2Z46A

Crystal structure of native-orf134
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
109
structure length
109
Chain Sequence
b'EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 44
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z46A00
2PEJA 3HYBA 2PEMA 4GR6A 3RG6C 2PENA 3Q20A 2Z45A 5BS2A 2PEKA 2Z46A 2PY8A 4GR2A 5BS1A 2PEOA 2Z44A 2PEIA 2PEQA
chains in the Genus database with same CATH superfamily
1VQKP 4BPFA 1N8RQ 3CC2P 1CEIA 3H4EA 2KOQA 3CCMP 2XZ1C 1M6EX 1M90Q 1AYIA 4QNBA 3CCLP 2VLPA 1NJIQ 1DNYA 1GPJA 2VLOA 1IMQA 4U0CA 2FHSC 1E6JP 2VSQA 1RNIA 2ONTA 3OW2O 4BPHA 2VLQA 2GDXA 5KP6B 2GZFA 4QKOA 2EIAA 2KOSA 1AF8A 2JQ4A 4NEOA 2FQ1A 3CMEP 3M1MA 4XFXA 3G29A 3I55P 2L9FA 2K0YA 1VQ6P 3EJEA 2MY5A 1IMPA 2KORA 2K2QA 3DS3A 2L6EA 3P05A 2CG5B 2MR7A 2DGYA 3G21A 2GZIA 2PEOA 1YIJP 1W2BO 2MR8A 2NO8A 1IUQA 2AF8A 4PH0A 1VQ4P 1EMVA 1K30A 2XT1A 2EFJA 3DPHA 4U0BA 4WYMA 5DCKA 1K8AQ 2KGEA 2K92A 1VQ7P 3CCJP 3Q20A 1T8KA 1MZ8A 1K9MQ 2KG6A 4IZ6A 3LRYA 2PNGA 1NQ4A 4M0IA 2AVAA 2JAZA 1X3OA 2GYKA 3CE7A 2AFDA 3B4QA 2KW2A 3G71P 2XXMA 2M8LA 4COCA 1M1KQ 4GR6A 2LKIA 4U0DA 5HVCA 4BPGA 5CZDB 2ROQA 1HQBA 1ZNVA 3DS2A 5HGNA 2JBGA 2KG9A 1Q86Q 1VHNA 3U43A 4H2WC 1VQ9P 7CEIA 1K73Q 4R0MA 3LMOA 1A8OA 2LL8A 3I56P 2LOLA 1VQPP 3CCUP 1RO0A 2K0DX 3CC7P 4MRTC 3DS0A 1VQMP 2X2BA 2KWLA 1VKUA 2JB0A 2JYGA 5EW5E 2MVUA 1L0HA 1FR2A 4XFYA 1YI2P 1RO2A 2EHTA 2GZEA 2OTJP 2AFEA 2JGPA 4DG9A 2PEKA 2EG5A 2K93A 2GDWA 2XV6A 1UJZA 2BUOA 4H2YC 1UNKA 5BS1A 3E2DA 1ACPA 4GR2A 2CQ8A 1VQ8P 5HGOA 1M6NA 3G4SP 1Q81Q 2KR5A 1OR5A 3GZLA 2Z44A 2PEIA 4U0FA 3VRLC 5HGMA 3WBHA 2PY8A 2DNWA 2CWOA 2FVFA 3CD6P 5HGLA 1BAJA 1QVFO 2PEMA 1DV5A 4H2XC 2LIWA 2FQ0A 1YITP 1YHQP 1Q7YQ 4UHPB 3GZMA 2E1MA 2KGAA 3GJNA 1JJ2O 2KGDA 2GZJA 2MD9A 1KLPA 2CNRA 2FAEA 2JYLA 3G1GA 4F37A 1F80D 2FQ2A 2N6ZA 3CXCO 3G28A 3RG2A 3CC4P 3CCQP 2LF4A 1A43A 3DS4A 2ERHA 3H47A 2K5XA 2N5HA 2GZGA 2KODA 1S72P 3DS5A 1YJ9P 2LMLA 1VQLP 4COPA 2JU1A 2LIUA 3G0VA 1L0IA 2LPKA 1Z6MA 1HY8A 2FADA 4U0AA 3CPWO 5HV8A 2FVAA 2PEQA 5BS2A 3G6EP 2QA4P 2KOPA 2N5IA 4XROA 4U0EA 2LTEA 3NTEA 2P9XA 5KP7B 2PENA 3HZQA 3MGEA 3EJBA 2BHVA 1ZMBA 4XFZA 5F2NA 1YJWP 2OTLP 2MF4A 3H0DA 2M8NA 2MVVA 4XRQA 2N50A 2Z45A 2GDYA 2N98A 2XZ0D 3NY7B 1QRJA 3CCVP 2L4BA 1KC8Q 2K0XA 5F2OA 3GKLC 1QVGO 1EIAA 1KD1Q 2Z46A 1E0HA 1D1DA 2L22A 1VQ5P 1M74A 2EHSA 4CA3A 5I4TG 1AUMA 1GXHA 2PEJA 1YJNP 2N6YA 1VQOP 3CCSP 1VQNP 3G26A 4HKGA 2QEXP 4PXHB 2M8PA 1EOQA 1Q82Q 5KP8B 2OARA 5EJDA 1BXIA 5F2KA 2WPTA 3HYBA 2JO0A 2M5RA 2K94A 2FVEA 3EJDA 3CCRP 2VLNA 2KOOA 2KG8A 3B5IA 1KQSO 3CCEP 2L0QA 3RG6C 2CGQA 4PH1A 3DTJA 2KGCA 2JU2A 1GXGA 3CMAP 3DS1A 3G1IA 4PWVB 4IPYA 5JPAA 2FACA 2QNWA
