3OPOA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
296
structure length
296
Chain Sequence
QNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 34
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3opoA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3opoA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3opoA01
3A8JE 4L8JA 3L7ZC 1GUGA 3I4LA 1Z6HA 1ZKOA 2AUJD 4OGQC 2PPBC 5BN5A 2O5JC 3CRKC 1H9JA 3EQLC 2A69C 2O5IC 3H94A 3U9SA 2BE5C 3ND9A 4H44C 2B8GA 1TU2B 2E75C 3WDNA 2A68D 1A6XA 2JEBI 1GJXA 1OXTA 1H9RA 3W3AA 1GUNA 2E76C 3SE0A 3A7LA 3PUWA 2QF7A 1OXVA 4KHZA 4TKOB 1LABA 1ZYRC 2D5DA 3OW7A 2DNEA 1Y69U 2D62A 4JBWA 4I7ZC 1DD2A 4OO1G 5K36G 2EVBA 2KA7A 1HTPA 1E2VA 1TKWB 1FR3A 3I73A 2F1MA 4TQUS 1OXUA 4IQZA 2JEAI 2A6ED 2BA0A 3A8IE 2EJMA 4G7OC 1H9KA 2KCCA 2NN6G 3A7AB 2DNCA 1E2WA 1HQMC 3BDOA 2B8FA 3RLFA 4G7ZC 2A68C 1CTMA 1LACA 1I6VC 1Y8OB 3VA7A 5JEAG 4OO1H 5K36H 4IFDH 1GHKA 1O78A 5C0XG 1QJOA 2V4DA 4DK0A 4GZYC 2PNRC 1B9MA 1Q1EA 2BE5D 1BDOA 2JE6I 3VR3A 1OXSC 1T5EA 1IYVA 1HCZA 3LNNA 2K32A 5BN3A 2ZT9C 1K8OA 4DNTB 4BA1I 2A6HD 4XIGS 3T56B 3M4YA 3MFYA 2K33A 2PCFB 3VR5A 3IFTA 2A6HC 2EJFC 3FMCA 1V8QA 2EDGA 3KLRA 1VF5C 2K7VA 3BG3A 2JXMB 2E74C 3VR4A 2D2CC 3PUYA 1G291 4LJZC 1HPCA 2BA1A 1FYCA 4H13C 1IYUA 2L5TA 1PMRA 4JK1C 3QIAA 4KKTA 4DNRB 1B9NA 3D4RA 3M7NA 4HR7B 2NN6I 4LK1C 1ONLA 2YYZA 4RCNA 3NE5B 3T51B 1E2ZA 5KNBA 1H9SB 2AUKA 1DCZA 4KKUA 1GUOA 5BN4A 2A6EC 1GUSA 2LMCB 2Q8IB 4XTCS 1YNNC 3HGBA 2IT1A 1IW7C 2AWOA 3LWUA 3N6RA 3P20A 3QG1A 5JEAH 2EJGC 4BA2I 1OXXK 1CI3M 3CRLC 1O7LA 3PUZA 1GUTA 3VR2A 3ND8A 1IW7D 1Q90A 3AB9A 4G7HC 4KI0A 1H9SA 3TZUA 3GD7A 3FPPA 1VDZA 3GQBA 3QJYA 2BDOA 3PUXA 3I72A 4KN7C 2CW0C 4PV1C 5A35A 3IKJA 3MXUA 1V43A 2A69D 1GHJA 2R6GA 4KMUC 2NN6H 3DXJC 1VF7A 3A8KE 1CFMA 5KNCA 1SMYC 5KNDA 3SDZA 4KKSA 1DXMA 1EWHA 1Q1BA 3OPOA 1Q12A 3M85A 1VCIA 1Y8PB 4H0LC 3OOCA 4DK1A 1YNJC 3PUVA 4IFDG 1H9MA 1Y8NB 3PV0A 3T53B 5C0XH 3VR6A 1K8MA 1Z7TA 4KN4C 3D31A 2DN8A
chains in the Genus database with same CATH superfamily
1PTOC 4OOXA 4OELB 2JJ2A 1MABA 1W9XA 4TMWA 1CNEA 4OO1I 5FLXE 2K1BA 5IYRA 5IT9L 3S16B 1PFMA 1TU2B 4Z4WA 4YCVA 1JB7A 3S15B 1RL2A 4QVJA 1IZ6A 4HJ7A 1JE4A 1ZYRC 2F4NA 4AQYL 5CR3A 4KK7A 5JBQA 3PO2H 2W6JA 1KNAA 3OMGA 2Q2UA 2QEXA 2F52A 3NPPA 2UU9L 1TKWB 4JOIC 1KLGD 1E43A 3S24A 2R6HA 4NB3A 3GTJH 4OPVA 4MZ9A 4XLHA 3GO5A 5F4JA 2YV5A 3U4VA 1W2BA 1EQVA 2RCNA 1II3A 3MEHA 3PO2G 1M8AA 1Q8KA 1IL8A 1O78A 1S4ZA 3QR8A 4O0AA 3CCUA 1YVCA 2CK3A 3GV6A 4IW3B 3F2UA 3GP7A 5ELNA 5GQOA 1S40A 5M5WB 1TWCB 1YHQB 2IWHA 2EYHA 4V190 1GD7A 2C4TA 1GOZA 2N88A 1LTRD 1MRZA 1BCPC 1OTCA 2R7ZG 1B3AA 4XIGS 5FL7A 4FO2A 1EP2B 4RPDA 1H42A 2DJFC 3M4PA 2ZITA 2IHFA 1B4OA 3FMCA 5I2XA 4A3FH 1VF5C 1PH4A 3PO3B 1K0SA 4QB4A 4YAFA 2HD3A 4BY1G 4TRDA 2ZZEA 1UNSA 3WNDA 1IB0A 2WKDA 5E1FA 1TWAH 1YI2A 3SR1A 4OPOA 1O7IA 1P8LA 1A2TA 2XIWA 3QFCA 4X64L 2CWAA 4RPBA 1KZLA 2EY1A 4C0SA 4K5WA 4A3FG 4G5GA 1RIPA 1PRTB 1BBUA 3CP8A 2AUKA 2F0FA 1TUIA 2ZXHA 2K5HA 2R92B 4RDJA 1E1OA 3CQZH 5JEAJ 3JAML 5M3FB 2VNJA 1ZEQX 1RKNA 2EYPA 4JI2L 3FKIB 4BA2I 3RUZA 3MVVA 3CRLC 2D74A 3G05A 1I4QA 3PA1A 4QUFA 1M90C 1IW7D 2JA6G 1WTVA 2UXBQ 4BY1B 3TSSA 3FJOA 2EIXA 2BDOA 5HURA 4JPBW 2NVTB 1I3QH 2NYZD 2D9RA 3HOVG 4KMUC 4P22A 1S5BD 1WYDA 1PYSB 2VNKA 5IT9E 1E1TA 1S5ED 4OX9L 2F4VL 1GM5A 1BO0A 1FX0A 1EIFA 4GQNA 4Z4ZA 2ICIA 5DM73 1YLOA 1K73D 1G2TA 1EFTA 4DK1A 1WTHD 1SNCA 1S3OA 1Y8NB 2EYOA 1K8MA 1A15A 2QEJC 4DAVA 1XFOA 3CF5A 3S2DH 4DV7Q 4BBSB 2AUJD 1OHHA 1TQOA 2FJ2A 2NVTH 4ZKBB 5A88A 4CJ1B 1ENCA 4K6DA 3K0XA 3SK5A 1KNEA 5KSWB 4LNQA 2EYFA 4C3JB 1OXTA 1SR3A 3A54A 3PUWA 4HMJA 4TKOB 2LSSA 4RDLA 4RD4A 4FDBA 3RN5A 2NTSA 4JBWA 1P16A 4FXDA 2J7ZA 3ZIAA 3V76A 1FNMA 4G7OC 1YJ9B 2IW3A 2RDHA 3A8IE 5CV8A 3VDYA 1HR0W 2WYRA 4C3JH 1TLLA 1KL9A 4YWKA 3U6BA 5JJKA 1CA6A 2K28A 1LACA 3STBD 1GHKA 2HIVA 1HJPA 3I4MG 3WYAA 2OWOA 3WNCA 1HFGA 2B2TC 1YJWB 3KF8B 4PC6A 4G1VA 3R93A 4RD0A 3SLDA 4X65L 2CW0D 1OXSC 3KLSA 1IYVA 2WZNA 3URYA 1E1QA 1J8IA 2OK8A 4GN3B 4OXPA 5JJIA 1RCVD 2XZLA 2A6HD 4JBJA 5ELEA 5TR9A 1K8GA 2H5XA 1Q81D 3I4NB 1QZGA 2A6HC 2R92H 2QMUA 2O4XA 1D7QA 1V8QA 4DR3L 2K50A 4XNFA 3F2CA 3CC4A 2IHEA 2DGYA 1B70B 5EKLA 4B3FX 2MGSA 5CC4A 4C56C 4P75A 4MTKA 4JK1C 1B9NA 3BU2A 4BY1H 1LTID 2BM0A 2XZPA 1E63A 3JQPA 2RSNA 2QILA 3JQQA 2DY8A 1UD3A 1G51A 3BYTB 3T51B 5AN9A 4YHBA 1V5VA 1DCZA 3NELA 3W5HA 3AFQA 4GNXA 1EY6A 1UE6A 3RZOB 4IUTA 1BXTA 1PYWD 2B29A 2BOSA 3NSWA 4AIMA 4RD2A 1VQ4B 2K4KA 1QUFA 3JC66 2ZXIA 4JC0A 1HNXL 3I3CA 2I5LX 4L5SA 3OTOL 1LT3D 2VNUD 1I94Q 3NQTA 4TMZA 4B3XA 5C4JH 1QFYA 5C4ZA 3GTQB 1QNUA 1GO3E 1PFNA 1XTCD 4IOAA 3JU4A 3ZZTA 3BY1A 2IX0A 4DR6L 3W2DA 1VCIA 4H0LC 3NBHA 1Q82D 1VQBA 1L1OC 2C4UA 3MEFA 4J6HA 4A3EH 3OYYA 4L63B 5C0XJ 3MC0B 1FNVA 2MNAA 4PMWA 3S1MB 1MSHA 1EEID 5J35A 3H0GG 5BN5A 1H9JA 4B3MQ 1UWVA 3H0GB 5FLXL 1IJEA 3U9SA 1FNBA 2B8GA 4DGZA 2JA8G 3HOUB 4ZGQB 1JJGA 1D1IA 5M5XB 3I91A 3NTHA 3I70A 4HSVA 2R7FA 1UMKA 4KTAA 1R9TB 2KECA 1C4QA 4B3SQ 2IL8A 4RAUC 1XNRL 2JEAI 4A3CG 3S1RB 4LMQD 1U0LA 2CC2A 2B2WC 2JJ1A 1EFWA 1Q86C 4YWMA 1KK3A 3E0EA 2VL6A 2KVOA 1GVHA 2DERA 4XLEA 3B82A 5K36H 4X3KA 1FDRA 4WZTA 1HZ9A 2PI2A 2Z6KA 4IZ8A 4R1JA 2ZTCA 2K04A 3BC9A 5FLXc 1O7YA 2BE5D 2K6AA 2JYOA 4LFCL 2X6WA 3SJZA 3QWNA 1QOHA 4X64Q 4YAWA 4QVAA 3OTOQ 2EE1A 4POFA 5E3FA 1XNQQ 3SK6A 3QFSA 2QDXA 5IYBG 2HCCA 2OBTA 2EYMA 3CPWB 2AQ1B 1A2UA 4GS3A 1CKOA 1I4RA 3CMEB 2XSCA 1EU4A 4POGA 2F0JA 2R93B 1VQ6A 3PUYA 3WBJA 4I65A 2BH8A 4CDEC 3Q3AA 4H13C 2JA7B 2DJGC 4HIZA 2B7BA 4AVZA 3CCJB 1BOSA 3CTAA 2VXWA 4IJLA 4DR2L 4BY7B 3EROA 3I55B 2MP1A 3ZPNA 2WP8J 1N32L 5KNBA 1VQKB 1VQ6B 1VHEA 4ZUJA 5C5MA 3E9IA 1YNNC 1VQLA 3HRZC 3ZJYC 4ALPA 2BGJA 1BBWA 1NE3A 1SBBB 3NBHB 1E0BA 1EU3A 1OXXK 1SAPA 2H4OA 2X6GA 4JI3L 2LY7A 3VR2A 3GTMH 2VB3X 2FMCA 3CW2C 3WWVA 3FEWX 3DM1A 1IKMA 4IUNA 4O42A 4RMFA 2WAQG 5B6IA 2IPKD 1HRJA 4NXML 3D4WA 4LUVA 1VQNA 3J80c 3GV3A 2JK8A 1TXYA 1XE1A 2AHOA 4PC7A 2VB2X 5FLMG 1FGBD 3R6KA 1GUWA 1ZXTA 1EWHA 3K8AA 1JORA 2VBSA 3HKZG 2B2TA 3J7AF 4M4SA 3FPKA 1VQOA 4PC2A 1N9WA 1ESRA 1VQ8A 1K0RA 4CBVA 1WU8A 5FNZA 3RLOA 1A3TA 1YHQA 2CRVA 2JN4A 4XYOA 4YAUA 1R5OA 1TWCH 2QDLA 4RA8A 1BLIA 5M3FG 1JCKB 1DOKA 1NY4A 2BE5C 1F9QA 3ZC3A 5ELOA 1TT2A 2SEBD 1R5NA 4A3IH 1KIXA 2HDMA 2UUBL 5HXBA 1NMFA 3BZCA 5H59A 4RWSC 4RLZA 3WOFA 1X32A 1Y69U 4UP8A 2UXCQ 1JWSD 3NBIA 1DD2A 4HE6A 2VYQA 1KDCA 3P7JA 3J80E 5IWAQ 2Y0SE 1JJCB 3KEWA 1DGSA 4A3LH 3A1PA 1CK1A 3CCLA 4J1MA 2DNCA 4BWGB 4OHJA 2L1BA 4K8IA 1Q9SA 4P3IA 1EFID 3F1ZA 4YALA 2RCFA 2V4DA 4P2NA 4JI1Q 5H5JA 4P71A 3ULLA 2VBUA 2GN5A 1PFSA 5ELCA 1X3PA 1SYFA 4BA1I 1WCMB 2EPBA 2QA4A 1VQ8B 2RSOA 3PO2B 1HZEA 2QTZA 3CB4A 3G71B 5GADC 4ACBA 3I4MH 1CQXA 5EKIA 3KLRA 1F9SA 3CC4B 4P6VF 1SDFA 4JI0L 3X3NA 4A76A 3C46A 1VQMB 1W0KA 3I56B 2F0GA 4O2DA 4Q5VA 2MJ8A 2DUDA 3K5LA 2ZZGA 2VQFQ 5CV5A 4X62Q 2B63H 4RD1A 1N8RD 2QGQA 3AVVA 3K5NA 2AMCB 4K1XA 2WR8A 1UEAB 2B2UC 1ASZA 4F8MA 3HS0C 5HZBA 5M5WH 1TR5A 2ZJQA 2D3LA 2V7WA 2L15A 4GLAC 2NBFA 3CC7B 1RDPD 1ELOA 4GOPB 1GUSA 4OPSA 4A75A 3KL9A 1SNDA 2N78A 3RY8A 1SYEA 4LUZA 5TV2A 3ND8A 3OWFA 5I6WA 3MMPA 2C5HA 2QE7A 4DXGA 1J5EQ 3CC7A 1OGJA 4DAMA 2B2UA 3R6JA 1Q3LA 2CH4W 1D8TA 4Z9CB 2FXQA 4KV6A 1ZM3A 4GOPC 1ESFA 3EJIA 1W35A 1EIGA 5C6AA 4R71A 2OEOA 2FMMA 4DUYL 1K73C 1PH6A 1ILPA 1IHMA 1Q1BA 1WTHA 1UD6A 3OIQA 4YIJA 5AJ3Q 1N07A 3CXCA 4GNXC 4JI8Q 2KCTA 3WY9A 3A3BA 2GK7A 3ZBUA 2D3NA 1Y1WH 2M00A 2C5CA 2NWGA 2QDBA 4Y9RA 2A69C 2KEDA 1PH9A 1V0EA 4H44C 2Q2IA 3WDNA 2RF4A 3EVQA 3KJOA 3DLLA 4PC1A 5EPLA 4JI3Q 1VQJA 2YU9H 1XQBA 1LABA 4LF8L 1YNJD 2EFGA 4XM3A 4NW2A 3ISXA 1DM0B 1FR3A 4B3SL 1TIID 4LF9L 3E20A 4HN7A 4EVOA 3U6KA 1NNXA 4PG3A 2KCCA 2CBXA 3TRZA 3HKZE 4XT3B 5COYA 1YITA 4BBSH 4G7ZC 3K6OA 5KGUA 2ZXOA 1JT8A 2PI2E 2HIXA 1STYA 5CBEE 5EPKA 1U4RA 4DV7L 4ZUIA 3C3LA 3U58A 3U50C 2BMWA 1TWGB 2ZT9C 5D3DA 3T56B 4XQQA 2JA8B 1QZHA 2EJFC 1PTOD 4C1NI 4DR6Q 3GTMB 1QGZA 1VQ9B 2KQ3A 4OWWB 1CQFA 2C2WA 2ASBA 4EX5A 4UY8C 2MO1A 1HPCA 3U4ZA 2BA1A 1FYCA 3RMHA 4V0BA 3D26A 2QN6A 3PQIA 1A0IA 1WTPA 1QG0A 1SMYD 5DAUA 4A3LG 4BBRB 2F0EA 2L0CA 2LS01 4OP7A 4HR7B 4RCNA 4K2LA 1JNYA 4HAEA 1I3QB 3K7AH 4DK6C 2V7TA 3HP3A 3R2IA 4HIOA 1KRHA 1L1OB 1PDQA 2LMCB 3PUNA 2SOBA 3S14H 2VZLA 4HIDA 2XGTA 1SJHD 1Q82C 3VYSA 3PO3G 4IPCA 2NVQB 3A74A 4DU9A 2E2JH 5KW9A 4A3BB 4OEMB 4DV4Q 3T1HL 2KHSA 4M0LA 4LW1A 4ULLA 2N55A 4QQBX 3FPPA 4RH6A 3CC2B 3V2TA 1D5MC 3L0OA 2E8GA 4QL5A 3MXUA 4DNIA 2R6GA 4PZ8A 2JSOA 4DQLA 3A8KE 1N8RC 2F4IA 2ALYB 4C3HH 1G6ZA 2JA7H 3B78A 2B2YA 4A3MB 3H09A 1XMQQ 4Z4SA 3A56A 4UHVA 5KYIA 3I55A 3FVQA 1NJIC 1JB9A 5IP9H 2F0VA 3D31A 1VQ9A 3A8JE 2GK6A 1QUQA 1YEZA 2GJPA 3L7ZC 1EUJA 4DKAC 5FLMH 4DV0L 1BJKA 1PH7A 5HKKA 2B39A 1KHIA 1VMPA 3EQLC 4XXEA 2PMZB 2VS1A 3VO1A 4RDKA 1SYDA 1TS4A 1X3FA 1XMOL 3BZDB 5IYDG 5G3LD 4ZCMA 2K5VA 1VQPA 4H7BA 1I4GA 2E5LL 3CCVB 2OTJB 3QSYA 4I7ZC 3CRZA 4OO1G 4RCZA 3EIVA 2F43A 4Z4UA 4KY5A 2LZJA 1PZKD 5KIXA 4UZFA 1D5XC 3KJPA 5CDFA 3J7AV 3OE7A 1WOCA 2A74C 2B8FA 4IUQA 4ZKCB 3AVTA 1EYCA 3W1GA 5JEAG 3J7YW 3AMUA 3BYYB 5FO9B 1WTRA 1A63A 2PNRC 2WV6D 3Q22A 2R7ZH 3HOUH 1VS0A 1SE4A 1Y1WG 2JA6B 1AP0A 2Q6OA 2ES2A 2F0PA 4XOPA 1EY8A 2SDFA 3M4YA 1GXDC 2ZTDA 1WJJA 4P26A 2ZBVA 3KK7A 3RD4A 3GVLA 1H8HA 1WOSA 1SYGA 4C3HG 4P1VA 2XZOA 1EQQA 2DY7A 1FNUA 1OB0A 2R61A 3VR4A 3PIO3 4Z1MA 4AQYQ 4DR7Q 4A4IA 2KCNA 1UE5A 1HHVA 3DM3A 1IKLA 2D9UA 2L55A 4B3ML 4LAAA 2BSAA 2Q8RE 4JI4Q 3ER0A 4JV5L 1SKYB 5HZAA 2RC5A 1S5FD 1G7SA 1LYLA 3Q6SA 2PMDA 1SNPA 2F0WA 1M1KD 4JI7Q 4DV5Q 1CI3M 4RD3A 4DV5L 3KYHC 1A3VA 3I7FA 3TS0A 2AWNA 5C4XB 1QCBD 1EEFD 3K58A 5AFWA 4L6TB 4IFDJ 3HOXG 2R93H 3P75A 4LF6L 1BMFA 4DQKA 3BVZA 3R2TA 4Q0FA 1GAWA 4B9WA 3I56A 1QILA 4M1UB 4DV2Q 4WZEA 2A73B 4A3KG 3DXJC 5GROA 2RDFA 5KNCA 3CU7A 4B4DA 3D6CA 4A3GG 5KNDA 5C3EH 1C7YA 2NZOA 2MO0A 1YX2A 5C3WA 4P6YA 1Y8PB 2JN9A 3PUVA 2IX3A 5M5XH 3D0FA 1WI5A 3NWSA 2F0NA 2F3IA 1PJ7A 1GUGA 1UD8A 3W2EA 3ULJA 1TTTA 2FHTA 2KOLA 2BN4A 5IGFA 1JC7A 3OAAA 2EYLA 2PMZE 4HJ8A 1JJ2B 1O80A 1STHA 1BBXC 1H95A 3GSIA 1TWFB 1IXRA 1HA3A 5EKKA 3Q6RA 2M9VA 4TSSA 4KJNA 1R4PB 5A8AA 4S3SA 2KHJA 1VLOA 4YXWA 1V1PA 4IN3A 2UU9Q 4DV6L 3CMAA 3IAYA 1JA0A 1I6HH 2F0MA 4WRDA 2B2VA 5C44G 4G6IA 4X0CA 1IBLQ 3S2HB 4YELA 4DV2L 2A68C 1SFOB 2K5NA 1Y8OB 1JICA 3RZDB 5J3BA 1EWCA 1X54A 4R4OA 1NR2A 2E5LQ 2JP1A 2UXCL 2DYIA 3KDFB 4DK0A 1VQIA 2MHVA 1Q81C 1X56A 4A93G 4J0QA 2KVMA 4DNTB 4DV3L 5CORA 4NNJA 3Q0AA 5IY0A 2I07B 2I1LA 5DNFA 2NVYH 