXN A;  1Q12 A;  2F0D A;  1JOK A;  3T1Y Q;  3QR8 A;  4RPD A;  1EY9 A;  4QUZ A;  4BXX H;  5F2D A;  2R93 B;  1CT1 D;  4DNT B;  4IUR A;  1Q82 D;  1DCZ A;  4LF5 L;  1VQ9 B;  3DLL A;  3EFX D;  1KQS B;  5BSY A;  1PJ5 A;  4DR6 L;  1X3E A;  3OKX A;  4ZKC B;  4PGO A;  4EH1 A;  1V8Q A;  1H8E A;  1BCP B;  5ELF A;  2XGT A;  2YTY A;  4BBR B;  2ZBU A;  3S2H H;  4QV2 A;  3OJX A;  3T56 B;  1SBB B;  3ASP A;  1VQL A;  2V7T A;  1HFG A;  1TWG H;  4EQO A;  1VF5 C;  2IJ0 A;  1I4X A;  1S5B D;  3URY A;  1ELO A;  1DON A;  1G2S A;  1K0R A;  2R61 A;  3G6E B;  5CYU A;  1VQ9 A;  3BCF A;  1KQS A;  4LUZ A;  2F3W A;  5I6Y A;  4OIK A;  2CRV A;  3AVW A;  1YNJ C;  3EA6 A;  5C3E H;  2F0J A;  1PYB A;  2XZL A;  1I5F A;  5CGK A;  1HTP A;  1E2Z A;  2X6G A;  3DDY A;  4CDF C;  1I94 L;  3WOE A;  1R4Q B;  4R9W A;  1SJE D;  3G6E A;  2PW5 A;  4QIW E;  2WR8 A;  3LWE A;  4DV5 Q;  1HTL D;  1KIX A;  3RLF A;  1Z7T A;  2LY7 A;  2Q8I B;  1K73 C;  2FX3 A;  3RUZ A;  4OXP A;  4ZUJ A;  5IE8 A;  3S2H B;  4UDU C;  4DV0 L;  5JEA H;  1TWG B;  3ERQ A;  4RJL A;  2QGQ A;  1W3S A;  1XYI A;  4LBV A;  2A5H A;  4C3J G;  3A8J E;  5IOC A;  4DKA C;  1KAA A;  4AF7 A;  1VQI A;  5C3E B;  3KJP A;  1WU8 A;  3CB4 A;  2Z9H A;  5JVG 3;  5IT9 E;  4JV5 L;  4QVJ A;  1N9W A;  2EFG A;  1YI2 B;  1EWI A;  2Q2U A;  1M90 D;  2BE5 D;  2HUG A;  4R1J A;  1JMC A;  4YEL A;  2RVL A;  4QY7 A;  4A3K H;  2KHI A;  4ZCL A;  4A3J H;  3H15 A;  4RPB A;  1CKN B;  2L4N A;  5LMN Q;  1STA A;  2NN6 I;  5IYW A;  4IPD A;  1IJF A;  4TMT A;  3FRP B;  2Q2I A;  4FVM A;  4LF8 L;  1YI2 A;  4ZCM A;  4KN4 C;  1BPL A;  1IBK Q;  3AMU A;  3QFC A;  4JI4 L;  3CPX A;  4JCV E;  1J9Z A;  3LGJ A;  1U0L A;  3F8T A;  1X54 A;  4B08 A;  4LF4 L;  1CQV A;  1LT4 D;  2RC6 A;  5AJ3 Q;  5IK2 A;  4YY3 Q;  2OT2 A;  3U4V A;  1VQH A;  4X3K A;  1W34 A;  2VQF Q;  2B7C A;  2MGS A;  2A73 B;  3I3C A;  2F0K A;  4RCY A;  5FO8 B;  5C5L A;  4A3K B;  1BXT A;  4A3J B;  3S16 H;  1T6Z A;  4WZK A;  4IUU A;  4OEM B;  1O7Y A;  1V1Q A;  1EWH A;  1TUI A;  1Q86 D;  1ROD A;  2HIX A;  2KOL A;  2G9D A;  4RG1 A;  2OXP A;  4O42 A;  4RD2 A;  1VMP A;  4NBS A;  3JAM E;  2JA6 G;  1U4M A;  1JJC B;  4IFD I;  2V7W A;  1W2B B;  4IPH A;  4XLA A;  3FHW A;  4XYQ A;  1GHJ A;  3D8G A;  4Y7N H;  1ESF A;  2PNR C;  4JI1 Q;  1HNW Q;  1WOP A;  3S16 B;  1P4M A;  5TY0 A;  1I6V C;  2B2V A;  2CVR A;  1EOV A;  2Z0S A;  4JI7 L;  1NTG A;  1G6P A;  1WCM H;  1NJI C;  4KJN A;  1ENF A;  2TSS A;  4ACA A;  1QG7 A;  3I4N H;  3NBI A;  4DV2 L;  1KHI A;  4GNX C;  1KMH A;  1Z6H A;  1E2W A;  1QNU A;  1NMG A;  3W2F A;  4A4I A;  4PZ8 A;  5LL6 X;  2B2Y A;  5BN5 A;  1PH2 A;  3HOW G;  1DOM A;  3IFT A;  2J0T D;  1J5E Q;  2F3V A;  3NEL A;  4X8I A;  3QE2 A;  1NB0 A;  2GJK A;  3ZIA A;  1AMO A;  2C5C A;  1IW7 C;  4RFB A;  3HOU G;  1VQF A;  5KNC A;  4Y7N B;  4DAY B;  4X3S A;  4LFC L;  4DR2 Q;  4Y9R A;  3V76 A;  1YZ6 A;  2JA8 G;  3A3B A;  4XLF A;  3ZUG A;  1EYD A;  1SE2 A;  3HS0 C;  2GVB A;  5IYC H;  1WTH A;  2WSS A;  1U4R A;  3X3N A;  2DYI A;  1WCM B;  4O1N A;  1WTQ A;  3CC2 B;  1TKW B;  1VS0 A;  2EE1 A;  3I4N B;  1A62 A;  3RZD H;  1XNR Q;  2CF4 A;  4TT3 A;  4DAY A;  1EIH A;  4BWG B;  1PA6 A;  5FIU A;  4E0F A;  1FR3 A;  3CRK C;  1YX2 A;  4I7Z C;  1GAQ A;  3V7A A;  2V7X A;  2VUM G;  2JE6 I;  1ASY A;  2FMC A;  5CBA E;  1VQ8 B;  3CC2 A;  4Q7J B;  