1KD1Q

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kd1Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kd1Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kd1Q03
1M1KQ 3CCQP 3CCSP 1VQMP 1YITP 3CPWO 1VQ6P 3CD6P 3CXCO 1KD1Q 1VQNP 1VQ8P 1YJWP 1KQSO 3CCJP 1NJIQ 1K73Q 1N8RQ 1VQ9P 1VQLP 1VQKP 1YHQP 1M90Q 2QA4P 1Q81Q 1KC8Q 1VQPP 1VQOP 1YI2P 3G4SP 1Q82Q 1Q86Q 3CCMP 1QVGO 3I56P 3CCEP 3CCLP 3G6EP 3CCVP 2QEXP 1VQ5P 3CMAP 1YJ9P 1YJNP 3OW2O 3CCUP 1VQ7P 3CC2P 2OTLP 3G71P 1K8AQ 1VQ4P 1QVFO 1YIJP 1S72P 1K9MQ 3CC4P 2OTJP 3CCRP 1Q7YQ 3CMEP 3CC7P 3I55P 1W2BO 1JJ2O
chains in the Genus database with same CATH superfamily
4COCA 3VP8A 1RY3A 2YMYA 1DH3A 2V7QJ 4D6TE 3CE7A 1KD1Q 3L72G 2K0DX 2K92A 4H44D 4U0FA 4K3AA 2KG8A 1NTMK 1M74A 3TK1A 3L71E 1W2EA 2OYHA 4R4LA 1PGJA 1SQPG 2J5UA 3B4SA 2DW3A 1EZVE 4DG9A 1SLQA 1H0TB 2N1TA 2GZJA 3GLMA 2H89C 2KGAA 4W7ZA 3TGUJ 2FYZA 3HTKA 5H2FH 2IBZE 4RO0A 2Z5HA 2HG5D 3GKLC 1KQFB 1HH0A 1OWAA 2HFED 1GL2A 1EDIA 1KB9I 1LTJB 3TGUD 3H1HG 1NJIQ 3HUSB 1N73B 2KS1B 4IPYA 4ZKPA 1KILA 4PH0A 1L0HA 5EFWB 2L22A 1FZBA 2WWWA 4D6TD 1PGQA 4PD4H 4OWFA 3VYIA 3Q2YA 2JP3A 1JCDA 2GA1A 2E42A 3CMEP 1EOQA 2QM8A 5BS2A 5AW8B 2OYOA 4W80A 3WMM0 1S1CX 1NU1G 1S4XA 3E2DA 2HYNA 3AEFC 1NAYA 3FGAD 3AEGC 1RF1A 1FR2A 1EZVD 2E75D 5AW9B 1LT9A 3CC7P 1JO5A 4GR6A 3VMXA 1RNIA 2HPCA 3O8ZA 3V2QA 3PRJA 1FOSE 2IZ1A 1HGZA 2IBZD 2NPSD 2GZEA 3A5TA 2WSFJ 2FQ1A 5F2OA 1Q82Q 1U7JA 3S4RA 4U3FG 1SQXG 2D2CC 3M0DA 1RH5B 1M1JA 3P32A 1YIJP 1GK4A 4JYCA 1MV8A 3DPHA 5KKZB 5L8RJ 1Y47A 2P67A 1GK6A 3P7KA 3SWYA 4A7PA 1YITP 2KUBA 1OVUA 2WPRA 2KODA 3A0BH 4OGQB 3VRLC 3L70G 4IFMA 3U1AA 1RQVA 1DIPA 2WSEH 4NPFX 2FYUE 1FZEA 3DS2A 3H6PA 1J1EC 5HV8A 2KZJA 5KLVJ 1IFMA 1LGHB 2YXRB 4H0LD 1X9VA 5AW3B 2M5RA 2LTEA 1KLPA 2KNCB 4CA3A 5TJHA 1LTBC 3KZIE 4IFDK 1VQMP 2XZ1C 5HGOA 2IYPA 2BQ1E 3H1KG 2Z5IA 1L4AD 3WUTA 2ZYDA 3S1KA 5AW0B 4M0IA 4NEOA 1VF5C 3H1HE 3L72J 1A8OA 2OYIB 3GG2A 4YXWH 1KQSO 2YKPA 2KORA 3MHVA 2KI7B 3SWFA 2RMZA 2GZFA 2LMLA 3L72D 1BE3E 2O01N 1G1JA 1SQPJ 5BVZA 4ASVA 5E79E 2JDIH 5EW5E 1BGYE 1MUUA 3BCCG 1AVOA 2JYGA 2MR7A 2FYUD 3A0HH 3DS0A 5GTIE 3MGNA 2PFXA 1FJKA 1EZVI 1FE6A 1KC8Q 2M5AA 2C9NY 1EDLA 2KOGA 1NQ4A 2IBZI 2CNRA 3H1HJ 4M3LA 2N5IA 1Q7YQ 5KAIH 4GT1A 1PPJG 1IMPA 3TNUA 4RKUJ 4IL6H 5GTHE 1MFZA 3JCUE 1FZGA 2M8PA 3H1HD 2XZRA 4DT0A 2E5TA 4ZNCA 1GW3A 4F37A 3RK2B 3G29A 1OW6A 1BGYJ 1S72P 3RL0g 2SPZA 1NU1J 4C7RA 1BE3D 4IFFA 1AV1A 2PEOA 1OZHA 5AW1B 1GTWA 1N7SA 1BGYD 2PGDA 5AVQB 3NMDA 3B5ND 2AXTH 1ZMBA 4H2YC 4N78D 2VLOA 2JU2A 1WT6A 2QIWA 1URQB 4AYCA 3H1JG 3RL0C 1OVRA 3GHGA 3G1IA 2Z4EA 1OW8A 2N1TC 5CCGD 2H8PD 1NTMG 1ZLLA 2ITAA 2IPPA 1KV4A 3EWKA 1NH4A 4U3FJ 3T97B 5KJ7A 2Z45A 1SQXJ 2FY8A 2C0WA 1NTZG 2ZVNB 4I6MC 3LW5H 1GDTA 2N5HA 1PP9E 4H13D 3L70J 5APTA 2B9BA 1AJYA 3CWBE 3V4WA 5TISH 2YNYA 2QA4P 1L0LE 2N6ZA 1CEIA 1JY2P 3HYBA 2XNXA 2AEJA 1OVVA 1EMVA 2KSEA 2PEIA 2KR5A 4GODA 5CCHA 1XTCC 4BRYB 2CPBA 2HODB 1K9MQ 1RF0C 1KILE 3H1KJ 3RGUA 3SSUA 1MKMA 2WVRA 3DS1A 2MF4A 2IFNA 1EDJA 1QL1A 1LT1A 4PV1B 2E74C 1RF1C 4N6JA 1LJ2A 1PGPA 3G0VA 2D2CB 3H0DA 1USEA 1PPJE 1LT9C 4UHPB 3AE5C 3BRTB 3NY7B 1PIXA 1VQNP 3WU2H 1KN7A 1VQ8P 2Q3EA 3L74E 1BCCG 3RL0D 3T97A 1L0LJ 2N1TD 3MZWB 1PP9D 2JO1A 2MR8A 3M0DC 1J1EB 3JSVC 2MD9A 3B4QA 2PP6A 2OTJP 2IX7C 1L0LD 1VQKP 1GL2D 3LIEA 5AVYB 2LXBA 2BEZF 2B89A 2JEEA 5K5GB 5I4TG 5KP8B 5HGMA 2PENA 3RK3E 2L91A 2WITA 1SFCB 3IFMA 1KILD 3CMAP 1YJNP 1X22A 3WUUA 1VF5B 1VHNA 1M8OB 3AE3C 3NTNA 1RHZB 1P84E 1VQ6P 3MD0A 2QJPB 1IK9A 3DS4A 1PPJD 4EOTA 5KTBA 1T3JA 4D6TG 2BEQD 1R5LA 1BDDA 1PGOA 4I2LC 2IFMA 2E76D 5F2KA 2E74D 3L74D 3SFDC 1VPCA 2XKMA 2PNGA 3L71G 2A45I 3BVHA 4CPGA 2FBWC 3E1RA 1S5LH 1EIAA 2WSCJ 1VQPP 4ZMDA 2H88C 5AW6B 3N4XA 4IOIH 4ZKUA 3D6ZA 1Q2NA 