2B7BA

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a and gdp
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
b'GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1-alpha
publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 115
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7bA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7bA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b7bA01
2DEUA 5FBLB 3RC8A 4CIDA 1R7RA 2YHSA 4I99A 3AGQA 1JECA 4DJTA 1W47A 3KUCA 3J81k 2FDCA 1ZIPA 4DDVA 4N0EA 1XTKA 1Z6YA 4G5GA 3KTAB 5BN3A 4NHOA 2ZRIA 5EMNA 1AKEA 2DETA 4LHVA 1TUIA 2B7CA 2F3TA 3EZ9A 3JZMA 4MRNA 3LO5A 1HH4A 2GEDA 3TKLA 3DZDA 2P3SA 2JIZA 3CCRB 1TTTA 4IVQA 3A1WA 4JBWA 4HE5A 1K8AD 1E94E 3MG9A 2AK3A 1J99A 2DFTA 1OGJA 3KUDA 5EUMA 4CDGA 4W7SA 1GFIA 1OXVA 1E6CA 4HUQB 2JGNA 4LWZA 3K0FA 3C14C 1XMSA 3I8XA 4QBHA 4XH9B 3CR8A 4PGOA 3NBYC 3OJWA 2OLJA 4PTLA 3ZD7A 1DAHA 2HT6A 1B0UA 1Z2AA 3F0TA 4GL2A 2EU8A 1XX6A 4LRWA 3M4YA 3KQNA 4CEIA 3O8BA 2X2FA 1QG4A 3FHOA 2VSOA 3KX2A 1NJID 3LLMA 1SHZA 2Z5FA 3QXCA 1K6MA 1TMKA 1YR8A 1ZM9A 2IK8A 2CEAA 1MABA 2X8AA 4OI1A 3G0HA 2ZETA 2J9RA 4JLJA 4QFMA 1MKYA 1IOZA 4DCUA 1XEWY 2ZUCA 4TYNA 2V4ZA 1S8FA 1LFDB 4B4DA 3CRW1 1QF9A 2VF8A 1QG2A 2ZYUX 3TVTA 3E20A 5KSPA 2ECKA 3BB1A 2AXNA 2ZS8A 3R20A 1KMHB 1OB2A 4M1WA 5FPHA 1U0JA 3SNHA 3R8FA 2XSZD 1KSFX 2ZJOA 3R7WB 2WSSA 3DZ8A 3W2EA 2VSFA 1Q86D 2A5DA 4LHYA 2P5SA 1VYTA 2PBRA 4UJ3A 5CJPA 4QJ4A 2QTHA 2VH5R 5AUQA 2AHOA 4TMVA 5FUXA 4DLVA 2FZ4A 1VG8A 1VKJA 3KB2A 1OH7A 5CLQA 1CP2A 1EX6A 2OM2A 3PITA 3Q85A 1QZXA 1MH1A 1AK2A 2EYQA 2UZ3A 3A1VA 1BOFA 3KB1A 1E2IA 2W6ID 5CM9C 3U7FB 2QGNA 3K9GA 1JR3E 1VYVA 4BUJA 1W36B 3I4LA 4OHZA 1KI7A 4DKXA 3UANA 3RDPA 1KI9A 1NDHA 4A0HA 4U7DA 4DEYA 2W0MA 4WZAE 3SDZA 1PUJA 1IB0A 2OE2A 4TMXA 1CJMA 2Z6VA 4AKEA 5E7MA 2GA8A 4BZQA 2OK8A 1YE8A 4DQKA 4GPTA 1TNDA 3QKRB 2ZR7A 1CR4A 3ZBTA 3OFNA 3P32A 4B76A 4CRWB 3ADDA 4XWAA 4C2UA 2J0UB 4YMTA 2IYZA 4PR0A 3PJRA 3SHFA 1W35A 3IIJA 5FPKA 3FVQA 4MQBA 1AZSC 3TH5A 1FMJA 1VCIA 3X1WA 3A1TA 1JA0A 1M1KD 1TU3A 2LKCA 3CRRA 5EXPA 1QGYA 2ZAMA 4G5OA 4C43A 1GZSA 4IDPA 4RKFA 3VKHA 1D6JA 4HEJA 2QSZA 1RYFA 4Q18A 2V6JA 2IUTA 3U4QB 1NG1A 1FRNA 1E9EA 2J45A 3VAAA 3G82C 1WCV1 3LWNA 1KI6B 3K9NA 1BJKA 4B6FA 1QHGA 2FV8A 3ZVLA 2YWHA 1COWA 1IXZA 1IXSB 1ELOA 4B35A 3I62A 3U61B 3T06B 3VX3A 3NTUA 4CEJA 4YALA 5BW8A 2GKSA 4A1FA 5TDHA 3UKDA 3CC7B 2ANCA 1CS4C 1KGDA 2C95A 2F9LA 1NMYA 1U9IC 2OFWA 2GJ9A 3VTKA 3LLUA 3B9PA 1YR6A 3V4FA 1NMXA 4PC3A 2DWOA 2HMAA 3CNLA 3F5FA 1OV4A 4NL4H 4G1VA 4ESVA 2UKDA 1RRGA 4BLOA 2VP4A 1QHHA 3PV0A 3O8DA 2W2TA 2NGRA 4XVUA 2F1HA 2Z43A 1DDGA 2JA1A 1XF9A 2J87A 3BB4A 1Q57A 5L3QB 5G41A 4N1AA 4D26A 2GVZC 4I81A 2AFHE 4TZ6A 1E63A 2J5XA 3VNVA 3SU8A 1WBBA 1YQTA 2B6HA 5D3MB 2FWRA 3CXCB 3KTAA 3CMEB 5BN5A 3ZVMA 3QNUA 4NYIR 1XU4A 3BD9A 3AVUA 5FUWA 1XP8A 3KKMA 1YKSA 2HLDA 4FWTA 4RZXA 3R9IA 2J46A 1P61B 5TV2A 3IIKA 4U00A 2YWFA 3B85A 4MRSA 1P4SA 4JJKA 2YINC 1GKYA 4BFYA 1E69A 2PX3A 1N6OA 4Q48A 4TWZA 5KDLA 5FOUA 4QNMA 1W0JD 3ZZTA 1H8ED 1P9WA 1VQKB 3I32A 1EX7A 4HATA 4HUQA 5KNDA 2B8WA 2O8CA 5HR5A 4DUGD 3N70A 4QJ5A 3OIYA 4JT4A 2P65A 2H16A 3LAWA 1YJ5A 2W6JA 1SM4A 2A5YB 2Q3MA 1G4UR 2V7QD 2WWFA 4IVRA 1I2MA 3BORA 3QQ5A 4ESHA 3I5YA 4JYBA 2CRVA 2IWRA 1T91A 1NN1A 3KJIA 5DN6A 3TUZC 4TLEA 2N42A 3PXGA 2NQ2C 1XRJA 2BMDA 4B3XA 1N5IA 3ZIAA 3PENA 2V8OA 1W46A 4JLDA 5SZJA 4HDQB 1GILA 1K73D 1GNRA 2R65A 1RRCA 3QBVA 2IS2A 1IQPA 1ZRHA 2Q0HA 2QI9C 1G5TA 1TQ4A 3L82B 2O8DB 1MO3A 1PLLA 4XJXA 3THOA 5F9FA 4OBEA 2O8BB 4M2LA 2IT1A 5FTLA 4PQYA 5JS7A 1XEXB 4Q01A 4YXWD 3CRVA 3KQLA 3CCVB 3BFKA 1YJ9B 1T4GA 4X8OA 4D82A 4DSTA 3Q8XB 5FA6A 2VHUA 3R9WA 3THYA 1T3SA 2CBZA 2NZJA 4U9UA 5JJLA 2ERXA 3A4MA 3H1TA 3K53A 2VNJA 3R7WA 4DWJA 5CK4A 2A30A 1JR3A 1KO1A 3GCGA 3WY9A 1TUEA 3CR7A 1FQKA 1U8YA 2GCPA 1AS0A 2W2XA 5E7JA 3RWOA 2IUSA 2ODNA 3DOEA 4ZIRA 3C41J 1ZBDA 2GF0A 1E1RA 3K0AB 1H8HA 1RFLA 1KSJA 4KLZA 3RNLA 2WJHA 5FBQB 1HEIA 1VQ9B 3AV0B 3X1ZA 1Q1ZA 2RGGA 4HLUA 2DFKB 3O47A 4I1SA 2P67A 1RRFA 3ES9A 1PUIA 4FCTA 2GJ8A 3PCRB 2BPOA 4IW3B 1HY3A 5DH9A 3KQUA 1GL6A 5JRJA 1QVRA 2GILA 4M4SA 1FL9A 2ZRHA 1E0JA 4X8HA 1EWYA 4F92B 3SYKA 1Z28A 3DKVA 1U8AA 2I1VB 1FP7A 3GEHA 1LS1A 4OQFA 3OAAA 3W2IA 4G3XA 2A7QA 4HAUA 4N3NA 2BN4A 4LUCA 3ZGXA 5DLQC 8OHMA 5EP3A 2GXQA 3H84A 4KFUA 2QGZA 2ZJAA 1ANKA 1JQLB 3OIWA 4Z8XA 1G7SA 2J0UA 3QF4B 4IOLA 3RRZA 3W8NA 2GNOA 5K8IA 2IXFA 5BQ5A 3CBQA 1MV5A 2WM9B 4HSEA 5AJWA 1II8A 1NIPA 1Q82D 1T8TA 4M53A 1A7JA 1VPLA 2KWIA 1CKEA 4ZDWA 4GBMA 3TK1A 3WRYC 3L8ZA 5AK0A 3VO1A 1W4CA 1YU9A 2EFCB 2GF9A 2ZI9A 3C8UA 1S3GA 1IN8A 2JDID 2QP3A 3L2OB 2H5EA 4D0NA 1FDRA 4FMCF 3TUIC 2GETA 4EIWA 3WBJA 1NBMD 5GJCA 2YJTD 2X3UA 4F7WA 1CJVC 4X8MA 3U4QA 4MH0R 1IM2A 1AZTA 1CR1A 4B75A 1FRQA 1MOZA 1KI6A 1E64A 5F3WB 2IHBA 1E3MA 2RGNA 3W90A 3NDBB 1DAKA 5H8WA 4QHYA 2VZLA 5DO9A 4MGIR 2FEOA 2J0VA 4NMMA 3NH6A 2ONKA 3TW4A 5FUVA 2QU8A 4M1SA 4JL5A 1IXRC 2VRWA 5KNCA 4CZ2A 4D4LA 2WWGA 2CNWA 3GJXC 2OTJB 5LBIA 1PLJA 2X1VA 2IYWA 5KPDA 1LS6A 4KITB 4EJSC 2PJZA 4DLRA 4IDOA 2ZYTX 4TLAA 1ZVQA 3RAPR 