3ONYA

Crystal structure of p domain from norwalk virus strain vietnam 026 in complex with fucose
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
315
structure length
310
Chain Sequence
b'SKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVPGEGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Crystal Structures of GII.10 and GII.12 Norovirus Protruding Domains in Complex with Histo-Blood Group Antigens Reveal Details for a Potential Site of Vulnerability.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 62
structure length 310
sequence length 315
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3onyA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3onyA01
5F4OA 4X7EA 3PA2A 3Q3AA 4OOSA 5F4MA 4Z4WA 1IHMA 4WZEA 3PUNA 4Z4RA 3D26A 4QUZA 3SLNA 3Q6RA 3ASSA 4X7DA 3ASRA 3PVDA 3R6JA 3ONUA 3Q39A 2OBSA 5J35A 3SLDA 5E6TA 5IYPA 3Q38A 5IYQA 4P3IA 4X05A 4ROXA 3SKBA 4OPSA 5BSYA 3BQJA 4OOVA 4WZLA 2OBTA 5IYRA 3SJPA 4X07A 5BSXA 4OPOA 4X0CA 3ONYA 4P25A 2ZL5A 4OOXA 3V7AA 4Z4UA 5HZBA 4QVAA 4OP7A 3LQEA 4P2NA 2OBRA 4P12A 2ZL7A 3Q6QA 5IYNA 3BY2A 3RY8A 3LQ6A 3ASQA 4X7FA 4Z4VA 4WZKA 4QVJA 4OPVA 3ASPA 5F4JA 4RPDA 5HZAA 4RDLA 4WZTA 3PA1A 4QV2A 4RDKA 4Z4YA 4Z4ZA 5IYWA 3PUMA 4Z4SA 2ZL6A 4X7CA 3BY1A 4RPBA 4RLZA 5KW9A 3R6KA 4Z4TA 3ASTA 4RDJA 4P26A 4P1VA 5J3OA 3SEJA 4RM0A 4X06A
chains in the Genus database with same CATH superfamily
2QTZA 3MHPA 1BMFA 1WP6A 2NV4A 4ZV4A 1FRNA 4LBYA 1WOPA 4HE5A 1U2RA 3NE5B 1S4MA 1QGYA 4YHBA 4ACAA 4G7WA 4OOSA 2OK7A 3B82A 3A8JA 4M2LA 2WSSA 1DDGA 5DS0A 3VO1A 4B3FX 1EWYA 4XR6A 3BH4A 2QEXB 1E3XA 2E1RA 3SLNA 5IK2A 1H8HA 3FPKA 1KMHA 1QFYA 4LBZA 2BSAA 5H59A 1M1KD 4B4DA 3ASSA 2HLDA 1EFRA 1V0EA 3QSYA 1OB5A 1I8DA 1K28D 1K8AD 2GJKA 3R6JA 5KNLA 2GK7A 3ONUA 2OBSA 3WY9A 1Q82D 1PJ6A 2C5HA 4Z1MA 5E6TA 1M90D 2X53S 1W9XA 2BN4A 1W87A 3CMMA 3CRZA 2F1MA 4ROXA 3JQQA 3SKBA 5JBQA 2BV3A 3OW7A 2ZZGA 4E0FA 1Q9SA 4OOVA 4DQKA 5IYRA 1YJ9B 2ZTNA 4PC3A 1Y0RA 2VZLA 4XN0A 2VBSA 2DEUA 3BCDA 3ONYA 3KEWA 2DYIA 4RJLA 1VQLB 4MYTA 3WBKA 1KJZA 3CP2A 3U2QA 1VQMB 4G1VA 2Q6KA 4M4SA 3VO2A 1IJEA 1FRQA 1QVFB 5TRDA 1CQXA 1D8TA 4P12A 2F1LA 3AVXA 2DERA 