3OPOA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
296
structure length
296
Chain Sequence
QNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 34
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3opoA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3opoA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3opoA01
1HQMC 3A7LA 3CRKC 3TZUA 3D31A 2V4DA 1Z7TA 4OO1H 3L7ZC 3EQLC 4XIGS 1IYVA 3RLFA 1DD2A 2A6HD 2CW0C 3U9SA 4H44C 4JBWA 5C0XH 3FMCA 3DXJC 4BA1I 1HCZA 1VCIA 2DN8A 1Q1EA 1Y8OB 1GUGA 3P20A 1IW7C 1TU2B 2D62A 4OO1G 1CTMA 1OXSC 2PCFB 1EWHA 3QJYA 4I7ZC 2JXMB 4DNRB 4L8JA 1Y8NB 2B8GA 2NN6G 1DCZA 1TKWB 1VF5C 4KMUC 1G291 5KNDA 2DNEA 3BG3A 3VA7A 1LABA 2BDOA 3WDNA 4KKSA 3M85A 2D5DA 2YYZA 1GHJA 4KKTA 3LWUA 2LMCB 2K7VA 3SDZA 3VR3A 4KKUA 2NN6H 3ND8A 3VR6A 3A8IE 1ONLA 3GD7A 1T5EA 3PUZA 3KLRA 5BN3A 4G7ZC 1H9RA 2EJMA 1Q12A 3MXUA 2KA7A 4KHZA 3N6RA 1H9MA 1CI3M 2EVBA 1H9SB 1FYCA 3ND9A 2O5JC 4TQUS 3IFTA 4IFDH 4DNTB 2PNRC 4DK1A 3PV0A 4PV1C 3OOCA 3MFYA 2EJFC 4H0LC 1Q1BA 4G7HC 3H94A 2BE5D 1YNJC 5K36H 4BA2I 1OXUA 5JEAH 4IFDG 1K8MA 3VR5A 2AUJD 3M7NA 1H9SA 2A6HC 1HPCA 1ZYRC 1PMRA 3I4LA 2ZT9C 3T51B 1VDZA 1OXXK 3T53B 4KI0A 1Q90A 1Y69U 2E75C 4KN4C 1DXMA 1GUSA 2BA0A 1E2WA 2D2CC 1GJXA 1BDOA 1SMYC 2K33A 5K36G 1OXVA 3W3AA 2KCCA 3A8JE 1E2ZA 2EJGC 3CRLC 2A69D 3QG1A 5KNCA 5KNBA 1OXTA 4OGQC 3BDOA 2E74C 3SE0A 3VR2A 2F1MA 4GZYC 2L5TA 4RCNA 2PPBC 2A68C 4KN7C 1Y8PB 3M4YA 1B9NA 2EDGA 3GQBA 2JE6I 3A8KE 3T56B 2R6GA 2BA1A 1H9JA 1B9MA 2BE5C 2A6ED 5BN4A 1GHKA 2A69C 3PUWA 1K8OA 3QIAA 4TKOB 1HTPA 1QJOA 1GUTA 3NE5B 2QF7A 5C0XG 3OW7A 4H13C 2E76C 1GUNA 3AB9A 2K32A 3PUYA 1I6VC 3D4RA 4XTCS 2O5IC 3OPOA 1CFMA 1E2VA 2AWOA 3I72A 2DNCA 2IT1A 4HR7B 4JK1C 5A35A 1FR3A 1GUOA 2A68D 2AUKA 2Q8IB 5BN5A 1Z6HA 4LK1C 2B8FA 4DK0A 2JEBI 1O78A 3A7AB 1IW7D 4LJZC 1LACA 1YNNC 3VR4A 1H9KA 1ZKOA 1A6XA 1V43A 1VF7A 3PUVA 3I73A 1O7LA 3HGBA 3IKJA 5JEAG 1V8QA 3LNNA 2JEAI 2NN6I 4G7OC 3FPPA 2A6EC 4IQZA 3PUXA 1IYUA
chains in the Genus database with same CATH superfamily
2A19A 4A3DB 2F1LA 2R92H 1J5EL 4KTAA 2F0FA 4DK3C 4P75A 1GVPA 3NXWA 5EKIA 3Q6SA 3OJXA 4AIMA 2XRSD 3PA2A 1TS4A 4H44C 1UD4A 4XQQA 4RKBA 4RLZA 3DXJC 1ML0D 4JG2A 4LFAQ 3S1QB 1S5BD 2V7UA 5D14A 1HA3A 1NY4A 4GOPB 5EJWA 2VJIA 4EH1A 3AVYA 3L9AX 4LUZA 1DCZA 2JA7B 1TS3A 2UUAQ 1PYSB 2DNEA 2WAQB 4XQNA 4B43A 2C9OA 1PH7A 3S2HH 4KD4A 2ZM6Q 1EY0A 3HKZE 1OGJA 2HQEA 5JVG3 3J80L 3MZ5A 4KHZA 3D4DA 3B78A 4TMXA 1IJFA 4Z9CB 5HURA 1GUWA 4BY1B 1SNCA 4XL9A 3ND9A 5KSWB 1QVFB 3K5NA 1B7YB 1YIJA 3AFPA 2F0PA 2DY7A 1H8EA 2RA4A 2PW7A 3OOCA 3A0JA 1PH5A 1BX0A 1BX1A 4QMGA 3P1HA 1CKMA 4F88A 4YIJA 4MTKA 1E0BA 3GVJA 2NTTA 3ERQA 3AVUA 4IURA 3TP5A 4Z4YA 4KD3A 3JAML 1WD0A 2ZZFA 4DV6L 1Y69U 1S72A 4XONA 1SDFA 2BH2A 2ZJRA 2MPMA 2QW7A 4LF4L 3I55A 1QOHA 3W3AA 1W0JA 4IUUA 4DR7Q 4F7DA 2EQSA 5CBEE 3QG1A 2Z4HA 1OXTA 2EYFA 1ZM2A 3KF6B 3GV6A 5IP7H 3NTHA 3LVBA 2CW0D 1VLYA 1KTVA 1ZM9A 5T1IA 1ILQA 3CCLA 4RCYA 1WCMH 4RWSC 2OYNA 1WOCA 4DR4L 1HVXA 4TMTA 5DSZA 2A5HA 4RD0A 4B44A 3DEPA 5C4XH 5J39A 5CGKA 4GNXA 4XOTA 2QF7A 1I4PA 4H13C 5EQ0A 3SEBA 1M1KC 3BVMA 1TY0A 1YIJB 3J7A5 4N8FA 1SFOH 2K5NA 4ALPA 4B08A 5KNLA 1D5XC 1EP3B 1LT3D 3K59A 2PI2E 4MIUA 3OEHA 2DETA 2B63G 2FMCA 1AIPA 3ZIAA 1YNXA 2VB2X 2F0NA 3CW2C 1HR0Q 3JU4A 4C3HB 3PA1A 4QV2A 5JAVA 4JI2L 3Q3AA 3KJPA 3WY9A 1BVSA 3BVGA 1WTVA 2ZL6A 5M3FH 1SRUA 4FF3A 4G7OC 3TP7A 5L46A 2BVNA 1GD7A 2V7VA 3TZUA 1Z7TA 1F9RA 2WKCA 4LF6Q 2SNMA 1MJCA 2BSAA 1EQTA 2CW5A 1JOOA 3KBGA 4LMQD 1KK0A 3NTKA 4LBVA 2LS01 5FK9C 5IYPA 5IP7G 3QJYA 1IBLL 3HOZG 4LAAA 3HG9A 2BDNA 4UAIA 3ER0A 4YALA 4IN3A 5EKLA 2A74C 2B2TC 3DLLA 3CC4B 3WYAA 2Y0SG 3I55B 4X06A 1DOLA 2D5DA 5H5JA 1KQSB 5EBDA 4G1VA 1T5EA 2I0QA 4FK8A 2WIIB 1PZID 4UP8A 5TY0A 5C44G 2JA5G 3J80i 1PRTD 2JA9A 3W2HA 4Z4WA 2RC5A 3P27A 1CSPA 3DM1A 2ZJPA 4BPRA 1HNZQ 3RR5A 5IGEA 5IYCH 5GADC 1EYDA 2R6HA 1WORA 1E43A 3D26A 2YWGA 3EA6A 3MHPA 3Q8DA 4OIJA 5FJ8G 3S16B 4H0LC 1G2SA 2RC6A 1EFID 2PZUA 3G71A 1GJRA 2PE3A 2VUMH 1UE6A 1K8MA 4M4SA 3T4AC 1A8PA 4OELB 3V96A 2M2LA 1LTID 3I4LA 2EY6A 3U50C 3CCMB 3C3LA 4M1UB 1TT2A 3WBKA 2K4KA 2QGGA 2CNDA 2E75C 4ZGQB 3W2FA 2HUGA 1NAPA 5NUCA 2OTJA 1HHVA 2K75A 5K36G 2OBRA 3KLWA 3I1FA 4RMFA 1EL0A 3B8HA 2HCIA 1R4PB 4R4TA 2BCOA 4AC9A 1EZ8A 1K3RA 4WZEA 2KEDA 2NYZD 1B8AA 4XORA 4PMCA 4UHVA 2MQHA 1D8TA 2VJJA 1BO0A 1ZYRD 3FKSA 3CC2B 1WP6A 5GAGC 1BOSA 4QJFA 1Y14B 5IYNA 4DV3L 1ZEQX 2I1LA 3A3GA 3A8KE 2KHSA 2ES2A 1EOVA 4RHRA 3RD4A 1AE2A 3E5SA 4AF6A 3PUWA 2ZXIA 3OZVA 1E79A 1GM5A 4DK6C 1Y1VG 1RL2A 4J8QA 3PF4A 1WTOA 5HGQA 2IPKD 1XMQQ 3JAME 2F0LA 3W1GA 3PUYA 2ICEC 4XTCS 1S0UA 1C8CA 2C2WA 4QVJA 3I72A 1IBKL 2LXKA 1TWFH 4LF8L 3H9NA 3G48A 1NNXA 5KIXA 1O78A 3A7AB 1V0EA 1CKNA 2D9RA 3ZJYC 4HJAA 2NZHA 4X3TA 3CC2A 1OB5A 3S16H 1WSVA 2MJ8A 4BBSG 2UXBQ 2HMAA 2KEEA 1CSQA 1QGYA 3ERSX 2F43A 4X62Q 1SYBA 2EY2A 2JK8A 4UZUA 1SJED 4OO1H 4X6AH 1L0WA 3MWYW 4AYBE 1VMCA 2R92B 5HKKA 2X6LA 3K6OA 4JI7Q 3UE0A 4M53A 2LZJA 2DN8A 2UUCL 3J7ZC 4J0QA 4QVAA 3A74A 4GLVB 1CTMA 3HOYB 1F60A 3AU7A 3HS0C 4YCUA 2K04A 2FINB 4RGMA 5IYBH 3V7AA 1HJPA 4WJ3M 4U673 2IX0A 4ABNA 1PYWD 4BY7G 1K0RA 4Y52H 3GTGH 1BPLA 1JMCA 1X3QA 2UUCQ 3MTSA 1UE1A 4CBVA 2CC2A 2ENBA 1QUQA 4G7ZC 1JNYA 3PO3G 3RZOH 2ASBA 2N8NA 3FP9A 4FYDA 3B6YA 3BZKA 2PNRC 4ZYSA 1QX4A 3O13A 3MEFA 5EGTA 1Q82C 4JI3Q 1V9PA 2OQKA 3NBIA 2Q6LA 3I4MB 3K7UC 2JA6B 3S1MH 4J1MA 1QUQB 1LTTD 1KD1C 3K7AB 1B3QA 3MC0B 3EFXD 2UXDL 2JN4A 2X69A 3E0JA 1S3OA 5LMUL 1PH4A 1R5BA 2E2HH 5DS0A 1NSNS 3TN2A 1EEID 3QFCA 2WJVA 5EKKA 3VO2A 1SMYC 1SNPA 4K8JA 4XYOA 1QZHA 3OMCA 4JI1Q 4X64L 2GA4B 1PTOB 2KJXA 3HOVG 5EPJA 3KLSX 1KK1A 1JJCB 4KHPQ 2N3SA 2P3MA 2B2WA 4YAFA 4RCNA 2QEXA 4DR2Q 3A54A 3EVQA 4L5TA 5CV5A 4DAPA 5J22A 2LSSA 4DU9A 4Z4VA 2DCUA 4WJWA 1RTNA 5I9OA 1HRJA 1B9MA 4JI6Q 1RQPA 2Q2IA 4IJHA 5KRUA 2V7XA 1NDHA 1BCPB 4M8AA 4V190 3AVVA 1KJZA 4QUCA 4LFCQ 1I6HH 1GUNA 1RF2D 3PIO3 1UD2A 5EAYA 3HOVH 2R3ZA 1Y1WB 2WJYA 4ZLTF 1PXUA 1NTGA 1EY9A 1NJID 5E6TA 4HR7B 2R7ZG 4PC6A 2JA6H 4A3KG 4TN1A 2ZL5A 1EQVA 2RCFA 4DV0Q 4LNQA 1SNDA 2EYPA 1UEAB 2NVTB 1KK3A 4FN5A 2JA5H 2B2WC 1JJ2B 3S9WA 4CDCC 1VHEA 1WFQA 2L12A 5JJIA 4AH6A 5HXBA 1S5DD 4A3LH 4GOPA 1KL9A 3DEOA 1QVGA 2HDLA 3PUXA 2RSNA 1PJ5A 1G7RA 3A7LA 1WU8A 5HZAA 1ASZA 2VBVA 2QTLA 4EQ5A 1HFGA 1I94L 4XD7A 5A88A 2JA8B 3SK6A 1DONA 5GV7A 2JJQA 4IPDA 2R93B 1TU2B 2MP1A 4IOAA 2F0WA 5ELNA 3CCUA 3HOYH 1PH6A 4ID6A 3BJUA 2HCCA 1SJHD 3J81c 4ZUJA 3J7AF 2R93H 2N55A 1M90C 2BDOA 3CCJB 4WORA 3CCMA 1W6KA 2I5LX 1LTSD 3GVLA 2LMCB 3GP7A 1PH8A 1F9QA 2PMDA 2MFIA 2KBNA 5BN3A 1FNUA 3RNUA 3K8AA 1XXGA 1FYCA 4OIKA 1Q8KA 2UXCQ 4KY5A 1W6JA 5FO0A 1STYA 3MCAA 4B3FX 4HE5A 2O4XA 2UU9Q 1S4ZA 1ZM3A 2F0MA 3K0YA 3FKIG 1C9OA 1NUCA 4QQBX 2JA5B 1CHQD 2CRVA 4K8IA 3ASTA 3M4OH 1KK2A 4OPOA 1VQNB 3CQZH 4GNXB 4N9PA 5M3MB 4P74A 3FPKA 1B70B 2NVQB 1Q90A 1OTCA 4K5WA 4DXGA 3PO2G 4JYAQ 2BA0A 1CKOA 3NTIA 5ELBA 3PIPA 1A15A 1H85A 1VS0A 4GS3A 1YNJD 2KENA 1T6ZA 4K0KL 4NKLA 1SNOA 2CF4A 2L9HA 4OOVA 2MO1A 4GNXC 2XRQD 3L2PA 1K8AC 1Y8PB 4IZ8A 3J81j 2K6AA 1LLRD 1B53A 2JE6I 1N34L 2WR8A 1VQOB 2JP1A 4OXPA 4PZ6A 4NBSA 2QDBA 4PMBA 3HZXA 4PZ8A 4PC3A 1AW7A 3S1NB 2I5MX 1SKYB 2ZTGA 2EOTA 1EFRA 1IBLQ 4DAYB 4P6VF 5KEEA 1K0SA 2E1BA 1E2VA 4ZKCB 1Y0RA 2VUMB 3DWAA 4YWKA 3H3VC 2B39A 2VQEQ 3VA5A 4LJZC 5I9PA 3F2CA 3MVVA 1A0IA 2C5CA 3I73A 3H15A 5C4ZA 1EFTA 1V8QA 1KLGD 4RDLA 4A3MB 3RY8A 1AZQA 1IYVA 4A3IB 1O7IA 2F0OA 4FDBA 3BVZA 5LMNW 5C4XG 4XT1B 5IYCG 3S2DH 1YHAA 2C4UA 1VQPB 5E7NA 5CORA 1U4PA 2AKWB 4BA1I 1Q86C 3ULPA 1GUGA 5IGBA 3PUNA 3NBHA 5JJZA 3BCDA 1ZUNB 1DGSA 4YHHL 3KL9A 1O7ZA 4XLFA 3WBJA 2EFGA 2N49A 1T5XD 3BYTB 4KJNA 4XLEA 5HZBA 4RKLA 4GKJL 1GHJA 1RHPA 2F52A 3VR3A 1TS5A 2A73B 3CCJA 4DR3L 4A3BH 1AE3A 1HNWL 3MXGA 2JDIA 2FJ2A 4FF4A 3A5ZB 2WB1G 3G05A 1Q7YD 3Q39A 5AJ3L 4YXWA 4DNIA 2VB3X 4LF5L 1VQ6B 4BY7B 2Q2TA 2H1EA 2HHHQ 1KRSA 2Z4IA 3PO3B 4HIKA 4XT3B 5LL6S 3I70A 3SK5A 3RMHA 4J15A 1XMQL 3IL8A 2DY1A 3PENA 3K57A 4MTNA 1N32Q 1PH9A 2VNHA 1BCPD 3I3CA 1PMRA 1PZKD 3AMUA 2Q6OA 1YVCA 5FO8B 5FO9B 4QCLA 4XLHA 3CMAB 3NELA 1SR3A 4RAUC 3ASSA 2F4IA 4E0FA 4HE6A 2K28A 3A8JE 3PIP3 5GAHC 2JA8G 1E2ZA 2A69D 4OWXB 4YEJA 3UI2A 4Y7NH 2XTIA 2VQFL 1IZ6A 1ENFA 2PPBC 2PO4A 4TRDA 5FKAC 1XB2A 2C77A 1EY7A 4WZKA 1F9SA 4JW0A 4JPBW 2ZBUA 1NBMA 1W9XA 2WZPP 1XE1A 2ZXHA 4XM3A 1KDCA 3QIAA 1GUTA 2BM1A 1BXTA 3NWSA 2AWNA 4A3EG 3ASRA 3AB9A 2V31A 1CZWA 2K32A 4GKKL 2VS1A 3RZDH 1QE6A 2KHJA 1STGA 4XQFA 5A35A 3UE1A 1LTAD 1K28D 4M1KA 4C3JG 1NMFA 1VQFA 4GN5A 3I8ZA 1H9KA 3G6EA 4QIWE 4POGA 4QHYA 3A5UA 4DV1Q 1WTQA 1U4MA 3IKJA 1FNBA 4X7DA 2AHOA 4RCZA 1KC8C 3HOXG 1D8LA 3ZZUA 4XDXA 4A3CG 4HMJA 4DUZQ 3SJPA 4UZFA 1IYJB 4H7BA 3BDCA 3EN2A 4TSSA 4CJ2C 5IGGA 3I90A 2ZM6L 1W3SA 2JA7H 2K05A 1U5KA 1MBYA 3H0GG 4ZK9B 4JCVE 3A1PA 2F4NA 3OYYA 4DA2A 4K2KA 4P25A 1J9OA 4ASUA 3CC7B 4YAWA 4IALA 1LABA 4OEMB 4EVOA 1HR0W 1ICWA 2R93G 2XN9C 1U4RA 1VQDA 4NMZA 2K7VA 4KKUA 4K1XA 1CKNB 1X6OA 2CQOA 2WFWA 1GVHA 3R2IA 2K5WA 4G57A 3N6RA 1G6PA 2ICIA 3GTLH 5IP9G 3I2ZA 1PRTF 3T1HQ 3ONYA 3X3NA 4C3HH 1EUJA 3N52A 4X3SA 1YI2A 4I65A 2B3GA 5JEAH 3CPWA 2XVSA 1K8GA 2F4VQ 1NB0A 1H9SA 4O1NA 4C2MB 4LWCA 3GTJH 2XNDA 1JT8A 1WTHD 4IFDJ 2EYJA 3T53B 3HOXH 1YJNA 4ZQ3A 2JSOA 1DXMA 4H9GA 2B63B 2R7ZH 3K5LA 4DR4Q 2F0TA 3RLOA 5C0XI 5IODA 1FX0A 1YLOA 3OP1A 3S15B 2ZTNA 5M3MG 4ZUIA 4HJ5A 4EQNA 1D1KA 1PVOA 2IL8A 2RDGA 4A93H 1IB0A 2L5TA 2JJ2A 4DR7L 4Y9RA 4C3IG 2IHEA 3TQYA 2F4VL 2BA1A 2A6ED 4B48A 5HY6A 3WOEA 1EIYB 1S5ED 2ZZGA 2VBSA 1QJOA 2X6GA 1FNVA 4A3GH 2EZVA 1HZ9A 3QR8A 2B5OA 1NB9A 1SMXA 4WRDA 4MYTA 3SK4A 4RGTA 3S1MB 2BN4A 4DV5L 4QL5A 5C44B 2Y0SB 3I4MH 4ACBA 4R4QA 3M4OB 1A8VA 1Z6HA 2OEOA 4PG3A 1B23P 5D3DA 2SOBA 1N33L 4BBSH 1EU4A 1P4MA 4B3GA 1XMOL 2UXCL 3A3BA 1GO3E 1K28A 3PUVA 2AQ2B 3LNNA 1V0FA 4IPGA 1U9RA 3BNWA 3CCUB 3FPPA 4GZYC 3CAMA 2L55A 4BBRB 3WQZA 1JA0A 1H8HA 2V4DA 1XX8A 4Z4TA 1DYQA 1F2LA 2PQAA 2YTYA 4IPHA 2X8KA 3CCVB 4BBRH 5FNZA 1DD2A 1QGZA 1BBUA 2R9VA 2UUBL 1YI2B 5BSXA 4A3EH 3OAAA 1EY5A 3GTQB 1L0YB 4DAYA 4XLAA 2EYHA 1QH0A 3P20A 3PF5A 3E9HA 4X7CA 3U9OA 1N9WA 4L5QA 4I7ZC 1TWCH 4JV5L 1PFSA 1TKWB 3ONAB 4KMUC 1D7QA 4AVZA 1W2BB 1BCPC 1XMOQ 3CCVA 2EIXA 4IOCA 3HOUH 1MSGA 5C3EG 1R9TB 3LQEA 3U6KA 2I5HA 2QDLA 3AYHB 3TSSA 5I2XA 2B7CA 2GJKA 5CV4A 4P72A 3OWFA 3Q23A 4DR2L 3U4ZA 4NXML 3PO2B 1G7TA 3JQPA 1W87A 5I4DA 1JOKA 5IOCA 4KHPL 1B44D 4OPVA 3HOWB 2RDFA 1KZLA 1QFZA 5M5XH 5C5MA 4IFDH 1TIID 3T1YL 4LW1A 5C3XA 