2B7BA

Yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a and gdp
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
440
structure length
440
Chain Sequence
GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1-alpha
publication title Mg2+ and a key lysine modulate exchange activity of eukaryotic translation elongation factor 1B alpha
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 115
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7bA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2b7bA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b7bA01
1QHGA 1VQ9B 1QFZA 2NO1A 4CEHB 4A0GA 3R9WA 3RWOA 1CJKC 3W6OA 1KK3A 3CCMB 4LZZA 1TU4A 3DMDA 3LXXA 5JZVA 4M9ZA 4KFUA 4O0MA 1N6HA 1YHQB 4U5XA 3PITA 3EW9A 3WRXC 2AKYA 1IXSB 5L3QB 4NTZA 3RYTC 1GFIA 4E07A 1P6XA 2W2XA 4MRRA 2AXPA 1OFUX 1DG1G 3EXAA 4DKXA 4PANA 2WTUA 3MD0A 1ZM9A 1QVGB 2IUSA 5EE9A 3PQCA 4MGKR 3BXZA 5G3ZA 3ZLJA 4Y9RA 4KVGA 1G9XA 1QHXA 4V03A 1DDIA 3CW2A 2CVHA 2ZJAA 1Q1QA 1BX1A 2UKDA 4MGZR 2IEYA 4M21A 1MABB 3H84A 1H8ED 4II7A 3LA6A 1JXOA 3KL4A 2QM7A 3VFDA 4AIIA 3AVPA 2DB3A 2FFQA 1XTKA 1E9DA 1Z0JA 4DEYA 2VF7A 4ZI3A 3DL0A 1WBDA 4RKEA 3N2EA 4OQXA 3MGCA 2VHUA 4HSEA 3PUVA 3DKPA 4EQ6B 4TMWA 1HE1C 3CH5A 1D2MA 4ESVA 2GEDA 4BEJA 1E9SA 5J40A 3I73A 1FW6A 3NBFA 1VKJA 1G3IA 3V9PA 3FHTA 1O3YA 1VYTA 4N1AA 3SI7A 3SJCA 1FUUA 1SHZA 1TPZA 1ZNYA 5EP1A 3ZD6A 3QG5A 3RS4A 1Q21A 2A30A 2XITA 4D2IA 4LHWA 3T61A 2O8BA 5JRJA 1JR3E 2JEOA 1NN3A 2UZIR 2PCJA 4Y9UA 3W2GA 1VMAA 4FMDF 1RFLA 1MT0A 2WJYA 4M1OA 4LCBA 4AD8A 1R4AA 2PLRA 4LBVA 3TQCA 3THWB 4C0BA 1YJ5A 3B1WA 1Q44A 3CIOA 4R71A 2VNHA 2OSBA 3CO5A 3FB4A 4GOKA 1PUIA 1FX0B 1BIFA 1GAQA 1P7CA 2GQFA 3CWQA 4MYHA 2ONJA 2MSCB 3UG7A 2P3SA 1KRHA 1TU3A 2IYZA 4KYIB 3B2EA 5EP3A 1D2NA 5LB4A 2ZJZA 4CZ2A 4URXR 5KDOA 3LV8A 3QFTA 5HCIA 1G8FA 2JIZA 4LUCA 2QENA 2YOFA 2ZVPX 1QUEA 3Q7PA 4BUJA 1II0A 4C0KA 4AURA 1LF5A 5HKKA 2QEXB 3RDPA 2ZR7A 2XTNA 5G40A 1IN8A 1LS6A 2ZRAA 3Q8XB 4CT4B 2LCFA 4Z1MA 1E4YA 4M0LA 4L16A 4I81A 1XNJA 4L9SA 1ZCBA 1H85A 2P65A 2OE2A 4JLJA 2RGBA 1YIJB 3AVWA 1E2PA 1OXTA 5EXSA 4ZKEA 3KX2A 4CT5A 3BJIC 5CB6A 3GMTA 3R20A 4NCJA 1OV4A 4ACAA 1PJRA 3P32A 4OK3A 3JQRA 1TVCA 3OEEA 1NP6A 3KJIA 3ZD7A 1YHNA 3W5UA 3NVAA 4TYWA 3MHPA 4N0EA 3FKSA 4ESHA 3Q5EA 5EP2A 1Q1EA 2OLJA 3NBYC 3THXA 4TLBA 3BH0A 1II8A 5CDFE 2OEPA 2J0QA 3O8CA 5FI1B 4TT3A 4R7ZA 3EZ2A 1TX4B 2IS4A 1TF2A 2XJ4A 3SU8A 2ZIAA 4DLXA 4W5HA 3LFUA 1S3GA 3I32A 1VG8A 2O8CA 4TLCA 1E2QA 3PVSA 1A2BA 3I8XA 4UXIA 3CNLA 4EPVA 3AP2A 4BRWA 5JHHB 5BYKA 1Z29A 1G3UA 2EFHB 4D4JA 5JSZA 3Q72A 4KCGA 5F98A 3GLHB 4L4UA 2FWRA 2XXAB 2KJQA 4C7OB 4JBYA 1E62A 3QENA 4AKEA 3AUXA 1FPMA 4MKHA 3VKHA 1K9MD 5CM8B 5D3QA 2GHIA 3GEEA 2WOJA 4DLTA 2HJGA 4QG7A 4DSOA 3B60A 1CJUC 2D2FA 1XPRA 1NJGA 3EWSA 1KQSB 1P9WA 1W5SA 2DFLA 4QOSA 2OFWA 4ASUD 1MR3F 2ZUBA 1YJWB 4RD0A 2ZREA 1LFDB 4TTRA 5B30A 3AUYA 1WB9A 3ICEA 2CMKA 1W35A 1VQ8B 2PL3A 2R44A 2ZI6A 1SZPA 5EXXA 4Q1BA 4QC2A 4JJZA 2VNJA 3A58B 5GJCA 1OIVA 2EYUA 3QKRA 4QXAA 5IK2A 2V55B 3VR2A 3K70C 2QT1A 2ZYVX 1KO7A 1JPNA 3AVUA 1ZRHA 4JT2A 4Q1EA 1KOFA 4DB2A 1KKLA 4JT4A 4Q5IA 3SC3A 3IHLA 2CE2X 2ODEA 5HE9A 3KKQA 3KQHA 5DIFA 1T5LA 2OAQ1 2O8FA 4BFTA 1D1NA 2D06A 1U9IA 2MSDB 3CMEB 1XPUA 1F2UB 1EWRA 1G19A 5FTJA 3SJBA 2DBYA 1Z6AA 3L0PA 4URZR 3SS8A 4EJSB 2YWHA 3CONA 3Q9LA 2FA9A 1S3SA 2A2ZA 1ZMXA 2ZJOA 2XNCA 2ZSFA 1F60A 4LV5B 3SJZA 1IXZA 4QHTA 3WP1B 2EIXA 1IN5A 2F1RA 4OHXA 3BS4A 5HKKD 1UMKA 4IFBA 1TADA 4P4UA 1CR4A 2G88A 4NONA 1OT3A 4ZCIA 2ZRKA 3AF4A 4BLTA 4RKFA 1AQUA 1QG0A 4B43A 1DELA 2XZPA 5ANRB 5EUQB 4YAWA 3GJ0A 4RVCA 4AK9A 2YWFA 3FMIA 3ADCA 2FSHA 4JLVA 4NMMA 3K8YA 4M1SA 2W6JA 1CR2A 4Q18A 4HZUB 3ADBA 1EG7A 1BKDR 2RGDA 4LHVA 3UG6A 1G20E 3RVBA 2XOKA 3LQQA 1RZ3A 1T0HB 1ZVQA 1QHHA 4DJTA 3QEOA 4IEIA 3KB1A 1PLKA 1U98A 3EA5A 3AQ4A 2IYYA 4AKIA 4JSTA 1T9HA 4C3ZA 3FKSD 1Z63A 5F9FA 2GXQA 1F20A 4F93B 5HXBA 4LYFA 4NE2A 1I2DA 5UKDA 4UNSA 5GJVC 3QF4B 4O2LA 1IOZA 2A78A 5KNCA 1G1MA 1Q57A 4NYIQ 1KZ7B 5BYJA 1CR0A 2AFHE 3I72A 4K8OA 5JS7A 4TT3D 2BDTA 2GA8A 2B8TA 3WMFA 1XPOA 1Q0UA 5FBRB 1G291 1XDBA 1L8QA 4RD3A 2VA8A 3AKEA 2IUTA 4K1XA 2WWWA 3TGPA 4LJ5A 2GRJA 3IILA 3QPVA 5JRZA 1R5OA 3CWZA 5CK4A 4EIWA 1CF4A 5KPDA 1LNZA 3IPYA 4TTPA 2J0UB 3NKVA 1BQEA 4C9BA 3TUJC 3VNUA 1LV7A 3MJHA 4B76A 3VQTA 1A1VA 1Q3HA 5L3SA 1TTTA 2FH5B 3K9HA 3TUIC 2BCGY 2D3WA 2EFGA 2PEZA 5TB5A 1TF5A 5CITA 2C8VA 1GDDA 2J7KA 2MMGA 4X8HA 1P72A 3GJ5A 1RPZA 3LO8A 2CLDX 3CRQA 2Z4RA 1M6NA 3I92A 1R0XA 3VNVA 2ODWA 2GCPA 2OCPA 1GM5A 1XP8A 3W5HA 1JBKA 1SXJB 1CQXA 4DQLA 2WWHA 3FFAA 3WP0A 4DDTA 1UDXA 2QROA 2ZM5A 1OIWA 2GJ8A 3F5FA 3IEUA 5CJPA 4DEXA 5FI0B 3NDBB 4QM7A 3EPJA 3CMAB 4YMSA 3D31A 3QFRA 3QFCA 4FIDA 1ZM2A 1SKYB 4PAOA 5IK2D 4ZKDA 1X8KA 4YAOA 2RC5A 5KNDA 2AL7A 2RGNA 2XNJA 4D25A 1QGAA 2DHRA 1KSGA 3DEFA 1VYUA 3NEYA 3NBXX 4TWZA 1NY5A 1GTVA 3K53A 2IYVA 4C0JA 4JVMA 5EE5B 2BMJA 1JJ7A 3ZS9A 4F4IA 3QNUA 4B6FA 2QPTA 2V6IA 4Q9IA 1NDHA 4RFSA 1X1SA 4EPTA 5KSPA 1IJFA 5TXGA 5DHAA 3B1VA 3I55B 3ZJYA 3DPUA 4Q21A 3RC8A 1T3HA 1VTKA 5JCPA 1KO1A 3I62A 4Q9HA 1AQYA 2Q3FA 4CF7A 1W4BA 3LNCA 5F2EA 