3ONYA

Crystal structure of p domain from norwalk virus strain vietnam 026 in complex with fucose
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
315
structure length
310
Chain Sequence
SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVPGEGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Crystal Structures of GII.10 and GII.12 Norovirus Protruding Domains in Complex with Histo-Blood Group Antigens Reveal Details for a Potential Site of Vulnerability.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 62
structure length 310
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3onyA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3onyA01
3SKBA 4P12A 1IHMA 4OPOA 4RDKA 3BY2A 4P3IA 4Z4RA 4QV2A 4X0CA 4OOVA 5IYNA 5J3OA 4RDLA 5IYRA 3ONYA 3V7AA 5F4OA 2OBRA 4X7CA 3Q39A 4WZLA 5BSXA 4P1VA 4Z4YA 4OOXA 3LQEA 3Q3AA 4X7FA 2OBSA 4RPBA 3Q6RA 5F4MA 4Z4ZA 2ZL7A 3SJPA 3Q6QA 4OPVA 3ASQA 3SEJA 4QVJA 4OPSA 5F4JA 5HZBA 3LQ6A 3ASPA 3PA1A 4OOSA 3PUNA 4QVAA 5KW9A 4P2NA 4X7EA 4RDJA 4X7DA 4P26A 4Z4WA 4WZTA 3SLNA 3PA2A 2ZL5A 4QUZA 3ASSA 4WZEA 5HZAA 4P25A 4Z4SA 5IYQA 4ROXA 3BY1A 3ONUA 4Z4TA 4Z4UA 4OP7A 5IYWA 5E6TA 4X07A 4RPDA 3RY8A 5J35A 3BQJA 3R6KA 2ZL6A 4WZKA 2OBTA 3Q38A 4X06A 3ASRA 5IYPA 4RM0A 4X05A 4Z4VA 3PVDA 3D26A 3ASTA 4RLZA 3SLDA 5BSYA 3R6JA 3PUMA
chains in the Genus database with same CATH superfamily
2DYIA 1E79A 2BVNA 3QFCA 4LBYA 3VO1A 1CQXA 1FNCA 3ZZTA 3BY2A 2QTZA 3BNWA 4TSFA 4XMYA 3JQPA 2CBXA 2Q6OA 1E64A 3ZUGA 1TLLA 1J9ZA 3WYAA 3T53B 3A35A 2F4NA 3CCMB 3BCDA 3WBKA 5IYRA 1W34A 4XONA 2B7BA 1U2RA 3AGPA 5DN6A 3OZUA 3JU4A 1OB5A 2OBRA 4TN1A 4XKVA 2DIEA 4RD0A 3W2IA 4AVZA 5A89A 1H8HA 1ELOA 5JBQA 3LQEA 4M1KA 3Q3AA 4TMTA 1K9MD 4RPBA 2VBUA 2KVOA 2VBTA 2ZZGA 3OZWA 1BX0A 1KMHA 3W2EA 2NPFA 2DEUA 2GK6A 1W35A 4XD7A 2CNDA 1EP3B 1ZM9A 3Q6QA 4OPVA 2J7KA 4P9SA 3CCQB 1VQPB 2XZLA 2B7CA 3I1FA 3GQBA 3SEJA 4OPSA 5F4JA 5HZBA 4B44A 1Q86D 2C4UA 3FJOA 3ZC3A 1W9XA 4XOPA 1PKVA 4PABA 4C0SA 1VQ5B 1F20A 2C78A 4PC1A 4XLHA 1RQRA 4ZGNB 1G7SA 3CMMA 5LMZA 5HXBA 4ASUA 2P3MA 4P2NA 1HVXA 2XNJA 4ACAA 3GSIA 1GJRA 3BH4A 4YHBA 1A8PA 1PJ5A 1GR1A 1QX4A 1W2BB 1K8AD 4Z4WA 