1X9N A;  5K36 H;  1ZM2 A;  3BDL A;  2DEU A;  1COW A;  1HR0 Q;  2UUB Q;  4G7X A;  3M7N A;  2EY2 A;  2CWA A;  1UD6 A;  2BF4 A;  2CKZ B;  4HJ8 A;  3L0O A;  1K0S A;  4N8F A;  4UY8 C;  3M85 A;  4H0L C;  2O5J C;  2N78 A;  2JQO A;  4RD1 A;  3IKJ A;  4A76 A;  2D5D A;  4WZE A;  1NY4 A;  2OK8 A;  5CV8 A;  4GN4 B;  2OF1 A;  4OP7 A;  4QIW B;  3RZD B;  1VQ8 A;  2PIA A;  3PO3 G;  2WAQ E;  2VYQ A;  4UPA A;  3QG1 A;  2X85 A;  4XIG S;  1STY A;  3MMP A;  2PW7 A;  4YWL A;  4TMW A;  5IYD G;  5EQ0 A;  3SDZ A;  4U67 3;  1KRT A;  1UD4 A;  1KZL A;  2QEJ C;  4JW0 A;  4P75 A;  3PGZ A;  1DZ1 A;  3G6J B;  2BMW A;  3SHL A;  1FX0 A;  4PMC A;  3KK7 A;  1GUN A;  3QB3 A;  3AYH B;  1G8Z D;  2B39 A;  1VQM B;  3BC9 A;  3C46 A;  1PRT C;  2QTZ A;  2B63 G;  1HQM C;  3BJU A;  4OHJ A;  4P73 A;  3HEJ A;  1SXT A;  2H1E A;  4KHP L;  1N06 A;  3E5S A;  4YWK A;  1DDG A;  4DV6 L;  4B4D A;  4A3C G;  4X66 L;  1NBM A;  3CCV B;  1BKB A;  2L11 A;  4P72 A;  4FXK C;  3S2D H;  5FL7 A;  3W5V A;  3TP5 A;  3HP3 A;  1UE1 A;  3NP8 A;  5IYB G;  3J80 L;  3K59 A;  1SND A;  1VQO A;  5FO0 A;  3HG9 A;  3PUV A;  1ZXT A;  5HXB A;  3OIP A;  1TU2 B;  1X56 A;  1R9T H;  4HCE A;  3CCR A;  2UUA L;  1S4Z A;  4RGN A;  3SEJ A;  3R93 A;  2WJV A;  3CCV A;  3NHH A;  1CHQ D;  5CC4 A;  1FL0 A;  2VS1 A;  1WDT A;  4X7D A;  4RDL A;  2AUJ D;  1T5E A;  1FJG L;  4M2L A;  2EVB A;  1K3B C;  2WII B;  4EX5 A;  4F8M A;  3ZZT A;  5A2Q E;  3BDO A;  1FGB D;  1IL8 A;  1EIF A;  3GTM H;  3I72 A;  1BMF A;  1SJH D;  2F0I A;  1RKN A;  5FLM H;  3E1Y E;  4YAL A;  1JQY D;  1PFS A;  5CR3 A;  3S2D B;  5BSX A;  4QUC A;  1XJV A;  3K81 C;  2P3M A;  1AFP A;  1C0A A;  4M1K A;  2DY8 A;  1Q1B A;  3K7A H;  2CW5 A;  1EXM A;  1R9T B;  4K2K A;  2ALY B;  1NMF A;  1GXD C;  1UMK A;  2ICE C;  3ULL A;  4HED A;  4QF4 A;  4NNJ A;  4C3H H;  3KJO A;  4K14 A;  2PZW A;  5EGT A;  1W9X A;  1ML0 D;  3W2D A;  1UD2 A;  4RH6 A;  2CH4 A;  2ZXI A;  4K5W A;  3P7J A;  4JPB W;  3WNB A;  3GTM B;  1RD9 D;  3DMU A;  3EVQ A;  4RD0 A;  3BZC A;  1CA5 A;  4GQN A;  2CND A;  1MRZ A;  1QGY A;  4C2M H;  3ONY A;  3KDF A;  1YVC A;  3TME A;  4AVZ A;  1M4V A;  1T9H A;  2RBM A;  1DXM A;  3EN2 A;  1E3P A;  3K7A B;  3CF5 A;  4MZ9 A;  1EFR A;  1FRN A;  2K32 A;  3FPP A;  5L37 A;  2Y0S G;  1GD7 A;  4C3H B;  5GRO A;  5LMU Q;  1MIU A;  1QVG A;  3AVU A;  4H9G A;  3IFD A;  2QMU A;  3GD7 A;  3WWV A;  4GKK Q;  4R4C A;  3AB9 A;  2AHO A;  2OEO A;  4XTC S;  5KYL A;  4G7O C;  2M9V A;  3VA5 A;  4X64 Q;  3PUZ A;  2UXD Q;  2VZL A;  2EIF A;  3Q6S A;  2A1A A;  4LC0 A;  2WAC A;  4DAM A;  1EP1 B;  1EFU A;  3S1M H;  3RMH A;  4A3B H;  5BR8 L;  2VNI A;  4GLV B;  5ELC A;  1A3T A;  4NMZ A;  3PUX A;  4K5V A;  4C2M B;  2UXC Q;  3VYS A;  1S5D D;  2C35 B;  2NB0 A;  1WTR A;  3T1Y L;  1ONL A;  4B3S Q;  2JA7 G;  3KLR A;  2RCF A;  3EIV A;  4CJ0 B;  1D5M C;  4KN7 C;  1ZKO A;  2B2U A;  3MVV A;  3H9N A;  3QWN A;  4KKT A;  4R71 A;  3AVT A;  3SLN A;  3HGB A;  3MFY A;  4B47 A;  2BGI A;  1V0E A;  3CC7 B;  1XMO L;  3PIO A;  2QE7 A;  3R8B A;  4EQN A;  4IAL A;  1HA5 A;  3CC4 B;  3C1F A;  3S1M B;  1E24 A;  4A3B B;  2R7F A;  2L9H A;  2NZ1 D;  2KJX A;  4ASU A;  4CGY B;  4HSP A;  3IL8 A;  4YAW A;  1LTS D;  5FO1 A;  4PV1 C;  1LYL A;  3MAQ A;  3CC7 A;  3GVJ A;  2X53 S;  2A19 A;  3OMC A;  4DV7 Q;  3Q0A A;  2K03 A;  1U4L A;  4DR4 Q;  2VB3 X;  