chains in the Genus database with same CATH topology
1VQKP 1N8RQ 1YITP 3CC2P 1M1KQ 4GR6A 4XRQA 3H4EA 2Z45A 1YHQP 1Q7YQ 4U0DA 3CCMP 1M6EX 1M90Q 2E1MA 1QRJA 4QNBA 3CCLP 3CCVP 1JJ2O 3DS2A 1NJIQ 5HGNA 1KC8Q 4U0CA 1Q86Q 5F2OA 1E6JP 1QVGO 1EIAA 2JYLA 1VQ9P 3G1GA 1RNIA 1K73Q 2ONTA 3OW2O 1A8OA 3I56P 3CXCO 1KD1Q 1VQPP 2Z46A 3CCUP 1D1DA 3G28A 1RO0A 1VQ5P 3CC7P 1M74A 3DS0A 3CC4P 1VQMP 2EIAA 5I4TG 1AUMA 2JYGA 2PEJA 1YJNP 3CCQP 2LF4A 1A43A 3DS4A 1VQOP 3CCSP 1VQNP 3CMEP 3M1MA 3H47A 4XFYA 4XFXA 3G26A 1YI2P 3G29A 2KODA 1S72P 3I55P 1RO2A 2OTJP 2QEXP 3DS5A 2M8PA 1YJ9P 1EOQA 1Q82Q 1VQLP 1VQ6P 4COPA 2OARA 2PEKA 2EG5A 3G0VA 3DS3A 2L6EA 2XV6A 5F2KA 3P05A 3HYBA 2JO0A 2DGYA 4U0AA 3G21A 2BUOA 2PEOA 1YIJP 1W2BO 3CPWO 1IUQA 3CCRP 5BS1A 4PH0A 2PEQA 3E2DA 1VQ4P 1K30A 5BS2A 2XT1A 2EFJA 4GR2A 3DPHA 4U0BA 3B5IA 4WYMA 1VQ8P 3G6EP 5HGOA 5DCKA 2QA4P 1M6NA 1K8AQ 1KQSO 3CCEP 4XROA 3G4SP 1Q81Q 4U0EA 3RG6C 4PH1A 1VQ7P 3CCJP 2Z44A 2PEIA 3DTJA 3NTEA 4U0FA 2P9XA 3VRLC 5HGMA 2PENA 3Q20A 3WBHA 3HZQA 3MGEA 2PY8A 3CMAP 2CWOA 3DS1A 3G1IA 1K9MQ 2BHVA 1ZMBA 3LRYA 3CD6P 4IPYA 5HGLA 5JPAA 4XFZA 4M0IA 1BAJA 5F2NA 1QVFO 1YJWP 2OTLP 2PEMA 3G71P 2XXMA 2M8LA 4COCA 3H0DA 2M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEJ A;  3HYB A;  2PEM A;  4GR6 A;  3RG6 C;  2PEN A;  3Q20 A;  2Z45 A;  5BS2 A;  2PEK A;  2Z46 A;  2PY8 A;  4GR2 A;  5BS1 A;  2PEO A;  2Z44 A;  2PEI A;  2PEQ A; 
#chains in the Genus database with same CATH topology
 1VQK P;  4BPF A;  1N8R Q;  3CC2 P;  1CEI A;  3H4E A;  2KOQ A;  3CCM P;  2XZ1 C;  1M6E X;  1M90 Q;  1AYI A;  4QNB A;  3CCL P;  2VLP A;  1NJI Q;  1DNY A;  1GPJ A;  2VLO A;  1IMQ A;  4U0C A;  2FHS C;  1E6J P;  2VSQ A;  1RNI A;  2ONT A;  3OW2 O;  4BPH A;  2VLQ A;  2GDX A;  5KP6 B;  2GZF A;  4QKO A;  2EIA A;  2KOS A;  1AF8 A;  2JQ4 A;  4NEO A;  2FQ1 A;  3CME P;  3M1M A;  4XFX A;  3G29 A;  3I55 P;  2L9F A;  2K0Y A;  1VQ6 P;  3EJE A;  2MY5 A;  1IMP A;  2KOR A;  2K2Q A;  3DS3 A;  2L6E A;  