2C9CA 4PHGA 2AK2A 3ZZUA 4R98A 4D0GA 2W2TA 4B47A 4OQLA 3GLGE 3KUDA 4W5JA 1ELOA 4PC7A 2R6FA 3GLFE 3GFPA 1FUKA 1U2RA 5H70A 4Z54A 2R65A 5DI9A 3UMFA 3E5HA 3PEUA 3OEHA 1JNYA 4LBWA 2B8WA 1J8YF 1UM8A 3QXJA 4JLMA 4Q19A 5EZ5A 3X1XA 1T6NA 2GJKA 2W6JD 3SZRA 1XRJA 1NBMA 1TUIA 2VSOA 1CU1A 2ZRGA 2A5JA 5KU1A 3UKDA 3DOFA 4WOPA 3QQ5A 4EUNA 1LS1A 2ZRPA 1HQCA 4F7DA 3VKGA 1BH2A 5D3MB 1G7CA 2Z0MA 4A0RA 2ZVQX 2BWJA 3THWA 3QIAA 4IKEA 3HR7A 3V00A 4ERNA 2RAPA 2XX3A 1COWA 1E0AA 4GPTA 1DVRA 3WYAA 4IRUB 4KFSA 1FNDA 3IO3A 3SNHA 3A36A 4PR0A 3QF7A 1G8YA 4LY6A 2I4IA 2C96A 1IY2A 2G0TA 3EC1A 1FP6A 3UK6A 3LVQE 3KQUA 2P0EA 2C9YA 2D4HA 5E7MA 2PMDA 1CBUA 4PAMA 1W48A 1CNEA 1YRBA 1YZGA 2IYLD 2VQSA 3I3SR 5KDDA 3KJEA 1EX7A 2WIBA 4A6XA 1F3OA 1U8AA 1G4AE 3U7FB 1I4LD 4KU4A 2V7QA 4KLZA 2QBYB 2QPOA 2I1QA 4PO1A 1HE8B 3RANA 1XEXB 4A8JA 2A9KA 5FPSA 5C4MA 4DLVA 4M1YA 2ZSDA 1AIPA 3QUSA 4QNRA 2FX3A 1P9NA 2FJUA 4S35A 3VR6A 3J81k 4FWTA 3CPHA 1S96A 5L3VA 1XJQA 1BJKA 4LJ4A 4EPXA 1SVOA 1W36D 3TQFA 1ZD1A 3K1JA 5J4LA 1BYIA 3JZMA 4IDHA 5B58C 2PH1A 3AGQA 1T0JB 5JI3E 4BFXA 4DSNA 1UKZA 3BAFA 1NSTA 1MRSA 3FHCB 2FGKA 2HXSA 4QGAA 5A5GA 3DZ8A 3LBHA 4B4DA 1HT1E 1Z0AA 2O52A 4IFEA 4HAUA 3ZVLA 4A9AA 3KXIA 1W2HA 4R2IA 3WBJA 4FD2A 3ZBTA 3DM5A 3GFOA 2IS1A 1N0WA 4V0LA 1M1KD 4DLSA 1LB1B 4LC0A 2XB2A 1VCOA 3RS2A 4G0NA 4DXAA 1G3MA 4US0R 5FL3A 2VF8A 3UXMA 2YZ2A 3KFVA 1E64A 2E1RA 2G77B 4HB3A 4D81A 3P26A 1GKUB 1XMSA 1YKSA 4IXNA 4PHHA 1YR6A 2KBEA 3AF1A 1GVNB 4TL8A 3GPLA 4XOIA 4KFRA 5GV7A 2WJHA 4E5UA 2X19A 4WQMA 2XAUA 2WWIA 1WQ1R 5JI2E 4ZGNB 3G82C 3U3MA 4HUTA 1KI9A 2ZJ2A 2QTZA 2W00A 4ZDKA 4P4TA 2WOOA 3EZ6A 4MYUA 4KO8A 3TAHA 4JLKA 4CEJB 5FBLB 1OXUA 3AV0B 2WHXA 2QAGC 2XSZA 4L9WA 1FZQA 2IYWA 4LSGA 3K0AB 1OXVA 3OEHD 4EH1A 4TSFA 3X2SA 2OCAA 1N25A 3IIKA 3Q85A 3WNDA 3E1YE 1NBMD 2IF2A 2C2HA 3BIFA 1E0JA 2H1LA 3BH7A 2R6DA 4HAVA 4DCNA 3CX8A 1QVAA 2PBRA 3L8YA 2OBMA 1JQJC 2N42A 2QE7A 4NL4H 5DHFA 1E0KA 1XXHE 2BBOA 1COWD 5E4FA 1R5NA 1L4UA 5C1BA 1E96A 1GZSA 2OBNA 2ZANA 3QEJA 1K73D 2ZI4A 4D26A 2NQ2C 1GKIA 4OHVA 4Q4HB 4US2R 3GLGB 3G4SB 3GLFB 2QNRA 3M1IA 2C04A 2DY1A 1X8JA 2VHTA 4TQ9A 1NIJA 4X8OA 1MH1A 2K5UA 2BEKA 2V1XA 2JA1A 2F3TA 1DAHA 2MMCA 1CR1A 1KDTA 4HB2A 4M9QA 4UNRA 3NHAA 1T3SA 5KSYA 3ZDQA 1W34A 3U4QA 4DDVA 1XMVA 1TF7A 4QJ5A 2DFKB 1BYUA 1KD1D 1R6BX 4Y0AA 4BZXA 1I4DD 1A2KC 1NI3A 4I1VA 2UZ3A 4HZUA 3O8RA 1RYHA 3KKOA 2Q6TA 3SFVA 1OSNA 1CULC 3EZ9A 5IRCD 3TAUA 4OHYA 4GFDA 1N0VC 1AS3A 2QU8A 4BWYA 4PC2A 3AVTA 2ZI5A 3ND9A 2C98A 4QM6A 1OH5A 3LRPA 2FZLA 4C2TA 4JYCA 1CRQA 2RMKA 2VO1A 1D9ZA 3SYKA 4S2EA 1U81A 4Q4JB 5DYIA 3QF4A 3BE4A 1M7BA 1UBGA 3NDPA 4MQBA 2W0SA 4GMXA 4LK2A 3THYB 1QRAA 3NG1A 1D8TA 3PUXA 3SN6A 1ESNA 3IPXA 3T5DA 2ZRFA 4ZDWA 4OKSA 2OXCA 2GETA 4FK8A 3C7KA 3PFIA 4EKDA 3U5ZB 1E99A 2VHQA 2VP9A 1JPJA 3WY9A 1N6RA 3L43A 3F8TA 3PENA 3AH8A 3NIBA 4U00A 4G1VA 2JATA 3VX3A 1AS2A 1PV4A 4B2PA 3QE0A 5HCNA 1F6BA 2QRNA 1VQ4B 2QTVB 4LJ6A 4TZ0A 3LLMA 1G5TA 4XIGS 2ZRHA 4BFSA 4AYTA 2IXGA 4TQAA 3K0FA 2HUPA 3GQBA 2YOGA 4YDHB 1EX6A 1NLYA 4ARZB 5KYKA 3TR0A 1RC8A 4PPNA 1TNDA 3G71B 4G5SA 4IOJA 3W34A 4ZIRB 1Z0KA 4N0DA 3EASA 2NMVA 2F43A 3SBDA 2W6IA 1SVWA 1XD8A 2RKOA 3H1TA 1WMSA 4HAYA 3H2YA 1SXJA 2CLSA 4IXMA 2QTLA 2VNKA 4F4JA 2RGCA 2BM0A 4AC9A 3LO5A 1US8B 1Z07A 4CDGA 1DO2A 2XSZD 2FNAA 4UXHA 3VR1A 5FPHA 1N6NA 2CEAA 3ZGXA 1W0KA 4AG5A 4NCNA 1E1QA 1Q20A 2FF7A 4PC3A 3AF0A 4TSFD 5CLLA 1TLLA 2IHYA 4Q9KA 1DAGA 5J4KA 3VO2A 1DAFA 5DE3A 2BMDA 2BBWA 2I3BA 4HEJA 4LBZA 4HUQA 1G16A 2AR7A 1G7SA 1WCV1 2YINC 1W87A 2GEUA 2VP2A 3R9XA 2A5DA 4IVQA 4LJYA 1J7KA 2QE7D 1B2RA 4DCTA 4L5BA 1N2CE 1T3LA 2GJAA 3A1TA 2OK7A 4ASUA 3RABA 3SFZA 5EP4A 3X1ZA 3EPKA 1R5BA 2KE5A 4GI7A 4URUR 1U9IC 4DZZA 5DLQC 1WP9A 1JB1A 5JEDA 4D4KA 1VHLA 4UKDA 2ZITA 4EAQA 4RJLA 2G3YA 3EIEA 1L4YA 1J8MF 3DVLA 5DNYB 2JLRA 4GP6A 1E69A 3LAWA 2EWWA 2ANCA 5B64A 4BECA 3OHMA 1E6CA 1D9XA 2ZU6A 1RRCA 4KITB 1FNBA 3M0EA 2R6GA 1CKEA 4GOXA 4YMWA 4IJMA 3K70B 1IJEA 4Q47A 2Z43A 3QFSA 4CEIB 3UANA 3GLIE 3I1FA 4C43A 1Z8FA 4DVGA 4KHZA 4V0MA 2O8EA 4IW3B 2W2VA 5GJBA 2QP9X 2V1UA 4G3XA 4O2RA 1LF0A 4CW7A 3CLVA 3H0KA 2N46A 1YR9A 4DLZA 1UBFA 2R8RA 1U0JA 1ZYUA 1S9HA 2X1VA 421PA 5LB2A 3CF6R 3KKMA 3B6EA 1JAHA 1LTQA 4U7DA 4FMBB 4BLQA 1W49A 1KGDA 4RD2A 2GJ9A 3V4FA 4ZCMA 2IYSA 1P2UA 4QBHA 4B3GA 1BOFA 2Q9BA 3I8SA 2FN4A 4Q1FA 4A2QA 4RZ3A 2GESA 2GZHA 2QTFA 5FTNA 3RS5A 4PSKA 1M7GA 3QSYA 1NJFA 3UMSA 4PO8A 3ZQ6A 1TEVA 2A5YB 1Z0DA 3REFA 3MFYA 4DDUA 2IWRA 1G6HA 2IL1A 3IHWA 4BLSA 1VCMA 3NC1C 4WIAA 5HE8A 1E9RA 4AF7A 3UWKA 3BH6A 1ZUNB 1G21E 2WIAA 3EZFA 4KAXA 1YQTA 1TMKA 5EE0A 2QBYA 5KO2A 2HLDA 4TZ6A 5TV2A 1XCMA 4QJ3A 2VP4A 3ZH9B 2GK7A 2B7CA 1Z2AA 1YZLA 1M8PA 1M7HA 1UBEA 1IY0A 3VR5A 3QJYA 1M2OB 4MRPA 3CB4A 2QY9A 1FRQA 5K8LA 1IAQA 3CF2A 4XVQA 4PPGA 1AN0A 3S1AB 1KDOA 3ASZA 1W0JA 4AG6A 3SBEA 3A1UA 3WMGA 2W6ID 1XD2A 4NYJR 4D4LA 1AK2A 1SXJD 4HZIA 3SQXA 1EWQA 1K8RA 4XH9B 2ZU0C 2BGJA 3HJNA 2ATVA 2OZEA 4W5WA 5KDLA 3KQLA 4KSCA 4LBYA 3CKLA 2CHVA 2CJWB 2BN4A 3QOFA 4DLUA 1BS1A 1G8GA 5AJVB 5FTKA 2DERA 1B0UA 4PPQA 4Q7LA 4QBIA 2GTPA 4TMVA 2AX4A 1W0KD 3B8HA 2Q9CA 1E1QD 