1D2BA 1IKMA 4A3FG 4N3GA 2XZPA 2EE1A 1S5CD 4XMYA 1QGAA 1R5OA 1X3GA 2DJGC 3KF8A 2N78A 4ULLA 3CCRA 3M3YH 3T51B 3CCSB 2KECA 5FOBB 2XEXA 3ONUA 4XQJA 1GJXA 3FEWX 4X66L 4LFBL 4IPCA 4TSFA 3NHHA 4C2MH 5D3IB 1Q8IA 2ZTEA 4DV5Q 1IHMA 2XNCA 5J1ZA 4JI0Q 2QMUA 4HCEA 4X3UA 4RD3A 3GTMB 1LTLA 3SE0A 1WDTA 1WYDA 3PMFA 3P26A 4HCSA 2YU9H 1GO2A 2HCJB 3HKZB 1SAPA 4QB4A 2QDXA 1QILA 1VQ4B 2GVAA 3E9IA 2Y0SE 1A62A 1P16A 4EQOA 1K9MC 1CA5A 4ACAA 2E5LL 1QWYA 4YY3L 1KD1D 5LMZA 2E2IH 5I6YA 5FLXL 4X7FA 2QKIC 3K80C 3A8IA 1CFMA 2QN6A 1EYCA 2PQEA 1HA6A 1IL8A 1HNWQ 5FL7A 4JV5Q 2Q8IB 3HOUB 4II2A 1EOTA 1IW7D 3J81E 1A6XA 3S15H 1VF7A 4TT3A 4PC1A 5IY0A 2OTLA 2B63H 2R7DA 3TEHB 4NXMQ 3OIQA 4HSVA 1IHZA 1SNQA 1IYUA 4CDEC 3RN2A 1SYGA 2G9DA 4FXGC 1MD2D 1VHOA 2UUAL 3GTJB 4B3SQ 2KCNA 5KW9A 2V7QA 4JBWA 4NW2A 5FO1A 1LYLA 3T1HL 1G7CA 1W34A 4C56C 3PGZA 4X0CA 3BC9A 3CB4A 4LFAL 1HFNA 4G6IA 2G5DA 1EZ6A 3F2BA 1Y8NB 3CC7A 1X65A 4JVZA 4HTHA 3C1FA 4B3TQ 4YCWA 4DR1L 1I4QA 3BG3A 4PABA 4KKSA 3S1RH 4R1JA 3ZYYX 4QGUA 1UD6A 4XR6A 5JJLA 4B3XA 4HMIA 3KLRA 5L37A 1B2TA 3MXUA 4OONA 4C3IH 4A75A 3TS0A 4NB3A 2YWHA 2OBSA 4RA8A 4A3GB 1EIFA 1WI5A 2IWHA 1S40A 5THXA 4Z4UA 2RHSB 2MGSA 3NP8A 1E1OA 2FMMA 1WD1A 3Q38A 4LF8Q 1MKHA 1MSHA 1PRTB 3GDEA 1AZPA 2NPFA 1KTKA 3H94A 1I4HA 2HDNB 4A3KB 1D1NA 2YTXA 2M5SA 2AUJD 1E1QA 3VR5A 3E3XA 1NR4A 4A93B 2DYIA 1TWFB 1E64A 5J35A 3OWEB 4KV6A 4JI8L 2VBTA 4CJ0B 1VDZA 2K52A 1PDQA 5IGCA 1OXXK 4KI0A 4II3A 2QA4A 2NVXH 2D3NA 1U0LA 1NCVA 1GUSA 1II3A 2VNUD 2B29A 3FRPB 2OTJB 3M9BA 1J6QA 1E3PA 2ZBVA 1PFNA 4A3JB 2Q8TA 1K73C 3I4MG 3BY1A 2A68C 2JA6G 3OHXC 3Q24A 5AN9A 5M5WH 3KDFA 3GQBA 2XIWA 2R6GA 1GXDC 4FXUA 1SE8A 3I56A 4TVAB 5M9OA 2E76C 3OSOA 3WXMA 1KLUD 1NJIC 3UDIA 3AVWA 4G4KA 4A4IA 2C78A 2RHQB 1XNRL 2RVLA 2IT1A 1GAWA 3VMFA 1QCBD 1G51A 4A3LG 1IXRA 4JI3L 3VDYA 4DK0A 1NE3A 1OGIA 1V1PB 1K83H 4A3FB 5F4MA 2GN5A 3DMUA 4C1NI 1N36Q 3GSIA 2GQFA 5ELOA 2OWOA 4H02A 1XNQL 3HGBA 4JI8Q 4DUZL 1N8RD 2E2DC 4GN3B 1S5FD 1A63A 1E7ZA 1K9MD 2QE7A 3S2DB 2YWFA 2JQOA 4HIOA 3I91A 2NVYB 3NUCA 4R8NA 1KABA 1AEXA 3L7ZC 3GO5A 1UEBA 3S2HB 5FLMH 2ZXOA 5B6IA 2CH4A 3TREA 1CQVA 4Q5VA 4C1NK 2JJ1A 1CNFA 5GV8A 4DNRB 2KOLA 2K5QA 1VF5C 1G91A 4JI7L 3W1BA 1XTCD 4GKKQ 2EXZA 4DV4L 4DV7L 1EIHA 2X85A 5G3LF 2BV3A 3A8IE 4IUQA 1UE7A 4X62L 3KYHC 3PUZA 1M8AA 1YITA 5BR8Q 1I4XA 4X65L 5C0XJ 4DV1L 3ES9A 4UZEA 3G6JB 2QEXB 2J4XA 4DNTB 4RH6A 5A8AA 1Q82D 3M7GA 3PV0A 4IUPA 4YCVA 4CDDC 5M3FB 1BKBA 2C35B 3MFYA 3MEHA 2C5HA 1VQLA 1MHWC 2K50A 4O0AA 2NZOA 2F0VA 4K5XA 3SEJA 4DQLA 2F0UA 1HPCA 2OK7A 1PJ6A 4P6YA 1L0XB 1W35A 2PW5A 4OHJA 1STEA 2XOKA 4JI5Q 1Y0YA 1X56A 3LWEA 4A3IH 4JI5L 2AMCB 2NVQH 3DWPA 2VQEL 3LGJA 2X6YA 1OXVA 2TSSA 4AQYL 1UAPA 5EPLA 3CQZB 1N0VC 4PNYA 1N06A 4RFBA 5E3FA 2NVXB 3R8BA 1I50H 4BY1G 2F0QA 2ZTDA 4LUVA 1Q9SA 2E74C 1HZEA 2IX1A 4R71A 3KK7A 1YZ6A 2VNJA 1WCMB 1PTOF 2OCEA 4YY3Q 5A2QE 1B2RA 5KGUA 2DY8A 4MZ9A 3JQQA 5AJ3Q 4NPSA 3T56B 1JICA 4B9XA 4JI4Q 4ZKBB 4OO1I 3I4NH 4NXNL 1K8OA 1UUPA 3HKZG 3STBC 3T1YQ 4QUZA 2L0CA 2RF4A 1PLFA 1CK1A 3QSYA 3L0OA 3LO8A 1XFOA 5C4HA 1BMFA 4JMQA 3VO1A 3QFRA 3L3OC 3MAQA 2O5IC 3PO2H 1KAWA 1KIXA 3J80E 5J3OA 3F8TA 4DR1Q 4LBYA 4JK1C 3CF5A 1R9TH 4FP5D 1N8RC 2IX3A 3G7LA 3P7JA 5EPKA 4F8MA 4LK1C 2B8FA 2Z6KC 3LX0A 2GVBA 5G3LD 1ZKOA 2E2JB 2F0KA 3V2TA 5C3WA 1O7LA 4JBKA 1FL0A 1J8IA 1AFPA 4F87A 2NN6I 3CP0A 2O2LD 2A6EC 3QFTA 4QF4A 4LF7Q 4WQMA 1KRHA 1SEBD 4DR3Q 3J7YW 2MHVA 4YWMA 1ZXTA 2F3WA 1JQYD 3M4PA 1DDGA 1WPCA 2J0TD 1DJRD 3QO2A 4YHBA 5IGFA 3K5MA 5CV6A 1E3XA 1HA5A 1JA1A 1HZCA 4OX9Q 1VQ6A 2OF1A 4FF2A 4A3CH 2D62A 1I3QH 4A3MH 4K6LA 2V1CC 1Q81D 1Q86D 1PJ7A 1SE2A 1UWVA 3GV3A 1QB5D 3NWTA 1VQ5A 2WV6D 3QWNA 5FJ8H 5CMDA 4LF7L 4C0SA 3BS1A 1U2RA 2BM0A 1K73D 4JI4L 3HOWH 1SN8A 1TWGB 2K01A 5C44H 3W2IA 4KKTA 1PFBA 4DQKA 1TVCA 1VQAA 1LO5D 3GD7A 1N33Q 2Z6BD 1YX2A 5IT9L 3KUPA 2W6JA 4R4CA 1IBML 4Q7JB 3BCFA 2E8GA 1VQKA 1FNDA 4TQUS 5DEHA 1ILPA 2DJFC 4DK1A 2GJRA 3SXHA 4DKAC 4XOPA 3CMAA 4LF9L 1PHJA 3GTOH 2C4TA 4CQJA 2ALYB 2NV4A 1CNEA 4RPDA 1AMOA 1KRTA 4LFBQ 1IJEA 3ITPA 5CYUA 2F0EA 1QZGA 3KFUA 1KHIA 2F0JA 1TQOA 2WB1B 1GAQA 2D2CC 4G5GA 1LTBD 4JI1L 2WPDA 4P22A 3HOXB 3NENA 5JVH3 1JWSD 1HZBA 3FKIH 2IHFA 2NVTH 2W6IA 2I46A 3KBXA 3M3YB 1TWHH 2B2UC 2QCPX 4K0KQ 2UU9L 4LFCL 4K6DA 4OWWB 1E1RA 1TWHB 2Z6BA 2PI2A 2WSSA 1WJJA 3H0GB 4DV7Q 3HOVB 5I2YA 4NNJA 2RKSA 3PQIA 1I6HB 5BN4A 1KC8D 4DV6Q 2A69C 4WZTA 3I7FA 1KQSA 4K5VA 3NE5B 1MRZA 5M5XB 1LV9A 1N07A 1OHHA 1SM4A 1EY8A 5F4JA 1U4LA 4P3YA 2KVMA 1BQQT 1XTDA 3HOYG 1L1OA 1HZAA 2VBUA 2AQ3B 1EFUA 5M3FG 3SKBA 1GUOA 3EJIA 4PAAA 3Q6RA 2BF4A 1C0AA 3KF8B 4JOIC 1XPRA 3CP2A 4KY6A 3CCQB 1WTPA 4DPGA 4F7XA 3CU7A 2R7ZB 2EY1A 2SEBD 2Q8RE 1JB7A 4BWGB 4AF7A 1HQMC 3C46A 3OE7A 4CKCA 3CRKC 1M90D 2E2HB 1Q46A 3HOZB 2WZNA 1VJSA 2K14A 3EIVA 2J7KA 4P12A 1FNMA 4A3EB 1OB0A 3LQ6A 5E4XA 2HDMA 2V7WA 3G71B 2NVYH 1RQRA 2ZL7A 5DM73 3S17H 1Z9FA 1Y8OB 1NMGA 5IE8A 3D3RA 5ELDA 3C2PA 2XZOA 2JXMB 4ME3A 2VXWA 3I4OA 4XKWA 2R7FA 4ZCKA 4C3JB 1WCMG 1WOSA 3VNVA 3NPPA 3CMMA 1X54A 2WAQE 1S4MA 3ND8A 4IO9A 1ONLA 2NUCA 3R6KA 1LT6D 5COYA 3CCLB 4OX9L 1F20A 2VL6A 4OL7A 2H4OA 1GOZA 4DV2L 3GTPH 4FXDA 1WTRA 2EYLA 2G9HD 1F2ZA 1PA6A 2X53S 4DV3Q 2K5VA 4BA2I 1MJEA 4L5RC 1FJGL 4BXXG 2LKVA 4TMZA 5LL6X 1ZYRC 1NRKA 2VQFQ 5HGTA 4RHSA 4PC2A 2KQ3A 5JBQA 1I18A 3BZDB 1QFYA 2HD3A 2PNHA 3CESA 1DOKA 4APVA 3EBEA 2K33A 4RG1A 3D4WA 3I4NB 1B4OA 4BBRG 2KCCA 4PQXA 5GROA 1JE4A 2GK7A 2WYRA 4ZAIA 4ZCMA 3CRLC 2QTZA 5KNCA 3E6ZX 1HUNA 1EXMA 5DM63 2I07B 1QG7A 4JYAL 5IP9H 1VQJA 3CCEB 5CR3A 1UD5A 1E3ZA 2IW3A 1FRQA 1E1TA 2EDGA 1HXYD 4HJ7A 1VQBA 2CCZA 4KK7A 1VQMA 1H9JA 4P1VA 1VQLB 1IKLA 4BY7H 3TMEA 1KXLA 2HLDA 4LUOA 1HTPA 3DM3A 2OTLB 4N9TA 3CP8A 1XWEA 2ZJQA 1LUZA 2AWOA 1PRTC 1L2FA 2H5XA 1VQCA 1EYAA 4IUVA 4FF1A 3ICEA 1YHQA 4QIWB 1GKHA 1JORA 2M00A 4RJLA 4ZCLA 4WFN3 5C3EH 4Z1MA 3W2DA 5K5PA 2DGYA 2BGIA 2PYKA 5H59A 1HTLD 1HQRD 1W2BA 3G6EB 3H3VH 3FPUB 1G2TA 4DAMA 1WTXA 1V1OA 4AYBB 1KNAA 1V5VA 2QILA 4P26A 4UDUC 4DR5L 4GQNA 2A6HD 2BOSA 1CM9A 1CT1D 2K03A 4PGOA 1D5ZC 1EQQA 1Y1WG 1C48A 2VZAA 2A1AA 2EY5A 3SHLA 3IAYA 2NN6G 5IYDG 4DF7A 1TXYA 3S17B 1N05A 3G4SB 4DUYQ 1JJGA 3MHBA 5IYWA 3WDNA 5A2QL 4X7EA 1E22A 1C7YA 1QVGB 2YYZA 2VY3A 3I56B 1X9NA 1XPOA 3CHBD 1I7PA 1I4GA 4M0LA 2NB0A 1H9RA 1EWCA 2E2IB 1N36L 3MXPA 2AQ1B 3A56A 4P2CB 3E1YE 4B3RL 4OOXA 1TWAB 1DOMA 3E0EA 3BU2A 3SJZA 1YHBA 4A3FH 3HP3A 2EJFC 3GTKH 4K2LA 1Q3LA 1N34Q 4A3DG 2RSOA 3IRBA 1HUMA 2XWJB 4WWVA 2ZT9C 2F3VA 1BR9A 2JA7G 2XGJA 4CHTB 1G6ZA 4QUFA 4DGZA 3C1EA 4EX5A 1HR0L 1VQIA 1JE5A 2ZXPA 1E2WA 4XYQA 2WACA 5M3MH 1JB9A 5FIUA 1WTHA 4MNOA 4CDFC 3F2UA 2GREA 4X64Q 4K14A 2RDHA 4P73A 1LTGD 2LY7A 1TLLA 4U68A 3SVMA 4Z4RA 1EP2B 4A3JH 1T6YA 3RN5A 1VQGA 2HIXA 4Y9UA 5KYLA 2Z6KA 1TS2A 2UXDQ 2DEUA 5C6AA 4MYUA 2AHOB 3CTAA 2B2VC 3AEVA 2D3LA 2C5BA 1F2YA 2BE5C 4A3BG 4G1BA 1L1OC 1B3AA 3K0XA 2PMZE 3A8JA 3OZUA 1JJ2A 2XGTA 1STHA 4X8IA 4X07A 4B47A 4DAVA 4AQYQ 2F0IA 4DV4Q 4GLXA 5CC4A 1ASYA 3HOZH 2P5ZX 4ROXA 2DNCA 5CV7A 3K58A 2AUKA 2OK8A 5C5LA 2K5HA 2KVOA 5TR9A 1PFMA 1KNEA 1LACA 2NBFA 1YNNC 1D2EA 2BGJA 2CVRA 3PSIA 2B2UA 3QOLA 2OXPA 3JAMi 4LF6L 3UDFA 1VQHA 4G7XA 4A3GG 2FVGA 2HQLA 5GQOA 1W0KA 1WSRA 4PMWA 2JA8H 1QUEA 1QFJA 4XNFA 1X55A 3JQRA 4B3TL 1H95A 3CD6A 1J9ZA 4Z4ZA 3ZUGA 1RODA 2F0SA 4X3KA 1CHPD 3PUMA 3S1RB 5C0XH 2HHHL 3TRZA 2UUBQ 3D6WA 2BPOA 4OO1G 1IW7C 5C4JH 1EFWA 2PCFB 5IK2A 1EWHA 4B3ML 5C4JB 4L8JA 1VQKB 2B8GA 4A76A 2KUMA 4FWTA 1G291 5KNDA 3CMEA 4A3JG 1BF4A 1XPUA 1A3UA 4RD1A 5D65A 1GR1A 1YHQB 4RM0A 1X32A 3CKIB 3VYSA 1YJ9A 4FO2A 4IFDI 3FKIB 1VQ8A 2KHIA 1BQEA 5ELFA 1A3VA 2EVBA 1H9SB 3QB3A 2WB1E 1ENAA 4ZGNB 4MN3A 5CBAE 4PV1C 4ODGA 4HEDA 1STNA 4C3HG 4JI6L 2F3IA 1XYIA 2OQ0A 5T1GA 3NQTA 1FDRA 1DDIA 4IW3B 1YJWB 1PZJD 1YITB 2EIFA 1J5EQ 2FXQA 3CPXA 3WNCA 2D0OA 4BS9A 2B2YC 3F1ZA 3OFNA 2MUYA 1VMPA 1PTOD 4R4OA 1K3BC 3TZDA 3MXNA 3T13A 1Y1VB 3CCSA 2EYMA 5IYRA 1COWA 1DM0B 3KDFB 1IL2A 4HSPA 3BYYB 4AYBG 5LMNQ 4HIMA 3ZZTA 3NBHB 4N8X1 2VW9A 4CJ1B 3U6BA 2EYOA 1OB2A 1VQPA 1O7YA 1ZM4A 1PH1A 1F2MA 5LMUQ 4X65Q 5M5YB 3M4QA 5JPMC 1CZGA 3I4NG 1SLJA 4KN7C 3GTMH 1CQXA 4L63B 2Q6KA 3U58A 5M5YH 5LMNL 2JIZA 2B2YA 1EYGA 2ZZQA 3GTLB 1RTOA 3QFSA 4I7AA 4CGYB 4BY1H 3PVDA 4R8IA 3GTGB 4GOPC 2FX3A 1HNZL 3D4RA 5F2DA 2IY5B 3CMEB 4DR6L 1TY2A 3GVKA 1MI2A 4NP5A 4LF9Q 1FR3A 2A68D 3F2DA 5BN5A 3GIRA 4U9UA 1EIGA 2Z1CA 4UP7A 4ZV4A 1ESRA 1MGSA 1O80A 1N32L 2K1BA 2HIVA 3R93A 3QOJA 4JBMA 1IBMQ 1VQ7B 1I94Q 5TSSA 3W5HA 4O42A 1WVLA 2XNAC 3OMGA 2RQXA 1JCKB 1LTRD 4N3NA 4R4IA 3H6MA 1F9PA 1AN8A 3S1QH 3BZCA 4LBZA 1D6EC 1FNWA 1VLOA 1A3TA 2ID0A 3D31A 3CC4A 3EQLC 5IWAL 4RDJA 3RLFA 5DN6A 3U4VA 1CA6A 3OEEA 1JOQA 2X0KA 3CD6B 1X3EA 3K7AH 4DXFA 4MHEA 1Q1EA 1T9HA 2CHBD 5JOBA 4B3MQ 3BH4A 1TVXA 4LC0A 4L6TB 3J81L 4YAOA 3P75A 4DUYL 3W5UA 1I3QB 2UXBL 2QA4B 1K8AD 1YJWA 1KAAA 3V76A 1OO9B 1VQNA 5IWAQ 5JEAJ 1B1ZA 4UPAA 3SDZA 3FHWA 3UDXA 3VR6A 2NN6H 3SR1A 3RZDB 5IYDH 3MMPA 3VYRA 1CQFA 3J80c 2VZLA 1IBKQ 5KYIA 2FHTA 3DHQA 2E5LQ 1YNND 1Y1WH 4OPSA 4B3SL 1TUIA 1SYDA 2O5JC 1UD3A 2DERA 5C3EB 1CUKA 2CQAA 4EQPA 1LT5D 2E2JH 1E24A 4BBSB 1SROA 2Q6IA 4O2DA 1EQRA 3J7AV 1SKQA 3CW2A 3BQJA 3W2EA 2OT2A 1FRNA 1VQ7A 4WJ4A 1OXUA 3U2QA 3R3OA 1BBWA 4CKEA 2A6HC 4Y7NB 2XWBB 3JAMc 3SLDA 3TP6A 2EXDA 1BLIA 2B2VA 1FVIA 3BDLA 3RUZA 5BSYA 5FLXE 2R92G 4NXNQ 1PTOH 3X3MA 1SNMA 4KN4C 1DARA 4XN3A 1M1KD 3FVQA 4RPBA 2CH4W 1AH9A 1V1PA 4OOSA 3D0FA 5DNFA 4YWLA 4XKVA 4LBWA 3K81C 4B9WA 3W5OA 2PLFA 3CPWB 1RCVD 1QVFA 1H42A 1E62A 2SDFA 2HT1A 4IUTA 4R9WA 1D5MC 3VR2A 4UP9A 1WOPA 5LHY1 5BR8L 1EY4A 3M4YA 3J81i 2RBMA 3KLSA 2NWGA 2D0PA 3PO3H 1JWUD 3PCOB 1F77A 2BH8A 2L15A 1GHKA 2ZITA 2CBXA 2YU9B 2X6WA 1SYCA 4OP7A 1I5FA 1ET9A 1EY6A 4DV2Q 4TKOB 3S14H 3SLNA 3C2QA 4KY7A 3OW7A 4PC7A 5FLXc 3IFDA 1Z47A 4YHHQ 1SXTA 3QE2A 1I6VC 3DWQA 1EP1B 4IJLA 3RZOB 2XSCA 3K5OA 4A3BB 1C4QA 2CK3A 3VYUA 1ICFB 3H09A 3AGPA 4KLKA 3SK8A 2F03A 2LXJA 2GJPA 4FNFA 4UAJA 2CWAA 3ULJA 3Q22A 1JWMD 3GTKB 2XNJA 3GTPB 1EEFD 4POFA 5A89A 1K83B 4BXXH 2GK6A 1A2UA 5IIFA 1B50A 4XN0A 1KDBA 4C3IB 1XNQQ 2JEAI 1TWAH 3ZBTA 4IQZA 5ELCA 3HOWG 3HOUG 2K5DA 1ENCA 4P9SA 1JB3A 4P71A 4TMWA 4Y7CA 2CW0C 5I6WA 2YTVA 1QNUA 3HKSA 3FMCA 1HCZA 1VCIA 5IGDA 1VQ9A 4JOIA 3NEMA 4UY8C 1JC7A 1LM0A 2KCTA 1ELOA 1I8DA 1QNKA 1SBBB 5DLQE 1PTOC 2KCMA 4E6IA 5ISRA 5M5WB 1S72B 3B82A 1PYBA 2PQAB 5EMNA 5CDFA 5IYQA 3W5VA 1P8LA 3VA7A 4TMVA 1STBA 3LWUA 1YEZA 1QUFA 1KMHA 3CCRB 4S3SA 1BCPF 4HIZA 4ZCIA 1MIUA 