3ONYA

Crystal structure of p domain from norwalk virus strain vietnam 026 in complex with fucose
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
315
structure length
310
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVPGEGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title Crystal Structures of GII.10 and GII.12 Norovirus Protruding Domains in Complex with Histo-Blood Group Antigens Reveal Details for a Potential Site of Vulnerability.
pubmed doi rcsb
source organism Norwalk virus
total genus 62
structure length 310
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3onyA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3onyA01
3Q3AA 3LQ6A 5F4JA 4P25A 4OPVA 2OBTA 4RM0A 3ASQA 5IYQA 3LQEA 5HZAA 4Z4RA 4Z4UA 5IYPA 4P26A 4OOVA 4QUZA 5IYRA 4ROXA 4WZLA 5KW9A 3PUMA 3ASPA 4Z4ZA 4WZEA 3BY1A 5J3OA 4RPDA 3SLDA 3Q6RA 4X7FA 5BSXA 3PUNA 4OP7A 4P2NA 3R6KA 4QVJA 3SEJA 2OBRA 2ZL5A 4X7CA 4P3IA 4OPOA 4P12A 4X06A 3ASRA 4RLZA 4RDJA 4RDKA 4Z4YA 3Q38A 5IYNA 3V7AA 4RDLA 4P1VA 3ASTA 5J35A 5HZBA 3ONYA 4OPSA 5E6TA 3PA1A 3PA2A 4QVAA 3D26A 3ONUA 3Q39A 5F4OA 4Z4VA 4Z4TA 3SJPA 3BQJA 4X07A 4Z4SA 3R6JA 4X7DA 4Z4WA 4WZKA 3PVDA 3SLNA 5F4MA 4OOXA 4RPBA 4QV2A 3BY2A 3RY8A 5BSYA 3ASSA 4X7EA 1IHMA 4WZTA 2ZL7A 5IYWA 2OBSA 3SKBA 4X0CA 4X05A 2ZL6A 3Q6QA 4OOSA
chains in the Genus database with same CATH superfamily
2VYQA 4PC3A 3A1PA 3QFCA 3VO2A 3OKXA 5LMZA 2OYNA 1S4MA 1HZEA 4P25A 4X8IA 4HIZA 1FNCA 2QN6A 3ISXA 1NJID 4PGOA 4RM0A 3VR6A 5IYQA 2GJKA 1XB2A 3FJOA 4YEJA 3AVWA 3OZUA 5IYPA 2WZNA 3CPXA 4YALA 1DDGA 1FNDA 4ACBA 1NB9A 3OE7A 4QUZA 4KKTA 4ZCIA 1VQ4B 1VQKB 1YJNB 3CCVB 5KW9A 3ASPA 2BPOA 4KKUA 4WZEA 3DDYA 1GJRA 3OJXA 2JJ2A 2VJIA 1BX0A 2YWEA 3BY1A 3OP1A 4ZCLA 3JQQA 4LC0A 4C43A 2V7UA 4DQKA 4YAWA 3QE2A 1SKQA 1ZM2A 3CCUB 1UD3A 1GAWA 2ZTGA 4OP7A 2FX3A 2GJPA 1GAQA 1VJSA 3CD6B 2XZOA 5TRDA 1QUFA 3W2FA 1DDIA 1W0KA 1YX2A 1Q7YD 4N3GA 1WTHD 1VQ9B 4XOTA 1ELOA 2NV4A 2VBSA 5DSZA 1QGZA 4P12A 3FKSA 5GV8A 4RLZA 3OOCA 2ZBUA 2OK8A 4RDKA 3CCLB 4WQMA 3CP2A 1FRNA 1VLOA 3FPPA 4DK0A 4RD6A 2F1MA 4MYUA 1T5EA 4P1VA 5EMNA 4K1XA 1HA3A 2GPJA 2RC6A 5J35A 4FN5A 1TLLA 4XD7A 