1OJLA 2FG5A 1JJVA 5L3VA 4TL9A 2R44A 4P32A 4Y0AA 5UKDA 3RS5A 2XZLA 1F20A 2F43A 1U0LA 1NIJA 1A8PA 2XTZA 1SVMA 4NCIA 1E4YA 2XZPA 1XPRA 2YWEA 2OCAA 3WYFA 1CLUA 1DVRA 4IOJA 4F4IA 5L3QA 1J7KA 4KV9A 3BXZA 1HQCA 3QG5A 5G3ZA 4YMSA 3PEWA 1Q12A 2W2VA 2BV3A 3AEZA 1NKSA 4O0MA 5FBWB 1FW6A 1BMFA 2QNRA 4F4CA 5FTJA 2WHXA 4Q19A 1VQOB 5HE8A 1BIFA 4FW9A 5GJWC 1OFHA 1XMJA 3HDTA 3FMIA 1VQ5B 3UG7A 3L0OA 4M21A 3P1JA 3QFCA 4A36A 1XCGB 3DL0A 4IFEA 1BH2A 1YR7A 3IGFA 3TUJC 4C0AC 4XD7A 5IRCD 3Q7PA 4O2RA 2ZSFA 4OI0A 4QBGB 4RSGA 5H5JA 2QMHA 2O5VA 1IHUA 1M7BA 2G83A 2LWIA 3LW7A 3W5UA 5HKKA 1KOFA 4GDFA 1ZUHA 2IYYA 5KTYA 3HU2A 1G291 3CO5A 3SBDA 2J0QA 2IUUA 1XTSA 3CW2A 2ORIA 1KHTA 1QFYA 5FOWA 1DAEA 2CLCX 4AURA 1Z2CA 1NMZA 3ZVRA 1K5DA 5J4YA 5JZVA 2AR7A 4TT3A 4KYUA 4UNNA 5EXXA 3GLHA 1NLYA 1NLZA 2RB4A 3WHKA 1SVLA 2BJWA 2G0TA 2JEOA 1VQPB 4H9GA 5HZHA 1WQ1R 1JXMA 3ETLA 2JCSA 2TMKA 3GD7A 4BZPA 3P27A 2PEYA 4LJAA 1L7VC 1LB1B 4TQ9A 4BE7B 2O8DA 1OH5A 1X6VA 2O8BA 3B82A 3FHCB 1XEXA 3OEHD 1DS6A 3IBYA 4QNRA 4CEHB 1E9CA 3FKSD 4QXAA 4F91B 5C4MA 3B78A 1XD2B 1IY1A 1MO5A 2NO0A 4D4JA 1YHNA 2WPDA 3L0SA 3N2IA 2CHQA 3NBXX 2PZFA 2ZRAA 3AVQA 3PUXA 3DMNA 1FNCA 3W2HA 3JVUA 3NKVA 4Q4AB 4RJLA 4B48A 2GBLC 1Z07A 3W2FA 1L8QA 1QHNA 1P9RA 1R4AA 2A3RA 3CF2A 2WAXA 3T1VA 3U7GA 2ZU6A 2BBOA 1ZJ6A 1F2UB 3K0AA 2ZVPX 4HB0A 1UM8A 3BFXA 3WMGA 4FMBB 2GCNA 3WHLA 1GAQA 2K5UA 621PA 1H42A 1OHHA 5CIWA 4MDFA 1JPNA 1GRRA 1UAAA 4AYTA 2IYQA 4B6EA 4UNQA 4OK6A 4P3YA 1XE1A 1KNXA 3DO6A 4TMWA 2ATVA 4U02A 4OQNA 1TADA 1R0YA 1I4LD 4UNRA 721PA 4ZKEA 3WNCA 4E07A 2AWOA 1LF5A 1U99A 4GNKA 4L9WA 1W87A 1OB5A 3LXXA 3V9PA 3LA6A 4M9QA 1Z3IX 3WXMA 1FTNA 4ILEA 1JEDA 4Q9KA 1W48A 4QGHA 4M1YA 1EP3B 2D74A 3TJZA 4A92A 2RGXA 3FGNA 2EWWA 3MAAC 5C18A 1AN0A 2PCJA 1MO6A 1TEXA 3AM1A 1GVNB 1TF2A 1Z0DA 2WAYA 4B43A 4TYWA 5A0FA 1II0A 4JZKA 2B21A 2RGCA 2CK3D 1WB9A 4LYAA 4DLUA 3EASA 4HUTA 2ODBA 1YI2B 3NEYA 5DI3B 2ZYVX 1RKBA 2J7PD 1Q1EA 3HYRA 2G1KA 4H1VA 4HLQB 5GVSA 1US8B 1KI8A 2ZE7A 2ZQ5A 1GKUB 4JSTA 2AX4A 1XPUA 3AVYA 3BS4A 2GPJA 4BRUA 4G5RA 4DBLC 1UBGA 1H65A 3JVVA 3FHTA 2BEKA 2OV2A 1S3SA 2DYKA 2WWWA 3EWAA 1IAQA 2VP9A 2CDNA 1M90D 3LO8A 1HV8A 2AXPA 4LSGA 4EDHA 5ELXA 2NMVA 2O8FA 1E79A 2JIZD 2NO6A 4IOMA 5A4JA 4A82A 5EP2A 3ZQJA 1KJYA 1OW3B 2AWNA 2BIFA 3DOFA 3AVVA 2FJUA 3AKYA 3L0PA 3VU9B 5HZKA 4IEEA 1G7CA 3LX5A 1KO5A 3BK7A 4PFSA 1W49A 1SXJA 2WKPA 4IHQA 1CRPA 1SZPA 4LPKA 4CW7A 1G8HA 1HE8B 2GK7A 2QAGC 2F55A 2WIAA 1UBEA 3DPUA 3NC0C 2JLZA 2BCGY 4URVR 3QE2A 5HTKA 4HAWA 2C9OA 3K9HA 1OFIA 3EZ7A 1GKIA 3G5UA 3NWJA 4GMXA 1XDBA 3SYNA 1Q21A 1CIPA 1L2TA 4K1XA 1XD9A 4M9ZA 1HT2E 1TQDA 3DMDA 3U3RA 3PVSA 4Y7CA 2D2EA 5ANRB 1U2RA 3B5JA 3KKOA 2ZUBA 2JAQA 2YOHA 1IN4A 1Z6AA 4BFWA 4CVNA 1EFRA 3EG5A 4AKGA 2V1UA 5GADl 5TY0A 3CC2B 2QEXB 3THWB 3W6OA 5CLLA 4XVQA 3WBKA 4AKHA 2HXSA 2VA8A 5L8VA 4Q02A 2ZE6A 3TRFA 1RIFA 1XMIA 1AJEA 2CHVA 2IF0A 2ZSAA 4BLRA 4OJQA 1TEVA 3U5ZB 3D6TB 4ZDKA 1E2NA 2WSSD 2OO7A 1BYUA 4JKIA 3CNOA 3Q9LA 4D80A 3H2YA 2FN4A 5GJVC 2CXXA 3IPXA 4IJMA 4JL8A 2OBMA 5FH9A 1GDDA 3CC4B 5AN9A 5J4KA 3TR0A 1KTVA 1P9NA 3CPJB 3ECCA 3Q5DA 2C77A 3W2GA 2ZRLA 2PLRA 3BH6A 5LD2C 2IYLD 1UEJA 5F98A 1R8SA 2R6HA 1QVGB 1U9IA 2FF7A 1CNFA 3IIMA 4EJSB 4PXAA 3C5HA 1OE0A 3H86A 4CEHA 1AQUA 4DLTA 1ESMA 4BQSA 4NYIQ 1QDEA 3GLGB 3C16C 1XD2A 1SVSA 2ZEJA 2ZSEA 5FBVB 3G6EB 2GZAA 4H1UA 2AD1A 2O8EB 2WJJA 4XWKA 4YMUA 1VG0B 1QUEA 1N8RD 1TF7A 1OXSC 2CLDX 2QMOA 1XTIA 4LPSA 4MUBA 4NCKA 4Q4AA 4B47A 2ZREA 4DHEA 3OFND 4LZZA 3ZZ0A 3PEYA 2BEJA 1T6NA 1ZU5A 3VR4A 1F2UA 1F2TB 3T15A 3CNNA 4YC7A 1E96A 3BE4A 1JQJC 3CZPA 1PZNA 1P3JA 2XNDD 1T8UA 2ZJ5A 2JJ8A 4GRAA 3GLGE 2EFEB 1Y3AA 1UMKA 2ZJ8A 4TL7A 2FU5C 1MO4A 1M2OB 3LQQA 3VR3A 4L5BA 3EWSA 3SJAA 1G64A 5A5GA 1A2BA 1XJQA 2CHGA 3KJGA 4LBYA 1P75A 1W5TA 1W4RA 2F7SA 3RHFA 5BWMA 4FINA 2WJIA 1GL9B 1ZIOA 3ADBA 5G3YA 4QGAA 1JAHA 1FPMA 1T9HA 2QRNA 1KSGA 3LVQE 2O52A 3BGWA 1VECA 2HCJB 221PA 4KXFB 5C4GB 1G3MA 4MGYR 2GEVA 3TR5A 1VQ4B 1QHXA 1MRSA 4Z1MA 5JI3E 4LDJA 3OIVA 1FFHA 5JWOA 1YZNA 4TMTA 3UWOA 4FIDA 4EPRA 3THXB 3SJCA 1IJEA 1ZM4A 2VBCA 4PZLA 2ANBA 2FFBA 4FMDF 5EE1A 2Z83A 1GSIA 2WZQA 3FDIA 4TTRA 2JLUA 2Y8EA 2V55B 3KXKA 2UVQA 1GL7A 1IN6A 2MMGA 4P6VF 2ORVA 1CQXA 1NRJB 2NTYC 2Q9AA 4A2WA 3TQFA 2GK6A 4YAOA 1OH6A 1AIPA 2FGJA 3QUSA 4YMWA 1GAJA 1W34A 1L4YA 2GZHA 5DI3A 5E95A 3S1AB 4A2QA 4TTPA 5J47A 2D7CA 2OG2A 1EGAA 4DIDA 4B44A 3DVLA 3ZS9A 3TW8B 3AP2A 3MWJA 2H8KA 2CL0X 4V0NA 3AP3A 5KUTA 1US8A 1DADA 4NZYA 5LB4A 3V00A 5IHPA 4WZBE 3BRWD 3PUYA 5BXQC 3GP8A 4ZCIA 1TAGA 4TN1A 3AUXA 4Q4HB 2OCYC 4HAVA 3RWMB 2VTKA 4RD6A 3LNCA 2P6NA 2YVUA 2BBTA 2GTPA 3GJ0A 3MD0A 3Q72A 2DPXA 4LJ9A 2H18A 3WP1B 3VU9A 2B5OA 1E99A 1EESA 1JALA 1Q1BA 4C0SA 1GITA 2PEZA 2WJVA 5AJYA 4C7OB 4WA7A 3AVTA 2QBYB 1G19A 5TVKA 1LW7A 1P73A 1K5GA 2H1LA 2BBSA 3QG1A 3T12A 1ZD1A 3X1YA 4A8JC 4BLQA 3KKNA 1SULA 1ZYUA 3DEFA 1PVOA 5LPNA 3OF5A 3I56B 3MHPA 1ZUNB 2RCNA 3QY0A 2RGBA 3AVOA 1E2JA 5IF9A 3IBGA 4G5SA 4KLNA 4F4JA 2W0SA 2NPIA 5DN6D 1AS3A 2WWIA 1J8YF 2OBLA 5FL7A 1M6NA 3ZIAD 1D2MA 4A4DA 5HPYB 3OEEA 2JLVA 4AI6A 3SOPA 4A2PA 3QPUA 