2Q0HA 1E98A 4BQSA 2GCNA 3CBQA 3NH6A 1O87A 2BVNA 1VQOB 1VQ7B 2V3CC 4D80A 3SQWA 1IQPA 3TH5A 2ZJYA 4Q1CA 4C0HA 3O8DA 1I4TD 3Q7QA 3SHWA 1OJLA 4OL0A 2QQ0A 3U44A 4IDPA 1HQYE 4I1UA 4DIEA 1QFYA 2RGNC 2B6HA 1I2MA 1NVUQ 4IDOA 1W46A 3CCVB 4HAXA 2QA4B 4ACBA 2IYXA 3PCRB 4JVSB 3GD7A 4MDFA 1E2DA 3U6BA 1LVGA 1E4VA 2OTJB 1N6KA 2WMNB 1OH7A 1VIYA 4KSBA 4UQOA 1AS0A 1FDRA 4OQMA 4TL9A 5IDVA 3U3RA 2WAXA 4BPRA 2HYDA 1QX4A 1VQLB 1KIMA 2REBA 1R0ZA 3ASYA 1VQPB 3F0TA 5DI3B 5H8WA 2ZE6A 3EC2A 2FOLA 5KPJA 2WVJA 2AD5A 3EPHA 2A5FA 3D3QA 5TARA 5M04A 4URWR 5J47A 1M1YE 5EXPA 4FXPA 1W47A 2W58A 1X86B 1N5KA 4EPWA 4HLCA 4XVUA 1NVXQ 3K0AA 1CNFA 3WNBA 1KI6B 4PQFA 5LD2C 4HAZA 3VAAA 1QZXA 4LGMA 3VKWA 1UEJA 4KVAA 4Y7CA 3P4XA 1OXSC 2JLXA 1L7VC 3L8ZA 2GPJA 5K8IA 4A92A 1QUFA 4PTLA 5FFMA 3C5CA 4MRNA 2WWFA 2IUUA 5BN3A 8OHMA 1E3MA 4UNPA 1SULA 2R6HA 1N6OA 1ZNXA 1XU4A 2IS6A 3BB3A 5CK5A 2G83A 4TMZA 3K09A 5GADl 1VQMB 3TR5A 2VSXA 5THXA 2CL6X 2GZDA 4DT1B 4PSAA 4DRZA 1S1MA 3ZYCA 5FPTA 1JB9A 4M4SA 2BMFA 4JKIA 2F6RA 2FFHA 1LW7A 3T1OA 1HUQA 1UKEA 1VG9B 4KXFB 4HB0A 1Q7YD 3GLIB 1TQ4A 4HE6A 1FRNA 1ZP6A 3CPWB 1T91A 2BBSA 4LHZA 1R7RA 1CS4C 4GBMA 3KQNA 3U7GA 4ILEA 621PA 2HLDD 5AN9A 4DB4A 2C77A 1E2JA 1AM4D 2P6NA 3IKJA 5KTYA 1HA3A 4DWJA 1X3SA 2PZEA 3HDTA 2VSFA 3MWLA 2OLKA 4DCVA 3K0CA 4P33A 5KSOA 1T8TA 2WWYA 1QG2A 3QXXA 1NJID 2KWIA 2B5OA 5JWOA 1HY3A 3IIMA 3PEYA 1G8PA 2GXSA 4A8JC 1W0JD 5CYOA 3DZDA 3K0SA 1OPXA 1GITA 5FR2A 3EAQA 1G4UR 1KC8D 1ZUHA 3IBYA 2WSSA 3I4LA 4MGIR 1OH6A 4LYAA 2NO0A 521PA 2FPKA 3HYRA 3TVDA 4H9GA 3NC0C 2RH5A 3SYLA 3THYA 2CE7A 4NYJQ 1RYFA 4MH0R 4PC1A 3L0OA 2BJVA 1NVVR 2B92A 2ZEJA 1UDWA 2R9VA 1FTNA 1HT2E 3CXCB 4B75A 1GP2A 3LWNA 4BPBA 1ANKA 1P61B 2G6BA 2ZI7A 3HP1A 1W4RA 3EA0A 2IWHA 3QVUA 2OFOA 3WNCA 4BFVA 4QHSA 3CC4B 3QG1A 4BRUA 2IYTA 3T12A 4F92B 1KYIA 2H17A 3ZIAA 3IBGA 3BORA 3UATA 1Z0IA 2P5TB 1E2LA 1U8YA 3AKCA 4DUGA 3CCUB 2QMEA 1EP3B 3A6PC 4Q02A 2QPAA 2PX0A 1KK1A 4CEHA 2F1IA 2IC5A 3GFTA 5GJWC 4BFZA 3P4YA 1KSJA 1KSHA 1YR7A 3BBPA 1DS6A 1IXRC 1ZW6A 1U94A 3A1WA 4G5RA 2ZRDA 1NIPA 1XTIA 4B2IA 5L3QA 1YR8A 4XD7A 5CYPA 2AXNA 1OGIA 2CCGA 3GJ6A 3W2FA 2BEJA 2NO7A 1XTSA 2QL6A 4LPSA 1US8A 3WYGA 1GL9B 2AKAB 3TE6A 3TBKA 2GNOA 4KI0A 3TW8B 3QI2A 1S8FA 4TYYA 4A0HA 4G1BA 5FH9A 1KMHB 1DEKA 3CUEF 1P2VA 2GAAA 1KI3A 2ZE7A 5ELXA 2GDJA 2ASEA 1KO4A 1MABA 3NEJA 4X8MA 2X2EA 3QPWA 4MGYR 4JS0A 1P60A 3CRVA 5G41A 1EFCA 2QAJA 4D82A 2PZFA 3D7MA 4GSYA 1YI2B 3IDQA 2OHFA 2VP0A 5SZHB 2H16A 1HV8A 4RCYA 2YC2C 4YXWA 1JXMA 4TMTA 2W0MA 4Y0VA 2Z5FA 3ADKA 1OFTA 1SKQA 2ZXUA 2YKGA 3R8FA 4TLEA 4WZ6A 1Z08A 3B1XA 3AVXA 1KNQA 3CPJB 3LX5A 4YAUA 4OBEA 5J4YA 4I1OA 2OV2A 2PT5A 4MKFA 4A2PA 4EQ6A 1Q86D 1FNNA 5BN5A 3AB3A 3FE2A 3T1TA 3E20A 2Z83A 3T5GA 4W7SA 3RRNA 2B21A 5DSZA 2DWQA 2F3RA 2JJ1A 4M1WA 2RGAA 5AUOB 4NPHA 2QAGB 1FNMA 1W2BB 1QHIA 1Q81D 2ATXA 3K0EA 2HMAA 4JLPA 3X1DA 3W8RA 2QA5A 4YHBA 1VQ6B 4JLBA 1U0HC 1W44A 3PUWA 4PQRA 5FTMA 3RSLA 2ZTSA 4DLWA 4QFMA 3VO1A 4OI2A 4Q1AA 4OYHA 4CEIA 4MYCA 3W5VA 2QSYA 1YZQA 4IEEA 1XMJA 1RE0A 2VHJA 2OBLA 2KB0A 3LW7A 3CRRA 4B34A 1HH4A 1CP2A 2D2EA 2EFEB 5E7IA 5SZIA 2GXAA 3AVVA 1ZC3A 2GILA 4ZO4A 3DMNA 1OF1A 3X1WA 5CB8A 1FX0A 4HE5A 2FPMA 2FEOA 4Q4AB 2JLUA 1T5IA 4AY2A 1W1WA 1IM2A 4WZBE 2CNWA 4URYR 3CCJB 4M9SA 5JWHA 4C0QC 3BOSA 4KYUA 4C0LA 1PZNA 1IONA 1E9CA 2ODNA 2DETA 2WSSD 5B57C 1N5JA 4RCZA 1SVMA 2RGXA 5FTLA 1GIAA 2BGIA 2WJVA 2JLYA 2V9PA 2IEZA 3HU1A 3CCRB 2EYQA 3T06B 2F9MA 1VG1A 1ZBDA 4HLQB 2YWGA 5C4GB 1G5PA 3QXHA 5FOSA 4BLOA 1SM4A 5JECA 1IN6A 3ZVMA 1P2TA 4JVNA 1RVDA 4C30A 2BIFA 3RAPR 1KDRA 4EDHA 1Q1ZA 3TK1A 4D0LB 3VMFA 3BD9A 5TMPA 3D8BA 4LPKA 2IA5A 4F91B 1XTJA 3AKDA 3ND8A 2VL7A 4N3NA 4W9MC 1QVRA 1NMZA 1FMJA 1WA5A 1WF3A 4GRAA 3VTKA 3HYTA 3W5IA 1RRPA 2CVFA 3D6TB 5FPYA 3ZIAD 3HPRA 1G41A 4DUGD 2P2LA 4B6EA 2J87A 3H4MA 3FKQA 1E2KA 2QQEA 1EFUA 2OUKA 2WKRA 3ONWA 5J4VA 5FOWA 1EFHA 1YU9A 1ZC4A 1E2NA 1DADA 3W3AA 3W5JA 4KBGA 2A5GA 1H8HD 4JKYA 3BFVA 2O0HA 2WWXA 3W6NA 2Q21A 3AP3A 3NWJA 2REXB 3AVQA 4YC7A 3RS0A 3W2IA 4JYBA 4XD7D 3VHXA 2GF0A 2Q3MA 3C15C 5A4JA 1EXMA 1R2QA 5EE1A 4ZDJA 3THXB 1II8B 1WBBA 3DKVA 1JEEA 1G3RA 1GR1A 1N8RD 4RD1A 1SXJC 1NMXA 3FTQA 3CR8A 5LBIA 2IS2A 1PVOA 1KNXA 3GLHA 2XXAA 2JLSA 5FUXA 1GRNA 4C7OA 1MKYA 2BJWA 4CVNA 3WRYC 2O8CB 3EPLA 3LQRA 1XF9A 4IOLA 2VH5R 5JLJA 1SVIA 4OK6A 2PT7A 4G5GA 221PA 3ZVNA 1QGZA 2NGRA 1Y63A 1KY3A 4WZAE 3N2IA 4YXWD 3FFBA 4I4LA 3RHFA 4B32A 2V4ZA 4MDEA 3OE7A 4Q01A 4C0SA 2OT3B 2ZSAA 3C8UA 3CZQA 2OILA 3U3KA 3JQQA 2FG5A 2C5LA 2ZE5A 1DARA 4TYPA 1YRAA 3TUZC 2RGGA 3W2EA 1W4CA 2OAP1 1ZAKA 1DAKA 2EFCB 2EW1A 3A1SA 5DI3A 4DC9A 3W2HA 4EFLA 3RS3A 1NN5A 3PEWA 2JJ1D 1XX6A 1R8QA 3UIEA 2ECKA 4Q7JB 1KKMA 5C2JB 2J5XA 1GWNA 4XTCS 1KDPA 3KQKA 4LJ7A 3N5CA 5CM9C 2FDCA 3U60B 1GILA 1KI6A 1NG1A 3OAAA 4O3MA 1E79D 2AHOA 2QDXA 1H42A 4HDOB 3DHWC 2NPIA 3SOPA 4HAWA 1JA0A 3DO6A 1AGPA 3QKRB 3MSXA 4M8NE 2CHGA 1F2UA 2VP5A 2PJRA 4A4DA 4FINA 4WAUA 2HV8A 2X2FA 4MRVA 3GP8A 4EJSA 2PCLA 4LJ8A 4B73A 2BMEA 2CNWD 1KI8A 2IYRA 3FDIA 4RY2A 1NBME 4IDNA 4R2HA 5F9HA 4A36A 2QEQA 4KJZA 4P32A 1ZM3A 3EIQA 3UWOA 2YJTD 2QP3A 4PO9A 2QGZA 