2WJVA 3CRZA 1XQBA 4M1KA 5GV7A 4QVAA 1R5BA 3VO1A 4B3FX 3ZBTA 4L8JA 3Q39A 1D2EA 1D1NA 2OK7A 3R6JA 3W2IA 4XL9A 4XMYA 4Z4WA 1VQ7B 4DK1A 1NBMA 1V5VA 1GO2A 2E1BA 3SLNA 1NRKA 1HVXA 2PMDA 2WPDA 4OOXA 3KEWA 4RPBA 1GR1A 1UD2A 3BY2A 4AF7A 3RY8A 4TN1A 5A8AA 1FNBA 2VNHA 1JA1A 1IHMA 2BF4A 3GVKA 3PENA 4WZTA 5IYWA 2GJRA 2YWHA 1GVHA 4DQLA 1AMOA 1UD8A 3WY9A 4P3YA 5TR9A 1RQRA 2V7XA 3OFNA 3G4SB 3SJZA 2BVNA 2ZL6A 4NBSA 3CC4B 1CQXA 3MHPA 2WZPP 3LQ6A 2HLDA 5FO1A 4DNTB 5F4JA 1I18A 1BJKA 1DG1G 1UMKA 4M0LA 1K9MD 1I7PA 2D9RA 2OBTA 5FIUA 1YITB 1M90D 3ASQA 3ZZTA 3A8KA 2QEXB 4UZFA 1ZM3A 3G71B 2Q6KA 2D3LA 1W34A 1H8EA 2VNKA 4P26A 1Q82D 3T51B 4PC2A 4FK8A 1TTTA 4Y7CA 5L46A 3WXMA 2Z6BD 4NNJA 5FL7A 4LBWA 4N3NA 4HE5A 4WZLA 2GK7A 1DARA 3JU4A 1WOSA 4XN3A 4Z4ZA 3I1FA 2DEUA 4P6YA 1VQNB 2XGJA 2GK6A 1N07A 1SM4A 4LBZA 5TV2A 4YXWA 1WU8A 2DY1A 4IW3B 3QFRA 2ZZGA 2QMUA 2WR8A 3AVVA 2C5BA 3Q6RA 1FX0A 1Y0YA 2C78A 3PUNA 3U6BA 4QFMA 2B7CA 4TMXA 3W2EA 3J81k 1BQEA 1VHEA 1I8DA 4RCYA 3W5VA 1AIPA 5FNZA 2QE7A 4B3XA 1EFUA 2OBRA 2AHOA 2YWGA 3LNNA 3NE5B 1YJ9B 2XNJA 4AF6A 3G6EB 3ES9A 2EIXA 4M53A 4X06A 3ASRA 3BCDA 2V7QA 4RDJA 3A8IA 1YJWB 1TUIA 3V76A 3Q38A 4Q7JB 1R5NA 2Q6OA 4NCNA 4B43A 4RCZA 3VNUA 3WQZA 4PC6A 5THXA 5JBQA 1E62A 1S72B 4XLCA 5A89A 5E6TA 2C5HA 4M2LA 5KSWB 3PA2A 2VBTA 1E43A 2W6JA 2CRVA 1VF7A 1ZUNB 1MRZA 3CESA 1VQLB 3D26A 1WSRA 3WYAA 4ACAA 4Z4TA 2V31A 4X07A 2XNDA 2V7VA 1QG0A 2ZBVA 4LBVA 1W0JA 2PLFA 5H5JA 3BCFA 2JJ1A 4WZKA 2C4UA 3PVDA 2D74A 5F4MA 1E64A 4ASUA 2QGGA 4C0SA 4QV2A 1VQOB 3A8JA 5DS0A 1B2RA 1EXMA 2ZITA 2CC2A 4E0FA 1WP6A 2D3NA 2ZXHA 3CC7B 1EP3B 1Q9SA 2EFGA 2JN9A 3ASSA 3LVBA 1KK1A 2ZTNA 2BM0A 4FXUA 3BC9A 1IB0A 2OBSA 1YLOA 1VQ5B 1VQMB 4XKWA 2CNDA 2CBXA 2VZLA 1FDRA 1KRHA 1IJFA 1CNEA 2CW5A 2XNCA 3OEEA 2FVGA 2DYIA 4X0CA 1VQPB 3OAAA 1YI2B 4OOSA 1T6YA 2XZPA 4II3A 3WNCA 1F20A 4P22A 1E1QA 2B5OA 1K8AD 2DCUA 2PIAA 1VHOA 2W6IA 2B7BA 1YHQB 1QH0A 3MCAA 1QGAA 4Z4RA 3AVTA 1Q81D 1OHHA 3VMFA 1OB0A 4OOVA 3H94A 4H9GA 4Z1MA 3GVJA 3OZWA 4ROXA 1Y0RA 3CC2B 4B3GA 1E1RA 5A88A 3E1YE 1B23P 3CCEB 2CF4A 1E3XA 2F43A 1E3ZA 3AGQA 4YHBA 2HCJB 1V0FA 1ZM4A 4PABA 2J7KA 2QTZA 3AVYA 4TKOB 4RPDA 4XONA 3SLDA 