1YJNA 4F87A 2EDGA 3FDTA 1G7RA 1N0VC 4DA2A 2NZ1D 2YWGA 1EP1B 1ET6A 1NB9A 1I5FA 4A3JH 4X07A 1JJ2A 4DFAA 2RVLA 4XQNA 4C3HB 3OP1A 2GQFA 4FK8A 5JAVA 2JA5B 4XN3A 2SNMA 4Z4VA 3M9BA 4UPAA 2XNJA 2E2HB 2Y0SB 4P9SA 1AEXA 1EYDA 3CCRB 2OCEA 5TSSA 1A8PA 3CMAB 1QVGB 2PLFA 2IT1A 3S9WA 4PC3A 2L4NA 4LF4Q 1MJCA 3CD6B 1CHQD 4IPGA 3VMFA 1YHAA 2K75A 4MIUA 4RHSA 3KLWA 1I7PA 3MCAA 4X06A 1B7YB 1B44D 1EY9A 2FFKB 1QG7A 3E6ZX 5CBAE 4A3FB 5JJZA 4AYBE 3CCQB 1FNCA 1E64A 4B3RL 2X3UA 4NPSA 1VDZA 1NCVA 3FKSA 4TMTA 2JA5H 1L2FA 4A3DG 2A69D 2F0OA 4M8AA 3SK4A 4ZYSA 1KD1D 3IFDA 1I4PA 1E62A 3N52A 1CHPD 1RODA 2WB1G 1EIYB 1SNMA 2G5DA 2Y0SG 5EGTA 5FK9C 4TMVA 1TY2A 5T1GA 1EQRA 1LLRD 4B3TQ 3PV0A 3ULPA 1PTOF 3VR6A 1J9ZA 3D6WA 2YTVA 5IGEA 1V0FA 3PF4A 3E0JA 2VY3A 1I6HB 1ET9A 4ROXA 1MHWC 2R3ZA 3ASSA 1PRTF 4IALA 2RC6A 1A6XA 4A3KB 1GUNA 4WORA 3CHBD 2OTLB 3P26A 1VQPB 4II2A 1OB5A 1T6XA 4NDXA 4IPHA 2X69A 1WVLA 4A3CH 4NXNQ 1ENAA 3ITPA 2A19A 2ZM6Q 1PH5A 3BH4A 4QCLA 1RQPA 2PQAA 3GTPH 5KEEA 4UAIA 4BY7G 4DUZL 2GREA 1F60A 2CFMA 2BPOA 1RJTA 4XT1B 4Y7NB 3VYRA 4OO1H 4HIMA 3M4OH 4YAOA 2IX1A 2HLDA 1B2RA 4Z4YA 1BCPF 2WZPP 3SEJA 4IUUA 3PUMA 2E2JB 5GV8A 3RZOH 5BN3A 4XKVA 4P12A 1B50A 1LT5D 4QMGA 4G1BA 5BSYA 2Z9HA 3JAME 3J81E 2JXMB 1COWA 2E74C 3WBKA 4EQOA 3VO2A 4TVAB 1ZUNB 4JI8L 5LL6S 4CDCC 1CKNB 2F0KA 2F0HA 3S1NB 4RFBA 4HMIA 5IP9G 2XTIA 1Z47A 4RG1A 4LF9Q 2D0PA 4LFCQ 1PHJA 3M7NA 3EBEA 3MAQA 2HQEA 1CUKA 4B3RQ 4Y7CA 1FGUA 1QWYA 1V1OA 2ZTEA 4DR3Q 1GUOA 5BN4A 1KC8C 4XL9A 4G7XA 2AWOA 2X53S 2EJGC 1SROA 4LUOA 1IJFA 1K3RA 1JE5A 1O7LA 2VQEL 3STBC 4KD3A 2DIEA 4KI0A 1EZ8A 4UP7A 4XR6A 1J9OA 2NB0A 4FXUA 3DEPA 3G48A 3I72A 1D8LA 3U9OA 5IWAL 2VZAA 3J81i 1BNZA 2HDLA 5I2YA 1C0AA 2Q2HA 4RD6A 1UD5A 2XNDA 1F77A 1STGA 2HCIA 2RDGA 4DUYQ 1WD1A 3PCOB 2OTLA 1X3GA 4X3TA 1JWMD 2ZTNA 3OOCA 3S15H 2UXDL 3OJXA 1IBML 3T53B 1IHZA 1CKMA 1Z7TA 4OWXB 2AHOB 1DONA 2N8NA 1I94L 2PIAA 2R9VA 4GKJL 3I4LA 1JQYD 2ZTGA 1FL0A 3Q8DA 4A3GH 2ZL6A 3RLNA 4A3MG 4CJ0B 1A3UA 1ENFA 1LM0A 1WTQA 1LO5D 3MXNB 3HOXH 5CMDA 1ICFB 5DLQE 1XXGA 5F4MA 1NDHA 4ASUA 3VNVA 4GOPA 2P5ZX 2XN9C 4J8QA 2KA7A 1HTPA 3I4MB 4TQUS 3HOZH 4X62L 2PNHA 4DV6Q 4IJHA 2EJMA 2NUCA 1W6KA 1H9KA 5ELBA 5TRDA 2NN6G 2F4VQ 3MZ5A 4AH6A 2Q2TA 4KHPL 3CW2A 4QV2A 5HGTA 1VQEA 1I6VC 1JOKA 3VA7A 4JYAL 5IGDA 3GVKA 2HCJB 1VQOB 3H0GH 1TVXA 1SRUA 4Y52H 4HCSA 5BSXA 1U5KA 4G57A 3BCFA 4UP9A 4R4IA 5IODA 2EY5A 2WKCA 2ZXPA 1SMXA 2X6YA 1WSVA 4B43A 2SNSA 5HY6A 4AC9A 3CCMA 1FJGQ 3SHLA 3HOVB 2CCZA 1VQ5B 3I8ZA 4QIWE 4P3YA 1EFCA 1QFJA 2TMPA 3D8GA 1BVSA 4BXXG 5GV7A 3S14B 2NTTA 4X3SA 4CKCA 3CPXA 1EP3B 3A8JA 1LTGD 2VQFL 3D4RA 4Y9UA 4JI6Q 4C1NK 3IL8A 2XNCA 1KRSA 3Q38A 2A5HA 3NTIA 5D65A 1S72B 3OSOA 2JA6H 1I4XA 2X0KA 1NRKA 3ASPA 1Y1VH 2NN6I 4LK1C 4DUZQ 1ASYA 3ES9A 5G3LF 1JOQA 1E3XA 3M4OB 1SNQA 1U4LA 4KKUA 3HOYB 3SJPA 1KJZA 1LTBD 1M90D 3HGBA 5LMNQ 4UZEA 1UE1A 3P20A 1EOTA 5JEAH 3CD6A 3I4NG 2HHHL 1GO2A 2HUGA 5C0XI 1LUZA 1PTOB 2RA4A 1GUTA 2OQ0A 5I9OA 2CQAA 1Y1WB 3AB9A 2ZJPA 4K0KQ 3LQEA 1D1KA 4FXKC 5E6TA 1U4PA 4A3IG 3JQRA 4BBRH 2QA4B 4FVMA 5IP7H 1N32Q 2OYNA 2KENA 1NUCA 3OW2B 3F2BA 3S1NH 3CCSA 4K2KA 4XKWA 4U68A 4X7DA 1DG1G 4HTHA 4LF4L 1EYAA 3QFTA 1J6QA 5M3FH 1PTOH 1ZM9A 5LMZA 4FXGC 3HOXB 4DXFA 2EXDA 4XQFA 2VNHA 3AQQA 2WJVA 4OOSA 2ZL5A 1ZM2A 4B48A 2GPJA 3U2QA 3L2PA 3TP5A 2CQOA 1V9PA 1PLFA 2F0TA 1QX4A 1YJNB 4WJ4A 3SE0A 4LWCA 3MHPA 2D5DA 2AKWB 1Z9FA 2R7ZB 1BQEA 2K14A 1VQ7A 1Q46A 2WB1E 2WAQB 1E2VA 3W1BA 2VJJA 4NCNA 1WOPA 4CJ2C 1U4MA 1HNXQ 4XOTA 1STAA 3UDXA 1EY0A 4R8IA 4JI4L 3G6EA 4TSFA 1DYQA 3K7UC 2C5BA 4MNOA 3TP7A 4LF7L 1G7CA 4LFBQ 4CKEA 3AVYA 3PO3H 3NXWA 5JPMC 1OB2A 1AH9A 4TMXA 2JQOA 5I9PA 1RTOA 3I2ZA 1AZQA 1E22A 1KTKA 1L0XB 4X7EA 1Q1EA 3K7AB 3G6EB 2X85A 4JVZA 2BVNA 4X8IA 2HQLA 2K32A 4WJWA 3CCQA 5TY0A 1VMCA 1SEBD 3DUZA 5JVG3 2P3MA 2YTXA 4K14A 2VJIA 3H3VI 3VYUA 2ENBA 3RZDH 1PH3A 1HXYD 2VUMB 1B1ZA 4UAJA 3GTGB 5HGQA 3AGPA 1PZJD 3H9NA 4LJZC 1G6PA 2JJQA 2OQKA 3ZUGA 2J4XA 2I46A 5IK2A 1N06A 4KKTA 4DNRB 3G4SB 4HEDA 2PE3A 2QGGA 4C43A 1FNWA 1DDGA 2DOGA 5M5YH 4ID6A 3K59A 1SXTA 4GN5A 3LVBA 3OHXC 3T16A 1G2SA 2YYZA 4FN5A 3NE5B 3OEEA 2M2LA 1CQVA 1IYJB 1DARA 3TN2A 4ZGNB 4U673 2BH2A 2DETA 3N6RA 3G4SA 2DY1A 2F0LA 4DR4L 1KTVA 3QFRA 1VQNB 1X55A 4LF7Q 3CCUB 3S16H 1T5XD 4RCYA 1Q90A 4K0KL 4XD7A 5FO0A 5GAHC 2JA8H 4L5RC 1FVIA 1Y0RA 3PUXA 4KN7C 1E7ZA 1STEA 1R4QB 1BCPB 1ICWA 1V43A 1I50H 1VF7A 4MYUA 1EFRA 1L0WA 4HJ5A 1TWFH 2VUMG 1E1RA 3CP2A 4EH1A 1PJ5A 1K83B 2QEXB 3NEMA 3M85A 5NUCA 2EY2A 2LXJA 5EMNA 2M5SA 1CT1D 1XTDA 2N49A 5C0XH 1B2TA 3UE0A 4FF3A 2OBSA 3W2IA 1IBKL 1WTWA 4QHYA 3GTLB 4E6IA 3G7LA 2R7DA 4FF1A 1R5BA 1HNZL 4XLAA 2B7CA 1PA6A 2BV3A 2F0IA 1FRQA 2K03A 4YHHL 2UUAQ 1BQQT 3KBGA 3MTSA 1SFOH 1A62A 4F7DA 3PF5A 1H9RA 1KK2A 1OO9B 3A7LA 1K83H 3FHWA 2F0SA 3ZYYX 4GN4B 5J3OA 2RKSA 4JI6L 5E7NA 3OW7A 5ELDA 2VW9A 3S1QH 5EPJA 2JDIA 4DN4M 3UDGA 4IURA 5K36G 5I6YA 2IY5B 1TY0A 2WAQE 2H1EA 1Q86D 3T1YQ 1BX0A 2F1MA 3CC2A 2BA0A 4XYQA 3OW2A 4A3DH 1WSRA 1VQDA 4ZK9B 3ZZUA 2L11A 5FKAC 1STNA 4WQMA 3HFZB 4A3IB 3ASQA 5DS0A 4K5XA 5THXA 4KY7A 2BM1A 4DR5L 2HDNB 3V7AA 1B9MA 3G71A 4R4CA 2EQSA 3Q23A 2EYJA 2NVQH 1T5EA 3C2PA 5M5YB 1UEBA 1G8ZD 4HSPA 1VQFA 1EY7A 1K8OA 1ML0D 2XRSD 3F2DA 3MFYA 1UUPA 2NZHA 3GTPB 3GIRA 1QGAA 3HOYG 1L0YB 1PFBA 3A55A 3KF8A 5E4XA 3KDFA 2CH4A 3LGJA 4FWTA 3IRBA 4Z4RA 2I5HA 4AYBG 1GAQA 3QE2A 1QVFB 3DEOA 3KUPA 3K81C 4DR5Q 4OONA 1G291 1YITB 2A1AA 3FPUB 5J1ZA 1UAPA 4HIKA 2MPMA 4KHVA 2FVGA 5FA6A 2F0UA 2KUMA 2V1CC 4G4KA 1C48A 1PH8A 3ONYA 4P25A 5IYCH 1H9SB 3A5ZB 3Q24A 1AMOA 1EQTA 2A6EC 2CF4A 3B6YA 1JA1A 4RGTA 5EBCA 2PYKA 3LX0A 4B3GA 4E0FA 3J80i 2CWPA 3TMEA 1YNND 2PO4A 4OWTB 1HH2P 2E2IH 3S1MH 4P74A 2RHSB 4LBVA 4ZCLA 1PH1A 1Y14B 3TZUA 3GD7A 4DAYB 2DCUA 4N8X1 1K28A 4JW0A 1EFUA 3CCSB 1PVOA 4EQ5A 1NAPA 2K52A 3SK8A 4OIJA 4LFAQ 2JIZA 4II3A 1DXMA 2CNDA 1PXUA 3I4OA 3T4AC 3QOJA 4A93B 4DAYA 1N36Q 2N3SA 2EZVA 2YWHA 2KEEA 3A0JA 2WJYA 1UD2A 4UZUA 3H91A 3PVDA 3CQZB 1BUVT 4TN1A 4JMQA 4X7CA 3WNBA 5CYUA 3S2HH 4L8JA 3D3RA 5CV6A 5ELFA 2O5JC 3HKSA 4ZRZA 1NBWA 3ONUA 2BGIA 1YZ6A 2O5IC 3MA2B 4A3DB 4JI5Q 2G9DA 1F2MA 4B47A 1JB3A 4EQNA 3W3AA 1SE3A 1KQSB 4OIKA 1HR0Q 5DEHA 1E3ZA 5H1SE 1PH2A 1YBYA 2E2DC 3HOVH 3WXMA 4DR1L 2EVBA 4RGNA 1Q7YD 4K8JA 4XLFA 3I73A 3A35A 2PQEA 3ERSX 3HOUG 1YJ9A 1S72A 3QO2A 1KABA 4N3NA 2C35B 4A3KH 1E79A 1FRNA 3H3VC 4A3EB 2I5MX 1E2WA 1QFZA 2Z6KC 4PNYA 3W2FA 1LTTD 3RLFA 5C3EG 1QVFA 1STBA 4IFDH 1YHBA 1HNWQ 1KXLA 1QJOA 3KBXA 4MYTA 3MFGA 2KJXA 3SGIA 2JE6I 1HZBA 5CGKA 2UXBL 1EL0A 2Z8LA 4U9UA 1GR1A 1WORA 4BY7H 2K01A 1TVCA 2Z4HA 3W2HA 1HUNA 4H9GA 4MHEA 2K5DA 2WFWA 1UD4A 2W6IA 5I4DA 5F2DA 1N36L 4IOCA 4QFMA 5C4XH 1AFPA 1H8EA 1LT4D 5ISRA 4LFAL 4CDFC 3SVMA 2YTYA 5GAGC 1DDIA 2ZL7A 3GTOH 2NVXB 1EWYA 3RNUA 2XOKA 4WWVA 3CAMA 1Y1VG 1SLJA 4BXXH 5F4OA 1KQSA 2WACA 3DDYA 3ERQA 3BDLA 2QW7A 1ONLA 1SYBA 1HNZQ 1RQRA 4YY3Q 3S17B 1HZCA 1VHOA 1VQAA 1HA5A 1SNOA 3E5SA 3M7GA 1GVPA 3J81L 2NVXH 4F88A 1HA6A 4C3IB 2XRQD 4J15A 4XN0A 1U2RA 2ID0A 3PUZA 3J81j 1HR0L 3UI2A 5M3MH 2OF1A 4ZCKA 4MN3A 1VQHA 2F0DA 2BCOA 4ZQ3A 3BS1A 5C4XG 3GQBA 3QJYA 2NPFA 1DZ1A 3DWAA 5A35A 3DWPA 3H6MA 4EQPA 1EXMA 1HVXA 1SMYC 5IYPA 1MGSA 1GJRA 1W87A 5FJ8H 2EXZA 2XWBB 4KJOA 3OPOA 3DHQA 3AEVA 4IFDG 3OJWA 1H9MA 2QKIC 4RGMA 1S0UA 3NENA 5J22A 3CCJA 4C3IG 4DR1Q 1BX1A 5FO1A 2C78A 4RKLA 4OGQC 4DV0Q 3WQZA 3HOZB 3AVWA 5D14A 1LTLA 2RQXA 2CKZB 3HOZG 1VQKA 4JOIA 3CESA 3H94A 2B3GA 2A68D 1VQCA 1E3PA 3BCDA 3FRPB 1X6OA 1UE7A 4B9XA 4IO9A 1D2EA 4IUVA 3PMFA 2K05A 3GTQH 2DNEA 1W2BB 3D4DA 2L12A 3RN2A 4DV1Q 2UUCQ 3H3VH 4A3MH 3AU7A 2ZBUA 3NUCA 2TSSA 3T1YL 3K0YA 1XNRQ 3FKIG 3HAGA 1OXUA 3L9AX 2A6ED 4C3JG 3EN2A 4ZAIA 3TP8A 1N33L 4L5TA 4X05A 1H85A 3CP0A 3TQYA 1YNXA 3KOJA 1JMCA 4DR2Q 4N9PA 1K9MD 1SSOA 2IJ0A 1NTGA 4AF7A 2MUYA 3CPFA 4GKKL 1CKNA 1PZID 2CVRA 2E2HH 3NQIA 4NMZA 2KCMA 4QGUA 3CCLB 1CZGA 3OZWA 1M4VA 1G7TA 1B53A 4LF5L 1BDOA 3J80L 1DOMA 5KNLA 4YCWA 4XDXA 4ZLTF 4N3GA 5EBDA 3S1QB 1YI2B 4LF6Q 2OT2A 4PZ6A 1AE3A 1VJSA 4FYDA 3HOWH 4PQXA 2V31A 3FKIH 4NP5A 2BF4A 2D2CC 3H15A 3CMMA 3Q6QA 1X3QA 4LC0A 2CW5A 1IYUA 2F3WA 2PZUA 1IBMQ 4XMYA 2DEUA 4GNXB 4XLCA 1NSNS 1QGYA 4CDDC 1JR0D 1VQ5A 1U9RA 1F9RA 2EY6A 1TWGH 3BVMA 1Q7YC 1E2ZA 1VQMA 3ZZ0A 4IUPA 1NB0A 3PIOA 1QVGA 1X65A 3QG1A 4H02A 4ABNA 1CNFA 3LQ6A 1CSQA 3C2QA 1BPLA 1SE8A 2GVBA 4X65Q 1EIHA 1T6YA 4R8NA 4CGYB 2GJRA 4PMBA 4G7HC 1MI2A 2HT1A 4NXMQ 3GVJA 3S2DB 3IKJA 5LMNW 2VNIA 2NN6H 2F3VA 4JBKA 4A3GB 3BVGA 1CFMA 5IGCA 4JI0Q 1VLYA 5E4WC 4JBMA 5EQ0A 3S1RH 4BBSG 4WZLA 4C2MB 1KRTA 1Q12A 5IT9c 1EY5A 1YNJC 1M1KC 1XYIA 3ASTA 3MWYW 4CHTB 4DK3C 3J7ZC 4BBRG 1MSGA 5LHY1 1F20A 1EYGA 1JOOA 4PGOA 1HTLD 1F9PA 1Z6HA 1XPUA 1KAAA 2Z1CA 4WJ3M 2E2IB 1AE2A 2F03A 5C3EB 4CKBA 3LO8A 2Q8TA 1RTNA 2F0QA 3ND9A 2E75C 5GAEC 1V1PB 3C1EA 2UUAL 2JEBI 4JV5Q 3DWQA 2V7XA 1PRTC 3OZUA 5JPNC 5AJ3L 1B3QA 5LL6X 3E9HA 2EIFA 5C44B 3CMEA 5JJLA 1E24A 2NVYB 1C9OA 1S5CD 2LKVA 2D62A 3Q39A 1X3EA 1C8CA 5L37A 3HKZB 1PKVA 1P4MA 1CZWA 2WSSA 3OWEB 3EFXD 2JA7G 4IQZA 3E1YE 3CCMB 2PQAB 3R8BA 2XGJA 1KK0A 4AYBB 1D6EC 1N34L 3M3YH 1XX8A 1VQ4A 3GTLH 1HQMC 1VQ7B 4JI7L 4B3TL 3P27A 1CTMA 4PABA 3WOEA 3AGQA 5C0XG 2B2YC 1XMQL 1Y1VB 3GTKB 4WZKA 4JCVE 4X66L 1AIPA 5IYWA 2B5OA 2OK7A 4QF4A 4C3IH 3VR3A 2C77A 1T9HA 1KC8D 4L5QA 1EOVA 4M1KA 1ILQA 2K33A 2XVSA 4X3UA 4XQJA 3IFTA 3CCEA 4FF4A 4ZV4A 4M53A 5IYNA 5CV4A 1FNDA 5C5LA 4HJ9A 3BDCA 4BS9A 3K5MA 3GTKH 3RR5A 3W5VA 3JAMc 4NBSA 3HG9A 1XJVA 2PZWA 1QH0A 3GTJB 2EOTA 4IPDA 3UDIA 5JVH3 2Q6KA 3A8KA 2PZTA 1RHPA 4XORA 3F8TA 4A3JG 2UUCL 2XEXA 1PYBA 3E3XA 4R9WA 1XB2A 3HEJA 4A3EG 1XMOQ 1BF4A 3I90A 3I4NH 1AN8A 1AZPA 1IL2A 5LMNL 2E1BA 5IE8A 3KF6B 3LWUA 4NKLA 3I1FA 1NJID 4NXNL 1EZ6A 1WP6A 2ZZFA 1K9MC 4QJFA 4APVA 4YEJA 2GJKA 3AVUA 3UDFA 4ACAA 1PRTD 1S4MA 4DV3Q 4DV1L 1F2LA 4KD4A 3V05A 2V7UA 2FINB 3PA2A 2PW5A 4YY3L 1I4HA 3L3OC 2I0QA 4HE5A 4LBZA 1BCPD 4LFBL 5DSZA 3BJUA 3W5OA 3HZXA 2JA9A 4GLXA 1JWUD 3SDZA 1VQGA 4O1NA 2Z6BA 5KRUA 3PIPA 4QY7A 4DR4Q 3JAMi 4LF5Q 4X66Q 2UUBQ 4M2LA 3S17H 4P2CB 3CXCB 5C44H 5CV7A 1HQRD 3NHHA 4PMCA 4Y7NH 1S5DD 4Q7JB 2GA4B 1I50B 3TP6A 3SXHA 2X6LA 1ZKOA 3J81k 4ODGA 2PW7A 3CRKC 1HFNA 5M3MB 4YWLA 4MTNA 1N33Q 1XPOA 2Q6LA 3K80C 2Z4IA 1F2ZA 4DPGA 4PZ7A 2R92G 1BR9A 4FF2A 1NR4A 1GJXA 3LWEA 1EWIA 3ASRA 2E76C 1V1QA 4YCUA 2YWFA 1F2YA 4RGOS 4LF8Q 4GLVB 3EA6A 3PSIA 2ZJRA 2NV4A 4TT3A 1B8AA 1KLUD 4JI2Q 2ZM6L 3KF6A 3VYTA 3VA5A 4RKBA 1MBYA 2G9HD 5IIFA 3SEBA 4FP5D 1CM9A 