4RGNA 1SFOB 2Q2HA 2ZXRA 3STBD 1JR0D 1RKNA 2EJMA 1Q12A 2R61A 2Q2UA 3S14B 1MABA 3D6CA 3E20A 2SNSA 1CI3M 3S1NH 1SE4A 2NZ1D 4DR6Q 5F4OA 5TV2A 1VQEA 5JPNC 1FGUA 3IFTA 3OW2A 1R5NA 1XQBA 3FDTA 1LT4D 1RIPA 1XNRQ 1WOOA 1FD7D 3TDQA 5FO7B 1Q1BA 4G7HC 4CKBA 2F0GA 2F0DA 1XJVA 3G4SA 5GAEC 5K36H 2V7TA 4P2NA 1HNXL 4IFDG 2JN9A 3M7NA 3CRZA 5H1SE 3S24A 2PZTA 4C43A 3MXNB 3CCEA 3ZZ0A 2VYQA 1EWIA 2PMZB 2WKDA 1YBYA 2Z9HA 3DUZA 3KOJA 4LF4Q 3HEJA 2PZWA 4DFAA 1HNXQ 2L4NA 4RGOS 2EJGC 2Z0SA 4HIDA 5E1FA 1BJKA 1TR5A 4KHVA 4OGQC 2QEJC 3ZPNA 3BDOA 4GLAC 5KNBA 2MNAA 4Q0FA 2F1MA 3URYA 3ZBUA 1RDPD 3TBIB 1QG0A 1B9NA 4C3JH 4PZ7A 5FA6A 1Q7YC 4A3MG 4KJOA 4JC0A 4HN7A 2XZLA 4ME5A 1FGBD 2JYOA 3TS2A 5C0XG 1SSOA 2DIEA 1SYFA 2GPJA 1BUVT 4V0BA 1VQ5B 5C4XB 1DZ1A 1HH2P 1X3PA 1FJGQ 1V1QA 5ELEA 4X66Q 4RD2A 2QGQA 2RCNA 4RD4A 3Q6QA 4XXEA 2YWEA 3WNBA 4YAUA 2ZZEA 3R2TA 4RDKA 1EU3A 1I4RA 1N08A 3HAGA 2JEBI 3D8GA 4A3KH 3J81k 3WWVA 3DDYA 4ILWA 4L5SA 4B3RQ 3VR4A 1RD9D 5DAUA 3CXCB 4J6HA 5IYBG 2EPBA 4IUNA 3ISXA 3WNDA 5CV9A 2BE5D 3KJOA 4HJ9A 3NSWA 2CFMA 4EGVA 2DOGA 4XIGS 3H3VI 1KDAA 5EBCA 5TRDA 3AVTA 3U9SA 4A3DH 3BY2A 5CV8A 3FJOA 4RCOA 2BMWA 4ZRZA 3TP8A 3OW2B 2D74A 3WOFA 2CWPA 3HRZC 1OXSC 4G7WA 3MFGA 3A8KA 3OKXA 3OZWA 1STAA 2FFKB 4DR5Q 1E63A 1NBWA 5FLMG 1YJNB 1VQMB 1L1OB 4QY7A 3GTQH 2VUMG 4FXKC 3OTOL 3M85A 4DN4M 4NDXA 1YJ9B 1UNSA 4X05A 4NCNA 2M9VA 2IJ0A 2MO0A 4DV0L 2WAQG 2OBTA 4OWTB 2B7BA 2ATWA 3KF6A 1N0UA 4HJ8A 2KA7A 4XLCA 1H9MA 3VNUA 1G8ZD 5IT9c 3OJWA 1PV4A 3NQIA 2X6XA 4A3IG 3PIOA 1QVCA 5E4WC 1PH3A 1SYEA 3OIPA 1R4QB 1X3FA 3A35A 2PIAA 1RJTA 4WZLA 2NTSA 1Q81C 2Z8LA 4HAEA 1YNJC 3GTOB 1D1IA 2N88A 3RLNA 3AQQA 4FVMA 3UDGA 4JI2Q 2A8VA 3W2GA 3MA2B 1VQ8B 5AFWA 1PH2A 3AFQA 1ET6A 1EFCA 1G7SA 1WTWA 1ESFA 3SGIA 2E1RA 2YV5A 1BDOA 5J3BA 3R6JA 2WINB 4JBJA 2B2TA 3Q0AA 2D9UA 1M4VA 4JI0L 4YELA 1TWGH 3H0GH 1A2TA 3KEWA 2LFNA 2ZTCA 3CPFA 1BBXC 4GN4B 3CCQA 1I50B 3T16A 3V05A 3AGQA 3ULLA 3NK9A 3JC66 1EWYA 2L1BA 4LF5Q 4B4DA 1TWCB 1PKVA 2VNKA 2WP8J 3CXCA 4A93G 3HFZB 3H91A 1FNCA 3EROA 4M2LA 2X3UA 2TMPA 3ASPA 1BNZA 1SMYD 4RD6A 1DG1G 4GKJQ 4Z4SA 1VQ9B 3OPOA 2DUDA 2L11A 3VYTA 1AP0A 4P3IA 3ASQA 1VQOA 1NR2A 2J7ZA 3A55A 2CKZB 3AVXA 5JJKA 3OTOQ 1SE3A 2VNIA 2F0HA 1V43A 1T6XA 3ZC3A 5JEAG 1UMKA 1VQ4A 5IT9E 1TTTA 4QFMA 1UD8A 1Y1VH 1UE5A
chains in the Genus database with same CATH topology
4A3DB 4KTAA 2F0FA 3NXWA 5EKIA 3Q6SA 2XRSD 1TS4A 4H44C 1UD4A 4XQQA 4RKBA 3DXJC 1ML0D 3S1QB 1S5BD 5D14A 5EJWA 2VJIA 3L9AX 1DCZA 2JA7B 1TS3A 2DNEA 2WAQB 4XQNA 2C9OA 4KD4A 1EY0A 2HQEA 5JVG3 3J80L 3MZ5A 4KHZA 3D4DA 4Z9CB 5HURA 1GUWA 4BY1B 1SNCA 4XL9A 3ND9A 3K5NA 2F0PA 2DY7A 1H8EA 2RA4A 2PW7A 3OOCA 4QMGA 3P1HA 4F88A 4YIJA 1E0BA 3GVJA 2NTTA 3ERQA 4IURA 3TP5A 3JAML 4KD3A 1WD0A 2ZZFA 1Y69U 4XONA 1SDFA 2MPMA 1QOHA 3W3AA 1W0JA 4IUUA 5CBEE 3QG1A 2Z4HA 1OXTA 2EYFA 3GV6A 3NTHA 2CW0D 1VLYA 5T1IA 1ILQA 4RWSC 1HVXA 2A5HA 3DEPA 5J39A 5CGKA 4XOTA 2QF7A 1I4PA 4H13C 5EQ0A 3SEBA 3BVMA 1TY0A 4B08A 5KNLA 1D5XC 1LT3D 3K59A 4MIUA 3OEHA 2FMCA 3ZIAA 2VB2X 2F0NA 3JU4A 4C3HB 5JAVA 1WTVA 3BVGA 4G7OC 4FF3A 3TP7A 3TZUA 1Z7TA 1F9RA 2WKCA 2SNMA 1EQTA 1JOOA 3KBGA 4LMQD 3NTKA 2LS01 5FK9C 3QJYA 4LAAA 3HG9A 2BDNA 4UAIA 4IN3A 5EKLA 2A74C 2B2TC 1DOLA 2D5DA 5EBDA 1T5EA 2WIIB 1PZID 1PRTD 3DM1A 5IGEA 1EYDA 3EA6A 1E43A 4OIJA 3S16B 4H0LC 1G2SA 1EFID 2PZUA 1K8MA 3T4AC 3V96A 2M2LA 1LTID 3I4LA 2EY6A 3C3LA 4M1UB 1TT2A 2E75C 2HUGA 1NAPA 5NUCA 1HHVA 5K36G 1EL0A 2HCIA 1R4PB 2BCOA 1EZ8A 2KEDA 2NYZD 4XORA 4PMCA 2VJJA 1BO0A 1ZYRD 3FKSA 1WP6A 1BOSA 1ZEQX 3A8KE 3A3GA 2KHSA 4RHRA 3RD4A 3E5SA 3PUWA 2ZXIA 1E79A 4J8QA 1WTOA 2IPKD 3JAME 2F0LA 3PUYA 2ICEC 4XTCS 1C8CA 3I72A 5KIXA 1O78A 3A7AB 1V0EA 4X3TA 2MJ8A 2KEEA 2F43A 1SYBA 2EY2A 4UZUA 1SJED 4OO1H 3MWYW 1VMCA 2R92B 5HKKA 2X6LA 3K6OA 2LZJA 2DN8A 1CTMA 3HOYB 3AU7A 3HS0C 2K04A 2FINB 4RGMA 4U673 2IX0A 4ABNA 1PYWD 1BPLA 1X3QA 3MTSA 4CBVA 2ENBA 4G7ZC 4FYDA 2PNRC 4ZYSA 3O13A 5EGTA 3NBIA 3I4MB 2JA6B 4J1MA 1LTTD 3K7AB 3MC0B 3EFXD 2X69A 3E0JA 1NSNS 3TN2A 1EEID 2WJVA 5EKKA 1SMYC 1SNPA 4K8JA 4XYOA 3OMCA 2GA4B 1PTOB 2KJXA 5EPJA 3KLSX 2B2WA 4RCNA 3A54A 3EVQA 5CV5A 4DAPA 5J22A 4DU9A 4WJWA 1RTNA 5I9OA 1HRJA 1B9MA 5KRUA 4M8AA 1BCPB 4V190 4QUCA 1GUNA 1RF2D 3PIO3 1UD2A 2R3ZA 1Y1WB 2WJYA 4ZLTF 1PXUA 1EY9A 4HR7B 1EQVA 1SNDA 2EYPA 1UEAB 2NVTB 2B2WC 3S9WA 2L12A 1S5DD 3DEOA 2HDLA 3PUXA 2RSNA 3A7LA 1HFGA 4XD7A 1DONA 2JA8B 3SK6A 2R93B 1TU2B 2MP1A 2F0WA 4ID6A 2HCCA 1SJHD 4ZUJA 3J7AF 2N55A 2BDOA 4WORA 1W6KA 1LTSD 3GVLA 2LMCB 3GP7A 1F9QA 5BN3A 1FNUA 1XXGA 1FYCA 4OIKA 4KY5A 1W6JA 1STYA 4B3FX 2O4XA 1S4ZA 2F0MA 3K0YA 1NUCA 2JA5B 1CHQD 4K8IA 4N9PA 5M3MB 2NVQB 1Q90A 4K5WA 4DXGA 2BA0A 3NTIA 5ELBA 1A15A 1YNJD 4NKLA 1SNOA 2L9HA 2XRQD 1Y8PB 4IZ8A 2K6AA 1LLRD 1B53A 2JE6I 2JP1A 2QDBA 4PMBA 3HZXA 1AW7A 3S1NB 1SKYB 2ZTGA 2EOTA 1EFRA 5KEEA 2E1BA 1E2VA 4ZKCB 2VUMB 3DWAA 3H3VC 2B39A 3VA5A 4LJZC 5I9PA 3MVVA 2C5CA 3I73A 5C4ZA 1V8QA 1KLGD 4A3MB 1AZQA 1IYVA 4A3IB 2F0OA 3BVZA 4XT1B 5CORA 1U4PA 4BA1I 1GUGA 5IGBA 5JJZA 3NBHA 3BCDA 1O7ZA 4XLFA 1T5XD 3BYTB 4KJNA 4XLEA 4RKLA 1GHJA 1RHPA 3VR3A 1TS5A 2A73B 3MXGA 2JDIA 2FJ2A 4FF4A 3G05A 4YXWA 2VB3X 4BY7B 2H1EA 2Z4IA 3PO3B 4XT3B 5LL6S 3I70A 3SK5A 3RMHA 3IL8A 3K57A 1BCPD 3I3CA 1PMRA 1PZKD 3AMUA 5FO8B 5FO9B 4QCLA 4XLHA 4RAUC 2F4IA 4E0FA 2K28A 3A8JE 3PIP3 1E2ZA 2A69D 4YEJA 3UI2A 1ENFA 2PPBC 2PO4A 4TRDA 5FKAC 1EY7A 1F9SA 1NBMA 1W9XA 2WZPP 2ZXHA 4XM3A 1KDCA 3QIAA 1GUTA 1BXTA 3NWSA 2AWNA 3AB9A 2V31A 1CZWA 2K32A 1QE6A 1STGA 4XQFA 5A35A 1LTAD 1K28D 4C3JG 3I8ZA 1H9KA 1WTQA 1U4MA 3IKJA 4XDXA 4HMJA 4H7BA 4CJ2C 3BDCA 4TSSA 5IGGA 3I90A 2K05A 1MBYA 4ZK9B 4DA2A 4K2KA 1J9OA 4ASUA 4IALA 4EVOA 1LABA 1ICWA 2XN9C 1U4RA 4NMZA 2K7VA 4KKUA 3R2IA 2K5WA 4G57A 3N6RA 2ICIA 1PRTF 3X3NA 3N52A 4X3SA 4I65A 5JEAH 2XVSA 1H9SA 4O1NA 4C2MB 2XNDA 1WTHD 4IFDJ 2EYJA 3T53B 4ZQ3A 2JSOA 1DXMA 2B63B 3K5LA 2F0TA 5C0XI 5IODA 1FX0A 3S15B 2ZTNA 4ZUIA 4EQNA 1D1KA 2IL8A 2RDGA 2L5TA 2JJ2A 4C3IG 2BA1A 2A6ED 3WOEA 1S5ED 2ZZGA 1QJOA 2X6GA 1FNVA 2EZVA 4WRDA 3SK4A 4RGTA 3S1MB 5C44B 2Y0SB 3M4OB 1Z6HA 2OEOA 5D3DA 2SOBA 1EU4A 4B3GA 3A3BA 3PUVA 3LNNA 1V0FA 1U9RA 3FPPA 4GZYC 2L55A 4BBRB 3WQZA 1H8HA 2V4DA 1XX8A 1DYQA 1F2LA 2X8KA 1DD2A 2R9VA 3OAAA 1EY5A 3GTQB 1L0YB 4DAYA 4XLAA 2EYHA 3P20A 3U9OA 4I7ZC 1TKWB 3ONAB 4KMUC 4AVZA 1BCPC 1MSGA 1R9TB 3TSSA 5I2XA 2GJKA 5CV4A 3Q23A 3OWFA 3PO2B 5I4DA 1JOKA 5IOCA 1B44D 3HOWB 2RDFA 1KZLA 5C5MA 4IFDH 1TIID 5C3XA 1D2BA 1IKMA 2XZPA 2EE1A 1S5CD 4XMYA 3KF8A 4ULLA 3T51B 2KECA 5FOBB 4XQJA 1GJXA 3FEWX 4TSFA 3NHHA 5D3IB 1Q8IA 5J1ZA 4HCEA 4X3UA 3GTMB 3SE0A 3PMFA 4HCSA 3HKZB 1SAPA 4QB4A 1QILA 4EQOA 1CA5A 1QWYA 5I6YA 5FLXL 2QKIC 1CFMA 1EYCA 2PQEA 1HA6A 1IL8A 5FL7A 2Q8IB 3HOUB 4II2A 1EOTA 1IW7D 3J81E 1A6XA 1VF7A 4TT3A 3OIQA 4HSVA 1IHZA 1SNQA 1IYUA 1SYGA 2G9DA 4FXGC 1MD2D 3GTJB 2KCNA 2V7QA 4JBWA 4NW2A 4C56C 3BC9A 1HFNA 4G6IA 1EZ6A 1Y8NB 4HTHA 3C1FA 1I4QA 3BG3A 4KKSA 3ZYYX 1UD6A 4XR6A 4HMIA 3KLRA 1B2TA 3MXUA 4RA8A 4A3GB 2IWHA 2MGSA 3NP8A 2FMMA 1WD1A 1MSHA 1PRTB 1AZPA 1KTKA 3H94A 1I4HA 4A3KB 2M5SA 2AUJD 1E1QA 3VR5A 1NR4A 4A93B 1TWFB 3OWEB 4KV6A 4CJ0B 1VDZA 1PDQA 5IGCA 1OXXK 4KI0A 4II3A 2D3NA 1NCVA 1GUSA 1II3A 2VNUD 3FRPB 1PFNA 4A3JB 2Q8TA 2A68C 3OHXC 3Q24A 3GQBA 2XIWA 2R6GA 1GXDC 4FXUA 5M9OA 2E76C 3OSOA 1KLUD 4G4KA 2RVLA 2IT1A 1QCBD 4DK0A 1V1PB 4A3FB 3DMUA 4C1NI 3HGBA 2E2DC 1S5FD 2QE7A 3S2DB 3I91A 2NVYB 3NUCA 4R8NA 1KABA 1AEXA 3L7ZC 3GO5A 3S2HB 2ZXOA 1CQVA 4Q5VA 4C1NK 2JJ1A 4DNRB 2KOLA 2K5QA 1VF5C 1G91A 1XTCD 2EXZA 1EIHA 2X85A 5G3LF 3A8IE 4IUQA 3PUZA 1M8AA 1I4XA 5C0XJ 3G6JB 2J4XA 4DNTB 4RH6A 3M7GA 4IUPA 5M3FB 3PV0A 3MFYA 3MEHA 2F0VA 4K5XA 2F0UA 1HPCA 1L0XB 2PW5A 4OHJA 1STEA 2XOKA 3LWEA 3DWPA 2X6YA 1OXVA 2TSSA 5EPLA 1UAPA 3CQZB 4PNYA 5E3FA 4RFBA 2NVXB 3R8BA 2F0QA 2E74C 1HZEA 2IX1A 3KK7A 1WCMB 1PTOF 5A2QE 5KGUA 2DY8A 3T56B 1JICA 4B9XA 4ZKBB 4OO1I 1K8OA 1UUPA 2L0CA 1PLFA 1CK1A 5C4HA 1BMFA 4JMQA 3L3OC 3MAQA 2O5IC 3J80E 4JK1C 4FP5D 2IX3A 3G7LA 3P7JA 5EPKA 4F8MA 4LK1C 2B8FA 3LX0A 5G3LD 1ZKOA 2E2JB 2F0KA 3V2TA 5C3WA 1O7LA 1J8IA 1AFPA 4F87A 2NN6I 2O2LD 2A6EC 4QF4A 1SEBD 3J7YW 2MHVA 1ZXTA 2F3WA 1JQYD 1WPCA 2J0TD 1DJRD 3QO2A 5IGFA 3K5MA 5CV6A 1E3XA 1HA5A 2OF1A 4FF2A 2D62A 4K6LA 1SE2A 3NWTA 3GV3A 1QB5D 2WV6D 3QWNA 5CMDA 3BS1A 2K01A 1TWGB 4KKTA 1PFBA 3GD7A 1LO5D 2Z6BD 5IT9L 3KUPA 2W6JA 3BCFA 4TQUS 5DEHA 1ILPA 4DK1A 2GJRA 3SXHA 4XOPA 3ITPA 5CYUA 2F0EA 2F0JA 1TQOA 2WB1B 2D2CC 1LTBD 2WPDA 4P22A 3HOXB 5JVH3 1JWSD 2W6IA 2I46A 3KBXA 3M3YB 2B2UC 2QCPX 4K6DA 1E1RA 1TWHB 2WSSA 3H0GB 3HOVB 5I2YA 4NNJA 2RKSA 1I6HB 5BN4A 2A69C 4K5VA 3NE5B 5M5XB 1LV9A 1OHHA 1EY8A 1U4LA 2KVMA 1BQQT 2AQ3B 1GUOA 3EJIA 3CP2A 4KY6A 1WTPA 4F7XA 3CU7A 2R7ZB 2EY1A 2SEBD 2Q8RE 4BWGB 1HQMC 3C46A 3OE7A 4CKCA 3CRKC 2E2HB 3HOZB 1VJSA 4A3EB 1OB0A 5E4XA 2HDMA 5DM73 1Y8OB 3D3RA 5ELDA 3C2PA 2XZOA 2JXMB 2VXWA 4XKWA 4C3JB 3NPPA 3CMMA 3ND8A 1ONLA 2NUCA 1LT6D 5COYA 4OL7A 2H4OA 1GOZA 4FXDA 1WTRA 2EYLA 2G9HD 1F2ZA 2X53S 4BA2I 2LKVA 5LL6X 1ZYRC 1NRKA 5HGTA 4RHSA 2KQ3A 1I18A 3BZDB 3CESA 1DOKA 2K33A 3D4WA 3I4NB 1B4OA 2KCCA 4PQXA 1JE4A 2GK7A 4ZAIA 3CRLC 5KNCA 3E6ZX 1HUNA 5DM63 2I07B 1QG7A 5CR3A 1UD5A 1E3ZA 2IW3A 2EDGA 1HXYD 4KK7A 1H9JA 1IKLA 3TMEA 2HLDA 1HTPA 4N9TA 3CP8A 1XWEA 2AWOA 1PRTC 1EYAA 4IUVA 4FF1A 4QIWB 1JORA 2M00A 4WFN3 4Z1MA 3W2DA 5K5PA 2PYKA 1HTLD 1HQRD 3FPUB 1G2TA 1WTXA 1V1OA 4AYBB 1KNAA 2QILA 4UDUC 4GQNA 2A6HD 2BOSA 1CM9A 1CT1D 2K03A 1D5ZC 1C48A 3IAYA 2EY5A 3SHLA 2NN6G 4DF7A 3S17B 3MHBA 3WDNA 5A2QL 2YYZA 3CHBD 1I4GA 2NB0A 1H9RA 1EWCA 2E2IB 3MXPA 2AQ1B 3A56A 4P2CB 1TWAB 1DOMA 3HP3A 2EJFC 4K2LA 1Q3LA 2RSOA 1HUMA 2XWJB 2ZT9C 2F3VA 1BR9A 2XGJA 4CHTB 4QUFA 4DGZA 3C1EA 2ZXPA 1E2WA 4XYQA 2WACA 3F2UA 4K14A 2RDHA 1LTGD 2LY7A 4U68A 3SVMA 5KYLA 1TS2A 5C6AA 2B2VC 2D3LA 2BE5C 1F2YA 1B3AA 1STHA 4DAVA 2F0IA 5CC4A 2DNCA 5CV7A 3K58A 2AUKA 5C5LA 2KVOA 1PFMA 1KNEA 1LACA 2NBFA 1YNNC 2CVRA 2B2UA 3QOLA 2OXPA 4G7XA 1W0KA 4PMWA 4XNFA 1RODA 2F0SA 4X3KA 1CHPD 3S1RB 5C0XH 3D6WA 4OO1G 1IW7C 2PCFB 5IK2A 1EWHA 5C4JB 4L8JA 2B8GA 2KUMA 1G291 5KNDA 1BF4A 1A3UA 5D65A 3CKIB 1X32A 3VYSA 4FO2A 4IFDI 3FKIB 5ELFA 1A3VA 2EVBA 1H9SB 3QB3A 1ENAA 4MN3A 5CBAE 4PV1C 4ODGA 4HEDA 1STNA 4C3HG 1XYIA 5T1GA 3NQTA 1PZJD 4BS9A 2B2YC 3OFNA 2MUYA 1VMPA 1PTOD 3TZDA 3MXNA 3T13A 1Y1VB 1G6ZA 2EYMA 1COWA 1DM0B 4HSPA 3BYYB 4CJ1B 2EYOA 1O7YA 1F2MA 5M5YB 5JPMC 1CZGA 4KN7C 4L63B 2JIZA 2B2YA 2ZZQA 3GTLB 1RTOA 