1BMFA 4B47A 2JDIA 1RQPA 3WBJA 1ZM9A 4P2NA 1U2RA 3MMPA 3AVUA 1EP1B 3HAGA 2X6YA 4UZEA 4AC9A 4RD1A 3CXCB 3CCQB 3R6KA 2Q6LA 1UD4A 3CP8A 1WOPA 3SEJA 2XEXA 4G6IA 2XOKA 3WBKA 1EP2B 2DOGA 3AGPA 1N0VC 3I56B 1KTVA 2X85A 1G7SA 2HMAA 2VJJA 4P3IA 4F7DA 2BGJA 3CB4A 4MYTA 3GIRA 4OPOA 4PAAA 2GQFA 4G5GA 1COWA 3QFTA 4Y9UA 1UD6A 4GQNA 1PJ7A 3V7AA 4RDLA 1E63A 1CNFA 4PC1A 2PE3A 1T6ZA 2X6WA 1FNMA 1BX1A 4II2A 4BPRA 3WNBA 4RJLA 2BGIA 2ZXIA 1VLYA 3JQPA 1N05A 4OPSA 1KC8D 2WYRA 3PA1A 2BN4A 3GSIA 4XORA 2DERA 1XFOA 4P6VF 4TMZA 2VBUA 1PKVA 1PJ5A 4XN0A 1JA0A 4XOPA 2BSAA 3BQJA 5HXBA 1N08A 2V4DA 4B4DA 1QVGB 2C4TA 1A8PA 1J9ZA 1KK3A 1OGJA 1YIJB 1E79A 1D8TA 4TSFA 4ZCMA 2BV3A 1S0UA 5B6IA 4XLFA 1G7TA 3FPKA 1QFYA 4RD4A 2I1LA 1KJZA 2X8KA 3CW2A 3I55B 3E20A 3B82A 2Q6IA 1N06A 4XLEA 2VNJA 4YAOA 3CPWB 1UD5A 1R5OA 4X7EA 4QHYA 3GQBA 2ZL7A 3ZZ0A 4YAFA 3GVLA 1EWYA 3QSYA 2X3UA 4FWTA 2OTLB 4DNRB 1W35A 3SKBA 1V0EA 1OGIA 1H8HA 2R6HA 3OZVA 3CCJB 3P26A 2JIZA 3CMMA 1VQ8B 3W5HA 4Y9RA 3Q3AA 1WOOA 2ZZQA 4B48A 3U2QA 3ZUGA 3ZZUA 4OPVA 2OTJB 1QUEA 2HDNB 1KK2A 3LQEA 3A3BA 2X6XA 1M1KD 3ZC3A 2VNIA 5HZAA 1H85A 1NB0A 2E1RA 4Z4UA 4G1VA 2KVOA 3ZIAA 3BH4A 4YELA 1JJ2B 4XKVA 5IYRA 1P4MA 2BMWA 1NDHA 1EFRA 2WSSA 1KQSB 4HE6A 1TVCA 3PUMA 3CMEB 4XQFA 1QX4A 1G7CA 4CQJA 2F4NA 4B44A 4ZGQB 1K28D 3U6KA 5J3OA 4YAUA 2ZZEA 2QA4B 3JQRA 1W2BB 1KD1D 2NPFA 4X7FA 5BSXA 3LO8A 4ZGNB 2QDXA 2ZZFA 2RC5A 1W87A 4U9UA 5FA6A 3W2HA 5HKKA 4G1BA 4XLHA 2DIEA 1PJ6A 2LZJA 3OPOA 4XM3A 2BM1A 4KKSA 5KNLA 4QVJA 1EFTA 1FRQA 4RD0A 4XLAA 1JNYA 4PC7A 4XR6A 2ZL5A 4X7CA 1QGYA 2X53S 1QFZA 3QFSA 3OJWA 4LBYA 3AVXA 5IK2A 1OB5A 3P27A 4UAJA 5H59A 3W2GA 1H42A 3CCSB 2P3MA 3CCRB 3CCMB 2M5SA 4Z4YA 1EFCA 5IYNA 2F1LA 1T6XA 3VNVA 2C77A 4TMTA 1WSVA 3T53B 3BNWA 3ASTA 1QVFB 3H9NA 4UZUA 3OW7A 2DETA 4M4SA 4J0QA 5TY0A 3G05A 1VQ6B 5HZBA 1JB9A 3B8HA 3ONYA 3OW2B 2V7WA 3A35A 3ZPNA 5AN9A 3ZBUA 2X0KA 1BPLA 1KZLA 2C2WA 3A3GA 4TMVA 1KK0A 4TMWA 4TT3A 3ONUA 1W9XA 4G7XA 5F4OA 2V7TA 2CK3A 4Z4VA 3SJPA 4EH1A 1N8RD 3OEHA 4Z4SA 4P9SA 2VBVA 4X7DA 5FO0A 2WJYA 1WORA 5DN6A 1G7RA 2YWFA 1Q86D 4WWVA 4G7WA 1KMHA 4JMQA 1F60A 1WPCA 2QTLA 3W5UA 3WNDA 3B78A 2XZLA 1WDTA 1BLIA 3CMAB 5CDFA 5BSYA 3T56B 4ZV4A 1K73D 2GREA 3CTAA 1IJEA 1MABA 1QFJA 1XE1A 1OB2A 3KL9A 4RD2A 4AVZA 4XNFA 2R9VA 4R71A 1SKYB 4RD3A 1N0UA 3Q6QA 4X05A
