2Z46A

Crystal structure of native-orf134
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
109
structure length
109
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
molecule keywords ORF134
total genus 44
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z46A00
2PEJA 2PEOA 2PEKA 4GR6A 5BS1A 2PEQA 2PY8A 2Z44A 4GR2A 2Z46A 2PEMA 5BS2A 2PEIA 2PENA 3RG6C 3HYBA 3Q20A 2Z45A
chains in the Genus database with same CATH superfamily
5KP8B 3CPWO 1VQKP 3Q20A 2EHSA 1VQPP 1YITP 2LL8A 1QVGO 1IMPA 2FADA 2LIUA 2FQ0A 4PH0A 1F80D 1IUQA 3CCVP 2CWOA 1S72P 3MGEA 1DV5A 2FQ1A 2XT1A 1ACPA 3CCEP 4BPFA 2FVFA 2CGQA 2ROQA 2M5RA 1KC8Q 2PEJA 1AF8A 1HQBA 1EIAA 3H47A 3RG6C 4PH1A 2LTEA 1NQ4A 1BAJA 1VQ4P 2KODA 1QRJA 1VQ8P 4XROA 1VKUA 5HGMA 2VSQA 4BPHA 3I56P 2XXMA 1GXGA 1KQSO 4UHPB 2MR8A 2JB0A 2PEOA 1FR2A 1K8AQ 4XFXA 2M8LA 3OW2O 4BPGA 1QVFO 2JGPA 2KW2A 2VLOA 3DS3A 3GKLC 2MY5A 1VQLP 4COCA 2FAEA 2MVUA 2K5XA 1M74A 1N8RQ 4QNBA 1VQ5P 2EIAA 5BS1A 2GZJA 2OARA 1GXHA 2VLQA 4XRQA 2KORA 2K92A 3CE7A 2OTLP 4M0IA 2KWLA 2L22A 1Z6MA 3NY7B 2LIWA 3DTJA 2ONTA 3NTEA 1KD1Q 2MF4A 5HVCA 1A8OA 1VQ9P 2NO8A 1YIJP 2JYLA 5HV8A 4GR2A 1RNIA 3CMAP 3DPHA 2M8PA 3DS0A 2FVAA 4F37A 4XFYA 4PWVB 3CMEP 4WYMA 1OR5A 2FVEA 2DGYA 5F2KA 3DS1A 3CC7P 2GZFA 2GDYA 1AYIA 2VLPA 1YJNP 4PXHB 1VQMP 1YI2P 3CCSP 2CQ8A 4U0CA 1L0IA 2L9FA 3EJDA 2AVAA 2L6EA 2JQ4A 2GZGA 1E6JP 3HZQA 1EMVA 1KLPA 4NEOA 2N98A 1VQOP 1UJZA 1M1KQ 3G29A 2MVVA 1JJ2O 4U0BA 2GYKA 3G4SP 2K93A 2JU2A 2LOLA 2P9XA 2N5IA 2PEIA 1W2BO 2MR7A 3CCJP 2QA4P 2L0QA 2AF8A 1VHNA 2JU1A 1RO0A 1K30A 3LMOA 1ZMBA 2K0YA 3DS4A 4IPYA 2K0XA 4U0DA 2XZ1C 2L4BA 4CA3A 1RO2A 2N50A 1MZ8A 2KR5A 2AFEA 3G6EP 2X2BA 5CZDB 1BXIA 3VRLC 2XZ0D 4R0MA 1Q7YQ 2WPTA 2AFDA 2KGEA 2N5HA 1M6NA 2K0DX 3H0DA 1YHQP 1K73Q 3DS5A 1L0HA 1Q81Q 1A43A 2EHTA 5HGLA 3CD6P 1M90Q 2KOQA 2DNWA 5EJDA 4QKOA 3G71P 2KOOA 3CC4P 3H4EA 2GDXA 3CCLP 2FACA 2VLNA 2QEXP 1DNYA 2CG5B 3GZMA 3E2DA 3I55P 1VQ6P 2K94A 2CNRA 3M1MA 4U0FA 4U0AA 3GZLA 2PEKA 2PEQA 2PNGA 1D1DA 2KG9A 2LPKA 2Z45A 2OTJP 3EJEA 2GZIA 2JAZA 1Q82Q 2LF4A 2KG6A 3G1GA 5BS2A 4IZ6A 4COPA 2N6ZA 2Z44A 3LRYA 2BHVA 3HYBA 2E1MA 1X3OA 2K2QA 3U43A 3B5IA 2KGAA 5DCKA 4MRTC 3RG2A 2JBGA 5HGNA 4U0EA 4H2XC 5F2NA 1M6EX 4H2YC 3CCQP 3CCUP 2EG5A 2KGDA 2KOSA 2KG8A 2PEMA 5KP7B 1NJIQ 2GZEA 2XV6A 3G28A 1E0HA 2MD9A 3EJBA 1ZNVA 5I4TG 