1A43A

Structure of the hiv-1 capsid protein dimerization domain at 2.6a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
72
structure length
72
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV-1 CAPSID
publication title Structures of the HIV-1 capsid protein dimerization domain at 2.6 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 25
structure length 72
sequence length 72
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1a43A00
4U0FA 1A43A 4XFZA 2BUOA 3G21A 3G29A 4U0BA 1BAJA 4U0EA 2XV6A 1A8OA 1EOQA 4QNBA 3G0VA 3DTJA 4COPA 4M0IA 5JPAA 3DPHA 5I4TG 2M8PA 5DCKA 4XFYA 3H47A 4PH0A 4COCA 3VRLC 1EIAA 2XXMA 2LF4A 4U0DA 3G1GA 3DS5A 1QRJA 2JO0A 2ONTA 2KODA 3DS2A 2M8NA 3DS4A 2JYLA 3G28A 2XT1A 3NTEA 4IPYA 4U0CA 4WYMA 5HGOA 4XROA 2L6EA 3MGEA 4U0AA 5HGNA 3H4EA 4XRQA 5HGMA 2EIAA 1E6JP 3G1IA 3DS0A 3DS1A 2JYGA 4XFXA 1D1DA 3DS3A 4PH1A 2M8LA 3P05A 3LRYA 3G26A 5HGLA 1AUMA
chains in the Genus database with same CATH superfamily
1Z6MA 1UNKA 2N50A 2N98A 1BXIA 3CE7A 2FVAA 2FQ1A 2KOOA 3M1MA 1VQOP 2FHSC 2EHSA 4CA3A 3OW2O 1QVFO 3I55P 1VQMP 2EG5A 3G1IA 1VQNP 3P05A 2GZEA 1RNIA 1IMQA 2K93A 2KG9A 3G29A 5EJDA 2PENA 2PEMA 2LPKA 1M6NA 3G1GA 3DS5A 3CC7P 1VQ4P 1VQLP 2EIAA 1M90Q 1YHQP 1VQ5P 1Q7YQ 3G71P 2GZFA 2GDXA 2GYKA 2CG5B 2X2BA 3CMAP 2PEJA 1VQ6P 4COPA 2JBGA 2AFEA 2JO0A 2ONTA 3DS4A 3CCMP 2MR8A 1AYIA 1DV5A 2JB0A 1ZNVA 2N5HA 3HZQA 2QEXP 4U0BA 2LL8A 5BS1A 1YIJP 2KOSA 2LIWA 2FVFA 4IPYA 1VQKP 3G4SP 2Z46A 3CCUP 1QVGO 2MVVA 2OTJP 3LMOA 2JAZA 2L22A 3B5IA 1GPJA 2EHTA 1EOQA 2KOQA 2MD9A 2ROQA 2AF8A 4H2WC 2KG6A 2KODA 3CCJP 5HGOA 1NJIQ 5F2OA 3H4EA 1L0HA 5HGMA 5HVCA 2KGAA 2CNRA 3U43A 3Q20A 1AUMA 2Z45A 3CC4P 3CD6P 2Z44A 2LKIA 2VLOA 1L0IA 2DNWA 4PXHB 2JU2A 1YITP 1GXHA 1M6EX 2MVUA 2PEQA 3WBHA 2K94A 1ZMBA 2K0XA 3I56P 2FQ2A 1NQ4A 2AFDA 3G0VA 1KC8Q 5HV8A 5DCKA 4NEOA 2PY8A 1W2BO 1K9MQ 1KQSO 2QNWA 2GDYA 1GXGA 1VQ9P 2L9FA 1F80D 1OR5A 3DS1A 4XFXA 2GZJA 4BPFA 1IUQA 2OARA 1AF8A 4XFZA 1K8AQ 1VQ7P 2FACA 3G21A 4U0EA 1RO2A 2NO8A 2K0DX 2M8PA 1JJ2O 3CC2P 4COCA 1QRJA 3NY7B 4BPGA 