5JJK A;  1KK2 A;  2X6L A;  4DV5 L;  2BSA A;  3J7A F;  4OO1 G;  4LMQ D;  2EY1 A;  4LBZ A;  2A8V A;  4XLC A;  4N3N A;  4N9P A;  3MHP A;  1KL9 A;  5J3B A;  4DK3 C;  1VQC A;  3OZV A;  1DYQ A;  2JP1 A;  2IWH A;  1PHJ A;  1CTM A;  2KA7 A;  3SJZ A;  2IW3 A;  1MD2 D;  2HDL A;  2XRQ D;  4C0S A;  3VYR A;  1ENC A;  1I18 A;  3G48 A;  1GHK A;  2NVY H;  2B8G A;  1B9M A;  4JI2 Q;  3KOJ A;  3BVM A;  3I1F A;  4LFA Q;  1SNO A;  3HKS A;  2GQF A;  1XFO A;  2XND A;  3OMG A;  4L63 B;  4ZAI A;  1HZE A;  4CKC A;  5LMN L;  4TMX A;  3M7G A;  3CRL C;  3EBE A;  4L5T A;  5IGG A;  4WFN 3;  3MTS A;  4B3R Q;  3W5H A;  2VB2 X;  2A69 D;  1E1T A;  5IT9 c;  1KDB A;  5IYR A;  1OB5 A;  1Z47 A;  5M9O A;  2K5W A;  1CA6 A;  5BN3 A;  1IBK L;  1YNN D;  3BY2 A;  3PO2 H;  4CHT B;  3RNU A;  3JQP A;  5IYN A;  2E2D C;  4QCL A;  2PLF A;  3LWU A;  2L5T A;  5AJ3 L;  4YY3 L;  2NVY B;  3PIO 3;  4RD3 A;  1B2T A;  2VQF L;  2V31 A;  1CZW A;  3ONU A;  1MAB A;  4OOX A;  1Y8N B;  3DHQ A;  3I8Z A;  4FF1 A;  4FNF A;  3PV0 A;  2I46 A;  2RKS A;  3AGQ A;  1D2B A;  3HZX A;  4K0K Q;  3I56 B;  4DK1 A;  2MO1 A;  3BNW A;  3KF8 B;  5GAG C;  2JJQ A;  3C3L A;  4P1V A;  1PZK D;  3A0J A;  3HOY G;  3GTG H;  1FGU A;  2CK3 A;  1YEZ A;  3F2D A;  3F2B A;  3S17 H;  3TP7 A;  3PO2 B;  3D4D A;  3CTA A;  4Z4R A;  3ZYY X;  2BE5 C;  1M90 C;  4GLX A;  3Q24 A;  4OEL B;  4KJO A;  4FWT A;  3TZU A;  2L1B A;  3KF8 A;  3FEW X;  3C2P A;  5L46 A;  1NAP A;  2RF4 A;  3D4R A;  3BU2 A;  2K5V A;  2BCO A;  1F9R A;  2Q6L A;  1HZC A;  4JI1 L;  5J22 A;  5J39 A;  5DM6 3;  1PH1 A;  1HNW L;  2E5L Q;  1A6X A;  1QGA A;  4P12 A;  1GOZ A;  1S0U A;  3E6Z X;  1PVO A;  4IFD J;  2R92 G;  1KD1 D;  3J7A V;  2K04 A;  3NPP A;  3J7Y W;  2Z6B A;  4C3I H;  3ZZU A;  3A8K A;  5EKK A;  4FF2 A;  3C1E A;  1EEI D;  4C3J H;  4B3T Q;  3ISX A;  3GTG B;  2OTJ B;  2HIV A;  2K33 A;  3CPF A;  3RY8 A;  1E63 A;  3K0X A;  3FKI H;  2MNA A;  3PMF A;  1SYB A;  1WPC A;  1BCP C;  3S17 B;  2QIL A;  1N8R D;  2ZTC A;  5CMD A;  1J5E L;  2ATW A;  5FJ8 G;  5IYP A;  4BBS G;  1QIL A;  5EBC A;  2HHH Q;  3CP2 A;  1R5N A;  1UAP A;  2LFN A;  4IQZ A;  1PRT F;  1F20 A;  1E7Z A;  4F88 A;  1L0Y B;  4DR2 L;  4G1B A;  2D3L A;  2OBS A;  1WTV A;  2WV6 D;  2AQ3 B;  3GV3 A;  1VQA A;  3A7L A;  4A3F G;  1Q86 C;  1ET9 A;  4BPR A;  1MHW C;  2F0W A;  2KEN A;  1E79 A;  3Q23 A;  4EQ5 A;  4C3I B;  4GKJ Q;  1STH A;  4M4S A;  3H09 A;  4C3J B;  1Q81 C;  1BUV T;  4JC0 A;  1D6E C;  1XNR L;  1XPO A;  2A6E D;  2B2W A;  3FKI B;  5A8A A;  2KQ3 A;  5FO9 B;  5M5Y H;  3AVY A;  4YHH Q;  1TY0 A;  1IHM A;  3H3V H;  1EY5 A;  3SJP A;  4OPV A;  3CXC B;  3A8I E;  1SE4 A;  3NEM A;  3PIP A;  1WOO A;  2KHS A;  1HR0 L;  1QVF B;  5CV9 A;  4HR7 B;  5J1Z A;  2UUB L;  4AQY Q;  2UU9 Q;  3HOX H;  5KRU A;  2EDG A;  3PUW A;  5IGC A;  2X6W A;  3OJW A;  2B3G A;  3SKB A;  1FNC A;  2K6A A;  4M53 A;  4MYU A;  5C3W A;  4A3D G;  3CP8 A;  2O4X A;  3PQI A;  4LF6 Q;  1YJ9 B;  3HOZ G;  1G7T A;  3CXC A;  4M1U B;  4M0L A;  4DNR B;  2KCC A;  1D1K A;  1YBY A;  2WIN B;  2JA6 H;  5JJI A;  1JC7 A;  4QHY A;  1QVF A;  4HIK A;  2EYO A;  4AC9 A;  2ZJP A;  3DWP A;  1L2F A;  5M5Y B;  2NPF A;  2N3S A;  4JI6 Q;  2KVM A;  1BNZ A;  4R8N A;  4DAV A;  3OWF A;  3I4O A;  1YJ9 A;  3JQQ A;  4KKU A;  3D31 A;  3HOX B;  4LF7 Q;  2XVS A;  3NE5 B;  4HID A;  4KY5 A;  3J81 