3W2IA 3OZWA 1HZEA 1UD8A 4KKTA 1S72B 4B43A 1FNCA 1UD2A 3B78A 4Q7JB 2KVOA 2JJ1A 3CESA 4RD4A 2PE3A 1G7CA 1AMOA 4AF7A 1UD6A 3CPXA 1ZM3A 4QVJA 2GREA 2ZBVA 5TY0A 4OPVA 2VBVA 4PC7A 3OJXA 1NJID 1YJNB 2Z6BD 4NNJA 2QE7A 4Y9RA 4RD3A 1PJ7A 1NBMA 4UZFA 1KK2A 2VNKA 4YXWA 2OTJB 3OZUA 1VQ6B 3CC2B 1XB2A 4Z4YA 4HE6A 1V0FA 1FNMA 1VHEA 4QFMA 4RD1A 1W2BB 1GAQA 1G7RA 3BY1A 4PAAA 4RLZA 5KW9A 2GJRA 2QDXA 3AVUA 4FXUA 1FX0A 2GJPA 3OP1A 1GVHA 1YLOA 2D3LA 2XNDA 4UAJA 2VYQA 1VF7A 1KC8D 1R5NA 2ZXIA 2X8KA 3AVYA 2VJJA 3WNBA 1VQOB 3SEJA 4RM0A 2LZJA 4EH1A 2YWHA 3A8KA 5CDFA 2QGGA 3WNCA 3CXCB 3PA2A 5F4MA 4XLHA 5A88A 4U9UA 3MMPA 2QMUA 4UZEA 4WZEA 3A8IA 2XGJA 4NBSA 4ACBA 2JN9A 4P3YA 2B7CA 3W5HA 4P22A 2C2WA 2GPJA 1W35A 5FIUA 1NDHA 4K1XA 1W34A 3T51B 3ASRA 1E43A 4KKSA 4BPRA 3W2GA 5AN9A 3ZZTA 5KSWB 4TN1A 1BPLA 4II2A 3ZZ0A 2X85A 2X6WA 5IYPA 1T6XA 2CBXA 3H9NA 1E3ZA 1QGZA 2P3MA 2VNHA 1BJKA 4TMTA 2RC6A 1Q7YD 4XLFA 1J9ZA 3CCSB 1E64A 1FNBA 4RCZA 1VHOA 3OZVA 1VLOA 1E79A 2OBTA 1G7TA 2X6XA 4XKVA 1VQNB 5BSXA 3W2FA 2E1BA 4OPOA 1VQKB 1DARA 4G7XA 1YJWB 4R71A 1BX1A 3VNUA 1QGAA 4RD2A 2FVGA 3V7AA 4DNTB 5L46A 1R5OA 1JA1A 1N06A 4XMYA 3AGPA 4QVAA 2GQFA 2BPOA 4ZGQB 1JNYA 2WZPP 1H42A 2ZZQA 3LVBA 4TMZA 4DK0A 4PC2A 2D74A 1SKYB 2Q6LA 2QA4B 5IYNA 2V7WA 3BY2A 1VQ9B 1ZM2A 3U6BA 1VJSA 2YWFA 5B6IA 2VNIA 1COWA 4YELA 1B2RA 3QE2A 2D9RA 3A3BA 3RY8A 3LQ6A 2EIXA 2BM1A 4ZCIA 3LO8A 1YIJB 2CC2A 1CNFA 3JQPA 4GQNA 1QUFA 2ZZFA 1YHQB 4P6VF 1UD5A 2QTLA 5H5JA 1JA0A 4N3GA 1FDRA 2RC5A 2WJVA 3QFSA 5F4JA 4C0SA 4RPDA 3ZUGA 1K9MD 4G1BA 1W0KA 4WWVA 3PA1A 3CMEB 4J0QA 2ZITA 4M1KA 4F7DA 1VQ4B 5A8AA 4QV2A 4RDKA 3GQBA 1N0UA 3CCLB 1I18A 4ZCLA 1EFUA 1E62A 1RQPA 2WYRA 3WYAA 2M5SA 2F4NA 3CW2A 3CCUB 3R6KA 4Z4TA 2DOGA 4XNFA 4ZCMA 1EXMA 5FL7A 4B47A 3AGQA 3GIRA 1H8EA 1KK0A 1DG1G 3QFTA 4RDJA 4RCYA 3WXMA 3G4SB 4TMXA 3J81k 2GK6A 3T56B 4RD0A 4TT3A 3AVTA 2VNJA 2DCUA 4G5GA 3ZC3A 1XFOA 3E1YE 4G6IA 4X7EA 2DY1A 1BQEA 1OHHA 3AVWA 2Q6OA 3CPWB 1TTTA 1FNDA 1QUEA 3W5VA 1WOSA 1IHMA 3LNNA 4PGOA 1RQRA 1T6YA 1QFZA 4Z4RA 2B7BA 3D26A 4QUZA 1YITB 2B5OA 1VQ7B 3FPPA 4RD6A 1EP3B 1GJRA 3P27A 5GV7A 1T6ZA 1ELOA 2BVNA 4YEJA 2BF4A 2V7VA 3CC7B 3PVDA 1IB0A 2QN6A 