5KNBA 3IDQA 4DIEA 1D9ZA 3QKTA 4OHVA 2ZSBA 1JA1A 2ZRBA 3EC1A 4XWOA 4G0NA 1G5PA 2VO1A 1DAFA 4MITA 2P0EA 2FX3A 3UMFA 2I1QA 5GJBA 1N6LA 1WE2A 2C03A 4BLTA 5CB6A 5JJIA 2HT1A 2CL7X 3CCUB 1TX4B 2ZI3A 3QXJA 3THWA 3K0CC 1VQLB 2R62A 3LV8A 2QT0A 3QF7A 5F2EA 4KU4A 2V3CC 3RANA 1ZM2A 1LY1A 1KI2A 4Q7LA 4EPTA 1YRAA 3QPWA 3WYGA 2ZE5A 4DDWA 3FOZA 1DBSA 1JAIA 2CJWA 3L8YA 1W0KA 1E1RD 1JI0A 3NDPA 3EPHA 2FOLA 1VQ8B 2EFDB 2BMWA 3QSYA 1E4VA 2FFAA 4ARZA 3TNFA 1Z8FA 2BGIA 1JJ2B 5GVRA 1W4BA 3BH0A 2GCOB 4UNSA 3D3QA 4UXIA 2PZEA 4A9AA 4KJZA 3NHBA 1W36D 2R2AA 3P20A 4JJZA 3GLGA 4QL3A 2JLYA 1GNPA 1B23P 3HJNA 2OFXA 3CH4B 3CONA 4Q9LA 4KBFA 5C2JB 1E2EA 4KHZA 2FMXA 2IEZA 1W5SA 3OAAD 3ONWA 2O8EA 1X1RA 2I3BA 2JJ2D 2QAGB 3K9LA 3KKQA 1P62B 1QBKC 5EP1A 1WF3A 2QTFA 4B33A 4RCYA 3GFTA 4N0DA 4C3ZA 1F2TA 4JVLA 3SYLA 1QFZA 3EARA 2QROA 3CH5A 4M1TA 2DFNA 5JRZA 1X8KA 2PLFA 4HAXA 2QA5A 3A1UA 1R5NA 3W5HA 4M1MA 4A15A 1N2CE 1KDTA 2OFOA 3GLIB 2C96A 3UG6A 2FA9A 4PSVA 4JLKA 2QE7A 5IDVA 1AGRA 5SZKB 1RZ3A 2PX0A 4NCJA 3IEUA 4EH1A 4U5XA 1E9BA 3A36A 3RSOA 5JI2E 2FSGA 5BYKA 2FZLA 3GJ7A 4E5UA 1R6BX 4AC9A 1CJTC 3EPKA 4C0BA 1UKZA 2NIPA 5E4FA 2D4HA 4YONB 1OSNA 3K0SA 2GDJA 1RE0A 4PO8A 3QOFA 3CF0A 4URZR 3GLIE 2JLRA 5EZ5A 5K8LA 5TR9A 1KDRA 3I3SR 2BJVA 3THXA 3X2SA 3VQTA 3ND9A 1RC8A 1E9AA 2NO7A 4ZI3A 4LYHA 3MRSA 4M1KA 1KZGB 3X1DA 4AD8A 1W1WA 2YC4C 2ZRKA 4A6PA 4DLSA 3DM9B 1KMHA 4KVAA 4B3DA 5LD2B 1U0HC 3LW8A 5G40A 1JNYA 4R71A 4DLXA 4B2LA 4JSYA 1G8YA 3FYHA 1E2MA 3BWDD 4JLVA 4CYMA 1XB2A 1CJKC 5D3QA 1YZKA 3FJOA 3S1AA 3TSOA 4UKDA 1E2DA 1WBDA 4YAFA 2FSHA 3OESA 5EE9A 4LHZA 1UBCA 4JVMA 4RD4A 1X8LA 1KJWA 1OIVA 2ZJ2A 4URWR 1BMFD 4HB3A 4I1UA 3I72A 1DO2A 3GJ4A 4KSBA 3IO5A 3CLVA 2GBLA 1OIWA 2BVNA 4GZLA 3SEAA 3T35A 3EX7C 4Q4HA 3MWLA 1E9DA 4DLWA 1KDOA 5FI0B 5JHHB 4LGMA 5EE5B 4LHWA 1E2FA 1T5LA 4JVSB 4R98A 3FPKA 3LXRA 4XD7D 1XZPA 3PEUA 4ZKDA 5BN4A 4C7OA 1G8GA 4PAQA 2XZOA 1NBME 1TQ2A 3VR2A 1P7CA 2QBYA 3A58B 3B6EA 4L4UA 4NU0A 2BMJA 4KBGA 1IBRA 1CTQA 4AYWA 4Q4LA 4DZZA 3QKRA 4ASUD 1T5IA 4GP6A 4RD0A 2BMEA 2PJRA 4Z54A 3FTQA 1VQ7B 2GJSA 2Q3FA 4GSYA 4ON9A 4OHYA 2IW3A 2ZRNA 1IN7A 5H68A 3I61A 2Q9BA 4TT3D 1R5BA 1QG0A 2F9MA 4NH0A 5KO2A 5JBQA 2ZRDA 3TBKA 2C78A 4LV5B 4WXPA 4XSHA 2XNCA 1KI4A 4OK3A 4V0ME 2QMEA 1QHSA 1R0ZA 4Q9HA 4BFUA 2ZJYA 4LC1A 1CULC 1KNQA 4Q7JB 3CIOA 3IO3A 1XMVA 4F38A 2G9NA 5H59A 1YHQB 4PPGA 1NVXQ 3ASZA 3PG5A 5CIQA 3MJRA 2WSMA 3ZQ6A 1OT3A 4B32A 4DCSA 1G3IA 2KSQA 3LFUA 4JYCA 2VSXA 3SE0A 2DFLA 4IXNA 5TARA 4JLNA 1G7RA 3EPLA 4Y9UA 2WPDD 4YLGA 1ZC4A 5E7IA 4D4KA 4W9MC 1KRHA 4V0LA 4LJ5A 1H8EA 5FTKA 4WAUA 3I73A 3OZWA 1X8JA 1FZQA 1DPFA 1Y63A 4IKEA 1DTSA 2JJ1A 2FEMA 3BC1A 1BX0A 1KIMA 3OJXA 2Q6TA 2R8RA 3M6AA 3PR1A 2D62A 2V7QA 4TL6A 4D0LB 3A1SA 3QKUA 1UF9A 3CCEB 1J2JA 2BOVA 3MUFA 3W5JA 2EWVA 5FTMA 1OHHD 3SFVA 3PUVA 2J7KA 4BPRA 1N5JA 2GCOA 4UJ5A 1VCNA 3EA5A 4LBWA 1CR0A 3IUYA 1UKYA 3BERA 3AP1A 4DCNA 1N3BA 2GESA 3CX7A 3RRNA 2VHQA 1KY3A 3B2EA 2ZTSA 1BS1A 1TLLA 3R8CA 1NKTA 4TSFA 4QG7A 3TLXA 1Z0KA 1U90A 5EE0A 4JS0A 1E2QA 3OIUA 4A8JB 1OH8A 1TL7C 1I7PA 1GRNA 4YXWA 3TGPA 3H4MA 5D3MA 2P6UA 2Z4RA 2QAGA 2XTNA 1JR6A 3GQBA 3VKWA 4HLDA 3E1YE 4DSOA 3AB3A 3KZ1E 1O87A 5EXTA 1OPXA 1KYIA 1VCMA 2VLIA 5JSZB 1OXTA 1YRBA 4GOXA 4PC6A 3UK6A 3LH5A 2XJ9A 2FGKA 4TQUS 5H1YA 3K70D 5TB5A 2ZROA 3IILA 4QHSA 4PC1A 3LDAA 5CM8B 4LY6A 4YAUA 3NIBA 1YJWB 3WNBA 2BGJA 1QUFA 5EJEA 3E2IA 3GLIA 4B3GA 2NOAA 4BLPA 2HJVA 3HPQA 4KODA 3ICEA 2PT7A 2XOKD 2ZITA 2IYTA 4JMPA 1D5CA 1A82A 3FMFA 2YV5A 5JCPA 2QM8A 3ZLJA 3GEEA 2WWYA 4EUNA 3IHWA 1K8RA 4OKSA 5TMPA 4QJ3A 1XWIA 4XTCS 2IA5A 5CJ2A 3ND8A 4ITRC 1ODFA 1E2PA 2DWPA 2JLWA 2H57A 3B1VA 2DBYA 3KFVA 1EFCA 4X8LA 5AJXA 521PA 5CYPA 421PA 3A4LA 1GUAA 1ZD9A 4Q1CA 1CRQA 2IBMA 3CPHA 3HU1A 4G1UC 2G88A 4LI0A 3ZYCA 1VQNB 2FPMA 4ERNA 2C04A 2KJQA 4LV6A 4OQLA 5FBRB 1AA9A 2ODWA 1E79D 3JZAA 1NVWQ 821PA 4LJ8A 4NCHA 2KBFA 2ZI6A 3MCAA 5AUPB 1E2KA 4OHXA 5DGXA 5EP4A 2CCGA 4GP7A 4B34A 3ZC3A 4DDTA 1W44A 1SXJD 3L0IB 4FMCB 4IXMA 3RYTC 2Z4SA 4MDEA 1FOEB 3AF3A 3AUYA 1LTQA 1I2DA 4MKFA 4PZZA 3SI7A 3B1ZA 1VHLA 4JT2A 1Z08A 4C30A 4YMVA 3U2QA 4XOIA 1I4TD 1G20E 4URYR 3ZH9B 3ZD6A 1KAGA 2JLQA 1NG9A 1XBTA 5B64A 3WYAA 1RJ9B 3HU3A 4XIGS 2A5JA 1SHKA 1KSHA 3GJ8A 1OLOA 1DAMA 3LRPA 3OHMA 4HYYA 1FNNA 2QUZA 4P31A 1MRNA 3MGCA 3JQRA 2FFQA 4K81B 3SQXA 3MWYW 2DHRA 4L9SA 5JJKA 1QH0A 2WOOA 1FUUA 3MMPA 2ZUDA 3LY5A 4JLAA 2WBLC 4MYUA 4V0MA 3UMRA 1DE0A 1QX4A 4RD3A 3AF1A 1ZNYA 4DSNA 1CU1A 3GMTA 3RS0A 1W36C 1UJ2A 2ZPTX 3CM0A 3U44B 2AFIE 2YWGA 3SS8A 1P72A 4NYJR 3REGA 5FI1B 2QZ4A 1MT0A 2FPKA 3QF4A 3QXXA 2VL7A 3LBIA 2IF2A 1DAGA 2CL6X 4TYQA 4IDQA 2HF8A 5KHOC 2AN9A 1EWRA 3WP0A 4B3FX 2YOGA 2OLKA 1CR2A 4C0JA 4Q03A 3OW2B 3B8HA 3ZZUA 3WRXC 1JJ7A 1NI3A 4IEIA 1X86B 5EUQB 1VMAA 3T5GA 5JHGB 5LDDC 2IL1A 2X2EA 3I55B 3EW9A 4LJYA 4C4PA 1E2GA 3CPWB 3T61A 1XJ0A 3NHAA 5TXGA 2VP0A 2ZVQX 4NYMR 2EW1A 3NBZC 2IS4A 3JQQA 1ZM3A 1N6NA 5DI9A 1R10A 3T1QA 2IYVA 3TAHA 3KQHA 2XX3A 4D25A 4DDUA 1BX1A 4Q7MB 2WMNB 1W4AA 3MWKA 4J0QA 2QPTA 4EQ6B 2BDTA 3G4SB 3W3AA 1Q3HA 1QGAA 2JASA 1GAWA 4CT4B 1SKQA 2C98A 