3H1JJ 4XE5B 2QRXA 2IBZG 1M6EX 1NTMJ 1LWUA 1L0LK 3RK3D 1GPJA 3FWNA 2GZIA 1SQQG 4O9BA 2KLUA 3PP5A 4EIJA 3DS3A 1MZ8A 3KDPB 2YIUC 2VRSA 1L0NE 3B5NA 4WY4B 1NTZJ 1SFCA 2PEJA 2VLNA 4GR2A 1P84D 2WTYA 3CCRP 5AW4B 3PTZA 3BATA 2YKOA 3VOPA 5CCGA 1BCCE 3CD6P 5B66H 2L4BA 2GUVA 3FXDA 3LIDA 3G6EP 1NOHA 2JKVA 3VN0A 3H1IE 2XZ0D 1AQTA 1PEMA 3IR9A 2FXOA 1JB0J 2V7QH 1ZR4A 2Q7CA 2Q1KA 4OVNF 1PZQA 3CC2P 1X8YA 3GHGC 2A06E 2FXPA 3CL3D 1L0ND 1BCCJ 4C7NA 5CBOA 4BXLA 1K73Q 4Y99B 1KYOH 5CJ0A 2LIWA 1IMQA 1DX7A 2E75C 1BCCD 3EFFK 2FYUG 2QEXP 3II6A 2R5BA 3C8VA 3MUDA 3R2PA 2NPSC 2GDYA 2N6YA 2FFDC 2QJYB 1M56D 2ZT9B 3AECC 5H2FE 2Q6QA 1NTZK 2XT1A 2M8RA 2Y0EA 1FC2C 4OH8B 1NHLA 1FZCA 2JU1A 4JPZB 5CCHC 2MJZA 3PLNA 4GKGA 3L35A 2N98A 1SQQE 2E43A 2H7HA 1CW5A 3D71A 4D6TJ 2WT7B 5F2NA 1P84I 2JJLA 2W83C 4PD4E 4H0LC 3O6QB 3L36A 1QGKB 1N7SD 2A06D 1CI6A 1LTTC 5KP7B 2KG9A 1EDKA 3I5CA 3L71J 1BE3G 1FZAA 4EYYQ 1GMJA 3KXDA 1A02F 1BGYG 1L0NK 3U59A 3HD7B 5APWA 1Q90D 3Q5PA 1L4AC 5B5EE 2WPVB 2LL8A 2GDWA 1F80D 3L71D 4WYMA 3FX0A 1KZUB 5KJ7D 1USDA 4RJTA 2WSFH 2H43A 4K35A 2M0BA 4U0EA 2I1JA 2PEMA 1SQQJ 2FVEA 3GW6A 1FJPA 2JO0A 5C39A 1H0TA 2BCCE 1A02J 1HBWA 4C46A 2L9FA 4L74A 4GOEA 1SQQD 3GZLA 4HYTB 1SVFA 3UIAA 2WPTA 3H32B 5HVCA 2FKWB 2XDJA 3A0BE 3VMZA 1NTKE 5AW2B 4PD4D 1LTJA 5CCHD 2RKLA 2GM4A 1KTMA 2W8ZA 2PY8A 1FOSF 2WT7A 1JNMA 2A45G 3HUSA 1DD3A 3KHUA 2B88A 4XFZA 1N73A 2KS1A 1LTIC 1VL2A 1U57A 5HGLA 3H1LE 2XV6A 2K88A 1VQ7P 4PH1A 5AVTB 1ZMEC 4W7YA 1HF9A 2P7JA 1ZN5A 1A43A 4H44B 3HD7A 2KB7P 2LOLA 2YIUB 5BU8B 1LTGC 2FYNC 2QJKC 1GXHA 1IFPA 2HR3A 2BCCD 1KQGB 2LR2A 1LWUC 3B8EB 4GDOA 1HTLC 1DD4A 1YQ4C 4LC1A 3A7OA 3AEDC 4GOFA 2FXMA 1PP9G 4B86A 5KP6B 4U0DA 3B5NC 2Z46A 2FYUJ 1NTKD 2FADA 2PAJA 3M0AA 1D7MA 3CWBG 1AUMA 3H32A 1SQQK 2IYOA 1L0LG 4WB4A 3M06A 2ONTA 3KPEA 5CCGC 2K5XA 1L2PA 2O3JA 1VKUA 3H1LD 2K93A 1RE4A 2OGUA 2AFEA 1MZ9A 4L73A 1KMIZ 2CQ8A 1H8AA 4YPCA 1T8ZA 5AVSB 5KAIE 4HKZH 1KORA 1ZRTE 4H13C 4UB8H 2AF8A 4IL6E 3V4QA 2KNCA 1YTZI 3CC4P 3LRYA 1KFMA 2K0YA 4ASWA 3AEEC 3L74G 4PD4I 1DNYA 3E1IA 1BE3J 1IFIA 4I7ZC 2QG4A 3CCUP 1JCCA 1FDMA 4XFXA 2OYIA 2KG6A 4R0MA 1AVYA 3RBZA 2FFDB 2FVFA 2P9XA 3V2RA 3Q1MA 2LIUA 5AW5B 1JY3P 2WPSA 1NTKK 3IF4A 3EJBA 5HGNA 1UIIA 1IZNB 3TYYA 2OYHC 2MY5A 1SFCD 3M9HA 4EI2A 1JY2N 2FYUK 2WQYC 4PJ0E 3R4YA 2DGYA 1OW7A 1ZRTD 2K1AA 4MN4C 2DNWA 4H0LB 1QVGO 2G3AA 1FZFA 3CX5E 4KJMA 5CHXA 1NYHA 5KAFE 1GL2C 3AE6C 1M7LA 2AEMA 2W6JH 1YHQP 1L4AB 3G28A 1R5SA 1IO4A 1KILC 3CCMP 1OIPA 3QWOC 2Y9YA 3SWKA 3MIWA 3AEBC 3I55P 1N86A 4L76A 4AUWA 1SP4A 1J2JB 1JOCA 3K5BA 3G3ZA 2E76C 4IZ6A 4XFYA 2YXQB 2K0XA 3CCLP 4WY4D 3DS5A 1L0NG 3WU2E 2CWOA 1VDFA 2Q5UA 4U0BA 1URQA 2JB0A 5JPAA 2QM7A 3CXHH 2GYKA 4WVZA 1G2CB 1PP9J 3B5IA 1IJDB 1AA0A 3ITKA 4WBAA 3CX5D 2NO8A 3CWBJ 2FACA 2P10A 1J1DC 1M1JC 2O1KA 3EJEA 3RK3C 1LTJC 3CWBD 1GZLA 1S9KE 2K94A 1GU4A 3HUSC 5M1BA 3CXCO 2C0XA 1N73C 3H1IG 3V6IA 1VQOP 1T8KA 4XROA 2X2BA 2QJKB 1NKZB 2C9LY 1FDIA 4BRYA 2HODA 4QKOA 3N7NA 3CCSP 2M3BA 1EXJA 2A06G 3L75E 2WSSH 3L74J 1Q81Q 2EFJA 2BHVA 2XXMA 1ZXGA 2WMMA 2B87B 3GJNA 2WSCH 2KZIA 2PEKA 3F89A 1S5LE 3EQ2A 2ZXEB 3NTEA 3ABVC 1KB9H 4UB6H 1NVOA 5AVRB 3CLQA 1S9KD 3EJDA 2MVUA 1YQ3C 3RG2A 3A3YB 1RO2A 1JY3O 1OFCX 5APQA 2ZJSE 1QX8A 3JC22 4QMAA 5KKZC 1YBKA 2YMKA 4OGQC 3L4FA 1E0HA 1SQBE 1RE4C 2R32A 3PHLA 2JGPA 1JTHB 3C9IA 2R5DA 2FQ2A 3Q5RA 1HJ0A 1YJ9P 2Y0CA 3HE4B 4I7ZB 1Y8AA 3L75D 3KYQA 3HE5B 3CX5I 1T2KC 3WBHA 2O01J 5B66E 2YO2A 5APSA 4DOJA 1UNKA 3HD7D 1SS1A 2OTKE 3L73E 1Q86Q 3U1CA 4L75A 4IL6X 5KLIC 2E1MA 1GW4A 4BPGA 1IC2A 2OYIC 5BS1A 2FQ0A 3H25A 1WRGA 1PL5A 1S3JA 3RL0B 1M57D 3G21A 2N1TB 1N7SC 2K3RA 4GIFA 1L0NJ 3HTKB 2BCCG 2CK3H 2WPQA 1R8EA 1BSHA 4XFJA 1SQBD 2LKIA 1UIXA 1KYOE 2KP8A 2OQQA 1L0IA 1NTKG 2AVAA 2YKQA 