chains in the Genus database with same CATH topology
3Q3AA 3LQ6A 5F4JA 4P25A 4OPVA 2OBTA 4RM0A 3ASQA 5IYQA 3LQEA 5HZAA 4Z4RA 4Z4UA 5IYPA 4P26A 4OOVA 4QUZA 5IYRA 4ROXA 4WZLA 5KW9A 3PUMA 3ASPA 4Z4ZA 4WZEA 3BY1A 5J3OA 4RPDA 3SLDA 3Q6RA 4X7FA 5BSXA 3PUNA 4OP7A 4P2NA 3R6KA 4QVJA 3SEJA 2OBRA 2ZL5A 4X7CA 4P3IA 4OPOA 4P12A 4X06A 3ASRA 4RLZA 4RDJA 4RDKA 4Z4YA 3Q38A 5IYNA 3V7AA 4RDLA 4P1VA 3ASTA 5J35A 5HZBA 3ONYA 4OPSA 5E6TA 3PA1A 3PA2A 4QVAA 3D26A 3ONUA 3Q39A 5F4OA 4Z4VA 4Z4TA 3SJPA 3BQJA 4X07A 4Z4SA 3R6JA 4X7DA 4Z4WA 4WZKA 3PVDA 3SLNA 5F4MA 4OOXA 4RPBA 4QV2A 3BY2A 3RY8A 5BSYA 3ASSA 4X7EA 1IHMA 4WZTA 2ZL7A 5IYWA 2OBSA 3SKBA 4X0CA 4X05A 2ZL6A 3Q6QA 4OOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3A A;  3LQ6 A;  5F4J A;  4P25 A;  4OPV A;  2OBT A;  4RM0 A;  3ASQ A;  5IYQ A;  3LQE A;  5HZA A;  4Z4R A;  4Z4U A;  5IYP A;  4P26 A;  4OOV A;  4QUZ A;  5IYR A;  4ROX A;  4WZL A;  5KW9 A;  3PUM A;  3ASP A;  4Z4Z A;  4WZE A;  3BY1 A;  5J3O A;  4RPD A;  3SLD A;  3Q6R A;  4X7F A;  5BSX A;  3PUN A;  4OP7 A;  4P2N A;  3R6K A;  4QVJ A;  3SEJ A;  2OBR A;  2ZL5 A;  4X7C A;  4P3I A;  4OPO A;  4P12 A;  4X06 A;  3ASR A;  4RLZ A;  4RDJ A;  4RDK A;  4Z4Y A;  3Q38 A;  5IYN A;  3V7A A;  4RDL A;  4P1V A;  3AST A;  5J35 A;  5HZB A;  3ONY A;  4OPS A;  5E6T A;  3PA1 A;  3PA2 A;  4QVA A;  3D26 A;  3ONU A;  3Q39 A;  5F4O A;  4Z4V A;  4Z4T A;  3SJP A;  3BQJ A;  4X07 A;  4Z4S A;  3R6J A;  4X7D A;  4Z4W A;  4WZK A;  3PVD A;  3SLN A;  5F4M A;  4OOX A;  4RPB A;  4QV2 A;  3BY2 A;  3RY8 A;  5BSY A;  3ASS A;  4X7E A;  1IHM A;  4WZT A;  2ZL7 A;  5IYW A;  2OBS A;  3SKB A;  4X0C A;  4X05 A;  2ZL6 A;  3Q6Q A;  4OOS A; 
#chains in the Genus database with same CATH topology
