1KD1Q

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kd1Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kd1Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kd1Q03
1QVGO 3CCSP 1VQ9P 3G4SP 1VQOP 1NJIQ 3OW2O 1KC8Q 1K8AQ 3CXCO 2OTJP 3I56P 1VQMP 1VQPP 1K73Q 3CCLP 1QVFO 1YI2P 1Q82Q 1Q7YQ 3CC2P 2OTLP 1YJWP 3G6EP 3CCRP 3CD6P 1YHQP 3CC7P 1YJNP 1JJ2O 3CMEP 1YITP 3CCUP 1N8RQ 1VQ8P 3CMAP 1VQNP 1YJ9P 3CCVP 3CPWO 1S72P 2QEXP 1KD1Q 3CCJP 1VQKP 3G71P 1VQ6P 3CCQP 1K9MQ 1Q86Q 1M90Q 1KQSO 3CC4P 1Q81Q 1VQ4P 2QA4P 1VQ5P 1W2BO 1YIJP 1M1KQ 1VQ7P 3CCMP 1VQLP 3CCEP 3I55P
chains in the Genus database with same CATH superfamily
3P32A 3AE2C 4JBZA 1U7MA 3JC22 2FADA 4BRYB 2G8YA 2Z4EA 1GW3A 2AFEA 2ZYGA 4GODA 2QEXP 3MHVA 2GZIA 2NRGA 3HD7B 2IZ1A 4RJTA 2K37A 1SP4A 3EJBA 3S4RA 2PEIA 1SQVK 2YMYA 1PGOA 5APTA 1BE3G 3CXHI 4QKOA 2C9NY 3SFDC 2YO2A 1VHNA 4XFXA 3B4QA 2OYHC 1J2JB 4H44B 2IPPA 1ZR2A 1A02F 5AW6B 2V7QJ 3CMEP 1URQB 4UHPB 1OXZA 1EDJA 2A45I 1BAJA 5C39A 2ZJSE 1GXHA 1R8EA 2FY8A 3KHUA 4I1LA 4OGQB 5DJTB 4COCA 1VQ4P 1NTMK 3BRTB 2RKLA 1JY3P 1SFCD 1JY2P 3WMM0 4HH2A 1K05A 1SQXJ 1Q7YQ 2LMLA 2EHSA 1EZVD 1IO4A 5F2OA 3L71E 3HUSB 4IL6H 2M8NA 2FVEA 3RK3E 1OW8A 3DPHA 2VLPA 1MFZA 2IBZG 4Y28J 2L6EA 4PV1D 4U3FD 1UJZA 2ZVOB 3CXCO 3HE5B 1QX8A 3W67A 1FR2A 4AYCA 1DX7A 3H1JG 4XRQA 3W68A 1X22A 2XZ0D 2JJLA 4D6TG 1FZAA 3V4QA 1LT1A 1SQQJ 4YTPC 5BS2A 2GZFA 3E7KA 1FJKA 2JYLA 2Y9YA 3SWKA 3RL0g 3Q5SA 2OYHA 2Z5HA 3E1IA 4NEOA 5CZDB 3A0BH 1JNMA 1JMMA 2LR2A 1RHZB 2KYVA 1GK4A 1PEUA 1SQXD 1GD2E 3TYYA 1VQKP 1S5LH 3V2QA 3MUDC 3M9QA 4I6MC 2FYNC 1USDA 3UIAA 3G26A 3A0HH 2FYUD 2KXPB 1CI6B 3KYQA 1L0LD 1GL2D 3LW5H 3L75G 2JU1A 2LKIA 1FU1A 3MIWA 1RNIA 3BVHA 2N98A 3AE3C 1EDLA 1USEA 1BSHA 1M8OB 3KDPB 1VQ5P 3FX0A 1BE3J 3G21A 3OAKA 2K93A 1LT9C 4H44C 1A43A 1OVRA 3BASA 1NYHA 3H1ID 1AQ5A 3TF5A 3NY7B 2IYPA 2HG5D 3H47A 3H0DA 4PD4D 4H2XC 1J1DB 2J5UA 1VQ7P 2JWDA 2QJYB 1VPCA 3AE8C 3H1LD 1OVVA 2XZRA 2MF4A 3DS2A 5EW5E 2C9LY 2M5RA 3F89A 4EOTA 5B5EE 1LTJA 1NTKJ 1LTIC 2AXTH 1LTSC 4NPDA 2Q5UA 2R5DA 1GL2C 2H7HA 1FZEA 2LOLA 1BGYE 1KILC 1N7SC 1JCCA 4EYYQ 2FYNB 3M9BA 2Q7CA 4N3YB 1NVOA 1M1JC 2IBZE 2YXQB 3CWBG 2P58A 4HKZH 2ZT9B 3ZDMA 1URQD 1YYCA 3U1CA 1URQA 1PEOA 4H0LD 4JPZB 1IMPA 1S5LE 3WBHA 3CC4P 1SQQK 1VF5C 1SQXG 2M3EA 2KGEA 1KLPA 1LTJB 2PP6A 1NJIQ 1KC8Q 1D1DA 3CXHH 5HGOA 1X9VA 4DJGA 3D70A 1BGYD 2KR5A 2DW3A 3RL0C 2ZYDA 5CCGC 3L72D 1HQBA 5KP7B 2WSFJ 3CCLP 4GT1A 3L71D 1NTMG 2N1TB 3M1MA 3L74E 1KD1Q 1EZVI 3VP9A 2K2QA 1Q86Q 3CWBE 2E74D 2PY8A 2JEEA 4PJ0H 2KOGA 1EMVA 2X2BA 1N7SA 2FACA 4NPFX 2CGQA 2I1JA 3HE4A 4U3FG 4WYMA 2MVVA 3C8VA 3TDKA 1KZUB 3KQGA 1GMJA 4NPEA 1EXJA 1BE3E 4R0MA 2BQ1E 2O1JA 3SWYA 1KB9I 2W27A 3RL0D 1GXGA 1FJPA 2V4HA 2RMZA 2ZYAA 5TJHA 2WSFH 3I56P 5L8RJ 1A02J 1AUMA 4IFFA 2PFXA 1JTHB 2AEJA 3DS5A 3P8MC 2QM8A 4W7ZA 1GK6A 4KHXA 3HTKB 2QJKC 3H1JE 4CA3A 3E2DA 3L75D 2FYUG 4DG9A 2A06D 4IFMA 3G1IA 1FAVA 2WT7A 3S1KA 2C0WA 2YKQA 2P1JA 2EFJA 1P84D 3G71P 3CCQP 4PJ0E 2FHSC 1SQPJ 2MR8A 2KG6A 1LTAC 1W2EA 3D6YA 2OYIC 3P8CE 3NTNA 1KV4A 2WPRA 1YI2P 1ZMEC 1KTMA 4XA4A 1RE4A 3B5NA 2Y0DA 3CCRP 3OA7A 1F80D 2K0YA 4U7JA 1SQVD 1AA0A 1KILB 1DD4A 3H1LG 2ZVNB 3GJNA 2FYZA 3M91A 5KKZC 1AF8A 1VQLP 3GF7A 2BUOA 4PH1A 2ERHA 1L0HA 1G2CB 1M7LA 1JUNA 2LIWA 2JP3A 5HGLA 1P84E 1K9MQ 4R4LA 1BSNA 4PV1B 3D6ZA 4M3LA 2K0DX 3L73J 2ZAEB 1OIPA 2O3JA 5H2FH 1LTJC 2JQ4A 1EC5A 2A06E 3L35A 2E5YA 1JOCA 1HVVA 1VDFA 4U0EA 2GZEA 3WU2H 1IFJA 3H1HG 1FBMA 1X79B 1RQVA 5AVWB 4PD4E 1M57D 4DCKA 4EI2A 5APQA 2LXCB 2QA4P 3A5TA 2K3RA 1GU5A 1ZN5A 3G0VA 2VSQA 3TGUD 1E0HA 3TGUE 5KLIC 1BDCA 1JY2O 1SQXK 3BCCD 1FS0E 1L0NE 2N9YB 2MD9A 3CCVP 4YPCA 1AJYA 5KP6B 2RN0A 3LIEA 3C1LA 2KG9A 1AFOA 2KOSA 2KSEA 2Z46A 1KB9H 5DJUB 2BASA 2DNWA 3FGAD 