5KJ7C 2KW2A 2AXCA 4OGQD 3L73J 2LXCB 4WY4A 1GXGA 3PH0A 4BPHA 1HJBA 1M6NA 3AE4C 4JBZA 1QVFO 3MGEA 5AVVB 3H1LG 3H1IJ 3L73D 1IUQA 5AVZB 2LPKA 1T2KD 3VTPC 1K30A 2R3CA 3G4SP 1FS0E 1NAFA 2E76B 2E74B 3F5HA 3H1ID 1RF1B 3RK2C 2E5YA 2M8LA 1Y9BA 3Q20A 5CJ4A 3GZMA 1SQVG 3SFEC 2G8YA 1LT9B 2AFDA 1NO4A 1JJ2O 2HPCB 2I8DA 1OR5A 1WMKA 4NPEA 3V2PA 1PV3A 4U0AA 2L0QA 2ROQA 1KYOD 1CZQA 1NKNA 2PRRA 5APVA 1TU3F 3W67A 1URQC 2KOQA 1J1DB 1M1JB 3G71P 1ZV8A 3RK3B 4PXHB 1SQBK 1W2BO 4HKGA 4QNBA 2N9YB 2ERHA 3M9BA 1HQBA 4XA4A 4KHXA 2JAZA 4HB1A 2KSJA 2W6AA 5BU5A 2UWJE 1RF0A 3H4EA 3VMAA 3TSIA 2RH0A 3AEAC 2N50A 2QSIA 1BAJA 1QLED 2IZ0A 3IN6A 5CZDB 1KFNA 1PEOA 2KOPA 2KIKA 5KLVE 1ZP0C 2IDBA 5B5EH 2KK7A 3AE8C 3RK2D 5AVUB 1Z6MA 3EFGA 2JYLA 1YJWP 1D1DA 2L6EA 4PV1C 3V5BA 3O6QA 3V2NA 2MKVA 2KGEA 2K2QA 1OX3A 1U7MA 2W6BA 2ZYGA 3L72E 1RE3A 1HY8A 1PFIA 2ZFCA 4JF7A 1URQD 1CSBA 4YXDC 2BCCJ 1SQVE 2M5AB 1SQPE 4WWIA 4Y28J 1K05A 1S5LX 3FWLA 3AE1C 1VQ4P 4R4MA 1NTKJ 2O1JA 2WSEJ 3TNUB 2ZVOB 3CCQP 1KYOI 5KLVD 2AEFA 2BASA 3HRNA 1QRJA 4NPDA 2EIAA 2XV5A 3KZIH 2KWLA 2JWAA 3ZDMA 1SFCC 4Z1MH 3OA7A 3FXEA 3A0HE 2L5GB 4TLFA 2Q3IA 3H1LJ 2KGDA 5KLIB 4YTPC 1EQ7A 2I1KA 3BASA 2QJPC 3QH9A 1G1IA 3D70A 4I1LA 1N8RQ 1UJZA 1N7SB 4UB8E 1YI2P 2VLQA 1SQVJ 3RBXA 3E7KA 4PV1D 1JM0A 3TDKA 3M1MA 2P58A 3B71A 1K8AQ 2D2CD 1LTAC 3GHGB 1JY3N 1NU1E 1SQVD 2NZ2A 4N78E 5E79H 3CPWO 1X79B 1SQPD 2JQ4A 3CCJP 1VQLP 1AQ5A 3G26A 5GTIH 2GDXA 4H2XC 5APYA 2E75B 3OW2O 1RO0A 2KOSA 2K9JB 3P05A 1LTSC 2GZGA 3AE7C 2NPSB 1ZW0A 2FHSC 2XNDH 1FAVA 4DZOA 5KLVK 4XRQA 2AXTE 4U3FE 1PEUA 1SQXE 2KXPB 4TT3H 4WY4C 1JUNA 1IFNA 3KQGA 3AE2C 5GTHH 3CCEP 1AF8A 2VSQA 3JCUH 3MUDC 1NWQA 3Q5SA 3L70E 1E5WA 1HWTC 1BSNA 1X0TA 1VF5D 3MTUE 1MFTA 1BDCA 2P1JA 1VQ9P 3G9RA 1IFDA 2A45H 3WUVA 3P8MC 4KT0J 2QE7H 1FZCC 3L75G 1YTZT 5AVWB 1NU1D 3CCVP 1ZNVA 1RQUA 3H47A 2J59M 5TISE 2Q9IA 3G1GA 5EJDA 3H1KE 1SQVK 2XU6A 1SQPK 3M9QA 3GMAA 1X3OA 3BRVB 2KGCA 4PJ0H 3I56P 2K9JA 2OTLP 4U3FD 1SQXD 1GD2E 2HLOA 3NFQA 3CX5H 2NPSA 2KLVA 1ZR2A 2FFDA 5KAFH 4Y99C 3RG6C 2FVAA 4N3YB 1H89A 4COPA 3LW5J 3CXHE 5AVXB 3L70D 3BCCE 1SQBG 1JMMA 2LKMA 5CMZA 2KOOA 4LGDE 2EG5A 2QJYC 2ZT9C 1Z56A 1QEXA 1LNQA 3GF7A 3C1LA 1HUCA 2M3EA 3P8CE 2JR8A 3H1KD 1VQ5P 1XTGB 3L73G 1NU1K 1AFOA 2CG5B 4HJGH 2K37A 1T6AA 1EXIA 1L4AA 1NGMB 2JWDA 3USSA 3BCCJ 2OARA 4U7JA 2EHSA 2J58A 2FYNB 1RE3C 3Q3DA 4JQ0D 5AW7B 3CXHD 1LWUB 1SQXK 3HD7C 2Y0DA 3BCCD 3M91A 2GUSA 1IFJA 3B5NB 1OXZA 3H1JE 3TGUG 2W90A 4MRTC 1KB9E 1E79H 2W27A 3TF5A 4DJGA 4UB6E 1S2EA 1FDOA 1NTME 1G2CA 1GU5A 2KYVA 5DJTB 1YYCA 3P8CD 2ZYAA 3OAKA 3IAOA 2PEQA 2ZAEB 4EDFA 2ZT9D 1N7LA 1M90Q 3W68A 1W5CE 3U43A 1NTZE 1P84H 2N9BA 2POHA 1QL2A 1OMIA 4H13B 1E6JP 3S9OA 1ZOYC 2VLPA 1DV5A 2LF4A 1M1KQ 1PEQA 2Z44A 2EHTA 2R44A 2Y9ZA 2M8NA 1AYIA 1HVVA 2O01H 3L75J 1DEBA 1EZVG 4JYBA 3D6YA 5APUA 1H88A 2YO3A 2WZ7A 4DCKA 4U0CA 3A2AA 2V4HA 1LP1B 4H44C 4C7NB 2NRGA 2QNWA 1T3UA 3NXSA 2CPSA 3H1JD 2BUOA 1KB9D 3HZQA 5DCKA 1FBMA 2K9YA 1NTMD 2B87A 4LLHA 1K04A 3CI9A 1FU1A 2OYHB 2MVVA 3MP7B 1JMBA 1NTZD 5CBNA 3PJSK 3GF3A 2CGQA 3VP9A 7CEIA 4AQRD 5APXA 3DTJA 1SQBJ 4HH2A 1EC5A 1HGVA 2FAEA 2JBGA 1IK7A 2R3SA 1FZCB 1BXIA 3CXHI 3AE9C 1ACPA 4BPFA 1JY2O 5KLVG 1GL2B 5DJUB 3L37A 1JEKA 1KQLA 2QVAA 4RESB 4PWVB 3TGUE 1CI6B 1JTHA 1KILB 2ZXXA 4H2WC 3HE4A 3OJAB 1DEEG 2RN0A 3HE5A 4BWNA 1LP1A 3LMOA 2P2UA 3VMYA 1N2DC
chains in the Genus database with same CATH topology