4CGYB 4R8IA 3GTGB 3D4RA 5F2DA 1TY2A 3GVKA 4NP5A 1MI2A 1FR3A 2A68D 5BN5A 1EIGA 2Z1CA 1ESRA 1MGSA 1O80A 2K1BA 3R93A 3QOJA 5TSSA 4O42A 1WVLA 2XNAC 3OMGA 2RQXA 1JCKB 1LTRD 3H6MA 1F9PA 1AN8A 1FNWA 1D6EC 2ID0A 1A3TA 3D31A 3EQLC 3RLFA 5DN6A 1CA6A 3OEEA 1JOQA 4DXFA 4MHEA 1Q1EA 2CHBD 5JOBA 3BH4A 1TVXA 4L6TB 3J81L 3P75A 1I3QB 1KAAA 1OO9B 5JEAJ 1B1ZA 3SDZA 3VR6A 2NN6H 3SR1A 3RZDB 3VYRA 1CQFA 5KYIA 2FHTA 3DHQA 1YNND 1SYDA 2O5JC 1UD3A 5C3EB 2CQAA 4EQPA 1LT5D 4BBSB 3J7AV 2OT2A 1OXUA 3R3OA 4CKEA 2A6HC 4Y7NB 2XWBB 3TP6A 1BLIA 2B2VA 3BDLA 3RUZA 5FLXE 1PTOH 3X3MA 1SNMA 4KN4C 4XN3A 3FVQA 1V1PA 5DNFA 4B9WA 4XKVA 1RCVD 2SDFA 4IUTA 4R9WA 1D5MC 3VR2A 5LHY1 1EY4A 3M4YA 2RBMA 3KLSA 2NWGA 1JWUD 1F77A 1GHKA 2X6WA 1SYCA 1ET9A 1EY6A 4TKOB 4KY7A 3OW7A 3IFDA 1Z47A 1SXTA 1I6VC 3DWQA 3RZOB 2XSCA 3K5OA 4A3BB 1C4QA 2CK3A 3VYUA 3SK8A 3H09A 2F03A 2GJPA 4FNFA 3Q22A 1JWMD 3GTKB 3GTPB 1EEFD 1K83B 2GK6A 1A2UA 5IIFA 1B50A 4XN0A 1KDBA 4C3IB 2JEAI 4IQZA 5ELCA 2K5DA 1ENCA 1JB3A 2CW0C 5I6WA 1QNUA 3FMCA 1HCZA 1VCIA 5IGDA 1JC7A 1I8DA 1QNKA 1SBBB 4E6IA 1PTOC 5ISRA 5M5WB 5CDFA 3VA7A 1STBA 3LWUA 1KMHA 4S3SA 1BCPF 4HIZA 4RGNA 1SFOB 2ZXRA 1JR0D 1RKNA 2EJMA 1Q12A 2R61A 3S14B 1MABA 3D6CA 2SNSA 1CI3M 1SE4A 2NZ1D 5JPNC 3IFTA 3FDTA 1LT4D 3TDQA 1FD7D 5FO7B 1Q1BA 4G7HC 4CKBA 2F0GA 2F0DA 5K36H 4IFDG 3M7NA 2PZTA 2PMZB 2WKDA 3DUZA 3HEJA 2PZWA 4DFAA 2L4NA 4RGOS 2EJGC 5E1FA 1TR5A 4KHVA 5KNBA 4OGQC 2QEJC 3ZPNA 3BDOA 4Q0FA 2F1MA 3URYA 1RDPD 3TBIB 1B9NA 4KJOA 4HN7A 2XZLA 4ME5A 1FGBD 2JYOA 5C0XG 1SSOA 2DIEA 1SYFA 4V0BA 1BUVT 5C4XB 1DZ1A 1X3PA 5ELEA 4XXEA 2ZZEA 3R2TA 1EU3A 1I4RA 3HAGA 2JEBI 3D8GA 3DDYA 4ILWA 3VR4A 1RD9D 5DAUA 4J6HA 2EPBA 4IUNA 5CV9A 2BE5D 3NSWA 4EGVA 4XIGS 1KDAA 5EBCA 3U9SA 5CV8A 4RCOA 4ZRZA 3TP8A 3WOFA 3HRZC 1OXSC 4G7WA 3MFGA 1STAA 2FFKB 4FXKC 3M85A 4DN4M 4NDXA 1UNSA 2M9VA 2IJ0A 2KA7A 4XLCA 1H9MA 1G8ZD 3NQIA 2X6XA 5E4WC 1SYEA 3OIPA 1R4QB 3A35A 1RJTA 2NTSA 2Z8LA 4HAEA 1YNJC 3GTOB 1D1IA 2N88A 4FVMA 3MA2B 5AFWA 1ET6A 1WTWA 1ESFA 1BDOA 2WINB 2B2TA 3Q0AA 2D9UA 1M4VA 4YELA 1A2TA 3KEWA 2LFNA 1BBXC 2YU9B 1I50B 3T16A 3V05A 3NK9A 2L1BA 1TWCB 1PKVA 2WP8J 3H91A 3EROA 2TMPA 1BNZA 1SMYD 3OPOA 2L11A 3VYTA 1AP0A 1NR2A 2J7ZA 3A55A 1SE3A 2F0HA 1V43A 5JEAG 5IT9E 1UD8A 2AQ2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM C;  3A7L A;  3CRK C;  3TZU A;  3D31 A;  2V4D A;  1Z7T A;  4OO1 H;  3L7Z C;  3EQL C;  4XIG S;  1IYV A;  3RLF A;  1DD2 A;  2A6H D;  2CW0 C;  3U9S A;  4H44 C;  4JBW A;  5C0X H;  3FMC A;  3DXJ C;  4BA1 I;  1HCZ A;  1VCI A;  2DN8 A;  1Q1E A;  1Y8O B;  1GUG A;  3P20 A;  1IW7 C;  1TU2 B;  2D62 A;  4OO1 G;  1CTM A;  1OXS C;  2PCF B;  1EWH A;  3QJY A;  4I7Z C;  2JXM B;  4DNR B;  4L8J A;  1Y8N B;  2B8G A;  2NN6 G;  1DCZ A;  1TKW B;  1VF5 C;  4KMU C;  1G29 1;  5KND A;  2DNE A;  3BG3 A;  3VA7 A;  1LAB A;  2BDO A;  3WDN A;  4KKS A;  3M85 A;  2D5D A;  2YYZ A;  1GHJ A;  4KKT A;  3LWU A;  2LMC B;  2K7V A;  3SDZ A;  3VR3 A;  4KKU A;  2NN6 H;  3ND8 A;  3VR6 A;  3A8I E;  1ONL A;  3GD7 A;  1T5E A;  3PUZ A;  3KLR A;  5BN3 A;  4G7Z C;  1H9R A;  2EJM A;  1Q12 A;  3MXU A;  2KA7 A;  4KHZ A;  3N6R A;  1H9M A;  1CI3 M;  2EVB A;  1H9S B;  1FYC A;  3ND9 A;  2O5J C;  4TQU S;  3IFT A;  4IFD H;  4DNT B;  2PNR C;  4DK1 A;  3PV0 A;  4PV1 C;  3OOC A;  3MFY A;  2EJF C;  4H0L C;  1Q1B A;  4G7H C;  3H94 A;  2BE5 D;  1YNJ C;  5K36 H;  4BA2 I;  1OXU A;  5JEA H;  4IFD G;  1K8M A;  3VR5 A;  2AUJ D;  3M7N A;  1H9S A;  2A6H C;  1HPC A;  1ZYR C;  1PMR A;  3I4L A;  2ZT9 C;  3T51 B;  1VDZ A;  1OXX K;  3T53 B;  4KI0 A;  1Q90 A;  1Y69 U;  2E75 C;  4KN4 C;  1DXM A;  1GUS A;  2BA0 A;  1E2W A;  2D2C C;  1GJX A;  1BDO A;  1SMY C;  2K33 A;  5K36 G;  1OXV A;  3W3A A;  2KCC A;  3A8J E;  1E2Z A;  2EJG C;  3CRL C;  2A69 D;  3QG1 A;  5KNC A;  5KNB A;  1OXT A;  4OGQ C;  3BDO A;  2E74 C;  3SE0 A;  3VR2 A;  2F1M A;  4GZY C;  2L5T A;  4RCN A;  2PPB C;  2A68 C;  4KN7 C;  1Y8P B;  3M4Y A;  1B9N A;  2EDG A;  3GQB A;  2JE6 I;  3A8K E;  3T56 B;  2R6G A;  2BA1 A;  1H9J A;  1B9M A;  2BE5 C;  2A6E D;  5BN4 A;  1GHK A;  2A69 C;  3PUW A;  1K8O A;  3QIA A;  4TKO B;  1HTP A;  1QJO A;  1GUT A;  3NE5 B;  2QF7 A;  5C0X G;  3OW7 A;  4H13 C;  2E76 C;  1GUN A;  3AB9 A;  2K32 A;  3PUY A;  1I6V C;  3D4R A;  4XTC S;  2O5I C;  3OPO A;  1CFM A;  1E2V A;  2AWO A;  3I72 A;  2DNC A;  2IT1 A;  4HR7 B;  4JK1 C;  5A35 A;  1FR3 A;  1GUO A;  2A68 D;  2AUK A;  2Q8I B;  5BN5 A;  1Z6H A;  4LK1 C;  2B8F A;  4DK0 A;  2JEB I;  1O78 A;  3A7A B;  1IW7 D;  4LJZ C;  1LAC A;  1YNN C;  3VR4 A;  1H9K A;  1ZKO A;  1A6X A;  1V43 A;  1VF7 A;  3PUV A;  3I73 A;  1O7L A;  3HGB A;  3IKJ A;  5JEA G;  1V8Q A;  3LNN A;  2JEA I;  2NN6 I;  4G7O C;  3FPP A;  2A6E C;  4IQZ A;  3PUX A;  1IYU A; 
#chains in the Genus database with same CATH topology
 2A19 A;  4A3D B;  2F1L A;  2R92 H;  1J5E L;  4KTA A;  2F0F A;  4DK3 C;  4P75 A;  1GVP A;  3NXW A;  5EKI A;  3Q6S A;  3OJX A;  4AIM A;  2XRS D;  3PA2 A;  1TS4 A;  4H44 C;  1UD4 A;  4XQQ A;  4RKB A;  4RLZ A;  3DXJ C;  1ML0 D;  4JG2 A;  4LFA Q;  3S1Q B;  1S5B D;  2V7U A;  5D14 A;  1HA3 A;  1NY4 A;  4GOP B;  5EJW A;  2VJI A;  4EH1 A;  3AVY A;  3L9A X;  4LUZ A;  1DCZ A;  2JA7 B;  1TS3 A;  2UUA Q;  1PYS B;  2DNE A;  2WAQ B;  4XQN A;  4B43 A;  2C9O A;  1PH7 A;  3S2H H;  4KD4 A;  2ZM6 Q;  1EY0 A;  3HKZ E;  1OGJ A;  2HQE A;  5JVG 3;  3J80 L;  3MZ5 A;  4KHZ A;  3D4D A;  3B78 A;  4TMX A;  1IJF A;  4Z9C B;  5HUR A;  1GUW A;  4BY1 B;  1SNC A;  4XL9 A;  3ND9 A;  5KSW B;  1QVF B;  3K5N A;  1B7Y B;  1YIJ A;  3AFP A;  2F0P A;  2DY7 A;  1H8E A;  2RA4 A;  2PW7 A;  3OOC A;  3A0J A;  1PH5 A;  1BX0 A;  1BX1 A;  4QMG A;  3P1H A;  1CKM A;  4F88 A;  4YIJ A;  4MTK A;  1E0B A;  3GVJ A;  2NTT A;  3ERQ A;  3AVU A;  4IUR A;  3TP5 A;  4Z4Y A;  4KD3 A;  3JAM L;  1WD0 A;  2ZZF A;  4DV6 L;  1Y69 U;  1S72 A;  4XON A;  1SDF A;  2BH2 A;  2ZJR A;  2MPM A;  2QW7 A;  4LF4 L;  3I55 A;  1QOH A;  3W3A A;  1W0J A;  4IUU A;  4DR7 Q;  4F7D A;  2EQS A;  5CBE E;  3QG1 A;  2Z4H A;  1OXT A;  2EYF A;  1ZM2 A;  3KF6 B;  3GV6 A;  5IP7 H;  3NTH A;  3LVB A;  2CW0 D;  1VLY A;  1KTV A;  1ZM9 A;  5T1I A;  1ILQ A;  3CCL A;  4RCY A;  1WCM H;  4RWS C;  2OYN A;  1WOC A;  4DR4 L;  1HVX A;  4TMT A;  5DSZ A;  2A5H A;  4RD0 A;  4B44 A;  3DEP A;  5C4X H;  5J39 A;  5CGK A;  4GNX A;  4XOT A;  2QF7 A;  1I4P A;  4H13 C;  5EQ0 A;  3SEB A;  1M1K C;  3BVM A;  1TY0 A;  1YIJ B;  3J7A 5;  4N8F A;  1SFO H;  2K5N A;  4ALP A;  4B08 A;  5KNL A;  1D5X C;  1EP3 B;  1LT3 D;  3K59 A;  2PI2 E;  4MIU A;  3OEH A;  2DET A;  2B63 G;  2FMC A;  1AIP A;  3ZIA A;  1YNX A;  2VB2 X;  2F0N A;  3CW2 C;  1HR0 Q;  3JU4 A;  4C3H B;  3PA1 A;  4QV2 A;  5JAV A;  4JI2 L;  3Q3A A;  3KJP A;  3WY9 A;  1BVS A;  3BVG A;  1WTV A;  2ZL6 A;  5M3F H;  1SRU A;  4FF3 A;  4G7O C;  3TP7 A;  5L46 A;  2BVN A;  1GD7 A;  2V7V A;  3TZU A;  1Z7T A;  1F9R A;  2WKC A;  4LF6 Q;  2SNM A;  1MJC A;  2BSA A;  1EQT A;  2CW5 A;  1JOO A;  3KBG A;  4LMQ D;  1KK0 A;  3NTK A;  4LBV A;  2LS0 1;  5FK9 C;  5IYP A;  5IP7 G;  3QJY A;  1IBL L;  3HOZ G;  4LAA A;  3HG9 A;  2BDN A;  4UAI A;  3ER0 A;  4YAL A;  4IN3 A;  5EKL A;  2A74 C;  2B2T C;  3DLL A;  3CC4 B;  3WYA A;  2Y0S G;  3I55 B;  4X06 A;  1DOL A;  2D5D A;  5H5J A;  1KQS B;  5EBD A;  4G1V A;  1T5E A;  2I0Q A;  4FK8 A;  2WII B;  1PZI D;  4UP8 A;  5TY0 A;  5C44 G;  2JA5 G;  3J80 i;  1PRT D;  2JA9 A;  3W2H A;  4Z4W A;  2RC5 A;  3P27 A;  1CSP A;  3DM1 A;  2ZJP A;  4BPR A;  1HNZ Q;  3RR5 A;  5IGE A;  5IYC H;  5GAD C;  1EYD A;  2R6H A;  1WOR A;  1E43 A;  3D26 A;  2YWG A;  3EA6 A;  3MHP A;  3Q8D A;  4OIJ A;  5FJ8 G;  3S16 B;  4H0L C;  1G2S A;  2RC6 A;  1EFI D;  2PZU A;  3G71 A;  1GJR A;  2PE3 A;  2VUM H;  1UE6 A;  1K8M A;  4M4S A;  3T4A C;  1A8P A;  4OEL B;  3V96 A;  2M2L A;  1LTI D;  3I4L A;  2EY6 A;  3U50 C;  3CCM B;  3C3L A;  4M1U B;  1TT2 A;  3WBK A;  2K4K A;  2QGG A;  2CND A;  2E75 C;  4ZGQ B;  3W2F A;  2HUG A;  1NAP A;  5NUC A;  2OTJ A;  1HHV A;  2K75 A;  5K36 G;  2OBR A;  3KLW A;  3I1F A;  4RMF A;  1EL0 A;  3B8H A;  2HCI A;  1R4P B;  4R4T A;  2BCO A;  4AC9 A;  1EZ8 A;  1K3R A;  4WZE A;  2KED A;  2NYZ D;  1B8A A;  4XOR A;  4PMC A;  4UHV A;  2MQH A;  1D8T A;  2VJJ A;  1BO0 A;  1ZYR D;  3FKS A;  3CC2 B;  1WP6 A;  5GAG C;  1BOS A;  4QJF A;  1Y14 B;  5IYN A;  4DV3 L;  1ZEQ X;  2I1L A;  3A3G A;  3A8K E;  2KHS A;  2ES2 A;  1EOV A;  4RHR A;  3RD4 A;  1AE2 A;  3E5S A;  4AF6 A;  3PUW A;  2ZXI A;  3OZV A;  1E79 A;  1GM5 A;  4DK6 C;  1Y1V G;  1RL2 A;  4J8Q A;  3PF4 A;  1WTO A;  5HGQ A;  2IPK D;  1XMQ Q;  3JAM E;  2F0L A;  3W1G A;  3PUY A;  2ICE C;  4XTC S;  1S0U A;  1C8C A;  2C2W A;  4QVJ A;  3I72 A;  1IBK L;  2LXK A;  1TWF H;  4LF8 L;  3H9N A;  3G48 A;  1NNX A;  5KIX A;  1O78 A;  3A7A B;  1V0E A;  1CKN A;  2D9R A;  3ZJY C;  4HJA A;  2NZH A;  4X3T A;  3CC2 A;  1OB5 A;  3S16 H;  1WSV A;  2MJ8 A;  4BBS G;  2UXB Q;  2HMA A;  2KEE A;  1CSQ A;  1QGY A;  3ERS X;  2F43 A;  4X62 Q;  1SYB A;  2EY2 A;  2JK8 A;  4UZU A;  1SJE D;  4OO1 H;  4X6A H;  1L0W A;  3MWY W;  4AYB E;  1VMC A;  2R92 B;  5HKK A;  2X6L A;  3K6O A;  4JI7 Q;  3UE0 A;  4M53 A;  2LZJ A;  2DN8 A;  2UUC L;  3J7Z C;  4J0Q A;  4QVA A;  3A74 A;  4GLV B;  1CTM A;  3HOY B;  1F60 A;  3AU7 A;  3HS0 C;  4YCU A;  2K04 A;  2FIN B;  4RGM A;  5IYB H;  3V7A A;  1HJP A;  4WJ3 M;  4U67 3;  2IX0 A;  4ABN A;  1PYW D;  4BY7 G;  1K0R A;  4Y52 H;  3GTG H;  1BPL A;  1JMC A;  1X3Q A;  2UUC Q;  3MTS A;  1UE1 A;  4CBV A;  2CC2 A;  2ENB A;  1QUQ A;  4G7Z C;  1JNY A;  3PO3 G;  3RZO H;  2ASB A;  2N8N A;  3FP9 A;  4FYD A;  3B6Y A;  3BZK A;  2PNR C;  4ZYS A;  1QX4 A;  3O13 A;  3MEF A;  5EGT A;  1Q82 C;  4JI3 Q;  1V9P A;  2OQK A;  3NBI A;  2Q6L A;  3I4M B;  3K7U C;  2JA6 B;  3S1M H;  4J1M A;  1QUQ B;  1LTT D;  1KD1 C;  3K7A B;  1B3Q A;  3MC0 B;  3EFX D;  2UXD L;  2JN4 A;  2X69 A;  3E0J A;  1S3O A;  5LMU L;  1PH4 A;  1R5B A;  2E2H H;  5DS0 A;  1NSN S;  3TN2 A;  1EEI D;  3QFC A;  2WJV A;  5EKK A;  3VO2 A;  1SMY C;  1SNP A;  4K8J A;  4XYO A;  1QZH A;  3OMC A;  4JI1 Q;  4X64 L;  2GA4 B;  1PTO B;  2KJX A;  3HOV G;  5EPJ A;  3KLS X;  1KK1 A;  1JJC B;  4KHP Q;  2N3S A;  2P3M A;  2B2W A;  4YAF A;  4RCN A;  2QEX A;  4DR2 Q;  3A54 A;  3EVQ A;  4L5T A;  5CV5 A;  4DAP A;  5J22 A;  2LSS A;  4DU9 A;  4Z4V A;  2DCU A;  4WJW A;  