1N34Q 2OXPA 4RJLA 1TWHB 3OKXA 4UDUC 2LFNA 1Y0YA 1NMGA 1I8DA 3BDOA 3GDEA 4LBYA 4KY6A 3GTGH 4G7WA 3BZKA 3ZBTA 1W3SA 2FX3A 1XWEA 2MFIA 1G91A 3TREA 3K57A 3CPWA 4GZYC 4XONA 2Q6IA 4AF6A 5LMUL 1KMHA 5EJWA 3ICEA 2L9HA 4DAPA 2R93G 4ZCIA 4RHRA 1FJGL 2GVAA 4JI5L 3TEHB 1MIUA 1K3BC 1TS5A 1ZM4A 1KDBA 2PCFB 3V96A 1QUEA 2AQ3B 1W0JA 1N0UA 1QNKA 2XNAC 2K7VA 5FJ8G 4WFN3 1WTXA 2B63G 1PV4A 1I18A 2F1LA 2J0TD 4JG2A 2BDNA 2OTJA 5K5PA 3QIAA 1D5ZC 1VQLB 1O7ZA 4C2MH 1D2BA 4OL7A 1CA5A 3B8HA 3M4QA 2ZXRA 5IYBH 2ZZQA 1KK1A 5KYLA 1K28D 3OMCA 5DN6A 4B44A 3NWTA 5D3IB 4IFDI 1D1NA 4EGVA 3DMUA 3A8IA 1N05A 2Z6BD 2ICEC 1L1OA 2Q8IB 4A93H 5BR8Q 3MXNA 1WCMH 1QUQB 5FO8B 3OZVA 2WINB 5J39A 2RBMA 4A3JB 2XWJB 2HMAA 1YJWA 5DM63 1KAWA 1PJ6A 3QOLA 5A89A 2E1RA 1H9SA 2B63B 1QE6A 2CW0C 1Q8IA 3K5OA 2VUMH 4ME5A 1SJED 1GHJA 1SYCA 1HUMA 5FOBB 5FIUA 3BY2A 4R4QA 2D0OA 3CCVA 3ONAB 1OGIA 4HJAA 4KKSA 4KHPQ 4CQJA 4JI1L 2HHHQ 4ME3A 1RF2D 5M9OA 3MXGA 3M3YB 4K5VA 2UXDQ 3NP8A 4QIWB 2RHQB 4KN4C 2JA5G 5IYDH 2DN8A 1K8AD 2QCPX 5CV9A 1YIJA 3A3GA 4DR7L 4X7FA 3UE1A 1NBMA 1TS3A 4A3BG 2VBVA 2PPBC 2B2WA 3SKBA 2C9OA 2CHBD 3TZDA 4OOVA 3O13A 1IBLL 3R3OA 1LTAD 2VQEQ 2QF7A 1OXVA 1CSPA 2KBNA 4KHZA 1WD0A 3T13A 4B08A 1MD2D 3C1FA 3J81c 3X3MA 5M3MG 3J7A5 4LBWA 1W6JA 1AW7A 5C4JB 2J7KA 3P1HA 2K5QA 3SLNA 1LT6D 1EY4A 1XPRA 2X8KA 3TDQA 1J5EL 3MHBA 1MJEA 3A7AB 4BPRA 3OEHA 3KFUA 5FO7B 1WDTA 5IGBA 2YU9B 2AQ2B 3G6JB 1WCMG 4QUCA 4JYAQ 2A8VA 3AVXA 4R4TA 1KDAA 2MQHA 2V7VA 3VNUA 1SN8A 1A8VA 4K6LA 4P73A 3GTOB 4QUZA 3KLSX 1WOOA 1WFQA 5C3XA 3BQJA 1B23P 1HCZA 3W5UA 3LNNA 2LXKA 1KD1C 5L46A 3QB3A 3HOWG 4YHHQ 3CCEB 3VR5A 1MKHA 2OBRA 4DF7A 2V7QA 1YIJB 4GKKQ 2Z0SA 5C4HA 3BG3A 1R9TH 1LV9A 2KHIA 1W34A 4RM0A 1TS2A 1IBKQ 5JOBA 1FD7D 1QB5D 4P72A 2ATWA 5EAYA 1HZAA 2L5TA 1PMRA 3AYHB 3MXPA 4ILWA 4I7AA 1DJRD 4KLKA 2QTLA 2B2VC 2VBTA 2YWEA 1BKBA 4N8FA 3PENA 4X6AH 3OFNA 2WB1B 4GKJQ 3CKIB 3PIP3 4N9TA 3NK9A 3NTKA 1WTOA 1K8AC 5IYQA 3FP9A 1ZYRD 4PAAA 4XTCS 3HOWB 2K5WA 1IW7C 3AFPA 5BR8L 5IYCG 3W2GA 4FNFA 1N08A 5LMUQ 1RD9D 1SE2A 4Z4TA 4DV4L 3T1HQ 5A2QL 3OIPA 4RCOA 3CCRA 1SM4A 3TBIB 3TS2A 5A2QE 3PGZA 1LTSD 1XNQL 1WPCA 4PV1C 5IGGA 2WPDA 1TWAB 5IOCA 1SKQA 3HOYH 1GKHA 1QVCA 4HCEA 5T1IA 2WIIB 4OX9Q 5IP7G 3A5UA 1T6ZA 2X6XA 2O2LD 3BNWA 1DOLA 4F7XA 4A3BH 1HNWL 1X9NA 1TWHH
chains in the Genus database with same CATH topology
1PTOC 2JJ2A 1MABA 1W9XA 4OO1I 5FLXE 2K1BA 5IT9L 3S16B 1PFMA 1TU2B 3S15B 1JE4A 1ZYRC 5CR3A 4KK7A 2W6JA 1KNAA 3OMGA 3NPPA 1TKWB 1KLGD 1E43A 4XLHA 3GO5A 1EQVA 1II3A 3MEHA 1M8AA 1IL8A 1O78A 1S4ZA 2CK3A 3GV6A 3F2UA 3GP7A 5M5WB 1TWCB 2IWHA 2EYHA 4V190 1GOZA 2N88A 1LTRD 1BCPC 1B3AA 4XIGS 5FL7A 4FO2A 1B4OA 3FMCA 5I2XA 1VF5C 3PO3B 4QB4A 4TRDA 2ZZEA 1UNSA 2WKDA 5E1FA 3SR1A 1A2TA 2XIWA 1KZLA 2EY1A 4K5WA 1PRTB 3CP8A 2AUKA 2F0FA 2ZXHA 2R92B 3JAML 5JEAJ 5M3FB 1ZEQX 1RKNA 2EYPA 3FKIB 4BA2I 3RUZA 3MVVA 3CRLC 3G05A 1I4QA 4QUFA 1IW7D 1WTVA 4BY1B 3TSSA 2BDOA 5HURA 2NVTB 2NYZD 4KMUC 4P22A 1S5BD 5IT9E 1S5ED 1BO0A 1FX0A 4GQNA 2ICIA 5DM73 1G2TA 4DK1A 1WTHD 1SNCA 1Y8NB 2EYOA 1K8MA 1A15A 2QEJC 4DAVA 4BBSB 2AUJD 1OHHA 1TQOA 2FJ2A 4ZKBB 4CJ1B 1ENCA 4K6DA 3SK5A 1KNEA 2EYFA 4C3JB 1OXTA 3A54A 3PUWA 4HMJA 4TKOB 2NTSA 4JBWA 4FXDA 2J7ZA 3ZIAA 4G7OC 2RDHA 2IW3A 3A8IE 5CV8A 1CA6A 2K28A 1LACA 1GHKA 1HFGA 2B2TC 3R93A 2CW0D 1OXSC 3KLSA 1IYVA 3URYA 1E1QA 1J8IA 1RCVD 2XZLA 2A6HD 5ELEA 3I4NB 2A6HC 2O4XA 1V8QA 4XNFA 5EKLA 4B3FX 2MGSA 5CC4A 4C56C 4JK1C 1B9NA 1LTID 2XZPA 2RSNA 2QILA 2DY8A 1UD3A 3BYTB 3T51B 1DCZA 1EY6A 3RZOB 4IUTA 1BXTA 1PYWD 2BOSA 3NSWA 2ZXIA 3I3CA 2VNUD 1LT3D 3NQTA 5C4ZA 3GTQB 1QNUA 1PFNA 1XTCD 3JU4A 2IX0A 3W2DA 1VCIA 4H0LC 3NBHA 4J6HA 4L63B 5C0XJ 3MC0B 1FNVA 4PMWA 3S1MB 1MSHA 1EEID 5BN5A 1H9JA 3H0GB 5FLXL 3U9SA 2B8GA 4DGZA 3HOUB 1D1IA 5M5XB 3I91A 3NTHA 3I70A 4HSVA 4KTAA 1R9TB 2KECA 1C4QA 2IL8A 4RAUC 2JEAI 3S1RB 4LMQD 2B2WC 2JJ1A 2KVOA 4XLEA 5K36H 4X3KA 4IZ8A 2K04A 3BC9A 1O7YA 2BE5D 2K6AA 2JYOA 2X6WA 3QWNA 1QOHA 2EE1A 5E3FA 3SK6A 2HCCA 2EYMA 2AQ1B 1A2UA 1I4RA 2XSCA 1EU4A 2R93B 2F0JA 3PUYA 4I65A 4H13C 2JA7B 4HIZA 4AVZA 1BOSA 2VXWA 4BY7B 3EROA 2MP1A 3ZPNA 2WP8J 5KNBA 4ZUJA 5C5MA 1YNNC 3HRZC 1SBBB 1E0BA 1EU3A 1OXXK 1SAPA 2H4OA 2X6GA 3VR2A 2LY7A 2VB3X 2FMCA 3FEWX 3DM1A 1IKMA 4IUNA 4O42A 2IPKD 1HRJA 3D4WA 3GV3A 2VB2X 1FGBD 1GUWA 1ZXTA 1EWHA 1JORA 2B2TA 3J7AF 1ESRA 4CBVA 1A3TA 4XYOA 4RA8A 1BLIA 1JCKB 1DOKA 2BE5C 1F9QA 1TT2A 2SEBD 2HDMA 4RWSC 1Y69U 3WOFA 1X32A 1JWSD 3NBIA 1DD2A 1KDCA 3P7JA 3J80E 3KEWA 1CK1A 4J1MA 2DNCA 4BWGB 4OHJA 2L1BA 4K8IA 1EFID 2V4DA 5ELCA 1X3PA 1SYFA 4BA1I 1WCMB 2EPBA 2RSOA 3PO2B 1HZEA 5EKIA 3KLRA 1F9SA 1SDFA 3X3NA 3C46A 1W0KA 2F0GA 4Q5VA 3K5LA 2MJ8A 2ZZGA 5CV5A 3K5NA 1UEAB 2B2UC 4F8MA 3HS0C 1TR5A 2D3LA 2NBFA 1RDPD 1GUSA 1SNDA 1SYEA 3ND8A 3OWFA 5I6WA 2QE7A 4DXGA 2B2UA 1Q3LA 4Z9CB 4KV6A 1ESFA 3EJIA 1EIGA 5C6AA 2OEOA 2FMMA 1ILPA 1Q1BA 1UD6A 3OIQA 4YIJA 2GK7A 3A3BA 2D3NA 2M00A 2C5CA 2NWGA 2QDBA 2A69C 2KEDA 1V0EA 4H44C 3WDNA 3EVQA 5EPLA 1LABA 1YNJD 4XM3A 4NW2A 1DM0B 1FR3A 1TIID 4HN7A 4EVOA 2KCCA 4XT3B 5COYA 4G7ZC 3K6OA 5KGUA 2ZXOA 1STYA 5CBEE 5EPKA 1U4RA 4ZUIA 3C3LA 1TWGB 2ZT9C 5D3DA 3T56B 4XQQA 2JA8B 2EJFC 1PTOD 4C1NI 3GTMB 2KQ3A 1CQFA 1HPCA 2BA1A 1FYCA 3RMHA 4V0BA 1WTPA 1SMYD 5DAUA 4BBRB 2F0EA 2L0CA 2LS01 4HR7B 4RCNA 4K2LA 4HAEA 1I3QB 3HP3A 3R2IA 1PDQA 2LMCB 2SOBA 1SJHD 2NVQB 3VYSA 4DU9A 4A3BB 2KHSA 4ULLA 2N55A 3FPPA 4RH6A 3V2TA 1D5MC 3MXUA 2R6GA 2JSOA 3A8KE 2F4IA 1G6ZA 4A3MB 2B2YA 3H09A 3A56A 5KYIA 3FVQA 2F0VA 3D31A 3A8JE 2GK6A 3L7ZC 2GJPA 5HKKA 2B39A 1VMPA 3EQLC 4XXEA 2PMZB 1SYDA 1TS4A 3BZDB 5G3LD 4H7BA 1I4GA 4I7ZC 4OO1G 2F43A 4KY5A 2LZJA 1PZKD 5KIXA 1D5XC 5CDFA 3J7AV 3OE7A 2A74C 2B8FA 4IUQA 4ZKCB 1EYCA 5JEAG 3J7YW 3AMUA 3BYYB 5FO9B 1WTRA 2PNRC 2WV6D 3Q22A 1SE4A 2JA6B 1AP0A 2F0PA 4XOPA 1EY8A 2SDFA 3M4YA 1GXDC 3KK7A 3RD4A 3GVLA 1H8HA 4C3HG 1SYGA 2XZOA 2DY7A 1FNUA 1OB0A 2R61A 3VR4A 3PIO3 4Z1MA 2KCNA 1HHVA 1IKLA 2D9UA 2L55A 4LAAA 2Q8RE 1SKYB 1S5FD 3Q6SA 1SNPA 2F0WA 1CI3M 1A3VA 2AWNA 5C4XB 1QCBD 1EEFD 3K58A 5AFWA 4L6TB 4IFDJ 3P75A 1BMFA 4Q0FA 3BVZA 3R2TA 4B9WA 1QILA 4M1UB 2A73B 3DXJC 2RDFA 5KNCA 3CU7A 3D6CA 5KNDA 5C3WA 1Y8PB 3PUVA 2IX3A 3NWSA 2F0NA 1GUGA 1UD8A 2FHTA 2KOLA 5IGFA 1JC7A 3OAAA 2EYLA 1O80A 1STHA 1BBXC 1TWFB 5EKKA 2M9VA 4TSSA 4KJNA 1R4PB 4S3SA 4YXWA 1V1PA 4IN3A 3IAYA 2F0MA 4WRDA 2B2VA 4G6IA 3S2HB 4YELA 2A68C 1SFOB 1Y8OB 1JICA 3RZDB 1EWCA 1NR2A 2JP1A 4DK0A 2MHVA 2KVMA 4DNTB 5CORA 4NNJA 3Q0AA 2I07B 5DNFA 4F87A 2EDGA 3FDTA 4DA2A 2NZ1D 1ET6A 4DFAA 2RVLA 4XQNA 4C3HB 5JAVA 2JA5B 4XN3A 2SNMA 2E2HB 2Y0SB 1AEXA 1EYDA 5TSSA 2IT1A 3S9WA 2L4NA 1CHQD 4MIUA 4RHSA 1EY9A 2FFKB 1B44D 5CBAE 3E6ZX 1QG7A 4A3FB 5JJZA 1VDZA 1NCVA 3FKSA 2A69D 2F0OA 4M8AA 3SK4A 4ZYSA 3IFDA 3N52A 1I4PA 1CHPD 1RODA 1SNMA 5EGTA 5FK9C 1TY2A 5T1GA 1LLRD 3PV0A 1PTOF 3VR6A 3D6WA 5IGEA 1V0FA 3E0JA 1I6HB 1ET9A 2R3ZA 1PRTF 4IALA 1A6XA 4A3KB 1GUNA 4WORA 3CHBD 4II2A 4NDXA 2X69A 1WVLA 1ENAA 3ITPA 3BH4A 4QCLA 5KEEA 4UAIA 1RJTA 4XT1B 4Y7NB 3VYRA 4OO1H 2IX1A 2HLDA 1BCPF 2WZPP 4IUUA 2E2JB 5BN3A 4XKVA 1B50A 1LT5D 4QMGA 3JAME 3J81E 2JXMB 1COWA 2E74C 4EQOA 5LL6S 2F0KA 2F0HA 3S1NB 4RFBA 4HMIA 1Z47A 3M7NA 3MAQA 2HQEA 1QWYA 1V1OA 1GUOA 5BN4A 4XL9A 4G7XA 2AWOA 2X53S 2EJGC 1O7LA 4KD3A 2DIEA 4KI0A 1EZ8A 4XR6A 1J9OA 2NB0A 4FXUA 3DEPA 3U9OA 3I72A 1BNZA 2HDLA 5I2YA 1UD5A 2XNDA 1F77A 1STGA 2HCIA 2RDGA 1WD1A 4X3TA 1JWMD 2ZTNA 3OOCA 3T53B 1IHZA 1Z7TA 1DONA 2R9VA 3I4LA 1JQYD 2ZTGA 4CJ0B 1A3UA 1ENFA 1WTQA 1LO5D 5CMDA 1XXGA 4ASUA 2XN9C 4J8QA 2KA7A 1HTPA 3I4MB 4TQUS 2EJMA 2NUCA 1W6KA 1H9KA 5ELBA 2NN6G 3MZ5A 5HGTA 1I6VC 1JOKA 3VA7A 5IGDA 3GVKA 1TVXA 4HCSA 4G57A 3BCFA 5IODA 2EY5A 2WKCA 2ZXPA 2SNSA 2X6YA 3SHLA 3HOVB 3I8ZA 2TMPA 3D8GA 3S14B 2NTTA 4X3SA 4CKCA 1LTGD 3D4RA 4C1NK 3IL8A 3NTIA 2A5HA 5D65A 3OSOA 1I4XA 1NRKA 2NN6I 4LK1C 1JOQA 5G3LF 1E3XA 3M4OB 1SNQA 1U4LA 4KKUA 3HOYB 1LTBD 3HGBA 3P20A 1EOTA 5JEAH 2HUGA 5C0XI 1PTOB 2RA4A 1GUTA 5I9OA 2CQAA 1Y1WB 3AB9A 1D1KA 4FXKC 1U4PA 4FVMA 1NUCA 4K2KA 4XKWA 4U68A 4HTHA 1EYAA 1PTOH 4FXGC 3HOXB 4DXFA 4XQFA 2WJVA 3TP5A 1PLFA 2F0TA 3SE0A 2D5DA 2R7ZB 2WAQB 1E2VA 2VJJA 4CJ2C 1U4MA 4XOTA 1STAA 1EY0A 4R8IA 4TSFA 1DYQA 3TP7A 4CKEA 3NXWA 5JPMC 1AZQA 5I9PA 1RTOA 1KTKA 1L0XB 1Q1EA 3K7AB 2X85A 2K32A 4WJWA 1VMCA 1SEBD 3DUZA 5JVG3 4K14A 2VJIA 3VYUA 2ENBA 1HXYD 2VUMB 1B1ZA 3GTGB 1PZJD 4LJZC 2J4XA 2I46A 5IK2A 4KKTA 4DNRB 4HEDA 1FNWA 4ID6A 3K59A 1SXTA 3OHXC 3T16A 1G2SA 2YYZA 3NE5B 3OEEA 2M2LA 1CQVA 3TN2A 4U673 3N6RA 2F0LA 1T5XD 1Q90A 4XD7A 3PUXA 4KN7C 1STEA 1R4QB 1BCPB 1ICWA 1V43A 1VF7A 1EFRA 1E1RA 3CP2A 1K83B 3M85A 5NUCA 2EY2A 2M5SA 1CT1D 5C0XH 1B2TA 4FF3A 1WTWA 3GTLB 4E6IA 3G7LA 4FF1A 4XLAA 2F0IA 2K03A 1BQQT 3KBGA 3MTSA 1H9RA 1OO9B 3A7LA 2F0SA 3ZYYX 2RKSA 5ELDA 3OW7A 5EPJA 2JDIA 4DN4M 4IURA 5K36G 5I6YA 1TY0A 2H1EA 2F1MA 2BA0A 4XYQA 4ZK9B 2L11A 5FKAC 1STNA 4A3IB 4K5XA 4KY7A 1B9MA 3Q23A 2EYJA 1T5EA 3C2PA 5M5YB 4HSPA 1G8ZD 1EY7A 1K8OA 1ML0D 2XRSD 3MFYA 1UUPA 3GTPB 1L0YB 1PFBA 3A55A 3KF8A 5E4XA 3KUPA 3DEOA 1G291 3FPUB 5J1ZA 1UAPA 2MPMA 4KHVA 2F0UA 2KUMA 4G4KA 1C48A 1H9SB 3Q24A 1EQTA 2A6EC 4RGTA 5EBCA 2PYKA 3LX0A 4B3GA 4E0FA 3TMEA 1YNND 2PO4A 3TZUA 3GD7A 1NAPA 3SK8A 4OIJA 2JIZA 4II3A 1DXMA 1PXUA 3T4AC 3QOJA 4A93B 4DAYA 2EZVA 2KEEA 2WJYA 1UD2A 4UZUA 3H91A 3CQZB 1BUVT 4JMQA 5CYUA 4L8JA 3D3RA 5CV6A 5ELFA 2O5JC 4ZRZA 2O5IC 4A3DB 3MA2B 2G9DA 1F2MA 1JB3A 4EQNA 3W3AA 1SE3A 4OIKA 5DEHA 1E3ZA 2E2DC 2EVBA 4RGNA 4K8JA 4XLFA 3I73A 3A35A 2PQEA 3QO2A 1KABA 1E79A 3H3VC 4A3EB 1E2WA 4PNYA 3RLFA 1LTTD 1STBA 4IFDH 1QJOA 3KBXA 3MFGA 2KJXA 2JE6I 5CGKA 1EL0A 2Z8LA 2K01A 2Z4HA 1HUNA 4MHEA 2K5DA 1UD4A 2W6IA 5I4DA 5F2DA 1AFPA 1H8EA 1LT4D 5ISRA 3SVMA 2NVXB 2XOKA 2WACA 3DDYA 3ERQA 3BDLA 1ONLA 1SYBA 3S17B 1HA5A 1SNOA 3E5SA 3M7GA 3J81L 4F88A 1HA6A 4C3IB 2XRQD 4XN0A 2ID0A 3PUZA 3UI2A 2OF1A 4MN3A 2F0DA 2BCOA 4ZQ3A 3BS1A 3QJYA 3GQBA 1DZ1A 3DWAA 5A35A 3DWPA 3H6MA 4EQPA 1HVXA 1SMYC 1MGSA 2EXZA 2XWBB 4KJOA 3OPOA 3DHQA 4IFDG 1H9MA 2QKIC 4RGMA 5J22A 4C3IG 4RKLA 4OGQC 3WQZA 3HOZB 5D14A 2RQXA 3CESA 3H94A 2A68D 3BCDA 3FRPB 4B9XA 4IUVA 3PMFA 2K05A 2DNEA 3D4DA 2L12A 3AU7A 3NUCA 2TSSA 3K0YA 3HAGA 1OXUA 3L9AX 2A6ED 4C3JG 4ZAIA 3TP8A 4N9PA 1SSOA 2IJ0A 2MUYA 1PZID 2CVRA 3NQIA 4NMZA 1CZGA 1M4VA 1B53A 1BDOA 3J80L 1DOMA 5KNLA 4XDXA 4ZLTF 5EBDA 3S1QB 2OT2A 1VJSA 4FYDA 4PQXA 2V31A 4NP5A 2D2CC 3CMMA 1X3QA 1IYUA 2F3WA 2PZUA 4XMYA 4XLCA 1NSNS 1JR0D 