2HODB 2M8RA 3L74J 3H4EA 2Y0CA 2FQ0A 4XROA 5KLVE 4PV1C 4YXDC 2ROQA 5GTHH 4AUWA 1SVFA 2AF8A 1DV5A 1YQ4C 3O8ZA 4D6TE 2KLUA 4PWVB 2B87A 2Q6QA 1H0TA 3BCCG 1ZOYC 3PLNA 3DS1A 4BWNA 3CPWO 3AE9C 1EZVE 5AW2B 1L2PA 1OWAA 5APSA 2PEQA 5BU8B 1JY3N 2HODA 2GDXA 1PEMA 2KSJA 2L9FA 1AYIA 1LWUA 5KLIB 3L72G 5AW7B 2P2UA 1NTZK 3DS4A 2ONTA 3N4XA 4ZKUA 4JYBA 3K5BA 2KGAA 4LGDE 1ZR4A 2IBZD 1S1CX 1KB9E 2ITAA 1QGKB 1PPJG 4DOJA 3D71A 5HGMA 3VMXA 3G3ZA 3PTZA 4LC1A 1PFIA 2N9BA 3AEEC 3B5NB 2PAJA 1KYOD 2VLOA 2A06G 5CJ0A 1SQBE 5APXA 5GTIH 1IJDB 4IOIH 1Q90D 4H13C 4ZMDA 2AXCA 4MN4C 5TISE 2LKMA 1PEQA 3HD7C 4IL6E 2WMMA 3H1LJ 2OARA 2W6BA 4HB1A 3RK2D 3QH9A 4W7YA 4QNBA 4L76A 3AEFC 3WUUA 1FC2C 1LJ2A 3VMAA 3G6EP 1EZVG 1S2EA 1ZRTE 2YO3A 1N7SB 5APWA 1BCCE 5AVVB 3RBZA 1X0TA 2OYIA 3PRJA 1L0NG 1QEXA 1G1IA 2JKVA 2AEMA 4GIFA 3AEDC 3FWNA 1KMIZ 1URQC 3HE4B 2Q3IA 3MP7B 3H1KG 1L0LJ 4PH0A 1QRJA 1EOQA 3CX5H 2GUSA 2FAEA 1NAYA 2W83C 4WY4C 5AVYB 1H89A 1SQVJ 2FYUE 3Q1MA 3U59A 3KZIE 5E79H 1KN7A 2E75D 2NPSB 5KLVJ 4OH8B 5H2FE 3A2AA 1RO2A 3II6A 2Z44A 2N5IA 2KOQA 2QE7H 2LF4A 4L75A 2YKOA 2SPZA 2HLOA 1ZV8A 4C46A 1GZLA 1RO0A 1N8RQ 5KP8B 2FBWC 2V7QH 3AEAC 2WSCJ 2I1KA 2R3CA 1KYOE 2M8LA 2EG5A 1K73Q 1GPJA 3V2RA 2KIKA 1SFCA 3P7KA 3GG2A 2FVAA 2ZT9D 1RF1B 2OTKE 1SQXE 4UB6E 5CBOA 3P8CD 5EJDA 2M5AB 3WUVA 1L4AC 3Q2YA 2JBGA 3AEGC 2XZ1C 1G2CA 1J1EB 1YTZT 4WY4B 1NHLA 1NTZD 2OTJP 1IUQA 4JF7A 3U1AA 1T8ZA 4H44D 1YJWP 5AVSB 5CCHD 3HYBA 2MR7A 5APYA 3L4FA 4OWFA 1JMBA 4KT0J 2BHVA 3H1HE 2I8DA 4Y99B 2PRRA 1KQSO 2WSSH 5AVUB 1L0NJ 5HV8A 1OVUA 3GLMA 2Z45A 2W8ZA 5GTHE 2XNDH 3IFMA 3L70D 4I7ZC 1QLED 2BCCJ 1KQGB 3VRLC 3H6PA 3HD7D 2M5AA 2XDJA 2XNXA 3DS3A 1S9KD 2UWJE 2YIUC 5BU5A 5CBNA 3H1KE 1YTZI 2DGYA 5HGNA 2JAZA 3TGUG 1BGYJ 3VTPC 1CZQA 2K9JB 3HTKA 1N73C 1FZFA 1NTKE 1SQPE 2EHTA 2PEJA 1L4AD 3GZMA 3JCUE 1N86A 2AFDA 3Q20A 3B71A 1AVOA 1KILD 3VN0A 1ZNVA 2WT7B 1NTME 3CCSP 4HYTB 3GZLA 1VQMP 1XTCC 3L70E 2LTEA 4WWIA 3ABVC 3H1HD 3IN6A 2WSEH 1SQBK 2N1TC 1H8AA 1VQ6P 1NAFA 2PENA 3HD7A 3FWLA 1M1KQ 1YBKA 3H1IE 3G1GA 4O9BA 2E74C 2VLQA 3A3YB 3G4SP 1RF0C 3BATA 3O6QA 3NXSA 1Q82Q 2BEZF 2W6JH 3V4WA 2K5XA 2Y0EA 3MGEA 3KPEA 2WTYA 3V6IA 2L22A 2JU2A 2P9XA 2FXPA 3L73E 1JM0A 2AXTE 3LW5J 1MV8A 2GYKA 3MTUE 4CPGA 1IK7A 2E75C 3MD0A 1GU4A 2LIUA 5CJ4A 2VLNA 1L4AB 1NU1D 3V2NA 2D2CC 1NTMD 4C7NA 2N6ZA 1PGJA 2KUBA 1D7MA 1DD3A 1YHQP 3CC7P 3HUSC 3AE5C 2QJPB 1IFMA 2YXRB 3L70J 2P67A 3CX5I 2KK7A 2WWWA 2PEOA 1FZBA 2KGDA 1OW7A 1ZXGA 2B89A 4GDOA 1SQBG 2G3AA 1S9KE 5TISH 2J58A 5B66H 2CWOA 3QWOC 5AW0B 2HR3A 2ZXXA 3OJAB 1NU1G 1OW6A 1UIXA 2W6AA 4RESB 1R5SA 3H1IG 3KZIH 5F2NA 2GDWA 3L71G 2JO1A 2BCCG 1HUCA 1Z56A 1IFNA 3H1LE 5K5GB 1CSBA 3B5ND 1N73B 1Y8AA 1IFPA 2B9BA 4Z1MH 2HFED 2GZJA 1JTHA 1LP1A 2FFDC 5EFWB 1GL2A 4LLHA 3B5IA 1PIXA 4EDFA 1SQQD 1VF5D 2Q1KA 3V5BA 2QNWA 5F2KA 2CPBA 5CCHC 4UB8H 2E5TA 3Q3DA 4I7ZB 3U43A 1M1JA 1GW4A 3EJDA 1YITP 1EDKA 2L5GB 1NOHA 1T2KD 4WY4D 3PHLA 5BVZA 2E74B 1LT9B 2K9JA 1HGVA 3TNUB 1HF9A 3HE5A 3NTEA 5KAIH 3WU2E 3B8EB 2FYUK 3L73D 2CK3H 4U0FA 3VOPA 4PD4H 1NO4A 1KYOH 2IFMA 1PP9E 2CG5B 1NU1E 2K88A 2AVAA 3E1RA 1Z6MA 3PH0A 3H1JD 1NTKK 4XFJA 2JGPA 4DT0A 4BPGA 1HGZA 1MZ8A 1JY2N 5AVQB 2AEFA 1VQNP 2QJPC 1IC2A 3M9HA 3IAOA 2FFDA 1EQ7A 1NQ4A 2H8PD 1RF1A 4K3AA 2POHA 4BPFA 1QL2A 1QL1A 1LWUC 3GF3A 3A7OA 1YJ9P 1GDTA 3CCJP 1SFCB 1FZCC 2C0XA 2KGCA 1VF5B 2KB7P 2O01H 3CCMP 1J1DC 1P84I 4HKGA 2IBZI 1NTZG 1FDOA 2LL8A 1G1JA 5I4TG 3B4SA 3N7NA 3L75J 2KZIA 2L4BA 2XKMA 4TLFA 3VYIA 1FOSE 1BCCG 2H43A 3M0AA 1VQ9P 3ITKA 2ZT9C 5KJ7C 4IFDK 4RO0A 1T8KA 3RK2C 3G9RA 2IX7C 3P05A 3L73G 3FXDA 1WT6A 1S4XA 1DEBA 4COPA 4R4MA 4WB4A 2B87B 1E5WA 1RF1C 1L0NK 3RGUA 1N2DC 1YJNP 2NPSA 3MUDA 1SFCC 1GL2B 3JSVC 1FZCB 3H1KD 2KODA 2GDYA 2B88A 3F5HA 1J1EC 1HY8A 