1JJ2B 4N3NA 4UZFA 5A8AA 5AN9A 4XLAA 1H42A 1VQKB 2C4TA 4TMVA 3PA2A 2BGIA 1N08A 5TY0A 2V7UA 4ZCMA 1RQPA 3VNUA 4KKSA 3G71B 4X8IA 3H94A 5HKKA 4PC7A 4Z4UA 4Z4TA 3LVBA 4UZEA 1E1RA 2JIZA 3T56B 5E6TA 4DK0A 5IYWA 3SJZA 3CPWB 2CK3A 4BPRA 3W5UA 3A1PA 3OW7A 4B47A 3BQJA 1TVCA 4II2A 3W2GA 4HE6A 2WSSA 1FRQA 3OZVA 1E62A 2WPDA 3U2QA 2F43A 3A8IA 2OK7A 1JA1A 4R71A 2GQFA 3MCAA 4TKOB 4CQJA 1BX1A 3D26A 2DERA 2B5OA 3GIRA 3R6JA 5L46A 4ZCLA 4AF7A 3FPKA 1MABA 1XB2A 3E1YE 1M1KD 2DCUA 4YALA 4P6YA 3MMPA 3I56B 1UD2A 4RDKA 1YJWB 4TT3A 3CCEB 3QFSA 4OOVA 1AMOA 1NDHA 1Y0RA 3DDYA 1AIPA 4WQMA 3CCRB 5J3OA 2V7TA 4ZV4A 3CCVB 3CW2A 5TRDA 1T5EA 3JQQA 2V7WA 4XORA 3G4SB 1Q81D 1OB2A 4XLFA 2ZXHA 3V7AA 2ZZEA 1UD5A 1EXMA 2Q6KA 4RD3A 4WZLA 5BSXA 1JNYA 1VJSA 2QGGA 3A3BA 4Z4YA 1QH0A 1XQBA 4FWTA 3WBJA 1NB0A 2VYQA 4YAOA 4P6VF 1EWYA 1EP2B 1KTVA 2BM1A 1UD8A 1QFYA 3P26A 4LBZA 1QGYA 3SJPA 3KL9A 3WQZA 2CF4A 4G1VA 3ASQA 1VQ7B 2D9RA 4IW3B 1BMFA 2GK7A 4QVJA 3VNVA 2X53S 4NBSA 2QEXB 5EMNA 1G7TA 3LQ6A 3OEHA 5FO0A 2VNKA 4RD6A 1SM4A 4UZUA 1W0JA 3LNNA 2QDXA 1YJNB 2VJIA 3CMEB 1Q7YD 4QVAA 1ZM4A 1OB0A 3ZPNA 3G6EB 2X6WA 1VQ4B 1YHQB 4X7EA 2DOGA 1OGJA 2C5BA 4HE5A 1R5NA 1VLYA 5KSWB 1V0EA 1IJEA 3ES9A 1EFCA 2FX3A 1S0UA 2F1MA 1T6ZA 4QHYA 4PC3A 2OTLB 2QTLA 4YAFA 1WPCA 3AVVA 4WWVA 2R6HA 2VZLA 1WORA 2E1RA 2GJPA 4XQFA 4G6IA 4PAAA 3OKXA 3CRZA 3CB4A 4QUZA 3ASSA 4WZEA 4RD2A 4P25A 5HZAA 2R9VA 2EIXA 2C2WA 3H9NA 3CC4B 2GJKA 3ONUA 4U9UA 4X07A 1T6XA 4NCNA 1KQSB 2BPOA 1EFRA 1GVHA 1COWA 1R5OA 1FX0A 1KK3A 1VQOB 2CRVA 5A88A 4HIZA 1QFZA 2ZL6A 1G7RA 4P3YA 3ISXA 2OTJB 1QGZA 1YLOA 2VJJA 2QN6A 4RM0A 4X05A 3CCJB 2JN9A 2VNHA 3PVDA 1P4MA 3OOCA 3SLDA 3PUMA 1N0VC 2XZOA 1EFTA 1E1QA 3CESA 2BN4A 3QFRA 3GVKA 3OJXA 4P12A 4RD4A 2VBSA 2D3NA 1IHMA 4DK1A 2HDNB 4MYTA 4PC6A 1TUIA 1YI2B 2Z6BD 4UAJA 3P27A 4EH1A 5DS0A 1IB0A 1QUEA 1T6YA 2X0KA 5IK2A 5IYNA 1Q82D 1FDRA 1WDTA 1BLIA 2PIAA 5TR9A 4RDLA 5B6IA 3CXCB 4XR6A 2ZBUA 3OE7A 4B43A 3WNBA 1EFUA 2FVGA 1HA3A 1OHHA 2ZZQA 2V4DA 2XNDA 2HMAA 3Q39A 1GO2A 1PJ7A 2X3UA 3CMAB 4P1VA 4Z1MA 4OOXA 1VLOA 2BGJA 4X7FA 3FKSA 1I18A 2OK8A 1QVFB 2JJ1A 1CNEA 3W5VA 2BF4A 1W87A 5F4MA 2ZL7A 4XNFA 2EFGA 3ZBTA 1VHOA 