2PH1A 1T3HA 1SKYB 1G18A 2PT5A 1D2NA 4IDHA 4O25A 1GR1A 4FCVA 1G3UA 4WQMA 2VNHA 2OILA 2WIBA 1R2QA 5AJZA 2BSAA 3FFAA 2CCKA 2XB2A 3ZS8A 3Q7QA 2CMKA 1XTJA 1E62A 2P6RA 4M9SA 2W58A 2IHYA 1QVFB 4ACAA 1U94A 5FL3A 1EK0A 1ZINA 4CGZA 3IPYA 1OIXA 1GM5A 4MRRA 2W83A 4MRPA 3W3ZB 1KO8A 1SKYE 4PANA 3K0EA 3IQWA 3HPRA 1WDTA 4NDZA 4XTRA 4MYTA 2GAOA 4A8JA 4HE6A 4D2IA 2DY1A 4PX9A 1ZM7A 5CDFE 2JATA 1NN0A 2HDNB 2CE7A 2R6DA 4QM7A 4QBFA 5DYIA 4V0OA 1VQMB 4HAYA 3D31A 1XCMA 1IJFA 3MFYA 4MKHA 5JSZA 4Z1MD 2ZXUA 1J9ZA 5DHFA 4URXR 5F9HA 1PV4A 2QMUA 1HE1C 3EZ6A 4NONA 5K8UA 4M22A 1YZQA 2C5LA 4UQOA 2H92A 4L16A 3B7GA 2OXCA 2D2FA 2ODEA 4LCBA 5BYJA 3RLFA 5JS8A 3NEJA 3CRZA 2N46A 1BQEA 4HZIA 3FMOB 2D3WA 1OFTA 1A2KC 4P4TA 4ZDIA 4LJ4A 1ZAKA 4IOKA 4N3GA 1Z6XA 4RFVA 1V5WA 2IWHA 4AG6A 2QTLA 4B74A 3K0CA 1UEIA 2BHRA 2HV8A 4FWIB 4NPHA 5HCIA 4D81A 4EAQA 2DR3A 1NN5A 5AR1A 3C15C 2ZANA 3UIEA 5CB8A 4NBSA 4QKQA 2OTLB 1EG7A 1M7GA 4EPWA 1YJNB 1N6IA 5THXA 1SGWA 1UKEA 2CCJA 1Z22A 4IDNA 2QAJA 2REBA 5FOVA 1N5LA 3IQXA 5DSZA 3VHLB 5JEEA 3B1YA 4Y0VA 1VCOA 3QVVA 1Z0JA 3U6BA 2RGDA 4PHFA 5FTNA 5JECA 1N0WA 3HR8A 4Q4JB 2PCLA 2YOFA 2F1IA 1NVVR 3SFZA 4F93B 4RCZA 4KAXA 2O0JA 3I1FA 1NLFA 2GJKA 2DB3A 1G5RA 4A6XA 4PHTA 2VQSA 2IYUA 3ASYA 5CYOA 5JMTA 2D06A 4NKRA 4GMDA 2P5TB 1R5OA 3CX6A 1NSTA 2REXB 2J0SA 1GRQA 2AD5A 3P4XA 1KAOA 3OE7A 2OEPA 2ZAOA 3H0KA 5GV8A 4D6PA 2XTMA 4C0LA 1GNQA 2J59A 4GOJA 2AKAB 2CK3A 1OKKA 3M1IA 3B1XA 3RRMA 3FKQA 4M0LA 2E1RA 4HDCA 1VG1A 1DELA 4Q21A 4WIAA 2IYRA 1AQYA 5FL7D 4BASA 2J7PA 1TF5A 1D8TA 3OEED 3C4JA 1VDZA 2R6GA 1G16A 4ZGNB 1RJ9A 3AF4A 4II7A 3VFDA 3VX4A 3VNUA 4LC0A 2VHJA 2YC2C 3HWSA 1UBFA 5FPTA 1FTSA 2VPPA 4ZPXA 1BKDR 1NN3A 3TVDA 1L4UA 5EQTA 1OYWA 2QPAA 2WWHA 5LB2A 1KI1A 1SVWA 4EPXA 1KI3A 1W2HA 2ZR0A 2ZJBA 1U8ZA 4OYHA 2WICA 5JCZA 3U7HB 4LBVA 1DDIA 3AKEA 3CB4A 2YNMA 3U44A 3LBHA 4PPFA 4MKIA 1COWD 4WOPA 2P2LA 5FOXA 2RGEA 2O8CB 4PQFA 1M7HA 1HTWA 2I4IA 5B57C 4S2EA 4XSGA 3U3JA 3AF0A 2GXAA 1W0KD 1PLKA 1R0XA 2CVHA 5FPSA 4ZCMA 5SZIA 2FSFA 3W8RA 4G1BA 3OZVA 3BB3A 2LKDA 1M74A 4QOSA 4TMKA 4TZ0A 1ZNZA 3EZ2A 1KJZA 2DWQA 1E1QA 2ZRMA 2G3YA 3FMPB 3NH9A 4F7DA 3K70C 2BWJA 1ZCBA 4POAA 3SZRA 1UDWA 4BFTA 4OL0A 4QRHA 2ZI5A 1QHYA 4MGZR 1ZMXA 1YZUA 2Q21A 5IK2A 2OCPA 1JB9A 5AUOB 4DB4A 3EA0A 3BOSA 1VTKA 4PPNA 2GJAA 4IFBA 2ZS9A 3I8SA 4Q5IA 3VHXA 4DLYA 4EQ6A 2VNIA 2IS6A 4HB2A 3A37A 5KSYA 3THYB 2HCBA 2WWXA 3TIFA 2HLDD 2V6IA 2RHMA 5KU1A 2F3RA 3EZFA 5FR1A 4PHGA 5CDFA 2AK2A 2VP5A 2L0XA 3UMSA 4MKGA 1Z47A 4ZIRB 2ORWA 4PSKA 2WOJA 3B60A 5FOTA 4EFLA 4CT5A 4M1OA 4EKDA 1U81A 1KQSB 4LYJA 2A5FA 4KI0A 5GV7A 1KDPA 2QE7D 5EZ6B 1S96A 3QENA 4W5JA 1G8PA 2YYZA 2QG6A 1HT1E 2QEQA 2W6JD 3HYTA 4DT1B 1S2MA 3ZVNA 5DYGA 3B9QA 1FP6A 2V1XA 1SXJC 2WKRA 3DM5A 4C9BA 1S9DA 1T3LA 3EC2A 2C2HA 4RFSB 3CF6R 3RRYA 2OAQ1 4BEJA 1P5ZB 4ZGQB 3B1WA 4PSAA 4D4MA 3BIFA 1FNDA 2OK7A 3QKSB 2EFHB 4LK2A 3WMEA 3SJZA 3CX8A 4K8OA 2QP4A 4E03A 2O0HA 1I4DD 4P4SB 2W00A 2ZRCA 4TTQA 4WZ6A 1KK2A 1E9RA 1CJUC 1QGZA 4WVFA 1RVDA 3U3KA 4DSUA 5H70A 4DQLA 3AKCA 2EIXA 2GHIA 2J1LA 4YQFA 1HYQA 2XNDA 4PZYA 2BM0A 2D7DA 2QDXA 1II8B 3RSLA 3W6PA 4UXJA 2XJ4A 1JR3D 3SJBA 4JL6A 1SQ5A 1GOTA 3MSXA 3E5HA 1R0WA 1H8HD 4R2HA 5AJVB 2ZSDA 1CXZA 3LD9A 1IY0A 4C2TA 4DC9A 3KFXA 1II9A 2ZRPA 2QA4B 3W34A 1P2UA 4YDHB 4V02A 4AG5A 4FMDB 4Q4JA 4EJSA 1VIAA 1LV7A 2XXAB 2WTUA 3K09C 4GOKA 4KO8A 4HB4A 1YZLA 4WXRA 1XTQA 1S0UA 2VNKA 1C9KA 5SZHB 1KZ7B 1Z0IA 2FFHA 4OK5A 5K8TA 4B73A 2IXEA 1JBKA 2XNSA 4AYXA 2AKYA 3BAFA 4GFDA 5HXBA 1AMOA 4S35A 1Z5ZA 3ICQB 4PHHA 2GQFA 2XSZA 5EE3A 1TPZA 3UWKA 1XXHB 1YR9A 4Q1FA 2C9YA 2F43B 3CZQA 4HDOB 4E22A 4TLDA 3CCJB 1ZW6A 4RY2A 5DHAA 5KYKA 2QENA 4BGDA 1RW4A 4US1R 1OF1A 3PFIA 1JPJA 4Y9RA 3OZUA 3QJYA 3CCMB 2FPLA 3VO2A 2QQEA 4LBZA 2UZIR 1AKYA 1WMSA 4QC2A 3I5XA 3PUZA 1DEKA 1M34E 4NTZA 1M1YE 1ZUIA 1DARA 2XNJA 1S1CA 4ZV4A 2W6IA 1XXHE 4G5QA 1GJRA 4I1VA 1P6XA 2N1BA 1ESNA 3KDSE 1DAIA 1G4AE 2J3EA 2YZ2A 3UATA 4A0FA 5KSOA 3U60B 3DHWC 2AL7A 2PIAA 2ZI4A 4AK9A 4PC7A 2MMCA 2VEDA 4C0KA 3P26A 1M8PA 4UXHA 5B30A 4Q1BA 4UAJA 4EFMA 1W7AA 4TLBA 2REOA 3TE6A 4ZO4A 1U98A 4FXPA 4AF6A 2CNWD 2NO9A 2JJ1D 1UDXA 2RHDA 2OZEA 2QP9X 4JLPA 1FX0B 1XEFA 2OCBA 4KFSA 4W5HA 1P60A 4PPQA 2OT3B 5L3SB 4BEBA 2CLSA 2QT1A 4BFSA 1O3YA 4US0R 3BFVA 4LOAA 2G1JA 1S9HA 1RPZA 1C1YA 1D9XA 3GLHB 4P33A 1NJGA 1OXXK 4I4LA 4DVGA 1WA5A 4BECA 5FUYA 2A5GA 1X3SA 4I1OA 2WV9A 5J4VA 1A4RA 1QVAA 1Q0UA 2RGAA 4TSFD 4ACBA 1OGIA 1NY5A 1IONA 3VR1A 4DCVA 2HJGA 4EPVA 1J8MF 3KXLA 1S72B 2GAAA 3GFOA 1PJRA 2NZ8A 2OBNA 2ONJA 4KFTA 3GLHE 2ZRFA 1NJFA 5JEDA 1EFHA 4BPBA 4JKYA 3ZDQA 1E32A 4RZ3A 4RVCA 4LYFA 4TYYA 2ZE8A 1DG1G 2R6FA 1JEEA 3WMFA 4NYJQ 2QN6A 3BJIC 4L15A 4TYPA 3CCLB 2LCFA 1E0KA 2FSIA 4P4UA 2NPFA 2KI5A 5HKKD 2G6BA 1GWNA 2BKUA 4MUAA 4PQRA 1Z06A 1SVOA 1DG3A 4FI3C 4QHTA 4OI4A 3FPAA 5FOSA 3W6NA 4Q9JA 4BFVA 2BF4A 2CNDA 3T34A 4DT1A 3U6KA 2ERYA 3CKLA 3VR6A 3EAQA 3AGPA 2XGJA 1N25A 2RKOA 4RD2A 1Z0FA 3RS4A 3VR5A 3W5VA 2ZYWX 4RFSA 4UNPA 3T5DA 2VYFA 4OI2A 4RZUA 3LQRA 4K46A 1T0JB 1WXQA 1UADA 1Q20A 4NYMQ 3BH7A 2VHCA 3QKSA 4LV8B 4WW0A 2FH5B 1G6HA 