1JB9A 2X0KA 4YAFA 1NRKA 2F43A 1D2EA 1JJ2B 3OW2B 4P9SA 4DK1A 3WQZA 4C43A 1B23P 1GAWA 2BGJA 3SLDA 1W0JA 1YI2B 3Q38A 2W6IA 1UD3A 3I1FA 1KK3A 4H9GA 5FA6A 5IYQA 3CCRB 4X05A 4XLCA 5BSYA 1N0VC 1Q86D 2XZPA 1ZM4A 3BQJA 3CP8A 1PKVA 3SJPA 4LBVA 4X07A 2X6YA 1BLIA 2XNJA 3OAAA 3G6EB 2ZXHA 2V31A 2XZOA 4ASUA 5FO0A 2CW5A 2ZL5A 1OGIA 3B8HA 4OOXA 3CTAA 4XOTA 4Z4UA 1TLLA 3GVJA 2WZNA 4PC1A 3VR6A 2V7XA 1E1QA 1EFTA 2V7TA 4P2NA 1T5EA 3WBJA 2YWGA 4UZUA 5TV2A 1Y0YA 1WPCA 2ZL7A 4AC9A 3OKXA 2BMWA 1KRHA 4Y9UA 4XKWA 1V5VA 3G71B 1N05A 1ZUNB 5FNZA 3ZIAA 2BM0A 3CCJB 4XLAA 4FK8A 3T53B 1OGJA 1K73D 2AHOA 1F60A 2DIEA 1CNEA 1F20A 1DDIA 4X7FA 4WQMA 3BC9A 3FKSA 1BX0A 1N08A 2ZBUA 4Z4VA 1E63A 4WZKA 2JIZA 1VQ5B 4FWTA 3ZZUA 1NB0A 3BNWA 3G05A 1PJ5A 3ZPNA 2XZLA 4TSFA 2HDNB 1QVGB 4X8IA 2X3UA 1QFJA 3OEEA 2PIAA 4YALA 3OPOA 4AF6A 5HZAA 4RDLA 4WZTA 4XM3A 1VQ8B 3ZBTA 3JU4A 4HIZA 4Y7CA 1QG0A 3GVKA 4Z4ZA 5IYWA 3PUMA 2XNCA 3QFRA 2W6JA 4X7CA 3VNVA 1H85A 1WDTA 3WNDA 4CQJA 1EP1B 1Q81D 3OOCA 3A3GA 2C5BA 3H94A 2WJYA 3P26A 1KQSB 3ASTA 4B48A 2CK3A 4TMVA 4P1VA 5GV8A 3CCMB 4XD7A 2CNDA 3CC4B 3MCAA 2WR8A 4JMQA 2PMDA 2VJIA 2HCJB 5F4OA 2D3NA 3ZBUA 1MRZA 4DNRB 3Q3AA 1WU8A 4LBWA 4Z4WA 3PUNA 3OEHA 2FX3A 4L8JA 2CRVA 3Q6RA 1WTHD 2I1LA 5DN6A 4X7DA 5A89A 2PLFA 1UMKA 2DETA 1S0UA 4B3XA 3CCVB 4XL9A 1HVXA 2OK8A 4PABA 1E1RA 3CCEB 3Q39A 1SKQA 1VQPB 2BGIA 3JQRA 3HAGA 1OB2A 1NB9A 4YAOA 3QFCA 5J35A 2XEXA 2OYNA 4TKOB 4P3IA 3A1PA 3V76A 1WSVA 3VMFA 4ZGNB 2WPDA 4OPSA 1N8RD 4XLEA 1XE1A 2C78A 5EMNA 4NCNA 4WZLA 4IW3B 3I56B 4DQLA 2V7UA 2VBTA 2XOKA 3BCFA 3W2HA 1TVCA 4X0CA 1IJFA 3KL9A 3OFNA 4P25A 4QHYA 2JDIA 3ISXA 1EP2B 4PC6A 1EFCA 3FJOA 2YWEA 5HZBA 2Q6IA 1YX2A 2R6HA 4TMWA 4OP7A 3LQEA 2VBUA 1ZM9A 3PENA 3DDYA 1OB0A 1HA3A 1R5BA 1SM4A 2OBRA 4YAUA 2V7QA 3Q6QA 2CF4A 2ZZEA 1I7PA 4N3NA 1GR1A 1MABA 4FN5A 1KZLA 3U6KA 1XQBA 4XOPA 3CD6B 2C4TA 5LMZA 3ASQA 2JJ2A 2EFGA 4M0LA 3A35A 2V4DA 3GSIA 1QX4A 3I55B 1AIPA 1A8PA 1WSRA 2OTLB 1VLYA 2HMAA 4P6YA 1GO2A 5HKKA 4AVZA 1D1NA 4XN3A 2NPFA 5FO1A 3OE7A 1UD4A 3AVVA 4II3A 3ASPA 4LC0A 3OJWA 4KKUA 4XONA 4XQFA 4YAWA 2J7KA 3CMAB 3W2EA 5HXBA 3W5UA 3GVLA 4M53A 1G7SA 3ES9A 1TUIA 1KK1A 4Z4SA 2ZL6A 4MYUA 1WOOA 1KTVA 4RPBA 2ZTGA 5DSZA 2R9VA 1P4MA 1N07A 4XORA 3SJZA 5TR9A 3CB4A 2C4UA 4P26A 4B44A 2C77A 5J3OA 1QH0A 3E20A 4B3GA 3CCQB 5THXA 1KD1D 1WORA 4X06A