2K92A 1BCCD 2K9YA 3GW6A 1L0LE 2R32A 3L71J 1K8AQ 1Y9BA 1OR5A 4L73A 3CC2P 1OX3A 1MFTA 5AVZB 3MZWB 1NU1J 1FDIA 3L74D 2QJKB 1TU3F 1FE6A 3O6QB 1Y47A 1N7SD 1LT9A 3A0BE 3WUTA 1K04A 3L75E 4XFYA 2WSCH 3CXHD 3RK2B 3CXHE 1RQUA 2QVAA 3Q5RA 5CCGA 1WMKA 5KTBA 1S5LX 1P84H 1M90Q 1NTZJ 4H13B 1DIPA 1W2BO 1X3OA 4A7PA 1YQ3C 5GTIE 2KI7B 3CX5E 3H32A 1IMQA 4N78D 5APUA 2IFNA 2WZ7A 2XT1A 1HTLC 3PP5A 1H88A 1PP9D 4ZNCA 1UNKA 4ASVA 2OYHB 4U0DA 3GHGA 5CHXA 2CPSA 2W90A 5CCHA 4OGQD 3GKLC 1SLQA 3KXDA 3VMZA 3CL3D 3C9IA 4F37A 1HH0A 1OMIA 1KORA 2LXBA 2QSIA 2MKVA 1U7JA 3NFQA 2HPCB 2A45H 3CD6P 3RG2A 2R3SA 3RBXA 2O1KA 5CCGD 1RH5B 5CMZA 2O01N 2GUVA 4D6TD 2R44A 5E79E 1AV1A 5KLVD 1QVGO 4DZOA 3EQ2A 2BCCE 2ZXEB 5AW8B 1RF0A 1IFDA 3RK3C 1BDDA 1BE3D 3USSA 3SFEC 3L72E 2WQYC 1M56D 2E75B 5KKZB 1JO5A 4GR6A 1ZMBA 2R5BA 1AVYA 4TT3H 2KOOA 3EFFK 1Q2NA 4M0IA 3H1JJ 2HPCA 1SS1A 2J59M 5KAFE 3IR9A 2OQQA 1EDIA 1SQQE 1T6AA 1VQ8P 2XV6A 2MY5A 1S72P 3HZQA 2KS1A 2N50A 2YKPA 3CWBD 2E43A 4OVNF 1JB0J 1ZP0C 2E76B 2XU6A 2FVFA 3CCEP 1KB9D 5B5EH 1X8YA 5M1BA 3CLQA 2E42A 1EIAA 1FOSF 1FZCA 2WVRA 3SWFA 2Q3EA 2WPSA 1PP9J 3TNUA 1L0LK 2YMKA 5KJ7A 1UIIA 4U0AA 5AW3B 5B66E 2NPSD 4KJMA 4C7RA 1CW5A 3RK3D 4U3FE 2KS1B 1HJ0A 2FFDB 1SQBJ 4RKUJ 4UB6H 1RE3A 1H0TB 3VMYA 2A45G 4WBAA 3L70G 2QIWA 3AE6C 1HBWA 2N6YA 2M3BA 2E1MA 2KNCA 1U57A 4W80A 1OZHA 1LNQA 1NWQA 1JY3O 2IYOA 2P10A 2QJYC 3GMAA 2E76C 3L74G 1SQVG 4JQ0D 4UB8E 4OGQC 2IDBA 4BRYA 1LTTC 4H13D 2NZ2A 1RE4C 3B5NC 4N6JA 1VKUA 1KQLA 2L0QA 1L0LG 3H1KJ 3PJSK 5KJ7D 3RK3B 5AVXB 2RH0A 1VL2A 1YIJP 4PXHB 2HYNA 4H2WC 4IPYA 4PD4I 4BPHA 1M1JB 1BGYG 2OGUA 3TK1A 2QRXA 1RY3A 1PP9G 2D2CB 1QVFO 2N1TD 2N1TA 4JYCA 1PV3A 2O01J 1W5CE 1NTMJ 4H0LC 3AE7C 3CCUP 2D2CD 3CE7A 2ZFCA 2MVUA 1DEEG 1T3JA 3JCUH 1NKZB 3G28A 3DS0A 4WVZA 4YXWH 1KFMA 5KAFH 1SQBD 2PEKA 4ZKPA 1LWUB 2L91A 1FDMA 2JB0A 1M6EX 5AVTB 2PGDA 3LIDA 3TGUJ 3V2PA 3RL0B 2KW2A 1NTKD 3I5CA 1SQPK 4H2YC 2QG4A 3H1HJ 4XFZA 5DCKA 3CX5D 4GR2A 1L4AA 4MRTC 3HUSA 1LGHB 1XTGB 2OYOA 2N5HA 2KLVA 1ZRTD 2QM7A 3R2PA 5AW5B 5BS1A 1MKMA 3CMAP 3H1IJ 1PGPA 2GA1A 1BXIA 2Y9ZA 2PNGA 1PPJD 3LMOA 3CWBJ 1PPJE 1LTGC 1IFIA 2CNRA 3HRNA 2Z5IA 4I2LC 3G29A 2VRSA 5AW4B 1MUUA 2FXMA 3R4YA 3FXEA 2WITA 4AQRD 2XXMA 3H32B 1PZQA 3M0DA 2WPTA 1NTKG 1ZLLA 2OYIB 2PEMA 1E79H 1SQVE 2BCCD 2FYUJ 2KZJA 1NTZE 1AQTA 5KLVG 1LTBC 2EIAA 2IZ0A 1L0ND 1FZGA 1N73A 3CI9A 2NPSC 1M6NA 2E76D 1LP1B 3IF4A 1KILE 1A8OA 1KYOI 1SQPD 4N78E 1JCDA 3L37A 3A0HE 3BCCJ 2LPKA 2KWLA 2KNCB 3GHGB 1PGQA 2KOPA 4XE5B 5JPAA 2H88C 1HJBA 5APVA 1CI6A 4IL6X 1IK9A 1Q81Q 4GOFA 1WRGA 4WY4A 4EIJA 3DTJA 4U0BA 4U3FJ 3SSUA 3I55P 1VQOP 1NKNA 3OW2O 2CQ8A 3Q5PA 1NU1K 3T97A 3EJEA 1MZ9A 3LRYA 2YNYA 2JR8A 1PL5A 2KP8A 7CEIA 1E6JP 4K35A 2KORA 2WPVB 1RE3C 2YIUB 3EFGA 4HJGH 5AVRB 3VP8A 5KLVK 5KAIE 2KG8A 4U0CA 2M8PA 1L0IA 1CEIA 3M0DC 1KQFB 2FQ1A 5HVCA 1IZNB 2FQ2A 1S3JA 4H0LB 2GZGA 1SQQG 3BCCE 2JWAA 2P7JA 2NO8A 2K94A 1DH3A 2JDIH 3H25A 1ACPA 4Y99C 3GHGC 3T97B 1OFCX 2GM4A 2M0BA 3AE1C 3NMDA 1KFNA 2OTLP 3M06A 1JJ2O 2BEQD 2WSEJ 2K1AA 3S9OA 4D6TJ 4BXLA 2MJZA 1K30A 2XV5A 3L72J 1R5LA 1BCCJ 4GOEA 3EWKA 2FKWB 1HWTC 1VQPP 1SQPG 3RG6C 1NGMB 3L36A 1EXIA 2H89C 2Q9IA 3AEBC 1N7LA 1T3UA 5AW9B 4L74A 1GTWA 2K0XA 2JYGA 4IZ6A 1T2KC 1KILA 3AE4C 1M74A 2FXOA 1NH4A 4B86A 4GKGA 1ZW0A 3TSIA 5AW1B 3BRVB 1JEKA 1DNYA 3MGNA 4ASWA 3AECC 2WPQA 4C7NB 4QMAA 2JO0A
chains in the Genus database with same CATH topology