 2VYQ A;  4PC3 A;  3A1P A;  3QFC A;  3VO2 A;  3OKX A;  5LMZ A;  2OYN A;  1S4M A;  1HZE A;  4P25 A;  4X8I A;  4HIZ A;  1FNC A;  2QN6 A;  3ISX A;  1NJI D;  4PGO A;  4RM0 A;  3VR6 A;  5IYQ A;  2GJK A;  1XB2 A;  3FJO A;  4YEJ A;  3AVW A;  3OZU A;  5IYP A;  2WZN A;  3CPX A;  4YAL A;  1DDG A;  1FND A;  4ACB A;  1NB9 A;  3OE7 A;  4QUZ A;  4KKT A;  4ZCI A;  1VQ4 B;  1VQK B;  1YJN B;  3CCV B;  5KW9 A;  3ASP A;  2BPO A;  4KKU A;  4WZE A;  3DDY A;  1GJR A;  3OJX A;  2JJ2 A;  2VJI A;  1BX0 A;  2YWE A;  3BY1 A;  3OP1 A;  4ZCL A;  3JQQ A;  4LC0 A;  4C43 A;  2V7U A;  4DQK A;  4YAW A;  3QE2 A;  1SKQ A;  1ZM2 A;  3CCU B;  1UD3 A;  1GAW A;  2ZTG A;  4OP7 A;  2FX3 A;  2GJP A;  1GAQ A;  1VJS A;  3CD6 B;  2XZO A;  5TRD A;  1QUF A;  3W2F A;  1DDI A;  1W0K A;  1YX2 A;  1Q7Y D;  4N3G A;  1WTH D;  1VQ9 B;  4XOT A;  1ELO A;  2NV4 A;  2VBS A;  5DSZ A;  1QGZ A;  4P12 A;  3FKS A;  5GV8 A;  4RLZ A;  3OOC A;  2ZBU A;  2OK8 A;  4RDK A;  3CCL B;  4WQM A;  3CP2 A;  1FRN A;  1VLO A;  3FPP A;  4DK0 A;  4RD6 A;  2F1M A;  4MYU A;  1T5E A;  4P1V A;  5EMN A;  4K1X A;  1HA3 A;  2GPJ A;  2RC6 A;  5J35 A;  4FN5 A;  1TLL A;  4XD7 A;  2WJV A;  3CRZ A;  1XQB A;  4M1K A;  5GV7 A;  4QVA A;  1R5B A;  3VO1 A;  4B3F X;  3ZBT A;  4L8J A;  3Q39 A;  1D2E A;  1D1N A;  2OK7 A;  3R6J A;  3W2I A;  4XL9 A;  4XMY A;  4Z4W A;  1VQ7 B;  4DK1 A;  1NBM A;  1V5V A;  1GO2 A;  2E1B A;  3SLN A;  1NRK A;  1HVX A;  2PMD A;  2WPD A;  4OOX A;  3KEW A;  4RPB A;  1GR1 A;  1UD2 A;  3BY2 A;  4AF7 A;  3RY8 A;  4TN1 A;  5A8A A;  1FNB A;  2VNH A;  1JA1 A;  1IHM A;  2BF4 A;  3GVK A;  3PEN A;  4WZT A;  5IYW A;  2GJR A;  2YWH A;  1GVH A;  4DQL A;  1AMO A;  1UD8 A;  3WY9 A;  4P3Y A;  5TR9 A;  1RQR A;  2V7X A;  3OFN A;  3G4S B;  3SJZ A;  2BVN A;  2ZL6 A;  4NBS A;  3CC4 B;  1CQX A;  3MHP A;  2WZP P;  3LQ6 A;  2HLD A;  5FO1 A;  4DNT B;  5F4J A;  1I18 A;  1BJK A;  1DG1 G;  1UMK A;  4M0L A;  1K9M D;  1I7P A;  2D9R A;  2OBT A;  5FIU A;  1YIT B;  1M90 D;  3ASQ A;  3ZZT A;  3A8K A;  2QEX B;  4UZF A;  1ZM3 A;  3G71 B;  2Q6K A;  2D3L A;  1W34 A;  1H8E A;  2VNK A;  4P26 A;  1Q82 D;  3T51 B;  4PC2 A;  4FK8 A;  1TTT A;  4Y7C A;  5L46 A;  3WXM A;  2Z6B D;  4NNJ A;  5FL7 A;  4LBW A;  4N3N A;  4HE5 A;  4WZL A;  2GK7 A;  1DAR A;  3JU4 A;  1WOS A;  4XN3 A;  4Z4Z A;  3I1F A;  2DEU A;  4P6Y A;  1VQN B;  2XGJ A;  2GK6 A;  1N07 A;  1SM4 A;  4LBZ A;  5TV2 A;  4YXW A;  1WU8 A;  2DY1 A;  