4LJAA 3IEVA 4Q4LA 1UJ2A 4PHFA 2JJ8A 1RJ9B 5AJXA 5HR5A 2CHQA 4NBSA 4B44A 1IY1A 4ITRC 1QFJA 4BGDA 2ZRBA 3HU2A 4L15A 1JR3A 3B5JA 3I5YA 2F55A 3OF5A 3W9YA 3A1VA 1TL7C 1DPFA 3B7GA 1E1RA 2H7VA 1E0SA 4QL3A 2OESA 5H59A 3BC1A 1D6JA 5F3WB 1E63A 3C41J 4AKGA 5BQ5A 2PLFA 3KKPA 3B1ZA 1JJVA 4LRWA 3DOEA 2D7CA 1U8ZA 5K8UA 4FN5A 4NHOA 1OH8A 4TTQA 1GNQA 1VCIA 4PX9A 4NZYA 1RRGA 1QHNA 1I7PA 1MO3A 3MAAC 3O8BA 4BFWA 1QHHB 1M74A 4B3BA 2ZQ5A 2F1JA 4DCSA 2DCUA 2BSAA 2D62A 3CRMA 1XTQA 2X77A 4A82A 5GVRA 2J0VA 2Q9AA 3B9PA 1DG3A 1GNPA 3TIFA 3PUZA 1EFRA 2SHKA 1E9AA 5A0FA 1YITB 2YV5A 1P73A 4PSVA 3KJGA 3VU9B 2GK6A 1P3JA 1AGRA 1E9BA 3MWKA 2J0UA 1R8SA 2ZUDA 3RC3A 4PFSA 2J41A 1ONBA 1NNEA 1OXXK 2CLCX 2AK3A 3G5UA 3DDCA 1UEIA 2VEDA 1YZNA 3EG5A 2GJSA 1XCPA 4QHYA 2HXYA 3V4RA 4MKGA 4BFUA 2XNDA 1S1CA 2LKDA 5FUYA 3DM9B 1SHKA 1KO8A 1GL7A 1XZPA 1V5WA 1VIAA 2CL0X 4A1FA 4LHYA 4BZPA 2OFXA 3K9GA 4FMCB 3VR3A 3K9NA 2RB4A 5CDFA 3LDAA 3Q3JB 4LV6A 4JJKA 3OE7D 3NXSA 1P2SA 5L3SB 2P67A 3JZAA 3AVYA 1QG4A 2C03A 2PZGA 1G7TA 1ZIOA 2QORA 2WAYA 4P0TA 1Q22A 3FMOB 3GLHE 3MCAA 1ZNWA 4RD4A 4JLOA 1QVFB 4GP7A 4RZ2A 5AUQA 1S2MA 4RSGA 4ZPXA 5FL7D 5LPNA 1G7RA 1AA9A 1J90A 1E2GA 1A82A 1DAMA 5FOTA 1E32A 2GCOB 3KUCA 3N70A 3SYNA 3CRW1 3F3YA 2EVWX 2GAOA 2R6CA 3FMPB 5G53C 1XBTA 2H57A 2Z6VA 1AZTA 3H86A 1V43A 1HEIA 3REGA 2HF9A 1P5ZB 1NSFA 4TMXA 3OAAD 3TNFA 1KMHA 2WV9A 2BPOA 2NIPA 3IUYA 5H5JA 5JCZA 2NTYC 3BGWA 1S4QA 4FCWA 3QE2A 2ZRIA 1IBRA 2ZR0A 4NDZA 1GNRA 4B48A 1GO2A 4UAJA 1KI4A 5FBQB 4FW9A 1G5RA 3AKYA 2GVDC 1GL6A 3B1YA 6Q21A 5JBQA 3OFNA 5IT5A 3CNNA 4JIMA 4N3GA 2ZRCA 3ZS8A 3LBIA 4WVFA 1KZGB 3C5HA 5FOUA 5GV8A 4HDCA 5JHGB 3OZWA 4RFSB 1TAGA 1GAJA 2YWEA 4GOJA 4B3DA 2FMXA 4IHQA 3K09C 2HCBA 1S9DA 4EPYA 2VP6A 1JR3D 3OZXA 2QAGA 5GVSA 1FTSA 1KK2A 4BLPA 2CDNA 1ZNZA 4DSUA 5LD2B 1GVHA 2ZE8A 1E1RD 3ZZ0A 2G1JA 2CCKA 1AKEA 3NHBA 1XXHB 2NZJA 2NPFA 4BEBA 2EFDB 5D3MA 3EWAA 5SZJA 2ZAOA 3OIUA 1UF9A 4US1R 3K9LA 2BBTA 2J7PD 3CCQB 5FPKA 2YNMA 4Q4AA 2ZUCA 4P4SB 2HDNB 1QBKC 2V6JA 4HLUA 1F2TB 3M4YA 4C4PA 1NN0A 4DCUA 4XVRA 2JLWA 1C1YA 2DEUA 1QF9A 3PXGA 4JZKA 4BE7B 3K0CC 1CEEA 3CRZA 2WSMA 4UJ5A 1G8HA 3GJ8A 2C78A 1GSIA 2J3EA 1OGJA 5L8VA 4DSTA 2YOHA 1EFRD 3L82B 3WYFA 4GMDA 4GL2A 1II9A 2DFNA 1N0UA 5EMNA 2C95A 1DAIA 3EARA 4LV8B 1GUAA 3GJ4A 2WM9B 4PC6A 1KHTA 2QMOA 4LHXA 2ZYUX 4ABYA 1VHTA 1XEXA 2XJ9A 3T34A 1ZD8A 2XNDD 2OK8A 1E2EA 2ZRMA 4NCKA 4Q9JA 4C2UA 4JLNA 3MMPA 1TUEA 3TW4A 2Q3HA 3FHOA 4TYQA 1CIPA 3PEVA 4HATA 1AZSC 4EFMA 3CCSB 2VRWA 4M1MA 1B23P 3ICQB 2IBMA 2J1LA 1KJWA 5C46F 4BLRA 1BX0A 1K5DA 3FOZA 2J0SA 2JASA 2DFTA 4A8JB 4FCTA 3W8NA 3Q5DA 3MRSA 4MITA 4LC1A 2ZROA 1KMQA 3GEHA 3WMEA 5EJEA 2OCYC 5AWFC 4FCVA 4OK5A 3FPKA 1CXZA 2ZI3A 3L2OB 4A6PA 3WHKA 5AK0A 1W36C 3QXSA 1UKVY 3L0SA 5FBWB 3A8TA 3LY5A 2AWNA 4ZGQB 1Z2CA 5FOXA 4QBGB 2GBLA 2XB4A 5E95A 3QY0A 4OJQA 1XFAA 1FNCA 4AF6A 4NYIR 1YJNB 3IQXA 3JVUA 4E03A 1TEXA 2GF9A 4B71A 4NH0A 3I61A 2RC6A 1QHYA 3W3ZB 4DLYA 4V0OA 2XGJA 3KFXA 1XTRA 121PA 3IIJA 4Q7KA 3GJ3A 4YMUA 2ZR9A 1SXJE 1W2GA 1NLZA 1JALA 1G3QA 1G64A 4WA7A 5H68A 2XEXA 1NL3A 3A37A 4PPFA 3O47A 2ZAMA 2GVZC 3LW8A 3QPUA 1R10A 2FU5C 3MJRA 2FPLA 2QP4A 5FUVA 1X8LA 1EFTA 5EE3A 2PJZA 5AJZA 2QTHA 3U6KA 1XE1A 1SKYE 4MKIA 3AEZA 2D7DA 4I1SA 2ZJBA 2WBLC 1KI2A 3AGPA 2O5VA 4B3XA 3GEIA 3OFND 3TSZA 3TVTA 3CPEA 2HYIC 1NKSA 2D74A 5KNBA 1XB2A 4V0KA 4BASA 1ZUIA 3KXLA 3PUYA 1JECA 2DWOA 3KTAB 3RWMB 4JLDA 2P6RA 2PIAA 2HT1A 4LYHA 5B2ZA 2NOAA 4CEJA 4PGOA 3A4LA 2IW3A 1XD9A 4DQKA 2KBFA 5EZ6B 2TMKA 1JR6A 4UNQA 2MSEB 1SVSA 4G5QA 4LWZA 5BW8A 5JMTA 4J0QA 3UPUA 1F48A 3JVVA 3ZZTA 5HTKA 2H18A 721PA 5J4HA 3LX8A 1KTVA 1YZKA 4G01B 4LX0A 4XWAA 1A5TA 2ORVA 4I99A 3CZPA 3V76A 2PMKA 3VX4A 1QGYA 5J5CA 3TLXA 4OI1A 4IVRA 4B35A 2XNSA 4TL6A 5CJ2A 3AF3A 3FJOA 4YMTA 1X1RA 3UMRA 4F4CA 4PXAA 3B82A 1CJTC 1NG9A 1ZU5A 2QMHA 1QH0A 2OTLB 4RZUA 5EXTA 1ODFA 1PLLA 2FFBA 1XEWY 1OE0A 3PV0A 1E2HA 4OQNA 3WHLA 4FWIB 1DDGA 4B33A 4Q03A 4DIDA 4FMCF 1RW4A 2IX3A 4ZCLA 1XZQA 2HF8A 3BB4A 4OHZA 4V0ME 5LDDC 1K6MA 4Q4HA 3GLGA 1OHHA 3T15A 1UADA 3AM1A 2JDIA 3GLFA 3CR7A 3C16C 1HYQA 1YZUA 3QKSB 3RLFA 3AVOA 1CRPA 3QBTA 1Z6TA 2VNIA 3U2QA 3U3JA 5HZHA 2IXFA 3CD6B 5E7JA 4QGFA 3LVRE 1RJ9A 1Q3TA 5TDHA 4KODA 2JIZD 4A0FA 3OIWA 3U7HB 4Z51A 2AFIE 3NTUA 2WKPA 4HLDA 3OZVA 4QKQA 1EWYA 2AD1A 2ZRLA 1XEWX 3CX7A 4KV9A 5BWMA 4RFVA 4Z1MD 3R7WB 2BF4A 4URVR 2RHDA 4DDWA 1UFQA 1QHSA 4PZLA 1OYYA 1D5CA 1UPTA 2O8DB 3U4QB 5BXQC 4LJ9A 2QG6A 3B85A 3AF2A 1VG0B 2QMUA 2NO9A 3ECCA 4Q7MB 2EWVA 2JCSA 2UVQA 4YQFA 1Z28A 5HZKA 1NRJB 1Q82D 3KXKA 1D2EA 1Z06A 2VPPA 4Q4JA 4Q00A 4YALA 4B2LA 1VDZA 3B9QA 4RZXA 2J59A 4M22A 4XJXA 3RNLA 2BV3A 3OEED 4WW0A 3RRMA 4ZI2A 5EUMA 1IHUA 1A8PA 3QVVA 1Q12A 1Q1BA 1U0LA 1Z6YA 2WKQA 4GZMA 4YDSA 1GG2A 2QT0A 2ONKA 3L0IB 2IYUA 5P21A 1VQNB 3U61B 2ERYA 2V8OA 4JLAA 1SVLA 2BCJQ 3CC7B 1K5GA 4NP6A 3ADDA 3VU9A 3B78A 4B3FX 1FL9A 5FUWA 2ORWA 4QGHA 2C99A 4NYMR 3OIYA 2OM2A 4CYMA 1FQKA 2VZLA 1NN1A 2CNDA 3U7EB 2JAQA 1OFHA 3MG9A 1EK0A 1G18A 2IK8A 4PQYA 2OO7A 5EQTA 4JL5A 4CIDA 1FQJA 3GJXC 1DAEA 1XJCA 2R2AA 2IT1A 4FI3C 1KJYA 3A4NA 5FOVA 4UJ3A 3TKLA 