1RTN A;  5I9O A;  1HRJ A;  1B9M A;  4JI6 Q;  1RQP A;  2Q2I A;  4IJH A;  5KRU A;  2V7X A;  1NDH A;  1BCP B;  4M8A A;  4V19 0;  3AVV A;  1KJZ A;  4QUC A;  4LFC Q;  1I6H H;  1GUN A;  1RF2 D;  3PIO 3;  1UD2 A;  5EAY A;  3HOV H;  2R3Z A;  1Y1W B;  2WJY A;  4ZLT F;  1PXU A;  1NTG A;  1EY9 A;  1NJI D;  5E6T A;  4HR7 B;  2R7Z G;  4PC6 A;  2JA6 H;  4A3K G;  4TN1 A;  2ZL5 A;  1EQV A;  2RCF A;  4DV0 Q;  4LNQ A;  1SND A;  2EYP A;  1UEA B;  2NVT B;  1KK3 A;  4FN5 A;  2JA5 H;  2B2W C;  1JJ2 B;  3S9W A;  4CDC C;  1VHE A;  1WFQ A;  2L12 A;  5JJI A;  4AH6 A;  5HXB A;  1S5D D;  4A3L H;  4GOP A;  1KL9 A;  3DEO A;  1QVG A;  2HDL A;  3PUX A;  2RSN A;  1PJ5 A;  1G7R A;  3A7L A;  1WU8 A;  5HZA A;  1ASZ A;  2VBV A;  2QTL A;  4EQ5 A;  1HFG A;  1I94 L;  4XD7 A;  5A88 A;  2JA8 B;  3SK6 A;  1DON A;  5GV7 A;  2JJQ A;  4IPD A;  2R93 B;  1TU2 B;  2MP1 A;  4IOA A;  2F0W A;  5ELN A;  3CCU A;  3HOY H;  1PH6 A;  4ID6 A;  3BJU A;  2HCC A;  1SJH D;  3J81 c;  4ZUJ A;  3J7A F;  2R93 H;  2N55 A;  1M90 C;  2BDO A;  3CCJ B;  4WOR A;  3CCM A;  1W6K A;  2I5L X;  1LTS D;  3GVL A;  2LMC B;  3GP7 A;  1PH8 A;  1F9Q A;  2PMD A;  2MFI A;  2KBN A;  5BN3 A;  1FNU A;  3RNU A;  3K8A A;  1XXG A;  1FYC A;  4OIK A;  1Q8K A;  2UXC Q;  4KY5 A;  1W6J A;  5FO0 A;  1STY A;  3MCA A;  4B3F X;  4HE5 A;  2O4X A;  2UU9 Q;  1S4Z A;  1ZM3 A;  2F0M A;  3K0Y A;  3FKI G;  1C9O A;  1NUC A;  4QQB X;  2JA5 B;  1CHQ D;  2CRV A;  4K8I A;  3AST A;  3M4O H;  1KK2 A;  4OPO A;  1VQN B;  3CQZ H;  4GNX B;  4N9P A;  5M3M B;  4P74 A;  3FPK A;  1B70 B;  2NVQ B;  1Q90 A;  1OTC A;  4K5W A;  4DXG A;  3PO2 G;  4JYA Q;  2BA0 A;  1CKO A;  3NTI A;  5ELB A;  3PIP A;  1A15 A;  1H85 A;  1VS0 A;  4GS3 A;  1YNJ D;  2KEN A;  1T6Z A;  4K0K L;  4NKL A;  1SNO A;  2CF4 A;  2L9H A;  4OOV A;  2MO1 A;  4GNX C;  2XRQ D;  3L2P A;  1K8A C;  1Y8P B;  4IZ8 A;  3J81 j;  2K6A A;  1LLR D;  1B53 A;  2JE6 I;  1N34 L;  2WR8 A;  1VQO B;  2JP1 A;  4OXP A;  4PZ6 A;  4NBS A;  2QDB A;  4PMB A;  3HZX A;  4PZ8 A;  4PC3 A;  1AW7 A;  3S1N B;  2I5M X;  1SKY B;  2ZTG A;  2EOT A;  1EFR A;  1IBL Q;  4DAY B;  4P6V F;  5KEE A;  1K0S A;  2E1B A;  1E2V A;  4ZKC B;  1Y0R A;  2VUM B;  3DWA A;  4YWK A;  3H3V C;  2B39 A;  2VQE Q;  3VA5 A;  4LJZ C;  5I9P A;  3F2C A;  3MVV A;  1A0I A;  2C5C A;  3I73 A;  3H15 A;  5C4Z A;  1EFT A;  1V8Q A;  1KLG D;  4RDL A;  4A3M B;  3RY8 A;  1AZQ A;  1IYV A;  4A3I B;  1O7I A;  2F0O A;  4FDB A;  3BVZ A;  5LMN W;  5C4X G;  4XT1 B;  5IYC G;  3S2D H;  1YHA A;  2C4U A;  1VQP B;  5E7N A;  5COR A;  1U4P A;  2AKW B;  4BA1 I;  1Q86 C;  3ULP A;  1GUG A;  5IGB A;  3PUN A;  3NBH A;  5JJZ A;  3BCD A;  1ZUN B;  1DGS A;  4YHH L;  3KL9 A;  1O7Z A;  4XLF A;  3WBJ A;  2EFG A;  2N49 A;  1T5X D;  3BYT B;  4KJN A;  4XLE A;  5HZB A;  4RKL A;  4GKJ L;  1GHJ A;  1RHP A;  2F52 A;  3VR3 A;  1TS5 A;  2A73 B;  3CCJ A;  4DR3 L;  4A3B H;  1AE3 A;  1HNW L;  3MXG A;  2JDI A;  2FJ2 A;  4FF4 A;  3A5Z B;  2WB1 G;  3G05 A;  1Q7Y D;  3Q39 A;  5AJ3 L;  4YXW A;  4DNI A;  2VB3 X;  4LF5 L;  1VQ6 B;  4BY7 B;  2Q2T A;  2H1E A;  2HHH Q;  1KRS A;  2Z4I A;  3PO3 B;  4HIK A;  4XT3 B;  5LL6 S;  3I70 A;  3SK5 A;  3RMH A;  4J15 A;  1XMQ L;  3IL8 A;  2DY1 A;  3PEN A;  3K57 A;  4MTN A;  1N32 Q;  1PH9 A;  2VNH A;  1BCP D;  3I3C A;  1PMR A;  1PZK D;  3AMU A;  2Q6O A;  1YVC A;  5FO8 B;  5FO9 B;  4QCL A;  4XLH A;  3CMA B;  3NEL A;  1SR3 A;  4RAU C;  3ASS A;  2F4I A;  4E0F A;  4HE6 A;  2K28 A;  3A8J E;  3PIP 3;  5GAH C;  2JA8 G;  1E2Z A;  2A69 D;  4OWX B;  4YEJ A;  3UI2 A;  4Y7N H;  2XTI A;  2VQF L;  1IZ6 A;  1ENF A;  2PPB C;  2PO4 A;  4TRD A;  5FKA C;  1XB2 A;  2C77 A;  1EY7 A;  4WZK A;  1F9S A;  4JW0 A;  4JPB W;  2ZBU A;  1NBM A;  1W9X A;  2WZP P;  1XE1 A;  2ZXH A;  4XM3 A;  1KDC A;  3QIA A;  1GUT A;  2BM1 A;  1BXT A;  3NWS A;  2AWN A;  4A3E G;  3ASR A;  3AB9 A;  2V31 A;  1CZW A;  2K32 A;  4GKK L;  2VS1 A;  3RZD H;  1QE6 A;  2KHJ A;  1STG A;  4XQF A;  5A35 A;  3UE1 A;  1LTA D;  1K28 D;  4M1K A;  4C3J G;  1NMF A;  1VQF A;  4GN5 A;  3I8Z A;  1H9K A;  3G6E A;  4QIW E;  4POG A;  4QHY A;  3A5U A;  4DV1 Q;  1WTQ A;  1U4M A;  3IKJ A;  1FNB A;  4X7D A;  2AHO A;  4RCZ A;  1KC8 C;  3HOX G;  1D8L A;  3ZZU A;  4XDX A;  4A3C G;  4HMJ A;  4DUZ Q;  3SJP A;  4UZF A;  1IYJ B;  4H7B A;  3BDC A;  3EN2 A;  4TSS A;  4CJ2 C;  5IGG A;  3I90 A;  2ZM6 L;  1W3S A;  2JA7 H;  2K05 A;  1U5K A;  1MBY A;  3H0G G;  4ZK9 B;  4JCV E;  3A1P A;  2F4N A;  3OYY A;  4DA2 A;  4K2K A;  4P25 A;  1J9O A;  4ASU A;  3CC7 B;  4YAW A;  4IAL A;  1LAB A;  4OEM B;  4EVO A;  1HR0 W;  1ICW A;  2R93 G;  2XN9 C;  1U4R A;  1VQD A;  4NMZ A;  2K7V A;  4KKU A;  4K1X A;  1CKN B;  1X6O A;  2CQO A;  2WFW A;  1GVH A;  3R2I A;  2K5W A;  4G57 A;  3N6R A;  1G6P A;  2ICI A;  3GTL H;  5IP9 G;  3I2Z A;  1PRT F;  3T1H Q;  3ONY A;  3X3N A;  4C3H H;  1EUJ A;  3N52 A;  4X3S A;  1YI2 A;  4I65 A;  2B3G A;  5JEA H;  3CPW A;  2XVS A;  1K8G A;  2F4V Q;  1NB0 A;  1H9S A;  4O1N A;  4C2M B;  4LWC A;  3GTJ H;  2XND A;  1JT8 A;  1WTH D;  4IFD J;  2EYJ A;  3T53 B;  3HOX H;  1YJN A;  4ZQ3 A;  2JSO A;  1DXM A;  4H9G A;  2B63 B;  2R7Z H;  3K5L A;  4DR4 Q;  2F0T A;  3RLO A;  5C0X I;  5IOD A;  1FX0 A;  1YLO A;  3OP1 A;  3S15 B;  2ZTN A;  5M3M G;  4ZUI A;  4HJ5 A;  4EQN A;  1D1K A;  1PVO A;  2IL8 A;  2RDG A;  4A93 H;  1IB0 A;  2L5T A;  2JJ2 A;  4DR7 L;  4Y9R A;  4C3I G;  2IHE A;  3TQY A;  2F4V L;  2BA1 A;  2A6E D;  4B48 A;  5HY6 A;  3WOE A;  1EIY B;  1S5E D;  2ZZG A;  2VBS A;  1QJO A;  2X6G A;  1FNV A;  4A3G H;  2EZV A;  1HZ9 A;  3QR8 A;  2B5O A;  1NB9 A;  1SMX A;  4WRD A;  4MYT A;  3SK4 A;  4RGT A;  3S1M B;  2BN4 A;  4DV5 L;  4QL5 A;  5C44 B;  2Y0S B;  3I4M H;  4ACB A;  4R4Q A;  3M4O B;  1A8V A;  1Z6H A;  2OEO A;  4PG3 A;  1B23 P;  5D3D A;  2SOB A;  1N33 L;  4BBS H;  1EU4 A;  1P4M A;  4B3G A;  1XMO L;  2UXC L;  3A3B A;  1GO3 E;  1K28 A;  3PUV A;  2AQ2 B;  3LNN A;  1V0F A;  4IPG A;  1U9R A;  3BNW A;  3CCU B;  3FPP A;  4GZY C;  3CAM A;  2L55 A;  4BBR B;  3WQZ A;  1JA0 A;  1H8H A;  2V4D A;  1XX8 A;  4Z4T A;  1DYQ A;  1F2L A;  2PQA A;  2YTY A;  4IPH A;  2X8K A;  3CCV B;  4BBR H;  5FNZ A;  1DD2 A;  1QGZ A;  1BBU A;  2R9V A;  2UUB L;  1YI2 B;  5BSX A;  4A3E H;  3OAA A;  1EY5 A;  3GTQ B;  1L0Y B;  4DAY A;  4XLA A;  2EYH A;  1QH0 A;  3P20 A;  3PF5 A;  3E9H A;  4X7C A;  3U9O A;  1N9W A;  4L5Q A;  4I7Z C;  1TWC H;  4JV5 L;  1PFS A;  1TKW B;  3ONA B;  4KMU C;  1D7Q A;  4AVZ A;  1W2B B;  1BCP C;  1XMO Q;  3CCV A;  2EIX A;  4IOC A;  3HOU H;  1MSG A;  5C3E G;  1R9T B;  3LQE A;  3U6K A;  2I5H A;  2QDL A;  3AYH B;  3TSS A;  5I2X A;  2B7C A;  2GJK A;  5CV4 A;  4P72 A;  3OWF A;  3Q23 A;  4DR2 L;  3U4Z A;  4NXM L;  3PO2 B;  1G7T A;  3JQP A;  1W87 A;  5I4D A;  1JOK A;  5IOC A;  4KHP L;  1B44 D;  4OPV A;  3HOW B;  2RDF A;  1KZL A;  1QFZ A;  5M5X H;  5C5M A;  4IFD H;  1TII D;  3T1Y L;  4LW1 A;  5C3X A;  1D2B A;  1IKM A;  4A3F G;  4N3G A;  2XZP A;  2EE1 A;  1S5C D;  4XMY A;  1QGA A;  1R5O A;  1X3G A;  2DJG C;  3KF8 A;  2N78 A;  4ULL A;  3CCR A;  3M3Y H;  3T51 B;  3CCS B;  2KEC A;  5FOB B;  2XEX A;  3ONU A;  4XQJ A;  1GJX A;  3FEW X;  4X66 L;  4LFB L;  4IPC A;  4TSF A;  3NHH A;  4C2M H;  5D3I B;  1Q8I A;  2ZTE A;  4DV5 Q;  1IHM A;  2XNC A;  5J1Z A;  4JI0 Q;  2QMU A;  4HCE A;  4X3U A;  4RD3 A;  3GTM B;  1LTL A;  3SE0 A;  1WDT A;  1WYD A;  3PMF A;  3P26 A;  4HCS A;  2YU9 H;  1GO2 A;  2HCJ B;  3HKZ B;  1SAP A;  4QB4 A;  2QDX A;  1QIL A;  1VQ4 B;  2GVA A;  3E9I A;  2Y0S E;  1A62 A;  1P16 A;  4EQO A;  1K9M C;  1CA5 A;  4ACA A;  2E5L L;  1QWY A;  4YY3 L;  1KD1 D;  5LMZ A;  2E2I H;  5I6Y A;  5FLX L;  4X7F A;  2QKI C;  3K80 C;  3A8I A;  1CFM A;  2QN6 A;  1EYC A;  2PQE A;  1HA6 A;  1IL8 A;  1HNW Q;  5FL7 A;  4JV5 Q;  2Q8I B;  3HOU B;  4II2 A;  1EOT A;  1IW7 D;  3J81 E;  1A6X A;  3S15 H;  1VF7 A;  4TT3 A;  4PC1 A;  5IY0 A;  2OTL A;  2B63 H;  2R7D A;  3TEH B;  4NXM Q;  3OIQ A;  4HSV A;  1IHZ A;  1SNQ A;  1IYU A;  4CDE C;  3RN2 A;  1SYG A;  2G9D A;  4FXG C;  1MD2 D;  1VHO A;  2UUA L;  3GTJ B;  4B3S Q;  2KCN A;  5KW9 A;  2V7Q A;  4JBW A;  4NW2 A;  5FO1 A;  1LYL A;  3T1H L;  1G7C A;  1W34 A;  4C56 C;  3PGZ A;  4X0C A;  3BC9 A;  3CB4 A;  4LFA L;  1HFN A;  4G6I A;  2G5D A;  1EZ6 A;  3F2B A;  1Y8N B;  3CC7 A;  1X65 A;  4JVZ A;  4HTH A;  3C1F A;  4B3T Q;  4YCW A;  4DR1 L;  1I4Q A;  3BG3 A;  4PAB A;  4KKS A;  3S1R H;  4R1J A;  3ZYY X;  4QGU A;  1UD6 A;  4XR6 A;  5JJL A;  4B3X A;  4HMI A;  3KLR A;  5L37 A;  1B2T A;  3MXU A;  4OON A;  4C3I H;  4A75 A;  3TS0 A;  4NB3 A;  2YWH A;  2OBS A;  4RA8 A;  4A3G B;  1EIF A;  1WI5 A;  2IWH A;  1S40 A;  5THX A;  4Z4U A;  2RHS B;  2MGS A;  3NP8 A;  1E1O A;  2FMM A;  1WD1 A;  3Q38 A;  4LF8 Q;  1MKH A;  1MSH A;  1PRT B;  3GDE A;  1AZP A;  2NPF A;  1KTK A;  3H94 A;  1I4H A;  2HDN B;  4A3K B;  1D1N A;  2YTX A;  2M5S A;  2AUJ D;  1E1Q A;  3VR5 A;  3E3X A;  1NR4 A;  4A93 B;  2DYI A;  1TWF B;  1E64 A;  5J35 A;  3OWE B;  4KV6 A;  4JI8 L;  2VBT A;  4CJ0 B;  1VDZ A;  2K52 A;  1PDQ A;  5IGC A;  1OXX K;  4KI0 A;  4II3 A;  2QA4 A;  2NVX H;  2D3N A;  1U0L A;  1NCV A;  1GUS A;  1II3 A;  2VNU D;  2B29 A;  3FRP B;  2OTJ B;  3M9B A;  1J6Q A;  1E3P A;  2ZBV A;  1PFN A;  4A3J B;  2Q8T A;  1K73 C;  3I4M G;  3BY1 A;  2A68 C;  2JA6 G;  3OHX C;  3Q24 A;  5AN9 A;  5M5W H;  3KDF A;  3GQB A;  2XIW A;  2R6G A;  1GXD C;  4FXU A;  1SE8 A;  3I56 A;  4TVA B;  5M9O A;  2E76 C;  3OSO A;  3WXM A;  1KLU D;  1NJI C;  3UDI A;  3AVW A;  4G4K A;  4A4I A;  2C78 A;  2RHQ B;  1XNR L;  2RVL A;  2IT1 A;  1GAW A;  3VMF A;  1QCB D;  1G51 A;  4A3L G;  1IXR A;  4JI3 L;  3VDY A;  4DK0 A;  1NE3 A;  1OGI A;  1V1P B;  1K83 H;  4A3F B;  5F4M A;  2GN5 A;  3DMU A;  4C1N I;  1N36 Q;  3GSI A;  2GQF A;  5ELO A;  2OWO A;  4H02 A;  1XNQ L;  3HGB A;  4JI8 Q;  4DUZ L;  1N8R D;  2E2D C;  4GN3 B;  1S5F D;  1A63 A;  1E7Z A;  1K9M D;  2QE7 A;  3S2D B;  2YWF A;  2JQO A;  4HIO A;  3I91 A;  2NVY B;  3NUC A;  4R8N A;  1KAB A;  1AEX A;  3L7Z C;  3GO5 A;  1UEB A;  3S2H B;  5FLM H;  2ZXO A;  5B6I A;  2CH4 A;  3TRE A;  1CQV A;  4Q5V A;  4C1N K;  2JJ1 A;  1CNF A;  5GV8 A;  4DNR B;  2KOL A;  2K5Q A;  1VF5 C;  1G91 A;  4JI7 L;  3W1B A;  1XTC D;  4GKK Q;  2EXZ A;  4DV4 L;  4DV7 L;  1EIH A;  2X85 A;  5G3L F;  2BV3 A;  3A8I E;  4IUQ A;  1UE7 A;  4X62 