2KGCA 2FHSC 3CC2P 3GJNA 3CCMP 1CEIA 2N6YA 2KOPA 2LKIA 5HGOA 2QNWA 2LMLA 4HKGA 2EFJA 2JO0A 3WBHA 2GDWA 3P05A 5EW5E 4H2WC 1YJ9P 1Q86Q 4GR6A 1K9MQ 3CCRP 5JPAA 3DS2A 3G0VA 1HY8A 4XFZA 1IMQA 3G1IA 2M8NA 1T8KA 1UNKA 2JYGA 3CXCO 5F2OA 4DG9A 2BUOA 1VQ7P 3B4QA 1EOQA 2FQ2A 1VQNP 1AUMA 2Z46A 3G26A 1GPJA 1YJWP 7CEIA 5KP6B 2PY8A 2ERHA 2PENA 3G21A
chains in the Genus database with same CATH topology
2E1MA 2BHVA 2OARA 3B5IA 3CPWO 1RO0A 5DCKA 1K30A 1VQKP 4XRQA 3Q20A 1ZMBA 1VQPP 3DS4A 1YITP 2OTLP 4IPYA 1QVGO 4M0IA 4U0DA 5HGNA 4U0EA 1RO2A 5F2NA 1M6EX 3CCQP 4PH0A 3DTJA 2ONTA 3NTEA 3CCUP 3G6EP 1KD1Q 1IUQA 3CCVP 1A8OA 2CWOA 3MGEA 3VRLC 1S72P 2EG5A 1VQ9P 2XT1A 1Q7YQ 1YIJP 3CCEP 2JYLA 1M6NA 4GR2A 2PEMA 3H0DA 1RNIA 3CMAP 1YHQP 2PEJA 1KC8Q 1NJIQ 3DPHA 1EIAA 1K73Q 3H47A 2M8PA 2XV6A 3DS5A 3DS0A 3G28A 3RG6C 1Q81Q 1A43A 4PH1A 5I4TG 1BAJA 1VQ4P 2KODA 3CC2P 4XFYA 5HGLA 1QRJA 3CMEP 3CD6P 4WYMA 1M90Q 1VQ8P 2DGYA 3CCMP 5HGOA 4XROA 5F2KA 3DS1A 3CC7P 2EFJA 2JO0A 5HGMA 3WBHA 3G71P 3CC4P 3H4EA 1YJNP 3P05A 3CCLP 1VQMP 3I56P 1YI2P 2QEXP 2XXMA 3CCSP 4U0CA 1KQSO 1YJ9P 2L6EA 1Q86Q 1E6JP 4GR6A 2PEOA 3HZQA 1K8AQ 4XFXA 2M8LA 1K9MQ 3E2DA 3I55P 3CCRP 5JPAA 3G0VA 3DS2A 3OW2O 1VQ6P 3M1MA 4U0FA 4XFZA 4U0AA 1QVFO 3G1IA 2PEKA 2M8NA 2PEQA 2JYGA 3DS3A 3CXCO 1VQOP 1D1DA 2Z45A 5F2OA 1M1KQ 3G29A 1VQLP 1JJ2O 4U0BA 2OTJP 3G4SP 2BUOA 4COCA 1VQ7P 1EOQA 1Q82Q 2LF4A 1M74A 1N8RQ 2P9XA 1VQNP 1AUMA 2Z46A 2PEIA 4QNBA 1W2BO 3G1GA 5BS2A 3G26A 1YJWP 4COPA 3CCJP 1VQ5P 2EIAA 2Z44A 2PY8A 2QA4P 3LRYA 2PENA 5BS1A 3HYBA 3G21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEJ A;  2PEO A;  2PEK A;  4GR6 A;  5BS1 A;  2PEQ A;  2PY8 A;  2Z44 A;  4GR2 A;  2Z46 A;  2PEM A;  5BS2 A;  2PEI A;  2PEN A;  3RG6 C;  3HYB A;  3Q20 A;  2Z45 A; 
#chains in the Genus database with same CATH topology
 5KP8 B;  3CPW O;  1VQK P;  3Q20 A;  2EHS A;  1VQP P;  1YIT P;  2LL8 A;  1QVG O;  1IMP A;  2FAD A;  2LIU A;  2FQ0 A;  4PH0 A;  1F80 D;  1IUQ A;  3CCV P;  2CWO A;  1S72 P;  3MGE A;  1DV5 A;  2FQ1 A;  2XT1 A;  1ACP A;  3CCE P;  4BPF A;  2FVF A;  2CGQ A;  2ROQ A;  2M5R A;  1KC8 Q;  2PEJ A;  1AF8 A;  1HQB A;  1EIA A;  3H47 A;  3RG6 C;  4PH1 A;  2LTE A;  1NQ4 A;  1BAJ A;  1VQ4 P;  2KOD A;  1QRJ A;  1VQ8 P;  4XRO A;  1VKU A;  5HGM A;  2VSQ A;  4BPH A;  3I56 P;  2XXM A;  1GXG