4M0IA 3G4SP 4XFYA 2BUOA 4PH1A 5I4TG 3CXCO 5F2KA 2OTJP 1IUQA 1Q82Q 4WYMA 1YJWP 3MGEA 3G29A 3HYBA 2P9XA 3DS1A 1YITP 4XRQA 1VQ8P 2BHVA 2XV6A 5HGLA 3CPWO 1S72P 2QEXP 2BQ1E 3HZQA 1K9MQ 2XXMA 1M90Q 1KQSO 1W2BO 1YIJP 5BS2A 4PH0A 1QRJA 4IPYA 1EOQA 2PEQA 3CCEP 2Z45A 2PEMA 2JYLA 1VQ9P 1PEMA 3I56P 2PEIA 1QVFO 4U0EA 1AUMA 2OTLP 2EIAA 1EIAA 1PEOA 2XT1A 3NTEA 1YHQP 3CC7P 3DS4A 1JJ2O 2ONTA 3CCUP 3VRLC 1PEUA 3DS5A 4U0FA 1VQKP 3WBHA 3DS3A 3P05A 3CC4P 1M6NA 1K30A 4U0DA 4XFXA 2QA4P 3G28A 3DS0A 3G26A 1A8OA 2PEOA 1RO2A 3E2DA 2DGYA 5HGNA 4COPA 4U0AA 3G0VA 5HGMA 2Z44A 1NJIQ 1KC8Q 1D1DA 1VQPP 1VQLP 2LF4A 2PEKA 3RG6C 3G1IA 5JPAA 5HGOA 3CD6P 1RNIA 1RO0A 1YJNP 3CMEP 2CWOA 1N8RQ 1M6EX 1VQNP 1BAJA 3CCVP 2EFJA 2PEJA 3G71P 2KODA 3CCQP 4COCA 1Q81Q 1VQ4P 1VQ5P 2JYGA 3Q20A 3DTJA 4U0BA 4XFZA 3G21A 1PEQA 2Z46A 5DCKA 1M74A 3I55P 1QVGO 4GR2A 3CCSP 2M8LA 1VQOP 3OW2O 2OARA 1K8AQ 4QNBA 5F2NA 2EG5A 1VQMP 1K73Q 3CCLP 1YI2P 1A43A 1Q7YQ 3CC2P 2E1MA 3H4EA 3LRYA 3G6EP 3CCRP 5BS1A 3M1MA 5F2OA 4XROA 1E6JP 3CMAP 1YJ9P 2M8NA 1KD1Q 3CCJP 3H47A 1VQ6P 3H0DA 2PENA 1Q86Q 3DPHA 1M1KQ 4GR6A 2PY8A 1VQ7P 1ZMBA 3CCMP 3G1GA 4U0CA 2M8PA 3B5IA 2JO0A 2L6EA 3DS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG O;  3CCS P;  1VQ9 P;  3G4S P;  1VQO P;  1NJI Q;  3OW2 O;  1KC8 Q;  1K8A Q;  3CXC O;  2OTJ P;  3I56 P;  1VQM P;  1VQP P;  1K73 Q;  3CCL P;  1QVF O;  1YI2 P;  1Q82 Q;  1Q7Y Q;  3CC2 P;  2OTL P;  1YJW P;  3G6E P;  3CCR P;  3CD6 P;  1YHQ P;  3CC7 P;  1YJN P;  1JJ2 O;  3CME P;  1YIT P;  3CCU P;  1N8R Q;  1VQ8 P;  3CMA P;  1VQN P;  1YJ9 P;  3CCV P;  3CPW O;  1S72 P;  2QEX P;  1KD1 Q;  3CCJ P;  1VQK P;  3G71 P;  1VQ6 P;  3CCQ P;  1K9M Q;  1Q86 Q;  1M90 Q;  1KQS O;  3CC4 P;  1Q81 Q;  1VQ4 P;  2QA4 P;  1VQ5 P;  1W2B O;  1YIJ P;  1M1K Q;  1VQ7 P;  3CCM P;  1VQL P;  3CCE P;  3I55 P; 
#chains in the Genus database with same CATH topology
 3P32 A;  3AE2 C;  4JBZ A;  1U7M A;  3JC2 2;  2FAD A;  4BRY B;  2G8Y A;  2Z4E A;  1GW3 A;  2AFE A;  2ZYG A;  4GOD A;  2QEX P;  3MHV A;  2GZI A;  2NRG A;  3HD7 B;  2IZ1 A;  4RJT A;  2K37 A;  1SP4 A;  3EJB A;  3S4R A;  2PEI A;  1SQV K;  2YMY A;  1PGO A;  5APT A;  1BE3 G;  3CXH I;  4QKO A;  2C9N Y;  3SFD C;  2YO2 A;  1VHN A;  4XFX A;  3B4Q A;  2OYH C;  1J2J B;  4H44 B;  2IPP A;  1ZR2 A;  1A02 F;  5AW6 B;  2V7Q J;  3CME P;  1URQ B;  4UHP B;  1OXZ A;  1EDJ A;  2A45 I;  1BAJ A;  5C39 A;  2ZJS E;  1GXH A;  1R8E A;  2FY8 A;  3KHU A;  4I1L A;  4OGQ B;  5DJT B;  4COC A;  1VQ4 P;  1NTM K;  3BRT B;  2RKL A;  1JY3 P;  1SFC D;  1JY2 P;  3WMM 0;  4HH2 A;  1K05 A;  1SQX J;  1Q7Y Q;  2LML A;  2EHS A;  1EZV D;  1IO4 A;  5F2O A;  3L71 E;  3HUS B;  4IL6 H;  2M8N A;  2FVE A;  3RK3 E;  1OW8 A;  3DPH A;  2VLP A;  1MFZ A;  2IBZ G;  4Y28 J;  2L6E A;  4PV1 D;  4U3F D;  1UJZ A;  2ZVO B;  3CXC O;  3HE5 B;  1QX8 A;  3W67 A;  1FR2 A;  4AYC A;  1DX7 A;  3H1J G;  4XRQ A;  3W68 A;  1X22 A;  2XZ0 D;  2JJL A;  4D6T G;  1FZA A;  3V4Q A;  1LT1 A;  1SQQ J;  4YTP C;  5BS2 A;  2GZF A;  3E7K A;  1FJK A;  2JYL A;  2Y9Y A;  3SWK A;  3RL0 g;  3Q5S A;  2OYH A;  2Z5H A;  3E1I A;  4NEO A;  5CZD B;  3A0B H;  1JNM A;  1JMM A;  2LR2 A;  1RHZ B;  2KYV A;  1GK4 A;  1PEU A;  1SQX D;  1GD2 E;  3TYY A;  1VQK P;  1S5L H;  3V2Q A;  3MUD C;  3M9Q A;  4I6M C;  2FYN C;  1USD A;  3UIA A;  3G26 A;  3A0H H;  2FYU D;  2KXP B;  1CI6 B;  3KYQ A;  1L0L D;  1GL2 D;  3LW5 H;  3L75 G;  2JU1 A;  2LKI A;  1FU1 A;  3MIW A;  1RNI A;  3BVH A;  2N98 A;  3AE3 C;  1EDL A;  1USE A;  1BSH A;  1M8O B;  3KDP B;  1VQ5 P;  3FX0 A;  1BE3 J;  3G21 A;  3OAK A;  2K93 A;  1LT9 C;  4H44 C;  1A43 A;  1OVR A;  3BAS A;  1NYH A;  3H1I D;  1AQ5 A;  3TF5 A;  3NY7 B;  2IYP A;  2HG5 D;  3H47 A;  3H0D A;  4PD4 D;  4H2X C;  1J1D B;  2J5U A;  1VQ7 P;  2JWD A;  2QJY B;  1VPC A;  3AE8 C;  3H1L D;  1OVV A;  2XZR A;  2MF4 A;  3DS2 A;  5EW5 E;  2C9L Y;  2M5R A;  3F89 A;  4EOT A;  5B5E E;  1LTJ A;  1NTK J;  1LTI C;  2AXT H;  1LTS C;  4NPD A;  2Q5U A;  2R5D A;  1GL2 C;  2H7H A;  1FZE A;  2LOL A;  1BGY E;  1KIL C;  1N7S C;  1JCC A;  