1Q9SA 3CPXA 2BMWA 2YWHA 4Y7CA 4YAUA 4J0QA 2CC2A 4RJLA 4Q7JB 2GJRA 3BC9A 4H9GA 4LC0A 1NJID 2ZTGA 1QGAA 4DQLA 4XM3A 4MYUA 1D1NA 3NE5B 3ZIAA 1NRKA 1W0KA 2X6XA 4XOTA 1N8RD 4N3GA 4L8JA 3MHPA 1M90D 1XFOA 4XN0A 2XEXA 2W6JA 2M5SA 4AC9A 1SKYB 4XKWA 1K28D 4YAWA 2WZNA 4YEJA 4B4DA 1TTTA 4RDJA 5FIUA 4JMQA 1FRNA 4X7DA 4P26A 4M0LA 1VQNB 2YWFA 1YX2A 1ZM2A 1FNMA 3OAAA 3A8KA 1YJ9B 1VF7A 1N07A 4M4SA 1WSRA 3B82A 3OFNA 4F7DA 3CD6B 4RCYA 1I8DA 1BQEA 3CP8A 4TMZA 4DNRB 1XE1A 1GAQA 1KC8D 3PENA 2QMUA 4WZTA 3SLNA 1MRZA 2WJYA 2VNJA 5GV8A 3W2HA 3W5HA 2ZL5A 4II3A 3VMFA 1BPLA 4LBWA 2Q6LA 3J81k 2RC5A 4G5GA 5FO1A 4Z4SA 1DDIA 1WSVA 3GVLA 3WNDA 2X6YA 1WTHD 2BV3A 4ROXA 3A8JA 4G1BA 1UD3A 2PLFA 2D74A 3OP1A 2ZZFA 3V76A 2LZJA 4RPDA 3RY8A 3B8HA 1K73D 4FXUA 1D8TA 3OEEA 1H85A 1B2RA 2V7XA 4LBVA 2F1LA 2ZBVA 4PGOA 4YELA 1WOPA 2GPJA 2OYNA 3LO8A 2WJVA 4FN5A 4M2LA 4GQNA 4P22A 5DSZA 3Q38A 4X06A 3U6KA 1VQLB 3AVYA 1KD1D 2XOKA 1NB9A 2C77A 4XLEA 3HAGA 3ASTA 4RLZA 5H59A 3G05A 1E63A 1H8EA 1V5VA 3ZBUA 1FNDA 4RCZA 3SKBA 1NBMA 3CCLB 3VR6A 2BM0A 2X85A 4B48A 3AVTA 4OPOA 3QSYA 4P3IA 4Z4RA 5TV2A 1WP6A 4QV2A 4TMWA 4X0CA 3U6BA 1FNBA 1N0UA 1S72B 4Y9UA 2ZITA 2I1LA 1IJFA 1KK0A 1WOSA 4ZCIA 2BSAA 1VQMB 2V31A 4TMXA 1N06A 1CNFA 4YXWA 3ONYA 1BJKA 2XZPA 3ZZ0A 1WU8A 4ACBA 5F4OA 2Q6IA 1YIJB 4X7CA 4XLCA 3CC2B 3FPPA 2JDIA 4NNJA 2D3LA 2OBSA 3WXMA 1KK2A 2DY1A 3OPOA 2NV4A 3Q6RA 5THXA 1I7PA 4M53A 4B3FX 4Z4ZA 2WYRA 1KJZA 3T51B 3A3GA 3E20A 2V7VA 4KKUA 1VQ6B 1GAWA 2V7QA 1PJ6A 1KRHA 1DARA 1QG0A 1DDGA 3QFTA 3CCUB 3AVUA 1EP1B 1D2EA 4XN3A 1JA0A 4K1XA 4Y9RA 2HCJB 2VNIA 2WR8A 3ASPA 3JQRA 4XL9A 2ZTNA 2E1BA 3OW2B 3PA1A 3AVXA 4OOSA 3ZZUA 1ZUNB 2RC6A 3PUNA 4ZGQB 1YITB 1V0FA 5FNZA 5KW9A 1Y0YA 4RD1A 1HZEA 4QFMA 1N05A 3QE2A 4B3XA 4E0FA 1S4MA 1QUFA 4AF6A 1E3ZA 5GV7A 2AHOA 3AGQA 2XNCA 2W6IA 1UD4A 4FK8A 2C5HA 4DNTB 3CC7B 2DETA 3KEWA 3VO2A 4B3GA 1VHEA 3GVJA 1F60A 1SKQA 2X8KA 5KNLA 2PE3A 2PMDA 2YWGA 4G7WA 2CW5A 2ZXIA 1DG1G 5FL7A 2QE7A 1UMKA 5IYQA 3CCSB 1KZLA 1ZM3A 3W2FA 1G7CA 2HLDA 2YWEA 3BY1A 1VQ9B 4OP7A 1R5BA 2JJ2A 4KKTA 4C43A 1VQ8B 3B78A 1UD6A 3CTAA 1E43A 5J35A 3R6KA 5CDFA 2WZPP 1B23P 4WZKA 2XGJA 1KK1A 4PC2A 1WOOA 3CP2A 3I55B 2OBTA 3WNCA 2QA4B 2GREA 1OGIA 3ASRA 1QFJA 3OJWA 5IYPA 1E3XA 2VBVA 4G7XA 4Z4VA 3WY9A 1QVGB 5H5JA 4DQKA 5BSYA 1JB9A 3BCFA 3AVWA 5FA6A