1U9RA 1F9RA 2EY6A 3BVMA 1E2ZA 4IUPA 3QG1A 4ABNA 1BPLA 1EIHA 4R8NA 4CGYB 2GJRA 4PMBA 4G7HC 1MI2A 3GVJA 3S2DB 3IKJA 2NN6H 2F3VA 4A3GB 3BVGA 1CFMA 5IGCA 1VLYA 5E4WC 5EQ0A 4C2MB 1Q12A 1EY5A 1YNJC 1XYIA 3MWYW 4CHTB 1MSGA 5LHY1 1JOOA 1HTLD 1F9PA 1Z6HA 1KAAA 2Z1CA 2E2IB 2F03A 5C3EB 4CKBA 2Q8TA 1RTNA 2F0QA 3ND9A 2E75C 1V1PB 3C1EA 2JEBI 3DWQA 1PRTC 5JPNC 5LL6X 5C44B 2NVYB 1S5CD 2LKVA 2D62A 1C8CA 3HKZB 1PKVA 1CZWA 2WSSA 3OWEB 3EFXD 4IQZA 3R8BA 2XGJA 4AYBB 1D6EC 1XX8A 1HQMC 1CTMA 3WOEA 5C0XG 2B2YC 1Y1VB 3GTKB 4QF4A 3VR3A 1ILQA 2K33A 2XVSA 4X3UA 4XQJA 3IFTA 4FF4A 5CV4A 5C5LA 3BDCA 4BS9A 3K5MA 3HG9A 2PZWA 3GTJB 2EOTA 5JVH3 2PZTA 1RHPA 4XORA 4R9WA 3HEJA 1BF4A 3I90A 1AN8A 1AZPA 2E1BA 3LWUA 4NKLA 1EZ6A 1WP6A 2ZZFA 4YEJA 2GJKA 1PRTD 1F2LA 4KD4A 3V05A 2FINB 2PW5A 1I4HA 3L3OC 1BCPD 3HZXA 1JWUD 3SDZA 5KRUA 4O1NA 4P2CB 5CV7A 1HQRD 3NHHA 4PMCA 1S5DD 2GA4B 1I50B 3TP6A 3SXHA 2X6LA 1ZKOA 4ODGA 2PW7A 3CRKC 1HFNA 5M3MB 2Z4IA 1F2ZA 1BR9A 4FF2A 1NR4A 1GJXA 3LWEA 2E76C 1F2YA 4RGOS 3EA6A 4TT3A 1KLUD 3VYTA 3VA5A 4RKBA 1MBYA 2G9HD 5IIFA 3SEBA 4FP5D 1CM9A 2OXPA 1TWHB 4UDUC 2LFNA 1I8DA 3BDOA 4KY6A 4G7WA 1XWEA 1G91A 3K57A 4GZYC 4XONA 1KMHA 5EJWA 2L9HA 4DAPA 4RHRA 1TS5A 1KDBA 2PCFB 3V96A 2AQ3B 1W0JA 1QNKA 2XNAC 2K7VA 4WFN3 1WTXA 1I18A 2J0TD 2BDNA 5K5PA 3QIAA 1D5ZC 1D2BA 1O7ZA 4OL7A 1CA5A 2ZXRA 2ZZQA 5KYLA 1K28D 3OMCA 5DN6A 3NWTA 5D3IB 4IFDI 4EGVA 3DMUA 2Z6BD 2ICEC 2Q8IB 3MXNA 5FO8B 2WINB 5J39A 2RBMA 4A3JB 2XWJB 5DM63 3QOLA 1H9SA 2B63B 1QE6A 2CW0C 1Q8IA 3K5OA 4ME5A 1SJED 1GHJA 1SYCA 1HUMA 5FOBB 3ONAB 4KKSA 5M9OA 1RF2D 3MXGA 3M3YB 4K5VA 3NP8A 4QIWB 4KN4C 2DN8A 2QCPX 5CV9A 3A3GA 1NBMA 1TS3A 2PPBC 2B2WA 2C9OA 2CHBD 3TZDA 3O13A 3R3OA 1LTAD 2QF7A 1OXVA 4KHZA 1WD0A 3T13A 4B08A 1MD2D 3C1FA 3X3MA 1W6JA 1AW7A 5C4JB 3P1HA 2K5QA 1LT6D 1EY4A 2X8KA 3TDQA 3MHBA 3A7AB 3OEHA 5FO7B 5IGBA 2YU9B 2AQ2B 3G6JB 4QUCA 1KDAA 4K6LA 3GTOB 3KLSX 5C3XA 1HCZA 3LNNA 3QB3A 3VR5A 4DF7A 2V7QA 5C4HA 3BG3A 1LV9A 1TS2A 5JOBA 1FD7D 1QB5D 2L5TA 1PMRA 3MXPA 4ILWA 1DJRD 2B2VC 3OFNA 2WB1B 3CKIB 3PIP3 4N9TA 3NK9A 3NTKA 1WTOA 1ZYRD 4XTCS 3HOWB 2K5WA 1IW7C 4FNFA 1RD9D 1SE2A 5A2QL 3OIPA 4RCOA 3TBIB 5A2QE 1LTSD 1WPCA 4PV1C 5IGGA 2WPDA 1TWAB 5IOCA 5T1IA 4HCEA 2WIIB 2X6XA 2O2LD 1DOLA 4F7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8J E;  4L8J A;  3L7Z C;  1GUG A;  3I4L A;  1Z6H A;  1ZKO A;  2AUJ D;  4OGQ C;  2PPB C;  5BN5 A;  2O5J C;  3CRK C;  1H9J A;  3EQL C;  2A69 C;  2O5I C;  3H94 A;  3U9S A;  2BE5 C;  3ND9 A;  4H44 C;  2B8G A;  1TU2 B;  2E75 C;  3WDN A;  2A68 D;  1A6X A;  2JEB I;  1GJX A;  1OXT A;  1H9R A;  3W3A A;  1GUN A;  2E76 C;  3SE0 A;  3A7L A;  3PUW A;  2QF7 A;  1OXV A;  4KHZ A;  4TKO B;  1LAB A;  1ZYR C;  2D5D A;  3OW7 A;  2DNE A;  1Y69 U;  2D62 A;  4JBW A;  4I7Z C;  1DD2 A;  4OO1 G;  5K36 G;  2EVB A;  2KA7 A;  1HTP A;  1E2V A;  1TKW B;  1FR3 A;  3I73 A;  2F1M A;  4TQU S;  1OXU A;  4IQZ A;  2JEA I;  2A6E D;  2BA0 A;  3A8I E;  2EJM A;  4G7O C;  1H9K A;  2KCC A;  2NN6 G;  3A7A B;  2DNC A;  1E2W A;  1HQM C;  3BDO A;  2B8F A;  3RLF A;  4G7Z C;  2A68 C;  1CTM A;  1LAC A;  1I6V C;  1Y8O B;  3VA7 A;  5JEA G;  4OO1 H;  5K36 H;  4IFD H;  1GHK A;  1O78 A;  5C0X G;  1QJO A;  2V4D A;  4DK0 A;  4GZY C;  2PNR C;  1B9M A;  1Q1E A;  2BE5 D;  1BDO A;  2JE6 I;  3VR3 A;  1OXS C;  1T5E A;  1IYV A;  1HCZ A;  3LNN A;  2K32 A;  5BN3 A;  2ZT9 C;  1K8O A;  4DNT B;  4BA1 I;  2A6H D;  4XIG S;  3T56 B;  3M4Y A;  3MFY A;  2K33 A;  2PCF B;  3VR5 A;  3IFT A;  2A6H C;  2EJF C;  3FMC A;  1V8Q A;  2EDG A;  3KLR A;  1VF5 C;  2K7V A;  3BG3 A;  2JXM B;  2E74 C;  3VR4 A;  2D2C C;  3PUY A;  1G29 1;  4LJZ C;  1HPC A;  2BA1 A;  1FYC A;  4H13 C;  1IYU A;  2L5T A;  1PMR A;  4JK1 C;  3QIA A;  4KKT A;  4DNR B;  1B9N A;  3D4R A;  3M7N A;  4HR7 B;  2NN6 I;  4LK1 C;  1ONL A;  2YYZ A;  4RCN A;  3NE5 B;  3T51 B;  1E2Z A;  5KNB A;  1H9S B;  2AUK A;  1DCZ A;  4KKU A;  1GUO A;  5BN4 A;  2A6E C;  1GUS A;  2LMC B;  2Q8I B;  4XTC S;  1YNN C;  3HGB A;  2IT1 A;  1IW7 C;  2AWO A;  3LWU A;  3N6R A;  3P20 A;  3QG1 A;  5JEA H;  2EJG C;  4BA2 I;  1OXX K;  1CI3 M;  3CRL C;  1O7L A;  3PUZ A;  1GUT A;  3VR2 A;  3ND8 A;  1IW7 D;  1Q90 A;  3AB9 A;  4G7H C;  4KI0 A;  1H9S A;  3TZU A;  3GD7 A;  3FPP A;  1VDZ A;  3GQB A;  3QJY A;  2BDO A;  3PUX A;  3I72 A;  4KN7 C;  2CW0 C;  4PV1 C;  5A35 A;  3IKJ A;  3MXU A;  1V43 A;  2A69 D;  1GHJ A;  2R6G A;  4KMU C;  2NN6 H;  3DXJ C;  1VF7 A;  3A8K E;  1CFM A;  5KNC A;  1SMY C;  5KND A;  3SDZ A;  4KKS A;  1DXM A;  1EWH A;  1Q1B A;  3OPO A;  1Q12 A;  3M85 A;  1VCI A;  1Y8P B;  4H0L C;  3OOC A;  4DK1 A;  1YNJ C;  3PUV A;  4IFD G;  1H9M A;  1Y8N B;  3PV0 A;  3T53 B;  5C0X H;  3VR6 A;  1K8M A;  1Z7T A;  4KN4 C;  3D31 A;  2DN8 A; 
#chains in the Genus database with same CATH topology
 1PTO C;  4OOX A;  4OEL B;  2JJ2 A;  1MAB A;  1W9X A;  4TMW A;  1CNE A;  4OO1 I;  5FLX E;  2K1B A;  5IYR A;  5IT9 L;  3S16 B;  1PFM A;  1TU2 B;  4Z4W A;  4YCV A;  1JB7 A;  3S15 B;  1RL2 A;  4QVJ A;  1IZ6 A;  4HJ7 A;  1JE4 A;  1ZYR C;  2F4N A;  4AQY L;  5CR3 A;  4KK7 A;  5JBQ A;  3PO2 H;  2W6J A;  1KNA A;  3OMG A;  2Q2U A;  2QEX A;  2F52 A;  3NPP A;  2UU9 L;  1TKW B;  4JOI C;  1KLG D;  1E43 A;  3S24 A;  2R6H A;  4NB3 A;  3GTJ H;  4OPV A;  4MZ9 A;  4XLH A;  3GO5 A;  5F4J A;  2YV5 A;  3U4V A;  1W2B A;  1EQV A;  2RCN A;  1II3 A;  3MEH A;  3PO2 G;  1M8A A;  1Q8K A;  1IL8 A;  1O78 A;  1S4Z A;  3QR8 A;  4O0A A;  3CCU A;  1YVC A;  2CK3 A;  3GV6 A;  4IW3 B;  3F2U A;  3GP7 A;  5ELN A;  5GQO A;  1S40 A;  5M5W B;  1TWC B;  1YHQ B;  2IWH A;  2EYH A;  4V19 0;  1GD7 A;  2C4T A;  1GOZ A;  2N88 A;  1LTR D;  1MRZ A;  1BCP C;  1OTC A;  2R7Z G;  1B3A A;  4XIG S;  5FL7 A;  4FO2 A;  1EP2 B;  4RPD A;  1H42 A;  2DJF C;  3M4P A;  2ZIT A;  2IHF A;  1B4O A;  3FMC A;  5I2X A;  4A3F H;  1VF5 C;  1PH4 A;  3PO3 B;  1K0S A;  4QB4 A;  4YAF A;  2HD3 A;  4BY1 G;  4TRD A;  2ZZE A;  1UNS A;  3WND A;  1IB0 A;  2WKD A;  5E1F A;  1TWA H;  1YI2 A;  3SR1 A;  4OPO A;  1O7I A;  1P8L A;  1A2T A;  2XIW A;  3QFC A;  4X64 L;  2CWA A;  4RPB A;  1KZL A;  2EY1 A;  4C0S A;  4K5W A;  4A3F G;  4G5G A;  1RIP A;  1PRT B;  1BBU A;  3CP8 A;  2AUK A;  2F0F A;  1TUI A;  2ZXH A;  2K5H A;  2R92 B;  4RDJ A;  1E1O A;  3CQZ H;  5JEA J;  3JAM L;  5M3F B;  2VNJ A;  1ZEQ X;  1RKN A;  2EYP A;  4JI2 L;  3FKI B;  4BA2 I;  3RUZ A;  3MVV A;  3CRL C;  2D74 A;  3G05 A;  1I4Q A;  3PA1 A;  4QUF A;  1M90 C;  1IW7 D;  2JA6 G;  1WTV A;  2UXB Q;  4BY1 B;  3TSS A;  3FJO A;  2EIX A;  2BDO A;  5HUR A;  4JPB W;  2NVT B;  1I3Q H;  2NYZ D;  2D9R A;  3HOV G;  4KMU C;  4P22 A;  1S5B D;  1WYD A;  1PYS B;  2VNK A;  5IT9 E;  1E1T A;  1S5E D;  4OX9 L;  2F4V L;  1GM5 A;  1BO0 A;  1FX0 A;  1EIF A;  4GQN A;  4Z4Z A;  2ICI A;  5DM7 3;  1YLO A;  1K73 D;  1G2T A;  1EFT A;  4DK1 A;  1WTH D;  1SNC A;  1S3O A;  1Y8N B;  2EYO A;  1K8M A;  1A15 A;  2QEJ C;  4DAV A;  1XFO A;  3CF5 A;  3S2D H;  4DV7 Q;  4BBS B;  2AUJ D;  1OHH A;  1TQO A;  2FJ2 A;  2NVT H;  4ZKB B;  5A88 A;  4CJ1 B;  1ENC A;  4K6D A;  3K0X A;  3SK5 A;  1KNE A;  5KSW B;  4LNQ A;  2EYF A;  4C3J B;  1OXT A;  1SR3 A;  3A54 A;  3PUW A;  4HMJ A;  4TKO B;  2LSS A;  4RDL A;  4RD4 A;  4FDB A;  3RN5 A;  2NTS A;  4JBW A;  1P16 A;  4FXD A;  2J7Z A;  3ZIA A;  3V76 A;  1FNM A;  4G7O C;  1YJ9 B;  2IW3 A;  2RDH A;  3A8I E;  5CV8 A;  3VDY A;  1HR0 W;  2WYR A;  4C3J H;  1TLL A;  1KL9 A;  4YWK A;  3U6B A;  5JJK A;  1CA6 A;  2K28 A;  1LAC A;  3STB D;  1GHK A;  2HIV A;  1HJP A;  3I4M G;  3WYA A;  2OWO A;  3WNC A;  1HFG A;  2B2T C;  1YJW B;  3KF8 B;  4PC6 A;  4G1V A;  3R93 A;  4RD0 A;  3SLD A;  4X65 L;  2CW0 D;  1OXS C;  3KLS A;  1IYV A;  2WZN A;  3URY A;  1E1Q A;  1J8I A;  2OK8 A;  4GN3 B;  4OXP A;  5JJI A;  1RCV D;  2XZL A;  2A6H D;  4JBJ A;  5ELE A;  5TR9 A;  1K8G A;  2H5X A;  1Q81 D;  3I4N B;  1QZG A;  2A6H C;  2R92 H;  2QMU A;  2O4X A;  1D7Q A;  1V8Q A;  4DR3 L;  2K50 A;  4XNF A;  3F2C A;  3CC4 A;  2IHE A;  2DGY A;  1B70 B;  5EKL A;  4B3F X;  2MGS A;  5CC4 A;  4C56 C;  4P75 A;  4MTK A;  4JK1 C;  1B9N A;  3BU2 A;  4BY1 H;  1LTI D;  2BM0 A;  2XZP A;  1E63 A;  3JQP A;  2RSN A;  2QIL A;  3JQQ A;  2DY8 A;  1UD3 A;  1G51 A;  3BYT B;  3T51 B;  5AN9 A;  4YHB A;  1V5V A;  1DCZ A;  3NEL A;  3W5H A;  3AFQ A;  4GNX A;  1EY6 A;  1UE6 A;  3RZO B;  4IUT A;  1BXT A;  1PYW D;  2B29 A;  2BOS A;  3NSW A;  4AIM A;  4RD2 A;  1VQ4 B;  2K4K A;  1QUF A;  3JC6 6;  2ZXI A;  4JC0 A;  1HNX L;  3I3C A;  2I5L X;  4L5S A;  3OTO L;  1LT3 D;  2VNU D;  1I94 Q;  3NQT A;  4TMZ A;  4B3X A;  5C4J H;  1QFY A;  5C4Z A;  3GTQ B;  1QNU A;  1GO3 E;  1PFN A;  1XTC D;  4IOA A;  3JU4 A;  3ZZT A;  3BY1 A;  2IX0 A;  4DR6 L;  3W2D A;  1VCI A;  4H0L C;  3NBH A;  1Q82 D;  1VQB A;  1L1O C;  2C4U A;  3MEF A;  4J6H A;  4A3E H;  3OYY A;  4L63 B;  5C0X J;  3MC0 B;  1FNV A;  2MNA A;  4PMW A;  3S1M B;  1MSH A;  1EEI D;  5J35 A;  3H0G G;  5BN5 A;  1H9J A;  4B3M Q;  1UWV A;  3H0G B;  5FLX L;  1IJE A;  3U9S A;  1FNB A;  2B8G A;  4DGZ A;  2JA8 G;  3HOU B;  4ZGQ B;  1JJG A;  1D1I A;  5M5X B;  3I91 A;  3NTH A;  3I70 A;  4HSV A;  2R7F A;  1UMK A;  4KTA A;  1R9T B;  2KEC A;  1C4Q A;  4B3S Q;  2IL8 A;  4RAU C;  1XNR L;  2JEA I;  4A3C G;  3S1R B;  4LMQ D;  1U0L A;  2CC2 A;  2B2W C;  2JJ1 A;  1EFW A;  1Q86 C;  4YWM A;  1KK3 A;  3E0E A;  2VL6 A;  2KVO A;  1GVH A;  2DER A;  4XLE A;  3B82 A;  5K36 H;  4X3K A;  1FDR A;  4WZT A;  1HZ9 A;  2PI2 A;  2Z6K A;  4IZ8 A;  4R1J A;  2ZTC A;  2K04 A;  3BC9 A;  5FLX c;  1O7Y A;  2BE5 D;  2K6A A;  2JYO A;  4LFC L;  2X6W A;  3SJZ A;  3QWN A;  1QOH A;  4X64 Q;  4YAW A;  4QVA A;  3OTO Q;  2EE1 A;  4POF A;  5E3F A;  1XNQ Q;  3SK6 A;  3QFS A;  2QDX A;  5IYB G;  2HCC A;  2OBT A;  2EYM A;  3CPW B;  2AQ1 B;  1A2U A;  4GS3 A;  1CKO A;  1I4R A;  3CME B;  2XSC A;  1EU4 A;  4POG A;  2F0J A;  2R93 B;  1VQ6 A;  3PUY A;  3WBJ A;  4I65 A;  2BH8 A;  4CDE C;  3Q3A A;  4H13 C;  2JA7 B;  2DJG C;  4HIZ A;  2B7B A;  4AVZ A;  3CCJ B;  1BOS A;  3CTA A;  2VXW A;  4IJL A;  4DR2 L;  4BY7 B;  3ERO A;  3I55 B;  2MP1 A;  3ZPN A;  2WP8 J;  1N32 L;  5KNB A;  1VQK B;  1VQ6 B;  1VHE A;  4ZUJ A;  5C5M A;  3E9I A;  1YNN C;  1VQL A;  3HRZ C;  3ZJY C;  4ALP A;  2BGJ A;  1BBW A;  1NE3 A;  1SBB B;  3NBH B;  1E0B A;  1EU3 A;  1OXX K;  1SAP A;  2H4O A;  2X6G A;  4JI3 L;  