4IW3 B;  3QFR A;  2ZZG A;  2QMU A;  2WR8 A;  3AVV A;  2C5B A;  3Q6R A;  1FX0 A;  1Y0Y A;  2C78 A;  3PUN A;  3U6B A;  4QFM A;  2B7C A;  4TMX A;  3W2E A;  3J81 k;  1BQE A;  1VHE A;  1I8D A;  4RCY A;  3W5V A;  1AIP A;  5FNZ A;  2QE7 A;  4B3X A;  1EFU A;  2OBR A;  2AHO A;  2YWG A;  3LNN A;  3NE5 B;  1YJ9 B;  2XNJ A;  4AF6 A;  3G6E B;  3ES9 A;  2EIX A;  4M53 A;  4X06 A;  3ASR A;  3BCD A;  2V7Q A;  4RDJ A;  3A8I A;  1YJW B;  1TUI A;  3V76 A;  3Q38 A;  4Q7J B;  1R5N A;  2Q6O A;  4NCN A;  4B43 A;  4RCZ A;  3VNU A;  3WQZ A;  4PC6 A;  5THX A;  5JBQ A;  1E62 A;  1S72 B;  4XLC A;  5A89 A;  5E6T A;  2C5H A;  4M2L A;  5KSW B;  3PA2 A;  2VBT A;  1E43 A;  2W6J A;  2CRV A;  1VF7 A;  1ZUN B;  1MRZ A;  3CES A;  1VQL B;  3D26 A;  1WSR A;  3WYA A;  4ACA A;  4Z4T A;  2V31 A;  4X07 A;  2XND A;  2V7V A;  1QG0 A;  2ZBV A;  4LBV A;  1W0J A;  2PLF A;  5H5J A;  3BCF A;  2JJ1 A;  4WZK A;  2C4U A;  3PVD A;  2D74 A;  5F4M A;  1E64 A;  4ASU A;  2QGG A;  4C0S A;  4QV2 A;  1VQO B;  3A8J A;  5DS0 A;  1B2R A;  1EXM A;  2ZIT A;  2CC2 A;  4E0F A;  1WP6 A;  2D3N A;  2ZXH A;  3CC7 B;  1EP3 B;  1Q9S A;  2EFG A;  2JN9 A;  3ASS A;  3LVB A;  1KK1 A;  2ZTN A;  2BM0 A;  4FXU A;  3BC9 A;  1IB0 A;  2OBS A;  1YLO A;  1VQ5 B;  1VQM B;  4XKW A;  2CND A;  2CBX A;  2VZL A;  1FDR A;  1KRH A;  1IJF A;  1CNE A;  2CW5 A;  2XNC A;  3OEE A;  2FVG A;  2DYI A;  4X0C A;  1VQP B;  3OAA A;  1YI2 B;  4OOS A;  1T6Y A;  2XZP A;  4II3 A;  3WNC A;  1F20 A;  4P22 A;  1E1Q A;  2B5O A;  1K8A D;  2DCU A;  2PIA A;  1VHO A;  2W6I A;  2B7B A;  1YHQ B;  1QH0 A;  3MCA A;  1QGA A;  4Z4R A;  3AVT A;  1Q81 D;  1OHH A;  3VMF A;  1OB0 A;  4OOV A;  3H94 A;  4H9G A;  4Z1M A;  3GVJ A;  3OZW A;  4ROX A;  1Y0R A;  3CC2 B;  4B3G A;  1E1R A;  5A88 A;  3E1Y E;  1B23 P;  3CCE B;  2CF4 A;  1E3X A;  2F43 A;  1E3Z A;  3AGQ A;  4YHB A;  2HCJ B;  1V0F A;  1ZM4 A;  4PAB A;  2J7K A;  2QTZ A;  3AVY A;  4TKO B;  4RPD A;  4XON A;  3SLD A;  1BMF A;  4B47 A;  2JDI A;  1RQP A;  3WBJ A;  1ZM9 A;  4P2N A;  1U2R A;  3MMP A;  3AVU A;  1EP1 B;  3HAG A;  2X6Y A;  4UZE A;  4AC9 A;  4RD1 A;  3CXC B;  3CCQ B;  3R6K A;  2Q6L A;  1UD4 