chains in the Genus database with same CATH topology
3SKBA 4P12A 1IHMA 4OPOA 4RDKA 3BY2A 4P3IA 4Z4RA 4QV2A 4X0CA 4OOVA 5IYNA 5J3OA 4RDLA 5IYRA 3ONYA 3V7AA 5F4OA 2OBRA 4X7CA 3Q39A 4WZLA 5BSXA 4P1VA 4Z4YA 4OOXA 3LQEA 3Q3AA 4X7FA 2OBSA 4RPBA 3Q6RA 5F4MA 4Z4ZA 2ZL7A 3SJPA 3Q6QA 4OPVA 3ASQA 3SEJA 4QVJA 4OPSA 5F4JA 5HZBA 3LQ6A 3ASPA 3PA1A 4OOSA 3PUNA 4QVAA 5KW9A 4P2NA 4X7EA 4RDJA 4X7DA 4P26A 4Z4WA 4WZTA 3SLNA 3PA2A 2ZL5A 4QUZA 3ASSA 4WZEA 5HZAA 4P25A 4Z4SA 5IYQA 4ROXA 3BY1A 3ONUA 4Z4TA 4Z4UA 4OP7A 5IYWA 5E6TA 4X07A 4RPDA 3RY8A 5J35A 3BQJA 3R6KA 2ZL6A 4WZKA 2OBTA 3Q38A 4X06A 3ASRA 5IYPA 4RM0A 4X05A 4Z4VA 3PVDA 3D26A 3ASTA 4RLZA 3SLDA 5BSYA 3R6JA 3PUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SKB A;  4P12 A;  1IHM A;  4OPO A;  4RDK A;  3BY2 A;  4P3I A;  4Z4R A;  4QV2 A;  4X0C A;  4OOV A;  5IYN A;  5J3O A;  4RDL A;  5IYR A;  3ONY A;  3V7A A;  5F4O A;  2OBR A;  4X7C A;  3Q39 A;  4WZL A;  5BSX A;  4P1V A;  4Z4Y A;  4OOX A;  3LQE A;  3Q3A A;  4X7F A;  2OBS A;  4RPB A;  3Q6R A;  5F4M A;  4Z4Z A;  2ZL7 A;  3SJP A;  3Q6Q A;  4OPV A;  3ASQ A;  3SEJ A;  4QVJ A;  4OPS A;  5F4J A;  5HZB A;  3LQ6 A;  3ASP A;  3PA1 A;  4OOS A;  3PUN A;  4QVA A;  5KW9 A;  4P2N A;  4X7E A;  4RDJ A;  4X7D A;  4P26 A;  4Z4W A;  4WZT A;  3SLN A;  3PA2 A;  2ZL5 A;  4QUZ A;  3ASS A;  4WZE A;  5HZA A;  4P25 A;  4Z4S A;  5IYQ A;  4ROX A;  3BY1 A;  3ONU A;  4Z4T A;  4Z4U A;  4OP7 A;  5IYW A;  5E6T A;  4X07 A;  4RPD A;  3RY8 A;  5J35 A;  3BQJ A;  3R6K A;  2ZL6 A;  4WZK A;  2OBT A;  3Q38 A;  4X06 A;  3ASR A;  5IYP A;  4RM0 A;  4X05 A;  4Z4V A;  3PVD A;  3D26 A;  3AST A;  4RLZ A;  3SLD A;  5BSY A;  3R6J A;  3PUM A; 
#chains in the Genus database with same CATH topology