L;  3BVZ A;  1KC8 C;  1Y1V G;  1VQL B;  2QGG A;  1VDZ A;  1QZG A;  2WP8 J;  1B8A A;  4DFA A;  3NTI A;  3V2T A;  1SYE A;  3RN2 A;  3OOC A;  5FLX c;  2JA6 B;  1CQX A;  1IZ6 A;  3SVM A;  1W0J A;  3W3A A;  4GZY C;  4WJ3 M;  1GJR A;  1K83 H;  5A89 A;  1TLL A;  3HOU H;  5B6I A;  3MXG A;  2IPK D;  2V1C C;  1XMO Q;  1LV9 A;  2I5M X;  2JA8 H;  2Q8T A;  4AH6 A;  1VHE A;  1RL2 A;  3SEB A;  1XXG A;  4ZKB B;  4FF3 A;  1CK1 A;  4JK1 C;  2B2V C;  4ODG A;  4IUT A;  1II3 A;  4X7C A;  2XN9 C;  4BY1 G;  1PH8 A;  3Q8D A;  2EXD A;  3MXP A;  3ONA B;  1VHO A;  1BJK A;  2X69 A;  3PIP 3;  2Y0S E;  1K9M D;  3PVD A;  2E76 C;  3GV6 A;  2M5S A;  4PMW A;  2A68 D;  2Z6K A;  2B2Y C;  1HZ9 A;  1EYC A;  1JA1 A;  1A2U A;  1RTN A;  4P22 A;  2VUM H;  1K83 B;  3HOU B;  1PZI D;  1TXY A;  1F2Y A;  3A7A B;  1TS4 A;  1CM9 A;  3TRZ A;  4HTH A;  4G7Z C;  2BVN A;  1SNC A;  5EBD A;  4CJ2 C;  2JA8 B;  1DJR D;  1XMQ Q;  1X3Q A;  3W5O A;  1Z9F A;  4N9T A;  4WQM A;  1QX4 A;  2R7D A;  3PA1 A;  4DUY Q;  4P26 A;  2ID0 A;  1EP2 B;  3GSI A;  1XX8 A;  2DIE A;  3W1G A;  4LF9 Q;  2YTV A;  3PO3 H;  1FNM A;  1CKO A;  5C0X G;  4R4Q A;  4KY6 A;  5EKL A;  1B53 A;  2Q2T A;  4OOS A;  2K7V A;  4JI0 Q;  2HQE A;  2LXJ A;  5IYD H;  3WOF A;  1MGS A;  1C9O A;  4G57 A;  4KHV A;  2VUM B;  3CW2 C;  1UNS A;  2F0H A;  2MO0 A;  4XDX A; 
#chains in the Genus database with same CATH homology
 3DUZ A;  5D3D A;  3VR3 A;  1DOK A;  2RA4 A;  2KUM A;  2JEA I;  4K8I A;  4DF7 A;  2CW0 C;  4PMB A;  1KDA A;  1F77 A;  4ZRZ A;  1QJO A;  2X6Y A;  4KY7 A;  3PO3 B;  1B4O A;  2AWN A;  4DK0 A;  5CDF A;  1DM0 B;  1ZYR D;  2ENB A;  5JVH 3;  1LAB A;  1AEX A;  4B9X A;  5JAV A;  1GUT A;  1B44 D;  1RJT A;  1DOL A;  1TQO A;  2NN6 G;  1TT2 A;  2Z1C A;  1FNW A;  2IL8 A;  2B63 B;  1Y69 U;  1EFI D;  1SKY B;  4XYO A;  1JWS D;  1MBY A;  4TSF A;  1GUO A;  2K1B A;  5I9P A;  1BO0 A;  4PQX A;  1RF2 D;  2A6H D;  2GA4 B;  4NDX A;  3NTH A;  4ABN A;  4II3 A;  1Y8O B;  2XGJ A;  1F2Z A;  3S1N B;  4G6I A;  2YU9 B;  5I4D A;  2EZV A;  3PUY A;  2QCP X;  4FXD A;  2DNE A;  2K01 A;  1I4H A;  5T1G A;  1H9S B;  4XNF A;  2K5Q A;  4LJZ C;  5IT9 L;  1KNA A;  1G6Z A;  1QNK A;  4L6T B;  3K6O A;  5IIF A;  3GVK A;  1WVL A;  4TKO B;  2ZZE A;  1F2L A;  3MHB A;  1VLY A;  1EY7 A;  3A54 A;  1H9S A;  1BDO A;  5AFW A;  2ZXP A;  1SNQ A;  3OIQ A;  2KCN A;  2L55 A;  1OXS C;  4OL7 A;  3GTL B;  3J80 E;  4BA2 I;  4IZ8 A;  1HRJ A;  4IUQ A;  5HUR A;  5EKI A;  1BCP F;  1OXX K;  2F0V A;  3S15 B;  4RHR A;  5C3X A;  1KLU D;  4EGV A;  2XRS D;  2EYL A;  2Y0S B;  5CV5 A;  3CMM A;  5IGF A;  2J4X A;  1EQV A;  2SNS A;  1I6H B;  3JAM L;  3R3O A;  2VXW A;  4CKB A;  3HRZ C;  1EY6 A;  1EEF D;  2F0L A;  4RA8 A;  2JIZ A;  5JEA G;  5I2Y A;  3MFG A;  2B8F A;  2FMM A;  5LL6 S;  2MUY A;  4C1N K;  5C4H A;  5FLX E;  3KLS A;  1BR9 A;  2AQ2 B;  1MSG A;  4Q0F A;  4HCS A;  4XL9 A;  1FYC A;  2JA7 B;  2ZXH A;  1BQQ T;  1H9J A;  2EYM A;  1K8M A;  1JOQ A;  2B2U C;  1U4P A;  1LTG D;  3MEH A;  3GTO B;  3T51 B;  2A69 C;  4FYD A;  1H8H A;  2PYK A;  2NVX B;  1YNN C;  4B3G A;  2SEB D;  4HMI A;  1O7L A;  1AZQ A;  1OB0 A;  2ZT9 C;  1SNM A;  1TS3 A;  5KEE A;  3K57 A;  3OPO A;  3LNN A;  3OW7 A;  5KGU A;  1SE3 A;  1AW7 A;  2PZU A;  3S14 B;  2D3N A;  3T53 B;  1TY2 A;  2F0P A;  4TQU S;  2GJP A;  2XWB B;  3GVL A;  2F0Q A;  