4EYY Q;  2FYN B;  3M9B A;  2Q7C A;  4N3Y B;  1NVO A;  1M1J C;  2IBZ E;  2YXQ B;  3CWB G;  2P58 A;  4HKZ H;  2ZT9 B;  3ZDM A;  1URQ D;  1YYC A;  3U1C A;  1URQ A;  1PEO A;  4H0L D;  4JPZ B;  1IMP A;  1S5L E;  3WBH A;  3CC4 P;  1SQQ K;  1VF5 C;  1SQX G;  2M3E A;  2KGE A;  1KLP A;  1LTJ B;  2PP6 A;  1NJI Q;  1KC8 Q;  1D1D A;  3CXH H;  5HGO A;  1X9V A;  4DJG A;  3D70 A;  1BGY D;  2KR5 A;  2DW3 A;  3RL0 C;  2ZYD A;  5CCG C;  3L72 D;  1HQB A;  5KP7 B;  2WSF J;  3CCL P;  4GT1 A;  3L71 D;  1NTM G;  2N1T B;  3M1M A;  3L74 E;  1KD1 Q;  1EZV I;  3VP9 A;  2K2Q A;  1Q86 Q;  3CWB E;  2E74 D;  2PY8 A;  2JEE A;  4PJ0 H;  2KOG A;  1EMV A;  2X2B A;  1N7S A;  2FAC A;  4NPF X;  2CGQ A;  2I1J A;  3HE4 A;  4U3F G;  4WYM A;  2MVV A;  3C8V A;  3TDK A;  1KZU B;  3KQG A;  1GMJ A;  4NPE A;  1EXJ A;  1BE3 E;  4R0M A;  2BQ1 E;  2O1J A;  3SWY A;  1KB9 I;  2W27 A;  3RL0 D;  1GXG A;  1FJP A;  2V4H A;  2RMZ A;  2ZYA A;  5TJH A;  2WSF H;  3I56 P;  5L8R J;  1A02 J;  1AUM A;  4IFF A;  2PFX A;  1JTH B;  2AEJ A;  3DS5 A;  3P8M C;  2QM8 A;  4W7Z A;  1GK6 A;  4KHX A;  3HTK B;  2QJK C;  3H1J E;  4CA3 A;  3E2D A;  3L75 D;  2FYU G;  4DG9 A;  2A06 D;  4IFM A;  3G1I A;  1FAV A;  2WT7 A;  3S1K A;  2C0W A;  2YKQ A;  2P1J A;  2EFJ A;  1P84 D;  3G71 P;  3CCQ P;  4PJ0 E;  2FHS C;  1SQP J;  2MR8 A;  2KG6 A;  1LTA C;  1W2E A;  3D6Y A;  2OYI C;  3P8C E;  3NTN A;  1KV4 A;  2WPR A;  1YI2 P;  1ZME C;  1KTM A;  4XA4 A;  1RE4 A;  3B5N A;  2Y0D A;  3CCR P;  3OA7 A;  1F80 D;  2K0Y A;  4U7J A;  1SQV D;  1AA0 A;  1KIL B;  1DD4 A;  3H1L G;  2ZVN B;  3GJN A;  2FYZ A;  3M91 A;  5KKZ C;  1AF8 A;  1VQL P;  3GF7 A;  2BUO A;  4PH1 A;  2ERH A;  1L0H A;  1G2C B;  1M7L A;  1JUN A;  2LIW A;  2JP3 A;  5HGL A;  1P84 E;  1K9M Q;  4R4L A;  1BSN A;  4PV1 B;  3D6Z A;  4M3L A;  2K0D X;  3L73 J;  2ZAE B;  1OIP A;  2O3J A;  5H2F H;  1LTJ C;  2JQ4 A;  1EC5 A;  2A06 E;  3L35 A;  2E5Y A;  1JOC A;  1HVV A;  1VDF A;  4U0E A;  2GZE A;  3WU2 H;  1IFJ A;  3H1H G;  1FBM A;  1X79 B;  1RQV A;  5AVW B;  4PD4 E;  1M57 D;  4DCK A;  4EI2 A;  5APQ A;  2LXC B;  2QA4 P;  3A5T A;  2K3R A;  1GU5 A;  1ZN5 A;  3G0V A;  2VSQ A;  3TGU D;  1E0H A;  3TGU E;  5KLI C;  1BDC A;  1JY2 O;  1SQX K;  3BCC D;  1FS0 E;  1L0N E;  2N9Y B;  2MD9 A;  3CCV P;  4YPC A;  1AJY A;  5KP6 B;  2RN0 A;  3LIE A;  3C1L A;  2KG9 A;  1AFO A;  2KOS A;  2KSE A;  2Z46 A;  1KB9 H;  5DJU B;  2BAS A;  2DNW A;  3FGA D;  2HOD B;  2M8R A;  3L74 J;  3H4E A;  2Y0C A;  2FQ0 A;  4XRO A;  5KLV E;  4PV1 C;  4YXD C;  2ROQ A;  5GTH H;  4AUW A;  1SVF A;  2AF8 A;  1DV5 A;  1YQ4 C;  3O8Z A;  4D6T E;  2KLU A;  4PWV B;  2B87 A;  2Q6Q A;  1H0T A;  3BCC G;  1ZOY C;  3PLN A;  3DS1 A;  4BWN A;  3CPW O;  3AE9 C;  1EZV E;  5AW2 B;  1L2P A;  1OWA A;  5APS A;  2PEQ A;  5BU8 B;  1JY3 N;  2HOD A;  2GDX A;  1PEM A;  2KSJ A;  2L9F A;  1AYI A;  1LWU A;  5KLI B;  3L72 G;  5AW7 B;  2P2U A;  1NTZ K;  3DS4 A;  2ONT A;  3N4X A;  4ZKU A;  4JYB A;  3K5B A;  2KGA A;  4LGD E;  1ZR4 A;  2IBZ D;  1S1C X;  1KB9 E;  2ITA A;  1QGK B;  1PPJ G;  4DOJ A;  3D71 A;  5HGM A;  3VMX A;  3G3Z A;  3PTZ A;  4LC1 A;  1PFI A;  2N9B A;  3AEE C;  3B5N B;  2PAJ A;  1KYO D;  2VLO A;  2A06 G;  5CJ0 A;  1SQB E;  5APX A;  5GTI H;  1IJD B;  4IOI H;  1Q90 D;  4H13 C;  4ZMD A;  2AXC A;  4MN4 C;  5TIS E;  2LKM A;  1PEQ A;  3HD7 C;  4IL6 E;  2WMM A;  3H1L J;  2OAR A;  2W6B A;  4HB1 A;  3RK2 D;  3QH9 A;  4W7Y A;  4QNB A;  4L76 A;  3AEF C;  3WUU A;  1FC2 C;  1LJ2 A;  3VMA A;  3G6E P;  1EZV G;  1S2E A;  1ZRT E;  2YO3 A;  1N7S B;  5APW A;  1BCC E;  5AVV B;  3RBZ A;  1X0T A;  2OYI A;  3PRJ A;  1L0N G;  1QEX A;  1G1I A;  2JKV A;  2AEM A;  4GIF A;  3AED C;  3FWN A;  1KMI Z;  1URQ C;  3HE4 B;  