 2DYI A;  1E79 A;  2BVN A;  3QFC A;  4LBY A;  3VO1 A;  1CQX A;  1FNC A;  3ZZT A;  3BY2 A;  2QTZ A;  3BNW A;  4TSF A;  4XMY A;  3JQP A;  2CBX A;  2Q6O A;  1E64 A;  3ZUG A;  1TLL A;  1J9Z A;  3WYA A;  3T53 B;  3A35 A;  2F4N A;  3CCM B;  3BCD A;  3WBK A;  5IYR A;  1W34 A;  4XON A;  2B7B A;  1U2R A;  3AGP A;  5DN6 A;  3OZU A;  3JU4 A;  1OB5 A;  2OBR A;  4TN1 A;  4XKV A;  2DIE A;  4RD0 A;  3W2I A;  4AVZ A;  5A89 A;  1H8H A;  1ELO A;  5JBQ A;  3LQE A;  4M1K A;  3Q3A A;  4TMT A;  1K9M D;  4RPB A;  2VBU A;  2KVO A;  2VBT A;  2ZZG A;  3OZW A;  1BX0 A;  1KMH A;  3W2E A;  2NPF A;  2DEU A;  2GK6 A;  1W35 A;  4XD7 A;  2CND A;  1EP3 B;  1ZM9 A;  3Q6Q A;  4OPV A;  2J7K A;  4P9S A;  3CCQ B;  1VQP B;  2XZL A;  2B7C A;  3I1F A;  3GQB A;  3SEJ A;  4OPS A;  5F4J A;  5HZB A;  4B44 A;  1Q86 D;  2C4U A;  3FJO A;  3ZC3 A;  1W9X A;  4XOP A;  1PKV A;  4PAB A;  4C0S A;  1VQ5 B;  1F20 A;  2C78 A;  4PC1 A;  4XLH A;  1RQR A;  4ZGN B;  1G7S A;  3CMM A;  5LMZ A;  5HXB A;  4ASU A;  2P3M A;  4P2N A;  1HVX A;  2XNJ A;  4ACA A;  3GSI A;  1GJR A;  3BH4 A;  4YHB A;  1A8P A;  1PJ5 A;  1GR1 A;  1QX4 A;  1W2B B;  1K8A D;  4Z4W A;  1JJ2 B;  4N3N A;  4UZF A;  5A8A A;  5AN9 A;  4XLA A;  1H42 A;  1VQK B;  2C4T A;  4TMV A;  3PA2 A;  2BGI A;  1N08 A;  5TY0 A;  2V7U A;  4ZCM A;  1RQP A;  3VNU A;  4KKS A;  3G71 B;  4X8I A;  3H94 A;  5HKK A;  4PC7 A;  4Z4U A;  4Z4T A;  3LVB A;  4UZE A;  1E1R A;  2JIZ A;  3T56 B;  5E6T A;  4DK0 A;  5IYW A;  3SJZ A;  3CPW B;  2CK3 A;  4BPR A;  3W5U A;  3A1P A;  3OW7 A;  4B47 A;  3BQJ A;  1TVC A;  4II2 A;  3W2G A;  4HE6 A;  2WSS A;  1FRQ A;  3OZV A;  1E62 A;  2WPD A;  3U2Q A;  2F43 A;  3A8I A;  2OK7 A;  1JA1 A;  4R71 A;  2GQF A;  3MCA A;  4TKO B;  4CQJ A;  1BX1 A;  3D26 A;  2DER A;  2B5O A;  3GIR A;  3R6J A;  5L46 A;  4ZCL A;  4AF7 A;  3FPK A;  1MAB A;  1XB2 A;  3E1Y E;  1M1K D;  2DCU A;  4YAL A;  4P6Y A;  3MMP A;  3I56 B;  1UD2 A;  4RDK A;  1YJW B;  4TT3 A;  3CCE B;  3QFS A;  4OOV A;  1AMO A;  1NDH A;  1Y0R A;  3DDY A;  1AIP A;  4WQM A;  3CCR B;  5J3O A;  2V7T A;  4ZV4 A;  3CCV B;  3CW2 A;  5TRD A;  1T5E A;  3JQQ A;  2V7W A;  4XOR A;  3G4S B;  1Q81 D;  1OB2 A;  4XLF A;  2ZXH A;  3V7A A;  2ZZE A;  1UD5 A;  1EXM A;  2Q6K A;  4RD3 A;  4WZL A;  5BSX A;  1JNY A;  1VJS A;  2QGG A;  3A3B A;  4Z4Y A;  1QH0 A;  1XQB A;  4FWT A;  3WBJ A;  1NB0 A;  2VYQ A;  4YAO A;  4P6V F;  1EWY A;  1EP2 B;  1KTV A;  2BM1 