4Q1DA 2JJ2A 2QORA 2EFGA 4FN5A 1V43A 4KSCA 1NVUQ 4P4SA 1N6RA 4JLOA 2CE2X 4AY2A 1BO6A 1GO2A 4YHBA 1HURA 3GJ6A 1E0AA 5KOYA 2A9KA 4HZUB 1GG2A 2RH5A 2Q9CA 2SHKA 4DB2A 3A4NA 4PO9A 3K70B 2VIIA 1Z0AA 3F3YA 1G17A 2MSCB 2V54A 3W5IA 4Q9IA 1W0JA 3TAUA 1CEEA 1LNZA 2VF7A 3U7EB 4DEXA 1AM4D 3RS7A 1KKLA 2E9SA 5AUNB 4DUGA 1GVHA 1OXUA 1W2GA 1IY2A 2OXRA 1EFTA 2ZM5A 1N6PA 3MLEA 4Z51A 1G7TA 1WP9A 2EVWX 4KCGA 1EXMA 3QFTA 4ZCLA 1JXOA 1FUKA 2ZJZA 1KC8D 1DOAA 3O8RA 3NG1A 4O3MA 2XXAA 4BLSA 2R6AA 3QFRA 5P21A 2EQBA 2QY9A 3GJ5A 3VKGA 5J4HA 2PMKA 3A6PC 3AVPA 5DISB 1FQJA 2O8FB 4YAWA 1KO7A 1G21E 1XCPA 2PZGA 5FFMA 1EP2B 4QM6A 3AVXA 3AF2A 4KVGA 3GLFB 1P2SA 4PC2A 4A0GA 3NBFA 4NCNA 4QBIA 1YZGA 1OYYA 1XXHA 3RABA 1QHIA 1AS2A 1SXJB 3LVRE 1Q3TA 1E2HA 4B3CA 3KQKA 4HI0E 2B7BA 1E9FA 1KY2A 5M04A 5C1BA 1A1VA 1W2BB 2XEXA 4P0TA 3SHWA 3FB4A 2GRJA 3G71B 4TMZA 4BWYA 3HP1A 2WJYA 3AH8A 4R2IA 3AQ4A 2QTVB 2BBWA 5C46F 1ZC3A 3GLFE 1AGPA 2WKQA 4CF7A 3PUWA 3EPJA 4HLCA 5J5CA 1F3OA 3R9XA 1SXJE 1XEWX 4US2R 2NO1A 2HXYA 2BC9A 3SBEA 4BFZA 2XITA 4FK8A 2QQ0A 3QI2A 2JLXA 1N5KA 1GTVA 2J41A 1KK1A 1Z83A 4DXAA 4FD2A 1UPTA 1CNEA 2O0KA 1G6OA 1NVVQ 5E3HA 2VP6A 1TVCA 1XPOA 4TLCA 5KSWB 4NP6A 3CD6B 1F6BA 1HQYE 4MA4A 1E9SA 3PQCA 3K8YA 4RZ2A 3U3MA 1FX0A 1X1SA 1IN5A 2MSDB 4R7ZA 4YDSA 3X1XA 4ASUA 4AKIA 4TQAA 5DIFA 1VIYA 3I92A 2F6RA 3CCQB 3QPVA 5L3SA 4Q00A 3QVUA 1NF3A 2PL3A 4BZXA 5JWHA 5J4LA 3KKPA 1ZU4A 1EFUA 1YZTA 3N5CA 3D8BA 1E2LA 5KSZA 1EP1B 2GZDA 2HF9A 2FE4A 3EXAA 1H85A 1KK3A 3EIEA 3RC3A 2Q3HA 5G53C 3WNDA 2JDIA 2IYXA 2PMDA 3MJHA 1VQ6B 2HEIA 2IC5A 3M0EA 1T0HB 1KO4A 1Q1QA 1XJCA 2V9PA 3AKDA 1NBMA 3E70C 1Z29A 4LJ6A 4KYIB 3TQCA 3QBTA 2WJGA 3QIAA 4QGFA 5FPYA 3C7KA 1S4QA 3ZBUA 2DCUA 3Q3JB 1A5TA 3V4RA 4AF7A 2OAP1 3KJEA 4MYCA 2OUKA 1WRBA 2E87A 1XD8A 1EFRD 1GP2A 2B92A 4HLUC 1DO0A 4D0GA 4IVPA 2EYUA 3IEVA 1UKVY 6Q21A 1Q81D 2IX3A 1F5NA 2BMFA 1E98A 4LJ7A 3VMFA 1SVIA 1Z6GA 5AWFC 4BRWA 1P2VA 4GZMA 2C8VA 4L8GA 1QRAA 5B2ZA 3DDCA 1B2RA 1XTRA 2FNAA 2R9VA 4KFRA 3HR7A 4LHXA 2ZRGA 3QEOA 4OHWA 4DRZA 2QSYA 4GI7A 3K0FB 3L43A 4W5WA 5HE9A 3NC1C 2BM1A 4B2IA 2ZIAA 4Q1AA 3QE0A 1Q44A 4GT1A 3IKJA 3GPLA 3LX8A 1Q7YD 2F1RA 2KB0A 2WVJA 4CEIB 1NY6A 3O8CA 2HYDA 4FCWA 4Q1EA 4HAZA 1NNEA 1QFJA 2ZS7A 4OQXA 4LX0A 2X19A 3EIQA 1VHTA 1P2TA 4MYHA 2A78A 2OHFA 1G8FA 1K9MD 3GEIA 1MABB 3SQWA 4B2PA 1J70A 4NE2A 1D2EA 2QM7A 3TSZA 3P4YA 4HZUA 4PO1A 2GEUA 1G1MA 1YITB 1G41A 4B71A 1HUQA 1MR3F 4WBSA 3CMAB 1C4OA 3JQPA 1TU4A 2QL6A 1S1MA 3CWZA 4G01B 4R9UC 3OE7D 5J40A 5KDOA 2ZRJA 1FNMA 5CITA 2XOKA 3CUEF 1F60A 1ZCAA 1ONBA 2BCJQ 3DKPA 2WMOB 2ZI7A 1OKKD 2RGNC 4O2LA 4OJKA 3E1SA 1NL3A 2B8TA 4ZDJA 2GWHA 1FMLA 4RKEA 2IEYA 3T1TA 1KKMA 1SVKA 4AIIA 3D7MA 1N0VC 1GIAA 3RVBA 1KMQA 2OESA 3FWYA 2ZU0C 1EWQA 1R8QA 3T1OA 3SC3A 4A0RA 5EXSA 2XB4A 2YKGA 1XFAA 1XZQA 2KBEA 3NVAA 4IRUB 1ZP6A 2G0NA 3TSWA 2BKEA 4ZI2A 2C9CA 3Q5EA 4M8NE 3OEHA 4B3BA 1YIJB 2RMKA 3CRMA 4JBXA 3FKSA 4OQMA 1KD1D 4URUR 4JVNA 3QXSA 3GLFA 2NG1A 3CRQA 4PAMA 5DNYB 4Q7KA 2OSBA 4JIMA 2GVDC 1D1NA 3K1JA 2IYSA 3KXIA 2VP2A 3UPUA 3EIHA 3QFSA 3CCSB 121PA 3ADKA 3QEJA 5KPJA 2QPOA 3LVBA 4JBYA 1BYIA 1F48A 5KDDA 2XAUA 2VYQA 1RRPA 3F8TA 3OZXA 2HUPA 4XVRA 3V76A 2RC5A 3FFBA 1G3RA 3GJ3A 3RS2A 1N6KA 4ABYA 2ZR9A 4BFXA 2KE5A 4DLZA 2HYIC 1HA3A 3U3OA 1ZNWA 1UFQA 4TL8A 1ZNXA 4JLMA 3UXMA 3NXSA 2VHTA 2F1JA 1KK0A 3BBPA 4DCTA 3KJHA 4V0KA 1E1QD 2IS1A 4RD1A 2C99A 1XNJA 3FE2A 3LBNA 2IXGA 4EPYA 5JFGA 4Z8YA 1N6HA 1ETUA 1FNBA 2GXSA 2MSEB 1OFUX 5JWRA 5JLJA 1CBUA 5CK5A 3ADCA 1G9XA 1VYUA 1Z6TA 4QGGA 2GXUA 4Q66C 3TMKA 4C0HA 2CVFA 1J90A 3C5CA 4Q47A 1CF4A 5IK2D 4MGKR 3PIRA 2JLSA 4C0QC 2ATXA 3IHLA 2DERA 5B58C 3RS3A 2H7VA 3SN6A 4E09A 2R6CA 4M9XA 5L3RA 5IT5A 3SR0A 3B13B 1JB1A 1N0UA 2RC6A 3A8TA 4EFNA 1VG9B 2X77A 1LF0A 3GFPA 1TQ6A 1LVGA 3N2EA 4JLBA 4CEJB 2QRZA 4AWXA 1NSFA 2CJWB 3CPEA 1YVDA 1RYHA 1Q22A 2H17A 4V03A 5HCNA 3K09A 3CWQA 2Z0MA 3W9YA 1E0SA 3PEVA 4ARZB 3ZJYA 3QXHA 1ZD8A 4MRVA 2A2ZA 1QHHB 2ASEA 2G77B 5DE3A 5FR2A 2QTZA 3AVWA 3KL4A 1Z63A 3REFA 4PAOA 2RAPA 1G3QA 1NP6A
chains in the Genus database with same CATH superfamily
5KOHB 3PA8A 3T3GA 3K71B 4CIDA 2YHSA 4DDMA 1J4AA 3AGQA 3T5TA 1I80A 4DJTA 3KUCA 5DX0A 3AI7A 4OOVA 4POOA 1NQXA 2AF4C 1EQAA 3LZDA 4DDVA 3CVVA 4KXMA 1XZMA 2BMAA 1XTKA 2FTKE 3UB2A 2Z2IA 2O1SA 3RVNA 5BN3A 5JV5A 4G9GA 2ZRIA 5EMNA 1VKNA 2WTAA 4WKBA 2B7CA 3Q3GE 2YX1A 4G0XA 2M9MA 3AG6A 1V6CA 1VA5A 2FETA 2CDRA 2JIZA 2WZCA 3GRRA 2EBUA 3FMVA 4TGLA 3P9NA 4IVQA 3WE7A 3A1WA 5F7OA 1QQ5A 4NULA 3MG9A 4BNNA 2EJVA 4OUDB 1W9HA 2JGAA 4MVJD 1ODCA 1SBTA 4ZVVA 3DCIA 3LYLA 1Z4IA 5L3SB 1OXVA 4XLAA 1ISRA 1NUUA 2JGNA 1BXGA 4MVJM 4OM8A 1XMSA 3ABSB 5ALVA 1C3XA 3CR8A 1UWVA 4C6TB 5KTPA 3RVOA 4PG8A 2NUAA 1B0UA 1Z2AA 3BILA 3F0TA 4TN5A 1QC5A 2I78A 5H16A 5IJAA 3TZBA 3O8BA 4GRIA 1DSSG 2I9KA 1PJ5A 2X2FA 3FHOA 2I54A 3K9BA 2WU8A 3EJ6A 1P7YA 3MTQA 4FYXA 3USZA 1SHZA 4OHBA 5BR7A 3DL7A 4BJHB 1YR8A 1ZM9A 4PS1A 2PJDA 1MABA 3BHMA 3R0QA 1LBHA 4PTZA 4X3CA 4NBVA 5COAA 4OI1A 5HRCA 5JS6A 2ZETA 1H6AA 2FWPA 2OHOA 3C3AA 3CLSC 3N07A 4ZO6A 4RZHA 1XEWY 2FPIA 3QOXA 4ZOQI 4RXMA 5A3RA 