1M1KQ 3DS0A 4COCA 1VQ6P 1PEMA 3CXCO 1KD1Q 1PEQA 2Z44A 2M8NA 4XRQA 2DGYA 4U0DA 5F2OA 3DS4A 2Z46A 4U0AA 2QA4P 4U0FA 1KC8Q 1VQOP 1PEUA 1Q82Q 4WYMA 1Q86Q 1QVGO 1AUMA 3HYBA 4XROA 3CCEP 1M74A 1VQ5P 2E1MA 5F2KA 2PEIA 3CC2P 4U0CA 4U0EA 3G71P 2ONTA 1VQ4P 1YIJP 1K9MQ 2PEMA 5BS1A 1Q7YQ 1W2BO 3DPHA 3CCQP 2JO0A 3G21A 3CCSP 1YITP 2KODA 3VRLC 4QNBA 1QRJA 1K73Q 1EIAA 1VQ9P 2EIAA 2BUOA 3DS1A 1YHQP 3G28A 3HZQA 1Q81Q 2M8PA 2EFJA 5DCKA 1VQPP 2BHVA 2XXMA 3CCMP 3DS2A 2OARA 3G0VA 3CCVP 2QEXP 3H0DA 3G29A 2PEKA 1S72P 3H47A 3CC4P 1M6EX 3LRYA 3H4EA 3I55P 2PY8A 3NTEA 3G1GA 1RNIA 1VQMP 1BAJA 1VQNP 1VQ8P 2PEOA 1NJIQ 3DTJA 2XT1A 1N8RQ 4XFZA 3DS3A 5HGOA 2BQ1E 1PEOA 4IPYA 1YI2P 4XFYA 3I56P 5HGLA 4PH0A 2PEJA 3CCLP 4GR2A 2XV6A 1ZMBA 3DS5A 3M1MA 4M0IA 3CCUP 1M6NA 4PH1A 1VQ7P 2OTLP 2CWOA 1K8AQ 4U0BA 1QVFO 1RO2A 5JPAA 2OTJP 4XFXA 3MGEA 3CCRP 1A8OA 3CMEP 1VQKP 3G1IA 1A43A 3B5IA 1EOQA 1IUQA 3CPWO 5BS2A 3CD6P 2JYLA 2P9XA 3RG6C 1YJWP 1KQSO 3CCJP 1K30A 2PEQA 5F2NA 1VQLP 4COPA 1D1DA 2L6EA 1M90Q 1JJ2O 3G26A 5I4TG 3E2DA 2Z45A 5HGMA 3G4SP 2PENA 2M8LA 5HGNA 3Q20A 3G6EP 3CMAP 1YJ9P 1YJNP 3OW2O 1RO0A 1E6JP 3P05A 2JYGA 3WBHA 2EG5A 3CC7P 4GR6A 2LF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K Q;  3CCQ P;  3CCS P;  1VQM P;  1YIT P;  3CPW O;  1VQ6 P;  3CD6 P;  3CXC O;  1KD1 Q;  1VQN P;  1VQ8 P;  1YJW P;  1KQS O;  3CCJ P;  1NJI Q;  1K73 Q;  1N8R Q;  1VQ9 P;  1VQL P;  1VQK P;  1YHQ P;  1M90 Q;  2QA4 P;  1Q81 Q;  1KC8 Q;  1VQP P;  1VQO P;  1YI2 P;  3G4S P;  1Q82 Q;  1Q86 Q;  3CCM P;  1QVG O;  3I56 P;  3CCE P;  3CCL P;  3G6E P;  3CCV P;  2QEX P;  1VQ5 P;  3CMA P;  1YJ9 P;  1YJN P;  3OW2 O;  3CCU P;  1VQ7 P;  3CC2 P;  2OTL P;  3G71 P;  1K8A Q;  1VQ4 P;  1QVF O;  1YIJ P;  1S72 P;  1K9M Q;  3CC4 P;  2OTJ P;  3CCR P;  1Q7Y Q;  3CME P;  3CC7 P;  3I55 P;  1W2B O;  1JJ2 O; 
#chains in the Genus database with same CATH topology
 4COC A;  3VP8 A;  1RY3 A;  2YMY A;  1DH3 A;  2V7Q J;  4D6T E;  3CE7 A;  1KD1 Q;  3L72 G;  2K0D X;  2K92 A;  4H44 D;  4U0F A;  4K3A A;  2KG8 A;  1NTM K;  1M74 A;  3TK1 A;  3L71 E;  1W2E A;  2OYH A;  4R4L A;  1PGJ A;  1SQP G;  2J5U A;  3B4S A;  2DW3 A;  1EZV E;  4DG9 A;  1SLQ A;  1H0T B;  2N1T A;  2GZJ A;  3GLM A;  2H89 C;  2KGA A;  4W7Z A;  3TGU J;  2FYZ A;  3HTK A;  5H2F H;  2IBZ E;  4RO0 A;  2Z5H A;  2HG5 D;  3GKL C;  1KQF B;  1HH0 A;  1OWA A;  2HFE D;  1GL2 A;  1EDI A;  1KB9 I;  1LTJ B;  3TGU D;  3H1H G;  1NJI Q;  3HUS B;  1N73 B;  2KS1 B;  4IPY A;  4ZKP A;  1KIL A;  4PH0 A;  1L0H A;  5EFW B;  2L22 A;  1FZB A;  2WWW A;  4D6T D;  1PGQ A;  4PD4 H;  4OWF A;  3VYI A;  3Q2Y A;  2JP3 A;  1JCD A;  2GA1 A;  2E42 A;  3CME P;  1EOQ A;  2QM8 A;  5BS2 A;  5AW8 B;  2OYO A;  4W80 A;  3WMM 0;  1S1C X;  1NU1 G;  1S4X A;  3E2D A;  2HYN A;  3AEF C;  1NAY A;  3FGA D;  3AEG C;  1RF1 A;  1FR2 A;  1EZV D;  2E75 D;  5AW9 B;  1LT9 A;  3CC7 P;  1JO5 A;  4GR6 A;  3VMX A;  1RNI A;  2HPC A;  3O8Z A;  3V2Q A;  3PRJ A;  1FOS E;  2IZ1 A;  1HGZ A;  2IBZ D;  2NPS D;  2GZE A;  3A5T A;  2WSF J;  2FQ1 A;  5F2O A;  1Q82 Q;  1U7J A;  3S4R A;  4U3F G;  1SQX G;  2D2C C;  3M0D A;  1RH5 B;  1M1J A;  3P32 A;  1YIJ P;  1GK4 A;  4JYC A;  1MV8 A;  3DPH A;  5KKZ B;  5L8R J;  1Y47 A;  2P67 A;  1GK6 A;  3P7K A;  3SWY A;  4A7P A;  1YIT P;  2KUB A;  1OVU A;  2WPR A;  2KOD A;  3A0B H;  4OGQ B;  3VRL C;  3L70 G;  4IFM A;  3U1A A;  1RQV A;  1DIP A;  2WSE H;  4NPF X;  2FYU E;  1FZE A;  3DS2 A;  3H6P A;  1J1E C;  5HV8 A;  2KZJ A;  5KLV J;  1IFM A;  1LGH B;  2YXR B;  4H0L D;  1X9V A;  5AW3 B;  2M5R A;  2LTE A;  1KLP A;  2KNC B;  4CA3 A;  5TJH A;  1LTB C;  3KZI E;  4IFD K;  1VQM P;  2XZ1 C;  5HGO A;  2IYP A;  2BQ1 E;  3H1K G;  2Z5I A;  1L4A D;  3WUT A;  2ZYD A;  3S1K A;  5AW0 B;  4M0I A;  4NEO A;  1VF5 C;  3H1H E;  3L72 J;  1A8O A;  2OYI B;  3GG2 A;  4YXW H;  1KQS O;  2YKP A;  2KOR A;  3MHV A;  2KI7 B;  3SWF A;  2RMZ A;  2GZF A;  2LML A;  3L72 D;  1BE3 E;  2O01 N;  1G1J A;  1SQP J;  5BVZ A;  4ASV A;  5E79 E;  2JDI H;  5EW5 E;  1BGY E;  1MUU A;  3BCC G;  1AVO A;  2JYG A;  2MR7 A;  