A;  1KQS O;  4UHP B;  2MR8 A;  2JB0 A;  2PEO A;  1FR2 A;  1K8A Q;  4XFX A;  2M8L A;  3OW2 O;  4BPG A;  1QVF O;  2JGP A;  2KW2 A;  2VLO A;  3DS3 A;  3GKL C;  2MY5 A;  1VQL P;  4COC A;  2FAE A;  2MVU A;  2K5X A;  1M74 A;  1N8R Q;  4QNB A;  1VQ5 P;  2EIA A;  5BS1 A;  2GZJ A;  2OAR A;  1GXH A;  2VLQ A;  4XRQ A;  2KOR A;  2K92 A;  3CE7 A;  2OTL P;  4M0I A;  2KWL A;  2L22 A;  1Z6M A;  3NY7 B;  2LIW A;  3DTJ A;  2ONT A;  3NTE A;  1KD1 Q;  2MF4 A;  5HVC A;  1A8O A;  1VQ9 P;  2NO8 A;  1YIJ P;  2JYL A;  5HV8 A;  4GR2 A;  1RNI A;  3CMA P;  3DPH A;  2M8P A;  3DS0 A;  2FVA A;  4F37 A;  4XFY A;  4PWV B;  3CME P;  4WYM A;  1OR5 A;  2FVE A;  2DGY A;  5F2K A;  3DS1 A;  3CC7 P;  2GZF A;  2GDY A;  1AYI A;  2VLP A;  1YJN P;  4PXH B;  1VQM P;  1YI2 P;  3CCS P;  2CQ8 A;  4U0C A;  1L0I A;  2L9F A;  3EJD A;  2AVA A;  2L6E A;  2JQ4 A;  2GZG A;  1E6J P;  3HZQ A;  1EMV A;  1KLP A;  4NEO A;  2N98 A;  1VQO P;  1UJZ A;  1M1K Q;  3G29 A;  2MVV A;  1JJ2 O;  4U0B A;  2GYK A;  3G4S P;  2K93 A;  2JU2 A;  2LOL A;  2P9X A;  2N5I A;  2PEI A;  1W2B O;  2MR7 A;  3CCJ P;  2QA4 P;  2L0Q A;  2AF8 A;  1VHN A;  2JU1 A;  1RO0 A;  1K30 A;  3LMO A;  1ZMB A;  2K0Y A;  3DS4 A;  4IPY A;  2K0X A;  4U0D A;  2XZ1 C;  2L4B A;  4CA3 A;  1RO2 A;  2N50 A;  1MZ8 A;  2KR5 A;  2AFE A;  3G6E P;  2X2B A;  5CZD B;  1BXI A;  3VRL C;  2XZ0 D;  4R0M A;  1Q7Y Q;  2WPT A;  2AFD A;  2KGE A;  2N5H A;  1M6N A;  2K0D X;  3H0D A;  1YHQ P;  1K73 Q;  3DS5 A;  1L0H A;  1Q81 Q;  1A43 A;  2EHT A;  5HGL A;  3CD6 P;  1M90 Q;  2KOQ A;  2DNW A;  5EJD A;  4QKO A;  3G71 P;  2KOO A;  3CC4 P;  3H4E A;  2GDX A;  3CCL P;  2FAC A;  2VLN A;  2QEX P;  1DNY A;  2CG5 B;  3GZM A;  3E2D A;  3I55 P;  1VQ6 P;  2K94 A;  2CNR A;  3M1M A;  4U0F A;  4U0A A;  3GZL A;  2PEK A;  2PEQ A;  2PNG A;  1D1D A;  2KG9 A;  2LPK A;  2Z45 A;  2OTJ P;  3EJE A;  2GZI A;  2JAZ A;  1Q82 Q;  2LF4 A;  2KG6 A;  3G1G A;  5BS2 A;  4IZ6 A;  4COP A;  2N6Z A;  2Z44 A;  3LRY A;  2BHV A;  3HYB A;  2E1M A;  1X3O A;  2K2Q A;  3U43 A;  3B5I A;  2KGA A;  5DCK A;  4MRT C;  3RG2 A;  2JBG A;  5HGN A;  4U0E A;  4H2X C;  5F2N A;  1M6E X;  4H2Y C;  3CCQ P;  3CCU P;  2EG5 A;  2KGD A;  2KOS A;  2KG8 A;  2PEM A;  5KP7 B;  1NJI Q;  2GZE A;  2XV6 A;  3G28 A;  1E0H A;  2MD9 A;  3EJB A;  1ZNV A;  5I4T G;  2KGC A;  2FHS C;  