L;  3KYH C;  3PUZ A;  1M8A A;  1YIT A;  5BR8 Q;  1I4X A;  4X65 L;  5C0X J;  4DV1 L;  3ES9 A;  4UZE A;  3G6J B;  2QEX B;  2J4X A;  4DNT B;  4RH6 A;  5A8A A;  1Q82 D;  3M7G A;  3PV0 A;  4IUP A;  4YCV A;  4CDD C;  5M3F B;  1BKB A;  2C35 B;  3MFY A;  3MEH A;  2C5H A;  1VQL A;  1MHW C;  2K50 A;  4O0A A;  2NZO A;  2F0V A;  4K5X A;  3SEJ A;  4DQL A;  2F0U A;  1HPC A;  2OK7 A;  1PJ6 A;  4P6Y A;  1L0X B;  1W35 A;  2PW5 A;  4OHJ A;  1STE A;  2XOK A;  4JI5 Q;  1Y0Y A;  1X56 A;  3LWE A;  4A3I H;  4JI5 L;  2AMC B;  2NVQ H;  3DWP A;  2VQE L;  3LGJ A;  2X6Y A;  1OXV A;  2TSS A;  4AQY L;  1UAP A;  5EPL A;  3CQZ B;  1N0V C;  4PNY A;  1N06 A;  4RFB A;  5E3F A;  2NVX B;  3R8B A;  1I50 H;  4BY1 G;  2F0Q A;  2ZTD A;  4LUV A;  1Q9S A;  2E74 C;  1HZE A;  2IX1 A;  4R71 A;  3KK7 A;  1YZ6 A;  2VNJ A;  1WCM B;  1PTO F;  2OCE A;  4YY3 Q;  5A2Q E;  1B2R A;  5KGU A;  2DY8 A;  4MZ9 A;  3JQQ A;  5AJ3 Q;  4NPS A;  3T56 B;  1JIC A;  4B9X A;  4JI4 Q;  4ZKB B;  4OO1 I;  3I4N H;  4NXN L;  1K8O A;  1UUP A;  3HKZ G;  3STB C;  3T1Y Q;  4QUZ A;  2L0C A;  2RF4 A;  1PLF A;  1CK1 A;  3QSY A;  3L0O A;  3LO8 A;  1XFO A;  5C4H A;  1BMF A;  4JMQ A;  3VO1 A;  3QFR A;  3L3O C;  3MAQ A;  2O5I C;  3PO2 H;  1KAW A;  1KIX A;  3J80 E;  5J3O A;  3F8T A;  4DR1 Q;  4LBY A;  4JK1 C;  3CF5 A;  1R9T H;  4FP5 D;  1N8R C;  2IX3 A;  3G7L A;  3P7J A;  5EPK A;  4F8M A;  4LK1 C;  2B8F A;  2Z6K C;  3LX0 A;  2GVB A;  5G3L D;  1ZKO A;  2E2J B;  2F0K A;  3V2T A;  5C3W A;  1O7L A;  4JBK A;  1FL0 A;  1J8I A;  1AFP A;  4F87 A;  2NN6 I;  3CP0 A;  2O2L D;  2A6E C;  3QFT A;  4QF4 A;  4LF7 Q;  4WQM A;  1KRH A;  1SEB D;  4DR3 Q;  3J7Y W;  2MHV A;  4YWM A;  1ZXT A;  2F3W A;  1JQY D;  3M4P A;  1DDG A;  1WPC A;  2J0T D;  1DJR D;  3QO2 A;  4YHB A;  5IGF A;  3K5M A;  5CV6 A;  1E3X A;  1HA5 A;  1JA1 A;  1HZC A;  4OX9 Q;  1VQ6 A;  2OF1 A;  4FF2 A;  4A3C H;  2D62 A;  1I3Q H;  4A3M H;  4K6L A;  2V1C C;  1Q81 D;  1Q86 D;  1PJ7 A;  1SE2 A;  1UWV A;  3GV3 A;  1QB5 D;  3NWT A;  1VQ5 A;  2WV6 D;  3QWN A;  5FJ8 H;  5CMD A;  4LF7 L;  4C0S A;  3BS1 A;  1U2R A;  2BM0 A;  1K73 D;  4JI4 L;  3HOW H;  1SN8 A;  1TWG B;  2K01 A;  5C44 H;  3W2I A;  4KKT A;  1PFB A;  4DQK A;  1TVC A;  1VQA A;  1LO5 D;  3GD7 A;  1N33 Q;  2Z6B D;  1YX2 A;  5IT9 L;  3KUP A;  2W6J A;  4R4C A;  1IBM L;  4Q7J B;  3BCF A;  2E8G A;  1VQK A;  1FND A;  4TQU S;  5DEH A;  1ILP A;  2DJF C;  4DK1 A;  2GJR A;  3SXH A;  4DKA C;  4XOP A;  3CMA A;  4LF9 L;  1PHJ A;  3GTO H;  2C4T A;  4CQJ A;  2ALY B;  2NV4 A;  1CNE A;  4RPD A;  1AMO A;  1KRT A;  4LFB Q;  1IJE A;  3ITP A;  5CYU A;  2F0E A;  1QZG A;  3KFU A;  1KHI A;  2F0J A;  1TQO A;  2WB1 B;  1GAQ A;  2D2C C;  4G5G A;  1LTB D;  4JI1 L;  2WPD A;  4P22 A;  3HOX B;  3NEN A;  5JVH 3;  1JWS D;  1HZB A;  3FKI H;  2IHF A;  2NVT H;  2W6I A;  2I46 A;  3KBX A;  3M3Y B;  1TWH H;  2B2U C;  2QCP X;  4K0K Q;  2UU9 L;  4LFC L;  4K6D A;  4OWW B;  1E1R A;  1TWH B;  2Z6B A;  2PI2 A;  2WSS A;  1WJJ A;  3H0G B;  4DV7 Q;  3HOV B;  5I2Y A;  4NNJ A;  2RKS A;  3PQI A;  1I6H B;  5BN4 A;  1KC8 D;  4DV6 Q;  2A69 C;  4WZT A;  3I7F A;  1KQS A;  4K5V A;  3NE5 B;  1MRZ A;  5M5X B;  1LV9 A;  1N07 A;  1OHH A;  1SM4 A;  1EY8 A;  5F4J A;  1U4L A;  4P3Y A;  2KVM A;  1BQQ T;  1XTD A;  3HOY G;  1L1O A;  1HZA A;  2VBU A;  2AQ3 B;  1EFU A;  5M3F G;  3SKB A;  1GUO A;  3EJI A;  4PAA A;  3Q6R A;  2BF4 A;  1C0A A;  3KF8 B;  4JOI C;  1XPR A;  3CP2 A;  4KY6 A;  3CCQ B;  1WTP A;  4DPG A;  4F7X A;  3CU7 A;  2R7Z B;  2EY1 A;  2SEB D;  2Q8R E;  1JB7 A;  4BWG B;  4AF7 A;  1HQM C;  3C46 A;  3OE7 A;  4CKC A;  3CRK C;  1M90 D;  2E2H B;  1Q46 A;  3HOZ B;  2WZN A;  1VJS A;  2K14 A;  3EIV A;  2J7K A;  4P12 A;  1FNM A;  4A3E B;  1OB0 A;  3LQ6 A;  5E4X A;  2HDM A;  2V7W A;  3G71 B;  2NVY H;  1RQR A;  2ZL7 A;  5DM7 3;  3S17 H;  1Z9F A;  1Y8O B;  1NMG A;  5IE8 A;  3D3R A;  5ELD A;  3C2P A;  2XZO A;  2JXM B;  4ME3 A;  2VXW A;  3I4O A;  4XKW A;  2R7F A;  4ZCK A;  4C3J B;  1WCM G;  1WOS A;  3VNV A;  3NPP A;  3CMM A;  1X54 A;  2WAQ E;  1S4M A;  3ND8 A;  4IO9 A;  1ONL A;  2NUC A;  3R6K A;  1LT6 D;  5COY A;  3CCL B;  4OX9 L;  1F20 A;  2VL6 A;  4OL7 A;  2H4O A;  1GOZ A;  4DV2 L;  3GTP H;  4FXD A;  1WTR A;  2EYL A;  2G9H D;  1F2Z A;  1PA6 A;  2X53 S;  4DV3 Q;  2K5V A;  4BA2 I;  1MJE A;  4L5R C;  1FJG L;  4BXX G;  2LKV A;  4TMZ A;  5LL6 X;  1ZYR C;  1NRK A;  2VQF Q;  5HGT A;  4RHS A;  4PC2 A;  2KQ3 A;  5JBQ A;  1I18 A;  3BZD B;  1QFY A;  2HD3 A;  2PNH A;  3CES A;  1DOK A;  4APV A;  3EBE A;  2K33 A;  4RG1 A;  3D4W A;  3I4N B;  1B4O A;  4BBR G;  2KCC A;  4PQX A;  5GRO A;  1JE4 A;  2GK7 A;  2WYR A;  4ZAI A;  4ZCM A;  3CRL C;  2QTZ A;  5KNC A;  3E6Z X;  1HUN A;  1EXM A;  5DM6 3;  2I07 B;  1QG7 A;  4JYA L;  5IP9 H;  1VQJ A;  3CCE B;  5CR3 A;  1UD5 A;  1E3Z A;  2IW3 A;  1FRQ A;  1E1T A;  2EDG A;  1HXY D;  4HJ7 A;  1VQB A;  2CCZ A;  4KK7 A;  1VQM A;  1H9J A;  4P1V A;  1VQL B;  1IKL A;  4BY7 H;  3TME A;  1KXL A;  2HLD A;  4LUO A;  1HTP A;  3DM3 A;  2OTL B;  4N9T A;  3CP8 A;  1XWE A;  2ZJQ A;  1LUZ A;  2AWO A;  1PRT C;  1L2F A;  2H5X A;  1VQC A;  1EYA A;  4IUV A;  4FF1 A;  3ICE A;  1YHQ A;  4QIW B;  1GKH A;  1JOR A;  2M00 A;  4RJL A;  4ZCL A;  4WFN 3;  5C3E H;  4Z1M A;  3W2D A;  5K5P A;  2DGY A;  2BGI A;  2PYK A;  5H59 A;  1HTL D;  1HQR D;  1W2B A;  3G6E B;  3H3V H;  3FPU B;  1G2T A;  4DAM A;  1WTX A;  1V1O A;  4AYB B;  1KNA A;  1V5V A;  2QIL A;  4P26 A;  4UDU C;  4DR5 L;  4GQN A;  2A6H D;  2BOS A;  1CM9 A;  1CT1 D;  2K03 A;  4PGO A;  1D5Z C;  1EQQ A;  1Y1W G;  1C48 A;  2VZA A;  2A1A A;  2EY5 A;  3SHL A;  3IAY A;  2NN6 G;  5IYD G;  4DF7 A;  1TXY A;  3S17 B;  1N05 A;  3G4S B;  4DUY Q;  1JJG A;  3MHB A;  5IYW A;  3WDN A;  5A2Q L;  4X7E A;  1E22 A;  1C7Y A;  1QVG B;  2YYZ A;  2VY3 A;  3I56 B;  1X9N A;  1XPO A;  3CHB D;  1I7P A;  1I4G A;  4M0L A;  2NB0 A;  1H9R A;  1EWC A;  2E2I B;  1N36 L;  3MXP A;  2AQ1 B;  3A56 A;  4P2C B;  3E1Y E;  4B3R L;  4OOX A;  1TWA B;  1DOM A;  3E0E A;  3BU2 A;  3SJZ A;  1YHB A;  4A3F H;  3HP3 A;  2EJF C;  3GTK H;  4K2L A;  1Q3L A;  1N34 Q;  4A3D G;  2RSO A;  3IRB A;  1HUM A;  2XWJ B;  4WWV A;  2ZT9 C;  2F3V A;  1BR9 A;  2JA7 G;  2XGJ A;  4CHT B;  1G6Z A;  4QUF A;  4DGZ A;  3C1E A;  4EX5 A;  1HR0 L;  1VQI A;  1JE5 A;  2ZXP A;  1E2W A;  4XYQ A;  2WAC A;  5M3M H;  1JB9 A;  5FIU A;  1WTH A;  4MNO A;  4CDF C;  3F2U A;  2GRE A;  4X64 Q;  4K14 A;  2RDH A;  4P73 A;  1LTG D;  2LY7 A;  1TLL A;  4U68 A;  3SVM A;  4Z4R A;  1EP2 B;  4A3J H;  1T6Y A;  3RN5 A;  1VQG A;  2HIX A;  4Y9U A;  5KYL A;  2Z6K A;  1TS2 A;  2UXD Q;  2DEU A;  5C6A A;  4MYU A;  2AHO B;  3CTA A;  2B2V C;  3AEV A;  2D3L A;  2C5B A;  1F2Y A;  2BE5 C;  4A3B G;  4G1B A;  1L1O C;  1B3A A;  3K0X A;  2PMZ E;  3A8J A;  3OZU A;  1JJ2 A;  2XGT A;  1STH A;  4X8I A;  4X07 A;  4B47 A;  4DAV A;  4AQY Q;  2F0I A;  4DV4 Q;  4GLX A;  5CC4 A;  1ASY A;  3HOZ H;  2P5Z X;  4ROX A;  2DNC A;  5CV7 A;  3K58 A;  2AUK A;  2OK8 A;  5C5L A;  2K5H A;  2KVO A;  5TR9 A;  1PFM A;  1KNE A;  1LAC A;  2NBF A;  1YNN C;  1D2E A;  2BGJ A;  2CVR A;  3PSI A;  2B2U A;  3QOL A;  2OXP A;  3JAM i;  4LF6 L;  3UDF A;  1VQH A;  4G7X A;  4A3G G;  2FVG A;  2HQL A;  5GQO A;  1W0K A;  1WSR A;  4PMW A;  2JA8 H;  1QUE A;  1QFJ A;  4XNF A;  1X55 A;  3JQR A;  4B3T L;  1H95 A;  3CD6 A;  1J9Z A;  4Z4Z A;  3ZUG A;  1ROD A;  2F0S A;  4X3K A;  1CHP D;  3PUM A;  3S1R B;  5C0X H;  2HHH L;  3TRZ A;  2UUB Q;  3D6W A;  2BPO A;  4OO1 G;  1IW7 C;  5C4J H;  1EFW A;  2PCF B;  5IK2 A;  1EWH A;  4B3M L;  5C4J B;  4L8J A;  1VQK B;  2B8G A;  4A76 A;  2KUM A;  4FWT A;  1G29 1;  5KND A;  3CME A;  4A3J G;  1BF4 A;  1XPU A;  1A3U A;  4RD1 A;  5D65 A;  1GR1 A;  1YHQ B;  4RM0 A;  1X32 A;  3CKI B;  3VYS A;  1YJ9 A;  4FO2 A;  4IFD I;  3FKI B;  1VQ8 A;  2KHI A;  1BQE A;  5ELF A;  1A3V A;  2EVB A;  1H9S B;  3QB3 A;  2WB1 E;  1ENA A;  4ZGN B;  4MN3 A;  5CBA E;  4PV1 C;  4ODG A;  4HED A;  1STN A;  4C3H G;  4JI6 L;  2F3I A;  1XYI A;  2OQ0 A;  5T1G A;  3NQT A;  1FDR A;  1DDI A;  4IW3 B;  1YJW B;  1PZJ D;  1YIT B;  2EIF A;  1J5E Q;  2FXQ A;  3CPX A;  3WNC A;  2D0O A;  4BS9 A;  2B2Y C;  3F1Z A;  3OFN A;  2MUY A;  1VMP A;  1PTO D;  4R4O A;  1K3B C;  3TZD A;  3MXN A;  3T13 A;  1Y1V B;  3CCS A;  2EYM A;  5IYR A;  1COW A;  1DM0 B;  3KDF B;  1IL2 A;  4HSP A;  3BYY B;  4AYB G;  5LMN Q;  4HIM A;  3ZZT A;  3NBH B;  4N8X 1;  2VW9 A;  4CJ1 B;  3U6B A;  2EYO A;  1OB2 A;  1VQP A;  1O7Y A;  1ZM4 A;  1PH1 A;  1F2M A;  5LMU Q;  4X65 Q;  5M5Y B;  3M4Q A;  5JPM C;  1CZG A;  3I4N G;  1SLJ A;  4KN7 C;  3GTM H;  1CQX A;  4L63 B;  2Q6K A;  3U58 A;  5M5Y H;  5LMN L;  2JIZ A;  2B2Y A;  1EYG A;  2ZZQ A;  3GTL B;  1RTO A;  3QFS A;  4I7A A;  4CGY B;  4BY1 H;  3PVD A;  4R8I A;  3GTG B;  4GOP C;  2FX3 A;  1HNZ L;  3D4R A;  5F2D A;  2IY5 B;  3CME B;  4DR6 L;  1TY2 A;  3GVK A;  1MI2 A;  4NP5 A;  4LF9 Q;  1FR3 A;  2A68 D;  3F2D A;  5BN5 A;  3GIR A;  4U9U A;  1EIG A;  2Z1C A;  4UP7 A;  4ZV4 A;  1ESR A;  1MGS A;  1O80 A;  1N32 L;  2K1B A;  2HIV A;  3R93 A;  3QOJ A;  4JBM A;  1IBM Q;  1VQ7 B;  1I94 Q;  5TSS A;  3W5H A;  4O42 A;  1WVL A;  2XNA C;  3OMG A;  2RQX A;  1JCK B;  1LTR D;  4N3N A;  4R4I A;  3H6M A;  1F9P A;  1AN8 A;  3S1Q H;  3BZC A;  4LBZ A;  1D6E C;  1FNW A;  1VLO A;  1A3T A;  2ID0 A;  3D31 A;  3CC4 A;  3EQL C;  5IWA L;  4RDJ A;  3RLF A;  5DN6 A;  3U4V A;  1CA6 A;  3OEE A;  1JOQ A;  2X0K A;  3CD6 B;  1X3E A;  3K7A H;  4DXF A;  4MHE A;  1Q1E A;  1T9H A;  2CHB D;  5JOB A;  4B3M Q;  3BH4 A;  1TVX A;  4LC0 A;  4L6T B;  3J81 L;  4YAO A;  3P75 A;  4DUY L;  3W5U A;  1I3Q B;  2UXB L;  2QA4 B;  1K8A D;  1YJW A;  1KAA A;  3V76 A;  1OO9 B;  1VQN A;  5IWA Q;  5JEA J;  1B1Z A;  4UPA A;  3SDZ A;  3FHW A;  3UDX A;  3VR6 A;  2NN6 H;  3SR1 A;  3RZD B;  5IYD H;  3MMP A;  3VYR A;  1CQF A;  3J80 c;  2VZL A;  1IBK Q;  5KYI A;  2FHT A;  3DHQ A;  2E5L Q;  1YNN D;  1Y1W H;  4OPS A;  4B3S L;  1TUI A;  1SYD A;  2O5J C;  1UD3 A;  2DER A;  5C3E B;  1CUK A;  2CQA A;  4EQP A;  1LT5 D;  2E2J H;  1E24 A;  4BBS B;  1SRO A;  2Q6I A;  4O2D A;  1EQR A;  3J7A V;  1SKQ A;  3CW2 A;  3BQJ A;  3W2E A;  2OT2 A;  1FRN A;  1VQ7 A;  4WJ4 A;  1OXU A;  3U2Q A;  3R3O A;  1BBW A;  4CKE A;  2A6H C;  4Y7N B;  2XWB B;  3JAM c;  3SLD A;  3TP6 A;  2EXD A;  1BLI A;  2B2V