A;  3CP8 A;  1WOP A;  3SEJ A;  2XEX A;  4G6I A;  2XOK A;  3WBK A;  1EP2 B;  2DOG A;  3AGP A;  1N0V C;  3I56 B;  1KTV A;  2X85 A;  1G7S A;  2HMA A;  2VJJ A;  4P3I A;  4F7D A;  2BGJ A;  3CB4 A;  4MYT A;  3GIR A;  4OPO A;  4PAA A;  2GQF A;  4G5G A;  1COW A;  3QFT A;  4Y9U A;  1UD6 A;  4GQN A;  1PJ7 A;  3V7A A;  4RDL A;  1E63 A;  1CNF A;  4PC1 A;  2PE3 A;  1T6Z A;  2X6W A;  1FNM A;  1BX1 A;  4II2 A;  4BPR A;  3WNB A;  4RJL A;  2BGI A;  2ZXI A;  1VLY A;  3JQP A;  1N05 A;  4OPS A;  1KC8 D;  2WYR A;  3PA1 A;  2BN4 A;  3GSI A;  4XOR A;  2DER A;  1XFO A;  4P6V F;  4TMZ A;  2VBU A;  1PKV A;  1PJ5 A;  4XN0 A;  1JA0 A;  4XOP A;  2BSA A;  3BQJ A;  5HXB A;  1N08 A;  2V4D A;  4B4D A;  1QVG B;  2C4T A;  1A8P A;  1J9Z A;  1KK3 A;  1OGJ A;  1YIJ B;  1E79 A;  1D8T A;  4TSF A;  4ZCM A;  2BV3 A;  1S0U A;  5B6I A;  4XLF A;  1G7T A;  3FPK A;  1QFY A;  4RD4 A;  2I1L A;  1KJZ A;  2X8K A;  3CW2 A;  3I55 B;  3E20 A;  3B82 A;  2Q6I A;  1N06 A;  4XLE A;  2VNJ A;  4YAO A;  3CPW B;  1UD5 A;  1R5O A;  4X7E A;  4QHY A;  3GQB A;  2ZL7 A;  3ZZ0 A;  4YAF A;  3GVL A;  1EWY A;  3QSY A;  2X3U A;  4FWT A;  2OTL B;  4DNR B;  1W35 A;  3SKB A;  1V0E A;  1OGI A;  1H8H A;  2R6H A;  3OZV A;  3CCJ B;  3P26 A;  2JIZ A;  3CMM A;  1VQ8 B;  3W5H A;  4Y9R A;  3Q3A A;  1WOO A;  2ZZQ A;  4B48 A;  3U2Q A;  3ZUG A;  3ZZU A;  4OPV A;  2OTJ B;  1QUE A;  2HDN B;  1KK2 A;  3LQE A;  3A3B A;  2X6X A;  1M1K D;  3ZC3 A;  2VNI A;  5HZA A;  1H85 A;  1NB0 A;  2E1R A;  4Z4U A;  4G1V A;  2KVO A;  3ZIA A;  3BH4 A;  4YEL A;  1JJ2 B;  4XKV A;  5IYR A;  1P4M A;  2BMW A;  1NDH A;  1EFR A;  2WSS A;  1KQS B;  4HE6 A;  1TVC A;  3PUM A;  3CME B;  4XQF A;  1QX4 A;  1G7C A;  4CQJ A;  2F4N A;  4B44 A;  4ZGQ B;  1K28 D;  3U6K A;  5J3O A;  4YAU A;  2ZZE A;  2QA4 B;  3JQR A;  1W2B B;  1KD1 D;  2NPF A;  4X7F A;  5BSX A;  3LO8 A;  4ZGN B;  2QDX A;  2ZZF A;  2RC5 A;  1W87 A;  4U9U A;  5FA6 A;  3W2H A;  5HKK A;  4G1B A;  4XLH A;  2DIE A;  1PJ6 A;  2LZJ A;  3OPO A;  4XM3 A;  2BM1 A;  4KKS A;  5KNL A;  4QVJ A;  1EFT A;  1FRQ A;  4RD0 A;  4XLA A;  1JNY A;  4PC7 A;  4XR6 A;  2ZL5 A;  4X7C A;  1QGY A;  2X53 S;  