2Z46A

Crystal structure of native-orf134
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
109
structure length
109
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
total genus 44
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z46A00
4GR6A 2PEIA 2PEOA 2PEKA 3RG6C 2Z44A 2PEMA 3HYBA 2PEJA 2Z46A 4GR2A 3Q20A 5BS2A 2Z45A 2PY8A 5BS1A 2PENA 2PEQA
chains in the Genus database with same CATH superfamily
2VLPA 5HGMA 3G0VA 4PH1A 2KR5A 3EJBA 3GZLA 1K8AQ 2OTJP 2FADA 2EFJA 4U0BA 3G4SP 4PH0A 2N5IA 2N50A 2LIWA 3EJDA 4XROA 5BS2A 3CPWO 4PXHB 2L0QA 1S72P 2MY5A 3GKLC 2FQ1A 2JO0A 4IZ6A 1VQOP 2JYLA 3NY7B 1GXGA 2FACA 1AYIA 2ROQA 5HV8A 1GXHA 3VRLC 3CD6P 4U0DA 3GJNA 2FHSC 5F2NA 3CCJP 1KLPA 2K94A 1A43A 2BHVA 1YITP 1Q81Q 2WPTA 4GR2A 3I56P 2JGPA 2M8PA 4NEOA 3HZQA 2KWLA 2MR7A 1N8RQ 5CZDB 3P05A 2FAEA 2FVFA 3RG2A 4HKGA 1QVFO 2OTLP 1YIJP 1VQLP 5KP6B 2OARA 5BS1A 4XFYA 4M0IA 3LRYA 2PEMA 3CCSP 1YI2P 1M1KQ 1AF8A 2PEQA 2GZFA 2VLQA 3DS1A 3CMAP 1HY8A 3G1GA 1UNKA 2E1MA 5KP7B 4H2XC 2Z44A 5F2OA 2KOSA 1YHQP 1W2BO 2L22A 1RO2A 2ONTA 3DS4A 1M6NA 3G26A 1F80D 1EIAA 2LF4A 2KGDA 2KG9A 1IUQA 1DV5A 1ZNVA 4DG9A 2LIUA 2NO8A 3I55P 1Q82Q 2KOPA 3G29A 1JJ2O 2EHTA 2KW2A 2L6EA 5HGNA 3WBHA 2KGAA 4GR6A 2L4BA 4BPFA 1KQSO 3CCRP 3DS5A 2EIAA 1VQ9P 2LL8A 4BPGA 1VQNP 2GDWA 2GZIA 2N5HA 3B4QA 1T8KA 3NTEA 5JPAA 2JAZA 2PNGA 1VQ7P 2CQ8A 2JQ4A 2GYKA 2AFEA 2FVEA 2PENA 5HVCA 2M8LA 2JU2A 3MGEA 5DCKA 3G71P 1YJWP 1UJZA 1EMVA 1BXIA 2M8NA 2CWOA 1KD1Q 1VKUA 2XT1A 2VLNA 7CEIA 2LKIA 4H2YC 1FR2A 4F37A 2GDXA 3H4EA 2XXMA 2K5XA 3CMEP 3CE7A 4U0CA 4QKOA 3DS3A 1QRJA 2P9XA 2VLOA 4PWVB 5EJDA 1IMPA 2QA4P 3G28A 1QVGO 2JBGA 2KODA 2GDYA 2QNWA 4U0EA 1Q7YQ 2GZGA 2KOQA 1Z6MA 1RNIA 4R0MA 2PEOA 3G21A 3CCQP 4XFZA 3CC4P 1M6EX 2FVAA 1YJ9P 2JYGA 2KOOA 3CXCO 4U0FA 2QEXP 3E2DA 2KORA 2GZEA 2N6YA 1M90Q 1NJIQ 2JB0A 1D1DA 1KC8Q 2LTEA 3RG6C 1BAJA 1AUMA 2Z46A 2JU1A 1DNYA 2EG5A 5F2KA 2K92A 2K93A 2DNWA 2Z45A 3CCVP 2FQ0A 1L0IA 4COCA 3G6EP 3DS0A 1VQMP 2AFDA 2KG8A 1YJNP 1VQKP 2XZ0D 4XFXA 2MR8A 4U0AA 2K0DX 1IMQA 1ACPA 2BUOA 2GZJA 4COPA 4XRQA 1K73Q 3CCEP 2AVAA 1VQ5P 2MD9A 1L0HA 2CNRA 2CG5B 2FQ2A 2XZ1C 4WYMA 5HGLA 2MF4A 3GZMA 2K2QA 3CC7P 2N98A 2KGCA 4BPHA 2K0YA 1MZ8A 4MRTC 2LMLA 2LOLA 2MVUA 4IPYA 1CEIA 2VSQA 3CCMP 1M74A 1GPJA 3G1IA 3Q20A 5HGOA 2PEKA 1X3OA 2X2BA 3CCLP 1VHNA 3DTJA 2AF8A 1VQPP 2CGQA 5EW5E 3CCUP 1E6JP 3LMOA 3CC2P 3EJEA 2LPKA 3B5IA 4QNBA 3OW2O 2ERHA 3H0DA 1VQ4P 2KG6A 2PEIA 1NQ4A 4H2WC 1VQ6P 3U43A 2XV6A 2EHSA 1OR5A 3DPHA 2L9FA 3M1MA 1K30A 4UHPB 1EOQA 1K9MQ 1A8OA 1E0HA 4CA3A 2K0XA 2KGEA 5KP8B 1ZMBA 2PY8A 3DS2A 1HQBA 2PEJA 2M5RA 5I4TG 2DGYA 1Q86Q 2N6ZA 1VQ8P 1RO0A 2MVVA 3HYBA 3H47A