3P05 A;  2CG5 B;  2MR7 A;  2DGY A;  3G21 A;  2GZI A;  2PEO A;  1YIJ P;  1W2B O;  2MR8 A;  2NO8 A;  1IUQ A;  2AF8 A;  4PH0 A;  1VQ4 P;  1EMV A;  1K30 A;  2XT1 A;  2EFJ A;  3DPH A;  4U0B A;  4WYM A;  5DCK A;  1K8A Q;  2KGE A;  2K92 A;  1VQ7 P;  3CCJ P;  3Q20 A;  1T8K A;  1MZ8 A;  1K9M Q;  2KG6 A;  4IZ6 A;  3LRY A;  2PNG A;  1NQ4 A;  4M0I A;  2AVA A;  2JAZ A;  1X3O A;  2GYK A;  3CE7 A;  2AFD A;  3B4Q A;  2KW2 A;  3G71 P;  2XXM A;  2M8L A;  4COC A;  1M1K Q;  4GR6 A;  2LKI A;  4U0D A;  5HVC A;  4BPG A;  5CZD B;  2ROQ A;  1HQB A;  1ZNV A;  3DS2 A;  5HGN A;  2JBG A;  2KG9 A;  1Q86 Q;  1VHN A;  3U43 A;  4H2W C;  1VQ9 P;  7CEI A;  1K73 Q;  4R0M A;  3LMO A;  1A8O A;  2LL8 A;  3I56 P;  2LOL A;  1VQP P;  3CCU P;  1RO0 A;  2K0D X;  3CC7 P;  4MRT C;  3DS0 A;  1VQM P;  2X2B A;  2KWL A;  1VKU A;  2JB0 A;  2JYG A;  5EW5 E;  2MVU A;  1L0H A;  1FR2 A;  4XFY A;  1YI2 P;  1RO2 A;  2EHT A;  2GZE A;  2OTJ P;  2AFE A;  2JGP A;  4DG9 A;  2PEK A;  2EG5 A;  2K93 A;  2GDW A;  2XV6 A;  1UJZ A;  2BUO A;  4H2Y C;  1UNK A;  5BS1 A;  3E2D A;  1ACP A;  4GR2 A;  2CQ8 A;  1VQ8 P;  5HGO A;  1M6N A;  3G4S P;  1Q81 Q;  2KR5 A;  1OR5 A;  3GZL A;  2Z44 A;  2PEI A;  4U0F A;  3VRL C;  5HGM A;  3WBH A;  2PY8 A;  2DNW A;  2CWO A;  2FVF A;  3CD6 P;  5HGL A;  1BAJ A;  1QVF O;  2PEM A;  1DV5 A;  4H2X C;  2LIW A;  2FQ0 A;  1YIT P;  1YHQ P;  1Q7Y Q;  4UHP B;  3GZM A;  2E1M A;  2KGA A;  3GJN A;  1JJ2 O;  2KGD A;  2GZJ A;  2MD9 A;  1KLP A;  2CNR A;  2FAE A;  2JYL A;  3G1G A;  4F37 A;  1F80 D;  2FQ2 A;  2N6Z A;  3CXC O;  3G28 A;  3RG2 A;  3CC4 P;  3CCQ P;  2LF4 A;  1A43 A;  3DS4 A;  2ERH A;  3H47 A;  2K5X A;  2N5H A;  2GZG A;  2KOD A;  1S72 P;  3DS5 A;  1YJ9 P;  2LML A;  1VQL P;  4COP A;  2JU1 A;  2LIU A;  3G0V A;  1L0I A;  2LPK A;  1Z6M A;  1HY8 A;  2FAD A;  4U0A A;  3CPW O;  5HV8 A;  2FVA A;  2PEQ A;  5BS2 A;  3G6E P;  2QA4 P;  2KOP A;  2N5I A;  4XRO A;  4U0E A;  2LTE A;  3NTE A;  2P9X A;  5KP7 B;  2PEN A;  3HZQ A;  3MGE A;  3EJB A;  2BHV A;  1ZMB A;  4XFZ A;  5F2N A;  1YJW P;  2OTL P;  2MF4 A;  3H0D A;  2M8N A;  2MVV A;  4XRQ A;  2N50 A;  2Z45 A;  2GDY A;  2N98 A;  2XZ0 D;  3NY7 B;  1QRJ A;  3CCV P;  2L4B A;  1KC8 Q;  2K0X A;  5F2O A;  3GKL C;  1QVG O;  1EIA A;  1KD1 Q;  2Z46 A;  1E0H A;  1D1D A;  2L22 A;  1VQ5 P;  1M74 