1A43A

Structure of the hiv-1 capsid protein dimerization domain at 2.6a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
72
structure length
72
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID
publication title Structures of the HIV-1 capsid protein dimerization domain at 2.6 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 25
structure length 72
sequence length 72
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1a43A00
4U0CA 5HGNA 5HGOA 2BUOA 4IPYA 1QRJA 3NTEA 3DPHA 2M8LA 3H4EA 5HGLA 5HGMA 3DS4A 4XROA 3DS3A 5JPAA 3MGEA 3G28A 3VRLC 4COPA 2JO0A 3G0VA 5I4TG 4COCA 2JYGA 2KODA 2XXMA 2ONTA 5DCKA 4XFXA 4U0AA 2EIAA 3G1GA 4PH0A 1A8OA 2M8PA 4XFZA 4M0IA 4QNBA 1BAJA 3DS0A 1A43A 3G1IA 3G29A 1EIAA 4U0EA 4WYMA 4XFYA 2XV6A 3P05A 3G21A 4U0DA 2JYLA 3DS5A 3G26A 3H47A 1D1DA 2LF4A 4PH1A 1AUMA 3DTJA 2M8NA 2XT1A 2L6EA 3DS1A 4U0FA 4XRQA 4U0BA 1EOQA 3LRYA 3DS2A 1E6JP
chains in the Genus database with same CATH superfamily
4PXHB 3B4QA 2BUOA 2AF8A 5EW5E 2X2BA 3CCUP 2GZFA 5CZDB 3DS3A 2KGEA 3CCSP 2LMLA 2KOPA 1X3OA 1VQNP 5KP7B 1A8OA 4XFZA 4BPGA 1MZ8A 2ERHA 3CC4P 1GXGA 2MVUA 1VQ5P 2JYLA 1M6EX 4GR2A 1VQ9P 2KG9A 2XT1A 1NQ4A 2K94A 2JGPA 3CCRP 2KWLA 2WPTA 3NTEA 4R0MA 3HYBA 1F80D 5HV8A 2JAZA 3G71P 2FVAA 2K0XA 2K92A 2PEQA 2GDYA 4U0EA 4PWVB 2CGQA 3DS1A 1VQPP 2FVFA 3CC7P 2LPKA 2MR8A 2K5XA 1YJ9P 1ACPA 4BPHA 3G0VA 3I55P 2M8PA 2Z46A 4H2WC 4MRTC 1A43A 1GXHA 3H0DA 1VQ8P 3DS5A 1Q86Q 2VLNA 2KW2A 3GZMA 2K93A 5KP8B 1K30A 3DS2A 2GDXA 2LIWA 2GZIA 5EJDA 3G28A 4COPA 1VQ7P 3CE7A 1RO2A 2DNWA 2E1MA 3CMAP 1M74A 3M1MA 2JQ4A 4HKGA 4XFYA 1NJIQ 2PEOA 1N8RQ 5KP6B 2LF4A 2LL8A 1S72P 4IPYA 2OARA 3CCEP 2K2QA 3G6EP 3U43A 2VSQA 1M6NA 1OR5A 1KD1Q 2FVEA 2N6YA 1DNYA 2N98A 1K9MQ 2AFEA 1VQMP 1K8AQ 3E2DA 2L4BA 2EHTA 3DS4A 2BHVA 2KOOA 1ZMBA 3VRLC 5BS1A 2KOQA 2Z44A 2XZ1C 3B5IA 4PH0A 2FADA 3NY7B 5F2KA 3G29A 3G1IA 2QA4P 2VLPA 2FQ1A 2L6EA 3LRYA 1FR2A 5F2OA 1VHNA 3CCMP 2JBGA 3MGEA 2K0DX 2PENA 2EIAA 1IMPA 1L0IA 1EIAA 3CXCO 2XV6A 1AYIA 2FACA 3RG6C 2LTEA 3G4SP 4XRQA 1VQ4P 3DPHA 3LMOA 4BPFA 2QEXP 