A;  1FVI A;  3BDL A;  3RUZ A;  5BSY A;  5FLX E;  2R92 G;  4NXN Q;  1PTO H;  3X3M A;  1SNM A;  4KN4 C;  1DAR A;  4XN3 A;  1M1K D;  3FVQ A;  4RPB A;  2CH4 W;  1AH9 A;  1V1P A;  4OOS A;  3D0F A;  5DNF A;  4YWL A;  4XKV A;  4LBW A;  3K81 C;  4B9W A;  3W5O A;  2PLF A;  3CPW B;  1RCV D;  1QVF A;  1H42 A;  1E62 A;  2SDF A;  2HT1 A;  4IUT A;  4R9W A;  1D5M C;  3VR2 A;  4UP9 A;  1WOP A;  5LHY 1;  5BR8 L;  1EY4 A;  3M4Y A;  3J81 i;  2RBM A;  3KLS A;  2NWG A;  2D0P A;  3PO3 H;  1JWU D;  3PCO B;  1F77 A;  2BH8 A;  2L15 A;  1GHK A;  2ZIT A;  2CBX A;  2YU9 B;  2X6W A;  1SYC A;  4OP7 A;  1I5F A;  1ET9 A;  1EY6 A;  4DV2 Q;  4TKO B;  3S14 H;  3SLN A;  3C2Q A;  4KY7 A;  3OW7 A;  4PC7 A;  5FLX c;  3IFD A;  1Z47 A;  4YHH Q;  1SXT A;  3QE2 A;  1I6V C;  3DWQ A;  1EP1 B;  4IJL A;  3RZO B;  2XSC A;  3K5O A;  4A3B B;  1C4Q A;  2CK3 A;  3VYU A;  1ICF B;  3H09 A;  3AGP A;  4KLK A;  3SK8 A;  2F03 A;  2LXJ A;  2GJP A;  4FNF A;  4UAJ A;  2CWA A;  3ULJ A;  3Q22 A;  1JWM D;  3GTK B;  2XNJ A;  3GTP B;  1EEF D;  4POF A;  5A89 A;  1K83 B;  4BXX H;  2GK6 A;  1A2U A;  5IIF A;  1B50 A;  4XN0 A;  1KDB A;  4C3I B;  1XNQ Q;  2JEA I;  1TWA H;  3ZBT A;  4IQZ A;  5ELC A;  3HOW G;  3HOU G;  2K5D A;  1ENC A;  4P9S A;  1JB3 A;  4P71 A;  4TMW A;  4Y7C A;  2CW0 C;  5I6W A;  2YTV A;  1QNU A;  3HKS A;  3FMC A;  1HCZ A;  1VCI A;  5IGD A;  1VQ9 A;  4JOI A;  3NEM A;  4UY8 C;  1JC7 A;  1LM0 A;  2KCT A;  1ELO A;  1I8D A;  1QNK A;  1SBB B;  5DLQ E;  1PTO C;  2KCM A;  4E6I A;  5ISR A;  5M5W B;  1S72 B;  3B82 A;  1PYB A;  2PQA B;  5EMN A;  5CDF A;  5IYQ A;  3W5V A;  1P8L A;  3VA7 A;  4TMV A;  1STB A;  3LWU A;  1YEZ A;  1QUF A;  1KMH A;  3CCR B;  4S3S A;  1BCP F;  4HIZ A;  4ZCI A;  1MIU A;  4RGN A;  1SFO B;  2Q2H A;  2ZXR A;  3STB D;  1JR0 D;  1RKN A;  2EJM A;  1Q12 A;  2R61 A;  2Q2U A;  3S14 B;  1MAB A;  3D6C A;  3E20 A;  2SNS A;  1CI3 M;  3S1N H;  1SE4 A;  2NZ1 D;  4DR6 Q;  5F4O A;  5TV2 A;  1VQE A;  5JPN C;  1FGU A;  3IFT A;  3OW2 A;  1R5N A;  1XQB A;  3FDT A;  1LT4 D;  1RIP A;  1XNR Q;  1WOO A;  1FD7 D;  3TDQ A;  5FO7 B;  1Q1B A;  4G7H C;  4CKB A;  2F0G A;  2F0D A;  1XJV A;  3G4S A;  5GAE C;  5K36 H;  2V7T A;  4P2N A;  1HNX L;  4IFD G;  2JN9 A;  3M7N A;  3CRZ A;  5H1S E;  3S24 A;  2PZT A;  4C43 A;  3MXN B;  3CCE A;  3ZZ0 A;  2VYQ A;  1EWI A;  2PMZ B;  2WKD A;  1YBY A;  2Z9H A;  3DUZ A;  3KOJ A;  4LF4 Q;  3HEJ A;  2PZW A;  4DFA A;  1HNX Q;  2L4N A;  4RGO S;  2EJG C;  2Z0S A;  4HID A;  5E1F A;  1BJK A;  1TR5 A;  4KHV A;  4OGQ C;  2QEJ C;  3ZPN A;  3BDO A;  4GLA C;  5KNB A;  2MNA A;  4Q0F A;  2F1M A;  3URY A;  3ZBU A;  1RDP D;  3TBI B;  1QG0 A;  1B9N A;  4C3J H;  4PZ7 A;  5FA6 A;  1Q7Y C;  4A3M G;  4KJO A;  4JC0 A;  4HN7 A;  2XZL A;  4ME5 A;  1FGB D;  2JYO A;  3TS2 A;  5C0X G;  1SSO A;  2DIE A;  1SYF A;  2GPJ A;  1BUV T;  4V0B A;  1VQ5 B;  5C4X B;  1DZ1 A;  1HH2 P;  1X3P A;  1FJG Q;  1V1Q A;  5ELE A;  4X66 Q;  4RD2 A;  2QGQ A;  2RCN A;  4RD4 A;  3Q6Q A;  4XXE A;  2YWE A;  3WNB A;  4YAU A;  2ZZE A;  3R2T A;  4RDK A;  1EU3 A;  1I4R A;  1N08 A;  3HAG A;  2JEB I;  3D8G A;  4A3K H;  3J81 k;  3WWV A;  3DDY A;  4ILW A;  4L5S A;  4B3R Q;  3VR4 A;  1RD9 D;  5DAU A;  3CXC B;  4J6H A;  5IYB G;  2EPB A;  4IUN A;  3ISX A;  3WND A;  5CV9 A;  2BE5 D;  3KJO A;  4HJ9 A;  3NSW A;  2CFM A;  4EGV A;  2DOG A;  4XIG S;  3H3V I;  1KDA A;  5EBC A;  5TRD A;  3AVT A;  3U9S A;  4A3D H;  3BY2 A;  5CV8 A;  3FJO A;  4RCO A;  2BMW A;  4ZRZ A;  3TP8 A;  3OW2 B;  2D74 A;  3WOF A;  2CWP A;  3HRZ C;  1OXS C;  4G7W A;  3MFG A;  3A8K A;  3OKX A;  3OZW A;  1STA A;  2FFK B;  4DR5 Q;  1E63 A;  1NBW A;  5FLM G;  1YJN B;  1VQM B;  1L1O B;  4QY7 A;  3GTQ H;  2VUM G;  4FXK C;  3OTO L;  3M85 A;  4DN4 M;  4NDX A;  1YJ9 B;  1UNS A;  4X05 A;  4NCN A;  2M9V A;  2IJ0 A;  2MO0 A;  4DV0 L;  2WAQ G;  2OBT A;  4OWT B;  2B7B A;  2ATW A;  3KF6 A;  1N0U A;  4HJ8 A;  2KA7 A;  4XLC A;  1H9M A;  3VNU A;  1G8Z D;  5IT9 c;  3OJW A;  1PV4 A;  3NQI A;  2X6X A;  4A3I G;  3PIO A;  1QVC A;  5E4W C;  1PH3 A;  1SYE A;  3OIP A;  1R4Q B;  1X3F A;  3A35 A;  2PIA A;  1RJT A;  4WZL A;  2NTS A;  1Q81 C;  2Z8L A;  4HAE A;  1YNJ C;  3GTO B;  1D1I A;  2N88 A;  3RLN A;  3AQQ A;  4FVM A;  3UDG A;  4JI2 Q;  2A8V A;  3W2G A;  3MA2 B;  1VQ8 B;  5AFW A;  1PH2 A;  3AFQ A;  1ET6 A;  1EFC A;  1G7S A;  1WTW A;  1ESF A;  3SGI A;  2E1R A;  2YV5 A;  1BDO A;  5J3B A;  3R6J A;  2WIN B;  4JBJ A;  2B2T A;  3Q0A A;  2D9U A;  1M4V A;  4JI0 L;  4YEL A;  1TWG H;  3H0G H;  1A2T A;  3KEW A;  2LFN A;  2ZTC A;  3CPF A;  1BBX C;  4GN4 B;  3CCQ A;  1I50 B;  3T16 A;  3V05 A;  3AGQ A;  3ULL A;  3NK9 A;  3JC6 6;  1EWY A;  2L1B A;  4LF5 Q;  4B4D A;  1TWC B;  1PKV A;  2VNK A;  2WP8 J;  3CXC A;  4A93 G;  3HFZ B;  3H91 A;  1FNC A;  3ERO A;  4M2L A;  2X3U A;  2TMP A;  3ASP A;  1BNZ A;  1SMY D;  4RD6 A;  1DG1 G;  4GKJ Q;  4Z4S A;  1VQ9 B;  3OPO A;  2DUD A;  2L11 A;  3VYT A;  1AP0 A;  4P3I A;  3ASQ A;  1VQO A;  1NR2 A;  2J7Z A;  3A55 A;  2CKZ B;  3AVX A;  5JJK A;  3OTO Q;  1SE3 A;  2VNI A;  2F0H A;  1V43 A;  1T6X A;  3ZC3 A;  5JEA G;  1UMK A;  1VQ4 A;  5IT9 E;  1TTT A;  4QFM A;  1UD8 A;  1Y1V H;  1UE5 A; 
#chains in the Genus database with same CATH homology
 4A3D B;  4KTA A;  2F0F A;  3NXW A;  5EKI A;  3Q6S A;  2XRS D;  1TS4 A;  4H44 C;  1UD4 A;  4XQQ A;  4RKB A;  3DXJ C;  1ML0 D;  3S1Q B;  1S5B D;  5D14 A;  5EJW A;  2VJI A;  3L9A X;  1DCZ A;  2JA7 B;  1TS3 A;  2DNE A;  2WAQ B;  4XQN A;  2C9O A;  4KD4 A;  1EY0 A;  2HQE A;  5JVG 3;  3J80 L;  3MZ5 A;  4KHZ A;  3D4D A;  4Z9C B;  5HUR A;  1GUW A;  4BY1 B;  1SNC A;  4XL9 A;  3ND9 A;  3K5N A;  2F0P A;  2DY7 A;  1H8E A;  2RA4 A;  2PW7 A;  3OOC A;  4QMG A;  3P1H A;  4F88 A;  4YIJ A;  1E0B A;  3GVJ A;  2NTT A;  3ERQ A;  4IUR A;  3TP5 A;  3JAM L;  4KD3 A;  1WD0 A;  2ZZF A;  1Y69 U;  4XON A;  1SDF A;  2MPM A;  1QOH A;  3W3A A;  1W0J A;  4IUU A;  5CBE E;  3QG1 A;  2Z4H A;  1OXT A;  2EYF A;  3GV6 A;  3NTH A;  2CW0 D;  1VLY A;  5T1I A;  1ILQ A;  4RWS C;  1HVX A;  2A5H A;  3DEP A;  5J39 A;  5CGK A;  4XOT A;  2QF7 A;  1I4P A;  4H13 C;  5EQ0 A;  3SEB A;  3BVM A;  1TY0 A;  4B08 A;  5KNL A;  1D5X C;  1LT3 D;  3K59 A;  4MIU A;  3OEH A;  2FMC A;  3ZIA A;  2VB2 X;  2F0N A;  3JU4 A;  4C3H B;  5JAV A;  1WTV A;  3BVG A;  4G7O C;  4FF3 A;  3TP7 A;  3TZU A;  1Z7T A;  1F9R A;  2WKC A;  2SNM A;  1EQT A;  1JOO A;  3KBG A;  4LMQ D;  3NTK A;  2LS0 1;  5FK9 C;  3QJY A;  4LAA A;  3HG9 A;  2BDN A;  4UAI A;  4IN3 A;  5EKL A;  2A74 C;  2B2T C;  1DOL A;  2D5D A;  5EBD A;  1T5E A;  2WII B;  1PZI D;  1PRT D;  3DM1 A;  5IGE A;  1EYD A;  3EA6 A;  1E43 A;  4OIJ A;  3S16 B;  4H0L C;  1G2S A;  1EFI D;  2PZU A;  1K8M A;  3T4A C;  3V96 A;  2M2L A;  1LTI D;  3I4L A;  2EY6 A;  3C3L A;  4M1U B;  1TT2 A;  2E75 C;  2HUG A;  1NAP A;  5NUC A;  1HHV A;  5K36 G;  1EL0 A;  2HCI A;  1R4P B;  2BCO A;  1EZ8 A;  2KED A;  2NYZ D;  4XOR A;  4PMC A;  2VJJ A;  1BO0 A;  1ZYR D;  3FKS A;  1WP6 A;  1BOS A;  1ZEQ X;  3A8K E;  3A3G A;  2KHS A;  4RHR A;  3RD4 A;  3E5S A;  3PUW A;  2ZXI A;  1E79 A;  4J8Q A;  1WTO A;  2IPK D;  3JAM E;  2F0L A;  3PUY A;  2ICE C;  4XTC S;  1C8C A;  3I72 A;  5KIX A;  1O78 A;  3A7A B;  1V0E A;  4X3T A;  2MJ8 A;  2KEE A;  2F43 A;  1SYB A;  2EY2 A;  4UZU A;  1SJE D;  4OO1 H;  3MWY W;  1VMC A;  2R92 B;  5HKK A;  2X6L A;  3K6O A;  2LZJ A;  2DN8 A;  1CTM A;  3HOY B;  3AU7 A;  3HS0 C;  2K04 A;  2FIN B;  4RGM A;  4U67 3;  2IX0 A;  4ABN A;  1PYW D;  1BPL A;  1X3Q A;  3MTS A;  4CBV A;  2ENB A;  4G7Z C;  4FYD A;  2PNR C;  4ZYS A;  3O13 A;  5EGT A;  3NBI A;  3I4M B;  2JA6 B;  4J1M A;  1LTT D;  3K7A B;  3MC0 B;  3EFX D;  2X69 A;  3E0J A;  1NSN S;  3TN2 A;  1EEI D;  2WJV A;  5EKK A;  1SMY C;  1SNP A;  4K8J A;  4XYO A;  3OMC A;  2GA4 B;  1PTO B;  2KJX A;  5EPJ A;  3KLS X;  2B2W A;  4RCN A;  3A54 A;  3EVQ A;  5CV5 A;  4DAP A;  5J22 A;  4DU9 A;  4WJW A;  1RTN A;  5I9O A;  1HRJ A;  1B9M A;  5KRU A;  4M8A A;  1BCP B;  4V19 0;  4QUC A;  1GUN A;  1RF2 D;  3PIO 3;  1UD2 A;  2R3Z A;  1Y1W B;  2WJY A;  4ZLT F;  1PXU A;  1EY9 A;  4HR7 B;  1EQV A;  1SND A;  2EYP A;  1UEA B;  2NVT B;  2B2W C;  3S9W A;  2L12 A;  1S5D D;  3DEO A;  2HDL A;  3PUX A;  2RSN A;  3A7L A;  1HFG A;  4XD7 A;  1DON A;  2JA8 B;  3SK6 A;  2R93 B;  1TU2 B;  2MP1 A;  2F0W A;  4ID6 A;  2HCC A;  1SJH D;  4ZUJ A;  3J7A F;  2N55 A;  2BDO A;  4WOR A;  1W6K A;  1LTS D;  3GVL A;  2LMC B;  3GP7 A;  1F9Q A;  5BN3 A;  1FNU A;  1XXG A;  1FYC A;  4OIK A;  4KY5 A;  1W6J A;  1STY A;  4B3F X;  2O4X A;  1S4Z A;  2F0M A;  3K0Y A;  1NUC A;  2JA5 B;  1CHQ D;  4K8I A;  4N9P A;  5M3M B;  2NVQ B;  1Q90 A;  4K5W A;  4DXG A;  2BA0 A;  3NTI A;  5ELB A;  1A15 A;  1YNJ D;  4NKL A;  1SNO A;  2L9H A;  2XRQ D;  1Y8P B;  4IZ8 A;  2K6A A;  1LLR D;  1B53 A;  2JE6 I;  2JP1 A;  2QDB A;  4PMB A;  3HZX A;  1AW7 A;  3S1N B;  1SKY B;  2ZTG A;  2EOT A;  1EFR A;  5KEE A;  2E1B A;  1E2V A;  4ZKC B;  2VUM B;  3DWA A;  3H3V C;  2B39 A;  3VA5 A;  4LJZ C;  5I9P A;  3MVV A;  2C5C A;  3I73 A;  5C4Z A;  1V8Q A;  1KLG D;  4A3M B;  1AZQ A;  1IYV A;  4A3I B;  2F0O A;  3BVZ A;  4XT1 B;  5COR A;  1U4P A;  4BA1 I;  1GUG A;  5IGB A;  5JJZ A;  3NBH A;  3BCD A;  1O7Z A;  4XLF A;  1T5X D;  3BYT B;  4KJN A;  4XLE A;  4RKL A;  1GHJ A;  1RHP A;  3VR3 A;  1TS5 A;  2A73 B;  3MXG A;  2JDI A;  2FJ2 A;  4FF4 A;  3G05 A;  4YXW A;  2VB3 X;  4BY7 B;  2H1E A;  2Z4I A;  3PO3 B;  4XT3 B;  5LL6 S;  3I70 A;  3SK5 A;  3RMH A;  3IL8 A;  3K57 A;  1BCP D;  3I3C A;  1PMR A;  1PZK D;  3AMU A;  5FO8 B;  5FO9 B;  4QCL A;  4XLH A;  4RAU C;  2F4I A;  4E0F A;  2K28 A;  3A8J E;  3PIP 3;  1E2Z A;  2A69 D;  4YEJ A;  3UI2 A;  1ENF A;  2PPB C;  2PO4 A;  4TRD A;  5FKA C;  1EY7 A;  1F9S A;  1NBM A;  1W9X A;  2WZP P;  2ZXH A;  4XM3 A;  1KDC A;  3QIA A;  1GUT A;  1BXT A;  3NWS A;  2AWN A;  3AB9 A;  2V31 A;  1CZW A;  2K32 A;  1QE6 A;  1STG A;  4XQF A;  5A35 A;  1LTA D;  1K28 D;  4C3J G;  3I8Z A;  1H9K A;  1WTQ A;  1U4M A;  3IKJ A;  4XDX A;  4HMJ A;  4H7B A;  4CJ2 C;  3BDC A;  4TSS A;  5IGG A;  3I90 A;  2K05 A;  1MBY A;  4ZK9 B;  4DA2 A;  4K2K A;  1J9O A;  4ASU A;  4IAL A;  4EVO A;  1LAB A;  1ICW A;  2XN9 C;  1U4R A;  4NMZ A;  2K7V A;  4KKU A;  3R2I A;  2K5W A;  4G57 A;  3N6R A;  2ICI A;  1PRT F;  3X3N A;  3N52 A;  4X3S A;  4I65 A;  