chains in the Genus database with same CATH topology
5HGMA 1VQ5P 3G0VA 4PH1A 3G1GA 2XT1A 3H4EA 1K8AQ 2XXMA 4WYMA 2OTJP 5HGLA 2E1MA 3CMEP 2EFJA 4U0CA 4U0BA 3G4SP 4PH0A 2Z44A 5F2OA 3CC7P 1YHQP 3DS3A 1W2BO 1QRJA 2P9XA 1RO2A 2ONTA 3DS4A 4XROA 1M6NA 5BS2A 3CPWO 2QA4P 3G28A 1QVGO 3G26A 4IPYA 1EIAA 2LF4A 1S72P 2KODA 1IUQA 3CCMP 1M74A 4U0EA 1Q7YQ 3G1IA 3Q20A 1RNIA 5HGOA 2JO0A 1VQOP 2JYLA 2PEOA 2PEKA 3I55P 3G21A 3CCQP 4XFZA 3CCLP 3CC4P 1Q82Q 3DTJA 1M6EX 3G29A 1JJ2O 1VQPP 3VRLC 3CD6P 4U0DA 2L6EA 5HGNA 3CCUP 3WBHA 1E6JP 1YJ9P 2JYGA 5F2NA 4U0FA 3CXCO 3CCJP 2QEXP 1K73Q 3CC2P 3E2DA 4GR6A 3B5IA 1A43A 4QNBA 1M90Q 3OW2O 2BHVA 3H0DA 1YITP 1NJIQ 3CCRP 1KQSO 1VQ4P 2PEIA 3DS5A 2EIAA 1Q81Q 1KD1Q 1D1DA 4GR2A 3I56P 1VQ6P 1VQ9P 2XV6A 2M8PA 1KC8Q 3DPHA 3HZQA 3RG6C 1N8RQ 1BAJA 1AUMA 2Z46A 3P05A 3M1MA 1K30A 1VQNP 1EOQA 2OTLP 1QVFO 1YIJP 1K9MQ 1A8OA 1VQLP 2OARA 2EG5A 3NTEA 1ZMBA 2PY8A 3DS2A 4XFYA 5BS1A 5F2KA 4M0IA 3LRYA 5JPAA 2PEMA 1VQ7P 2PEJA 3CCSP 1YI2P 2Z45A 5I4TG 2PENA 2M8LA 3CCVP 1M1KQ 2DGYA 1Q86Q 4COCA 3G6EP 3DS0A 1VQMP 1YJNP 3MGEA 1VQ8P 5DCKA 1VQKP 1RO0A 2PEQA 4XFXA 3G71P 4U0AA 1YJWP 3DS1A 2BUOA 3CMAP 3HYBA 2M8NA 2CWOA 3H47A 4COPA 4XRQA 3CCEP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR6 A;  2PEI A;  2PEO A;  2PEK A;  3RG6 C;  2Z44 A;  2PEM A;  3HYB A;  2PEJ A;  2Z46 A;  4GR2 A;  3Q20 A;  5BS2 A;  2Z45 A;  2PY8 A;  5BS1 A;  2PEN A;  2PEQ A; 
#chains in the Genus database with same CATH topology
 2VLP A;  5HGM A;  3G0V A;  4PH1 A;  2KR5 A;  3EJB A;  3GZL A;  1K8A Q;  2OTJ P;  2FAD A;  2EFJ A;  4U0B A;  3G4S P;  4PH0 A;  2N5I A;  2N50 A;  2LIW A;  3EJD A;  4XRO A;  5BS2 A;  3CPW O;  4PXH B;  2L0Q A;  1S72 P;  2MY5 A;  3GKL C;  2FQ1 A;  2JO0 A;  4IZ6 A;  1VQO P;  2JYL A;  3NY7 B;  1GXG A;  2FAC A;  1AYI A;  2ROQ A;  5HV8 A;  1GXH A;  3VRL C;  3CD6 P;  4U0D A;  3GJN A;  2FHS C;  5F2N A;  3CCJ P;  1KLP A;  2K94 A;  1A43 A;  2BHV A;  1YIT P;  1Q81 Q;  2WPT A;  4GR2 A;  3I56 P;  