4XROA 3H0DA 2N6ZA 2L4BA 2FAEA 2PEIA 2K5XA 5F2KA 2K92A 4QNBA 3DTJA 1UJZA 1VQ8P 4XFYA 2XXMA 2M8LA 1FR2A 5I4TG 2FADA 4WYMA 7CEIA 3GZLA 1K73Q 3CMEP 2L6EA 3MGEA 1Q81Q 4PWVB 2XZ0D 3GZMA 2DGYA 4H2YC 1YJWP 4M0IA 1YI2P 2KGCA 2JU1A 3H47A 2AVAA 2M8NA 2QA4P 1N8RQ 2VLNA 3CCEP 2CGQA 3GKLC 1HQBA 3DS0A 2CQ8A 4U0FA 3EJDA 1X3OA 2K2QA 1A8OA 2GZGA 4HKGA 2MR7A 2N5IA 3G6EP 3DS2A 3CCLP 2JGPA 3RG6C 4XRQA 2JQ4A 2VLQA 4IZ6A 5KP7B 2VSQA 1VKUA 3HYBA 3G26A 2GDWA 2KORA 5HGLA 1A43A 4H2XC 5JPAA 2E1MA 3CCSP 2FVEA 3EJBA 1KLPA 3E2DA 4U0CA 2M5RA 2KG8A 5BS2A 1K30A 5KP8B 5F2NA 3CCVP 3GJNA 4PH1A 3LRYA 1Q82Q 3B4QA 1VQPP 2KOPA 2XV6A 1IMPA 4UHPB 2LIUA 2PEKA 1KD1Q 1S72P 3CCQP 2LMLA 2CWOA 3NTEA 2XZ1C 5CZDB 2L0QA 5HGNA 2ERHA 4MRTC 3DS3A 2PEOA 5KP6B 4GR2A 2BHVA 2BUOA 1Q86Q 2VLPA 4F37A 2LOLA 3DPHA 1YJ9P 2N6YA 2LF4A 2LTEA 3EJEA 2MF4A 1DNYA 2EFJA 2FQ0A 1E6JP 2KR5A 1VHNA 2JYGA 2KWLA 2PNGA 1E0HA 2P9XA 1BAJA 3CCRP 2KGDA 3RG2A 2GZIA 1YJNP 3VRLC 1EIAA 1M1KQ 3G28A 2JYLA 2MY5A 1RO0A 4QKOA 4U0AA 1EMVA 1M74A 1D1DA 2WPTA 2K0YA 1CEIA 1ACPA 3CPWO 4BPHA 2KW2A 4R0MA 4PH0A 4U0DA 3CXCO 1T8KA 2OTLP 4DG9A 1MZ8A 2XT1A 4GR6A 2KGEA 5EW5E 1HY8A
chains in the Genus database with same CATH topology
3B5IA 5F2KA 1VQPP 2XV6A 1EOQA 4QNBA 3DTJA 2PEKA 1KD1Q 1S72P 3M1MA 1VQOP 3CCQP 1VQ8P 4XFYA 2XXMA 2CWOA 2M8LA 2KODA 5I4TG 3NTEA 4WYMA 5HGOA 3CCJP 3OW2O 1K73Q 1NJIQ 3CMEP 1QVFO 3I55P 2L6EA 3MGEA 1Q81Q 5HGNA 1VQMP 5F2OA 3H4EA 2EG5A 5HGMA 3G1IA 1VQNP 3DS3A 3P05A 2PEOA 4GR2A 1RNIA 2BHVA 3Q20A 1AUMA 2Z45A 3CC4P 2BUOA 2DGYA 1Q86Q 3CD6P 2Z44A 3G29A 1YJWP 2PENA 2PEMA 4M0IA 1YI2P 3DPHA 1M6NA 1YJ9P 3H47A 1YITP 2LF4A 3G1GA 3DS5A 3CC7P 1M6EX 2M8NA 2QA4P 1VQ4P 1N8RQ 2EFJA 1VQLP 2PEQA 3CCEP 2EIAA 1E6JP 1M90Q 1YHQP 3DS0A 2JYGA 1VQ5P 1Q7YQ 3G71P 2P9XA 4U0FA 3WBHA 1ZMBA 3I56P 1BAJA 3CMAP 2PEJA 1A8OA 3CCRP 1VQ6P 3G0VA 4COPA 1KC8Q 5DCKA 2PY8A 1W2BO 1YJNP 3VRLC 1EIAA 1M1KQ 1K9MQ 3G28A 3G6EP 2JO0A 2ONTA 3DS2A 3DS4A 3CCMP 1KQSO 2JYLA 3CCLP 1RO0A 3RG6C 1VQ9P 4U0AA 4XRQA 1M74A 3DS1A 4XFXA 1D1DA 3HYBA 3G26A 3HZQA 5HGLA 1IUQA 2OARA 1A43A 4XFZA 