2FYU D;  3A0H H;  3DS0 A;  5GTI E;  3MGN A;  2PFX A;  1FJK A;  1EZV I;  1FE6 A;  1KC8 Q;  2M5A A;  2C9N Y;  1EDL A;  2KOG A;  1NQ4 A;  2IBZ I;  2CNR A;  3H1H J;  4M3L A;  2N5I A;  1Q7Y Q;  5KAI H;  4GT1 A;  1PPJ G;  1IMP A;  3TNU A;  4RKU J;  4IL6 H;  5GTH E;  1MFZ A;  3JCU E;  1FZG A;  2M8P A;  3H1H D;  2XZR A;  4DT0 A;  2E5T A;  4ZNC A;  1GW3 A;  4F37 A;  3RK2 B;  3G29 A;  1OW6 A;  1BGY J;  1S72 P;  3RL0 g;  2SPZ A;  1NU1 J;  4C7R A;  1BE3 D;  4IFF A;  1AV1 A;  2PEO A;  1OZH A;  5AW1 B;  1GTW A;  1N7S A;  1BGY D;  2PGD A;  5AVQ B;  3NMD A;  3B5N D;  2AXT H;  1ZMB A;  4H2Y C;  4N78 D;  2VLO A;  2JU2 A;  1WT6 A;  2QIW A;  1URQ B;  4AYC A;  3H1J G;  3RL0 C;  1OVR A;  3GHG A;  3G1I A;  2Z4E A;  1OW8 A;  2N1T C;  5CCG D;  2H8P D;  1NTM G;  1ZLL A;  2ITA A;  2IPP A;  1KV4 A;  3EWK A;  1NH4 A;  4U3F J;  3T97 B;  5KJ7 A;  2Z45 A;  1SQX J;  2FY8 A;  2C0W A;  1NTZ G;  2ZVN B;  4I6M C;  3LW5 H;  1GDT A;  2N5H A;  1PP9 E;  4H13 D;  3L70 J;  5APT A;  2B9B A;  1AJY A;  3CWB E;  3V4W A;  5TIS H;  2YNY A;  2QA4 P;  1L0L E;  2N6Z A;  1CEI A;  1JY2 P;  3HYB A;  2XNX A;  2AEJ A;  1OVV A;  1EMV A;  2KSE A;  2PEI A;  2KR5 A;  4GOD A;  5CCH A;  1XTC C;  4BRY B;  2CPB A;  2HOD B;  1K9M Q;  1RF0 C;  1KIL E;  3H1K J;  3RGU A;  3SSU A;  1MKM A;  2WVR A;  3DS1 A;  2MF4 A;  2IFN A;  1EDJ A;  1QL1 A;  1LT1 A;  4PV1 B;  2E74 C;  1RF1 C;  4N6J A;  1LJ2 A;  1PGP A;  3G0V A;  2D2C B;  3H0D A;  1USE A;  1PPJ E;  1LT9 C;  4UHP B;  3AE5 C;  3BRT B;  3NY7 B;  1PIX A;  1VQN P;  3WU2 H;  1KN7 A;  1VQ8 P;  2Q3E A;  3L74 E;  1BCC G;  3RL0 D;  3T97 A;  1L0L J;  2N1T D;  3MZW B;  1PP9 D;  2JO1 A;  2MR8 A;  3M0D C;  1J1E B;  3JSV C;  2MD9 A;  3B4Q A;  2PP6 A;  2OTJ P;  2IX7 C;  1L0L D;  1VQK P;  1GL2 D;  3LIE A;  5AVY B;  2LXB A;  2BEZ F;  2B89 A;  2JEE A;  5K5G B;  5I4T G;  5KP8 B;  5HGM A;  2PEN A;  3RK3 E;  2L91 A;  2WIT A;  1SFC B;  3IFM A;  1KIL D;  3CMA P;  1YJN P;  1X22 A;  3WUU A;  1VF5 B;  1VHN A;  1M8O B;  3AE3 C;  3NTN A;  1RHZ B;  1P84 E;  1VQ6 P;  3MD0 A;  2QJP B;  1IK9 A;  3DS4 A;  1PPJ D;  4EOT A;  5KTB A;  1T3J A;  4D6T G;  2BEQ D;  1R5L A;  1BDD A;  1PGO A;  4I2L C;  2IFM A;  2E76 D;  5F2K A;  2E74 D;  3L74 D;  3SFD C;  1VPC A;  2XKM A;  2PNG A;  3L71 G;  2A45 I;  3BVH A;  4CPG A;  2FBW C;  3E1R A;  1S5L H;  1EIA A;  2WSC J;  1VQP P;  4ZMD A;  2H88 C;  5AW6 B;  3N4X A;  4IOI H;  4ZKU A;  3D6Z A;  1Q2N A;  3H1J J;  4XE5 B;  2QRX A;  2IBZ G;  1M6E X;  1NTM J;  1LWU A;  1L0L K;  3RK3 D;  1GPJ A;  3FWN A;  2GZI A;  1SQQ G;  4O9B A;  2KLU A;  3PP5 A;  4EIJ A;  3DS3 A;  1MZ8 A;  3KDP B;  2YIU C;  2VRS A;  1L0N E;  3B5N A;  4WY4 B;  1NTZ J;  1SFC A;  2PEJ A;  2VLN A;  4GR2 A;  1P84 D;  2WTY A;  3CCR P;  5AW4 B;  3PTZ A;  3BAT A;  2YKO A;  3VOP A;  5CCG A;  1BCC E;  3CD6 P;  5B66 H;  2L4B A;  2GUV A;  3FXD A;  3LID A;  3G6E P;  1NOH A;  2JKV A;  3VN0 A;  3H1I E;  2XZ0 D;  1AQT A;  1PEM A;  3IR9 A;  2FXO A;  1JB0 J;  2V7Q H;  1ZR4 A;  2Q7C A;  2Q1K A;  4OVN F;  1PZQ A;  3CC2 P;  1X8Y A;  3GHG C;  2A06 E;  2FXP A;  3CL3 D;  1L0N D;  1BCC J;  4C7N A;  5CBO A;  4BXL A;  1K73 Q;  4Y99 B;  1KYO H;  5CJ0 A;  2LIW A;  1IMQ A;  1DX7 A;  2E75 C;  1BCC D;  3EFF K;  2FYU G;  2QEX P;  3II6 A;  2R5B A;  3C8V A;  3MUD A;  3R2P A;  2NPS C;  2GDY A;  2N6Y A;  2FFD C;  2QJY B;  1M56 D;  2ZT9 B;  3AEC C;  5H2F E;  2Q6Q A;  1NTZ K;  2XT1 A;  2M8R A;  2Y0E A;  1FC2 C;  4OH8 B;  1NHL A;  1FZC A;  2JU1 A;  4JPZ B;  5CCH C;  2MJZ A;  3PLN A;  4GKG A;  3L35 A;  2N98 A;  1SQQ E;  2E43 A;  2H7H A;  1CW5 A;  3D71 A;  4D6T J;  2WT7 B;  5F2N A;  1P84 I;  2JJL A;  2W83 C;  4PD4 E;  4H0L C;  3O6Q B;  3L36 A;  1QGK B;  1N7S D;  2A06 D;  1CI6 A;  