chains in the Genus database with same CATH topology
5F4OA 4X7EA 3PA2A 3Q3AA 4OOSA 5F4MA 4Z4WA 1IHMA 4WZEA 3PUNA 4Z4RA 3D26A 4QUZA 3SLNA 3Q6RA 3ASSA 4X7DA 3ASRA 3PVDA 3R6JA 3ONUA 3Q39A 2OBSA 5J35A 3SLDA 5E6TA 5IYPA 3Q38A 5IYQA 4P3IA 4X05A 4ROXA 3SKBA 4OPSA 5BSYA 3BQJA 4OOVA 4WZLA 2OBTA 5IYRA 3SJPA 4X07A 5BSXA 4OPOA 4X0CA 3ONYA 4P25A 2ZL5A 4OOXA 3V7AA 4Z4UA 5HZBA 4QVAA 4OP7A 3LQEA 4P2NA 2OBRA 4P12A 2ZL7A 3Q6QA 5IYNA 3BY2A 3RY8A 3LQ6A 3ASQA 4X7FA 4Z4VA 4WZKA 4QVJA 4OPVA 3ASPA 5F4JA 4RPDA 5HZAA 4RDLA 4WZTA 3PA1A 4QV2A 4RDKA 4Z4YA 4Z4ZA 5IYWA 3PUMA 4Z4SA 2ZL6A 4X7CA 3BY1A 4RPBA 4RLZA 5KW9A 3R6KA 4Z4TA 3ASTA 4RDJA 4P26A 4P1VA 5J3OA 3SEJA 4RM0A 4X06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F4O A;  4X7E A;  3PA2 A;  3Q3A A;  4OOS A;  5F4M A;  4Z4W A;  1IHM A;  4WZE A;  3PUN A;  4Z4R A;  3D26 A;  4QUZ A;  3SLN A;  3Q6R A;  3ASS A;  4X7D A;  3ASR A;  3PVD A;  3R6J A;  3ONU A;  3Q39 A;  2OBS A;  5J35 A;  3SLD A;  5E6T A;  5IYP A;  3Q38 A;  5IYQ A;  4P3I A;  4X05 A;  4ROX A;  3SKB A;  4OPS A;  5BSY A;  3BQJ A;  4OOV A;  4WZL A;  2OBT A;  5IYR A;  3SJP A;  4X07 A;  5BSX A;  4OPO A;  4X0C A;  3ONY A;  4P25 A;  2ZL5 A;  4OOX A;  3V7A A;  4Z4U A;  5HZB A;  4QVA A;  4OP7 A;  3LQE A;  4P2N A;  2OBR A;  4P12 A;  2ZL7 A;  3Q6Q A;  5IYN A;  3BY2 A;  3RY8 A;  3LQ6 A;  3ASQ A;  4X7F A;  4Z4V A;  4WZK A;  4QVJ A;  4OPV A;  3ASP A;  5F4J A;  4RPD A;  5HZA A;  4RDL A;  4WZT A;  3PA1 A;  4QV2 A;  4RDK A;  4Z4Y A;  4Z4Z A;  5IYW A;  3PUM A;  4Z4S A;  2ZL6 A;  4X7C A;  3BY1 A;  4RPB A;  4RLZ A;  5KW9 A;  3R6K A;  4Z4T A;  3AST A;  4RDJ A;  4P26 A;  4P1V A;  5J3O A;  3SEJ A;  4RM0 A;  4X06 A; 
#chains in the Genus database with same CATH topology