2Q3I A;  3MP7 B;  3H1K G;  1L0L J;  4PH0 A;  1QRJ A;  1EOQ A;  3CX5 H;  2GUS A;  2FAE A;  1NAY A;  2W83 C;  4WY4 C;  5AVY B;  1H89 A;  1SQV J;  2FYU E;  3Q1M A;  3U59 A;  3KZI E;  5E79 H;  1KN7 A;  2E75 D;  2NPS B;  5KLV J;  4OH8 B;  5H2F E;  3A2A A;  1RO2 A;  3II6 A;  2Z44 A;  2N5I A;  2KOQ A;  2QE7 H;  2LF4 A;  4L75 A;  2YKO A;  2SPZ A;  2HLO A;  1ZV8 A;  4C46 A;  1GZL A;  1RO0 A;  1N8R Q;  5KP8 B;  2FBW C;  2V7Q H;  3AEA C;  2WSC J;  2I1K A;  2R3C A;  1KYO E;  2M8L A;  2EG5 A;  1K73 Q;  1GPJ A;  3V2R A;  2KIK A;  1SFC A;  3P7K A;  3GG2 A;  2FVA A;  2ZT9 D;  1RF1 B;  2OTK E;  1SQX E;  4UB6 E;  5CBO A;  3P8C D;  5EJD A;  2M5A B;  3WUV A;  1L4A C;  3Q2Y A;  2JBG A;  3AEG C;  2XZ1 C;  1G2C A;  1J1E B;  1YTZ T;  4WY4 B;  1NHL A;  1NTZ D;  2OTJ P;  1IUQ A;  4JF7 A;  3U1A A;  1T8Z A;  4H44 D;  1YJW P;  5AVS B;  5CCH D;  3HYB A;  2MR7 A;  5APY A;  3L4F A;  4OWF A;  1JMB A;  4KT0 J;  2BHV A;  3H1H E;  2I8D A;  4Y99 B;  2PRR A;  1KQS O;  2WSS H;  5AVU B;  1L0N J;  5HV8 A;  1OVU A;  3GLM A;  2Z45 A;  2W8Z A;  5GTH E;  2XND H;  3IFM A;  3L70 D;  4I7Z C;  1QLE D;  2BCC J;  1KQG B;  3VRL C;  3H6P A;  3HD7 D;  2M5A A;  2XDJ A;  2XNX A;  3DS3 A;  1S9K D;  2UWJ E;  2YIU C;  5BU5 A;  5CBN A;  3H1K E;  1YTZ I;  2DGY A;  5HGN A;  2JAZ A;  3TGU G;  1BGY J;  3VTP C;  1CZQ A;  2K9J B;  3HTK A;  1N73 C;  1FZF A;  1NTK E;  1SQP E;  2EHT A;  2PEJ A;  1L4A D;  3GZM A;  3JCU E;  1N86 A;  2AFD A;  3Q20 A;  3B71 A;  1AVO A;  1KIL D;  3VN0 A;  1ZNV A;  2WT7 B;  1NTM E;  3CCS P;  4HYT B;  3GZL A;  1VQM P;  1XTC C;  3L70 E;  2LTE A;  4WWI A;  3ABV C;  3H1H D;  3IN6 A;  2WSE H;  1SQB K;  2N1T C;  1H8A A;  1VQ6 P;  1NAF A;  2PEN A;  3HD7 A;  3FWL A;  1M1K Q;  1YBK A;  3H1I E;  3G1G A;  4O9B A;  2E74 C;  2VLQ A;  3A3Y B;  3G4S P;  1RF0 C;  3BAT A;  3O6Q A;  3NXS A;  1Q82 Q;  2BEZ F;  2W6J H;  3V4W A;  2K5X A;  2Y0E A;  3MGE A;  3KPE A;  2WTY A;  3V6I A;  2L22 A;  2JU2 A;  2P9X A;  2FXP A;  3L73 E;  1JM0 A;  2AXT E;  3LW5 J;  1MV8 A;  2GYK A;  3MTU E;  4CPG A;  1IK7 A;  2E75 C;  3MD0 A;  1GU4 A;  2LIU A;  5CJ4 A;  2VLN A;  1L4A B;  1NU1 D;  3V2N A;  2D2C C;  1NTM D;  4C7N A;  2N6Z A;  1PGJ A;  2KUB A;  1D7M A;  1DD3 A;  1YHQ P;  3CC7 P;  3HUS C;  3AE5 C;  2QJP B;  1IFM A;  2YXR B;  3L70 J;  2P67 A;  3CX5 I;  2KK7 A;  2WWW A;  2PEO A;  1FZB A;  2KGD A;  1OW7 A;  1ZXG A;  2B89 A;  4GDO A;  1SQB G;  2G3A A;  1S9K E;  5TIS H;  2J58 A;  5B66 H;  2CWO A;  3QWO C;  5AW0 B;  2HR3 A;  2ZXX A;  3OJA B;  1NU1 G;  1OW6 A;  1UIX A;  2W6A A;  4RES B;  1R5S A;  3H1I G;  3KZI H;  5F2N A;  2GDW A;  3L71 G;  2JO1 A;  2BCC G;  1HUC A;  1Z56 A;  1IFN A;  3H1L E;  5K5G B;  1CSB A;  3B5N D;  1N73 B;  1Y8A A;  1IFP A;  2B9B A;  4Z1M H;  2HFE D;  2GZJ A;  1JTH A;  1LP1 A;  2FFD C;  5EFW B;  1GL2 A;  4LLH A;  3B5I A;  1PIX A;  4EDF A;  1SQQ D;  1VF5 D;  2Q1K A;  3V5B A;  2QNW A;  5F2K A;  2CPB A;  5CCH C;  4UB8 H;  2E5T A;  3Q3D A;  4I7Z B;  3U43 A;  1M1J A;  1GW4 A;  3EJD A;  1YIT P;  1EDK A;  2L5G B;  1NOH A;  1T2K D;  4WY4 D;  3PHL A;  5BVZ A;  2E74 B;  1LT9 B;  2K9J A;  1HGV A;  3TNU B;  1HF9 A;  3HE5 A;  3NTE A;  5KAI H;  3WU2 E;  3B8E B;  2FYU K;  3L73 D;  2CK3 H;  4U0F A;  3VOP A;  4PD4 H;  1NO4 A;  1KYO H;  2IFM A;  1PP9 E;  2CG5 B;  1NU1 E;  2K88 A;  2AVA A;  3E1R A;  1Z6M A;  3PH0 A;  3H1J D;  1NTK K;  4XFJ A;  2JGP A;  4DT0 A;  4BPG A;  1HGZ A;  1MZ8 A;  1JY2 N;  5AVQ B;  2AEF A;  1VQN P;  2QJP C;  1IC2 A;  3M9H A;  3IAO A;  2FFD A;  1EQ7 A;  1NQ4 A;  2H8P D;  1RF1 A;  4K3A A;  2POH A;  4BPF A;  1QL2 A;  1QL1 A;  1LWU C;  3GF3 A;  3A7O A;  1YJ9 P;  1GDT A;  3CCJ P;  1SFC B;  1FZC C;  2C0X A;  2KGC A;  1VF5 B;  2KB7 P;  2O01 