1LTT C;  5KP7 B;  2KG9 A;  1EDK A;  3I5C A;  3L71 J;  1BE3 G;  1FZA A;  4EYY Q;  1GMJ A;  3KXD A;  1A02 F;  1BGY G;  1L0N K;  3U59 A;  3HD7 B;  5APW A;  1Q90 D;  3Q5P A;  1L4A C;  5B5E E;  2WPV B;  2LL8 A;  2GDW A;  1F80 D;  3L71 D;  4WYM A;  3FX0 A;  1KZU B;  5KJ7 D;  1USD A;  4RJT A;  2WSF H;  2H43 A;  4K35 A;  2M0B A;  4U0E A;  2I1J A;  2PEM A;  1SQQ J;  2FVE A;  3GW6 A;  1FJP A;  2JO0 A;  5C39 A;  1H0T A;  2BCC E;  1A02 J;  1HBW A;  4C46 A;  2L9F A;  4L74 A;  4GOE A;  1SQQ D;  3GZL A;  4HYT B;  1SVF A;  3UIA A;  2WPT A;  3H32 B;  5HVC A;  2FKW B;  2XDJ A;  3A0B E;  3VMZ A;  1NTK E;  5AW2 B;  4PD4 D;  1LTJ A;  5CCH D;  2RKL A;  2GM4 A;  1KTM A;  2W8Z A;  2PY8 A;  1FOS F;  2WT7 A;  1JNM A;  2A45 G;  3HUS A;  1DD3 A;  3KHU A;  2B88 A;  4XFZ A;  1N73 A;  2KS1 A;  1LTI C;  1VL2 A;  1U57 A;  5HGL A;  3H1L E;  2XV6 A;  2K88 A;  1VQ7 P;  4PH1 A;  5AVT B;  1ZME C;  4W7Y A;  1HF9 A;  2P7J A;  1ZN5 A;  1A43 A;  4H44 B;  3HD7 A;  2KB7 P;  2LOL A;  2YIU B;  5BU8 B;  1LTG C;  2FYN C;  2QJK C;  1GXH A;  1IFP A;  2HR3 A;  2BCC D;  1KQG B;  2LR2 A;  1LWU C;  3B8E B;  4GDO A;  1HTL C;  1DD4 A;  1YQ4 C;  4LC1 A;  3A7O A;  3AED C;  4GOF A;  2FXM A;  1PP9 G;  4B86 A;  5KP6 B;  4U0D A;  3B5N C;  2Z46 A;  2FYU J;  1NTK D;  2FAD A;  2PAJ A;  3M0A A;  1D7M A;  3CWB G;  1AUM A;  3H32 A;  1SQQ K;  2IYO A;  1L0L G;  4WB4 A;  3M06 A;  2ONT A;  3KPE A;  5CCG C;  2K5X A;  1L2P A;  2O3J A;  1VKU A;  3H1L D;  2K93 A;  1RE4 A;  2OGU A;  2AFE A;  1MZ9 A;  4L73 A;  1KMI Z;  2CQ8 A;  1H8A A;  4YPC A;  1T8Z A;  5AVS B;  5KAI E;  4HKZ H;  1KOR A;  1ZRT E;  4H13 C;  4UB8 H;  2AF8 A;  4IL6 E;  3V4Q A;  2KNC A;  1YTZ I;  3CC4 P;  3LRY A;  1KFM A;  2K0Y A;  4ASW A;  3AEE C;  3L74 G;  4PD4 I;  1DNY A;  3E1I A;  1BE3 J;  1IFI A;  4I7Z C;  2QG4 A;  3CCU P;  1JCC A;  1FDM A;  4XFX A;  2OYI A;  2KG6 A;  4R0M A;  1AVY A;  3RBZ A;  2FFD B;  2FVF A;  2P9X A;  3V2R A;  3Q1M A;  2LIU A;  5AW5 B;  1JY3 P;  2WPS A;  1NTK K;  3IF4 A;  3EJB A;  5HGN A;  1UII A;  1IZN B;  3TYY A;  2OYH C;  2MY5 A;  1SFC D;  3M9H A;  4EI2 A;  1JY2 N;  2FYU K;  2WQY C;  4PJ0 E;  3R4Y A;  2DGY A;  1OW7 A;  1ZRT D;  2K1A A;  4MN4 C;  2DNW A;  4H0L B;  1QVG O;  2G3A A;  1FZF A;  3CX5 E;  4KJM A;  5CHX A;  1NYH A;  5KAF E;  1GL2 C;  3AE6 C;  1M7L A;  2AEM A;  2W6J H;  1YHQ P;  1L4A B;  3G28 A;  1R5S A;  1IO4 A;  1KIL C;  3CCM P;  1OIP A;  3QWO C;  2Y9Y A;  3SWK A;  3MIW A;  3AEB C;  3I55 P;  1N86 A;  4L76 A;  4AUW A;  1SP4 A;  1J2J B;  1JOC A;  3K5B A;  3G3Z A;  2E76 C;  4IZ6 A;  4XFY A;  2YXQ B;  2K0X A;  3CCL P;  4WY4 D;  3DS5 A;  1L0N G;  3WU2 E;  2CWO A;  1VDF A;  2Q5U A;  4U0B A;  1URQ A;  2JB0 A;  5JPA A;  2QM7 A;  3CXH H;  2GYK A;  4WVZ A;  1G2C B;  1PP9 J;  3B5I A;  1IJD B;  1AA0 A;  3ITK A;  4WBA A;  3CX5 D;  2NO8 A;  3CWB J;  2FAC A;  2P10 A;  1J1D C;  1M1J C;  2O1K A;  3EJE A;  3RK3 C;  1LTJ C;  3CWB D;  1GZL A;  1S9K E;  2K94 A;  1GU4 A;  3HUS C;  5M1B A;  3CXC O;  2C0X A;  1N73 C;  3H1I G;  3V6I A;  1VQO P;  1T8K A;  4XRO A;  2X2B A;  2QJK B;  1NKZ B;  2C9L Y;  1FDI A;  4BRY A;  2HOD A;  4QKO A;  3N7N A;  3CCS P;  2M3B A;  1EXJ A;  2A06 G;  3L75 E;  2WSS H;  3L74 J;  1Q81 Q;  2EFJ A;  2BHV A;  2XXM A;  1ZXG A;  2WMM A;  2B87 B;  3GJN A;  2WSC H;  2KZI A;  2PEK A;  3F89 A;  1S5L E;  3EQ2 A;  2ZXE B;  3NTE A;  3ABV C;  1KB9 H;  4UB6 H;  1NVO A;  5AVR B;  3CLQ A;  1S9K D;  3EJD A;  2MVU A;  1YQ3 C;  3RG2 A;  3A3Y B;  1RO2 A;  1JY3 O;  1OFC X;  5APQ A;  2ZJS E;  1QX8 A;  3JC2 2;  4QMA A;  5KKZ C;  1YBK A;  2YMK A;  4OGQ C;  3L4F A;  1E0H A;  1SQB E;  1RE4 C;  2R32 A;  3PHL A;  2JGP A;  1JTH B;  3C9I A;  2R5D A;  2FQ2 A;  3Q5R A;  1HJ0 A;  1YJ9 