 2QTZ A;  3MHP A;  1BMF A;  1WP6 A;  2NV4 A;  4ZV4 A;  1FRN A;  4LBY A;  1WOP A;  4HE5 A;  1U2R A;  3NE5 B;  1S4M A;  1QGY A;  4YHB A;  4ACA A;  4G7W A;  4OOS A;  2OK7 A;  3B82 A;  3A8J A;  4M2L A;  2WSS A;  1DDG A;  5DS0 A;  3VO1 A;  4B3F X;  1EWY A;  4XR6 A;  3BH4 A;  2QEX B;  1E3X A;  2E1R A;  3SLN A;  5IK2 A;  1H8H A;  3FPK A;  1KMH A;  1QFY A;  4LBZ A;  2BSA A;  5H59 A;  1M1K D;  4B4D A;  3ASS A;  2HLD A;  1EFR A;  1V0E A;  3QSY A;  1OB5 A;  1I8D A;  1K28 D;  1K8A D;  2GJK A;  3R6J A;  5KNL A;  2GK7 A;  3ONU A;  2OBS A;  3WY9 A;  1Q82 D;  1PJ6 A;  2C5H A;  4Z1M A;  5E6T A;  1M90 D;  2X53 S;  1W9X A;  2BN4 A;  1W87 A;  3CMM A;  3CRZ A;  2F1M A;  4ROX A;  3JQQ A;  3SKB A;  5JBQ A;  2BV3 A;  3OW7 A;  2ZZG A;  4E0F A;  1Q9S A;  4OOV A;  4DQK A;  5IYR A;  1YJ9 B;  2ZTN A;  4PC3 A;  1Y0R A;  2VZL A;  4XN0 A;  2VBS A;  2DEU A;  3BCD A;  3ONY A;  3KEW A;  2DYI A;  4RJL A;  1VQL B;  4MYT A;  3WBK A;  1KJZ A;  3CP2 A;  3U2Q A;  1VQM B;  4G1V A;  2Q6K A;  4M4S A;  3VO2 A;  1IJE A;  1FRQ A;  1QVF B;  5TRD A;  1CQX A;  1D8T A;  4P12 A;  2F1L A;  3AVX A;  2DER A;  3W2I A;  3OZW A;  1HZE A;  1UD8 A;  4KKT A;  1S72 B;  4B43 A;  1FNC A;  1UD2 A;  3B78 A;  4Q7J B;  2KVO A;  2JJ1 A;  3CES A;  4RD4 A;  2PE3 A;  1G7C A;  1AMO A;  4AF7 A;  1UD6 A;  3CPX A;  1ZM3 A;  4QVJ A;  2GRE A;  2ZBV A;  5TY0 A;  4OPV A;  2VBV A;  4PC7 A;  3OJX A;  1NJI D;  1YJN B;  2Z6B D;  4NNJ A;  2QE7 A;  4Y9R A;  4RD3 A;  1PJ7 A;  1NBM A;  4UZF A;  1KK2 A;  2VNK A;  4YXW A;  2OTJ B;  3OZU A;  1VQ6 B;  3CC2 B;  1XB2 A;  4Z4Y A;  4HE6 A;  1V0F A;  1FNM A;  1VHE A;  4QFM A;  4RD1 A;  1W2B B;  1GAQ A;  1G7R A;  3BY1 A;  4PAA A;  4RLZ A;  5KW9 A;  2GJR A;  2QDX A;  3AVU A;  4FXU A;  1FX0 A;  2GJP A;  3OP1 A;  1GVH A;  1YLO A;  2D3L A;  2XND A;  4UAJ A;  2VYQ A;  1VF7 A;  1KC8 D;  1R5N A;  2ZXI A;  2X8K A;  3AVY A;  2VJJ A;  3WNB A;  1VQO B;  3SEJ A;  4RM0 A;  2LZJ A;  4EH1 A;  2YWH A;  3A8K A;  5CDF A;  2QGG A;  3WNC A;  3CXC B;  3PA2 A;  5F4M A;  4XLH A;  5A88 A;  4U9U A;  3MMP A;  2QMU A;  4UZE A;  4WZE A;  3A8I A;  2XGJ A;  4NBS A;  4ACB A;  2JN9 A;  4P3Y A;  2B7C A;  3W5H A;  4P22 A;  2C2W A;  2GPJ A;  1W35 A;  5FIU A;  1NDH A;  4K1X A;  1W34 A;  3T51 B;  3ASR A;  1E43 A;  4KKS A;  4BPR A;  3W2G A;  5AN9 A;  3ZZT A;  5KSW B;  4TN1 A;  1BPL A;  4II2 A;  3ZZ0 A;  2X85 A;  2X6W A;  5IYP A;  1T6X A;  2CBX A;  3H9N