4MHTA 1LFDB 4BFCA 2M6SA 1AHIA 2O8BB 1AQLA 3OZSA 1ZL0A 2ZYUX 4OGFA 4KWHA 3ENNA 4ZZ0A 3ZWYA 4B0PA 2ZS8A 1U7UA 2ZWVA 1JKMA 2QUBA 1FX1A 1ONPA 1JEQA 2SCUB 1Z7BA 1WMAA 3HL0A 3N7UA 3ILXA 3P9QA 4M1WA 5JTUA 3D4PA 4LQDA 5BQFA 1TO6A 1EI9A 2OAEA 3MNFA 4IDFA 5DLDA 2H52A 4TSRA 2VSFA 2Q3EA 3TCNA 1Q86D 3V8RA 4FHGA 4B40A 2X9QA 5ESWA 1DWPA 2ZVJA 3ENWA 3IHTA 2HLHA 5GWXA 4A23A 3KJNA 3M1AA 2H7YA 4U2CA 2X0DA 4WBNA 2OV4A 1NI4B 5AUQA 5DGDA 2J3KA 4UTZA 1OH7A 2GT1A 4B3HA 5CLQA 2PUDA 5E3IA 3VAYA 1CP2A 5U4QA 5HMMA 2MSLA 2X13A 3WQBA 1CR6A 4B6RA 2B4QA 1E2IA 3DW1X 2W6ID 4WNAB 2VBUA 4Y6QA 3I5AA 1CRWG 1EBFA 4BUJA 4DIMA 1TKAA 1QOZA 3I4LA 2CJPA 1KI7A 2FP4A 4OHZA 3ZYZA 4DKXA 2K7ZA 3VBCA 3L79A 4A0HA 4N3AA 4WZAE 3VTZA 3SDZA 4Z4GA 4QTUB 1IB0A 5H3CA 4M98A 2AQKA 1XLTC 3SY8A 4ZHQB 1Z7WA 1GTZA 3I6IA 1Z73A 2Z6VA 4CMHA 4AKEA 2JCBA 1DO8A 2QVBA 2GA8A 4MW0A 5HA5A 2GBPA 4UARA 4BZQA 2B1QA 2HMUA 2IPLA 2VJKA 4JI5B 1ZVVA 3TG2A 4JNCA 3UJ7A 4AZ0B 2KLBA 1E1MA 3AINA 5EIEA 1RQRA 3OFNA 1LQTA 2EZ9A 2FSVA 2C2YA 2N47A 3QKRB 5DXAA 3GFGA 3Q3VA 5HK9A 2P78A 3EGVA 4C2UA 1V8ZA 1OI2A 3RVDA 4YRAA 2IYZA 1E89A 4KE7A 4PR0A 4C1NA 4NAHA 5EHQA 3SHFA 4E5VA 4GLOA 1GLVA 1FMJA 3RT9A 1VI5A 2NPOA 4L50A 1USUA 1X7WA 4H7HA 4DYVA 5I51A 2K7FA 3GA0A 4FMPA 4JKOA 3OO1A 1C3VA 1K4MA 3U81A 2JGFA 1D6JA 4HEJA 5HTOA 2WTXA 3N6XA 4ALKA 2IUTA 3U4QB 1ZITA 1MT3A 1NDUA 3FOBA 4P2NA 3KT8A 2RBKA 3LWNA 3JQGA 4FGSA 5SV2A 3NZEA 3ETDA 4NCBA 3ABQB 4CIVA 1T10A 2XXBA 4KOAA 2FV8A 4TKUA 4RTNA 1XPJA 3KLBA 3QUAA 3RIHA 3ZVLA 1C0LA 2YWHA 1UR5A 2Q2WA 2V9ZA 4N6GA 2JVKA 1IXZA 1IXSB 2Z9BA 2Y1EA 4B35A 5FAKA 1X19A 3ILVA 1V3UA 1ABBA 3VX3A 3BGSA 3BXXA 1P2GA 4CEJA 4YALA 1VL2A 3N8GA 3S2EA 1W4LA 2Y68A 3CC7B 4O2BF 3UMJA 1KGDA 2I3DA 4CMIB 2BONA 1C29B 1HZZA 1ZRSA 5BT8A 4RLSA 1GT6A 2GJ9A 5ESXA 3VR2D 4LNUB 5HIKA 1RAHA 4BL5A 2DWOA 3GOQA 3JQ8A 2C7VA 3OLYA 4HQRA 3WZMA 3QE3A 4ESVA 2O0LA 1EEXB 3FCOA 3IT3A 3ZWPA 4Z4CA 4FHCA 2V6BA 5D3KA 2C8JA 2VP4A 3I9NA 3PV0A 4BLOA 1Y6QA 1RM3A 4PLCA 3H42B 1LPAB 1U5CA 3DG9A 3HKEB 1DDGA 3NC4A 4I50F 3WGZA 4XVUA 2CC2A 2VQ3A 3UK7A 3BB4A 1NULA 2VXYA 2IYPA 1ZCZA 4AO8A 4ZT2A 3FSGA 3KBOA 4LVNA 4MVJP 3JTEA 5L3QB 1SOUA 1DC4A 2GVZC 4II3A 1RRVA 2XUZA 4YRKA 3NDRA 3OE5A 1CSEE 3VNVA 1WBBA 2UUPA 3U4IA 4GBED 3U49A 3PDIB 2PUFA 1NI5A 2FWRA 2G1UA 4GE3A 4E7OA 2DT8A 3KUUA 1I2CA 3LDUA 4GBGA 2QUKA 3ZV3A 1U9YA 4ZQIA 3WJAA 5HMLA 3JZDA 5FUWA 4MWCA 3ROTA 3M82A 3SMQA 4FWTA 4RZXA 3R9IA 2ENWA 4YUVA 1P61B 1V9CA 3M5DA 2FPRA 2YWFA 2QZZA 5JZOA 4JJKA 2WG1A 1NPTO 4HEA6 3OOHA 1LLUA 2B1IA 4UM7A 2PX3A 1N6OA 4Q48A 5KDLA 2QK4A 3TSYA 4DR5B 4CKWA 1W0JD 2Y0PA 4ZC8A 1VQKB 2HD4A 2GN9A 3FCYA 3I32A 4DMKA 1SB9A 3F73A 3OWHA 5JJ5A 1N0HA 3N70A 1QZUA 4UOQA 1ILWA 4QJ5A 3CNHA 3OIYA 2GEBA 3PI6A 1W36D 3DAGA 3AUTA 5AW3A 1PT9A 1YJ5A 4BNLA 3V8EA 3DE5X 4R8KA 5F21A 4YCDA 3BORA 3I5YA 2ZZKA 4NHEA 1QYDA 3FBGA 2ZSHA 4JYBA 4DR3B 1UM9A 2X85A 2Y3IA 3PXGA 3WSVA 4YRCA 2NQ2C 3NGMA 4BOYA 1AV7A 2BMDA 4GG1A 4E5PA 3U3DA 3ZIAA 3P0IA 4JUAA 3HHPA 3PENA 1AUPA 1W46A 1FTQA 2AG6A 5SZJA 3R6TA 3AHDA 3BMCB 3F9RA 1K73D 5JZBA 1XQXA 2HM7A 2NT3A 2NVUA 1FVXA 3EK2A 2XE4A 1IZ8A 1G5TA 1MO3A 3ITDA 4OBEA 4KYTA 2MSKA 4E2YA 4M2LA 5HQ3A 4TTIA 5AXAA 3TEFA 4E5SA 1XO1A 3H87A 4PQYA 5FTLA 3BGIA 1J9GA 3OQ6A 4JX8A 1T2FA 3DE1X 3BFKA 3E61A 3JQBC 4JYZA 2IHKA 2P4QA 1GQOA 5CG2A 1LZKA 1M83A 1N2GA 1VKRA 3RTEA 5FEUA 1PV1A 5ITSA 1HNWB 4U9UA 2ISCA 4PEVA 1YE5A 2ERXA 2Y1OA 1LFAA 4W7IA 1FPQA 4Y2XA 2ZL6A 4BZZA 5IT9A 3LHDA 1KP3A 2BI4A 3TEJA 3KJFA 4Q24A 4ZVSA 4IDDA 2ZWPA 4QG3A 1WO8A 1NJSA 2GCPA 2C3OA 4TS3A 1RQGA 2IUSA 4IJUA 4YEDA 3V34A 4B3IA 2B8EA 3K0AB 1U1CA 2GF0A 1E1RA 4FTWA 5TQ2B 3TB6A 5GIOE 5IEBA 3D5QA 2RGGA 4HLUA 3GPCA 2DFKB 2G17A 3O47A 1JW9B 3VPGA 2P67A 1S2NA 2PA3A 3AJ9A 3PHBE 1EFLA 2WUEA 4BBPA 5JD6A 1XCBA 1QO0D 3SKBA 5DH9A 1TMYA 1GL6A 1OASA 2VBTA 3JATA 5DX1A 1K4YA 3VHQA 1T5DX 3KT3A 3MELA 3Q0TA 3JYQA 4L3OA 3PTAA 3LGAA 4N40A 4G7WA 1DHTA 5KYUA 3R24A 4F92B 1M54A 1QANA 2I1VB 1FP7A 2PSDA 3GEHA 1YACA 4OQFA 2ZUEA 3BHIA 4TS4A 5KYXA 4HAUA 3LP8A 2BN4A 4CLOB 4GU5A 4PF1A 1A2QA 1L8OA 1U65A 1YNOA 1HE2A 5DLQC 5E2AA 3ZGXA 8OHMA 1HNXB 5EP3A 1UBJS 2GXQA 5HF5A 2RHTA 1O4WA 2AN5A 1ZOPA 1JQLB 3D5TA 4HDKA 1ZESA 1P19A 1UD2A 2J0UA 2LBPA 3QF4B 3DQQA 4H3SA 4I55A 3SG0A 3W8NA 2GNOA 2Z9CA 4EHBA 4R31A 2IXFA 3ER9A 4N65A 3CBQA 1UMCA 1BKSB 2WUWE 1Q82D 2C4HA 4M53A 1A7JA 3I6MA 1IHOA 4DSZA 5E1DA 1E3TA 1THGA 4GBMA 4R4JA 4M8SA 3WRYC 3ZWNA 2ZSIA 1CJBA 2D0PB 1R6VA 2I6XA 3HG7A 2XGMA 2J32A 3A6HA 2EFCB 3K2QA 1DZ3A 1RXUA 4IG4A 4D1YA 1XTZA 3IOYA 4JGIA 2C92A 2JDID 4WWHA 5FBHA 5FPQA 2ZG6A 4EGCB 2YCLA 5KX5F 4D0NA 5E6SA 2Q8PA 3OO0A 2CFSA 2GETA 3EXIA 3K0BA 1WSWA 2YJTD 1D2AA 4FILA 5FA5A 3ZE1B 4EIWA 1U4SA 2QHXA 4AWBA 1IM2A 2ZL7A 3FIJA 1CR1A 2HRQA 3RFCA 4EO7A 1X1QA 1FRQA 1KI6A 3R5SA 1YFKA 2H08A 1C80A 1RM0A 3QE4A 4G1MB 3ZDCA 2M5SA 3IP9A 1DAKA 4ND1A 4QHYA 4MGIR 4Q3AA 2M1ZA 2J8ZA 3NH6A 3LS2A 2PSEA 2QU8A 4M1SA 2PR2A 1IXRC 1OPRA 5DU2A 4CZ2A 1RADA 2WWGA 2HBRA 3MB8A 3K05A 4X9XA 3FVVA 1GPBA 2BEUB 4F11A 4I6EA 3VSEA 2CV2A 4N18A 4C4OA 3MJTA 2PJZA 2FF5A 1ZVQA 3PJFA 2WSYB 4IZ6A 4F9GA 5L3VA 