H;  3CCM P;  1J1D C;  1P84 I;  4HKG A;  2IBZ I;  1NTZ G;  1FDO A;  2LL8 A;  1G1J A;  5I4T G;  3B4S A;  3N7N A;  3L75 J;  2KZI A;  2L4B A;  2XKM A;  4TLF A;  3VYI A;  1FOS E;  1BCC G;  2H43 A;  3M0A A;  1VQ9 P;  3ITK A;  2ZT9 C;  5KJ7 C;  4IFD K;  4RO0 A;  1T8K A;  3RK2 C;  3G9R A;  2IX7 C;  3P05 A;  3L73 G;  3FXD A;  1WT6 A;  1S4X A;  1DEB A;  4COP A;  4R4M A;  4WB4 A;  2B87 B;  1E5W A;  1RF1 C;  1L0N K;  3RGU A;  1N2D C;  1YJN P;  2NPS A;  3MUD A;  1SFC C;  1GL2 B;  3JSV C;  1FZC B;  3H1K D;  2KOD A;  2GDY A;  2B88 A;  3F5H A;  1J1E C;  1HY8 A;  2K92 A;  1BCC D;  2K9Y A;  3GW6 A;  1L0L E;  2R32 A;  3L71 J;  1K8A Q;  1Y9B A;  1OR5 A;  4L73 A;  3CC2 P;  1OX3 A;  1MFT A;  5AVZ B;  3MZW B;  1NU1 J;  1FDI A;  3L74 D;  2QJK B;  1TU3 F;  1FE6 A;  3O6Q B;  1Y47 A;  1N7S D;  1LT9 A;  3A0B E;  3WUT A;  1K04 A;  3L75 E;  4XFY A;  2WSC H;  3CXH D;  3RK2 B;  3CXH E;  1RQU A;  2QVA A;  3Q5R A;  5CCG A;  1WMK A;  5KTB A;  1S5L X;  1P84 H;  1M90 Q;  1NTZ J;  4H13 B;  1DIP A;  1W2B O;  1X3O A;  4A7P A;  1YQ3 C;  5GTI E;  2KI7 B;  3CX5 E;  3H32 A;  1IMQ A;  4N78 D;  5APU A;  2IFN A;  2WZ7 A;  2XT1 A;  1HTL C;  3PP5 A;  1H88 A;  1PP9 D;  4ZNC A;  1UNK A;  4ASV A;  2OYH B;  4U0D A;  3GHG A;  5CHX A;  2CPS A;  2W90 A;  5CCH A;  4OGQ D;  3GKL C;  1SLQ A;  3KXD A;  3VMZ A;  3CL3 D;  3C9I A;  4F37 A;  1HH0 A;  1OMI A;  1KOR A;  2LXB A;  2QSI A;  2MKV A;  1U7J A;  3NFQ A;  2HPC B;  2A45 H;  3CD6 P;  3RG2 A;  2R3S A;  3RBX A;  2O1K A;  5CCG D;  1RH5 B;  5CMZ A;  2O01 N;  2GUV A;  4D6T D;  2R44 A;  5E79 E;  1AV1 A;  5KLV D;  1QVG O;  4DZO A;  3EQ2 A;  2BCC E;  2ZXE B;  5AW8 B;  1RF0 A;  1IFD A;  3RK3 C;  1BDD A;  1BE3 D;  3USS A;  3SFE C;  3L72 E;  2WQY C;  1M56 D;  2E75 B;  5KKZ B;  1JO5 A;  4GR6 A;  1ZMB A;  2R5B A;  1AVY A;  4TT3 H;  2KOO A;  3EFF K;  1Q2N A;  4M0I A;  3H1J J;  2HPC A;  1SS1 A;  2J59 M;  5KAF E;  3IR9 A;  2OQQ A;  1EDI A;  1SQQ E;  1T6A A;  1VQ8 P;  2XV6 A;  2MY5 A;  1S72 P;  3HZQ A;  2KS1 A;  2N50 A;  2YKP A;  3CWB D;  2E43 A;  4OVN F;  1JB0 J;  1ZP0 C;  2E76 B;  2XU6 A;  2FVF A;  3CCE P;  1KB9 D;  5B5E H;  1X8Y A;  5M1B A;  3CLQ A;  2E42 A;  1EIA A;  1FOS F;  1FZC A;  2WVR A;  3SWF A;  2Q3E A;  2WPS A;  1PP9 J;  3TNU A;  1L0L K;  2YMK A;  5KJ7 A;  1UII A;  4U0A A;  5AW3 B;  5B66 E;  2NPS D;  4KJM A;  4C7R A;  1CW5 A;  3RK3 D;  4U3F E;  2KS1 B;  1HJ0 A;  2FFD B;  1SQB J;  4RKU J;  4UB6 H;  1RE3 A;  1H0T B;  3VMY A;  2A45 G;  4WBA A;  3L70 G;  2QIW A;  3AE6 C;  1HBW A;  2N6Y A;  2M3B A;  2E1M A;  2KNC A;  1U57 A;  4W80 A;  1OZH A;  1LNQ A;  1NWQ A;  1JY3 O;  2IYO A;  2P10 A;  2QJY C;  3GMA A;  2E76 C;  3L74 G;  1SQV G;  4JQ0 D;  4UB8 E;  4OGQ C;  2IDB A;  4BRY A;  1LTT C;  4H13 D;  2NZ2 A;  1RE4 C;  3B5N C;  4N6J A;  1VKU A;  1KQL A;  2L0Q A;  1L0L G;  3H1K J;  3PJS K;  5KJ7 D;  3RK3 B;  5AVX B;  2RH0 A;  1VL2 A;  1YIJ P;  4PXH B;  2HYN A;  4H2W C;  4IPY A;  4PD4 I;  4BPH A;  1M1J B;  1BGY G;  2OGU A;  3TK1 A;  2QRX A;  1RY3 A;  1PP9 G;  2D2C B;  1QVF O;  2N1T D;  2N1T A;  4JYC A;  1PV3 A;  2O01 J;  1W5C E;  1NTM J;  4H0L C;  3AE7 C;  3CCU P;  2D2C D;  3CE7 A;  2ZFC A;  2MVU A;  1DEE G;  1T3J A;  3JCU H;  1NKZ B;  3G28 A;  3DS0 A;  4WVZ A;  4YXW H;  1KFM A;  5KAF H;  1SQB D;  2PEK A;  4ZKP A;  1LWU B;  2L91 A;  1FDM A;  2JB0 A;  1M6E X;  5AVT B;  2PGD A;  3LID A;  3TGU J;  3V2P A;  3RL0 B;  2KW2 A;  1NTK D;  3I5C A;  1SQP K;  4H2Y C;  2QG4 A;  3H1H J;  4XFZ A;  5DCK A;  3CX5 D;  4GR2 A;  1L4A A;  4MRT C;  3HUS A;  1LGH B;  1XTG B;  2OYO A;  2N5H A;  2KLV A;  1ZRT D;  2QM7 A;  3R2P A;  5AW5 B;  5BS1 A;  1MKM A;  3CMA P;  3H1I J;  1PGP A;  2GA1 A;  1BXI A;  2Y9Z A;  2PNG A;  1PPJ D;  3LMO