2YYZ A;  3UI2 A;  5ISR A;  3D6C A;  2R3Z A;  5M3F B;  3QIA A;  3SE0 A;  4KI0 A;  4YIJ A;  1C8C A;  3VR4 A;  2F03 A;  4RHS A;  4B3F X;  5DAU A;  3TDQ A;  4ZLT F;  4HAE A;  3A8K E;  3NTK A;  1J9O A;  3BDC A;  4DAP A;  1HUN A;  2FHT A;  2JYO A;  4IUV A;  1RCV D;  2G9H D;  2Z4H A;  1VCI A;  1U9R A;  2Q8R E;  5JPM C;  2V4D A;  3BS1 A;  4K6D A;  2HDM A;  1I4R A;  4XXE A;  2Z8L A;  4ZUI A;  1E43 A;  2E1B A;  1SSO A;  4DN4 M;  2LMC B;  3HOY B;  2F4I A;  1PTO H;  4YXW A;  1HFN A;  1JCK B;  2GK7 A;  1EIG A;  4JBW A;  2Z4I A;  3I73 A;  4FXG C;  1W6K A;  4Q5V A;  5A2Q L;  1EL0 A;  5E4X A;  2ZTN A;  1PFB A;  3VYT A;  3U9S A;  1G91 A;  3MWY W;  3ITP A;  1IW7 D;  4XT3 B;  1CZG A;  4X3T A;  4XT1 B;  2R92 B;  4P2C B;  3OFN A;  2MPM A;  1R4P B;  1I4Q A;  1TS2 A;  3KBX A;  4PNY A;  2EXZ A;  4ZQ3 A;  3WDN A;  3KEW A;  1V1P A;  1PTO B;  1MSH A;  4RGM A;  4NW2 A;  5CBE E;  2EY6 A;  1OXU A;  3VR2 A;  1HHV A;  3H6M A;  2IX3 A;  1B3A A;  4BBS B;  1E3X A;  1EY8 A;  1O80 A;  3VA7 A;  4ULL A;  3KUP A;  1E1Q A;  1PKV A;  2F0M A;  4A3F B;  5G3L D;  2EJM A;  2F0E A;  5EPL A;  1KNE A;  1EY0 A;  3TP8 A;  4DGZ A;  4K5X A;  1STG A;  1F2M A;  4Z9C B;  2B2W C;  1H9R A;  2F0N A;  2NVQ B;  3OHX C;  4H7B A;  3GTK B;  4B9W A;  1SYD A;  3K0Y A;  4XN0 A;  3CHB D;  4NKL A;  1SNP A;  4G7W A;  2XWJ B;  1I4P A;  1EY4 A;  2JEB I;  1PLF A;  4BS9 A;  5KND A;  1EOT A;  1HUM A;  2F0U A;  1PRT D;  2NWG A;  3HOZ B;  2A68 C;  3DEP A;  1IYU A;  1CQF A;  1TWC B;  1G29 1;  2L0C A;  4C1N I;  4XQF A;  1JR0 D;  4XLH A;  2SDF A;  4EQP A;  5FO7 B;  1WTP A;  2K5D A;  5C6A A;  1X3P A;  5CV6 A;  4XQJ A;  1GJX A;  3X3M A;  1TWA B;  4K2L A;  4C3H G;  3ZPN A;  1Q1E A;  3BYT B;  2EY5 A;  1IKM A;  1PTO D;  5DEH A;  3LX0 A;  2ZXO A;  2MHV A;  3DWA A;  1SFO B;  1WTW A;  3VR6 A;  1C48 A;  2O2L D;  3H3V C;  2PO4 A;  4V0B A;  5I6W A;  1LT3 D;  1NSN S;  3SK6 A;  1JIC A;  1I50 B;  1JB3 A;  3KBG A;  2LS0 1;  5LHY 1;  2M2L A;  4ZYS A;  4XM3 A;  2VJI A;  3T4A C;  3I91 A;  1HA6 A;  3NBH A;  1SEB D;  2JDI A;  3BG3 A;  3D6W A;  2RQX A;  3TZD A;  3S9W A;  3D4W A;  3NXW A;  3F2U A;  4XKW A;  2KVO A;  3SK5 A;  1E3Z A;  1LTA D;  1SMY D;  1A2T A;  5JJZ A;  1PYW D;  5IOD A;  2ZXR A;  1H9K A;  2QF7 A;  3EJI A;  4KTA A;  2WZP P;  2ZZQ A;  1JWU D;  1Q8I A;  5HGT A;  3NWT A;  1LAC A;  2DNC A;  1EZ6 A;  2M00 A;  4HSV A;  2A6H C;  3P20 A;  1JE4 A;  4FP5 D;  1TS5 A;  4J8Q A;  3NQT A;  4ME5 A;  4XOP A;  1T5X D;  1LTT D;  5D3I B;  4K6L A;  1PFM A;  3A56 A;  3IAY A;  5FK9 C;  3KLS X;  4IUP A;  4K8J A;  2QDB A;  1SDF A;  3OE7 A;  4OIJ A;  2HCI A;  5I9O A;  2H4O A;  1F9Q A;  1XTC D;  3M4Y A;  3BVG A;  1NR4 A;  5IGB A;  1IYV A;  2NUC A;  5E1F A;  2C9O A;  2NYZ D;  3HAG A;  2DN8 A;  3ERO A;  5DM7 3;  5JOB A;  2MJ8 A;  1XWE A;  1BBX C;  1EU3 A;  3P75 A;  3TN2 A;  2E2J B;  1SAP A;  1DD2 A;  2L12 A;  2EYJ A;  1FNV A;  3NUC A;  4KK7 A;  3V05 A;  2E2H B;  5M5W B;  3EQL C;  1SYG A;  2B2T C;  5A35 A;  2XZP A;  3RD4 A;  2EYH A;  1OO9 B;  1KDC A;  5C5M A;  3BCD A;  1D5Z C;  4KKS A;  4QB4 A;  2RSN A;  1H9M A;  2AQ1 B;  3T13 A;  3HOW B;  5EPK A;  2K05 A;  3MXU A;  3GTQ B;  2D9U A;  1LTI D;  5KYI A;  4MHE A;  5FOB B;  5C0X I;  2O5I C;  1K28 D;  1I8D A;  4KHZ A;  4CKE A;  4DU9 A;  1CFM A;  1S5E D;  3ND8 A;  1QE6 A;  1STB A;  3K5O A;  4KD3 A;  1G2T A;  