2Z46A

Crystal structure of native-orf134
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
109
structure length
109
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 44
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z46A00
3HYBA 4GR6A 2PENA 2PEMA 5BS1A 2PEQA 5BS2A 2PEIA 2PEJA 2PEKA 3RG6C 4GR2A 2PY8A 2Z45A 2Z44A 2PEOA 3Q20A 2Z46A
chains in the Genus database with same CATH superfamily
1EOQA 1RO2A 4U0FA 2KGEA 3CD6P 1QVGO 3DS5A 2MVUA 5KP8B 3EJDA 7CEIA 3OW2O 2ONTA 1YHQP 2LF4A 3RG2A 3GKLC 2K0XA 5DCKA 2GZEA 2MF4A 1L0IA 4U0EA 4BPGA 5HGOA 2QNWA 3CCVP 1FR2A 2PEOA 4GR6A 1GPJA 2X2BA 1X3OA 3CCQP 4XFYA 2XV6A 4QKOA 1YJ9P 2JU1A 5KP7B 2DNWA 3CC4P 2FHSC 2XXMA 3CCUP 1IUQA 2GDWA 3G26A 1KLPA 3RG6C 2LPKA 3CCJP 2E1MA 5KP6B 1M90Q 1VQ9P 2GYKA 4U0AA 5HGMA 1JJ2O 4F37A 3GZMA 2JYLA 3HYBA 2FQ0A 4DG9A 3CXCO 2XT1A 2N98A 1M1KQ 1RO0A 3CE7A 4XROA 3NTEA 3U43A 1S72P 3DS0A 1IMPA 2EIAA 1MZ8A 1Z6MA 2AFDA 1VQ6P 4PWVB 2KG8A 3CCLP 2EFJA 2FAEA 5I4TG 4R0MA 2ERHA 1ACPA 2LTEA 2VLOA 2KW2A 3E2DA 2PEKA 2Z44A 1Q7YQ 3G1IA 2KODA 3B5IA 4U0BA 1VQLP 2VLQA 1VQOP 3MGEA 5EJDA 1K8AQ 2LIUA 2K93A 3DS3A 4XFZA 2FVAA 2MR8A 2L22A 3G0VA 1KC8Q 4QNBA 2GZGA 1ZNVA 3G28A 1RNIA 4BPHA 2JAZA 1GXGA 3CPWO 1VKUA 2MY5A 2DGYA 1VQ8P 3EJEA 2KG6A 5BS2A 2JB0A 3WBHA 5HVCA 4M0IA 2EG5A 1AUMA 2KORA 4WYMA 2K0YA 1VHNA 2KGAA 3LRYA 5EW5E 2LMLA 2FVEA 1HY8A 4U0CA 1KD1Q 2JU2A 2L9FA 1EMVA 2N6ZA 4HKGA 4UHPB 2VSQA 2BUOA 1K30A 3HZQA 2Z45A 4CA3A 1BXIA 2KGDA 3G6EP 1HQBA 3CCEP 3Q20A 5BS1A 3I55P 1Q86Q 1VQMP 1E0HA 2L0QA 2MD9A 1UJZA 2N6YA 5F2KA 2PENA 2M8PA 5HV8A 1W2BO 2JGPA 2CQ8A 2KWLA 4COPA 2LOLA 4PH0A 4XRQA 3G4SP 1DV5A 3G21A 3H0DA 3H4EA 4GR2A 1E6JP 1QVFO 4COCA 3M1MA 1CEIA 4XFXA 2KOOA 1KQSO 1A43A 3EJBA 1YJNP 2KOQA 1VQ5P 2FACA 2M8NA 1L0HA 4H2YC 5F2OA 1EIAA 2CGQA 1IMQA 1M6NA 1M6EX 1Q82Q 1GXHA 1NJIQ 1VQPP 2MR7A 2CNRA 3NY7B 2CWOA 3CMAP 2AVAA 2LL8A 2GDYA 2CG5B 4H2XC 2M8LA 3CCMP 3G71P 5CZDB 2PY8A 4U0DA 2FQ2A 3DTJA 2QA4P 5F2NA 4PH1A 1Q81Q 2Z46A 3DS1A 2K0DX 2FQ1A 2KG9A 2LIWA 2WPTA 4H2WC 2N5HA 4BPFA 3LMOA 2MVVA 2N50A 1K73Q 1VQ4P 2JYGA 5JPAA 2LKIA 3B4QA 2GZIA 3VRLC 2FADA 2AF8A 4MRTC 1DNYA 2XZ0D 3G29A 3CCRP 4IPYA 1D1DA 2PEQA 2PEJA 1QRJA 2QEXP 2N5IA 2PEMA 3H47A 1YITP 1NQ4A 3I56P 2JBGA 3CMEP 1OR5A 2K92A 2PNGA 1YIJP 1YJWP 2K2QA 2KOSA 1VQKP 2L4BA 1YI2P 1VQNP 2VLPA 3DS2A 2EHTA 1BAJA 2OTJP 3CC7P 3CCSP 1N8RQ 1F80D 2VLNA 4NEOA 1ZMBA 5HGLA 2PEIA 2M5RA 1AF8A 1AYIA 2K94A 2L6EA 1K9MQ 2ROQA 3DS4A 3P05A 1A8OA 2GZFA 4IZ6A 2KGCA 1T8KA 1VQ7P 2OTLP 1UNKA 2K5XA 2AFEA 2NO8A 3GJNA 2JO0A 3G1GA 2GZJA 2KR5A 2GDXA 2KOPA 2JQ4A 3GZLA 3DPHA 2BHVA 2P9XA 4PXHB 2OARA 3CC2P 5HGNA 2XZ1C 2EHSA 1M74A 2FVFA