A;  1UD8 A;  1QFY A;  3P26 A;  4LBZ A;  1QGY A;  3SJP A;  3KL9 A;  3WQZ A;  2CF4 A;  4G1V A;  3ASQ A;  1VQ7 B;  2D9R A;  4IW3 B;  1BMF A;  2GK7 A;  4QVJ A;  3VNV A;  2X53 S;  4NBS A;  2QEX B;  5EMN A;  1G7T A;  3LQ6 A;  3OEH A;  5FO0 A;  2VNK A;  4RD6 A;  1SM4 A;  4UZU A;  1W0J A;  3LNN A;  2QDX A;  1YJN B;  2VJI A;  3CME B;  1Q7Y D;  4QVA A;  1ZM4 A;  1OB0 A;  3ZPN A;  3G6E B;  2X6W A;  1VQ4 B;  1YHQ B;  4X7E A;  2DOG A;  1OGJ A;  2C5B A;  4HE5 A;  1R5N A;  1VLY A;  5KSW B;  1V0E A;  1IJE A;  3ES9 A;  1EFC A;  2FX3 A;  1S0U A;  2F1M A;  1T6Z A;  4QHY A;  4PC3 A;  2OTL B;  2QTL A;  4YAF A;  1WPC A;  3AVV A;  4WWV A;  2R6H A;  2VZL A;  1WOR A;  2E1R A;  2GJP A;  4XQF A;  4G6I A;  4PAA A;  3OKX A;  3CRZ A;  3CB4 A;  4QUZ A;  3ASS A;  4WZE A;  4RD2 A;  4P25 A;  5HZA A;  2R9V A;  2EIX A;  2C2W A;  3H9N A;  3CC4 B;  2GJK A;  3ONU A;  4U9U A;  4X07 A;  1T6X A;  4NCN A;  1KQS B;  2BPO A;  1EFR A;  1GVH A;  1COW A;  1R5O A;  1FX0 A;  1KK3 A;  1VQO B;  2CRV A;  5A88 A;  4HIZ A;  1QFZ A;  2ZL6 A;  1G7R A;  4P3Y A;  3ISX A;  2OTJ B;  1QGZ A;  1YLO A;  2VJJ A;  2QN6 A;  4RM0 A;  4X05 A;  3CCJ B;  2JN9 A;  2VNH A;  3PVD A;  1P4M A;  3OOC A;  3SLD A;  3PUM A;  1N0V C;  2XZO A;  1EFT A;  1E1Q A;  3CES A;  2BN4 A;  3QFR A;  3GVK A;  3OJX A;  4P12 A;  4RD4 A;  2VBS A;  2D3N A;  1IHM A;  4DK1 A;  2HDN B;  4MYT A;  4PC6 A;  1TUI A;  1YI2 B;  2Z6B D;  4UAJ A;  3P27 A;  4EH1 A;  5DS0 A;  1IB0 A;  1QUE A;  1T6Y A;  2X0K A;  5IK2 A;  5IYN A;  1Q82 D;  1FDR A;  1WDT A;  1BLI A;  2PIA A;  5TR9 A;  4RDL A;  5B6I A;  3CXC B;  4XR6 A;  2ZBU A;  3OE7 A;  4B43 A;  3WNB A;  1EFU A;  2FVG A;  1HA3 A;  1OHH A;  2ZZQ A;  2V4D A;  2XND A;  2HMA A;  3Q39 A;  1GO2 A;  1PJ7 A;  2X3U A;  3CMA B;  4P1V A;  4Z1M A;  4OOX A;  1VLO A;  2BGJ A;  4X7F A;  3FKS A;  1I18 A;  2OK8 A;  1QVF B;  2JJ1 A;  1CNE A;  3W5V A;  2BF4 A;  1W87 A;  5F4M A;  2ZL7 A;  4XNF A;  2EFG A;  3ZBT A;  1VHO A;  1Q9S A;  3CPX A;  2BMW A;  2YWH A;  4Y7C A;  4YAU A;  4J0Q A;  2CC2 A;  4RJL A;  4Q7J B;  2GJR A;  3BC9 A;  4H9G A;  4LC0 A;  1NJI D;  2ZTG A;  1QGA A;  4DQL A;  4XM3 A;  4MYU A;  1D1N