A;  3CWB J;  1PPJ E;  1LTG C;  1IFI A;  2CNR A;  3HRN A;  2Z5I A;  4I2L C;  3G29 A;  2VRS A;  5AW4 B;  1MUU A;  2FXM A;  3R4Y A;  3FXE A;  2WIT A;  4AQR D;  2XXM A;  3H32 B;  1PZQ A;  3M0D A;  2WPT A;  1NTK G;  1ZLL A;  2OYI B;  2PEM A;  1E79 H;  1SQV E;  2BCC D;  2FYU J;  2KZJ A;  1NTZ E;  1AQT A;  5KLV G;  1LTB C;  2EIA A;  2IZ0 A;  1L0N D;  1FZG A;  1N73 A;  3CI9 A;  2NPS C;  1M6N A;  2E76 D;  1LP1 B;  3IF4 A;  1KIL E;  1A8O A;  1KYO I;  1SQP D;  4N78 E;  1JCD A;  3L37 A;  3A0H E;  3BCC J;  2LPK A;  2KWL A;  2KNC B;  3GHG B;  1PGQ A;  2KOP A;  4XE5 B;  5JPA A;  2H88 C;  1HJB A;  5APV A;  1CI6 A;  4IL6 X;  1IK9 A;  1Q81 Q;  4GOF A;  1WRG A;  4WY4 A;  4EIJ A;  3DTJ A;  4U0B A;  4U3F J;  3SSU A;  3I55 P;  1VQO P;  1NKN A;  3OW2 O;  2CQ8 A;  3Q5P A;  1NU1 K;  3T97 A;  3EJE A;  1MZ9 A;  3LRY A;  2YNY A;  2JR8 A;  1PL5 A;  2KP8 A;  7CEI A;  1E6J P;  4K35 A;  2KOR A;  2WPV B;  1RE3 C;  2YIU B;  3EFG A;  4HJG H;  5AVR B;  3VP8 A;  5KLV K;  5KAI E;  2KG8 A;  4U0C A;  2M8P A;  1L0I A;  1CEI A;  3M0D C;  1KQF B;  2FQ1 A;  5HVC A;  1IZN B;  2FQ2 A;  1S3J A;  4H0L B;  2GZG A;  1SQQ G;  3BCC E;  2JWA A;  2P7J A;  2NO8 A;  2K94 A;  1DH3 A;  2JDI H;  3H25 A;  1ACP A;  4Y99 C;  3GHG C;  3T97 B;  1OFC X;  2GM4 A;  2M0B A;  3AE1 C;  3NMD A;  1KFN A;  2OTL P;  3M06 A;  1JJ2 O;  2BEQ D;  2WSE J;  2K1A A;  3S9O A;  4D6T J;  4BXL A;  2MJZ A;  1K30 A;  2XV5 A;  3L72 J;  1R5L A;  1BCC J;  4GOE A;  3EWK A;  2FKW B;  1HWT C;  1VQP P;  1SQP G;  3RG6 C;  1NGM B;  3L36 A;  1EXI A;  2H89 C;  2Q9I A;  3AEB C;  1N7L A;  1T3U A;  5AW9 B;  4L74 A;  1GTW A;  2K0X A;  2JYG A;  4IZ6 A;  1T2K C;  1KIL A;  3AE4 C;  1M74 A;  2FXO A;  1NH4 A;  4B86 A;  4GKG A;  1ZW0 A;  3TSI A;  5AW1 B;  3BRV B;  1JEK A;  1DNY A;  3MGN A;  4ASW A;  3AEC C;  2WPQ A;  4C7N B;  4QMA A;  2JO0 A; 
#chains in the Genus database with same CATH homology
 4M0I A;  3G4S P;  4XFY A;  2BUO A;  4PH1 A;  5I4T G;  3CXC O;  5F2K A;  2OTJ P;  1IUQ A;  1Q82 Q;  4WYM A;  1YJW P;  3MGE A;  3G29 A;  3HYB A;  2P9X A;  3DS1 A;  1YIT P;  4XRQ A;  1VQ8 P;  2BHV A;  2XV6 A;  5HGL A;  3CPW O;  1S72 P;  2QEX P;  2BQ1 E;  3HZQ A;  1K9M Q;  2XXM A;  1M90 Q;  1KQS O;  1W2B O;  1YIJ P;  5BS2 A;  4PH0 A;  1QRJ A;  4IPY A;  1EOQ A;  2PEQ A;  3CCE P;  2Z45 A;  2PEM A;  2JYL A;  1VQ9 P;  1PEM A;  3I56 P;  2PEI A;  1QVF O;  4U0E A;  1AUM A;  2OTL P;  2EIA A;  1EIA A;  1PEO A;  2XT1 A;  3NTE A;  1YHQ P;  3CC7 P;  3DS4 A;  1JJ2 O;  2ONT A;  3CCU P;  3VRL C;  1PEU A;  3DS5 A;  4U0F A;  1VQK P;  3WBH A;  3DS3 A;  3P05 A;  3CC4 P;  1M6N A;  1K30 A;  4U0D A;  4XFX A;  2QA4 P;  3G28 A;  3DS0 A;  3G26 A;  1A8O A;  2PEO A;  1RO2 A;  3E2D A;  2DGY A;  5HGN A;  4COP A;  4U0A A;  3G0V A;  5HGM A;  2Z44 A;  1NJI Q;  1KC8 Q;  1D1D A;  1VQP P;  1VQL P;  2LF4 A;  2PEK A;  3RG6 C;  3G1I A;  5JPA A;  5HGO A;  3CD6 P;  1RNI A;  1RO0 A;  1YJN P;  3CME P;  2CWO A;  1N8R Q;  1M6E X;  1VQN P;  1BAJ A;  3CCV P;  2EFJ A;  2PEJ A;  3G71 P;  2KOD A;  3CCQ P;  4COC A;  1Q81 Q;  1VQ4 P;  1VQ5 P;  2JYG A;  3Q20 A;  3DTJ A;  4U0B A;  4XFZ A;  3G21 A;  1PEQ A;  2Z46 A;  5DCK A;  1M74 A;  3I55 P;  1QVG O;  4GR2 A;  3CCS P;  2M8L A;  1VQO P;  3OW2 O;  2OAR A;  1K8A Q;  4QNB A;  5F2N A;  2EG5 A;  1VQM P;  1K73 Q;  3CCL P;  1YI2 P;  1A43 A;  1Q7Y Q;  3CC2 P;  2E1M A;  3H4E A;  3LRY A;  3G6E P;  3CCR P;  5BS1 A;  3M1M A;  5F2O A;  4XRO A;  1E6J P;  3CMA P;  1YJ9 P;  2M8N A;  1KD1 Q;  3CCJ P;  3H47 A;  1VQ6 P;  3H0D A;  2PEN A;  1Q86 Q;  3DPH A;  1M1K Q;  4GR6 A;  2PY8 A;  1VQ7 P;  1ZMB A;  3CCM P;  3G1G A;  4U0C A;  2M8P A;  3B5I A;  2JO0 A;  2L6E A;  3DS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...