chains in the Genus database with same CATH topology
1EOQA 3VRLC 1RO2A 4U0FA 5BS1A 3CD6P 3G29A 3CCRP 4IPYA 1QVGO 1D1DA 3DS5A 3I55P 1Q86Q 1VQMP 2PEQA 3E2DA 2PEJA 2PEKA 3OW2O 2Z44A 1QRJA 2ONTA 1YHQP 2LF4A 5F2KA 2PENA 2M8PA 1Q7YQ 1W2BO 3G1IA 2KODA 3B5IA 2QEXP 5DCKA 4U0BA 1VQLP 1VQOP 3MGEA 4U0EA 4COPA 4PH0A 1K8AQ 4XRQA 2PEMA 3H47A 5HGOA 3G4SP 1YITP 3G21A 3H0DA 3I56P 3H4EA 4GR2A 1E6JP 3CCVP 3DS3A 3CMEP 2PEOA 1QVFO 4GR6A 4COCA 3M1MA 4XFZA 4XFXA 1YIJP 3G0VA 1KC8Q 1YJWP 4QNBA 1KQSO 1A43A 3G28A 1RNIA 3CCQP 4XFYA 2XV6A 1VQKP 1YJ9P 1YJNP 3CPWO 1VQ5P 1YI2P 1VQNP 2M8NA 3CC4P 3DS2A 1BAJA 5F2OA 2OTJP 1EIAA 2DGYA 3CC7P 2XXMA 1VQ8P 3CCUP 3CCSP 1IUQA 1N8RQ 3G26A 1M6NA 1M6EX 3RG6C 5BS2A 1Q82Q 3CCJP 1ZMBA 1NJIQ 1VQPP 2E1MA 5HGLA 2PEIA 2CWOA 3CMAP 3WBHA 4M0IA 2L6EA 1M90Q 1K9MQ 2EG5A 1VQ9P 1AUMA 3DS4A 4U0AA 3P05A 5HGMA 1JJ2O 1A8OA 2M8LA 3CCMP 3G71P 4WYMA 2PY8A 1VQ7P 2JYLA 2OTLP 3HYBA 3LRYA 4U0DA 3DTJA 2QA4P 5F2NA 2JO0A 3CXCO 3G1GA 4PH1A 2XT1A 1Q81Q 1M1KQ 2Z46A 3DS1A 4U0CA 1RO0A 1KD1Q 4XROA 3NTEA 3DPHA 2BHVA 1S72P 3DS0A 2EIAA 2P9XA 1VQ6P 2BUOA 1K30A 2OARA 3CC2P 3HZQA 5HGNA 2Z45A 3CCLP 2EFJA 1K73Q 1VQ4P 2JYGA 5JPAA 5I4TG 3G6EP 1M74A 3CCEP 3Q20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYB A;  4GR6 A;  2PEN A;  2PEM A;  5BS1 A;  2PEQ A;  5BS2 A;  2PEI A;  2PEJ A;  2PEK A;  3RG6 C;  4GR2 A;  2PY8 A;  2Z45 A;  2Z44 A;  2PEO A;  3Q20 A;  2Z46 A; 
#chains in the Genus database with same CATH topology
 1EOQ A;  1RO2 A;  4U0F A;  2KGE A;  3CD6 P;  1QVG O;  3DS5 A;  2MVU A;  5KP8 B;  3EJD A;  7CEI A;  3OW2 O;  2ONT A;  1YHQ P;  2LF4 A;  3RG2 A;  3GKL C;  2K0X A;  5DCK A;  2GZE A;  2MF4 A;  1L0I A;  4U0E A;  4BPG A;  5HGO A;  2QNW A;  3CCV P;  1FR2 A;  2PEO A;  4GR6 A;  1GPJ A;  2X2B A;  1X3O A;  3CCQ P;  4XFY A;  2XV6 A;  4QKO A;  1YJ9 P;  2JU1 A;  5KP7 B;  2DNW A;  3CC4 P;  2FHS C;  2XXM A;  3CCU P;  1IUQ A;  2GDW A;  3G26 A;  1KLP A;  3RG6 C;  2LPK A;  3CCJ P;  2E1M A;  5KP6 B;  1M90 Q;  