A;  1E3Z A;  1QGZ A;  2P3M A;  2VNH A;  1BJK A;  4TMT A;  2RC6 A;  1Q7Y D;  4XLF A;  1J9Z A;  3CCS B;  1E64 A;  1FNB A;  4RCZ A;  1VHO A;  3OZV A;  1VLO A;  1E79 A;  2OBT A;  1G7T A;  2X6X A;  4XKV A;  1VQN B;  5BSX A;  3W2F A;  2E1B A;  4OPO A;  1VQK B;  1DAR A;  4G7X A;  1YJW B;  4R71 A;  1BX1 A;  3VNU A;  1QGA A;  4RD2 A;  2FVG A;  3V7A A;  4DNT B;  5L46 A;  1R5O A;  1JA1 A;  1N06 A;  4XMY A;  3AGP A;  4QVA A;  2GQF A;  2BPO A;  4ZGQ B;  1JNY A;  2WZP P;  1H42 A;  2ZZQ A;  3LVB A;  4TMZ A;  4DK0 A;  4PC2 A;  2D74 A;  1SKY B;  2Q6L A;  2QA4 B;  5IYN A;  2V7W A;  3BY2 A;  1VQ9 B;  1ZM2 A;  3U6B A;  1VJS A;  2YWF A;  5B6I A;  2VNI A;  1COW A;  4YEL A;  1B2R A;  3QE2 A;  2D9R A;  3A3B A;  3RY8 A;  3LQ6 A;  2EIX A;  2BM1 A;  4ZCI A;  3LO8 A;  1YIJ B;  2CC2 A;  1CNF A;  3JQP A;  4GQN A;  1QUF A;  2ZZF A;  1YHQ B;  4P6V F;  1UD5 A;  2QTL A;  5H5J A;  1JA0 A;  4N3G A;  1FDR A;  2RC5 A;  2WJV A;  3QFS A;  5F4J A;  4C0S A;  4RPD A;  3ZUG A;  1K9M D;  4G1B A;  1W0K A;  4WWV A;  3PA1 A;  3CME B;  4J0Q A;  2ZIT A;  4M1K A;  4F7D A;  1VQ4 B;  5A8A A;  4QV2 A;  4RDK A;  3GQB A;  1N0U A;  3CCL B;  1I18 A;  4ZCL A;  1EFU A;  1E62 A;  1RQP A;  2WYR A;  3WYA A;  2M5S A;  2F4N A;  3CW2 A;  3CCU B;  3R6K A;  4Z4T A;  2DOG A;  4XNF A;  4ZCM A;  1EXM A;  5FL7 A;  4B47 A;  3AGQ A;  3GIR A;  1H8E A;  1KK0 A;  1DG1 G;  3QFT A;  4RDJ A;  4RCY A;  3WXM A;  3G4S B;  4TMX A;  3J81 k;  2GK6 A;  3T56 B;  4RD0 A;  4TT3 A;  3AVT A;  2VNJ A;  2DCU A;  4G5G A;  3ZC3 A;  1XFO A;  3E1Y E;  4G6I A;  4X7E A;  2DY1 A;  1BQE A;  1OHH A;  3AVW A;  2Q6O A;  3CPW B;  1TTT A;  1FND A;  1QUE A;  3W5V A;  1WOS A;  1IHM A;  3LNN A;  4PGO A;  1RQR A;  1T6Y A;  1QFZ A;  4Z4R A;  2B7B A;  3D26 A;  4QUZ A;  1YIT B;  2B5O A;  1VQ7 B;  3FPP A;  4RD6 A;  1EP3 B;  1GJR A;  3P27 A;  5GV7 A;  1T6Z A;  1ELO A;  2BVN A;  4YEJ A;  2BF4 A;  2V7V A;  3CC7 B;  3PVD A;  1IB0 A;  2QN6 A;  1JB9 A;  2X0K A;  4YAF A;  1NRK A;  2F43 A;  1D2E A;  1JJ2 B;  3OW2 B;  4P9S A;  4DK1 A;  3WQZ A;  4C43 A;  1B23 P;  1GAW A;  2BGJ A;  3SLD A;  1W0J A;  1YI2 B;  3Q38 A;  2W6I A;  1UD3 A;  3I1F A;  1KK3 