A;  3NE5 B;  3ZIA A;  1NRK A;  1W0K A;  2X6X A;  4XOT A;  1N8R D;  4N3G A;  4L8J A;  3MHP A;  1M90 D;  1XFO A;  4XN0 A;  2XEX A;  2W6J A;  2M5S A;  4AC9 A;  1SKY B;  4XKW A;  1K28 D;  4YAW A;  2WZN A;  4YEJ A;  4B4D A;  1TTT A;  4RDJ A;  5FIU A;  4JMQ A;  1FRN A;  4X7D A;  4P26 A;  4M0L A;  1VQN B;  2YWF A;  1YX2 A;  1ZM2 A;  1FNM A;  3OAA A;  3A8K A;  1YJ9 B;  1VF7 A;  1N07 A;  4M4S A;  1WSR A;  3B82 A;  3OFN A;  4F7D A;  3CD6 B;  4RCY A;  1I8D A;  1BQE A;  3CP8 A;  4TMZ A;  4DNR B;  1XE1 A;  1GAQ A;  1KC8 D;  3PEN A;  2QMU A;  4WZT A;  3SLN A;  1MRZ A;  2WJY A;  2VNJ A;  5GV8 A;  3W2H A;  3W5H A;  2ZL5 A;  4II3 A;  3VMF A;  1BPL A;  4LBW A;  2Q6L A;  3J81 k;  2RC5 A;  4G5G A;  5FO1 A;  4Z4S A;  1DDI A;  1WSV A;  3GVL A;  3WND A;  2X6Y A;  1WTH D;  2BV3 A;  4ROX A;  3A8J A;  4G1B A;  1UD3 A;  2PLF A;  2D74 A;  3OP1 A;  2ZZF A;  3V76 A;  2LZJ A;  4RPD A;  3RY8 A;  3B8H A;  1K73 D;  4FXU A;  1D8T A;  3OEE A;  1H85 A;  1B2R A;  2V7X A;  4LBV A;  2F1L A;  2ZBV A;  4PGO A;  4YEL A;  1WOP A;  2GPJ A;  2OYN A;  3LO8 A;  2WJV A;  4FN5 A;  4M2L A;  4GQN A;  4P22 A;  5DSZ A;  3Q38 A;  4X06 A;  3U6K A;  1VQL B;  3AVY A;  1KD1 D;  2XOK A;  1NB9 A;  2C77 A;  4XLE A;  3HAG A;  3AST A;  4RLZ A;  5H59 A;  3G05 A;  1E63 A;  1H8E A;  1V5V A;  3ZBU A;  1FND A;  4RCZ A;  3SKB A;  1NBM A;  3CCL B;  3VR6 A;  2BM0 A;  2X85 A;  4B48 A;  3AVT A;  4OPO A;  3QSY A;  4P3I A;  4Z4R A;  5TV2 A;  1WP6 A;  4QV2 A;  4TMW A;  4X0C A;  3U6B A;  1FNB A;  1N0U A;  1S72 B;  4Y9U A;  2ZIT A;  2I1L A;  1IJF A;  1KK0 A;  1WOS A;  4ZCI A;  2BSA A;  1VQM B;  2V31 A;  4TMX A;  1N06 A;  1CNF A;  4YXW A;  3ONY A;  1BJK A;  2XZP A;  3ZZ0 A;  1WU8 A;  4ACB A;  5F4O A;  2Q6I A;  1YIJ B;  4X7C A;  4XLC A;  3CC2 B;  3FPP A;  2JDI A;  4NNJ A;  2D3L A;  2OBS A;  3WXM A;  1KK2 A;  2DY1 A;  3OPO A;  2NV4 A;  3Q6R A;  5THX A;  1I7P A;  4M53 A;  4B3F X;  4Z4Z A;  2WYR A;  1KJZ A;  3T51 B;  3A3G A;  3E20 A;  2V7V A;  4KKU A;  1VQ6 B;  1GAW A;  2V7Q A;  1PJ6 A;  1KRH A;  1DAR A;  1QG0 A;  1DDG A;  3QFT A;  3CCU B;  3AVU A;  1EP1 B;  1D2E A;  4XN3 A;  1JA0 A;  4K1X A;  4Y9R A;  