2KGAA 2JO0A 3Q20A 3CCVP 4COCA 2XXMA 1BAJA 1HY8A 2GZJA 4UHPB 3EJBA 1HQBA 1M90Q 2FHSC 2M8LA 2EFJA 3CPWO 5DCKA 4XFXA 2GZEA 2VLOA 4QNBA 1Q82Q 1EMVA 2AVAA 4H2XC 2KOSA 3GKLC 2PY8A 1UJZA 2N6ZA 2OTLP 3RG2A 3GZLA 2L22A 2N50A 2ONTA 1YIJP 3DS0A 1BXIA 1CEIA 2L9FA 4CA3A 1Q7YQ 1Q81Q 1QVFO 1DV5A 3GJNA 2K0YA 3H4EA 1VQLP 4XROA 2L0QA 2CWOA 5HVCA 1VQKP 2QNWA 3HZQA 1QVGO 3G1GA 7CEIA 1YJWP 2PNGA 2NO8A 2PEMA 2M5RA 4WYMA 1YHQP 4NEOA 3G21A 4U0DA 5BS2A 2KGCA 2MF4A 2MY5A 2KR5A 1KC8Q 2CNRA 1E6JP 2MVVA 5F2NA 1KLPA 2MD9A 1KQSO 2JU2A 3CD6P 2FQ2A 3CCLP 2LKIA 3G26A 1UNKA 1YI2P 4U0FA 4U0CA 5HGOA 5HGNA 1QRJA 2CG5B 2EHSA 1VQ6P 1AF8A 5JPAA 2P9XA 4GR6A 1YITP 3CMEP 4M0IA 1E0HA 1L0HA 3EJEA 2CQ8A 4PH1A 2KORA 2M8NA 2GDWA 1RNIA 3OW2O 3CCQP 1K73Q 1VQOP 4H2YC 2OTJP 3CCJP 5I4TG 2N5IA 1RO0A 2KODA 2Z45A 1YJNP 4IZ6A 2EG5A 2XZ0D 1D1DA 2LIUA 1Z6MA 4U0BA 1T8KA 2ROQA 4QKOA 2FQ0A 5HGMA 2GYKA 2DGYA 4F37A 2N5HA 1ZNVA 1W2BO 2JB0A 3I56P 2VLQA 3CC2P 2AFDA 3P05A 2JU1A 1AUMA 3DTJA 4DG9A 2PEKA 1VKUA 3EJDA 5HGLA 2FAEA 2MR7A 3WBHA 2JYGA 1GPJA 2KG8A 2PEJA 4U0AA 1IMQA 2KGDA 2GZGA 2LOLA 1JJ2O 2PEIA 3H47A 1M1KQ 1IUQA 1EOQA 2KG6A
chains in the Genus database with same CATH topology
4U0CA 5HGNA 5HGOA 2BUOA 4IPYA 1QRJA 2OARA 2M8LA 1VQ6P 2EFJA 3CCEP 3CCUP 3DS3A 5JPAA 3CPWO 3CCSP 2P9XA 3G6EP 4GR6A 1VQNP 1M6NA 5DCKA 4XFXA 1YITP 1KD1Q 3CMEP 1A8OA 4XFZA 4M0IA 4QNBA 1K9MQ 3CC4P 1VQ5P 1VQMP 1Q82Q 2JYLA 1K8AQ 1M6EX 4GR2A 4PH1A 1VQ9P 2M8NA 2XT1A 3E2DA 1RNIA 3OW2O 2PY8A 3CCQP 3CCRP 1K73Q 3NTEA 2OTLP 3HYBA 3DS4A 2BHVA 1VQOP 1ZMBA 3VRLC 2OTJP 3CCJP 5BS1A 5I4TG 1RO0A 2KODA 3G71P 2ONTA 2Z44A 1YIJP 2PEQA 3B5IA 4PH0A 2Z45A 5F2KA 1YJNP 3DS0A 3G29A 3G1IA 4U0EA 2QA4P 2EG5A 1D1DA 1Q7YQ 3DS1A 2L6EA 1Q81Q 1VQPP 1QVFO 4U0BA 3LRYA 5F2OA 3CCMP 3H4EA 3CC7P 5HGMA 1VQLP 4XROA 3MGEA 2CWOA 2DGYA 1YJ9P 3G0VA 1VQKP 3HZQA 1QVGO 2PENA 3I55P 2EIAA 3G1GA 1W2BO 3I56P 2M8PA 1YJWP 2Z46A 2PEMA 1A43A 4WYMA 1EIAA 3CC2P 3CXCO 1YHQP 2XV6A 3P05A 3H0DA 3G21A 4U0DA 1VQ8P 3DS5A 5BS2A 3RG6C 3G4SP 1Q86Q 1KC8Q 1AUMA 3DTJA 4XRQA 1VQ4P 2PEKA 3DS2A 1K30A 1E6JP 