4RCN A;  3TP6 A;  2MP1 A;  4IUN A;  4G4K A;  2D2C C;  2LKV A;  1BLI A;  1LLR D;  1JWM D;  1WD0 A;  1UD8 A;  4C3I G;  3H91 A;  1SYF A;  3G05 A;  4LAA A;  2EYF A;  3GTP B;  1J8I A;  1KAB A;  3OEH A;  1ENA A;  1EYA A;  4A3G B;  2BDN A;  3K5M A;  5C4Z A;  4HMJ A;  1UEA B;  4AYB B;  1ILP A;  1BF4 A;  2EOT A;  2E2I B;  5ELD A;  3E0J A;  5M3M B;  1BCP D;  2N88 A;  2F1M A;  5EPJ A;  5C4X B;  2W6J A;  4RKL A;  5TSS A;  3OSO A;  1ICW A;  1NR2 A;  2JXM B;  1TVX A;  4BA1 I;  3S1Q B;  5DNF A;  4E6I A;  2B2T A;  1STE A;  4H13 C;  4WJW A;  4RKB A;  2QKI C;  1PZJ D;  1PDQ A;  4QMG A;  1TWH B;  3SXH A;  4V19 0;  2IX0 A;  1F9S A;  2R6G A;  4CJ1 B;  4XR6 A;  4XD7 A;  4IFD G;  2ZTG A;  1K8O A;  2ZZG A;  3QOL A;  5M5X B;  3HKZ B;  3R2I A;  3FMC A;  1WD1 A;  2NTT A;  1EQT A;  1Q90 A;  1ZEQ X;  3G7L A;  5JPN C;  3K58 A;  5D14 A;  4XLE A;  4XQN A;  3QJY A;  3AU7 A;  1W6J A;  1EZ8 A;  3P1H A;  1UUP A;  3RZO B;  2XSC A;  2IT1 A;  3QO2 A;  5KIX A;  2PPB C;  2LZJ A;  1ET6 A;  2N55 A;  1WTO A;  1D5X C;  5CV4 A;  3I4M B;  5K5P A;  2EJG C;  1OHH A;  4C56 C;  4DXF A;  3FKS A;  4XN3 A;  1KLG D;  1O78 A;  5C44 B;  1JOR A;  3DM1 A;  3DWQ A;  3NK9 A;  3GQB A;  2BDO A;  2F0O A;  4BY7 B;  4I65 A;  3QOJ A;  1YNJ D;  1A3V A;  3R2T A;  2A74 C;  2EYP A;  5ELE A;  2ICI A;  4X3U A;  2F0S A;  5FKA C;  4OO1 H;  4M8A A;  2SNM A;  3K5L A;  2K28 A;  1NRK A;  3S1R B;  2HLD A;  4TRD A;  1FNU A;  3GP7 A;  4XOT A;  5COR A;  1WTH D;  3V96 A;  2XOK A;  2WKD A;  1TR5 A;  2FIN B;  3M3Y B;  1V43 A;  1GUG A;  3ND9 A;  2IX1 A;  4XMY A;  4XQQ A;  1B1Z A;  2GJR A;  1PTO C;  2EJF C;  2FJ2 A;  2HCC A;  2EPB A;  4UAI A;  4J6H A;  2E74 C;  4CBV A;  3N6R A;  3DXJ C;  1Q3L A;  2CW0 D;  2RSO A;  3NQI A;  4RGO S;  3L3O C;  2FFK B;  1EU4 A;  1HCZ A;  1Y8P B;  4HN7 A;  1L0X B;  2F0F A;  3A55 A;  4WOR A;  2GK6 A;  4DA2 A;  4WRD A;  4R8I A;  2F0G A;  3I4L A;  1OXV A;  5FLX L;  3VYU A;  4F87 A;  1SMY C;  5EJW A;  2RDG A;  3CQZ B;  2AWO A;  3JU4 A;  5BN4 A;  3GTJ B;  1QCB D;  2BA0 A;  1FD7 D;  2D62 A;  1W0K A;  2W6I A;  1VMC A;  3M4O B;  4YEJ A;  1A3U A;  3SK4 A;  3FDT A;  2A6E C;  2NVT B;  3TBI B;  1ESR A;  2R9V A;  1PRT B;  1C4Q A;  3SR1 A;  2JSO A;  1MI2 A;  4RCO A;  4II2 A;  3T16 A;  2WJY A;  4A3E B;  4A3M B;  1V1P B;  3L7Z C;  4G7H C;  1V0F A;  3MZ5 A;  3SK8 A;  5K36 G;  3CU7 A;  1I3Q B;  1STN A;  1HVX A;  3NWS A;  1V1O A;  5IGE A;  5C4J B;  4XOR A;  4RWS C;  5ELB A;  4KV6 A;  1LTB D;  2RDH A;  1B50 A;  4OO1 I;  1UD3 A;  3HOV B;  3BH4 A;  4XKV A;  4XON A;  4Z1M A;  2PCF B;  1HPC A;  3VR5 A;  1LTR D;  4RAU C;  1RTO A;  5KNL A;  1QWY A;  2F0T A;  1TII D;  3H94 A;  2PQE A;  2WAQ B;  2RDF A;  3OEE A;  3K5N A;  2J7Z A;  4FXU A;  1X32 A;  5C0X J;  2WKC A;  3L9A X;  3TSS A;  4NP5 A;  1BOS A;  2JA5 B;  1GUW A;  3WQZ A;  3U9O A;  4HIZ A;  1LO5 D;  1M8A A;  2V7Q A;  4H44 C;  1B9N A;  4A3D B;  4A93 B;  4MN3 A;  2X8K A;  4JMQ A;  2WPD A;  1WTX A;  3O13 A;  1GUS A;  3NSW A;  1VF7 A;  1HQR D;  1JOO A;  5D65 A;  2XIW A;  3FPU B;  1O7Z A;  5COY A;  1PXU A;  5IGD A;  3OAA A;  3I90 A;  4MIU A;  5HKK A;  4A3I B;  2PMZ B;  1WP6 A;  1SYC A;  2TMP A;  3BZD B;  2WB1 B;  1CI3 M;  1Y1V B;  4L8J A;  1CHP D;  1PMR A;  2NTS A;  2BA1 A;  3CES A;  4S3S A;  4RGT A;  1E1R A;  4ZK9 B;  2F43 A;  1VJS A;  4TSS A;  1HXY D;  4KMU C;  3CKI B;  