2G76A 2IGTA 5A3VA 4EHAA 3UAOA 2WIGA 4MEBA 4MV1A 3MWEA 4R8RA 4ZGGA 2A0XA 1AURA 2I03A 3QHQA 4IR7A 4NCIA 4Z4QA 1ORDA 1M0EA 1B76A 1U8UA 1E4YA 2ZIZA 3CJQA 3H5IA 4KPUB 4RELA 4GOLD 4RJ2A 4AB1A 4YT2A 2OCAA 3VU9B 1SPBS 1QK5A 1J7KA 1ORWA 3H2GA 3I2HA 5G3ZA 1HQCA 4MV4A 2VSNA 2AOUB 1B26A 4I9FA 4LRTB 1PX2A 2EARA 5FBWB 2HK7A 1FW6A 1BMFA 3DAHA 2AUMA 4EUHA 4NCAA 5DOZA 1VQOB 1IWPB 2FWMX 1Y98A 5HE8A 2YWDA 1BIFA 1D8AA 4Z4WA 2FQYA 2QJTA 4E2WA 3FPFA 4FEGA 2WJ3A 1VQ5B 4JQOA 3T0IA 2FW6A 3P1JA 4PBSA 1NYTA 1XCGB 2QM0A 2R25B 1YR7A 4A36A 1QH1A 3LT4A 1J0AA 3C6YA 2O05A 5MN6A 3O4IA 2EJWA 1W93A 1U04A 2VXCA 3Q88A 4M0DA 1K86A 3DMHA 4HH3C 4O2RA 1JHMA 2ZSFA 5H3HA 3EFBA 1KOLA 3TD2A 4DRXA 2CVOA 2QY6A 2PANA 4ILKA 1JGTA 1SK9A 4HV4A 2O5VA 2GQ0A 2F17A 4BMNA 3LWDA 1VKZA 2LWIA 4QDZA 3TL3A 1RRKA 2WE8A 3IULA 1H2XA 3L7IA 2X15A 3LW7A 1KOFA 3O2JA 1ZUHA 2HOQA 3OOWA 5AVKA 5TJHA 3MT9A 4AJ9A 4GDFA 1JVBA 3HU2A 1G291 3OU6A 4N0PA 2VRCA 3SBDA 2ZWIA 1IUKA 2UXBB 1XZNA 2NV6A 2F4VB 1H94A 3KWLA 3RH0A 4L3WA 1C9YA 4J3JA 4F1KA 1FP4B 1ZISA 2FX5A 2OBTA 4H35A 1EZZA 5AICA 3VNSA 3BD8A 2XOEA 4HDNB 4TT3A 1L7PA 1VP3A 4UNNA 1HZJA 3HEBA 4MGEA 4LGYA 4NV1A 4RETA 1NLZA 2HSGA 2RB4A 4H7IA 2JEOA 1GPH1 4BZPA 4U3JB 1PN3A 2QD4A 4Y2SA 4UAUA 5AVSA 5CIYA 3HJUA 4EAAA 4BE7B 1JHZA 4WBNF 1X6VA 3B82A 1G8KA 2E4XA 1ML4A 4CQMB 3ICVA 4QNRA 1AXEA 2MJLA 3VNQA 3CVUA 3A6FA 2XT6A 3EC7A 4CLEA 5KWEA 4F91B 4BMPB 4JC5A 2PD6A 5DFAA 1UK8A 2JB9A 2IS1A 3P2OA 2C2OA 2I65A 4P4GA 2OXFA 2UYCA 2WNSA 5HW0A 2CHQA 3NBXX 2QZPA 4RVFA 1FNCA 1C1DA 5A02A 3U4MA 3NKVA 1O0CA 4Q4AB 5TNXA 3ESAA 4BCDA 2GM4A 4HNGA 5IJ9B 1L8QA 1P9RA 1XGKA 3A2MA 2ZU6A 4LGVA 3SM9A 1ZH6A 1F2UB 2PWPA 2ZVPX 3Q3HA 5CXSA 5C7LO 2VNAA 4GSLA 4GMGA 2O7VA 4NENB 4PYMA 3VOTA 5IP5A 3S70A 5KYYA 3GY0A 1GAQA 3T3NA 1PL7A 3D6JA 4D79A 4FHDA 1Y1RA 4ENUA 621PA 2NXWA 2HMWA 1CVIA 1JIUA 1ECPA 3C3WA 1EGVB 3UY4A 1KMIY 6REQB 3UV7A 3AESA 4YVFA 4CF4A 1VLZA 5EHIA 4EVRA 4OK6A 3QX3A 5I8ZA 1L7EA 3I0NA 2W8ZA 1KNXA 4ZOBA 3SS9X 3TTVA 1IPFA 2IHVA 4B6OA 2WYIA 3IELA 5KNBH 1NC1A 2OC9A 1VRWA 5HOEA 4ZT6A 4BB0A 3WGKA 3MHTA 5F7JA 1WP4A 1X1BA 4UNRA 1GEEA 3QW2A 5BPHA 4JXKA 2GI4A 2VDPB 3QQPA 4O4IB 1LF5A 4YJDA 3L02A 4C7MA 1W87A 1XELA 2JKVA 4OA8A 4YN3A 3DKKA 2EQAA 1Z3IX 4IF6A 4ILEA 5G1OA 4ZEWA 1TKBA 1ZRMA 4ZQBA 2VJCA 1LBSA 3TQOA 3FGNA 1D04A 1KC1A 2C2MA 2RSLA 1NVFA 1MO6A 3DVAA 4CQNA 2Z1MA 1JYEA 1GVNB 1TF2A 4XN3A 3AHHA 3E9RA 5K0GA 3E7PA 2XYRA 1QCDA 2B36A 2EJUA 4G24A 4JMLA 3WA6A 1XQVA 4B43A 2NT4A 2W7TA 1LLDA 2YYAA 1II0A 5B1IA 3G2OA 4FFNA 5A0FA 3T4UA 4TYWA 2B21A 2RGCA 3M83A 3H3XA 5FD8A 3Q7RA 4DLUA 4W8OA 1GQ2A 1I7LA 2ODBA 3F4LA 4YRBA 1REQB 2AOTA 2PL1A 2V6GA 4UCFA 3KOOA 3ZTYA 2YN2A 3HYRA 1NTRA 4HLQB 2ZE7A 4UMEA 2ZQ5A 5IF3A 4ZARA 1G8SA 1I3OA 3NAGA 1XPUA 3DF9A 4BRUA 4RF4A 3GT0A 3I05A 4P3NA 1JE0A 1QF6A 2BEKA 2OV2A 1WTHD 2DYKA 2WWWA 5A5EA 1MB2A 3HCRA 4B3JA 3HCFA 2VP9A 1B42A 1M90D 1HV8A 4HGRA 4LSGA 1HE5A 3STHA 5T57A 1FW8A 2RGWA 2O8FA 4IOMA 3VOBA 3IOMA 2J9FA 2WU0A 5EP2A 3KBBA 1OW3B 1O4VA 2AWNA 1N1MA 3AVVA 2BIFA 2FJUA 3AKYA 3DOFA 3IVXA 4O0LA 4P4NA 3UHOA 5HZKA 2O2IA 4W6QA 2ZUSA 2OHGA 3BK7A 3G88A 1C9MA 1WOPA 1W49A 1NUHA 4AZWA 1A2OA 1SXJA 4V3CA 1APBA 1CUHA 4E88A 3UK2A 3TINA 1QP8A 2CXTA 2R00C 3KHKA 4OQQA 5CB0A 7REQB 2QAGC 4YLEA 1JDZA 3KYDA 3QVWA 4IEFB 5LP6C 5T4FA 4YGYA 3ZLUA 2YXLA 3FVWA 1DOZA 2CLIB 3EZ7A 3G5UA 3L0CA 3NWJA 3KO8A 3SYNA 1WD5A 3KS9A 2E4YA 1CIPA 2R8XA 3KEMA 4K1XA 5CNIA 1SBHA 3EQ8A 3I5UA 4G4SP 1CZUA 2GARA 4K9QA 4QPNA 1ZIXA 4CL0A 4ES6A 2XVMA 3U3RA 2YZ7A 1K8QA 3PVSA 4Y7CA 3BMOB 5IULC 4IGIA 3KKOA 4QUKA 5IAAA 3HBJA 5DHTA 4CVNA 2QRPA 2VYNA 3EG5A 3WMWA 1WDMA 4M9UA 5I9SA 2VAMA 2JAPA 1A5SB 1F0PA 1XQWA 3NHMA 5GADl 2Y1LA 2WG2A 1PT7A 2PX4A 5E6UA 3MUEA 5ISMA 2LDBA 2HXSA 4LE2A 1XK6A 2VAWA 2QN3A 1RIFA 1ZXBA 2A35A 1XA0A 4RPDA 1JPUA 2HUNA 3SK0A 1A9XA 4JXXA 2WI8A 5AM4A 3QVOA 4NMWA 3OOJA 1ODIA 2WSSD 2FMFA 1PWHA 4JKIA 4Q4DA 3S2UA 1AK9A 2ZIFA 4UBIA 3Q9LA 4HNAB 4I7EA 4OXNA 3IPCA 3H2YA 5LMNB 4GGPA 5E1BA 3IPXA 2Z3ZA 2GFIA 4JL8A 1PK8A 2CZGA 2FR1A 4JI6B 4KO2S 3CC4B 2WM3A 5BV0A 1Q83A 4TWRA 3FB1A 1KTVA 1P9NA 2GCGA 3ECCA 4FFWA 1RQXA 2X8JB 4KWCA 4F4HA 1ORHA 1DOHA 3K3PA 2ZRLA 2IHNA 2PLRA 1WNFA 5F98A 3EXHC 3FRIA 1X39A 4IXTA 4L7VA 1RYDA 5E9WA 5JNUA 4BO7A 2BELA 3H3JA 3C5HA 4CEHA 1O9BA 4HD8A 3GLGB 1DBVO 4H0NA 2IQIA 2ZIXB 2UDPA 3ICCA 3HTXA 3RC2A 1XD2A 2ZSEA 4YI5A 4TWBA 2HIGA 3A9VA 1AGXA 4H1UA 1QP0A 3BL5A 2O8EB 2FEPA 1NBIA 2QAIA 2NU6B 4MUBA 3N5KA 2DLDA 1U63A 5I47A 5ALQA 4B47A 2R68A 5BUZA 1TM4E 1PBTA 4RY9A 3FCUB 2YASA 3MC1A 1I3MA 1S2OA 2V8BA 2AYZA 3H4VA 4I9GA 1Y5IA 4QUZA 1V8PA 3U1TA 1BDMA 1L4EA 2ZTHA 1OWOA 2ENUA 2FZKA 3FLAA 4MP8A 2ZJ8A 4TL7A 4D6YA 2JAUA 2P9FA 5HQTA 1L4BA 4FFBA 4I8DA 2XA2A 3N8IA 4TPKA 5JCOA 4I55F 3SJAA 3TNYA 5K3OA 3NYQA 2VJIA 5A5GA 4L8LA 1XJQA 3QPAA 1FNSA 2Q45A 4LBYA 4PZDA 5T67A 4NSNA 3C74A 1XTBA 3FZGA 3ZHZA 3SXUA 4X84A 3N2GB 4TTVA 3CE9A 3HUTA 3P9IA 5IKOA 2JCYA 2QNBA 3A0RB 1DDOA 1VE3A 1NFQA 4G8BA 4BCCA 3DE7X 4L5YA 1OZ0A 1JFVA 4DA0A 3JU3A 1EQ2A 4B0OA 1UD3A 1KSGA 3W04A 3LVQE 1FK8A 3BGWA 5DPMA 1T13A 5MGNA 221PA 1CZLA 1O6BA 1YOVB 