2LY7 A;  3VR2 A;  3GTM H;  2VB3 X;  2FMC A;  3CW2 C;  3WWV A;  3FEW X;  3DM1 A;  1IKM A;  4IUN A;  4O42 A;  4RMF A;  2WAQ G;  5B6I A;  2IPK D;  1HRJ A;  4NXM L;  3D4W A;  4LUV A;  1VQN A;  3J80 c;  3GV3 A;  2JK8 A;  1TXY A;  1XE1 A;  2AHO A;  4PC7 A;  2VB2 X;  5FLM G;  1FGB D;  3R6K A;  1GUW A;  1ZXT A;  1EWH A;  3K8A A;  1JOR A;  2VBS A;  3HKZ G;  2B2T A;  3J7A F;  4M4S A;  3FPK A;  1VQO A;  4PC2 A;  1N9W A;  1ESR A;  1VQ8 A;  1K0R A;  4CBV A;  1WU8 A;  5FNZ A;  3RLO A;  1A3T A;  1YHQ A;  2CRV A;  2JN4 A;  4XYO A;  4YAU A;  1R5O A;  1TWC H;  2QDL A;  4RA8 A;  1BLI A;  5M3F G;  1JCK B;  1DOK A;  1NY4 A;  2BE5 C;  1F9Q A;  3ZC3 A;  5ELO A;  1TT2 A;  2SEB D;  1R5N A;  4A3I H;  1KIX A;  2HDM A;  2UUB L;  5HXB A;  1NMF A;  3BZC A;  5H59 A;  4RWS C;  4RLZ A;  3WOF A;  1X32 A;  1Y69 U;  4UP8 A;  2UXC Q;  1JWS D;  3NBI A;  1DD2 A;  4HE6 A;  2VYQ A;  1KDC A;  3P7J A;  3J80 E;  5IWA Q;  2Y0S E;  1JJC B;  3KEW A;  1DGS A;  4A3L H;  3A1P A;  1CK1 A;  3CCL A;  4J1M A;  2DNC A;  4BWG B;  4OHJ A;  2L1B A;  4K8I A;  1Q9S A;  4P3I A;  1EFI D;  3F1Z A;  4YAL A;  2RCF A;  2V4D A;  4P2N A;  4JI1 Q;  5H5J A;  4P71 A;  3ULL A;  2VBU A;  2GN5 A;  1PFS A;  5ELC A;  1X3P A;  1SYF A;  4BA1 I;  1WCM B;  2EPB A;  2QA4 A;  1VQ8 B;  2RSO A;  3PO2 B;  1HZE A;  2QTZ A;  3CB4 A;  3G71 B;  5GAD C;  4ACB A;  3I4M H;  1CQX A;  5EKI A;  3KLR A;  1F9S A;  3CC4 B;  4P6V F;  1SDF A;  4JI0 L;  3X3N A;  4A76 A;  3C46 A;  1VQM B;  1W0K A;  3I56 B;  2F0G A;  4O2D A;  4Q5V A;  2MJ8 A;  2DUD A;  3K5L A;  2ZZG A;  2VQF Q;  5CV5 A;  4X62 Q;  2B63 H;  4RD1 A;  1N8R D;  2QGQ A;  3AVV A;  3K5N A;  2AMC B;  4K1X A;  2WR8 A;  1UEA B;  2B2U C;  1ASZ A;  4F8M A;  3HS0 C;  5HZB A;  5M5W H;  1TR5 A;  2ZJQ A;  2D3L A;  2V7W A;  2L15 A;  4GLA C;  2NBF A;  3CC7 B;  1RDP D;  1ELO A;  4GOP B;  1GUS A;  4OPS A;  4A75 A;  3KL9 A;  1SND A;  2N78 A;  3RY8 A;  1SYE A;  4LUZ A;  5TV2 A;  3ND8 A;  3OWF A;  5I6W A;  3MMP A;  2C5H A;  2QE7 A;  4DXG A;  1J5E Q;  3CC7 A;  1OGJ A;  4DAM A;  2B2U A;  3R6J A;  1Q3L A;  2CH4 W;  1D8T A;  4Z9C B;  2FXQ A;  4KV6 A;  1ZM3 A;  4GOP C;  1ESF A;  3EJI A;  1W35 A;  1EIG A;  5C6A A;  4R71 A;  2OEO A;  2FMM A;  4DUY L;  1K73 C;  1PH6 A;  1ILP A;  1IHM A;  1Q1B A;  1WTH A;  1UD6 A;  3OIQ A;  4YIJ A;  5AJ3 Q;  1N07 A;  3CXC A;  4GNX C;  4JI8 Q;  2KCT A;  3WY9 A;  3A3B A;  2GK7 A;  3ZBU A;  2D3N A;  1Y1W H;  2M00 A;  2C5C A;  2NWG A;  2QDB A;  4Y9R A;  2A69 C;  2KED A;  1PH9 A;  1V0E A;  4H44 C;  2Q2I A;  3WDN A;  2RF4 A;  3EVQ A;  3KJO A;  3DLL A;  4PC1 A;  5EPL A;  4JI3 Q;  1VQJ A;  2YU9 H;  1XQB A;  1LAB A;  4LF8 L;  1YNJ D;  2EFG A;  4XM3 A;  4NW2 A;  3ISX A;  1DM0 B;  1FR3 A;  4B3S L;  1TII D;  4LF9 L;  3E20 A;  4HN7 A;  4EVO A;  3U6K A;  1NNX A;  4PG3 A;  2KCC A;  2CBX A;  3TRZ A;  3HKZ E;  4XT3 B;  5COY A;  1YIT A;  4BBS H;  4G7Z C;  3K6O A;  5KGU A;  2ZXO A;  1JT8 A;  2PI2 E;  2HIX A;  1STY A;  5CBE E;  5EPK A;  1U4R A;  4DV7 L;  4ZUI A;  3C3L A;  3U58 A;  3U50 C;  2BMW A;  1TWG B;  2ZT9 C;  5D3D A;  3T56 B;  4XQQ A;  2JA8 B;  1QZH A;  2EJF C;  1PTO D;  4C1N I;  4DR6 Q;  3GTM B;  1QGZ A;  1VQ9 B;  2KQ3 A;  4OWW B;  1CQF A;  2C2W A;  2ASB A;  4EX5 A;  4UY8 C;  2MO1 A;  1HPC A;  3U4Z A;  2BA1 A;  1FYC A;  3RMH A;  4V0B A;  3D26 A;  2QN6 A;  3PQI A;  1A0I A;  1WTP A;  1QG0 A;  1SMY D;  5DAU A;  4A3L G;  4BBR B;  2F0E A;  2L0C A;  2LS0 1;  4OP7 A;  4HR7 B;  4RCN A;  4K2L A;  1JNY A;  4HAE A;  1I3Q B;  3K7A H;  4DK6 C;  2V7T A;  3HP3 A;  3R2I A;  4HIO A;  1KRH A;  1L1O B;  1PDQ A;  2LMC B;  3PUN A;  2SOB A;  3S14 H;  2VZL A;  4HID A;  2XGT A;  1SJH D;  1Q82 C;  3VYS A;  3PO3 G;  4IPC A;  2NVQ B;  3A74 A;  4DU9 A;  2E2J H;  5KW9 A;  4A3B B;  4OEM B;  4DV4 Q;  3T1H L;  2KHS A;  4M0L A;  4LW1 A;  4ULL A;  2N55 A;  4QQB X;  3FPP A;  4RH6 A;  3CC2 B;  3V2T A;  1D5M C;  3L0O A;  2E8G A;  4QL5 A;  3MXU A;  4DNI A;  2R6G A;  4PZ8 A;  2JSO A;  4DQL A;  3A8K E;  1N8R C;  2F4I A;  2ALY B;  4C3H H;  1G6Z A;  2JA7 H;  3B78 A;  2B2Y A;  4A3M B;  3H09 A;  1XMQ Q;  4Z4S A;  3A56 A;  4UHV A;  5KYI A;  3I55 A;  3FVQ A;  1NJI C;  1JB9 A;  5IP9 H;  2F0V A;  3D31 A;  1VQ9 A;  3A8J E;  2GK6 A;  1QUQ A;  1YEZ A;  2GJP A;  3L7Z C;  1EUJ A;  4DKA C;  5FLM H;  4DV0 L;  1BJK A;  1PH7 A;  5HKK A;  2B39 A;  1KHI A;  1VMP A;  3EQL C;  4XXE A;  2PMZ B;  2VS1 A;  3VO1 A;  4RDK A;  1SYD A;  1TS4 A;  1X3F A;  1XMO L;  3BZD B;  5IYD G;  5G3L D;  4ZCM A;  2K5V A;  1VQP A;  4H7B A;  1I4G A;  2E5L L;  3CCV B;  2OTJ B;  3QSY A;  4I7Z C;  3CRZ A;  4OO1 G;  4RCZ A;  3EIV A;  2F43 A;  4Z4U A;  4KY5 A;  2LZJ A;  1PZK D;  5KIX A;  4UZF A;  1D5X C;  3KJP A;  5CDF A;  3J7A V;  3OE7 A;  1WOC A;  2A74 C;  2B8F A;  4IUQ A;  4ZKC B;  3AVT A;  1EYC A;  3W1G A;  5JEA G;  3J7Y W;  3AMU A;  3BYY B;  5FO9 B;  1WTR A;  1A63 A;  2PNR C;  2WV6 D;  3Q22 A;  2R7Z H;  3HOU H;  1VS0 A;  1SE4 A;  1Y1W G;  2JA6 B;  1AP0 A;  2Q6O A;  2ES2 A;  2F0P A;  4XOP A;  1EY8 A;  2SDF A;  3M4Y A;  1GXD C;  2ZTD A;  1WJJ A;  4P26 A;  2ZBV A;  3KK7 A;  3RD4 A;  3GVL A;  1H8H A;  1WOS A;  1SYG A;  4C3H G;  4P1V A;  2XZO A;  1EQQ A;  2DY7 A;  1FNU A;  1OB0 A;  2R61 A;  3VR4 A;  3PIO 3;  4Z1M A;  4AQY Q;  4DR7 Q;  4A4I A;  2KCN A;  1UE5 A;  1HHV A;  3DM3 A;  1IKL A;  2D9U A;  2L55 A;  4B3M L;  4LAA A;  2BSA A;  2Q8R E;  4JI4 Q;  3ER0 A;  4JV5 L;  1SKY B;  5HZA A;  2RC5 A;  1S5F D;  1G7S A;  1LYL A;  3Q6S A;  2PMD A;  1SNP A;  2F0W A;  1M1K D;  4JI7 Q;  4DV5 Q;  1CI3 M;  4RD3 A;  4DV5 L;  3KYH C;  1A3V A;  3I7F A;  3TS0 A;  2AWN A;  5C4X B;  1QCB D;  1EEF D;  3K58 A;  5AFW A;  4L6T B;  4IFD J;  3HOX G;  2R93 H;  3P75 A;  4LF6 L;  1BMF A;  4DQK A;  3BVZ A;  3R2T A;  4Q0F A;  1GAW A;  4B9W A;  3I56 A;  1QIL A;  4M1U B;  4DV2 Q;  4WZE A;  2A73 B;  4A3K G;  3DXJ C;  5GRO A;  2RDF A;  5KNC A;  3CU7 A;  4B4D A;  3D6C A;  4A3G G;  5KND A;  5C3E H;  1C7Y A;  2NZO A;  2MO0 A;  1YX2 A;  5C3W A;  4P6Y A;  1Y8P B;  2JN9 A;  3PUV A;  2IX3 A;  5M5X H;  3D0F A;  1WI5 A;  3NWS A;  2F0N A;  2F3I A;  1PJ7 A;  1GUG A;  1UD8 A;  3W2E A;  3ULJ A;  1TTT A;  2FHT A;  2KOL A;  2BN4 A;  5IGF A;  1JC7 A;  3OAA A;  2EYL A;  2PMZ E;  4HJ8 A;  1JJ2 B;  1O80 A;  1STH A;  1BBX C;  1H95 A;  3GSI A;  1TWF B;  1IXR A;  1HA3 A;  5EKK A;  3Q6R A;  2M9V A;  4TSS A;  4KJN A;  1R4P B;  5A8A A;  4S3S A;  2KHJ A;  1VLO A;  4YXW A;  1V1P A;  4IN3 A;  2UU9 Q;  4DV6 L;  3CMA A;  3IAY A;  1JA0 A;  1I6H H;  2F0M A;  4WRD A;  2B2V A;  5C44 G;  4G6I A;  4X0C A;  1IBL Q;  3S2H B;  4YEL A;  4DV2 L;  2A68 C;  1SFO B;  2K5N A;  1Y8O B;  1JIC A;  3RZD B;  5J3B A;  1EWC A;  1X54 A;  4R4O A;  1NR2 A;  2E5L Q;  2JP1 A;  2UXC L;  2DYI A;  3KDF B;  4DK0 A;  1VQI A;  2MHV A;  1Q81 C;  1X56 A;  4A93 G;  4J0Q A;  2KVM A;  4DNT B;  4DV3 L;  5COR A;  4NNJ A;  3Q0A A;  5IY0 A;  2I07 B;  2I1L A;  5DNF A;  2NVY H;  1YJN A;  4F87 A;  2EDG A;  3FDT A;  1G7R A;  1N0V C;  4DA2 A;  2NZ1 D;  2YWG A;  1EP1 B;  1ET6 A;  1NB9 A;  1I5F A;  4A3J H;  4X07 A;  1JJ2 A;  4DFA A;  2RVL A;  4XQN A;  4C3H B;  3OP1 A;  2GQF A;  4FK8 A;  5JAV A;  2JA5 B;  4XN3 A;  2SNM A;  4Z4V A;  3M9B A;  4UPA A;  2XNJ A;  2E2H B;  2Y0S B;  4P9S A;  1AEX A;  1EYD A;  3CCR B;  2OCE A;  5TSS A;  1A8P A;  3CMA B;  1QVG B;  2PLF A;  2IT1 A;  3S9W A;  4PC3 A;  2L4N A;  4LF4 Q;  1MJC A;  3CD6 B;  1CHQ D;  4IPG A;  3VMF A;  1YHA A;  2K75 A;  4MIU A;  4RHS A;  3KLW A;  1I7P A;  3MCA A;  4X06 A;  1B7Y B;  1B44 D;  1EY9 A;  2FFK B;  1QG7 A;  3E6Z X;  5CBA E;  4A3F B;  5JJZ A;  4AYB E;  3CCQ B;  1FNC A;  1E64 A;  4B3R L;  2X3U A;  4NPS A;  1VDZ A;  1NCV A;  3FKS A;  4TMT A;  2JA5 H;  1L2F A;  4A3D G;  2A69 D;  2F0O A;  4M8A A;  3SK4 A;  4ZYS A;  1KD1 D;  3IFD A;  1I4P A;  1E62 A;  3N52 A;  1CHP D;  1ROD A;  2WB1 G;  1EIY B;  1SNM A;  2G5D A;  2Y0S G;  5EGT A;  5FK9 C;  4TMV A;  1TY2 A;  5T1G A;  1EQR A;  1LLR D;  4B3T Q;  3PV0 A;  3ULP A;  1PTO F;  3VR6 A;  1J9Z A;  3D6W A;  2YTV A;  5IGE A;  1V0F A;  3PF4 A;  3E0J A;  2VY3 A;  1I6H B;  1ET9 A;  4ROX A;  1MHW C;  2R3Z A;  3ASS A;  1PRT F;  4IAL A;  2RC6 A;  1A6X A;  4A3K B;  1GUN A;  4WOR A;  3CHB D;  2OTL B;  3P26 A;  1VQP B;  4II2 A;  1OB5 A;  1T6X A;  4NDX A;  4IPH A;  2X69 A;  1WVL A;  4A3C H;  4NXN Q;  1ENA A;  3ITP A;  2A19 A;  2ZM6 Q;  1PH5 A;  3BH4 A;  4QCL A;  1RQP A;  2PQA A;  3GTP H;  5KEE A;  4UAI A;  4BY7 G;  4DUZ L;  2GRE A;  1F60 A;  2CFM A;  2BPO A;  1RJT A;  4XT1 B;  4Y7N B;  3VYR A;  4OO1 H;  4HIM A;  3M4O H;  4YAO A;  2IX1 A;  2HLD A;  1B2R A;  4Z4Y A;  1BCP F;  2WZP P;  3SEJ A;  4IUU A;  3PUM A;  2E2J B;  5GV8 A;  3RZO H;  5BN3 A;  4XKV A;  4P12 A;  1B50 A;  1LT5 D;  4QMG A;  4G1B A;  5BSY A;  2Z9H A;  3JAM E;  3J81 E;  2JXM B;  1COW A;  2E74 C;  3WBK A;  4EQO A;  3VO2 A;  4TVA B;  1ZUN B;  4JI8 L;  5LL6 S;  4CDC C;  1CKN B;  2F0K A;  2F0H A;  3S1N B;  4RFB A;  4HMI A;  5IP9 G;  2XTI A;  1Z47 A;  4RG1 A;  4LF9 Q;  2D0P A;  4LFC Q;  1PHJ A;  3M7N A;  3EBE A;  3MAQ A;  2HQE A;  1CUK A;  4B3R Q;  4Y7C A;  1FGU A;  1QWY A;  1V1O A;  2ZTE A;  4DR3 Q;  1GUO A;  5BN4 A;  1KC8 C;  4XL9 A;  4G7X A;  2AWO A;  2X53 S;  2EJG C;  1SRO A;  4LUO A;  1IJF A;  1K3R A;  1JE5 A;  1O7L A;  2VQE L;  3STB C;  4KD3 A;  2DIE A;  4KI0 A;  1EZ8 A;  4UP7 A;  4XR6 A;  1J9O A;  2NB0 A;  4FXU A;  3DEP A;  3G48 A;  3I72 A;  1D8L A;  3U9O A;  5IWA L;  2VZA A;  3J81 i;  1BNZ A;  2HDL A;  5I2Y A;  1C0A A;  2Q2H A;  4RD6 A;  1UD5 A;  2XND A;  1F77 A;  1STG A;  2HCI A;  2RDG A;  4DUY Q;  1WD1 A;  3PCO B;  2OTL A;  1X3G A;  4X3T A;  1JWM D;  2ZTN A;  3OOC A;  3S15 H;  2UXD L;  3OJX A;  1IBM L;  3T53 B;  1IHZ A;  1CKM A;  1Z7T A;  4OWX B;  2AHO B;  1DON A;  2N8N A;  1I94 L;  2PIA A;  2R9V A;  4GKJ L;  3I4L A;  1JQY D;  2ZTG A;  1FL0 A;  3Q8D A;  4A3G H;  2ZL6 A;  3RLN A;  4A3M G;  4CJ0 B;  1A3U A;  1ENF A;  1LM0 A;  1WTQ A;  1LO5 D;  3MXN B;  3HOX H;  5CMD A;  1ICF B;  5DLQ E;  1XXG A;  5F4M A;  1NDH A;  4ASU A;  3VNV A;  4GOP A;  2P5Z X;  2XN9 C;  4J8Q A;  2KA7 A;  1HTP A;  3I4M B;  4TQU S;  3HOZ H;  4X62 L;  2PNH A;  4DV6 Q;  4IJH A;  2EJM A;  2NUC A;  1W6K A;  1H9K A;  5ELB A;  5TRD A;  2NN6 G;  2F4V Q;  3MZ5 A;  4AH6 A;  2Q2T A;  4KHP L;  3CW2 A;  4QV2 A;  5HGT A;  1VQE A;  1I6V C;  1JOK A;  3VA7 A;  4JYA