A;  4H9G A;  5FA6 A;  5IYQ A;  3CCR B;  4X05 A;  4XLC A;  5BSY A;  1N0V C;  1Q86 D;  2XZP A;  1ZM4 A;  3BQJ A;  3CP8 A;  1PKV A;  3SJP A;  4LBV A;  4X07 A;  2X6Y A;  1BLI A;  2XNJ A;  3OAA A;  3G6E B;  2ZXH A;  2V31 A;  2XZO A;  4ASU A;  5FO0 A;  2CW5 A;  2ZL5 A;  1OGI A;  3B8H A;  4OOX A;  3CTA A;  4XOT A;  4Z4U A;  1TLL A;  3GVJ A;  2WZN A;  4PC1 A;  3VR6 A;  2V7X A;  1E1Q A;  1EFT A;  2V7T A;  4P2N A;  1T5E A;  3WBJ A;  2YWG A;  4UZU A;  5TV2 A;  1Y0Y A;  1WPC A;  2ZL7 A;  4AC9 A;  3OKX A;  2BMW A;  1KRH A;  4Y9U A;  4XKW A;  1V5V A;  3G71 B;  1N05 A;  1ZUN B;  5FNZ A;  3ZIA A;  2BM0 A;  3CCJ B;  4XLA A;  4FK8 A;  3T53 B;  1OGJ A;  1K73 D;  2AHO A;  1F60 A;  2DIE A;  1CNE A;  1F20 A;  1DDI A;  4X7F A;  4WQM A;  3BC9 A;  3FKS A;  1BX0 A;  1N08 A;  2ZBU A;  4Z4V A;  1E63 A;  4WZK A;  2JIZ A;  1VQ5 B;  4FWT A;  3ZZU A;  1NB0 A;  3BNW A;  3G05 A;  1PJ5 A;  3ZPN A;  2XZL A;  4TSF A;  2HDN B;  1QVG B;  4X8I A;  2X3U A;  1QFJ A;  3OEE A;  2PIA A;  4YAL A;  3OPO A;  4AF6 A;  5HZA A;  4RDL A;  4WZT A;  4XM3 A;  1VQ8 B;  3ZBT A;  3JU4 A;  4HIZ A;  4Y7C A;  1QG0 A;  3GVK A;  4Z4Z A;  5IYW A;  3PUM A;  2XNC A;  3QFR A;  2W6J A;  4X7C A;  3VNV A;  1H85 A;  1WDT A;  3WND A;  4CQJ A;  1EP1 B;  1Q81 D;  3OOC A;  3A3G A;  2C5B A;  3H94 A;  2WJY A;  3P26 A;  1KQS B;  3AST A;  4B48 A;  2CK3 A;  4TMV A;  4P1V A;  5GV8 A;  3CCM B;  4XD7 A;  2CND A;  3CC4 B;  3MCA A;  2WR8 A;  4JMQ A;  2PMD A;  2VJI A;  2HCJ B;  5F4O A;  2D3N A;  3ZBU A;  1MRZ A;  4DNR B;  3Q3A A;  1WU8 A;  4LBW A;  4Z4W A;  3PUN A;  3OEH A;  2FX3 A;  4L8J A;  2CRV A;  3Q6R A;  1WTH D;  2I1L A;  5DN6 A;  4X7D A;  5A89 A;  2PLF A;  1UMK A;  2DET A;  1S0U A;  4B3X A;  3CCV B;  4XL9 A;  1HVX A;  2OK8 A;  4PAB A;  1E1R A;  3CCE B;  3Q39 A;  1SKQ A;  1VQP B;  2BGI A;  3JQR A;  3HAG A;  1OB2 A;  1NB9 A;  4YAO A;  3QFC A;  5J35 A;  2XEX A;  2OYN A;  4TKO B;  4P3I A;  3A1P A;  3V76 A;  1WSV A;  3VMF A;  4ZGN B;  2WPD A;  4OPS A;  1N8R D;  4XLE A;  1XE1 A;  2C78 A;  5EMN A;  4NCN A;  4WZL A;  4IW3 B;  3I56 B;  4DQL A;  2V7U A;  2VBT A;  2XOK A;  3BCF A;  3W2H A;  1TVC A;  4X0C A;  1IJF