2HCJ B;  2VNI A;  2WR8 A;  3ASP A;  3JQR A;  4XL9 A;  2ZTN A;  2E1B A;  3OW2 B;  3PA1 A;  3AVX A;  4OOS A;  3ZZU A;  1ZUN B;  2RC6 A;  3PUN A;  4ZGQ B;  1YIT B;  1V0F A;  5FNZ A;  5KW9 A;  1Y0Y A;  4RD1 A;  1HZE A;  4QFM A;  1N05 A;  3QE2 A;  4B3X A;  4E0F A;  1S4M A;  1QUF A;  4AF6 A;  1E3Z A;  5GV7 A;  2AHO A;  3AGQ A;  2XNC A;  2W6I A;  1UD4 A;  4FK8 A;  2C5H A;  4DNT B;  3CC7 B;  2DET A;  3KEW A;  3VO2 A;  4B3G A;  1VHE A;  3GVJ A;  1F60 A;  1SKQ A;  2X8K A;  5KNL A;  2PE3 A;  2PMD A;  2YWG A;  4G7W A;  2CW5 A;  2ZXI A;  1DG1 G;  5FL7 A;  2QE7 A;  1UMK A;  5IYQ A;  3CCS B;  1KZL A;  1ZM3 A;  3W2F A;  1G7C A;  2HLD A;  2YWE A;  3BY1 A;  1VQ9 B;  4OP7 A;  1R5B A;  2JJ2 A;  4KKT A;  4C43 A;  1VQ8 B;  3B78 A;  1UD6 A;  3CTA A;  1E43 A;  5J35 A;  3R6K A;  5CDF A;  2WZP P;  1B23 P;  4WZK A;  2XGJ A;  1KK1 A;  4PC2 A;  1WOO A;  3CP2 A;  3I55 B;  2OBT A;  3WNC A;  2QA4 B;  2GRE A;  1OGI A;  3ASR A;  1QFJ A;  3OJW A;  5IYP A;  1E3X A;  2VBV A;  4G7X A;  4Z4V A;  3WY9 A;  1QVG B;  5H5J A;  4DQK A;  5BSY A;  1JB9 A;  3BCF A;  3AVW A;  5FA6 A; 
#chains in the Genus database with same CATH homology
 3SKB A;  4P12 A;  1IHM A;  4OPO A;  4RDK A;  3BY2 A;  4P3I A;  4Z4R A;  4QV2 A;  4X0C A;  4OOV A;  5IYN A;  5J3O A;  4RDL A;  5IYR A;  3ONY A;  3V7A A;  5F4O A;  2OBR A;  4X7C A;  3Q39 A;  4WZL A;  5BSX A;  4P1V A;  4Z4Y A;  4OOX A;  3LQE A;  3Q3A A;  4X7F A;  2OBS A;  4RPB A;  3Q6R A;  5F4M A;  4Z4Z A;  2ZL7 A;  3SJP A;  3Q6Q A;  4OPV A;  3ASQ A;  3SEJ A;  4QVJ A;  4OPS A;  5F4J A;  5HZB A;  3LQ6 A;  3ASP A;  3PA1 A;  4OOS A;  3PUN A;  4QVA A;  5KW9 A;  4P2N A;  4X7E A;  4RDJ A;  4X7D A;  4P26 A;  4Z4W A;  4WZT A;  3SLN A;  3PA2 A;  2ZL5 A;  4QUZ A;  3ASS A;  4WZE A;  5HZA A;  4P25 A;  4Z4S A;  5IYQ A;  4ROX A;  3BY1 A;  3ONU A;  4Z4T A;  4Z4U A;  4OP7 A;  5IYW A;  5E6T A;  4X07 A;  4RPD A;  3RY8 A;  5J35 A;  3BQJ A;  3R6K A;  2ZL6 A;  4WZK A;  2OBT A;  3Q38 A;  4X06 A;  3ASR A;  5IYP A;  4RM0 A;  4X05 A;  4Z4V A;  3PVD A;  3D26 A;  3AST A;  4RLZ A;  3SLD A;  5BSY A;  3R6J A;  3PUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...