A;  2EHS A;  4CA3 A;  5I4T G;  1AUM A;  1GXH A;  2PEJ A;  1YJN P;  2N6Y A;  1VQO P;  3CCS P;  1VQN P;  3G26 A;  4HKG A;  2QEX P;  4PXH B;  2M8P A;  1EOQ A;  1Q82 Q;  5KP8 B;  2OAR A;  5EJD A;  1BXI A;  5F2K A;  2WPT A;  3HYB A;  2JO0 A;  2M5R A;  2K94 A;  2FVE A;  3EJD A;  3CCR P;  2VLN A;  2KOO A;  2KG8 A;  3B5I A;  1KQS O;  3CCE P;  2L0Q A;  3RG6 C;  2CGQ A;  4PH1 A;  3DTJ A;  2KGC A;  2JU2 A;  1GXG A;  3CMA P;  3DS1 A;  3G1I A;  4PWV B;  4IPY A;  5JPA A;  2FAC A;  2QNW A; 
#chains in the Genus database with same CATH homology
 1VQK P;  1N8R Q;  1YIT P;  3CC2 P;  1M1K Q;  4GR6 A;  4XRQ A;  3H4E A;  2Z45 A;  1YHQ P;  1Q7Y Q;  4U0D A;  3CCM P;  1M6E X;  1M90 Q;  2E1M A;  1QRJ A;  4QNB A;  3CCL P;  3CCV P;  1JJ2 O;  3DS2 A;  1NJI Q;  5HGN A;  1KC8 Q;  4U0C A;  1Q86 Q;  5F2O A;  1E6J P;  1QVG O;  1EIA A;  2JYL A;  1VQ9 P;  3G1G A;  1RNI A;  1K73 Q;  2ONT A;  3OW2 O;  1A8O A;  3I56 P;  3CXC O;  1KD1 Q;  1VQP P;  2Z46 A;  3CCU P;  1D1D A;  3G28 A;  1RO0 A;  1VQ5 P;  3CC7 P;  1M74 A;  3DS0 A;  3CC4 P;  1VQM P;  2EIA A;  5I4T G;  1AUM A;  2JYG A;  2PEJ A;  1YJN P;  3CCQ P;  2LF4 A;  1A43 A;  3DS4 A;  1VQO P;  3CCS P;  1VQN P;  3CME P;  3M1M A;  3H47 A;  4XFY A;  4XFX A;  3G26 A;  1YI2 P;  3G29 A;  2KOD A;  1S72 P;  3I55 P;  1RO2 A;  2OTJ P;  2QEX P;  3DS5 A;  2M8P A;  1YJ9 P;  1EOQ A;  1Q82 Q;  1VQL P;  1VQ6 P;  4COP A;  2OAR A;  2PEK A;  2EG5 A;  3G0V A;  3DS3 A;  2L6E A;  2XV6 A;  5F2K A;  3P05 A;  3HYB A;  2JO0 A;  2DGY A;  4U0A A;  3G21 A;  2BUO A;  2PEO A;  1YIJ P;  1W2B O;  3CPW O;  1IUQ A;  3CCR P;  5BS1 A;  4PH0 A;  2PEQ A;  3E2D A;  1VQ4 P;  1K30 A;  5BS2 A;  2XT1 A;  2EFJ A;  4GR2 A;  3DPH A;  4U0B A;  3B5I A;  4WYM A;  1VQ8 P;  3G6E P;  5HGO A;  5DCK A;  2QA4 P;  1M6N A;  1K8A Q;  1KQS O;  3CCE P;  4XRO A;  3G4S P;  1Q81 Q;  4U0E A;  3RG6 C;  4PH1 A;  1VQ7 P;  3CCJ P;  2Z44 A;  2PEI A;  3DTJ A;  3NTE A;  4U0F A;  2P9X A;  3VRL C;  5HGM A;  2PEN A;  3Q20 A;  3WBH A;  3HZQ A;  3MGE A;  2PY8 A;  3CMA P;  2CWO A;  3DS1 A;  3G1I A;  1K9M Q;  2BHV A;  1ZMB A;  3LRY A;  3CD6 P;  4IPY A;  5HGL A;  5JPA A;  4XFZ A;  4M0I A;  1BAJ A;  5F2N A;  1QVF O;  1YJW P;  2OTL P;  2PEM A;  3G71 P;  2XXM A;  2M8L A;  4COC A;  3H0D A;  2M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...