A;  3KL9 A;  3OFN A;  4P25 A;  4QHY A;  2JDI A;  3ISX A;  1EP2 B;  4PC6 A;  1EFC A;  3FJO A;  2YWE A;  5HZB A;  2Q6I A;  1YX2 A;  2R6H A;  4TMW A;  4OP7 A;  3LQE A;  2VBU A;  1ZM9 A;  3PEN A;  3DDY A;  1OB0 A;  1HA3 A;  1R5B A;  1SM4 A;  2OBR A;  4YAU A;  2V7Q A;  3Q6Q A;  2CF4 A;  2ZZE A;  1I7P A;  4N3N A;  1GR1 A;  1MAB A;  4FN5 A;  1KZL A;  3U6K A;  1XQB A;  4XOP A;  3CD6 B;  2C4T A;  5LMZ A;  3ASQ A;  2JJ2 A;  2EFG A;  4M0L A;  3A35 A;  2V4D A;  3GSI A;  1QX4 A;  3I55 B;  1AIP A;  1A8P A;  1WSR A;  2OTL B;  1VLY A;  2HMA A;  4P6Y A;  1GO2 A;  5HKK A;  4AVZ A;  1D1N A;  4XN3 A;  2NPF A;  5FO1 A;  3OE7 A;  1UD4 A;  3AVV A;  4II3 A;  3ASP A;  4LC0 A;  3OJW A;  4KKU A;  4XON A;  4XQF A;  4YAW A;  2J7K A;  3CMA B;  3W2E A;  5HXB A;  3W5U A;  3GVL A;  4M53 A;  1G7S A;  3ES9 A;  1TUI A;  1KK1 A;  4Z4S A;  2ZL6 A;  4MYU A;  1WOO A;  1KTV A;  4RPB A;  2ZTG A;  5DSZ A;  2R9V A;  1P4M A;  1N07 A;  4XOR A;  3SJZ A;  5TR9 A;  3CB4 A;  2C4U A;  4P26 A;  4B44 A;  2C77 A;  5J3O A;  1QH0 A;  3E20 A;  4B3G A;  3CCQ B;  5THX A;  1KD1 D;  1WOR A;  4X06 A; 
#chains in the Genus database with same CATH homology
 5F4O A;  4X7E A;  3PA2 A;  3Q3A A;  4OOS A;  5F4M A;  4Z4W A;  1IHM A;  4WZE A;  3PUN A;  4Z4R A;  3D26 A;  4QUZ A;  3SLN A;  3Q6R A;  3ASS A;  4X7D A;  3ASR A;  3PVD A;  3R6J A;  3ONU A;  3Q39 A;  2OBS A;  5J35 A;  3SLD A;  5E6T A;  5IYP A;  3Q38 A;  5IYQ A;  4P3I A;  4X05 A;  4ROX A;  3SKB A;  4OPS A;  5BSY A;  3BQJ A;  4OOV A;  4WZL A;  2OBT A;  5IYR A;  3SJP A;  4X07 A;  5BSX A;  4OPO A;  4X0C A;  3ONY A;  4P25 A;  2ZL5 A;  4OOX A;  3V7A A;  4Z4U A;  5HZB A;  4QVA A;  4OP7 A;  3LQE A;  4P2N A;  2OBR A;  4P12 A;  2ZL7 A;  3Q6Q A;  5IYN A;  3BY2 A;  3RY8 A;  3LQ6 A;  3ASQ A;  4X7F A;  4Z4V A;  4WZK A;  4QVJ A;  4OPV A;  3ASP A;  5F4J A;  4RPD A;  5HZA A;  4RDL A;  4WZT A;  3PA1 A;  4QV2 A;  4RDK A;  4Z4Y A;  4Z4Z A;  5IYW A;  3PUM A;  4Z4S A;  2ZL6 A;  4X7C A;  3BY1 A;  4RPB A;  4RLZ A;  5KW9 A;  3R6K A;  4Z4T A;  3AST A;  4RDJ A;  4P26 A;  4P1V A;  5J3O A;  3SEJ A;  4RM0 A;  4X06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...