1K8AQ 1VQ7P 2QEXP 3G21A 4U0BA 3CPWO 4U0EA 1RO2A 5JPAA 2M8PA 5BS1A 1JJ2O 2E1MA 4PH0A 4COCA 3CC2P 4U0DA 3CXCO 3CCSP 1YIJP 2OTLP 1QRJA 3E2DA 4U0CA 4IPYA 2XT1A 1VQKP 3H0DA 4XROA 3G4SP 4GR6A 5BS2A 1K30A 2Z46A 5F2NA 3CCUP 1QVGO 3CCVP 4PH1A 2PEIA 2OTJP 3LRYA 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0F A;  1A43 A;  4XFZ A;  2BUO A;  3G21 A;  3G29 A;  4U0B A;  1BAJ A;  4U0E A;  2XV6 A;  1A8O A;  1EOQ A;  4QNB A;  3G0V A;  3DTJ A;  4COP A;  4M0I A;  5JPA A;  3DPH A;  5I4T G;  2M8P A;  5DCK A;  4XFY A;  3H47 A;  4PH0 A;  4COC A;  3VRL C;  1EIA A;  2XXM A;  2LF4 A;  4U0D A;  3G1G A;  3DS5 A;  1QRJ A;  2JO0 A;  2ONT A;  2KOD A;  3DS2 A;  2M8N A;  3DS4 A;  2JYL A;  3G28 A;  2XT1 A;  3NTE A;  4IPY A;  4U0C A;  4WYM A;  5HGO A;  4XRO A;  2L6E A;  3MGE A;  4U0A A;  5HGN A;  3H4E A;  4XRQ A;  5HGM A;  2EIA A;  1E6J P;  3G1I A;  3DS0 A;  3DS1 A;  2JYG A;  4XFX A;  1D1D A;  3DS3 A;  4PH1 A;  2M8L A;  3P05 A;  3LRY A;  3G26 A;  5HGL A;  1AUM A; 
#chains in the Genus database with same CATH topology
 1Z6M A;  1UNK A;  2N50 A;  2N98 A;  1BXI A;  3CE7 A;  2FVA A;  2FQ1 A;  2KOO A;  3M1M A;  1VQO P;  2FHS C;  2EHS A;  4CA3 A;  3OW2 O;  1QVF O;  3I55 P;  1VQM P;  2EG5 A;  3G1I A;  1VQN P;  3P05 A;  2GZE A;  1RNI A;  1IMQ A;  2K93 A;  2KG9 A;  3G29 A;  5EJD A;  2PEN A;  2PEM A;  2LPK A;  1M6N A;  3G1G A;  3DS5 A;  3CC7 P;  1VQ4 P;  1VQL P;  2EIA A;  1M90 Q;  1YHQ P;  1VQ5 P;  1Q7Y Q;  3G71 P;  2GZF A;  2GDX A;  2GYK A;  2CG5 B;  2X2B A;  3CMA P;  2PEJ A;  1VQ6 P;  4COP A;  2JBG A;  2AFE A;  2JO0 A;  2ONT A;  3DS4 A;  3CCM P;  2MR8 A;  1AYI A;  1DV5 A;  2JB0 A;  1ZNV A;  2N5H A;  3HZQ A;  2QEX P;  4U0B A;  2LL8 A;  5BS1 A;  1YIJ P;  2KOS A;  2LIW A;  2FVF A;  4IPY A;  1VQK P;  3G4S P;  2Z46 A;  3CCU P;  1QVG O;  2MVV A;  2OTJ P;  3LMO A;  2JAZ A;  2L22 A;  3B5I A;  1GPJ A;  2EHT A;  1EOQ A;  2KOQ A;  2MD9 A;  2ROQ A;  2AF8 A;  4H2W C;  2KG6 A;  2KOD A;  3CCJ P;  5HGO A;  1NJI Q;  5F2O A;  3H4E A;  1L0H A;  5HGM A;  5HVC A;  2KGA A;  2CNR A;  3U43 A;  