5F2NA 3DPHA 5HGLA 2QEXP 3G28A 4COPA 1VQ7P 2JO0A 3Q20A 3CCVP 1RO2A 1KQSO 4COCA 3WBHA 2JYGA 2XXMA 2E1MA 2PEJA 4U0AA 3CMAP 1M74A 3M1MA 1BAJA 3CD6P 4XFYA 1NJIQ 2PEOA 3CCLP 1JJ2O 3G26A 2PEIA 3H47A 1N8RQ 1YI2P 1M1KQ 2LF4A 1IUQA 4U0FA 1EOQA 1S72P 1M90Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0C A;  5HGN A;  5HGO A;  2BUO A;  4IPY A;  1QRJ A;  3NTE A;  3DPH A;  2M8L A;  3H4E A;  5HGL A;  5HGM A;  3DS4 A;  4XRO A;  3DS3 A;  5JPA A;  3MGE A;  3G28 A;  3VRL C;  4COP A;  2JO0 A;  3G0V A;  5I4T G;  4COC A;  2JYG A;  2KOD A;  2XXM A;  2ONT A;  5DCK A;  4XFX A;  4U0A A;  2EIA A;  3G1G A;  4PH0 A;  1A8O A;  2M8P A;  4XFZ A;  4M0I A;  4QNB A;  1BAJ A;  3DS0 A;  1A43 A;  3G1I A;  3G29 A;  1EIA A;  4U0E A;  4WYM A;  4XFY A;  2XV6 A;  3P05 A;  3G21 A;  4U0D A;  2JYL A;  3DS5 A;  3G26 A;  3H47 A;  1D1D A;  2LF4 A;  4PH1 A;  1AUM A;  3DTJ A;  2M8N A;  2XT1 A;  2L6E A;  3DS1 A;  4U0F A;  4XRQ A;  4U0B A;  1EOQ A;  3LRY A;  3DS2 A;  1E6J P; 
#chains in the Genus database with same CATH topology
 4PXH B;  3B4Q A;  2BUO A;  2AF8 A;  5EW5 E;  2X2B A;  3CCU P;  2GZF A;  5CZD B;  3DS3 A;  2KGE A;  3CCS P;  2LML A;  2KOP A;  1X3O A;  1VQN P;  5KP7 B;  1A8O A;  4XFZ A;  4BPG A;  1MZ8 A;  2ERH A;  3CC4 P;  1GXG A;  2MVU A;  1VQ5 P;  2JYL A;  1M6E X;  4GR2 A;  1VQ9 P;  2KG9 A;  2XT1 A;  1NQ4 A;  2K94 A;  2JGP A;  3CCR P;  2KWL A;  2WPT A;  3NTE A;  4R0M A;  3HYB A;  1F80 D;  5HV8 A;  2JAZ A;  3G71 P;  2FVA A;  2K0X A;  2K92 A;  2PEQ A;  2GDY A;  4U0E A;  4PWV B;  2CGQ A;  3DS1 A;  1VQP P;  2FVF A;  3CC7 P;  2LPK A;  2MR8 A;  2K5X A;  1YJ9 P;  1ACP A;  4BPH A;  3G0V A;  3I55 P;  2M8P A;  2Z46 A;  4H2W C;  4MRT C;  1A43 A;  1GXH A;  3H0D A;  1VQ8 P;  3DS5 A;  1Q86 Q;  2VLN A;  2KW2 A;  3GZM A;  2K93 A;  5KP8 B;  1K30 A;  3DS2 A;  2GDX A;  2LIW A;  2GZI A;  5EJD A;  3G28 A;  4COP A;  1VQ7 P;  3CE7 A;  1RO2 A;  2DNW A;  2E1M A;  3CMA P;  1M74 A;  3M1M A;  2JQ4 A;  4HKG A;  4XFY A;  1NJI Q;  2PEO A;  1N8R Q;  5KP6 B;  2LF4 A;  2LL8 A;  1S72 P;  4IPY A;  2OAR A;  