1VQ9 P;  2GYK A;  4U0A A;  5HGM A;  1JJ2 O;  4F37 A;  3GZM A;  2JYL A;  3HYB A;  2FQ0 A;  4DG9 A;  3CXC O;  2XT1 A;  2N98 A;  1M1K Q;  1RO0 A;  3CE7 A;  4XRO A;  3NTE A;  3U43 A;  1S72 P;  3DS0 A;  1IMP A;  2EIA A;  1MZ8 A;  1Z6M A;  2AFD A;  1VQ6 P;  4PWV B;  2KG8 A;  3CCL P;  2EFJ A;  2FAE A;  5I4T G;  4R0M A;  2ERH A;  1ACP A;  2LTE A;  2VLO A;  2KW2 A;  3E2D A;  2PEK A;  2Z44 A;  1Q7Y Q;  3G1I A;  2KOD A;  3B5I A;  4U0B A;  1VQL P;  2VLQ A;  1VQO P;  3MGE A;  5EJD A;  1K8A Q;  2LIU A;  2K93 A;  3DS3 A;  4XFZ A;  2FVA A;  2MR8 A;  2L22 A;  3G0V A;  1KC8 Q;  4QNB A;  2GZG A;  1ZNV A;  3G28 A;  1RNI A;  4BPH A;  2JAZ A;  1GXG A;  3CPW O;  1VKU A;  2MY5 A;  2DGY A;  1VQ8 P;  3EJE A;  2KG6 A;  5BS2 A;  2JB0 A;  3WBH A;  5HVC A;  4M0I A;  2EG5 A;  1AUM A;  2KOR A;  4WYM A;  2K0Y A;  1VHN A;  2KGA A;  3LRY A;  5EW5 E;  2LML A;  2FVE A;  1HY8 A;  4U0C A;  1KD1 Q;  2JU2 A;  2L9F A;  1EMV A;  2N6Z A;  4HKG A;  4UHP B;  2VSQ A;  2BUO A;  1K30 A;  3HZQ A;  2Z45 A;  4CA3 A;  1BXI A;  2KGD A;  3G6E P;  1HQB A;  3CCE P;  3Q20 A;  5BS1 A;  3I55 P;  1Q86 Q;  1VQM P;  1E0H A;  2L0Q A;  2MD9 A;  1UJZ A;  2N6Y A;  5F2K A;  2PEN A;  2M8P A;  5HV8 A;  1W2B O;  2JGP A;  2CQ8 A;  2KWL A;  4COP A;  2LOL A;  4PH0 A;  4XRQ A;  3G4S P;  1DV5 A;  3G21 A;  3H0D A;  3H4E A;  4GR2 A;  1E6J P;  1QVF O;  4COC A;  3M1M A;  1CEI A;  4XFX A;  2KOO A;  1KQS O;  1A43 A;  3EJB A;  1YJN P;  2KOQ A;  1VQ5 P;  2FAC A;  2M8N A;  1L0H A;  4H2Y C;  5F2O A;  1EIA A;  2CGQ A;  1IMQ A;  1M6N A;  1M6E X;  1Q82 Q;  1GXH A;  1NJI Q;  1VQP P;  2MR7 A;  2CNR A;  3NY7 B;  2CWO A;  3CMA P;  2AVA A;  2LL8 A;  2GDY A;  2CG5 B;  4H2X C;  2M8L A;  3CCM P;  3G71 P;  5CZD B;  2PY8 A;  4U0D A;  2FQ2 A;  3DTJ A;  2QA4 P;  5F2N A;  4PH1 A;  1Q81 Q;  2Z46 A;  3DS1 A;  2K0D X;  2FQ1 A;  2KG9 A;  2LIW A;  2WPT A;  4H2W C;  2N5H A;  4BPF A;  3LMO A;  2MVV A;  2N50 A;  1K73 Q;  1VQ4 P;  2JYG A;  5JPA A;  2LKI A;  3B4Q A;  2GZI A;  3VRL C;  2FAD A;  2AF8 A;  4MRT C;  1DNY A;  2XZ0 D;  3G29 A;  3CCR P;  4IPY A;  1D1D A;  2PEQ A;  2PEJ A;  1QRJ A;  2QEX P;  2N5I A;  2PEM A;  3H47 A;  1YIT P;  1NQ4 A;  3I56 P;  2JBG A;  3CME P;  1OR5 A;  2K92 A;  2PNG A;  1YIJ P;  1YJW P;  2K2Q A;  2KOS A;  1VQK P;  2L4B A;  1YI2 P;  1VQN P;  2VLP A;  3DS2 