2JGP A;  2M8P A;  4NEO A;  3HZQ A;  2KWL A;  2MR7 A;  1N8R Q;  5CZD B;  3P05 A;  2FAE A;  2FVF A;  3RG2 A;  4HKG A;  1QVF O;  2OTL P;  1YIJ P;  1VQL P;  5KP6 B;  2OAR A;  5BS1 A;  4XFY A;  4M0I A;  3LRY A;  2PEM A;  3CCS P;  1YI2 P;  1M1K Q;  1AF8 A;  2PEQ A;  2GZF A;  2VLQ A;  3DS1 A;  3CMA P;  1HY8 A;  3G1G A;  1UNK A;  2E1M A;  5KP7 B;  4H2X C;  2Z44 A;  5F2O A;  2KOS A;  1YHQ P;  1W2B O;  2L22 A;  1RO2 A;  2ONT A;  3DS4 A;  1M6N A;  3G26 A;  1F80 D;  1EIA A;  2LF4 A;  2KGD A;  2KG9 A;  1IUQ A;  1DV5 A;  1ZNV A;  4DG9 A;  2LIU A;  2NO8 A;  3I55 P;  1Q82 Q;  2KOP A;  3G29 A;  1JJ2 O;  2EHT A;  2KW2 A;  2L6E A;  5HGN A;  3WBH A;  2KGA A;  4GR6 A;  2L4B A;  4BPF A;  1KQS O;  3CCR P;  3DS5 A;  2EIA A;  1VQ9 P;  2LL8 A;  4BPG A;  1VQN P;  2GDW A;  2GZI A;  2N5H A;  3B4Q A;  1T8K A;  3NTE A;  5JPA A;  2JAZ A;  2PNG A;  1VQ7 P;  2CQ8 A;  2JQ4 A;  2GYK A;  2AFE A;  2FVE A;  2PEN A;  5HVC A;  2M8L A;  2JU2 A;  3MGE A;  5DCK A;  3G71 P;  1YJW P;  1UJZ A;  1EMV A;  1BXI A;  2M8N A;  2CWO A;  1KD1 Q;  1VKU A;  2XT1 A;  2VLN A;  7CEI A;  2LKI A;  4H2Y C;  1FR2 A;  4F37 A;  2GDX A;  3H4E A;  2XXM A;  2K5X A;  3CME P;  3CE7 A;  4U0C A;  4QKO A;  3DS3 A;  1QRJ A;  2P9X A;  2VLO A;  4PWV B;  5EJD A;  1IMP A;  2QA4 P;  3G28 A;  1QVG O;  2JBG A;  2KOD A;  2GDY A;  2QNW A;  4U0E A;  1Q7Y Q;  2GZG A;  2KOQ A;  1Z6M A;  1RNI A;  4R0M A;  2PEO A;  3G21 A;  3CCQ P;  4XFZ A;  3CC4 P;  1M6E X;  2FVA A;  1YJ9 P;  2JYG A;  2KOO A;  3CXC O;  4U0F A;  2QEX P;  3E2D A;  2KOR A;  2GZE A;  2N6Y A;  1M90 Q;  1NJI Q;  2JB0 A;  1D1D A;  1KC8 Q;  2LTE A;  3RG6 C;  1BAJ A;  1AUM A;  2Z46 A;  2JU1 A;  1DNY A;  2EG5 A;  5F2K A;  2K92 A;  2K93 A;  2DNW A;  2Z45 A;  3CCV P;  2FQ0 A;  1L0I A;  4COC A;  3G6E P;  3DS0 A;  1VQM P;  2AFD A;  2KG8 A;  1YJN P;  1VQK P;  2XZ0 D;  4XFX A;  2MR8 A;  4U0A A;  2K0D X;  1IMQ A;  1ACP A;  2BUO A;  2GZJ A;  4COP A;  4XRQ A;  1K73 Q;  3CCE P;  2AVA A;  1VQ5 P;  2MD9 A;  1L0H A;  2CNR A;  2CG5 B;  2FQ2 A;  2XZ1 C;  4WYM A;  5HGL A;  2MF4 A;  3GZM A;  2K2Q A;  3CC7 P;  2N98 A;  2KGC A;  4BPH A;  2K0Y A;  1MZ8 A;  4MRT C;  2LML A;  2LOL A;  2MVU A;  4IPY A;  1CEI A;  2VSQ A;  3CCM P;  1M74 A;  1GPJ A;  3G1I A;  3Q20 A;  5HGO A;  2PEK A;  1X3O A;  2X2B A;  3CCL P;  1VHN A;  3DTJ A;  