3CCE P;  2K2Q A;  3G6E P;  3U43 A;  2VSQ A;  1M6N A;  1OR5 A;  1KD1 Q;  2FVE A;  2N6Y A;  1DNY A;  2N98 A;  1K9M Q;  2AFE A;  1VQM P;  1K8A Q;  3E2D A;  2L4B A;  2EHT A;  3DS4 A;  2BHV A;  2KOO A;  1ZMB A;  3VRL C;  5BS1 A;  2KOQ A;  2Z44 A;  2XZ1 C;  3B5I A;  4PH0 A;  2FAD A;  3NY7 B;  5F2K A;  3G29 A;  3G1I A;  2QA4 P;  2VLP A;  2FQ1 A;  2L6E A;  3LRY A;  1FR2 A;  5F2O A;  1VHN A;  3CCM P;  2JBG A;  3MGE A;  2K0D X;  2PEN A;  2EIA A;  1IMP A;  1L0I A;  1EIA A;  3CXC O;  2XV6 A;  1AYI A;  2FAC A;  3RG6 C;  2LTE A;  3G4S P;  4XRQ A;  1VQ4 P;  3DPH A;  3LMO A;  4BPF A;  2QEX P;  2KGA A;  2JO0 A;  3Q20 A;  3CCV P;  4COC A;  2XXM A;  1BAJ A;  1HY8 A;  2GZJ A;  4UHP B;  3EJB A;  1HQB A;  1M90 Q;  2FHS C;  2M8L A;  2EFJ A;  3CPW O;  5DCK A;  4XFX A;  2GZE A;  2VLO A;  4QNB A;  1Q82 Q;  1EMV A;  2AVA A;  4H2X C;  2KOS A;  3GKL C;  2PY8 A;  1UJZ A;  2N6Z A;  2OTL P;  3RG2 A;  3GZL A;  2L22 A;  2N50 A;  2ONT A;  1YIJ P;  3DS0 A;  1BXI A;  1CEI A;  2L9F A;  4CA3 A;  1Q7Y Q;  1Q81 Q;  1QVF O;  1DV5 A;  3GJN A;  2K0Y A;  3H4E A;  1VQL P;  4XRO A;  2L0Q A;  2CWO A;  5HVC A;  1VQK P;  2QNW A;  3HZQ A;  1QVG O;  3G1G A;  7CEI A;  1YJW P;  2PNG A;  2NO8 A;  2PEM A;  2M5R A;  4WYM A;  1YHQ P;  4NEO A;  3G21 A;  4U0D A;  5BS2 A;  2KGC A;  2MF4 A;  2MY5 A;  2KR5 A;  1KC8 Q;  2CNR A;  1E6J P;  2MVV A;  5F2N A;  1KLP A;  2MD9 A;  1KQS O;  2JU2 A;  3CD6 P;  2FQ2 A;  3CCL P;  2LKI A;  3G26 A;  1UNK A;  1YI2 P;  4U0F A;  4U0C A;  5HGO A;  5HGN A;  1QRJ A;  2CG5 B;  2EHS A;  1VQ6 P;  1AF8 A;  5JPA A;  2P9X A;  4GR6 A;  1YIT P;  3CME P;  4M0I A;  1E0H A;  1L0H A;  3EJE A;  2CQ8 A;  4PH1 A;  2KOR A;  2M8N A;  2GDW A;  1RNI A;  3OW2 O;  3CCQ P;  1K73 Q;  1VQO P;  4H2Y C;  2OTJ P;  3CCJ P;  5I4T G;  2N5I A;  1RO0 A;  2KOD A;  2Z45 A;  1YJN P;  4IZ6 A;  2EG5 A;  2XZ0 D;  1D1D A;  2LIU A;  1Z6M A;  4U0B A;  1T8K A;  2ROQ A;  4QKO A;  2FQ0 A;  5HGM A;  2GYK A;  2DGY A;  4F37 A;  2N5H A;  1ZNV A;  1W2B O;  2JB0 A;  3I56 P;  2VLQ A;  3CC2 P;  2AFD A;  3P05 A;  2JU1 A;  1AUM A;  3DTJ A;  4DG9 A;  2PEK A;  1VKU A;  3EJD A;  5HGL A;  2FAE A;  2MR7 A;  3WBH A;  2JYG A;  1GPJ A;  2KG8 A;  2PEJ A;  4U0A A;  1IMQ A;  2KGD A;  2GZG A;  2LOL A;  1JJ2 O;  2PEI A;  3H47 A;  1M1K Q;  1IUQ A;  1EOQ A;  2KG6 A; 