L;  5IGD A;  3GVK A;  2HCJ B;  1VQO B;  3H0G H;  1TVX A;  1SRU A;  4Y52 H;  4HCS A;  5BSX A;  1U5K A;  4G57 A;  3BCF A;  4UP9 A;  4R4I A;  5IOD A;  2EY5 A;  2WKC A;  2ZXP A;  1SMX A;  2X6Y A;  1WSV A;  4B43 A;  2SNS A;  5HY6 A;  4AC9 A;  3CCM A;  1FJG Q;  3SHL A;  3HOV B;  2CCZ A;  1VQ5 B;  3I8Z A;  4QIW E;  4P3Y A;  1EFC A;  1QFJ A;  2TMP A;  3D8G A;  1BVS A;  4BXX G;  5GV7 A;  3S14 B;  2NTT A;  4X3S A;  4CKC A;  3CPX A;  1EP3 B;  3A8J A;  1LTG D;  2VQF L;  3D4R A;  4Y9U A;  4JI6 Q;  4C1N K;  3IL8 A;  2XNC A;  1KRS A;  3Q38 A;  2A5H A;  3NTI A;  5D65 A;  1S72 B;  3OSO A;  2JA6 H;  1I4X A;  2X0K A;  1NRK A;  3ASP A;  1Y1V H;  2NN6 I;  4LK1 C;  4DUZ Q;  1ASY A;  3ES9 A;  5G3L F;  1JOQ A;  1E3X A;  3M4O B;  1SNQ A;  1U4L A;  4KKU A;  3HOY B;  3SJP A;  1KJZ A;  1LTB D;  1M90 D;  3HGB A;  5LMN Q;  4UZE A;  1UE1 A;  3P20 A;  1EOT A;  5JEA H;  3CD6 A;  3I4N G;  2HHH L;  1GO2 A;  2HUG A;  5C0X I;  1LUZ A;  1PTO B;  2RA4 A;  1GUT A;  2OQ0 A;  5I9O A;  2CQA A;  1Y1W B;  3AB9 A;  2ZJP A;  4K0K Q;  3LQE A;  1D1K A;  4FXK C;  5E6T A;  1U4P A;  4A3I G;  3JQR A;  4BBR H;  2QA4 B;  4FVM A;  5IP7 H;  1N32 Q;  2OYN A;  2KEN A;  1NUC A;  3OW2 B;  3F2B A;  3S1N H;  3CCS A;  4K2K A;  4XKW A;  4U68 A;  4X7D A;  1DG1 G;  4HTH A;  4LF4 L;  1EYA A;  3QFT A;  1J6Q A;  5M3F H;  1PTO H;  1ZM9 A;  5LMZ A;  4FXG C;  3HOX B;  4DXF A;  2EXD A;  4XQF A;  2VNH A;  3AQQ A;  2WJV A;  4OOS A;  2ZL5 A;  1ZM2 A;  4B48 A;  2GPJ A;  3U2Q A;  3L2P A;  3TP5 A;  2CQO A;  1V9P A;  1PLF A;  2F0T A;  1QX4 A;  1YJN B;  4WJ4 A;  3SE0 A;  4LWC A;  3MHP A;  2D5D A;  2AKW B;  1Z9F A;  2R7Z B;  1BQE A;  2K14 A;  1VQ7 A;  1Q46 A;  2WB1 E;  2WAQ B;  1E2V A;  3W1B A;  2VJJ A;  4NCN A;  1WOP A;  4CJ2 C;  1U4M A;  1HNX Q;  4XOT A;  1STA A;  3UDX A;  1EY0 A;  4R8I A;  4JI4 L;  3G6E A;  4TSF A;  1DYQ A;  3K7U C;  2C5B A;  4MNO A;  3TP7 A;  4LF7 L;  1G7C A;  4LFB Q;  4CKE A;  3AVY A;  3PO3 H;  3NXW A;  5JPM C;  1OB2 A;  1AH9 A;  4TMX A;  2JQO A;  5I9P A;  1RTO A;  3I2Z A;  1AZQ A;  1E22 A;  1KTK A;  1L0X B;  4X7E A;  1Q1E A;  3K7A B;  3G6E B;  2X85 A;  4JVZ A;  2BVN A;  4X8I A;  2HQL A;  2K32 A;  4WJW A;  3CCQ A;  5TY0 A;  1VMC A;  1SEB D;  3DUZ A;  5JVG 3;  2P3M A;  2YTX A;  4K14 A;  2VJI A;  3H3V I;  3VYU A;  2ENB A;  3RZD H;  1PH3 A;  1HXY D;  2VUM B;  1B1Z A;  4UAJ A;  3GTG B;  5HGQ A;  3AGP A;  1PZJ D;  3H9N A;  4LJZ C;  1G6P A;  2JJQ A;  2OQK A;  3ZUG A;  2J4X A;  2I46 A;  5IK2 A;  1N06 A;  4KKT A;  4DNR B;  3G4S B;  4HED A;  2PE3 A;  2QGG A;  4C43 A;  1FNW A;  1DDG A;  2DOG A;  5M5Y H;  4ID6 A;  3K59 A;  1SXT A;  4GN5 A;  3LVB A;  3OHX C;  3T16 A;  1G2S A;  2YYZ A;  4FN5 A;  3NE5 B;  3OEE A;  2M2L A;  1CQV A;  1IYJ B;  1DAR A;  3TN2 A;  4ZGN B;  4U67 3;  2BH2 A;  2DET A;  3N6R A;  3G4S A;  2DY1 A;  2F0L A;  4DR4 L;  1KTV A;  3QFR A;  1VQN B;  1X55 A;  4LF7 Q;  3CCU B;  3S16 H;  1T5X D;  4RCY A;  1Q90 A;  4K0K L;  4XD7 A;  5FO0 A;  5GAH C;  2JA8 H;  4L5R C;  1FVI A;  1Y0R A;  3PUX A;  4KN7 C;  1E7Z A;  1STE A;  1R4Q B;  1BCP B;  1ICW A;  1V43 A;  1I50 H;  1VF7 A;  4MYU A;  1EFR A;  1L0W A;  4HJ5 A;  1TWF H;  2VUM G;  1E1R A;  3CP2 A;  4EH1 A;  1PJ5 A;  1K83 B;  2QEX B;  3NEM A;  3M85 A;  5NUC A;  2EY2 A;  2LXJ A;  5EMN A;  2M5S A;  1CT1 D;  1XTD A;  2N49 A;  5C0X H;  1B2T A;  3UE0 A;  4FF3 A;  2OBS A;  3W2I A;  1IBK L;  1WTW A;  4QHY A;  3GTL B;  4E6I A;  3G7L A;  2R7D A;  4FF1 A;  1R5B A;  1HNZ L;  4XLA A;  2B7C A;  1PA6 A;  2BV3 A;  2F0I A;  1FRQ A;  2K03 A;  4YHH L;  2UUA Q;  1BQQ T;  3KBG A;  3MTS A;  1SFO H;  1A62 A;  4F7D A;  3PF5 A;  1H9R A;  1KK2 A;  1OO9 B;  3A7L A;  1K83 H;  3FHW A;  2F0S A;  3ZYY X;  4GN4 B;  5J3O A;  2RKS A;  4JI6 L;  5E7N A;  3OW7 A;  5ELD A;  2VW9 A;  3S1Q H;  5EPJ A;  2JDI A;  4DN4 M;  3UDG A;  4IUR A;  5K36 G;  5I6Y A;  2IY5 B;  1TY0 A;  2WAQ E;  2H1E A;  1Q86 D;  3T1Y Q;  1BX0 A;  2F1M A;  3CC2 A;  2BA0 A;  4XYQ A;  3OW2 A;  4A3D H;  1WSR A;  1VQD A;  4ZK9 B;  3ZZU A;  2L11 A;  5FKA C;  1STN A;  4WQM A;  3HFZ B;  4A3I B;  3ASQ A;  5DS0 A;  4K5X A;  5THX A;  4KY7 A;  2BM1 A;  4DR5 L;  2HDN B;  3V7A A;  1B9M A;  3G71 A;  4R4C A;  2EQS A;  3Q23 A;  2EYJ A;  2NVQ H;  1T5E A;  3C2P A;  5M5Y B;  1UEB A;  1G8Z D;  4HSP A;  1VQF A;  1EY7 A;  1K8O A;  1ML0 D;  2XRS D;  3F2D A;  3MFY A;  1UUP A;  2NZH A;  3GTP B;  3GIR A;  1QGA A;  3HOY G;  1L0Y B;  1PFB A;  3A55 A;  3KF8 A;  5E4X A;  3KDF A;  2CH4 A;  3LGJ A;  4FWT A;  3IRB A;  4Z4R A;  2I5H A;  4AYB G;  1GAQ A;  3QE2 A;  1QVF B;  3DEO A;  3KUP A;  3K81 C;  4DR5 Q;  4OON A;  1G29 1;  1YIT B;  2A1A A;  3FPU B;  5J1Z A;  1UAP A;  4HIK A;  2MPM A;  4KHV A;  2FVG A;  5FA6 A;  2F0U A;  2KUM A;  2V1C C;  4G4K A;  1C48 A;  1PH8 A;  3ONY A;  4P25 A;  5IYC H;  1H9S B;  3A5Z B;  3Q24 A;  1AMO A;  1EQT A;  2A6E C;  2CF4 A;  3B6Y A;  1JA1 A;  4RGT A;  5EBC A;  2PYK A;  3LX0 A;  4B3G A;  4E0F A;  3J80 i;  2CWP A;  3TME A;  1YNN D;  2PO4 A;  4OWT B;  1HH2 P;  2E2I H;  3S1M H;  4P74 A;  2RHS B;  4LBV A;  4ZCL A;  1PH1 A;  1Y14 B;  3TZU A;  3GD7 A;  4DAY B;  2DCU A;  4N8X 1;  1K28 A;  4JW0 A;  1EFU A;  3CCS B;  1PVO A;  4EQ5 A;  1NAP A;  2K52 A;  3SK8 A;  4OIJ A;  4LFA Q;  2JIZ A;  4II3 A;  1DXM A;  2CND A;  1PXU A;  3I4O A;  3T4A C;  3QOJ A;  4A93 B;  4DAY A;  1N36 Q;  2N3S A;  2EZV A;  2YWH A;  2KEE A;  3A0J A;  2WJY A;  1UD2 A;  4UZU A;  3H91 A;  3PVD A;  3CQZ B;  1BUV T;  4TN1 A;  4JMQ A;  4X7C A;  3WNB A;  5CYU A;  3S2H H;  4L8J A;  3D3R A;  5CV6 A;  5ELF A;  2O5J C;  3HKS A;  4ZRZ A;  1NBW A;  3ONU A;  2BGI A;  1YZ6 A;  2O5I C;  3MA2 B;  4A3D B;  4JI5 Q;  2G9D A;  1F2M A;  4B47 A;  1JB3 A;  4EQN A;  3W3A A;  1SE3 A;  1KQS B;  4OIK A;  1HR0 Q;  5DEH A;  1E3Z A;  5H1S E;  1PH2 A;  1YBY A;  2E2D C;  3HOV H;  3WXM A;  4DR1 L;  2EVB A;  4RGN A;  1Q7Y D;  4K8J A;  4XLF A;  3I73 A;  3A35 A;  2PQE A;  3ERS X;  3HOU G;  1YJ9 A;  1S72 A;  3QO2 A;  1KAB A;  4N3N A;  2C35 B;  4A3K H;  1E79 A;  1FRN A;  3H3V C;  4A3E B;  2I5M X;  1E2W A;  1QFZ A;  2Z6K C;  4PNY A;  3W2F A;  1LTT D;  3RLF A;  5C3E G;  1QVF A;  1STB A;  4IFD H;  1YHB A;  1HNW Q;  1KXL A;  1QJO A;  3KBX A;  4MYT A;  3MFG A;  2KJX A;  3SGI A;  2JE6 I;  1HZB A;  5CGK A;  2UXB L;  1EL0 A;  2Z8L A;  4U9U A;  1GR1 A;  1WOR A;  4BY7 H;  2K01 A;  1TVC A;  2Z4H A;  3W2H A;  1HUN A;  4H9G A;  4MHE A;  2K5D A;  2WFW A;  1UD4 A;  2W6I A;  5I4D A;  5F2D A;  1N36 L;  4IOC A;  4QFM A;  5C4X H;  1AFP A;  1H8E A;  1LT4 D;  5ISR A;  4LFA L;  4CDF C;  3SVM A;  2YTY A;  5GAG C;  1DDI A;  2ZL7 A;  3GTO H;  2NVX B;  1EWY A;  3RNU A;  2XOK A;  4WWV A;  3CAM A;  1Y1V G;  1SLJ A;  4BXX H;  5F4O A;  1KQS A;  2WAC A;  3DDY A;  3ERQ A;  3BDL A;  2QW7 A;  1ONL A;  1SYB A;  1HNZ Q;  1RQR A;  4YY3 Q;  3S17 B;  1HZC A;  1VHO A;  1VQA A;  1HA5 A;  1SNO A;  3E5S A;  3M7G A;  1GVP A;  3J81 L;  2NVX H;  4F88 A;  1HA6 A;  4C3I B;  2XRQ D;  4J15 A;  4XN0 A;  1U2R A;  2ID0 A;  3PUZ A;  3J81 j;  1HR0 L;  3UI2 A;  5M3M H;  2OF1 A;  4ZCK A;  4MN3 A;  1VQH A;  2F0D A;  2BCO A;  4ZQ3 A;  3BS1 A;  5C4X G;  3GQB A;  3QJY A;  2NPF A;  1DZ1 A;  3DWA A;  5A35 A;  3DWP A;  3H6M A;  4EQP A;  1EXM A;  1HVX A;  1SMY C;  5IYP A;  1MGS A;  1GJR A;  1W87 A;  5FJ8 H;  2EXZ A;  2XWB B;  4KJO A;  3OPO A;  3DHQ A;  3AEV A;  4IFD G;  3OJW A;  1H9M A;  2QKI C;  4RGM A;  1S0U A;  3NEN A;  5J22 A;  3CCJ A;  4C3I G;  4DR1 Q;  1BX1 A;  5FO1 A;  2C78 A;  4RKL A;  4OGQ C;  4DV0 Q;  3WQZ A;  3HOZ B;  3AVW A;  5D14 A;  1LTL A;  2RQX A;  2CKZ B;  3HOZ G;  1VQK A;  4JOI A;  3CES A;  3H94 A;  2B3G A;  2A68 D;  1VQC A;  1E3P A;  3BCD A;  3FRP B;  1X6O A;  1UE7 A;  4B9X A;  4IO9 A;  1D2E A;  4IUV A;  3PMF A;  2K05 A;  3GTQ H;  2DNE A;  1W2B B;  3D4D A;  2L12 A;  3RN2 A;  4DV1 Q;  2UUC Q;  3H3V H;  4A3M H;  3AU7 A;  2ZBU A;  3NUC A;  2TSS A;  3T1Y L;  3K0Y A;  1XNR Q;  3FKI G;  3HAG A;  1OXU A;  3L9A X;  2A6E D;  4C3J G;  3EN2 A;  4ZAI A;  3TP8 A;  1N33 L;  4L5T A;  4X05 A;  1H85 A;  3CP0 A;  3TQY A;  1YNX A;  3KOJ A;  1JMC A;  4DR2 Q;  4N9P A;  1K9M D;  1SSO A;  2IJ0 A;  1NTG A;  4AF7 A;  2MUY A;  3CPF A;  4GKK L;  1CKN A;  1PZI D;  2CVR A;  2E2H H;  3NQI A;  4NMZ A;  2KCM A;  4QGU A;  3CCL B;  1CZG A;  3OZW A;  1M4V A;  1G7T A;  1B53 A;  4LF5 L;  1BDO A;  3J80 L;  1DOM A;  5KNL A;  4YCW A;  4XDX A;  4ZLT F;  4N3G A;  5EBD A;  3S1Q B;  1YI2 B;  4LF6 Q;  2OT2 A;  4PZ6 A;  1AE3 A;  1VJS A;  4FYD A;  3HOW H;  4PQX A;  2V31 A;  3FKI H;  4NP5 A;  2BF4 A;  2D2C C;  3H15 A;  3CMM A;  3Q6Q A;  1X3Q A;  4LC0 A;  2CW5 A;  1IYU A;  2F3W A;  2PZU A;  1IBM Q;  4XMY A;  2DEU A;  4GNX B;  4XLC A;  1NSN S;  1QGY A;  4CDD C;  1JR0 D;  1VQ5 A;  1U9R A;  1F9R A;  2EY6 A;  1TWG H;  3BVM A;  1Q7Y C;  1E2Z A;  1VQM A;  3ZZ0 A;  4IUP A;  1NB0 A;  3PIO A;  1QVG A;  1X65 A;  3QG1 A;  4H02 A;  4ABN A;  1CNF A;  3LQ6 A;  1CSQ A;  3C2Q A;  1BPL A;  1SE8 A;  2GVB A;  4X65 Q;  1EIH A;  1T6Y A;  4R8N A;  4CGY B;  2GJR A;  4PMB A;  4G7H C;  1MI2 A;  2HT1 A;  4NXM Q;  3GVJ A;  3S2D B;  3IKJ A;  5LMN W;  2VNI A;  2NN6 H;  2F3V A;  4JBK A;  4A3G B;  3BVG A;  1CFM A;  5IGC A;  4JI0 Q;  1VLY A;  5E4W C;  4JBM A;  5EQ0 A;  3S1R H;  4BBS G;  4WZL A;  4C2M B;  1KRT A;  1Q12 A;  5IT9 c;  1EY5 A;  1YNJ C;  1M1K C;  1XYI A;  3AST A;  3MWY W;  4CHT B;  4DK3 C;  3J7Z C;  4BBR G;  1MSG A;  5LHY 1;  1F20 A;  1EYG A;  1JOO A;  4PGO A;  1HTL D;  1F9P A;  1Z6H A;  1XPU A;  1KAA A;  2Z1C A;  4WJ3 M;  2E2I B;  1AE2 A;  2F03 A;  5C3E B;  4CKB A;  3LO8 A;  2Q8T A;  1RTN A;  2F0Q A;  3ND9 A;  2E75 C;  5GAE C;  1V1P B;  3C1E A;  2UUA L;  2JEB I;  4JV5 Q;  3DWQ A;  2V7X A;  1PRT C;  3OZU A;  5JPN C;  5AJ3 L;  1B3Q A;  5LL6 X;  3E9H A;  2EIF A;  5C44 B;  3CME A;  5JJL A;  1E24 A;  2NVY B;  1C9O A;  1S5C D;  2LKV A;  2D62 A;  3Q39 A;  1X3E A;  1C8C A;  5L37 A;  3HKZ B;  1PKV A;  1P4M A;  1CZW A;  2WSS A;  3OWE B;  3EFX D;  2JA7 G;  4IQZ A;  3E1Y E;  3CCM B;  2PQA B;  3R8B A;  2XGJ A;  1KK0 A;  4AYB B;  1D6E C;  1N34 L;  3M3Y H;  1XX8 A;  1VQ4 A;  3GTL H;  1HQM C;  1VQ7 B;  4JI7 L;  4B3T L;  3P27 A;  1CTM A;  4PAB A;  3WOE A;  3AGQ A;  5C0X G;  2B2Y C;  1XMQ L;  1Y1V B;  3GTK B;  4WZK A;  4JCV E;  4X66 L;  1AIP A;  5IYW A;  2B5O A;  2OK7 A;  4QF4 A;  4C3I H;  3VR3 A;  2C77 A;  1T9H A;  1KC8 