2AF8 A;  1VQP P;  2CGQ A;  5EW5 E;  3CCU P;  1E6J P;  3LMO A;  3CC2 P;  3EJE A;  2LPK A;  3B5I A;  4QNB A;  3OW2 O;  2ERH A;  3H0D A;  1VQ4 P;  2KG6 A;  2PEI A;  1NQ4 A;  4H2W C;  1VQ6 P;  3U43 A;  2XV6 A;  2EHS A;  1OR5 A;  3DPH A;  2L9F A;  3M1M A;  1K30 A;  4UHP B;  1EOQ A;  1K9M Q;  1A8O A;  1E0H A;  4CA3 A;  2K0X A;  2KGE A;  5KP8 B;  1ZMB A;  2PY8 A;  3DS2 A;  1HQB A;  2PEJ A;  2M5R A;  5I4T G;  2DGY A;  1Q86 Q;  2N6Z A;  1VQ8 P;  1RO0 A;  2MVV A;  3HYB A;  3H47 A; 
#chains in the Genus database with same CATH homology
 5HGM A;  1VQ5 P;  3G0V A;  4PH1 A;  3G1G A;  2XT1 A;  3H4E A;  1K8A Q;  2XXM A;  4WYM A;  2OTJ P;  5HGL A;  2E1M A;  3CME P;  2EFJ A;  4U0C A;  4U0B A;  3G4S P;  4PH0 A;  2Z44 A;  5F2O A;  3CC7 P;  1YHQ P;  3DS3 A;  1W2B O;  1QRJ A;  2P9X A;  1RO2 A;  2ONT A;  3DS4 A;  4XRO A;  1M6N A;  5BS2 A;  3CPW O;  2QA4 P;  3G28 A;  1QVG O;  3G26 A;  4IPY A;  1EIA A;  2LF4 A;  1S72 P;  2KOD A;  1IUQ A;  3CCM P;  1M74 A;  4U0E A;  1Q7Y Q;  3G1I A;  3Q20 A;  1RNI A;  5HGO A;  2JO0 A;  1VQO P;  2JYL A;  2PEO A;  2PEK A;  3I55 P;  3G21 A;  3CCQ P;  4XFZ A;  3CCL P;  3CC4 P;  1Q82 Q;  3DTJ A;  1M6E X;  3G29 A;  1JJ2 O;  1VQP P;  3VRL C;  3CD6 P;  4U0D A;  2L6E A;  5HGN A;  3CCU P;  3WBH A;  1E6J P;  1YJ9 P;  2JYG A;  5F2N A;  4U0F A;  3CXC O;  3CCJ P;  2QEX P;  1K73 Q;  3CC2 P;  3E2D A;  4GR6 A;  3B5I A;  1A43 A;  4QNB A;  1M90 Q;  3OW2 O;  2BHV A;  3H0D A;  1YIT P;  1NJI Q;  3CCR P;  1KQS O;  1VQ4 P;  2PEI A;  3DS5 A;  2EIA A;  1Q81 Q;  1KD1 Q;  1D1D A;  4GR2 A;  3I56 P;  1VQ6 P;  1VQ9 P;  2XV6 A;  2M8P A;  1KC8 Q;  3DPH A;  3HZQ A;  3RG6 C;  1N8R Q;  1BAJ A;  1AUM A;  2Z46 A;  3P05 A;  3M1M A;  1K30 A;  1VQN P;  1EOQ A;  2OTL P;  1QVF O;  1YIJ P;  1K9M Q;  1A8O A;  1VQL P;  2OAR A;  2EG5 A;  3NTE A;  1ZMB A;  2PY8 A;  3DS2 A;  4XFY A;  5BS1 A;  5F2K A;  4M0I A;  3LRY A;  5JPA A;  2PEM A;  1VQ7 P;  2PEJ A;  3CCS P;  1YI2 P;  2Z45 A;  5I4T G;  2PEN A;  2M8L A;  3CCV P;  1M1K Q;  2DGY A;  1Q86 Q;  4COC A;  3G6E P;  3DS0 A;  1VQM P;  1YJN P;  3MGE A;  1VQ8 P;  5DCK A;  1VQK P;  1RO0 A;  2PEQ A;  4XFX A;  3G71 P;  4U0A A;  1YJW P;  3DS1 A;  2BUO A;  3CMA P;  3HYB A;  2M8N A;  2CWO A;  3H47 A;  4COP A;  4XRQ A;  3CCE P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...