2P6UA 2RGEA 4QJ4A 4ARZA 2VYQA 3CCLB 1P4SA 4IVPA 1J9ZA 2ODBA 4ZIRA 3KJHA 3EX7C 3HWSA 4C0AC 4F38A 3PJRA 1H8HA 2YYZA 4JBWA 2XZLA 1EESA 2VIIA 2JLQA 3ZVRA 1WDTA 5H1YA 1MV5A 1TQDA 1KJZA 3K0FB 2G1KA 5KSZA 2A3RA 1UKYA 4Q66C 1YZTA 4QGGA 1OB5A 4JBXA 1N6LA 1C4OA 2ORIA 3RSOA 1CLUA 2GCOA 2BKEA 4U02A 4XSGA 1J99A 3CF0A 4M53A 3LXRA 2F43B 4LI0A 4XWKA 1ZU4A 2HCJB 2VHCA 3I5XA 3KB2A 1R0YA 3OJXA 4M1KA 3LBNA 1IN4A 2H92A 4AWXA 5JWRA 2BMWA 1NF3A 2AWOA 5JFGA 4F7WA 2R6AA 2X8AA 4GZLA 2CK3A 2GEVA 4JVLA 1T4GA 4DBLC 3CX6A 1NVWQ 2WJIA 3E70C 2HEIA 1NMYA 2WJGA 4Q48A 2FSFA 4TYNA 4JL6A 2R62A 3PG5A 4XSHA 2X3UA 3ZQJA 1IB0A 4HB4A 4M2LA 4TLAA 1F5NA 2ZS9A 1P9RA 1OB2A 1OKKA 4HYYA 1SVKA 4HUQB 2FSIA 5JJKA 4P6VF 1OHHD 4TMKA 2JDID 2ZPTX 1YJ9B 1JI0A 4TN1A 4YONB 3B13B 1Z5ZA 4EJSC 1A4RA 2FV8A 3KZ1E 4AYWA 2CCJA 5DO9A 2BM1A 1W5TA 3ETLA 1TQ6A 1R0WA 3SDZA 1XWIA 4IDQA 1OLOA 3BK7A 1K8AD 1GRRA 1VECA 4TL7A 2YC4C 4MUAA 2GZAA 2ERXA 1OFIA 4AYXA 1EP2B 3BFXA 5JEEA 1S0UA 3P20A 1E79A 3CCEB 4XWOA 1LY1A 2ZSEA 2IXEA 4D6PA 1KSFX 3QBVA 4YLGA 5DN6A 1L2TA 5FA6A 1XXHA 5IHPA 1SGWA 2V54A 3QKUA 2FZ4A 2WMOB 2O8BB 2FFAA 1Z3IX 1ETUA 3TJZA 4NCHA 3TMKA 3OJWA 1KI7A 1ZM7A 2FSGA 4Q1DA 5JJLA 4TQUS 3MLEA 2O8EB 5AJYA 4V02A 1OIXA 2QUZA 2WPDA 4P4SA 1HTWA 1MRNA 2XOKD 1KO5A 1F2TA 2W83A 4GNKA 3U3OA 1YE8A 1MO5A 3KKNA 1WE2A 4QBFA 2IHBA 1GJRA 4H1UA 1ZCAA 1Z0FA 3ES9A 4GDFA 2YHSA 5E3HA 1RKBA 4KBFA 3BERA 3CC2B 1NVVQ 1JAIA 3FMFA 2WZQA 3OIVA 4G1UC 3R8CA 3OZUA 3OW2B 4OI0A 4KFTA 4O25A 3OESA 1WRBA 3AP1A 1T8UA 3LD9A 2VLIA 3C14C 4OJKA 5DH9A 1AJEA 4NYMQ 3T35A 3ZBUA 1DOAA 2REOA 1PLJA 4JSYA 1ESMA 3X1YA 2L0XA 2JGNA 5JS8A 2G9NA 2JLVA 2QZ4A 2XTMA 1G6OA 2IF0A 4MRSA 1VQKB 1Z83A 1E9EA 1FP7A 1HURA 3LH5A 3SE0A 3S1AA 3A4MA 2QI9C 1U90A 3W90A 1AMOA 3BRWD 4PAQA 2OG2A 5L3RA 3T1VA 1Z6GA 3SEAA 4P3YA 4QRHA 3PR1A 4PZZA 1DBSA 3KDSE 4JL8A 1W4AA 3W6PA 2FGJA 1BO6A 2GWHA 3IGFA 3VHLB 1XMIA 2J46A 2ZYTX 2WJJA 3CNOA 2CJWA 5IF9A 2DPXA 2ZS7A 1VPLA 1N3BA 4D0NA 1VYVA 2ZSBA 4LYJA 5C18A 1XD2B 2Y8EA 2KSQA 3C4JA 1A7JA 2ZRJA 2H8KA 3THOA 3LLUA 1DTSA 1U99A 3FVQA 3PIRA 1NKTA 4NU0A 2RHMA 2BHRA 1N6IA 3R9IA 4AKHA 1KY2A 2CK3D 2ZJ5A 3HU3A 2CRVA 5KSWB 4BZQA 5KUTA 1JEDA 1Y3AA 1KI1A 4IOKA 1FMLA 2O0JA 5JSZB 1S72B 1Z6XA 2CXXA 3GCGA 4FMDB 3FPAA 2DWPA 5DYGA 2E9SA 5SZKB 2G0NA 1H65A 2A7QA 2ZETA 1X6VA 4U9UA 2VYFA 2DR3A 4MYTA 2ZRNA 1OKKD 2IYQA 1ZJ6A 4XTRA 1M34E 4YAFA 4TLDA 3SHFA 3U44B 4H1VA 1CJVC 4K81B 5FL7A 5K8TA 1BMFA 4Z8YA 2B7BA 5JJIA 4EPRA 2E87A 2JJ2A 3FYHA 3SR0A 4PHTA 3KTAA 4HDQB 4BFYA 1P62B 3WXMA 2J45A 4CRWB 3LVBA 3WBKA 4YMVA 3NH9A 5DISB 1J70A 3QXCA 1MO6A 3K70D 2EU8A 2FE4A 3NBZC 821PA 3SJAA 2O0KA 3RS7A 2JLZA 4B74A 1E94E 4UXJA 1YVDA 4X8LA 4PZYA 1P75A 5DGXA 2F7SA 2PX3A 2BKUA 4ZV4A 1CTQA 1DE0A 4KLNA 3JQPA 5DN6D 4LDJA 1GOTA 5CLQA 4D4MA 1M90D 5TVKA 1FOEB 5TR9A 1N6PA 1SQ5A 2PEYA 4NKRA 5HPYB 1W7AA 4AI6A 2LWIA 3HR8A 2O8FB 4M1TA 2NO6A 1JA1A 1QDEA 1MO4A 2NG1A 2WPDD 1AKYA 1JJ2B 1GKYA 1H8EA 4MUBA 4ON9A 1GAWA 1ZM4A 2F9LA 4ZDIA 1XJ0A 5FR1A 2ZI9A 4DT1A 2VBCA 4JMPA 2QSZA 1IN7A 2BOVA 4POAA 4OHWA 1RIFA 3E1SA 1JQLB 1E9FA 2N1BA 2QM8A 3QKSA 4HLUC 2NZ8A 1E2FA 1ZINA 4L8GA 1XCGB 4EFNA 1GRQA 3P1JA 3GLIA 3CM0A 4R9UC 5KHOC 2ZS8A 2CL7X 2Z4SA 2AN9A 4CGZA 4E22A 3M6AA 1G17A 4DHEA 1NLFA 4RD6A 3BFKA 3FGNA 2OXRA 3ZC3A 3QKTA 3T1QA 2OCBA 3IQWA 1VCNA 3BWDD 5KOYA 4Z8XA 5AUPB 1PUJA 3R7WA 2RCNA 2GKSA 1XEFA 4Q9LA 2H5EA 3G6EB 2J7PA 2O8DA 1FFHA 2WICA 3IO5A 2KI5A 2J9RA 2LKCA 4MA4A 5AJWA 1ZD9A 1CJMA 2V7QD 3EZ7A 1RRFA 5FBVB 1EP1B 1VQ5B 2QRZA 2VTKA 4GT1A 4OQFA 4A2WA 2DYKA 4OI4A 1ZIPA 2ZJ8A 1NY6A 3MUFA 1KAOA 4LOAA 4M9XA 2CBZA 4DLRA 2P5SA 2QGNA 3TSWA 2EQBA 5AR1A 4UNNA 3RRZA 3VR4A 2ANBA 4V0NA 3I56B 5AUNB 2I1VB 1EGAA 2C9OA 4HI0E 4WBSA 2XTZA 5TY0A 3MWYW 1OYWA 3CH4B 5G3YA 1N5LA 1Z22A 2HT6A 3GJ7A 3G0HA 1N5IA 5CIQA 4A15A 1MOZA 2GBLC 2WWGA 3TRFA 1DO0A 3BB1A 1E2IA 1UBCA 3MWJA 1KAGA 4WXRA 4IOMA 2GXUA 2ZYWX 1C9KA 3E2IA 2HJVA 4E09A 3RRYA 3HPQA 2QN6A 1E2MA 2BC9A 2XZOA 2YVUA 1J2JA 5CIWA 4NCIA 4P31A 1KK0A 3P27A 4G5OA 4QNMA 1OW3B 4WXPA 2F1HA 1UAAA 1BMFD 4K46A 1Z47A 3TSOA 5BN4A 2FEMA 2JJ2D 3EIHA 1W36B 3FWYA 4B3CA 1WXQA 1TQ2A
chains in the Genus database with same CATH superfamily
3HBMA 1VQ9B 1T8YA 2NXJA 1CJKC 3G2PA 1TZKA 3PWZA 3CCMB 1KJ8A 2OL4A 4H31A 2WB4A 1HT3A 4BXOB 2PBZA 1IVSA 1XZAA 4LJLA 3WJ7A 1AHHA 4IIBA 4U6SA 5G1NA 4GPEA 3OM0A 3A0UA 3Q8KA 4JGIA 4NTZA 3LC1O 2SBTA 4E07A 5ESRA 4JJAA 2W2XA 4NV1A 1OFUX 2RE8A 2JGKA 3AEKA 2A4KA 2Q2QA 4I1PA 1ZM9A 1V9CA 1AVTA 2IUSA 3D02A 4MGKR 3ZLJA 1QBGA 1MJHA 2AN1A 4Y9RA 4KVGA 5F2OA 1JTFA 4KR9A 4QGSA 2OKCA 1Q7CA 5E38A 1UMBB 5KYXA 3AUTA 1YONA 3GRKA 4DBLE 4F6RA 1NQAO 3M6FA 3V3KA 2XCQA 4X0CA 1M0TA 2IEYA 3OT5A 1WXXA 3VISA 1P6UA 2AZ4A 1CEXA 1FJGB 1B1CA 4KE9A 4ONEA 3IPRA 1D2RA 5FPQA 4J0CA 5A71A 1W9XA 1W96A 5HCUA 1PYDA 3KL4A 3D8UA 3H8WA 2LRHA 2LW7A 4G6ZA 3SDSA 4AIIA 4QUJA 1K92A 2YH2A 1YNOA 1RYDA 1NXXA 3CW9A 3R76A 4ABTA 1UC5B 5DCYA 2HA7A 1T5TA 1T8SA 1SCUB 2FN8A 1X1TA 4LE0A 1KEPA 4RKEA 1R9GA 4MUKA 1BZYA 1REQB 4EM6A 1R0LA 4HSEA 3T99A 1A2QA 2J4CA 5F2NA 2WC1A 3CH5A 2QIPA 4Y6OA 2GEDA 2EXXA 1I2BA 2FN7A 1C0KA 4ND5A 2XYPA 