3Q20 A;  1AUM A;  2Z45 A;  3CC4 P;  3CD6 P;  2Z44 A;  2LKI A;  2VLO A;  1L0I A;  2DNW A;  4PXH B;  2JU2 A;  1YIT P;  1GXH A;  1M6E X;  2MVU A;  2PEQ A;  3WBH A;  2K94 A;  1ZMB A;  2K0X A;  3I56 P;  2FQ2 A;  1NQ4 A;  2AFD A;  3G0V A;  1KC8 Q;  5HV8 A;  5DCK A;  4NEO A;  2PY8 A;  1W2B O;  1K9M Q;  1KQS O;  2QNW A;  2GDY A;  1GXG A;  1VQ9 P;  2L9F A;  1F80 D;  1OR5 A;  3DS1 A;  4XFX A;  2GZJ A;  4BPF A;  1IUQ A;  2OAR A;  1AF8 A;  4XFZ A;  1K8A Q;  1VQ7 P;  2FAC A;  3G21 A;  4U0E A;  1RO2 A;  2NO8 A;  2K0D X;  2M8P A;  1JJ2 O;  3CC2 P;  4COC A;  1QRJ A;  3NY7 B;  4BPG A;  4XRO A;  3H0D A;  2N6Z A;  2L4B A;  2FAE A;  2PEI A;  2K5X A;  5F2K A;  2K92 A;  4QNB A;  3DTJ A;  1UJZ A;  1VQ8 P;  4XFY A;  2XXM A;  2M8L A;  1FR2 A;  5I4T G;  2FAD A;  4WYM A;  7CEI A;  3GZL A;  1K73 Q;  3CME P;  2L6E A;  3MGE A;  1Q81 Q;  4PWV B;  2XZ0 D;  3GZM A;  2DGY A;  4H2Y C;  1YJW P;  4M0I A;  1YI2 P;  2KGC A;  2JU1 A;  3H47 A;  2AVA A;  2M8N A;  2QA4 P;  1N8R Q;  2VLN A;  3CCE P;  2CGQ A;  3GKL C;  1HQB A;  3DS0 A;  2CQ8 A;  4U0F A;  3EJD A;  1X3O A;  2K2Q A;  1A8O A;  2GZG A;  4HKG A;  2MR7 A;  2N5I A;  3G6E P;  3DS2 A;  3CCL P;  2JGP A;  3RG6 C;  4XRQ A;  2JQ4 A;  2VLQ A;  4IZ6 A;  5KP7 B;  2VSQ A;  1VKU A;  3HYB A;  3G26 A;  2GDW A;  2KOR A;  5HGL A;  1A43 A;  4H2X C;  5JPA A;  2E1M A;  3CCS P;  2FVE A;  3EJB A;  1KLP A;  3E2D A;  4U0C A;  2M5R A;  2KG8 A;  5BS2 A;  1K30 A;  5KP8 B;  5F2N A;  3CCV P;  3GJN A;  4PH1 A;  3LRY A;  1Q82 Q;  3B4Q A;  1VQP P;  2KOP A;  2XV6 A;  1IMP A;  4UHP B;  2LIU A;  2PEK A;  1KD1 Q;  1S72 P;  3CCQ P;  2LML A;  2CWO A;  3NTE A;  2XZ1 C;  5CZD B;  2L0Q A;  5HGN A;  2ERH A;  4MRT C;  3DS3 A;  2PEO A;  5KP6 B;  4GR2 A;  2BHV A;  2BUO A;  1Q86 Q;  2VLP A;  4F37 A;  2LOL A;  3DPH A;  1YJ9 P;  2N6Y A;  2LF4 A;  2LTE A;  3EJE A;  2MF4 A;  1DNY A;  2EFJ A;  2FQ0 A;  1E6J P;  2KR5 A;  1VHN A;  2JYG A;  2KWL A;  2PNG A;  1E0H A;  2P9X A;  1BAJ A;  3CCR P;  2KGD A;  3RG2 A;  2GZI A;  1YJN P;  3VRL C;  1EIA A;  1M1K Q;  3G28 A;  2JYL A;  2MY5 A;  1RO0 A;  4QKO A;  4U0A A;  1EMV A;  1M74 A;  1D1D A;  2WPT A;  2K0Y A;  1CEI A;  1ACP A;  3CPW O;  4BPH A;  2KW2 A;  4R0M A;  4PH0 A;  4U0D A;  3CXC O;  1T8K A;  2OTL P;  4DG9 A;  1MZ8 A;  2XT1 A;  4GR6 A;  2KGE A;  5EW5 E;  1HY8 A; 