3CC2 P;  3GJN A;  3CCM P;  1CEI A;  2N6Y A;  2KOP A;  2LKI A;  5HGO A;  2QNW A;  2LML A;  4HKG A;  2EFJ A;  2JO0 A;  3WBH A;  2GDW A;  3P05 A;  5EW5 E;  4H2W C;  1YJ9 P;  1Q86 Q;  4GR6 A;  1K9M Q;  3CCR P;  5JPA A;  3DS2 A;  3G0V A;  1HY8 A;  4XFZ A;  1IMQ A;  3G1I A;  2M8N A;  1T8K A;  1UNK A;  2JYG A;  3CXC O;  5F2O A;  4DG9 A;  2BUO A;  1VQ7 P;  3B4Q A;  1EOQ A;  2FQ2 A;  1VQN P;  1AUM A;  2Z46 A;  3G26 A;  1GPJ A;  1YJW P;  7CEI A;  5KP6 B;  2PY8 A;  2ERH A;  2PEN A;  3G21 A; 
#chains in the Genus database with same CATH homology
 2E1M A;  2BHV A;  2OAR A;  3B5I A;  3CPW O;  1RO0 A;  5DCK A;  1K30 A;  1VQK P;  4XRQ A;  3Q20 A;  1ZMB A;  1VQP P;  3DS4 A;  1YIT P;  2OTL P;  4IPY A;  1QVG O;  4M0I A;  4U0D A;  5HGN A;  4U0E A;  1RO2 A;  5F2N A;  1M6E X;  3CCQ P;  4PH0 A;  3DTJ A;  2ONT A;  3NTE A;  3CCU P;  3G6E P;  1KD1 Q;  1IUQ A;  3CCV P;  1A8O A;  2CWO A;  3MGE A;  3VRL C;  1S72 P;  2EG5 A;  1VQ9 P;  2XT1 A;  1Q7Y Q;  1YIJ P;  3CCE P;  2JYL A;  1M6N A;  4GR2 A;  2PEM A;  3H0D A;  1RNI A;  3CMA P;  1YHQ P;  2PEJ A;  1KC8 Q;  1NJI Q;  3DPH A;  1EIA A;  1K73 Q;  3H47 A;  2M8P A;  2XV6 A;  3DS5 A;  3DS0 A;  3G28 A;  3RG6 C;  1Q81 Q;  1A43 A;  4PH1 A;  5I4T G;  1BAJ A;  1VQ4 P;  2KOD A;  3CC2 P;  4XFY A;  5HGL A;  1QRJ A;  3CME P;  3CD6 P;  4WYM A;  1M90 Q;  1VQ8 P;  2DGY A;  3CCM P;  5HGO A;  4XRO A;  5F2K A;  3DS1 A;  3CC7 P;  2EFJ A;  2JO0 A;  5HGM A;  3WBH A;  3G71 P;  3CC4 P;  3H4E A;  1YJN P;  3P05 A;  3CCL P;  1VQM P;  3I56 P;  1YI2 P;  2QEX P;  2XXM A;  3CCS P;  4U0C A;  1KQS O;  1YJ9 P;  2L6E A;  1Q86 Q;  1E6J P;  4GR6 A;  2PEO A;  3HZQ A;  1K8A Q;  4XFX A;  2M8L A;  1K9M Q;  3E2D A;  3I55 P;  3CCR P;  5JPA A;  3G0V A;  3DS2 A;  3OW2 O;  1VQ6 P;  3M1M A;  4U0F A;  4XFZ A;  4U0A A;  1QVF O;  3G1I A;  2PEK A;  2M8N A;  2PEQ A;  2JYG A;  3DS3 A;  3CXC O;  1VQO P;  1D1D A;  2Z45 A;  5F2O A;  1M1K Q;  3G29 A;  1VQL P;  1JJ2 O;  4U0B A;  2OTJ P;  3G4S P;  2BUO A;  4COC A;  1VQ7 P;  1EOQ A;  1Q82 Q;  2LF4 A;  1M74 A;  1N8R Q;  2P9X A;  1VQN P;  1AUM A;  2Z46 A;  2PEI A;  4QNB A;  1W2B O;  3G1G A;  5BS2 A;  3G26 A;  1YJW P;  4COP A;  3CCJ P;  1VQ5 P;  2EIA A;  2Z44 A;  2PY8 A;  2QA4 P;  3LRY A;  2PEN A;  5BS1 A;  3HYB A;  3G21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...