5JEA H;  2XVS A;  1H9S A;  4O1N A;  4C2M B;  2XND A;  1WTH D;  4IFD J;  2EYJ A;  3T53 B;  4ZQ3 A;  2JSO A;  1DXM A;  2B63 B;  3K5L A;  2F0T A;  5C0X I;  5IOD A;  1FX0 A;  3S15 B;  2ZTN A;  4ZUI A;  4EQN A;  1D1K A;  2IL8 A;  2RDG A;  2L5T A;  2JJ2 A;  4C3I G;  2BA1 A;  2A6E D;  3WOE A;  1S5E D;  2ZZG A;  1QJO A;  2X6G A;  1FNV A;  2EZV A;  4WRD A;  3SK4 A;  4RGT A;  3S1M B;  5C44 B;  2Y0S B;  3M4O B;  1Z6H A;  2OEO A;  5D3D A;  2SOB A;  1EU4 A;  4B3G A;  3A3B A;  3PUV A;  3LNN A;  1V0F A;  1U9R A;  3FPP A;  4GZY C;  2L55 A;  4BBR B;  3WQZ A;  1H8H A;  2V4D A;  1XX8 A;  1DYQ A;  1F2L A;  2X8K A;  1DD2 A;  2R9V A;  3OAA A;  1EY5 A;  3GTQ B;  1L0Y B;  4DAY A;  4XLA A;  2EYH A;  3P20 A;  3U9O A;  4I7Z C;  1TKW B;  3ONA B;  4KMU C;  4AVZ A;  1BCP C;  1MSG A;  1R9T B;  3TSS A;  5I2X A;  2GJK A;  5CV4 A;  3Q23 A;  3OWF A;  3PO2 B;  5I4D A;  1JOK A;  5IOC A;  1B44 D;  3HOW B;  2RDF A;  1KZL A;  5C5M A;  4IFD H;  1TII D;  5C3X A;  1D2B A;  1IKM A;  2XZP A;  2EE1 A;  1S5C D;  4XMY A;  3KF8 A;  4ULL A;  3T51 B;  2KEC A;  5FOB B;  4XQJ A;  1GJX A;  3FEW X;  4TSF A;  3NHH A;  5D3I B;  1Q8I A;  5J1Z A;  4HCE A;  4X3U A;  3GTM B;  3SE0 A;  3PMF A;  4HCS A;  3HKZ B;  1SAP A;  4QB4 A;  1QIL A;  4EQO A;  1CA5 A;  1QWY A;  5I6Y A;  5FLX L;  2QKI C;  1CFM A;  1EYC A;  2PQE A;  1HA6 A;  1IL8 A;  5FL7 A;  2Q8I B;  3HOU B;  4II2 A;  1EOT A;  1IW7 D;  3J81 E;  1A6X A;  1VF7 A;  4TT3 A;  3OIQ A;  4HSV A;  1IHZ A;  1SNQ A;  1IYU A;  1SYG A;  2G9D A;  4FXG C;  1MD2 D;  3GTJ B;  2KCN A;  2V7Q A;  4JBW A;  4NW2 A;  4C56 C;  3BC9 A;  1HFN A;  4G6I A;  1EZ6 A;  1Y8N B;  4HTH A;  3C1F A;  1I4Q A;  3BG3 A;  4KKS A;  3ZYY X;  1UD6 A;  4XR6 A;  4HMI A;  3KLR A;  1B2T A;  3MXU A;  4RA8 A;  4A3G B;  2IWH A;  2MGS A;  3NP8 A;  2FMM A;  1WD1 A;  1MSH A;  1PRT B;  1AZP A;  1KTK A;  3H94 A;  1I4H A;  4A3K B;  2M5S A;  2AUJ D;  1E1Q A;  3VR5 A;  1NR4 A;  4A93 B;  1TWF B;  3OWE B;  4KV6 A;  4CJ0 B;  1VDZ A;  1PDQ A;  5IGC A;  1OXX K;  4KI0 A;  4II3 A;  2D3N A;  1NCV A;  1GUS A;  1II3 A;  2VNU D;  3FRP B;  1PFN A;  4A3J B;  2Q8T A;  2A68 C;  3OHX C;  3Q24 A;  3GQB A;  2XIW A;  2R6G A;  1GXD C;  4FXU A;  5M9O A;  2E76 C;  3OSO A;  1KLU D;  4G4K A;  2RVL A;  2IT1 A;  1QCB D;  4DK0 A;  1V1P B;  4A3F B;  3DMU A;  4C1N I;  3HGB A;  2E2D C;  1S5F D;  2QE7 A;  3S2D B;  3I91 A;  2NVY B;  3NUC A;  4R8N A;  1KAB A;  1AEX A;  3L7Z C;  3GO5 A;  3S2H B;  2ZXO A;  1CQV A;  4Q5V A;  4C1N K;  2JJ1 A;  4DNR B;  2KOL A;  2K5Q A;  1VF5 C;  1G91 A;  1XTC D;  2EXZ A;  1EIH A;  2X85 A;  5G3L F;  3A8I E;  4IUQ A;  3PUZ A;  1M8A A;  1I4X A;  5C0X J;  3G6J B;  2J4X A;  4DNT B;  4RH6 A;  3M7G A;  4IUP A;  5M3F B;  3PV0 A;  3MFY A;  3MEH A;  2F0V A;  4K5X A;  2F0U A;  1HPC A;  1L0X B;  2PW5 A;  4OHJ A;  1STE A;  2XOK A;  3LWE A;  3DWP A;  2X6Y A;  1OXV A;  2TSS A;  5EPL A;  1UAP A;  3CQZ B;  4PNY A;  5E3F A;  4RFB A;  2NVX B;  3R8B A;  2F0Q A;  2E74 C;  1HZE A;  2IX1 A;  3KK7 A;  1WCM B;  1PTO F;  5A2Q E;  5KGU A;  2DY8 A;  3T56 B;  1JIC A;  4B9X A;  4ZKB B;  4OO1 I;  1K8O A;  1UUP A;  2L0C A;  1PLF A;  1CK1 A;  5C4H A;  1BMF A;  4JMQ A;  3L3O C;  3MAQ A;  2O5I C;  3J80 E;  4JK1 C;  4FP5 D;  2IX3 A;  3G7L A;  3P7J A;  5EPK A;  4F8M A;  4LK1 C;  2B8F A;  3LX0 A;  5G3L D;  1ZKO A;  2E2J B;  2F0K A;  3V2T A;  5C3W A;  1O7L A;  1J8I A;  1AFP A;  4F87 A;  2NN6 I;  2O2L D;  2A6E C;  4QF4 A;  1SEB D;  3J7Y W;  2MHV A;  1ZXT A;  2F3W A;  1JQY D;  1WPC A;  2J0T D;  1DJR D;  3QO2 A;  5IGF A;  3K5M A;  5CV6 A;  1E3X A;  1HA5 A;  2OF1 A;  4FF2 A;  2D62 A;  4K6L A;  1SE2 A;  3NWT A;  3GV3 A;  1QB5 D;  2WV6 D;  3QWN A;  5CMD A;  3BS1 A;  2K01 A;  1TWG B;  4KKT A;  1PFB A;  3GD7 A;  1LO5 D;  2Z6B D;  5IT9 L;  3KUP A;  2W6J A;  3BCF A;  4TQU S;  5DEH A;  1ILP A;  4DK1 A;  2GJR A;  3SXH A;  4XOP A;  3ITP A;  5CYU A;  2F0E A;  2F0J A;  1TQO A;  2WB1 B;  2D2C C;  1LTB D;  2WPD A;  4P22 A;  3HOX B;  5JVH 3;  1JWS D;  2W6I A;  2I46 A;  3KBX A;  3M3Y B;  2B2U C;  2QCP X;  4K6D A;  1E1R A;  1TWH B;  2WSS A;  3H0G B;  3HOV B;  5I2Y A;  4NNJ A;  2RKS A;  1I6H B;  5BN4 A;  2A69 C;  4K5V A;  3NE5 B;  5M5X B;  1LV9 A;  1OHH A;  1EY8 A;  1U4L A;  2KVM A;  1BQQ T;  2AQ3 B;  1GUO A;  3EJI A;  3CP2 A;  4KY6 A;  1WTP A;  4F7X A;  3CU7 A;  2R7Z B;  2EY1 A;  2SEB D;  2Q8R E;  4BWG B;  1HQM C;  3C46 A;  3OE7 A;  4CKC A;  3CRK C;  2E2H B;  3HOZ B;  1VJS A;  4A3E B;  1OB0 A;  5E4X A;  2HDM A;  5DM7 3;  1Y8O B;  3D3R A;  5ELD A;  3C2P A;  2XZO A;  2JXM B;  2VXW A;  4XKW A;  4C3J B;  3NPP A;  3CMM A;  3ND8 A;  1ONL A;  2NUC A;  1LT6 D;  5COY A;  4OL7 A;  2H4O A;  1GOZ A;  4FXD A;  1WTR A;  2EYL A;  2G9H D;  1F2Z A;  2X53 S;  4BA2 I;  2LKV A;  5LL6 X;  1ZYR C;  1NRK A;  5HGT A;  4RHS A;  2KQ3 A;  1I18 A;  3BZD B;  3CES A;  1DOK A;  2K33 A;  3D4W A;  3I4N B;  1B4O A;  2KCC A;  4PQX A;  1JE4 A;  2GK7 A;  4ZAI A;  3CRL C;  5KNC A;  3E6Z X;  1HUN A;  5DM6 3;  2I07 B;  1QG7 A;  5CR3 A;  1UD5 A;  1E3Z A;  2IW3 A;  2EDG A;  1HXY D;  4KK7 A;  1H9J A;  1IKL A;  3TME A;  2HLD A;  1HTP A;  4N9T A;  3CP8 A;  1XWE A;  2AWO A;  1PRT C;  1EYA A;  4IUV A;  4FF1 A;  4QIW B;  1JOR A;  2M00 A;  4WFN 3;  4Z1M A;  3W2D A;  5K5P A;  2PYK A;  1HTL D;  1HQR D;  3FPU B;  1G2T A;  1WTX A;  1V1O A;  4AYB B;  1KNA A;  2QIL A;  4UDU C;  4GQN A;  2A6H D;  2BOS A;  1CM9 A;  1CT1 D;  2K03 A;  1D5Z C;  1C48 A;  3IAY A;  2EY5 A;  3SHL A;  2NN6 G;  4DF7 A;  3S17 B;  3MHB A;  3WDN A;  5A2Q L;  2YYZ A;  3CHB D;  1I4G A;  2NB0 A;  1H9R A;  1EWC A;  2E2I B;  3MXP A;  2AQ1 B;  3A56 A;  4P2C B;  1TWA B;  1DOM A;  3HP3 A;  2EJF C;  4K2L A;  1Q3L A;  2RSO A;  1HUM A;  2XWJ B;  2ZT9 C;  2F3V A;  1BR9 A;  2XGJ A;  4CHT B;  4QUF A;  4DGZ A;  3C1E A;  2ZXP A;  1E2W A;  4XYQ A;  2WAC A;  3F2U A;  4K14 A;  2RDH A;  1LTG D;  2LY7 A;  4U68 A;  3SVM A;  5KYL A;  1TS2 A;  5C6A A;  2B2V C;  2D3L A;  2BE5 C;  1F2Y A;  1B3A A;  1STH A;  4DAV A;  2F0I A;  5CC4 A;  2DNC A;  5CV7 A;  3K58 A;  2AUK A;  5C5L A;  2KVO A;  1PFM A;  1KNE A;  1LAC A;  2NBF A;  1YNN C;  2CVR A;  2B2U A;  3QOL A;  2OXP A;  4G7X A;  1W0K A;  4PMW A;  4XNF A;  1ROD A;  2F0S A;  4X3K A;  1CHP D;  3S1R B;  5C0X H;  3D6W A;  4OO1 G;  1IW7 C;  2PCF B;  5IK2 A;  1EWH A;  5C4J B;  4L8J A;  2B8G A;  2KUM A;  1G29 1;  5KND A;  1BF4 A;  1A3U A;  5D65 A;  3CKI B;  1X32 A;  3VYS A;  4FO2 A;  4IFD I;  3FKI B;  5ELF A;  1A3V A;  2EVB A;  1H9S B;  3QB3 A;  1ENA A;  4MN3 A;  5CBA E;  4PV1 C;  4ODG A;  4HED A;  1STN A;  4C3H G;  1XYI A;  5T1G A;  3NQT A;  1PZJ D;  4BS9 A;  2B2Y C;  3OFN A;  2MUY A;  1VMP A;  1PTO D;  3TZD A;  3MXN A;  3T13 A;  1Y1V B;  1G6Z A;  2EYM A;  1COW A;  1DM0 B;  4HSP A;  3BYY B;  4CJ1 B;  2EYO A;  1O7Y A;  1F2M A;  5M5Y B;  5JPM C;  1CZG A;  4KN7 C;  4L63 B;  2JIZ A;  2B2Y A;  2ZZQ A;  3GTL B;  1RTO A;  4CGY B;  4R8I A;  3GTG B;  3D4R A;  5F2D A;  1TY2 A;  3GVK A;  4NP5 A;  1MI2 A;  1FR3 A;  2A68 D;  5BN5 A;  1EIG A;  2Z1C A;  1ESR A;  1MGS A;  1O80 A;  2K1B A;  3R93 A;  3QOJ A;  5TSS A;  4O42 A;  1WVL A;  2XNA C;  3OMG A;  2RQX A;  1JCK B;  1LTR D;  3H6M A;  1F9P A;  1AN8 A;  1FNW A;  1D6E C;  2ID0 A;  1A3T A;  3D31 A;  3EQL C;  3RLF A;  5DN6 A;  1CA6 A;  3OEE A;  1JOQ A;  4DXF A;  4MHE A;  1Q1E A;  2CHB D;  5JOB A;  3BH4 A;  1TVX A;  4L6T B;  3J81 L;  3P75 A;  1I3Q B;  1KAA A;  1OO9 B;  5JEA J;  1B1Z A;  3SDZ A;  3VR6 A;  2NN6 H;  3SR1 A;  3RZD B;  3VYR A;  1CQF A;  5KYI A;  2FHT A;  3DHQ A;  1YNN D;  1SYD A;  2O5J C;  1UD3 A;  5C3E B;  2CQA A;  4EQP A;  1LT5 D;  4BBS B;  3J7A V;  2OT2 A;  1OXU A;  3R3O A;  4CKE A;  2A6H C;  4Y7N B;  2XWB B;  3TP6 A;  1BLI A;  2B2V A;  3BDL A;  3RUZ A;  5FLX E;  1PTO H;  3X3M A;  1SNM A;  4KN4 C;  4XN3 A;  3FVQ A;  1V1P A;  5DNF A;  4B9W A;  4XKV A;  1RCV D;  2SDF A;  4IUT A;  4R9W A;  1D5M C;  3VR2 A;  5LHY 1;  1EY4 A;  3M4Y A;  2RBM A;  3KLS A;  2NWG A;  1JWU D;  1F77 A;  1GHK A;  2X6W A;  1SYC A;  1ET9 A;  1EY6 A;  4TKO B;  4KY7 A;  3OW7 A;  3IFD A;  1Z47 A;  1SXT A;  1I6V C;  3DWQ A;  3RZO B;  2XSC A;  3K5O A;  4A3B B;  1C4Q A;  2CK3 A;  3VYU A;  3SK8 A;  3H09 A;  2F03 A;  2GJP A;  4FNF A;  3Q22 A;  1JWM D;  3GTK B;  3GTP B;  1EEF D;  1K83 B;  2GK6 A;  1A2U A;  5IIF A;  1B50 A;  4XN0 A;  1KDB A;  4C3I B;  2JEA I;  4IQZ A;  5ELC A;  2K5D A;  1ENC A;  1JB3 A;  2CW0 C;  5I6W A;  1QNU A;  3FMC A;  1HCZ A;  1VCI A;  5IGD A;  1JC7 A;  1I8D A;  1QNK A;  1SBB B;  4E6I A;  1PTO C;  5ISR A;  5M5W B;  5CDF A;  3VA7 A;  1STB A;  3LWU A;  1KMH A;  4S3S A;  1BCP F;  4HIZ A;  4RGN A;  1SFO B;  2ZXR A;  1JR0 D;  1RKN A;  2EJM A;  1Q12 A;  2R61 A;  3S14 B;  1MAB A;  3D6C A;  2SNS A;  1CI3 M;  1SE4 A;  2NZ1 D;  5JPN C;  3IFT A;  3FDT A;  1LT4 D;  3TDQ A;  1FD7 D;  5FO7 B;  1Q1B A;  4G7H C;  4CKB A;  2F0G A;  2F0D A;  5K36 H;  4IFD G;  3M7N A;  2PZT A;  2PMZ B;  2WKD A;  3DUZ A;  3HEJ A;  2PZW A;  4DFA A;  2L4N A;  4RGO S;  2EJG C;  5E1F A;  1TR5 A;  4KHV A;  5KNB A;  4OGQ C;  2QEJ C;  3ZPN A;  3BDO A;  4Q0F A;  2F1M A;  3URY A;  1RDP D;  3TBI B;  1B9N A;  4KJO A;  4HN7 A;  2XZL A;  4ME5 A;  1FGB D;  2JYO A;  5C0X G;  1SSO A;  2DIE A;  1SYF A;  4V0B A;  1BUV T;  5C4X B;  1DZ1 A;  1X3P A;  5ELE A;  4XXE A;  2ZZE A;  3R2T A;  1EU3 A;  1I4R A;  3HAG A;  2JEB I;  3D8G A;  3DDY A;  4ILW A;  3VR4 A;  1RD9 D;  5DAU A;  4J6H A;  2EPB A;  4IUN A;  5CV9 A;  2BE5 D;  3NSW A;  4EGV A;  4XIG S;  1KDA A;  5EBC A;  3U9S A;  5CV8 A;  4RCO A;  4ZRZ A;  3TP8 A;  3WOF A;  3HRZ C;  1OXS C;  4G7W A;  3MFG A;  1STA A;  2FFK B;  4FXK C;  3M85 A;  4DN4 M;  4NDX A;  1UNS A;  2M9V A;  2IJ0 A;  2KA7 A;  4XLC A;  1H9M A;  1G8Z D;  3NQI A;  2X6X A;  5E4W C;  1SYE A;  3OIP A;  1R4Q B;  3A35 A;  1RJT A;  2NTS A;  2Z8L A;  4HAE A;  1YNJ C;  3GTO B;  1D1I A;  2N88 A;  4FVM A;  3MA2 B;  5AFW A;  1ET6 A;  1WTW A;  1ESF A;  1BDO A;  2WIN B;  2B2T A;  3Q0A A;  2D9U A;  1M4V A;  4YEL A;  1A2T A;  3KEW A;  2LFN A;  1BBX C;  2YU9 B;  1I50 B;  3T16 A;  3V05 A;  3NK9 A;  2L1B A;  1TWC B;  1PKV A;  2WP8 J;  3H91 A;  3ERO A;  2TMP A;  1BNZ A;  1SMY D;  3OPO A;  2L11 A;  3VYT A;  1AP0 A;  1NR2 A;  2J7Z A;  3A55 A;  1SE3 A;  2F0H A;  1V43 A;  5JEA G;  5IT9 E;  1UD8 A;  2AQ2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...