A;  2EHT A;  1BAJ A;  2OTJ P;  3CC7 P;  3CCS P;  1N8R Q;  1F80 D;  2VLN A;  4NEO A;  1ZMB A;  5HGL A;  2PEI A;  2M5R A;  1AF8 A;  1AYI A;  2K94 A;  2L6E A;  1K9M Q;  2ROQ A;  3DS4 A;  3P05 A;  1A8O A;  2GZF A;  4IZ6 A;  2KGC A;  1T8K A;  1VQ7 P;  2OTL P;  1UNK A;  2K5X A;  2AFE A;  2NO8 A;  3GJN A;  2JO0 A;  3G1G A;  2GZJ A;  2KR5 A;  2GDX A;  2KOP A;  2JQ4 A;  3GZL A;  3DPH A;  2BHV A;  2P9X A;  4PXH B;  2OAR A;  3CC2 P;  5HGN A;  2XZ1 C;  2EHS A;  1M74 A;  2FVF A; 
#chains in the Genus database with same CATH homology
 1EOQ A;  3VRL C;  1RO2 A;  4U0F A;  5BS1 A;  3CD6 P;  3G29 A;  3CCR P;  4IPY A;  1QVG O;  1D1D A;  3DS5 A;  3I55 P;  1Q86 Q;  1VQM P;  2PEQ A;  3E2D A;  2PEJ A;  2PEK A;  3OW2 O;  2Z44 A;  1QRJ A;  2ONT A;  1YHQ P;  2LF4 A;  5F2K A;  2PEN A;  2M8P A;  1Q7Y Q;  1W2B O;  3G1I A;  2KOD A;  3B5I A;  2QEX P;  5DCK A;  4U0B A;  1VQL P;  1VQO P;  3MGE A;  4U0E A;  4COP A;  4PH0 A;  1K8A Q;  4XRQ A;  2PEM A;  3H47 A;  5HGO A;  3G4S P;  1YIT P;  3G21 A;  3H0D A;  3I56 P;  3H4E A;  4GR2 A;  1E6J P;  3CCV P;  3DS3 A;  3CME P;  2PEO A;  1QVF O;  4GR6 A;  4COC A;  3M1M A;  4XFZ A;  4XFX A;  1YIJ P;  3G0V A;  1KC8 Q;  1YJW P;  4QNB A;  1KQS O;  1A43 A;  3G28 A;  1RNI A;  3CCQ P;  4XFY A;  2XV6 A;  1VQK P;  1YJ9 P;  1YJN P;  3CPW O;  1VQ5 P;  1YI2 P;  1VQN P;  2M8N A;  3CC4 P;  3DS2 A;  1BAJ A;  5F2O A;  2OTJ P;  1EIA A;  2DGY A;  3CC7 P;  2XXM A;  1VQ8 P;  3CCU P;  3CCS P;  1IUQ A;  1N8R Q;  3G26 A;  1M6N A;  1M6E X;  3RG6 C;  5BS2 A;  1Q82 Q;  3CCJ P;  1ZMB A;  1NJI Q;  1VQP P;  2E1M A;  5HGL A;  2PEI A;  2CWO A;  3CMA P;  3WBH A;  4M0I A;  2L6E A;  1M90 Q;  1K9M Q;  2EG5 A;  1VQ9 P;  1AUM A;  3DS4 A;  4U0A A;  3P05 A;  5HGM A;  1JJ2 O;  1A8O A;  2M8L A;  3CCM P;  3G71 P;  4WYM A;  2PY8 A;  1VQ7 P;  2JYL A;  2OTL P;  3HYB A;  3LRY A;  4U0D A;  3DTJ A;  2QA4 P;  5F2N A;  2JO0 A;  3CXC O;  3G1G A;  4PH1 A;  2XT1 A;  1Q81 Q;  1M1K Q;  2Z46 A;  3DS1 A;  4U0C A;  1RO0 A;  1KD1 Q;  4XRO A;  3NTE A;  3DPH A;  2BHV A;  1S72 P;  3DS0 A;  2EIA A;  2P9X A;  1VQ6 P;  2BUO A;  1K30 A;  2OAR A;  3CC2 P;  3HZQ A;  5HGN A;  2Z45 A;  3CCL P;  2EFJ A;  1K73 Q;  1VQ4 P;  2JYG A;  5JPA A;  5I4T G;  3G6E P;  1M74 A;  3CCE P;  3Q20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...