#chains in the Genus database with same CATH homology
 4U0C A;  5HGN A;  5HGO A;  2BUO A;  4IPY A;  1QRJ A;  2OAR A;  2M8L A;  1VQ6 P;  2EFJ A;  3CCE P;  3CCU P;  3DS3 A;  5JPA A;  3CPW O;  3CCS P;  2P9X A;  3G6E P;  4GR6 A;  1VQN P;  1M6N A;  5DCK A;  4XFX A;  1YIT P;  1KD1 Q;  3CME P;  1A8O A;  4XFZ A;  4M0I A;  4QNB A;  1K9M Q;  3CC4 P;  1VQ5 P;  1VQM P;  1Q82 Q;  2JYL A;  1K8A Q;  1M6E X;  4GR2 A;  4PH1 A;  1VQ9 P;  2M8N A;  2XT1 A;  3E2D A;  1RNI A;  3OW2 O;  2PY8 A;  3CCQ P;  3CCR P;  1K73 Q;  3NTE A;  2OTL P;  3HYB A;  3DS4 A;  2BHV A;  1VQO P;  1ZMB A;  3VRL C;  2OTJ P;  3CCJ P;  5BS1 A;  5I4T G;  1RO0 A;  2KOD A;  3G71 P;  2ONT A;  2Z44 A;  1YIJ P;  2PEQ A;  3B5I A;  4PH0 A;  2Z45 A;  5F2K A;  1YJN P;  3DS0 A;  3G29 A;  3G1I A;  4U0E A;  2QA4 P;  2EG5 A;  1D1D A;  1Q7Y Q;  3DS1 A;  2L6E A;  1Q81 Q;  1VQP P;  1QVF O;  4U0B A;  3LRY A;  5F2O A;  3CCM P;  3H4E A;  3CC7 P;  5HGM A;  1VQL P;  4XRO A;  3MGE A;  2CWO A;  2DGY A;  1YJ9 P;  3G0V A;  1VQK P;  3HZQ A;  1QVG O;  2PEN A;  3I55 P;  2EIA A;  3G1G A;  1W2B O;  3I56 P;  2M8P A;  1YJW P;  2Z46 A;  2PEM A;  1A43 A;  4WYM A;  1EIA A;  3CC2 P;  3CXC O;  1YHQ P;  2XV6 A;  3P05 A;  3H0D A;  3G21 A;  4U0D A;  1VQ8 P;  3DS5 A;  5BS2 A;  3RG6 C;  3G4S P;  1Q86 Q;  1KC8 Q;  1AUM A;  3DTJ A;  4XRQ A;  1VQ4 P;  2PEK A;  3DS2 A;  1K30 A;  1E6J P;  5F2N A;  3DPH A;  5HGL A;  2QEX P;  3G28 A;  4COP A;  1VQ7 P;  2JO0 A;  3Q20 A;  3CCV P;  1RO2 A;  1KQS O;  4COC A;  3WBH A;  2JYG A;  2XXM A;  2E1M A;  2PEJ A;  4U0A A;  3CMA P;  1M74 A;  3M1M A;  1BAJ A;  3CD6 P;  4XFY A;  1NJI Q;  2PEO A;  3CCL P;  1JJ2 O;  3G26 A;  2PEI A;  3H47 A;  1N8R Q;  1YI2 P;  1M1K Q;  2LF4 A;  1IUQ A;  4U0F A;  1EOQ A;  1S72 P;  1M90 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...