2ZZF A;  1ILQ A;  4UZU A;  1NUC A;  3OWE B;  2KEC A;  2JJ2 A;  4OGQ C;  2JJ1 A;  5C0X H;  4BY1 B;  1ZYR C;  3FVQ A;  4KD4 A;  5G3L F;  3BYY B;  3D3R A;  1LT5 D;  1S5C D;  5E3F A;  1TWF B;  3J81 E;  5KNB A;  2SOB A;  3I70 A;  4ILW A;  2KEE A;  3A35 A;  2XZO A;  3MA2 B;  2CHB D;  2E75 C;  3Q22 A;  4IN3 A;  2VJJ A;  4DXG A;  3N52 A;  4EVO A;  2AUK A;  1IKL A;  1E2V A;  1AN8 A;  1RHP A;  1IHZ A;  3DEO A;  1KTK A;  1AP0 A;  1LT6 D;  5CV7 A;  1PFN A;  2NN6 H;  5DN6 A;  4J1M A;  2DY7 A;  2PZT A;  2R7Z B;  1S5F D;  4FF4 A;  1A15 A;  4F7X A;  3GO5 A;  1PTO F;  5NUC A;  2VNU D;  5E4W C;  1QB5 D;  1E0B A;  2XNA C;  2CQA A;  2NBF A;  2I07 B;  1QOH A;  5JEA J;  1AZP A;  1I4G A;  2KED A;  3MC0 B;  4U68 A;  3A3G A;  5I2X A;  4FO2 A;  5T1I A;  2Z6B D;  1OXT A;  1NCV A;  1F9P A;  3H0G B;  2BOS A;  1RDP D;  2X6X A;  4QUF A;  4IFD H;  1D1I A;  4LK1 C;  1UD5 A;  4ID6 A;  1EWC A;  1Y1W B;  3MXN A;  1Q12 A;  2F0D A;  1JOK A;  1EY9 A;  5F2D A;  2R93 B;  1CT1 D;  4DNT B;  4IUR A;  1DCZ A;  3EFX D;  4ZKC B;  1V8Q A;  1H8E A;  1BCP B;  5ELF A;  4BBR B;  3T56 B;  1SBB B;  1HFG A;  4EQO A;  1VF5 C;  2IJ0 A;  1I4X A;  1S5B D;  3URY A;  1DON A;  1G2S A;  2R61 A;  5CYU A;  3BCF A;  2F3W A;  5I6Y A;  4OIK A;  3EA6 A;  1YNJ C;  2F0J A;  2XZL A;  5CGK A;  1HTP A;  1E2Z A;  2X6G A;  3DDY A;  3WOE A;  1R4Q B;  4R9W A;  1SJE D;  2PW5 A;  3LWE A;  1HTL D;  3RLF A;  1Z7T A;  2LY7 A;  2Q8I B;  3RUZ A;  4ZUJ A;  3S2H B;  4UDU C;  5JEA H;  1TWG B;  3ERQ A;  1XYI A;  2A5H A;  4C3J G;  3A8J E;  5IOC A;  1KAA A;  5C3E B;  5IT9 E;  5JVG 3;  2BE5 D;  2HUG A;  4YEL A;  2RVL A;  2L4N A;  1STA A;  2NN6 I;  3FRP B;  4FVM A;  4KN4 C;  1BPL A;  3AMU A;  4B08 A;  1CQV A;  1LT4 D;  5IK2 A;  2OT2 A;  4X3K A;  2MGS A;  2A73 B;  3I3C A;  2F0K A;  5FO8 B;  5C5L A;  4A3K B;  1BXT A;  4A3J B;  4IUU A;  1O7Y A;  1EWH A;  1ROD A;  2KOL A;  2G9D A;  2OXP A;  4O42 A;  1VMP A;  3JAM E;  1U4M A;  4IFD I;  4XLA A;  4XYQ A;  1GHJ A;  3D8G A;  1ESF A;  2PNR C;  3S16 B;  1I6V C;  2B2V A;  2CVR A;  4KJN A;  1ENF A;  2TSS A;  1QG7 A;  3NBI A;  1KMH A;  1Z6H A;  1E2W A;  1QNU A;  5LL6 X;  2B2Y A;  5BN5 A;  1DOM A;  3IFT A;  2J0T D;  2F3V A;  4RFB A;  3ZIA A;  2GJK A;  2C5C A;  1IW7 C;  5KNC A;  4Y7N B;  4X3S A;  3A3B A;  4XLF A;  1EYD A;  1SE2 A;  3HS0 C;  2WSS A;  1U4R A;  3X3N A;  1WCM B;  4O1N A;  1WTQ A;  1TKW B;  2EE1 A;  3I4N B;  4TT3 A;  4DAY A;  1EIH A;  4BWG B;  4E0F A;  1FR3 A;  3CRK C;  4I7Z C;  2JE6 I;  2FMC A;  5CBA E;  5K36 H;  3BDL A;  1COW A;  4G7X A;  3M7N A;  2EY2 A;  1UD6 A;  3M85 A;  4H0L C;  2O5J C;  3IKJ A;  2D5D A;  5CV8 A;  3RZD B;  2OF1 A;  4QIW B;  4XIG S;  3QG1 A;  2X85 A;  1STY A;  2PW7 A;  5EQ0 A;  3SDZ A;  4U67 3;  1UD4 A;  1KZL A;  2QEJ C;  1DZ1 A;  3G6J B;  3SHL A;  1FX0 A;  4PMC A;  3KK7 A;  1GUN A;  3QB3 A;  1G8Z D;  2B39 A;  3BC9 A;  3C46 A;  1PRT C;  1HQM C;  4OHJ A;  3HEJ A;  1SXT A;  2H1E A;  3E5S A;  1NBM A;  2L11 A;  4FXK C;  5FL7 A;  3TP5 A;  3HP3 A;  3NP8 A;  3J80 L;  3K59 A;  1SND A;  3HG9 A;  3PUV A;  1ZXT A;  3OIP A;  1TU2 B;  4HCE A;  1S4Z A;  4RGN A;  3R93 A;  2WJV A;  3NHH A;  1CHQ D;  5CC4 A;  2AUJ D;  1T5E A;  2EVB A;  2WII B;  4F8M A;  5A2Q E;  3BDO A;  1FGB D;  1IL8 A;  3I72 A;  1BMF A;  1SJH D;  2F0I A;  1RKN A;  1JQY D;  5CR3 A;  3S2D B;  4QUC A;  1AFP