D;  4L5Q A;  1EOV A;  4M1K A;  1ILQ A;  2K33 A;  2XVS A;  4X3U A;  4XQJ A;  3IFT A;  3CCE A;  4FF4 A;  4ZV4 A;  4M53 A;  5IYN A;  5CV4 A;  1FND A;  5C5L A;  4HJ9 A;  3BDC A;  4BS9 A;  3K5M A;  3GTK H;  3RR5 A;  3W5V A;  3JAM c;  4NBS A;  3HG9 A;  1XJV A;  2PZW A;  1QH0 A;  3GTJ B;  2EOT A;  4IPD A;  3UDI A;  5JVH 3;  2Q6K A;  3A8K A;  2PZT A;  1RHP A;  4XOR A;  3F8T A;  4A3J G;  2UUC L;  2XEX A;  1PYB A;  3E3X A;  4R9W A;  1XB2 A;  3HEJ A;  4A3E G;  1XMO Q;  1BF4 A;  3I90 A;  3I4N H;  1AN8 A;  1AZP A;  1IL2 A;  5LMN L;  2E1B A;  5IE8 A;  3KF6 B;  3LWU A;  4NKL A;  3I1F A;  1NJI D;  4NXN L;  1EZ6 A;  1WP6 A;  2ZZF A;  1K9M C;  4QJF A;  4APV A;  4YEJ A;  2GJK A;  3AVU A;  3UDF A;  4ACA A;  1PRT D;  1S4M A;  4DV3 Q;  4DV1 L;  1F2L A;  4KD4 A;  3V05 A;  2V7U A;  2FIN B;  3PA2 A;  2PW5 A;  4YY3 L;  1I4H A;  3L3O C;  2I0Q A;  4HE5 A;  4LBZ A;  1BCP D;  4LFB L;  5DSZ A;  3BJU A;  3W5O A;  3HZX A;  2JA9 A;  4GLX A;  1JWU D;  3SDZ A;  1VQG A;  4O1N A;  2Z6B A;  5KRU A;  3PIP A;  4QY7 A;  4DR4 Q;  3JAM i;  4LF5 Q;  4X66 Q;  2UUB Q;  4M2L A;  3S17 H;  4P2C B;  3CXC B;  5C44 H;  5CV7 A;  1HQR D;  3NHH A;  4PMC A;  4Y7N H;  1S5D D;  4Q7J B;  2GA4 B;  1I50 B;  3TP6 A;  3SXH A;  2X6L A;  1ZKO A;  3J81 k;  4ODG A;  2PW7 A;  3CRK C;  1HFN A;  5M3M B;  4YWL A;  4MTN A;  1N33 Q;  1XPO A;  2Q6L A;  3K80 C;  2Z4I A;  1F2Z A;  4DPG A;  4PZ7 A;  2R92 G;  1BR9 A;  4FF2 A;  1NR4 A;  1GJX A;  3LWE A;  1EWI A;  3ASR A;  2E76 C;  1V1Q A;  4YCU A;  2YWF A;  1F2Y A;  4RGO S;  4LF8 Q;  4GLV B;  3EA6 A;  3PSI A;  2ZJR A;  2NV4 A;  4TT3 A;  1B8A A;  1KLU D;  4JI2 Q;  2ZM6 L;  3KF6 A;  3VYT A;  3VA5 A;  4RKB A;  1MBY A;  2G9H D;  5IIF A;  3SEB A;  4FP5 D;  1CM9 A;  1N34 Q;  2OXP A;  4RJL A;  1TWH B;  3OKX A;  4UDU C;  2LFN A;  1Y0Y A;  1NMG A;  1I8D A;  3BDO A;  3GDE A;  4LBY A;  4KY6 A;  3GTG H;  4G7W A;  3BZK A;  3ZBT A;  1W3S A;  2FX3 A;  1XWE A;  2MFI A;  1G91 A;  3TRE A;  3K57 A;  3CPW A;  4GZY C;  4XON A;  2Q6I A;  4AF6 A;  5LMU L;  1KMH A;  5EJW A;  3ICE A;  2L9H A;  4DAP A;  2R93 G;  4ZCI A;  4RHR A;  1FJG L;  2GVA A;  4JI5 L;  3TEH B;  1MIU A;  1K3B C;  1TS5 A;  1ZM4 A;  1KDB A;  2PCF B;  3V96 A;  1QUE A;  2AQ3 B;  1W0J A;  1N0U A;  1QNK A;  2XNA C;  2K7V A;  5FJ8 G;  4WFN 3;  1WTX A;  2B63 G;  1PV4 A;  1I18 A;  2F1L A;  2J0T D;  4JG2 A;  2BDN A;  2OTJ A;  5K5P A;  3QIA A;  1D5Z C;  1VQL B;  1O7Z A;  4C2M H;  1D2B A;  4OL7 A;  1CA5 A;  3B8H A;  3M4Q A;  2ZXR A;  5IYB H;  2ZZQ A;  1KK1 A;  5KYL A;  1K28 D;  3OMC A;  5DN6 A;  4B44 A;  3NWT A;  5D3I B;  4IFD I;  1D1N A;  4EGV A;  3DMU A;  3A8I A;  1N05 A;  2Z6B D;  2ICE C;  1L1O A;  2Q8I B;  4A93 H;  5BR8 Q;  3MXN A;  1WCM H;  1QUQ B;  5FO8 B;  3OZV A;  2WIN B;  5J39 A;  2RBM A;  4A3J B;  2XWJ B;  2HMA A;  1YJW A;  5DM6 3;  1KAW A;  1PJ6 A;  3QOL A;  5A89 A;  2E1R A;  1H9S A;  2B63 B;  1QE6 A;  2CW0 C;  1Q8I A;  3K5O A;  2VUM H;  4ME5 A;  1SJE D;  1GHJ A;  1SYC A;  1HUM A;  5FOB B;  5FIU A;  3BY2 A;  4R4Q A;  2D0O A;  3CCV A;  3ONA B;  1OGI A;  4HJA A;  4KKS A;  4KHP Q;  4CQJ A;  4JI1 L;  2HHH Q;  4ME3 A;  1RF2 D;  5M9O A;  3MXG A;  3M3Y B;  4K5V A;  2UXD Q;  3NP8 A;  4QIW B;  2RHQ B;  4KN4 C;  2JA5 G;  5IYD H;  2DN8 A;  1K8A D;  2QCP X;  5CV9 A;  1YIJ A;  3A3G A;  4DR7 L;  4X7F A;  3UE1 A;  1NBM A;  1TS3 A;  4A3B G;  2VBV A;  2PPB C;  2B2W A;  3SKB A;  2C9O A;  2CHB D;  3TZD A;  4OOV A;  3O13 A;  1IBL L;  3R3O A;  1LTA D;  2VQE Q;  2QF7 A;  1OXV A;  1CSP A;  2KBN A;  4KHZ A;  1WD0 A;  3T13 A;  4B08 A;  1MD2 D;  3C1F A;  3J81 c;  3X3M A;  5M3M G;  3J7A 5;  4LBW A;  1W6J A;  1AW7 A;  5C4J B;  2J7K A;  3P1H A;  2K5Q A;  3SLN A;  1LT6 D;  1EY4 A;  1XPR A;  2X8K A;  3TDQ A;  1J5E L;  3MHB A;  1MJE A;  3A7A B;  4BPR A;  3OEH A;  3KFU A;  5FO7 B;  1WDT A;  5IGB A;  2YU9 B;  2AQ2 B;  3G6J B;  1WCM G;  4QUC A;  4JYA Q;  2A8V A;  3AVX A;  4R4T A;  1KDA A;  2MQH A;  2V7V A;  3VNU A;  1SN8 A;  1A8V A;  4K6L A;  4P73 A;  3GTO B;  4QUZ A;  3KLS X;  1WOO A;  1WFQ A;  5C3X A;  3BQJ A;  1B23 P;  1HCZ A;  3W5U A;  3LNN A;  2LXK A;  1KD1 C;  5L46 A;  3QB3 A;  3HOW G;  4YHH Q;  3CCE B;  3VR5 A;  1MKH A;  2OBR A;  4DF7 A;  2V7Q A;  1YIJ B;  4GKK Q;  2Z0S A;  5C4H A;  3BG3 A;  1R9T H;  1LV9 A;  2KHI A;  1W34 A;  4RM0 A;  1TS2 A;  1IBK Q;  5JOB A;  1FD7 D;  1QB5 D;  4P72 A;  2ATW A;  5EAY A;  1HZA A;  2L5T A;  1PMR A;  3AYH B;  3MXP A;  4ILW A;  4I7A A;  1DJR D;  4KLK A;  2QTL A;  2B2V C;  2VBT A;  2YWE A;  1BKB A;  4N8F A;  3PEN A;  4X6A H;  3OFN A;  2WB1 B;  4GKJ Q;  3CKI B;  3PIP 3;  4N9T A;  3NK9 A;  3NTK A;  1WTO A;  1K8A C;  5IYQ A;  3FP9 A;  1ZYR D;  4PAA A;  4XTC S;  3HOW B;  2K5W A;  1IW7 C;  3AFP A;  5BR8 L;  5IYC G;  3W2G A;  4FNF A;  1N08 A;  5LMU Q;  1RD9 D;  1SE2 A;  4Z4T A;  4DV4 L;  3T1H Q;  5A2Q L;  3OIP A;  4RCO A;  3CCR A;  1SM4 A;  3TBI B;  3TS2 A;  5A2Q E;  3PGZ A;  1LTS D;  1XNQ L;  1WPC A;  4PV1 C;  5IGG A;  2WPD A;  1TWA B;  5IOC A;  1SKQ A;  3HOY H;  1GKH A;  1QVC A;  4HCE A;  5T1I A;  2WII B;  4OX9 Q;  5IP7 G;  3A5U A;  1T6Z A;  2X6X A;  2O2L D;  3BNW A;  1DOL A;  4F7X A;  4A3B H;  1HNW L;  1X9N A;  1TWH H; 
#chains in the Genus database with same CATH homology
 1PTO C;  2JJ2 A;  1MAB A;  1W9X A;  4OO1 I;  5FLX E;  2K1B A;  5IT9 L;  3S16 B;  1PFM A;  1TU2 B;  3S15 B;  1JE4 A;  1ZYR C;  5CR3 A;  4KK7 A;  2W6J A;  1KNA A;  3OMG A;  3NPP A;  1TKW B;  1KLG D;  1E43 A;  4XLH A;  3GO5 A;  1EQV A;  1II3 A;  3MEH A;  1M8A A;  1IL8 A;  1O78 A;  1S4Z A;  2CK3 A;  3GV6 A;  3F2U A;  3GP7 A;  5M5W B;  1TWC B;  2IWH A;  2EYH A;  4V19 0;  1GOZ A;  2N88 A;  1LTR D;  1BCP C;  1B3A A;  4XIG S;  5FL7 A;  4FO2 A;  1B4O A;  3FMC A;  5I2X A;  1VF5 C;  3PO3 B;  4QB4 A;  4TRD A;  2ZZE A;  1UNS A;  2WKD A;  5E1F A;  3SR1 A;  1A2T A;  2XIW A;  1KZL A;  2EY1 A;  4K5W A;  1PRT B;  3CP8 A;  2AUK A;  2F0F A;  2ZXH A;  2R92 B;  3JAM L;  5JEA J;  5M3F B;  1ZEQ X;  1RKN A;  2EYP A;  3FKI B;  4BA2 I;  3RUZ A;  3MVV A;  3CRL C;  3G05 A;  1I4Q A;  4QUF A;  1IW7 D;  1WTV A;  4BY1 B;  3TSS A;  2BDO A;  5HUR A;  2NVT B;  2NYZ D;  4KMU C;  4P22 A;  1S5B D;  5IT9 E;  1S5E D;  1BO0 A;  1FX0 A;  4GQN A;  2ICI A;  5DM7 3;  1G2T A;  4DK1 A;  1WTH D;  1SNC A;  1Y8N B;  2EYO A;  1K8M A;  1A15 A;  2QEJ C;  4DAV A;  4BBS B;  2AUJ D;  1OHH A;  1TQO A;  2FJ2 A;  4ZKB B;  4CJ1 B;  1ENC A;  4K6D A;  3SK5 A;  1KNE A;  2EYF A;  4C3J B;  1OXT A;  3A54 A;  3PUW A;  4HMJ A;  4TKO B;  2NTS A;  4JBW A;  4FXD A;  2J7Z A;  3ZIA A;  4G7O C;  2RDH A;  2IW3 A;  3A8I E;  5CV8 A;  1CA6 A;  2K28 A;  1LAC A;  1GHK A;  1HFG A;  2B2T C;  3R93 A;  2CW0 D;  1OXS C;  3KLS A;  1IYV A;  3URY A;  1E1Q A;  1J8I A;  1RCV D;  2XZL A;  2A6H D;  5ELE A;  3I4N B;  2A6H C;  2O4X A;  1V8Q A;  4XNF A;  5EKL A;  4B3F X;  2MGS A;  5CC4 A;  4C56 C;  4JK1 C;  1B9N A;  1LTI D;  2XZP A;  2RSN A;  2QIL A;  2DY8 A;  1UD3 A;  3BYT B;  3T51 B;  1DCZ A;  1EY6 A;  3RZO B;  4IUT A;  1BXT A;  1PYW D;  2BOS A;  3NSW A;  2ZXI A;  3I3C A;  2VNU D;  1LT3 D;  3NQT A;  5C4Z A;  3GTQ B;  1QNU A;  1PFN A;  1XTC D;  3JU4 A;  2IX0 A;  3W2D A;  1VCI A;  4H0L C;  3NBH A;  4J6H A;  4L63 B;  5C0X J;  3MC0 B;  1FNV A;  4PMW A;  3S1M B;  1MSH A;  1EEI D;  5BN5 A;  1H9J A;  3H0G B;  5FLX L;  3U9S A;  2B8G A;  4DGZ A;  3HOU B;  1D1I A;  5M5X B;  3I91 A;  3NTH A;  3I70 A;  4HSV A;  4KTA A;  1R9T B;  2KEC A;  1C4Q A;  2IL8 A;  4RAU C;  2JEA I;  3S1R B;  4LMQ D;  2B2W C;  2JJ1 A;  2KVO A;  4XLE A;  5K36 H;  4X3K A;  4IZ8 A;  2K04 A;  3BC9 A;  1O7Y A;  2BE5 D;  2K6A A;  2JYO A;  2X6W A;  3QWN A;  1QOH A;  2EE1 A;  5E3F A;  3SK6 A;  2HCC A;  2EYM A;  2AQ1 B;  1A2U A;  1I4R A;  2XSC A;  1EU4 A;  2R93 B;  2F0J A;  3PUY A;  4I65 A;  4H13 C;  2JA7 B;  4HIZ A;  4AVZ A;  1BOS A;  2VXW A;  4BY7 B;  3ERO A;  2MP1 A;  3ZPN A;  2WP8 J;  5KNB A;  4ZUJ A;  5C5M A;  1YNN C;  3HRZ C;  1SBB B;  1E0B A;  1EU3 A;  1OXX K;  1SAP A;  2H4O A;  2X6G A;  3VR2 A;  2LY7 A;  2VB3 X;  2FMC A;  3FEW X;  3DM1 A;  1IKM A;  4IUN A;  4O42 A;  2IPK D;  1HRJ A;  3D4W A;  3GV3 A;  2VB2 X;  1FGB D;  1GUW A;  1ZXT A;  1EWH A;  1JOR A;  2B2T A;  3J7A F;  1ESR A;  4CBV A;  1A3T A;  4XYO A;  4RA8 A;  1BLI A;  1JCK B;  1DOK A;  2BE5 C;  1F9Q A;  1TT2 A;  2SEB D;  2HDM A;  4RWS C;  1Y69 U;  3WOF A;  1X32 A;  1JWS D;  3NBI A;  1DD2 A;  1KDC A;  3P7J A;  3J80 E;  3KEW A;  1CK1 A;  4J1M A;  2DNC A;  4BWG B;  4OHJ A;  2L1B A;  4K8I A;  1EFI D;  2V4D A;  5ELC A;  1X3P A;  1SYF A;  4BA1 I;  1WCM B;  2EPB A;  2RSO A;  3PO2 B;  1HZE A;  5EKI A;  3KLR A;  1F9S A;  1SDF A;  3X3N A;  3C46 A;  1W0K A;  2F0G A;  4Q5V A;  3K5L A;  2MJ8 A;  2ZZG A;  5CV5 A;  3K5N A;  1UEA B;  2B2U C;  4F8M A;  3HS0 C;  1TR5 A;  2D3L A;  2NBF A;  1RDP D;  1GUS A;  1SND A;  1SYE A;  3ND8 A;  3OWF A;  5I6W A;  2QE7 A;  4DXG A;  2B2U A;  1Q3L A;  4Z9C B;  4KV6 A;  1ESF A;  3EJI A;  1EIG A;  5C6A A;  2OEO A;  2FMM A;  1ILP A;  1Q1B A;  1UD6 A;  3OIQ A;  4YIJ A;  2GK7 A;  3A3B A;  2D3N A;  2M00 A;  2C5C A;  2NWG A;  2QDB A;  2A69 C;  2KED A;  1V0E A;  4H44 C;  3WDN A;  3EVQ A;  5EPL A;  1LAB A;  1YNJ D;  4XM3 A;  4NW2 A;  1DM0 B;  1FR3 A;  1TII D;  4HN7 A;  4EVO A;  2KCC A;  4XT3 B;  5COY A;  4G7Z C;  3K6O A;  5KGU A;  2ZXO A;  1STY A;  5CBE E;  5EPK A;  1U4R A;  4ZUI A;  3C3L A;  1TWG B;  2ZT9 C;  5D3D A;  3T56 B;  4XQQ A;  2JA8 B;  2EJF C;  1PTO D;  4C1N I;  3GTM B;  2KQ3 A;  1CQF A;  1HPC A;  2BA1 A;  1FYC A;  3RMH A;  4V0B A;  1WTP A;  1SMY D;  5DAU A;  4BBR B;  2F0E A;  2L0C A;  2LS0 1;  4HR7 B;  4RCN A;  4K2L A;  4HAE A;  1I3Q B;  3HP3 A;  3R2I A;  1PDQ A;  2LMC B;  2SOB A;  1SJH D;  2NVQ B;  3VYS A;  4DU9 A;  4A3B B;  2KHS A;  4ULL A;  2N55 A;  3FPP A;  4RH6 A;  3V2T A;  1D5M C;  3MXU A;  2R6G A;  2JSO A;  3A8K E;  2F4I A;  1G6Z A;  4A3M B;  2B2Y A;  3H09 A;  3A56 A;  5KYI A;  3FVQ A;  2F0V A;  3D31 A;  3A8J E;  2GK6 A;  3L7Z C;  2GJP A;  5HKK A;  2B39 A;  1VMP A;  3EQL C;  4XXE A;  2PMZ B;  1SYD A;  1TS4 A;  3BZD B;  5G3L D;  4H7B A;  1I4G A;  4I7Z C;  4OO1 G;  2F43 A;  4KY5 A;  2LZJ A;  1PZK D;  5KIX A;  1D5X C;  5CDF A;  3J7A V;  3OE7 A;  2A74 C;  2B8F A;  4IUQ A;  4ZKC B;  1EYC A;  5JEA G;  3J7Y W;  3AMU A;  3BYY B;  5FO9 B;  1WTR A;  2PNR C;  2WV6 D;  3Q22 A;  1SE4 A;  2JA6 B;  