1QFZ A;  3QFS A;  3OJW A;  4LBY A;  3AVX A;  5IK2 A;  1OB5 A;  3P27 A;  4UAJ A;  5H59 A;  3W2G A;  1H42 A;  3CCS B;  2P3M A;  3CCR B;  3CCM B;  2M5S A;  4Z4Y A;  1EFC A;  5IYN A;  2F1L A;  1T6X A;  3VNV A;  2C77 A;  4TMT A;  1WSV A;  3T53 B;  3BNW A;  3AST A;  1QVF B;  3H9N A;  4UZU A;  3OW7 A;  2DET A;  4M4S A;  4J0Q A;  5TY0 A;  3G05 A;  1VQ6 B;  5HZB A;  1JB9 A;  3B8H A;  3ONY A;  3OW2 B;  2V7W A;  3A35 A;  3ZPN A;  5AN9 A;  3ZBU A;  2X0K A;  1BPL A;  1KZL A;  2C2W A;  3A3G A;  4TMV A;  1KK0 A;  4TMW A;  4TT3 A;  3ONU A;  1W9X A;  4G7X A;  5F4O A;  2V7T A;  2CK3 A;  4Z4V A;  3SJP A;  4EH1 A;  1N8R D;  3OEH A;  4Z4S A;  4P9S A;  2VBV A;  4X7D A;  5FO0 A;  2WJY A;  1WOR A;  5DN6 A;  1G7R A;  2YWF A;  1Q86 D;  4WWV A;  4G7W A;  1KMH A;  4JMQ A;  1F60 A;  1WPC A;  2QTL A;  3W5U A;  3WND A;  3B78 A;  2XZL A;  1WDT A;  1BLI A;  3CMA B;  5CDF A;  5BSY A;  3T56 B;  4ZV4 A;  1K73 D;  2GRE A;  3CTA A;  1IJE A;  1MAB A;  1QFJ A;  1XE1 A;  1OB2 A;  3KL9 A;  4RD2 A;  4AVZ A;  4XNF A;  2R9V A;  4R71 A;  1SKY B;  4RD3 A;  1N0U A;  3Q6Q A;  4X05 A; 
#chains in the Genus database with same CATH homology
 3Q3A A;  3LQ6 A;  5F4J A;  4P25 A;  4OPV A;  2OBT A;  4RM0 A;  3ASQ A;  5IYQ A;  3LQE A;  5HZA A;  4Z4R A;  4Z4U A;  5IYP A;  4P26 A;  4OOV A;  4QUZ A;  5IYR A;  4ROX A;  4WZL A;  5KW9 A;  3PUM A;  3ASP A;  4Z4Z A;  4WZE A;  3BY1 A;  5J3O A;  4RPD A;  3SLD A;  3Q6R A;  4X7F A;  5BSX A;  3PUN A;  4OP7 A;  4P2N A;  3R6K A;  4QVJ A;  3SEJ A;  2OBR A;  2ZL5 A;  4X7C A;  4P3I A;  4OPO A;  4P12 A;  4X06 A;  3ASR A;  4RLZ A;  4RDJ A;  4RDK A;  4Z4Y A;  3Q38 A;  5IYN A;  3V7A A;  4RDL A;  4P1V A;  3AST A;  5J35 A;  5HZB A;  3ONY A;  4OPS A;  5E6T A;  3PA1 A;  3PA2 A;  4QVA A;  3D26 A;  3ONU A;  3Q39 A;  5F4O A;  4Z4V A;  4Z4T A;  3SJP A;  3BQJ A;  4X07 A;  4Z4S A;  3R6J A;  4X7D A;  4Z4W A;  4WZK A;  3PVD A;  3SLN A;  5F4M A;  4OOX A;  4RPB A;  4QV2 A;  3BY2 A;  3RY8 A;  5BSY A;  3ASS A;  4X7E A;  1IHM A;  4WZT A;  2ZL7 A;  5IYW A;  2OBS A;  3SKB A;  4X0C A;  4X05 A;  2ZL6 A;  3Q6Q A;  4OOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...