#chains in the Genus database with same CATH homology
 3B5I A;  5F2K A;  1VQP P;  2XV6 A;  1EOQ A;  4QNB A;  3DTJ A;  2PEK A;  1KD1 Q;  1S72 P;  3M1M A;  1VQO P;  3CCQ P;  1VQ8 P;  4XFY A;  2XXM A;  2CWO A;  2M8L A;  2KOD A;  5I4T G;  3NTE A;  4WYM A;  5HGO A;  3CCJ P;  3OW2 O;  1K73 Q;  1NJI Q;  3CME P;  1QVF O;  3I55 P;  2L6E A;  3MGE A;  1Q81 Q;  5HGN A;  1VQM P;  5F2O A;  3H4E A;  2EG5 A;  5HGM A;  3G1I A;  1VQN P;  3DS3 A;  3P05 A;  2PEO A;  4GR2 A;  1RNI A;  2BHV A;  3Q20 A;  1AUM A;  2Z45 A;  3CC4 P;  2BUO A;  2DGY A;  1Q86 Q;  3CD6 P;  2Z44 A;  3G29 A;  1YJW P;  2PEN A;  2PEM A;  4M0I A;  1YI2 P;  3DPH A;  1M6N A;  1YJ9 P;  3H47 A;  1YIT P;  2LF4 A;  3G1G A;  3DS5 A;  3CC7 P;  1M6E X;  2M8N A;  2QA4 P;  1VQ4 P;  1N8R Q;  2EFJ A;  1VQL P;  2PEQ A;  3CCE P;  2EIA A;  1E6J P;  1M90 Q;  1YHQ P;  3DS0 A;  2JYG A;  1VQ5 P;  1Q7Y Q;  3G71 P;  2P9X A;  4U0F A;  3WBH A;  1ZMB A;  3I56 P;  1BAJ A;  3CMA P;  2PEJ A;  1A8O A;  3CCR P;  1VQ6 P;  3G0V A;  4COP A;  1KC8 Q;  5DCK A;  2PY8 A;  1W2B O;  1YJN P;  3VRL C;  1EIA A;  1M1K Q;  1K9M Q;  3G28 A;  3G6E P;  2JO0 A;  2ONT A;  3DS2 A;  3DS4 A;  3CCM P;  1KQS O;  2JYL A;  3CCL P;  1RO0 A;  3RG6 C;  1VQ9 P;  4U0A A;  4XRQ A;  1M74 A;  3DS1 A;  4XFX A;  1D1D A;  3HYB A;  3G26 A;  3HZQ A;  5HGL A;  1IUQ A;  2OAR A;  1A43 A;  4XFZ A;  1K8A Q;  1VQ7 P;  2QEX P;  3G21 A;  4U0B A;  3CPW O;  4U0E A;  1RO2 A;  5JPA A;  2M8P A;  5BS1 A;  1JJ2 O;  2E1M A;  4PH0 A;  4COC A;  3CC2 P;  4U0D A;  3CXC O;  3CCS P;  1YIJ P;  2OTL P;  1QRJ A;  3E2D A;  4U0C A;  4IPY A;  2XT1 A;  1VQK P;  3H0D A;  4XRO A;  3G4S P;  4GR6 A;  5BS2 A;  1K30 A;  2Z46 A;  5F2N A;  3CCU P;  1QVG O;  3CCV P;  4PH1 A;  2PEI A;  2OTJ P;  3LRY A;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...