P;  2Y0C A;  3HE4 B;  4I7Z B;  1Y8A A;  3L75 D;  3KYQ A;  3HE5 B;  3CX5 I;  1T2K C;  3WBH A;  2O01 J;  5B66 E;  2YO2 A;  5APS A;  4DOJ A;  1UNK A;  3HD7 D;  1SS1 A;  2OTK E;  3L73 E;  1Q86 Q;  3U1C A;  4L75 A;  4IL6 X;  5KLI C;  2E1M A;  1GW4 A;  4BPG A;  1IC2 A;  2OYI C;  5BS1 A;  2FQ0 A;  3H25 A;  1WRG A;  1PL5 A;  1S3J A;  3RL0 B;  1M57 D;  3G21 A;  2N1T B;  1N7S C;  2K3R A;  4GIF A;  1L0N J;  3HTK B;  2BCC G;  2CK3 H;  2WPQ A;  1R8E A;  1BSH A;  4XFJ A;  1SQB D;  2LKI A;  1UIX A;  1KYO E;  2KP8 A;  2OQQ A;  1L0I A;  1NTK G;  2AVA A;  2YKQ A;  5KJ7 C;  2KW2 A;  2AXC A;  4OGQ D;  3L73 J;  2LXC B;  4WY4 A;  1GXG A;  3PH0 A;  4BPH A;  1HJB A;  1M6N A;  3AE4 C;  4JBZ A;  1QVF O;  3MGE A;  5AVV B;  3H1L G;  3H1I J;  3L73 D;  1IUQ A;  5AVZ B;  2LPK A;  1T2K D;  3VTP C;  1K30 A;  2R3C A;  3G4S P;  1FS0 E;  1NAF A;  2E76 B;  2E74 B;  3F5H A;  3H1I D;  1RF1 B;  3RK2 C;  2E5Y A;  2M8L A;  1Y9B A;  3Q20 A;  5CJ4 A;  3GZM A;  1SQV G;  3SFE C;  2G8Y A;  1LT9 B;  2AFD A;  1NO4 A;  1JJ2 O;  2HPC B;  2I8D A;  1OR5 A;  1WMK A;  4NPE A;  3V2P A;  1PV3 A;  4U0A A;  2L0Q A;  2ROQ A;  1KYO D;  1CZQ A;  1NKN A;  2PRR A;  5APV A;  1TU3 F;  3W67 A;  1URQ C;  2KOQ A;  1J1D B;  1M1J B;  3G71 P;  1ZV8 A;  3RK3 B;  4PXH B;  1SQB K;  1W2B O;  4HKG A;  4QNB A;  2N9Y B;  2ERH A;  3M9B A;  1HQB A;  4XA4 A;  4KHX A;  2JAZ A;  4HB1 A;  2KSJ A;  2W6A A;  5BU5 A;  2UWJ E;  1RF0 A;  3H4E A;  3VMA A;  3TSI A;  2RH0 A;  3AEA C;  2N50 A;  2QSI A;  1BAJ A;  1QLE D;  2IZ0 A;  3IN6 A;  5CZD B;  1KFN A;  1PEO A;  2KOP A;  2KIK A;  5KLV E;  1ZP0 C;  2IDB A;  5B5E H;  2KK7 A;  3AE8 C;  3RK2 D;  5AVU B;  1Z6M A;  3EFG A;  2JYL A;  1YJW P;  1D1D A;  2L6E A;  4PV1 C;  3V5B A;  3O6Q A;  3V2N A;  2MKV A;  2KGE A;  2K2Q A;  1OX3 A;  1U7M A;  2W6B A;  2ZYG A;  3L72 E;  1RE3 A;  1HY8 A;  1PFI A;  2ZFC A;  4JF7 A;  1URQ D;  1CSB A;  4YXD C;  2BCC J;  1SQV E;  2M5A B;  1SQP E;  4WWI A;  4Y28 J;  1K05 A;  1S5L X;  3FWL A;  3AE1 C;  1VQ4 P;  4R4M A;  1NTK J;  2O1J A;  2WSE J;  3TNU B;  2ZVO B;  3CCQ P;  1KYO I;  5KLV D;  2AEF A;  2BAS A;  3HRN A;  1QRJ A;  4NPD A;  2EIA A;  2XV5 A;  3KZI H;  2KWL A;  2JWA A;  3ZDM A;  1SFC C;  4Z1M H;  3OA7 A;  3FXE A;  3A0H E;  2L5G B;  4TLF A;  2Q3I A;  3H1L J;  2KGD A;  5KLI B;  4YTP C;  1EQ7 A;  2I1K A;  3BAS A;  2QJP C;  3QH9 A;  1G1I A;  3D70 A;  4I1L A;  1N8R Q;  1UJZ A;  1N7S B;  4UB8 E;  1YI2 P;  2VLQ A;  1SQV J;  3RBX A;  3E7K A;  4PV1 D;  1JM0 A;  3TDK A;  3M1M A;  2P58 A;  3B71 A;  1K8A Q;  2D2C D;  1LTA C;  3GHG B;  1JY3 N;  1NU1 E;  1SQV D;  2NZ2 A;  4N78 E;  5E79 H;  3CPW O;  1X79 B;  1SQP D;  2JQ4 A;  3CCJ P;  1VQL P;  1AQ5 A;  3G26 A;  5GTI H;  2GDX A;  4H2X C;  5APY A;  2E75 B;  3OW2 O;  1RO0 A;  2KOS A;  2K9J B;  3P05 A;  1LTS C;  2GZG A;  3AE7 C;  2NPS B;  1ZW0 A;  2FHS C;  2XND H;  1FAV A;  4DZO A;  5KLV K;  4XRQ A;  2AXT E;  4U3F E;  1PEU A;  1SQX E;  2KXP B;  4TT3 H;  4WY4 C;  1JUN A;  1IFN A;  3KQG A;  3AE2 C;  5GTH H;  3CCE P;  1AF8 A;  2VSQ A;  3JCU H;  3MUD C;  1NWQ A;  3Q5S A;  3L70 E;  1E5W A;  1HWT C;  1BSN A;  1X0T A;  1VF5 D;  3MTU E;  1MFT A;  1BDC A;  2P1J A;  1VQ9 P;  3G9R A;  1IFD A;  2A45 H;  3WUV A;  3P8M C;  4KT0 J;  2QE7 H;  1FZC C;  3L75 G;  1YTZ T;  5AVW B;  1NU1 D;  3CCV P;  1ZNV A;  1RQU A;  3H47 A;  2J59 M;  5TIS E;  2Q9I A;  3G1G A;  5EJD A;  3H1K E;  1SQV K;  2XU6 A;  1SQP K;  3M9Q A;  3GMA A;  1X3O A;  3BRV B;  2KGC A;  4PJ0 H;  3I56 P;  2K9J A;  2OTL P;  4U3F D;  1SQX D;  1GD2 E;  2HLO A;  3NFQ A;  3CX5 H;  2NPS A;  2KLV A;  1ZR2 A;  2FFD A;  5KAF H;  4Y99 C;  3RG6 C;  2FVA A;  4N3Y B;  1H89 A;  4COP A;  3LW5 J;  3CXH E;  5AVX B;  3L70 D;  3BCC E;  1SQB