1GZ7A 1PT5A 4TVKA 3H1GA 1G3IA 1RWXA 3V9PA 1VYTA 5AVTA 3ISJA 1GCOA 1SHZA 1HF3A 4OIFA 5KOIA 2W2QA 3SWWA 1RP7A 5KNBH 5BWNA 3RS4A 1Q21A 3CUSA 4TWIA 1Y8QA 3T56B 1ZPDA 2NM0A 4ZEXA 4YCBA 1TC1A 2WG2A 3RJZA 4ENTA 5JARA 1TK3A 3G0OA 3OY2A 4JGGA 1JR3E 2ACKA 5JRJA 1XXLA 1NN3A 2FTKE 3O9VA 1DX4A 1UQTA 1PHPA 2FETA 4Y9UA 3W2GA 1Y4UA 2PCJA 2W2LD 4BNDA 4HD8A 1JH9A 1J2YA 4F9GA 3BL6A 1MOQA 4M1OA 5MN4A 3F78A 5AVZA 6ADHA 2HDHA 3PC2A 1YBMA 2OV6A 1YJ5A 1ZLXA 3PA1A 1YZFA 4GOKA 5HF8A 5BNTA 1GAQA 1DMSA 1P7CA 1TPYA 3UG7A 4MMZB 3O8QB 1EVQA 1BD4A 2HU8A 2P3SA 1MT3A 1BXRA 1TU3A 1WZUA 1TRKA 2AC2A 2WNHA 3FAZA 1DUSA 2QR3A 4KYIB 5CTJA 5LB4A 4CZ2A 3ZQ4A 2JIQA 1E4EB 3GSIA 3LV8A 5IPFA 3QFTA 3CVYA 2I9PA 1KYTA 1XU9A 5DX0A 4BUJA 3NM5A 2OC9A 2EAUA 4BWFB 1QPBA 2UDPA 3JW8A 4G24A 2W4MA 4NOJA 4UVGA 4RK4A 4BDTA 3SE7A 1LWOA 1W88B 2ASVA 2QZZA 3V8VA 3KDAA 3Q8XB 1U2GA 4Z1MA 1BQ3A 4D9NA 1EVEA 1E4YA 2V5AA 3K4PA 1WTCA 1XNJA 3AERA 4I81A 3R6WA 4JITA 4OB6A 4RETA 3U7RA 4EABA 2YS7A 1O0SA 3WLMA 2HCRA 2PZKA 5EWLB 1H85A 3PDIB 1QV6A 2O0LA 3NOQA 4IIVA 1E2PA 2JI7A 3RC1A 3RYIB 1TCCA 2J8ZA 3BJIC 3AR6A 4BGUA 4TTTS 3SQDA 1XLTA 2N9UA 2XWSA 1P39A 2A1TR 2I33A 3NNDA 5BWLA 4IDBA 1RLUA 2NXNA 2VP3A 3M3DA 3OI7A 2B35A 3VPCA 3QYJA 4XX0B 3JQRA 2BCEA 4LISA 3N6VA 4RK0A 4C03A 3VA7A 2CNBA 1A77A 3O95A 2OTCA 2Q6OA 2CDBA 3MHPA 4TYWA 3MPOA 3FKSA 3M6VA 3WAKA 1AF4A 4ESHA 1ZHHA 1ZSNA 2PD4A 5LUBA 4RMHA 2JCXA 2ZIXB 4QVGA 3N7AA 2VKTA 2P3MA 2JI8A 4HADA 5CDFE 1ZN2A 2OEPA 4UHKA 3ZXSA 4Z9FA 3G8DA 5FI1B 1XL1A 3CUUA 3NEPX 3EMKA 3EG9B 1ADYA 3I4FA 3SU8A 5KX5A 1FMCA 3NJ4A 4H1HA 4NC9A 4ZV9A 1J22A 2VFAA 1LK7A 3LFUA 3VHXB 5DYYA 2NLOA 3EPRA 1OI2A 2EKLA 4FR0A 4JFAA 4P98A 4JELA 4CU5A 1WM1A 1XR3A 3PVSA 4JB0A 3ZJ4A 3OC6A 4CCYA 4YUYA 3EF1A 3AZQA 3H6KA 2W42A 1U1IA 3C5WP 2NSJA 3FWHA 4KKVA 5PGMA 4II2A 4KKXB 3GLHB 4MQEB 4L4UA 1X15A 2FWRA 5J3OA 4Q39A 2VJIA 4U2EA 5AI8A 4YT5A 3QENA 5AVOA 3RPEA 4XWYA 1FPMA 3MA0A 4MKHA 5JFOA 5D3QA 5CM8B 1WVIA 5B7PA 2WOJA 1RMTA 2HJGA 2KLHA 4QG7A 4CU2A 2YMQA 2ZG6A 3LA8A 3TRHA 1WNFA 2D2FA 3QFFA 2FZVA 3MUNA 2AOVA 2K4MA 4MS3A 4P4LA 4PFQA 3EWSA 5E6RA 2BUBA 2X86A 2X0FA 5JS1A 4UE2A 1BRTA 2OFWA 3QHQA 1DKUA 1MR3F 4QOSA 4ASUD 1JVSA 1L5ZA 1W52X 2H9IA 1TB4A 1XSEA 5JY1A 1LFDB 2G5CA 1G5HA 3RIHA 1WB9A 1W35A 2D8MA 3FROA 4P5EA 3WGYA 3VC2A 1X7HA 3HJGA 3O38A 4JY7A 3T9CA 1T4MA 1SZPA 3Q3VA 4ZCTA 4MP3A 4JJZA 3A58B 3AUFA 3K35A 1EINA 3OZEA 1PR6A 4BBPA 1KY5A 2GS9A 1FP4B 5ISMA 3QKRA 4QXAA 5ERGB 2V55B 3VR2A 1D3AA 2J85A 4BAZA 1KOFA 3GNSA 1E58A 1B00A 4Q5IA 3O8NA 2CE2X 3OWXA 5KCMA 1I2CA 5JD6A 2QAIA 2OQ2A 3IJEB 1E1NA 5G1PA 1A9PA 2D06A 4P1VA 1UINA 2MSDB 3CMEB 3HUTA 4RSMA 1XPUA 1BGVA 5AYVA 3SJBA 3A2LA 1CS0B 5D1HA 2DBYA 1RP1A 3GU3A 1UFVA 4L9AA 3V7AA 4QPZA 5F33A 3SS8A 4EJSB 1KH3A 3CONA 3G7SA 4J0JA 2FA9A 4X05A 2VDPB 4RDKA 4P7JA 2BT4A 1AGXA 4BQIA 1ZMXA 4P3XA 4URFA 4HYTA 4RW0A 1R18A 2OBTA 1XZIA 3QLVA 4QHTA 2EIXA 1UBJS 2FPPB 4WOKA 4QULA 3TJMA 4TV8A 4EO7A 1J8VA 4ZQCB 5HKKD 1NXQA 3AJ9A 4X84A 2J32A 2G88A 4EP1A 2JLBA 4ZCIA 2P2YA 3NYQA 4Z7NB 3KOYA 4LXGA 1DELA 4RKFA 4B43A 5ANRB 5EUQB 4YAIA 2F8SA 5ADWA 2YWFA 4S0XA 1OCEA 1GRVA 3UT6A 4FGKA 1G60A 5CT8A 2W6JA 4II3A 1NJ8A 2AW5A 3ADBA 5FJJA 3V8MA 1VXOA 2RB5A 1G20E 1JDNA 1JLHA 1I6WA 1RZ3A 2OO3A 1ZVQA 3OWOA 1QHHA 3JATB 4E6EA 4S05A 1V71A 5JTTA 2VAMA 2BFDB 1JQBA 1TIBA 3DDSA 4WZZA 1WSWA 4AKIA 3GVPA 1ECJA 4N47A 4G0YA 1L9KA 4GKVA 1IK4A 4I55B 4YCMA 3ERCA 1KH1A 3PD0A 2GXQA 1F20A 2PUHA 3G2MA 5HXBA 1OBVA 5DGTA 1I2DA 4OFBA 1FSFA 1VRWA 3H9JA 5KNCA 3VZCA 3ISXA 1B8UA 4WGFA 1E1KA 2G4CA 4Q3OA 3BG5A 4W6ZA 3I42A 4TT3D 4MR8A 1TE2A 3K2IA 3WMFA 3HVUA 3RKUA 1MX1A 3ITEA 3LVFO 3R0QA 4EUFA 1L8QA 4GI1A 4E5SA 2AH5A 2QLBA 5LMZA 1M2GA 1EXNA 4X97A 4DR5B 3GO4A 2WWWA 1JDBC 3CSUA 1EFLA 3P19A 4CKBA 5KB3A 2WY2D 3UV7A 3T3NA 1CF4A 1LNZA 3IPYA 1UD4A 1GQRA 2IEIA 2EJWA 4KLAA 4OGFA 4EB6A 3WGJA 2QUHA 3UN1A 3U16A 4JNCA 2OY0A 2QD5A 4RIHA 4DR4B 4R8KA 3VNUA 3OX1A 1ZRNA 1H2XA 1V26A 3QWFA 4FYVA 3HO6A 3VQTA 3ZD8A 3IVAA 1Q3HA 4W1PA 5KQMA 1HDIA 2FH5B 3L18A 1DJOA 1R9JA 4RU1A 2BCGY 3V1NA 5CITA 2NU9B 2QN8A 2C8VA 4DR6B 2J7KA 1NBHA 2MMGA 2QB5A 4YUVA 1PK7A 2CNKA 4PWYA 1P72A 4BAGA 3IPLA 1RPZA 4BNUA 2C5BA 1GXSB 1TI7A 2Z4RA 1XUOA 4JYMA 5IYZB 1PJ5A 3E5RA 5BSTA 2ZT7A 3AWDA 3LPLA 1ONOA 4L2IA 4QGBA 2ODWA 2GCPA 3HACA 4FFNA 2BD0A 1TM7E 1XP8A 2JGLA 4PLZA 1SXJB 1CQXA 3N7TA 4HKTA 4BX8A 3ORHA 4BC0A 1HVXA 3GMDA 3KWFA 3WP0A 4L4ZA 3K73O 4HTAA 2J5BA 5EQJB 3V3TA 4MWCA 2J5QA 2ZM5A 1OIWA 2GJ8A 2A7XA 3D4LA 1ISRA 3IEUA 2QT9A 1Z8DA 2GPSA 3OC0A 4MLDA 3CMAB 3QFRA 3QFCA 1N1MA 4GSKA 1UT6A 1AQ6A 5EHZA 5IK2D 2GM4A 4HMOA 2P3LA 3Q3CA 4GX1A 2JHAA 2JVJA 4GYKA 1OJ7A 3ZTTA 1H5UA 5CHEA 4MUMA 4CV0A 4N4AA 5C34B 1EI9A 2CZQA 3O94A 5BY2A 2FZKA 4OREX 3TB6A 3ZDYB 2Y1FA 4R5MA 4CI0B 4AWBA 1U0TA 2ADMA 2PYZA 4S12A 4B31A 4CHGA 4ESEA 5JTUA 2O1SA 1A5ZA 1O6BA 2ZJ1A 4YREA 2C07A 4EF4A 1SEPA 4XI9A 3L0YA 4CKCB 1ULAA 2WYRA 3P9SA 4KR3A 4EPTA 3UM9A 1PNTA 4E3WA 5DMXA 3IFSA 3SOZA 1XRLA 2IU4A 2VYNA 3INYA 1T3HA 2RI0A 4P22A 2GPBA 2ZB2A 3IB6A 1OI7A 4H6XA 1TT5B 3IRVA 3TM4A 4D57A 5JDCC 3LT0A 1QU3A 1YBAA 4K9OA 2OV8A 4BO8A 4D0GA 1RXEA 3ESAA 