1AP0 A;  2F0P A;  4XOP A;  1EY8 A;  2SDF A;  3M4Y A;  1GXD C;  3KK7 A;  3RD4 A;  3GVL A;  1H8H A;  4C3H G;  1SYG A;  2XZO A;  2DY7 A;  1FNU A;  1OB0 A;  2R61 A;  3VR4 A;  3PIO 3;  4Z1M A;  2KCN A;  1HHV A;  1IKL A;  2D9U A;  2L55 A;  4LAA A;  2Q8R E;  1SKY B;  1S5F D;  3Q6S A;  1SNP A;  2F0W A;  1CI3 M;  1A3V A;  2AWN A;  5C4X B;  1QCB D;  1EEF D;  3K58 A;  5AFW A;  4L6T B;  4IFD J;  3P75 A;  1BMF A;  4Q0F A;  3BVZ A;  3R2T A;  4B9W A;  1QIL A;  4M1U B;  2A73 B;  3DXJ C;  2RDF A;  5KNC A;  3CU7 A;  3D6C A;  5KND A;  5C3W A;  1Y8P B;  3PUV A;  2IX3 A;  3NWS A;  2F0N A;  1GUG A;  1UD8 A;  2FHT A;  2KOL A;  5IGF A;  1JC7 A;  3OAA A;  2EYL A;  1O80 A;  1STH A;  1BBX C;  1TWF B;  5EKK A;  2M9V A;  4TSS A;  4KJN A;  1R4P B;  4S3S A;  4YXW A;  1V1P A;  4IN3 A;  3IAY A;  2F0M A;  4WRD A;  2B2V A;  4G6I A;  3S2H B;  4YEL A;  2A68 C;  1SFO B;  1Y8O B;  1JIC A;  3RZD B;  1EWC A;  1NR2 A;  2JP1 A;  4DK0 A;  2MHV A;  2KVM A;  4DNT B;  5COR A;  4NNJ A;  3Q0A A;  2I07 B;  5DNF A;  4F87 A;  2EDG A;  3FDT A;  4DA2 A;  2NZ1 D;  1ET6 A;  4DFA A;  2RVL A;  4XQN A;  4C3H B;  5JAV A;  2JA5 B;  4XN3 A;  2SNM A;  2E2H B;  2Y0S B;  1AEX A;  1EYD A;  5TSS A;  2IT1 A;  3S9W A;  2L4N A;  1CHQ D;  4MIU A;  4RHS A;  1EY9 A;  2FFK B;  1B44 D;  5CBA E;  3E6Z X;  1QG7 A;  4A3F B;  5JJZ A;  1VDZ A;  1NCV A;  3FKS A;  2A69 D;  2F0O A;  4M8A A;  3SK4 A;  4ZYS A;  3IFD A;  3N52 A;  1I4P A;  1CHP D;  1ROD A;  1SNM A;  5EGT A;  5FK9 C;  1TY2 A;  5T1G A;  1LLR D;  3PV0 A;  1PTO F;  3VR6 A;  3D6W A;  5IGE A;  1V0F A;  3E0J A;  1I6H B;  1ET9 A;  2R3Z A;  1PRT F;  4IAL A;  1A6X A;  4A3K B;  1GUN A;  4WOR A;  3CHB D;  4II2 A;  4NDX A;  2X69 A;  1WVL A;  1ENA A;  3ITP A;  3BH4 A;  4QCL A;  5KEE A;  4UAI A;  1RJT A;  4XT1 B;  4Y7N B;  3VYR A;  4OO1 H;  2IX1 A;  2HLD A;  1BCP F;  2WZP P;  4IUU A;  2E2J B;  5BN3 A;  4XKV A;  1B50 A;  1LT5 D;  4QMG A;  3JAM E;  3J81 E;  2JXM B;  1COW A;  2E74 C;  4EQO A;  5LL6 S;  2F0K A;  2F0H A;  3S1N B;  4RFB A;  4HMI A;  1Z47 A;  3M7N A;  3MAQ A;  2HQE A;  1QWY A;  1V1O A;  1GUO A;  5BN4 A;  4XL9 A;  4G7X A;  2AWO A;  2X53 S;  2EJG C;  1O7L A;  4KD3 A;  2DIE A;  4KI0 A;  1EZ8 A;  4XR6 A;  1J9O A;  2NB0 A;  4FXU A;  3DEP A;  3U9O A;  3I72 A;  1BNZ A;  2HDL A;  5I2Y A;  1UD5 A;  2XND A;  1F77 A;  1STG A;  2HCI A;  2RDG A;  1WD1 A;  4X3T A;  1JWM D;  2ZTN A;  3OOC A;  3T53 B;  1IHZ A;  1Z7T A;  1DON A;  2R9V A;  3I4L A;  1JQY D;  2ZTG A;  4CJ0 B;  1A3U A;  1ENF A;  1WTQ A;  1LO5 D;  5CMD A;  1XXG A;  4ASU A;  2XN9 C;  4J8Q A;  2KA7 A;  1HTP A;  3I4M B;  4TQU S;  2EJM A;  2NUC A;  1W6K A;  1H9K A;  5ELB A;  2NN6 G;  3MZ5 A;  5HGT A;  1I6V C;  1JOK A;  3VA7 A;  5IGD A;  3GVK A;  1TVX A;  4HCS A;  4G57 A;  3BCF A;  5IOD A;  2EY5 A;  2WKC A;  2ZXP A;  2SNS A;  2X6Y A;  3SHL A;  3HOV B;  3I8Z A;  2TMP A;  3D8G A;  3S14 B;  2NTT A;  4X3S A;  4CKC A;  1LTG D;  3D4R A;  4C1N K;  3IL8 A;  3NTI A;  2A5H A;  5D65 A;  3OSO A;  1I4X A;  1NRK A;  2NN6 I;  4LK1 C;  1JOQ A;  5G3L F;  1E3X A;  3M4O B;  1SNQ A;  1U4L A;  4KKU A;  3HOY B;  1LTB D;  3HGB A;  3P20 A;  1EOT A;  5JEA H;  2HUG A;  5C0X I;  1PTO B;  2RA4 A;  1GUT A;  5I9O A;  2CQA A;  1Y1W B;  3AB9 A;  1D1K A;  4FXK C;  1U4P A;  4FVM A;  1NUC A;  4K2K A;  4XKW A;  4U68 A;  4HTH A;  1EYA A;  1PTO H;  4FXG C;  3HOX B;  4DXF A;  4XQF A;  2WJV A;  3TP5 A;  1PLF A;  2F0T A;  3SE0 A;  2D5D A;  2R7Z B;  2WAQ B;  1E2V A;  2VJJ A;  4CJ2 C;  1U4M A;  4XOT A;  1STA A;  1EY0 A;  4R8I A;  4TSF A;  1DYQ A;  3TP7 A;  4CKE A;  3NXW A;  5JPM C;  1AZQ A;  5I9P A;  1RTO A;  1KTK A;  1L0X B;  1Q1E A;  3K7A B;  2X85 A;  2K32 A;  4WJW A;  1VMC A;  1SEB D;  3DUZ A;  5JVG 3;  4K14 A;  2VJI A;  3VYU A;  2ENB A;  1HXY D;  2VUM B;  1B1Z A;  3GTG B;  1PZJ D;  4LJZ C;  2J4X A;  2I46 A;  5IK2 A;  4KKT A;  4DNR B;  4HED A;  1FNW A;  4ID6 A;  3K59 A;  1SXT A;  3OHX C;  3T16 A;  1G2S A;  2YYZ A;  3NE5 B;  3OEE A;  2M2L A;  1CQV A;  3TN2 A;  4U67 3;  3N6R A;  2F0L A;  1T5X D;  1Q90 A;  4XD7 A;  3PUX A;  4KN7 C;  1STE A;  1R4Q B;  1BCP B;  1ICW A;  1V43 A;  1VF7 A;  1EFR A;  1E1R A;  3CP2 A;  1K83 B;  3M85 A;  5NUC A;  2EY2 A;  2M5S A;  1CT1 D;  5C0X H;  1B2T A;  4FF3 A;  1WTW A;  3GTL B;  4E6I A;  3G7L A;  4FF1 A;  4XLA A;  2F0I A;  2K03 A;  1BQQ T;  3KBG A;  3MTS A;  1H9R A;  1OO9 B;  3A7L A;  2F0S A;  3ZYY X;  2RKS A;  5ELD A;  3OW7 A;  5EPJ A;  2JDI A;  4DN4 M;  4IUR A;  5K36 G;  5I6Y A;  1TY0 A;  2H1E A;  2F1M A;  2BA0 A;  4XYQ A;  4ZK9 B;  2L11 A;  5FKA C;  1STN A;  4A3I B;  4K5X A;  4KY7 A;  1B9M A;  3Q23 A;  2EYJ A;  1T5E A;  3C2P A;  5M5Y B;  4HSP A;  1G8Z D;  1EY7 A;  1K8O A;  1ML0 D;  2XRS D;  3MFY A;  1UUP A;  3GTP B;  1L0Y B;  1PFB A;  3A55 A;  3KF8 A;  5E4X A;  3KUP A;  3DEO A;  1G29 1;  3FPU B;  5J1Z A;  1UAP A;  2MPM A;  4KHV A;  2F0U A;  2KUM A;  4G4K A;  1C48 A;  1H9S B;  3Q24 A;  1EQT A;  2A6E C;  4RGT A;  5EBC A;  2PYK A;  3LX0 A;  4B3G A;  4E0F A;  3TME A;  1YNN D;  2PO4 A;  3TZU A;  3GD7 A;  1NAP A;  3SK8 A;  4OIJ A;  2JIZ A;  4II3 A;  1DXM A;  1PXU A;  3T4A C;  3QOJ A;  4A93 B;  4DAY A;  2EZV A;  2KEE A;  2WJY A;  1UD2 A;  4UZU A;  3H91 A;  3CQZ B;  1BUV T;  4JMQ A;  5CYU A;  4L8J A;  3D3R A;  5CV6 A;  5ELF A;  2O5J C;  4ZRZ A;  2O5I C;  4A3D B;  3MA2 B;  2G9D A;  1F2M A;  1JB3 A;  4EQN A;  3W3A A;  1SE3 A;  4OIK A;  5DEH A;  1E3Z A;  2E2D C;  2EVB A;  4RGN A;  4K8J A;  4XLF A;  3I73 A;  3A35 A;  2PQE A;  3QO2 A;  1KAB A;  1E79 A;  3H3V C;  4A3E B;  1E2W A;  4PNY A;  3RLF A;  1LTT D;  1STB A;  4IFD H;  1QJO A;  3KBX A;  3MFG A;  2KJX A;  2JE6 I;  5CGK A;  1EL0 A;  2Z8L A;  2K01 A;  2Z4H A;  1HUN A;  4MHE A;  2K5D A;  1UD4 A;  2W6I A;  5I4D A;  5F2D A;  1AFP A;  1H8E A;  1LT4 D;  5ISR A;  3SVM A;  2NVX B;  2XOK A;  2WAC A;  3DDY A;  3ERQ A;  3BDL A;  1ONL A;  1SYB A;  3S17 B;  1HA5 A;  1SNO A;  3E5S A;  3M7G A;  3J81 L;  4F88 A;  1HA6 A;  4C3I B;  2XRQ D;  4XN0 A;  2ID0 A;  3PUZ A;  3UI2 A;  2OF1 A;  4MN3 A;  2F0D A;  2BCO A;  4ZQ3 A;  3BS1 A;  3QJY A;  3GQB A;  1DZ1 A;  3DWA A;  5A35 A;  3DWP A;  3H6M A;  4EQP A;  1HVX A;  1SMY C;  1MGS A;  2EXZ A;  2XWB B;  4KJO A;  3OPO A;  3DHQ A;  4IFD G;  1H9M A;  2QKI C;  4RGM A;  5J22 A;  4C3I G;  4RKL A;  4OGQ C;  3WQZ A;  3HOZ B;  5D14 A;  2RQX A;  3CES A;  3H94 A;  2A68 D;  3BCD A;  3FRP B;  4B9X A;  4IUV A;  3PMF A;  2K05 A;  2DNE A;  3D4D A;  2L12 A;  3AU7 A;  3NUC A;  2TSS A;  3K0Y A;  3HAG A;  1OXU A;  3L9A X;  2A6E D;  4C3J G;  4ZAI A;  3TP8 A;  4N9P A;  1SSO A;  2IJ0 A;  2MUY A;  1PZI D;  2CVR A;  3NQI A;  4NMZ A;  1CZG A;  1M4V A;  1B53 A;  1BDO A;  3J80 L;  1DOM A;  5KNL A;  4XDX A;  4ZLT F;  5EBD A;  3S1Q B;  2OT2 A;  1VJS A;  4FYD A;  4PQX A;  2V31 A;  4NP5 A;  2D2C C;  3CMM A;  1X3Q A;  1IYU A;  2F3W A;  2PZU A;  4XMY A;  4XLC A;  1NSN S;  1JR0 D;  1U9R A;  1F9R A;  2EY6 A;  3BVM A;  1E2Z A;  4IUP A;  3QG1 A;  4ABN A;  1BPL A;  1EIH A;  4R8N A;  4CGY B;  2GJR A;  4PMB A;  4G7H C;  1MI2 A;  3GVJ A;  3S2D B;  3IKJ A;  2NN6 H;  2F3V A;  4A3G B;  3BVG A;  1CFM A;  5IGC A;  1VLY A;  5E4W C;  5EQ0 A;  4C2M B;  1Q12 A;  1EY5 A;  1YNJ C;  1XYI A;  3MWY W;  4CHT B;  1MSG A;  5LHY 1;  1JOO A;  1HTL D;  1F9P A;  1Z6H A;  1KAA A;  2Z1C A;  2E2I B;  2F03 A;  5C3E B;  4CKB A;  2Q8T A;  1RTN A;  2F0Q A;  3ND9 A;  2E75 C;  1V1P B;  3C1E A;  2JEB I;  3DWQ A;  1PRT C;  5JPN C;  5LL6 X;  5C44 B;  2NVY B;  1S5C D;  2LKV A;  2D62 A;  1C8C A;  3HKZ B;  1PKV A;  1CZW A;  2WSS A;  3OWE B;  3EFX D;  4IQZ A;  3R8B A;  2XGJ A;  4AYB B;  1D6E C;  1XX8 A;  1HQM C;  1CTM A;  3WOE A;  5C0X G;  2B2Y C;  1Y1V B;  3GTK B;  4QF4 A;  3VR3 A;  1ILQ A;  2K33 A;  2XVS A;  4X3U A;  4XQJ A;  3IFT A;  4FF4 A;  5CV4 A;  5C5L A;  3BDC A;  4BS9 A;  3K5M A;  3HG9 A;  2PZW A;  3GTJ B;  2EOT A;  5JVH 3;  2PZT A;  1RHP A;  4XOR A;  4R9W A;  3HEJ A;  1BF4 A;  3I90 A;  1AN8 A;  1AZP A;  2E1B A;  3LWU A;  4NKL A;  1EZ6 A;  1WP6 A;  2ZZF A;  4YEJ A;  2GJK A;  1PRT D;  1F2L A;  4KD4 A;  3V05 A;  2FIN B;  2PW5 A;  1I4H A;  3L3O C;  1BCP D;  3HZX A;  1JWU D;  3SDZ A;  5KRU A;  4O1N A;  4P2C B;  5CV7 A;  1HQR D;  3NHH A;  4PMC A;  1S5D D;  2GA4 B;  1I50 B;  3TP6 A;  3SXH A;  2X6L A;  1ZKO A;  4ODG A;  2PW7 A;  3CRK C;  1HFN A;  5M3M B;  2Z4I A;  1F2Z A;  1BR9 A;  4FF2 A;  1NR4 A;  1GJX A;  3LWE A;  2E76 C;  1F2Y A;  4RGO S;  3EA6 A;  4TT3 A;  1KLU D;  3VYT A;  3VA5 A;  4RKB A;  1MBY A;  2G9H D;  5IIF A;  3SEB A;  4FP5 D;  1CM9 A;  2OXP A;  1TWH B;  4UDU C;  2LFN A;  1I8D A;  3BDO A;  4KY6 A;  4G7W A;  1XWE A;  1G91 A;  3K57 A;  4GZY C;  4XON A;  1KMH A;  5EJW A;  2L9H A;  4DAP A;  4RHR A;  1TS5 A;  1KDB A;  2PCF B;  3V96 A;  2AQ3 B;  1W0J A;  1QNK A;  2XNA C;  2K7V A;  4WFN 3;  1WTX A;  1I18 A;  2J0T D;  2BDN A;  5K5P A;  3QIA A;  1D5Z C;  1D2B A;  1O7Z A;  4OL7 A;  1CA5 A;  2ZXR A;  2ZZQ A;  5KYL A;  1K28 D;  3OMC A;  5DN6 A;  3NWT A;  5D3I B;  4IFD I;  4EGV A;  3DMU A;  2Z6B D;  2ICE C;  2Q8I B;  3MXN A;  5FO8 B;  2WIN B;  5J39 A;  2RBM A;  4A3J B;  2XWJ B;  5DM6 3;  3QOL A;  1H9S A;  2B63 B;  1QE6 A;  2CW0 C;  1Q8I A;  3K5O A;  4ME5 A;  1SJE D;  1GHJ A;  1SYC A;  1HUM A;  5FOB B;  3ONA B;  4KKS A;  5M9O A;  1RF2 D;  3MXG A;  3M3Y B;  4K5V A;  3NP8 A;  4QIW B;  4KN4 C;  2DN8 A;  2QCP X;  5CV9 A;  3A3G A;  1NBM A;  1TS3 A;  2PPB C;  2B2W A;  2C9O A;  2CHB D;  3TZD A;  3O13 A;  3R3O A;  1LTA D;  2QF7 A;  1OXV A;  4KHZ A;  1WD0 A;  3T13 A;  4B08 A;  1MD2 D;  3C1F A;  3X3M A;  1W6J A;  1AW7 A;  5C4J B;  3P1H A;  2K5Q A;  1LT6 D;  1EY4 A;  2X8K A;  3TDQ A;  3MHB A;  3A7A B;  3OEH A;  5FO7 B;  5IGB A;  2YU9 B;  2AQ2 B;  3G6J B;  4QUC A;  1KDA A;  4K6L A;  3GTO B;  3KLS X;  5C3X A;  1HCZ A;  3LNN A;  3QB3 A;  3VR5 A;  4DF7 A;  2V7Q A;  5C4H A;  3BG3 A;  1LV9 A;  1TS2 A;  5JOB A;  1FD7 D;  1QB5 D;  2L5T A;  1PMR A;  3MXP A;  4ILW A;  1DJR D;  2B2V C;  3OFN A;  2WB1 B;  3CKI B;  3PIP 3;  4N9T A;  3NK9 A;  3NTK A;  1WTO A;  1ZYR D;  4XTC S;  3HOW B;  2K5W A;  1IW7 C;  4FNF A;  1RD9 D;  1SE2 A;  5A2Q L;  3OIP A;  4RCO A;  3TBI B;  5A2Q E;  1LTS D;  1WPC A;  4PV1 C;  5IGG A;  2WPD A;  1TWA B;  5IOC A;  5T1I A;  4HCE A;  2WII B;  2X6X A;  2O2L D;  1DOL A;  4F7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...