3BMXA 3ASRA 2Q5IA 3COSA 1VQ4B 1W581 2OCIA 1P0QA 1R66A 1I1HA 1XMPA 2IUFA 2P91A 3P9CA 3QU4A 1AMNA 4TMTA 4ZO8A 4C7BA 3THXB 4R2WA 2V98A 3RI3A 2JLCA 1GADO 3PYMA 1ZM4A 1H2EA 1N57A 1UINA 4FMDF 4HDSA 3SDSA 4JJGA 1IN6A 3H75A 4J1SA 1MVNA 1Z4LA 3RADC 2ORVA 2HNKA 3FAZA 4LVCA 3ZNNA 4A2WA 1XVLA 4L1KA 1SG6A 3RVSA 4AJEA 3DNMA 1PK9A 2GK6A 3DMTA 2QZSA 2BAGA 3H16A 1AIPA 2J09A 1Z0ZA 2FGJA 2WVHA 3ADPA 3HUDA 4LRYA 1W34A 1L4YA 1H3FA 2GZHA 4LWOA 3TW6A 3RW9A 1R6AA 2D7CA 2OG2A 3WLIA 2FZGA 4GKKB 1T36A 1PFWA 1FYWA 3DVLA 3OKCA 3TW8B 3Q15C 4YELA 1GYQA 3AP3A 5KUTA 1US8A 1DADA 2WHRA 3HXLA 4IQ0A 4NZYA 5CLGA 5LB4A 4YRTA 1FFXB 3E4DA 5I5GA 2BGWA 3I39X 4B82A 5J9FA 5BXQC 4PABA 2XV1A 5TGZA 4ZCIA 4TN1A 2E4WA 3AUXA 5CYFA 1N9KA 3ICPA 2XGSA 3IE1A 1V8FA 3QYPA 3N3BC 1TFUA 2P3OA 3ZZ1A 3L41A 2YVUA 2BBTA 5LVAA 3GJ0A 5CCDA 3EY4A 1YH3A 5BSXA 4H15A 3TDKA 4MW2A 2DPXA 4BMVA 1C7EA 3ZNPA 2JGKA 2YYSA 1DTWA 2BFBB 3BY1A 3KL9A 1JALA 1SC3A 3QUTA 4MA5A 5JDIC 1EESA 3COZA 3LHFA 4JGGA 5AJYA 5GINE 3NHPA 1SCBA 1DEXA 2V74B 2QBYB 1G19A 4RS3A 1DKNA 1K5GA 1YUBA 2BBSA 5DWDA 1U2QA 5AKKA 1CS0A 2IPMA 3X1YA 4EY5A 2UUBB 1ZYUA 4HGPA 1PEAA 1P4MA 3FBWA 3OF5A 3K4HA 5IAGA 2Q4TA 2FEAA 1LC3A 3STUA 2WAAA 2HTEA 5DK6A 5IF9A 1UBOS 4G25A 1E6EA 3E7DA 2ID9A 4FC7A 4F4JA 2GPTA 1C14A 2NPIA 2CSXA 1Y7HA 5BWNA 3H5TA 2A57A 5DN6D 2FUG1 4JFAA 1DLIA 2Q3CA 2FLVA 5FL7A 1LJLA 3KB8A 3ZW7A 5L6MB 4A4DA 8ADHA 5HPYB 1EK5A 3BPSA 1UZMA 5EKUA 1FDOA 3SOPA 2X6TA 1P7ZA 3HP7A 3QPUA 3RODA 5KNBA 1F0YA 3IDQA 1Z2NX 4OHVA 5JS1A 1Z7GA 1Q17A 1ESCA 4IICA 1JA1A 1XNGA 3EC1A 4KQGA 4G0NA 4IGEA 2X0JA 4I1PA 4EKGA 1QYVA 1WCYA 1N06A 1Y37A 5CM2Z 3UMFA 4D5EA 5GJBA 3HVJA 2ZAIA 4HRVA 3GUVA 2OYRA 2HT1A 1CIJA 4UEWA 3CCUB 3THWA 1XG5A 2Q62A 3DE2X 4TUYA 3JARA 1VQLB 2R62A 3QF7A 3PR2B 4F4DA 2KW5A 1A5BB 2YVAA 4NRDA 4LFCB 2HMYB 2RH4A 3KELA 2DUNA 3CX4A 3RGWS 2GEFA 5IWCA 3ONNA 3I9OA 1LY1A 1WHTA 9GPBA 3QEMA 4Q7LA 4R3NA 5E4JA 4EPTA 1XF1A 3OHPA 1L6RA 3ESZA 2BFOA 4XRRA 4DLNA 1WKVA 1Z88A 3NHWA 5A3JA 5FI5A 3FOZA 1DBSA 1K75A 1S4MA 1I8DA 2WEKA 3IR7A 1LSSA 1XDWA 4R0VA 1W0KA 4DNTB 1FSSA 3LPNA 1EVYA 3NDPA 2C3UA 4HZGA 2BMWA 2OENG 4EKIA 1GGMA 2GPWA 4TTSA 3I04A 3IP6A 1WXXA 1Z12A 1D7OA 2BP7A 2G6TA 2C3MA 2OCXA 1WKCA 3BH0A 4GX1A 3V8NA 2NUPB 3KEOA 2ZBQA 5EKSA 1X94A 4QQRA 5ITVA 2PZEA 2WFZA 4E4RA 3NHBA 3VR6D 1B4DA 3EJWA 3P9RA 4JJZA 4XIYA 4L8FA 4ND8B 4MO9A 3VR5D 4QL3A 1TECE 4C76A 1GNPA 1IB6A 2W42A 2OFXA 3CH4B 1VGQA 1N2CB 4OJMX 1PFKA 2F3SA 4OEHA 3ODGA 4BP8A 3Q3IA 4MUXA 2FMXA 3ONWA 5IDWA 1QU2A 1U0RA 1IIRA 2O7RA 3PZRA 4PHCA 1GFZA 1P62B 3E05A 1QBKC 3GQBB 4JC0A 1JDBC 4Q39A 5EP1A 3QYFA 4GPAA 4EGQA 5KQLA 1P74A 4N39A 5F3DA 3GFTA 1PZGA 1LLFA 2CJFA 1XRQA 1F2TA 3HJTA 3RD5A 4KQWA 3HJGA 1VJGA 2QROA 1TZCA 2WTBA 3Q0IA 2BZGA 4M1TA 2DFNA 1RBMA 2RI1A 3KVVA 3MOSA 4HAXA 2QA5A 1ORVA 3A1UA 4O6VA 3V8BA 4CM8B 3RU9A 4K28A 3MBIA 5CVVA 3BMNB 1EWTA 1G38A 4EEZA 1U2DA 2BTEA 1N8KA 1AGRA 3B3GA 1RZ3A 2QTBA 2Z57A 3CISA 2P8JA 4YQZA 3UO8B 4DNXA 4I08A 3Q39A 4EH1A 4CPDA 5A8AA 2I6SA 3H1GA 2YNMC 4V0QA 3A8IA 3SF0A 4F3YA 3DDHA 3LL4A 3UYKA 1EE2A 4Q6WA 3V1NA 4E5UA 3W1VA 4KIGA 3EPKA 1TT7A 4O1IA 1RP1A 3Q40A 1I13A 3PXDA 1RACA 4FEYA 5BSYA 2J33A 1YZYA 3C5WP 3K0SA 5K7SA 4X24A 1H2YA 3GLIE 3QOFA 1H2FA 5C80A 1SPXA 4XPIB 3ZLTA 3I3SR 1AKQA 4RL6A 1N2JA 3GRVA 1U2GC 3WGLA 3JWHA 4HYEA 4M1KA 1RT9A 3E5MA 4ZZIA 3DFMA 1W1WA 3FYUB 4PU0A 1DRKA 5H81A 1Y6GA 1E6WA 2GASA 3LW8A 5G40A 1EUCA 1I36A 1DMSA 2ZP1A 4LKOA 5EIFA 1GUDA 4JSYA 3GEGA 5IYPA 5CH8A 3R3HA 3M3DA 4JLVA 1V11B 4Q3KA 4CYMA 1SKUA 1H2ZA 1CVLA 1VIVA 3FJOA 1YZKA 1NT4A 2Z30A 3OM0A 4CLRB 5A4DA 4CKZA 2EEPA 1WBDA 1R9GA 4YAFA 2FSHA 2HZBA 3B36A 3RSCA 1KP9A 3TD9A 5KCZA 3OESA 5EE9A 5CAEB 3ITKA 3FHJA 4JVMA 2QX6A 1PD0A 1X8LA 1PWZA 2NZVG 2XUIA 3Q2OA 2DIEA 4PWYA 5IAKA 4EG6A 3KZVA 3GJ4A 4YAKA 3RIYA 4LQ4A 1TOAA 3M4XA 3EEFA 5AVVA 1OIWA 2GBIA 1FLAA 3NHKA 1MXFA 2I6FA 5BR8B 2OHVA 4Q4HA 3EX7C 2I33A 2NXNA 1A95A 3D3WB 3MWLA 3AJEA 1E9DA 1H1DA 3D43A 2P4SA 4UU7A 4YR9A 3A06A 1VLVA 1KFKB 4NOLA 3UJPA 1T5LA 1J00A 2JBAB 4JBGA 3LXRA 4JVSB 3EDMA 2C5SA 2WMDA 3MJEA 3PEUA 4FLFA 4HX5A 1TRKA 1M6WA 5BN4A 2YH2A 1Q3KA 2IY9A 4I50B 2FDRA 4AM8A 1TQ2A 2A0FA 5AJTA 4QV2A 2C5FA 2J6IA 3B6EA 4HFRA 4I4TF 4S3MA 4CKEA 2DKFA 2AJDA 1RD4A 3AUJB 2X9NA 5D5HA 2VTBB 4E5NA 3ENKA 3ODPA 4GP6A 1JAXA 4RD0A 1ARZA 4OJTA 1IBSA 5LWQA 1VSTA 1NAIA 2ZRNA 2H54A 4FDLA 3ZLBA 3I61A 1X9HA 1YBAA 2FW9A 4NH0A 5JBQA 2ZRDA 3ND5A 4GE0A 2C78A 4XN0A 1S7CA 2YXEA 4XSHA 3G8AA 1NR5A 3BWMA 1ACMA 3L6BA 4HGZA 2CFIA 2HSZA 3UV3A 2Z98A 4Q9HA 2CWDA 4FE3A 1CULC 1GL3A 3WNVA 3CIOA 3QJ5A 9LDBA 3NV7A 5BSHA 4UEOA 4BN4A 1IHDA 3QWBA 1U8XX 3S1SA 1KORA 1M1UA 1ZSYA 4LYDA 4RVNA 5DWQA 3PG5A 4XB6B 4Y2HA 4GQNA 1DWOA 4KDEA 2ZT7A 3ER8A 4RVGA 1Y0YA 3COYA 2KSQA 3MGBA 4OKIA 4IXNA 5TARA 4R8MA 2PRZA 1K6XA 2D1YA 1JH8A 2V9CA 3AOEA 4H0CA 4NE7A 3V8MA 2MWMA 4HVAA 1VB5A 5ALYA 2KMLA 1GCOA 3TLGA 3EPLA 2E4AA 4YLGA 5E7IA 1YCGA 3HB9A 4D4KA 1OREA 4V0LA 1TVEA 3O4GA 4K9LA 4XDGA 3VXKA 4Q4CA 4WNCA 2ECQA 4ER6A 4F5DA 2Y0EA 4CV2A 1X8JA 4DMFA 4YRNA 1FZQA 3REQB 4C05A 5C8XA 4X66B 1C30B 4KH0A 1BHO1 2FEMA 2J3DA 4BX0A 3GT7