4B47A 1C0EA 4OQLA 2VYVA 4ZA2A 3KUDA 1ELOA 5GGXA 3GLFE 3D7SA 1PGJA 4NJMA 3DAYA 4INOA 2BI8A 5HFNA 4Z54A 2GCIA 2R65A 4JSRA 4FZ5A 5DI9A 1A0OA 2YXEA 3NBKA 2HMSA 2M6SA 3OEHA 5CH8A 3UMFA 5EZ5A 1AO0A 4CLOA 4TWRA 1CR6A 3HGQA 1XQYA 2G09A 4JENA 1ZJJA 1NBMA 4WNCA 1CU1A 1SBZA 2Q50A 2A5JA 1IHOA 2ZRGA 3HCFA 1NQXA 2QD1A 3URKA 5KU1A 2KW5A 4NPCA 1YD7A 1HQCA 3F7MA 5KTTA 3UF0A 3N74A 1OBCA 5A2QA 1KMMA 2CMDA 3UWMA 4CGYA 1KYXA 4IKEA 3V00A 3HR7A 1QHEA 5THKA 4YWHA 2XX3A 3W05A 1COWA 4DSAA 2WA2A 1XHEA 3F46A 4RV5A 3H4VA 4GPTA 5HZGA 4J4BA 3REQB 4C4AA 2WILA 3A36A 2V45A 1G8YA 5CFZA 4JOBA 3WGQA 2W2OA 1KEWA 1V8ZA 1ECPA 2YY7A 3EVZA 5BQPA 4BVEA 3ITNA 1AXEA 1SQSA 3P5BA 4N01A 5ES3A 13PKA 3FVWA 1YS1X 3NALA 3EY9A 3FDZB 2BEWA 3C3XA 1XLUA 2HZBA 2A0FA 3EQZA 1Q0QA 3I3SR 4G8DA 3KJEA 3RRJA 2CF5A 4UFNA 2WIBA 4AP5A 2OWDA 4A6XA 2WFLB 3IXMA 1U8AA 1VJRA 1YR2A 2DC1A 5CLIA 4AY5A 1G4AE 4NH4A 1TD1A 4YXFA 4D8UA 4PHCA 4KU4A 2BGLA 1GKLA 4KLZA 4YYEA 4YV1A 4K2AA 3IKMB 5FB3A 1HE8B 4DC9A 3B20A 5H7XA 2FHPA 2ZL7A 4ZARA 3PNBA 4MPPA 2JBAB 3GDWA 4M1YA 5L3ZA 3GGGA 4QNRA 2FX3A 1OB0A 2FJUA 1RTKA 3P9KA 4FWTA 4UCWA 5A03A 1QYXA 1YQWA 3BKXA 3PXUA 1SC1A 4PICA 3RTDA 4CM5A 4LJ4A 5IAOA 1CZRA 2QLLA 1UC8A 2QLTA 3H05A 2ZBDA 5J4LA 3GFGA 1U2QA 1BYIA 2F59A 3EY4A 1N1DA 3JZMA 2FWNA 2VJKA 3MJFA 4YO7A 5JI3E 1HFEL 4BFXA 3WB0A 3BAFA 2C2MA 4UBOA 4Y2HA 4F8JA 1MRSA 3BZWA 4KQ6A 3ZCXA 1B3RA 4MQ4A 1GFWA 4QGAA 5MHTA 1BMDA 1VCHA 3DZ8A 3LBHA 4HFJA 3WGZA 1HT1E 3LX4A 2H2HA 2WABA 5EC8A 1Q0RA 1KMIY 3E27A 3PWTA 1M1NB 4B7AA 2GZ2A 1W2HA 5AW1A 1QE3A 2V58A 3EGCA 3ZBTA 2FX2A 4BVHA 4RLSA 1TM1E 1U3GA 3WR5A 1SQGA 2IUYA 4DAEA 2P9HA 1L8AA 2PX5A 4LC0A 4X06A 1ORRA 2IHVA 4KIJA 4WXEA 1DRUA 1VCOA 2FQQA 4YIKA 5BVHB 1PEDA 1NM5A 4LOJA 5EINA 4IX1A 1G3MA 4RPJA 3ZQUA 3D2CA 4ZT5A 2Q5FA 4DGQA 4G09A 2BTQA 3JVIA 2IBTA 1ZK0A 4FFLA 4EY3A 1E64A 3DLBA 1C3LA 3PNVA 1FDIA 1JG1A 4KG7A 4D81A 4FSXA 2VPWA 1SY7A 1V0JA 3EYWA 3JR7A 4PZ9A 4RHCA 1TKRA 4YAGA 3IR5A 4TL8A 5HS4A 3GPLA 2PMEA 4KFRA 3U5TA 1K9VF 1Z74A 2QXTA 2IYPA 3PP8A 4GSLA 2WZBA 5EERA 1YDMA 2R48A 4IJQA 5EIWA 3V48A 1DBRA 4A7PA 4LZPA 1KPIA 1E4OA 2WD8A 2AQ8A 5I7OA 2VQDA 3G82C 3HV2A 4YDRA 4G4SO 1KI9A 4UU0A 3NFRA 4BEVA 3IEMA 4HHEA 3CEMA 3WQHA 5B55A 5C4IA 4MYUA 1GQFA 1IPHA 4QQFA 4CKZA 5AIAA 1X77A 4BQNA 1Y4DE 2B1JA 2PMBA 4EB0A 2R4TA 2QAGC 3Q6MA 4L9WA 1FZQA 2FY8A 2XUDA 3ELYA 4LSGA 3K0AB 1JGTA 3Q10A 4EH1A 5C8YA 2JZNA 3HV0A 3NVMB 3X2SA 7ABPA 2OCAA 4L6AA 4BU0A 4MUNA 4EG5A 1L3CA 2C2WA 1RQXA 3OW7A 3M6MD 4A91A 4CG1A 3E1YE 4F5ZA 4KR6A 2WAOA 5AD1A 1E3QA 3NZEA 5K0NA 2C2HA 3L7CA 4ZVSA 1E0JA 2H1LA 3PT9A 3FTEA 1RAGA 1GYRA 3FUXA 5JD5A 3ZCTA 1UZUA 4XUGB 1CC1S 1L1EA 5JPIA 2GTIA 1QVAA 2PBRA 5CA0B 3O1JC 2OHJA 3HI6A 1BA3A 5EAIA 5BN3B 2OBMA 1CLEA 4U6QA 1XZGA 4KOAA 4CFYA 3ZDAA 2NZYA 1I1NA 1ST2A 3JQ6A 3RTAA 3UA3A 1O0CA 2BSXA 3T3GA 2BBOA 4XWWA 1VMEA 3QWHA 1A50B 1Z4IA 1T2VA 4XZ3A 4ZICA 3DTVA 2VUTA 5C1BA 3LU1A 2OBNA 3JQEA 4TX1A 4BEWA 4MTLA 4D26A 2NQ2C 2Z2JA 4OHVA 4OPMA 1RS0A 1VM6A 1ZI9A 1UP4A 3GLGB 1QVWA 1KYZA 1WY7A 2C4HA 2ZYDA 4AL4A 3LWBA 2K5UA 1PTKA 3E9DA 2BEKA 2IHNA 1VPVA 2V1XA 2JA1A 3AUUA 2ZXHA 4AZ3B 1ZD2P 2MMCA 4M9QA 2H6EA 2IITA 2HSZA 4GI5A 2BKAA 4IJVA 1W34A 3DE2X 3U4QA 1Z0UA 2W4IA 1PNRA 1UOQA 3TW6A 1N5OX 2EHDA 4W99A 4QJ5A 4DMKA 1BYUA 1KD1D 1R6BX 2WTBA 1XZDA 1I4DD 3B1JA 3IOMA 1NI3A 1FSZA 4Y0AA 1A69A 2UZ3A 1C41A 1JZTA 2AYXA 4G1FA 4HZUA 3SFVA 1OSNA 1JYEA 3DH0A 1H69A 1XKTA 4J43A 2NZVG 4EHAA 4LJRA 1E3SA 4EWLA 1CT9A 4BWYA 3AVTA 3P5SA 4AUKA 3QLTA 3LZ6A 4ML3A 5C1IA 4NU8X 4N65A 4P0QB 4QM6A 4WNYA 1XLTC 2BH9A 1V5VA 5AKHA 3P9RA 2P1RA 3OUZA 3GYBA 2X8JA 3GGJA 3DZIA 3PHIA 3W90A 2I65A 4DOMA 3GP5A 1K4KA 4S2EA 2FOXA 4Q4JB 2AJLI 2CF6A 1JRLA 2QRUA 3QF4A 3HS3A 3I37X 1AKUA 1UBGA 2B2CA 2W0SA 1M73E 1XA3A 4ZHQA 1XT6A 2HK8A 2R7AA 3IPXA 1QYVA 4LJKA 4C5BA 3G1TA 2QRJA 4KSYA 3VSBA 5JBNA 1RBYA 1L4FA 4O8ZA 2OXCA 4OKSA 3RO7A 3U5ZB 3GOQA 5HDBB 2W5UA 3OFVA 5K51A 1WU8A 4DIMA 4G85A 2VP9A 4RV4A 1CUSA 1XO1A 1JPJA 1WSAA 3AFNA 1T25A 3QLJA 5FWAA 3TOVA 3L43A 3N0XA 5L6LB 2IXAA 5LOVF 2CXTA 3NIBA 4R2JA 1ABFA 4EKGA 4JI4B 2MCFA 2XODA 2JATA 1N32B 2EQAA 5COAA 4OB8A 2QRNA 4Y2RA 1VQ4B 2KX7A 5JSYA 2WT4A 1MMFB 3CG4A 1ECLA 3RAJA 1M5UA 4BFSA 5DHTA 2IXGA 4TQAA 2DTEA 2GQ0A 3IUNA 4XRGA 2NUAA 4CKWA 1QOZA 1I3NA 2DP4E 2QVBA 3QVGB 3GQBA 2HUPA 3B7PA 4KRXA 1UAGA 4YDHB 3TRDA 3I09A 3ZY4A 3WLNA 2YHIA 2YXPX 1TNDA 3G71B 2PFGA 3NHRA 4IOJA 4ZAZA 4ZIRB 3DDYA 4L1KA 3U3XA 1Z0KA 2YJ6A 1Z0SA 3PUMA 4L5JA 2ICAA 2E1BA 3PHBE 1N34B 5HG0A 2F43A 2ZRQA 4Y2JA 2W6IA 3OCCA 3SBDA 3H1TA 3UTCA 3WO0A 5JE8A 5BUQA 3PTAA 4K9LA 5IFLA 1H0HA 2ZB7A 4P26A 2CLSA 4IXMA 2GASA 2YFYA 1NOIA 1FFXB 1ECFA 1Y7PA 4GYYA 3FOEC 4FSHA 3LO5A 4CV1A 3KHTA 5FBKA 1PZXA 1US8B 2OPBA 1HE5A 1ZJZA 5IJ0A 3WDSA 1TW3A 2ILTA 2PL1A 3DO5A 1NR5A 1XGKA 2H0AA 2Y66A 5AW8A 3E7WA 1QLJA 2AS0A 4TSFD 2FF7A 2RK6A 4RK5A 4X0EA 3QUAA 2BHTA 4JMLA 5CLLA 3UXYA 1JDUA 3D81A 1CHDA 3ZBQA 4H6PA 4NENA 1LVUA 4CM9D 5J4KA 4Z4RA 4RH0A 1DAFA 1QCCA 4K6HA 1G0OA 1HZZA 2BBWA 3AY3A 3KR2A 1U9CA 1H5QA 1ZCFA 4YDQA 4DJFC 5IJ9A 4TKUA 3P9NA 3U17A 1M54A 2VP2A 4EW1A 4IVQA 5E8JA 5JSUA 4L5BA 3TOSA 