A;  2DY8 A;  1Q1B A;  1R9T B;  4K2K A;  1GXD C;  2ICE C;  4HED A;  4QF4 A;  4NNJ A;  4K14 A;  2PZW A;  5EGT A;  1W9X A;  1ML0 D;  3W2D A;  1UD2 A;  4RH6 A;  2ZXI A;  4K5W A;  3P7J A;  3GTM B;  1RD9 D;  3DMU A;  3EVQ A;  1CA5 A;  4GQN A;  3TME A;  4AVZ A;  1M4V A;  2RBM A;  1DXM A;  3K7A B;  1EFR A;  2K32 A;  3FPP A;  4C3H B;  3IFD A;  3GD7 A;  3AB9 A;  4XTC S;  2OEO A;  5KYL A;  4G7O C;  2M9V A;  3VA5 A;  3PUZ A;  3Q6S A;  2WAC A;  3RMH A;  5ELC A;  1A3T A;  4NMZ A;  3PUX A;  4K5V A;  4C2M B;  3VYS A;  1S5D D;  2NB0 A;  1WTR A;  1ONL A;  3KLR A;  4CJ0 B;  1D5M C;  4KN7 C;  1ZKO A;  2B2U A;  3MVV A;  3QWN A;  4KKT A;  3HGB A;  3MFY A;  1V0E A;  2QE7 A;  3R8B A;  4EQN A;  4IAL A;  1HA5 A;  3C1F A;  3S1M B;  4A3B B;  2L9H A;  2NZ1 D;  2KJX A;  4ASU A;  4CGY B;  4HSP A;  3IL8 A;  1LTS D;  4PV1 C;  3MAQ A;  3GVJ A;  2X53 S;  3OMC A;  3Q0A A;  2K03 A;  1U4L A;  2VB3 X;  2X6L A;  3J7A F;  4OO1 G;  4LMQ D;  2EY1 A;  4XLC A;  4N9P A;  1DYQ A;  2JP1 A;  2IWH A;  1CTM A;  2KA7 A;  2IW3 A;  1MD2 D;  2HDL A;  2XRQ D;  3VYR A;  1ENC A;  1I18 A;  1GHK A;  2B8G A;  1B9M A;  3BVM A;  1SNO A;  2XND A;  3OMG A;  4L63 B;  4ZAI A;  1HZE A;  4CKC A;  3M7G A;  3CRL C;  4WFN 3;  5IGG A;  3MTS A;  2VB2 X;  2A69 D;  1KDB A;  1CA6 A;  1Z47 A;  5M9O A;  2K5W A;  5BN3 A;  1YNN D;  4CHT B;  2E2D C;  4QCL A;  3LWU A;  2L5T A;  2NVY B;  3PIO 3;  1B2T A;  2V31 A;  1CZW A;  1Y8N B;  1MAB A;  3DHQ A;  3I8Z A;  4FF1 A;  4FNF A;  3PV0 A;  2I46 A;  2RKS A;  1D2B A;  3HZX A;  4DK1 A;  3C3L A;  1PZK D;  2CK3 A;  3PO2 B;  3TP7 A;  3D4D A;  3ZYY X;  2BE5 C;  3Q24 A;  4KJO A;  3TZU A;  2L1B A;  3KF8 A;  3FEW X;  3C2P A;  1NAP A;  3D4R A;  2BCO A;  1F9R A;  5J22 A;  5J39 A;  1A6X A;  5DM6 3;  1GOZ A;  3E6Z X;  4IFD J;  3J7A V;  2K04 A;  3NPP A;  3J7Y W;  5EKK A;  4FF2 A;  3C1E A;  1EEI D;  3GTG B;  2K33 A;  3PMF A;  1SYB A;  1WPC A;  1BCP C;  3S17 B;  2QIL A;  5CMD A;  1QIL A;  5EBC A;  3CP2 A;  4IQZ A;  1UAP A;  2LFN A;  1PRT F;  4F88 A;  1L0Y B;  2D3L A;  1WTV A;  2WV6 D;  2AQ3 B;  3GV3 A;  3A7L A;  1ET9 A;  2F0W A;  3Q23 A;  1E79 A;  4C3I B;  1STH A;  3H09 A;  4C3J B;  1BUV T;  1D6E C;  2A6E D;  2B2W A;  3FKI B;  2KQ3 A;  5FO9 B;  1TY0 A;  1EY5 A;  3A8I E;  1SE4 A;  2KHS A;  5CV9 A;  4HR7 B;  5J1Z A;  5KRU A;  2EDG A;  3PUW A;  5IGC A;  2X6W A;  2K6A A;  5C3W A;  3CP8 A;  2O4X A;  4M1U B;  4DNR B;  2KCC A;  2WIN B;  1D1K A;  1JC7 A;  2EYO A;  3DWP A;  5M5Y B;  2KVM A;  1BNZ A;  4R8N A;  4DAV A;  3OWF A;  4KKU A;  3D31 A;  3HOX B;  2XVS A;  3NE5 B;  4KY5 A;  3J81 L;  3BVZ A;  1VDZ A;  2WP8 J;  4DFA A;  3NTI A;  3V2T A;  1SYE A;  3OOC A;  2JA6 B;  3SVM A;  1W0J A;  3W3A A;  4GZY C;  3MXG A;  2IPK D;  1LV9 A;  2Q8T A;  3SEB A;  1XXG A;  4ZKB B;  4FF3 A;  1CK1 A;  4JK1 C;  2B2V C;  4ODG A;  4IUT A;  1II3 A;  2XN9 C;  3MXP A;  3ONA B;  2X69 A;  3PIP 3;  4PMW A;  2E76 C;  3GV6 A;  2M5S A;  2A68 D;  2B2Y C;  1EYC A;  1A2U A;  4P22 A;  1RTN A;  1K83 B;  3HOU B;  1PZI D;  3A7A B;  1F2Y A;  1TS4 A;  1CM9 A;  4HTH A;  4G7Z C;  1SNC A;  4CJ2 C;  5EBD A;  2JA8 B;  1DJR D;  1X3Q A;  4N9T A;  2ID0 A;  1XX8 A;  2DIE A;  5C0X G;  4KY6 A;  5EKL A;  1B53 A;  2K7V A;  2HQE A;  3WOF A;  1MGS A;  4G57 A;  4KHV A;  2VUM B;  1UNS A;  2F0H A;  4XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...