G;  1JMM A;  2LKM A;  5CMZ A;  2KOO A;  4LGD E;  2EG5 A;  2QJY C;  2ZT9 C;  1Z56 A;  1QEX A;  1LNQ A;  3GF7 A;  3C1L A;  1HUC A;  2M3E A;  3P8C E;  2JR8 A;  3H1K D;  1VQ5 P;  1XTG B;  3L73 G;  1NU1 K;  1AFO A;  2CG5 B;  4HJG H;  2K37 A;  1T6A A;  1EXI A;  1L4A A;  1NGM B;  2JWD A;  3USS A;  3BCC J;  2OAR A;  4U7J A;  2EHS A;  2J58 A;  2FYN B;  1RE3 C;  3Q3D A;  4JQ0 D;  5AW7 B;  3CXH D;  1LWU B;  1SQX K;  3HD7 C;  2Y0D A;  3BCC D;  3M91 A;  2GUS A;  1IFJ A;  3B5N B;  1OXZ A;  3H1J E;  3TGU G;  2W90 A;  4MRT C;  1KB9 E;  1E79 H;  2W27 A;  3TF5 A;  4DJG A;  4UB6 E;  1S2E A;  1FDO A;  1NTM E;  1G2C A;  1GU5 A;  2KYV A;  5DJT B;  1YYC A;  3P8C D;  2ZYA A;  3OAK A;  3IAO A;  2PEQ A;  2ZAE B;  4EDF A;  2ZT9 D;  1N7L A;  1M90 Q;  3W68 A;  1W5C E;  3U43 A;  1NTZ E;  1P84 H;  2N9B A;  2POH A;  1QL2 A;  1OMI A;  4H13 B;  1E6J P;  3S9O A;  1ZOY C;  2VLP A;  1DV5 A;  2LF4 A;  1M1K Q;  1PEQ A;  2Z44 A;  2EHT A;  2R44 A;  2Y9Z A;  2M8N A;  1AYI A;  1HVV A;  2O01 H;  3L75 J;  1DEB A;  1EZV G;  4JYB A;  3D6Y A;  5APU A;  1H88 A;  2YO3 A;  2WZ7 A;  4DCK A;  4U0C A;  3A2A A;  2V4H A;  1LP1 B;  4H44 C;  4C7N B;  2NRG A;  2QNW A;  1T3U A;  3NXS A;  2CPS A;  3H1J D;  2BUO A;  1KB9 D;  3HZQ A;  5DCK A;  1FBM A;  2K9Y A;  1NTM D;  2B87 A;  4LLH A;  1K04 A;  3CI9 A;  1FU1 A;  2OYH B;  2MVV A;  3MP7 B;  1JMB A;  1NTZ D;  5CBN A;  3PJS K;  3GF3 A;  2CGQ A;  3VP9 A;  7CEI A;  4AQR D;  5APX A;  3DTJ A;  1SQB J;  4HH2 A;  1EC5 A;  1HGV A;  2FAE A;  2JBG A;  1IK7 A;  2R3S A;  1FZC B;  1BXI A;  3CXH I;  3AE9 C;  1ACP A;  4BPF A;  1JY2 O;  5KLV G;  1GL2 B;  5DJU B;  3L37 A;  1JEK A;  1KQL A;  2QVA A;  4RES B;  4PWV B;  3TGU E;  1CI6 B;  1JTH A;  1KIL B;  2ZXX A;  4H2W C;  3HE4 A;  3OJA B;  1DEE G;  2RN0 A;  3HE5 A;  4BWN A;  1LP1 A;  3LMO A;  2P2U A;  3VMY A;  1N2D C; 
#chains in the Genus database with same CATH homology
 1M1K Q;  3DS0 A;  4COC A;  1VQ6 P;  1PEM A;  3CXC O;  1KD1 Q;  1PEQ A;  2Z44 A;  2M8N A;  4XRQ A;  2DGY A;  4U0D A;  5F2O A;  3DS4 A;  2Z46 A;  4U0A A;  2QA4 P;  4U0F A;  1KC8 Q;  1VQO P;  1PEU A;  1Q82 Q;  4WYM A;  1Q86 Q;  1QVG O;  1AUM A;  3HYB A;  4XRO A;  3CCE P;  1M74 A;  1VQ5 P;  2E1M A;  5F2K A;  2PEI A;  3CC2 P;  4U0C A;  4U0E A;  3G71 P;  2ONT A;  1VQ4 P;  1YIJ P;  1K9M Q;  2PEM A;  5BS1 A;  1Q7Y Q;  1W2B O;  3DPH A;  3CCQ P;  2JO0 A;  3G21 A;  3CCS P;  1YIT P;  2KOD A;  3VRL C;  4QNB A;  1QRJ A;  1K73 Q;  1EIA A;  1VQ9 P;  2EIA A;  2BUO A;  3DS1 A;  1YHQ P;  3G28 A;  3HZQ A;  1Q81 Q;  2M8P A;  2EFJ A;  5DCK A;  1VQP P;  2BHV A;  2XXM A;  3CCM P;  3DS2 A;  2OAR A;  3G0V A;  3CCV P;  2QEX P;  3H0D A;  3G29 A;  2PEK A;  1S72 P;  3H47 A;  3CC4 P;  1M6E X;  3LRY A;  3H4E A;  3I55 P;  2PY8 A;  3NTE A;  3G1G A;  1RNI A;  1VQM P;  1BAJ A;  1VQN P;  1VQ8 P;  2PEO A;  1NJI Q;  3DTJ A;  2XT1 A;  1N8R Q;  4XFZ A;  3DS3 A;  5HGO A;  2BQ1 E;  1PEO A;  4IPY A;  1YI2 P;  4XFY A;  3I56 P;  5HGL A;  4PH0 A;  2PEJ A;  3CCL P;  4GR2 A;  2XV6 A;  1ZMB A;  3DS5 A;  3M1M A;  4M0I A;  3CCU P;  1M6N A;  4PH1 A;  1VQ7 P;  2OTL P;  2CWO A;  1K8A Q;  4U0B A;  1QVF O;  1RO2 A;  5JPA A;  2OTJ P;  4XFX A;  3MGE A;  3CCR P;  1A8O A;  3CME P;  1VQK P;  3G1I A;  1A43 A;  3B5I A;  1EOQ A;  1IUQ A;  3CPW O;  5BS2 A;  3CD6 P;  2JYL A;  2P9X A;  3RG6 C;  1YJW P;  1KQS O;  3CCJ P;  1K30 A;  2PEQ A;  5F2N A;  1VQL P;  4COP A;  1D1D A;  2L6E A;  1M90 Q;  1JJ2 O;  3G26 A;  5I4T G;  3E2D A;  2Z45 A;  5HGM A;  3G4S P;  2PEN A;  2M8L A;  5HGN A;  3Q20 A;  3G6E P;  3CMA P;  1YJ9 P;  1YJN P;  3OW2 O;  1RO0 A;  1E6J P;  3P05 A;  2JYG A;  3WBH A;  2EG5 A;  3CC7 P;  4GR6 A;  2LF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...