4C30A 4OOEA 4EZEA 3QU7A 4ASUA 3BMXA 2YVLA 4OTZA 4RULA 2IXTA 5ERXA 3UV6A 3R0VA 4F46A 3N9IA 4JBGA 4GI7A 5FYQA 1NLUA 3C5VA 1LPPA 4DZZA 3BMQB 1J5PA 1H5NA 4G5FA 4D4KA 2ZITA 4YMLA 4RJLA 1U5CA 2YRWA 3RGGA 2VDWB 3GHHA 2ECOA 2JLRA 1JHVA 1BA2A 1WSBA 3ETGA 4GP6A 4YMGA 3LAWA 3TPZA 2VJLA 3FUUA 1J5XA 2C5EA 5ECGC 5B64A 4GMKA 4ZAGA 3NONA 3DEZA 4KO2S 1E6CA 2ZU6A 5IJXA 1R0CA 3ZWPA 1NU6A 3UJNA 4YRAA 1RRCA 1CKEA 4FFOA 1JQ5A 3FBGA 2AG1A 2HH9A 4Q47A 1CQIA 1V1RB 1SG0A 1DXYA 3OCYA 4CEIB 4EVQA 3I1FA 2OGSA 4ZOCA 2G0AA 2ZUUA 4FKBA 2O8EA 4FFPA 4IW3B 2HQOA 2BLNA 2W2VA 2HR1A 5JSHA 2WHPA 1N2GA 1O95A 1ZI8A 4O2RA 2HW8A 2CJXA 1K6JA 2OBXA 4GOND 1UQRA 1B6RA 1ZVKA 2YWBA 3JAWB 2X1VA 2D1QA 2PR2A 1S01A 5LB2A 3OWHA 2DIEA 3IOEA 3Q8LA 4E1BA 5TSDA 4RPDA 1JAHA 5IDYA 1B73A 4PGMA 3ROZA 1W49A 4QVAA 1NJ5A 2FR1A 4ZCMA 2IH5A 1GADO 2Y67A 2O4CA 3FHLA 2FZWA 3LZCA 1KY4A 5BVGB 1DIRA 5JNLA 2ZIEA 3CUWA 3OLWA 4IQ0A 5EOVA 2GESA 2GZHA 2WSIA 2QTFA 4IFIA 4QU0A 4PSKA 1MENA 1P7ZA 1S7CA 2CJFA 1PZHA 1X9HA 2NNLD 4IZIA 4MR9B 4PO8A 5FFNA 3SHQA 3LGXA 3AIMA 3WWEA 3REFA 4BP1A 1IBLB 4L75A 3MFYA 1QX3A 3ETDA 4DANA 2IWRA 4D1YA 1Z6QA 1XQXA 1HDYA 2OBSA 1KERA 2M6KA 3S2UA 3S29A 3TI7A 3UWKA 2O9JA 2ZTGA 1BNCA 2RHBA 4RGVA 4BNMA 5EE0A 4L7VA 5KO2A 1GPBA 2I0FA 2VP4A 1YWGO 4QYTA 5E4JA 3KJZA 4L51A 3WDKA 2LIPA 2HQ1A 4PYLA 1X1AA 2XUHA 4EYKA 3UPTA 1D1TA 4N6GA 1AQJA 4BV9A 3H0EA 5IWAB 1IZZA 2WLSA 2PV7A 4EI9A 3FTDA 5K8LA 2XW6A 1H2WA 2CDAA 4XVQA 1AN0A 5TPZD 3V7FA 1SIOA 4PNHA 4LW8A 5AK6A 3COVA 2OPHA 4BCDA 2Q2WA 1BC5A 3MTJA 1A97A 3MT0A 3WMGA 1FLAA 1P1IA 4DR3B 2BFPA 4PG4A 4D4LA 5I7EA 1CY0A 1SXJD 4HZIA 4DE5A 5K4GA 1K8RA 1Z25A 2Z8YA 4XR9A 4Q3EA 2BGJA 2RAUA 2ATVA 3EXHA 3KQLA 4HOYA 4S1PA 3MB5A 4LBYA 3CKLA 4RH3A 2CHVA 3RLIA 3CPXA 3P45A 4DLUA 3IQIX 1JFTA 3VPGA 1IOLA 1G2IA 4FYPA 1JU3A 4PPQA 4QBIA 1YZVA 3H1PA 3I6YA 2Q0HA 2N75A 3G5TA 3S1LA 1PUXA 1LI5A 3NH6A 1TFRA 4D80A 4ZJZA 1T1IA 3SQWA 1YUBA 3PUKA 3TH5A 4BGVA 4LKRA 2V9CA 2ZDQA 2V6FA 3EIWA 3PIDA 4U2FA 1F8UA 1O03A 2HFJA 4C0HA 4B45A 2JIMA 1GAXA 2E2WA 2QXUA 2ZIVB 4ZYLA 2B6HA 2HOQA 4GRIA 4ZOEA 1F6DA 2B1GA 3C7DB 4HAXA 1F9AA 3GD7A 4HDRA 3N6XA 3ZDEA 1E2DA 4W1SA 3KWJA 4RHFA 1PJ8A 5CVJA 1P19A 3RJ9A 1NJ6A 1SHTX 2I7CA 1GAEO 2ZQZA 3DTYA 3IMCA 4UQOA 4FDVA 5IDVA 2P9ZA 1KYVA 3RC8A 3GLRA 5KOJB 3O75A 4I50A 1I8DA 3Q3GE 1C7ZA 2FOLA 2H63A 1I7LA 1U1DA 1NB0A 2AD5A 2A5FA 3D5TA 2WF5A 3N86A 2PH5A 4L4XA 1UEXC 5FRDA 2W58A 3JASB 1D7OA 4UARA 4MW5A 3IBCA 4HLCA 1NVXQ 4NHEA 4ENVA 3TIVA 1CNFA 5A62A 2R8OA 2GAIA 3VAAA 1QZXA 3TNLA 4Y7CA 3P4XA 7GPBA 1H0SA 2HKIA 1L7VC 3ZWOA 4DQUA 2GPJA 4YRCA 5K8IA 1DBIA 3GZ4A 1YUMA 3IBTA 3JSXA 4YNBA 3LQ6A 5ILQA 2J67A 4IILA 3UK7A 4AN0A 1N2CB 3VTFA 3ZHTA 4J03A 1IEXA 1KJ9A 4E0BA 4X1YB 2V03A 8OHMA 1E3MA 1ISSA 1U0NA 1Z7EA 4DG5A 4UNPA 5B7GA 2R6HA 4FFVA 4CFSA 5F73A 1K9SA 3JD0A 1ADJA 1GTMA 1OLUA 1V8BA 4R6XA 2YWRA 4MJ7A 3K09A 3BK2A 2AB0A 2O3TA 1E6WA 2N0SA 1ZJYA 2BM9A 2ZBGA 3NQ41 4PZPA 4G07A 2AUTA 2VSXA 5F7JA 3VU1A 2CXQA 4JYZA 3IESA 1U4NA 1M8JA 3PFCA 5IU6A 3OIFA 3HXTA 2BMVA 4MCIA 4XVCA 3R7DA 2JHPA 2SKDA 2BMFA 4X54A 2F6RA 1Y48E 2XE7A 1PS0A 4RH1A 3WYBA 4INAA 4JB2A 2GD1O 4G0OA 3PGA1 3COPA 2QLNA 3UUFA 5HF6A 1ZJWA 1STOA 3U7GA 1R7RA 1VYHA 3DDOA 2ZYHA 4I3GA 4D99A 3P0EA 4L4YA 3UKJA 5JJ5A 2XQVA 3FD8A 2C77A 5BSHA 3IKJA 5KTYA 2CVQA 5GGYA 4DWJA 2D2IA 3ZKWA 1V2GA 5D5QA 4N8EA 1L4KA 2FQWA 2VSFA 3HY3A 1LDEA 1IOVA 2OLKA 3MWLA 5A7FA 1TEHA 2Z1NA 4MQFB 1RD4A 4TKMA 3C8DA 4AO6A 1GSHA 3C3KA 1NJID 2J07A 2NWQA 3QU5A 3RVOA 4E94A 1OZAA 5K8UA 1HY3A 5DBHX 1G8PA 3OBIA 3EIXA 4HBGA 5EMJA 3IERA 4BJ5A 4M7OA 4KKTA 2ORYA 2OYCA 3LCCA 2OSVA 4U7WA 1ZUHA 3BA6A 3I4LA 4V3BA 1OH6A 4O2AB 5CP8A 1AKNA 4MJLA 5EKXA 1FYXA 1U2PA 4LECA 2RH5A 1T3ZA 1I3MA 2P11A 3OPQA 3CNHA 3EUWA 3HP7A 2DUJA 3L0OA 5LM3A 2BJVA 2P91A 2B92A 2R9VA 2QR2A 1RWQA 2XUJA 4TV9B 2XCUA 3TZHA 3MCWA 3IVGA 3LWNA 4PAAA 4LXUA 1ANKA 1MZVA 2HRRA 3FYTA 4BJHB 4I4TF 1M2JA 1P61B 4EEKA 4S1WA 5JMPA 4WX2B 4FB4A 3KPUA 4RKWA 4FDLA 3B9BA 3RS9A 1VSVA 4QHSA 3RF6A 4EL5A 3QG1A 2O7QA 3L1IA 1R88A 1W76A 3JRXA 3T12A 4A03A 1U7HA 5CLJA 3UJ7A 2H17A 3ZIAA 3C3CA 1QKKA 1RZVA 3AKCA 1JDSA 2GUGA 3IAAA 4ZAYA 2VDRB 3ZWKA 3DNFA 1F0PA 5JIBA 1EP3B 1NM5C 2QPAA 2PX0A 2AGVA 3FWKA 5JROA 2A6PA 5K0JA 1E9VA 4LXXA 5EKUA 3OT1B 2F1IA 2IC5A 2FX5A 3I2HA 5C31A 3SQMA 4NU5A 5CD1A 2CXNA 4QELA 4BXOA 1KSJA 1KSHA 1UFKA 4DGSA 1WMBA 3WKBA 1EZ4A 2OR3A 2IZ5A 3ILXA 1JTEA 1TK2A 1XK7A 1XTIA 2HWXA 2JEYA 5K03A 3GUUA 4XD7A 2VDJA 5EIHA 2AXNA 2PNFA 2PUVA 1YCDA 1XVVA 1NRIA 3LK6A 4HFMA 2FWMX 2GK4A 2QIOA 3ZWWA 4DNPA 2GFIA 2QL6A 1YA8A 3GFFA 4FFRA 4OHPA 1UJCA 2AKAB 1OU4A 3GI1A 4H7FA 4KI0A 1K7CA 3QI2A 2C84A 2VAPA 4PM4A 4TYYA 3KXPA 4CUJA 4EG3A 2BMAA 4GD3Q 1KMHB 1DEKA 1A9XB 1U80A 2MYPA 4K0KB 4RC9A 1SIWA 5ELXA 3O7MA 3AHHA 3GRYA 1ADGA 1CUFA 1I2ZA 1JQKA 2Y6VA 3ITKA 5KYTA 1Z7YA 2V3WA 1Z62A 1RWWA 2X2EA 2EV9A 3C7CB 2CKMA 3NEJA 1Q1NA 1D4ZA 3DG9A 4GAEA 5JAZA 5EXEA 4MI6A 1T34A 2RG7A 4GSYA 3B5IA 3BEDA 1WOYA 3IDQA 4FEYA 5SZHB 4D6XA 3ZHXA 2H16A 3ILSA 4ZTUB 3I30X 1IUKA 5AI6A 3H5TA 3I04A 3ML1A 3TKYA 4BMYA 1NFQA 4IMRA 4JVOA 4CQJA 3R8FA 4MEJA 3D8RA 2JAPA 3PQ6A 4WZ6A 3A3GA