2GZEA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y55a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
b'KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYAPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y55A)
rcsb
molecule keywords Colicin-E9 immunity protein
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzeA00
2ERHA 2K5XA 1AYIA 1BXIA 2WPTA 2JB0A 3U43A 7CEIA 2GZEA 1CEIA 2GZJA 2GZGA 5EW5E 1EMVA 1GXHA 1UNKA 4QKOA 2VLOA 1FR2A 1E0HA 2GZIA 1UJZA 2JBGA 4F37A 2VLQA 2GYKA 1IMQA 1GXGA 2K0DX 3GJNA 3GKLC 4UHPB 1MZ8A 2JAZA 1ZNVA 2NO8A 2GZFA 2VLNA 2VLPA 1IMPA
chains in the Genus database with same CATH superfamily
2X2BA 1VQKP 2KWLA 4U0AA 5HV8A 3U43A 3LMOA 4NEOA 3CMAP 3CCJP 1Q7YQ 1GXHA 2KW2A 5EJDA 1N8RQ 2XT1A 2PEKA 2KGDA 4U0EA 2FQ1A 3CCMP 3M1MA 1Z6MA 1NJIQ 1KC8Q 3LRYA 2CWOA 2BHVA 4U0DA 4PXHB 3CC2P 1EOQA 4COCA 1VQNP 1RO2A 3RG6C 1YJWP 2GZJA 4GR2A 2GZGA 5KP6B 1YJ9P 1FR2A 3CE7A 2PEOA 1NQ4A 2AFEA 1A8OA 3G71P 2K0DX 1D1DA 2BUOA 3G21A 4UHPB 1IMPA 2K93A 3GZMA 1M74A 2M8NA 1K30A 2AF8A 3E2DA 4CA3A 1A43A 5F2NA 2GZEA 2XZ1C 2OTJP 2QEXP 1RNIA 2KG6A 3GJNA 3I56P 2FHSC 2NO8A 2PENA 3B4QA 1S72P 2CGQA 1YITP 3H0DA 5HGNA 2QA4P 1CEIA 2KGEA 1W2BO 2JU1A 1L0HA 1YJNP 2QNWA 2MD9A 2L6EA 1AUMA 4DG9A 2FADA 2AFDA 3RG2A 4QNBA 1M6NA 3CMEP 2FVEA 2VLOA 5HGMA 1YHQP 3G28A 1Q86Q 3G1GA 2MVVA 3G26A 2KORA 2P9XA 3H47A 3DPHA 2VLPA 3EJDA 4XROA 1OR5A 2KR5A 4XRQA 1DV5A 3B5IA 4PH0A 2OARA 3CCUP 1BAJA 2N5HA 4QKOA 4GR6A 2JBGA 2XV6A 1L0IA 2L9FA 2JAZA 1E6JP 1X3OA 2JGPA 2LF4A 1KD1Q 4U0CA 1VHNA 2GDYA 2N5IA 2N6YA 2K94A 3MGEA 1QVGO 3HZQA 1EMVA 2LIWA 5BS2A 2K0XA 3NTEA 5HVCA 1HQBA 2MF4A 2PNGA 2CQ8A 4R0MA 5JPAA 1BXIA 2WPTA 4U0FA 2ROQA 4M0IA 1ZMBA 4U0BA 5EW5E 1VQMP 2KGCA 3CCRP 1VQ7P 1VQLP 2JO0A 3DS1A 3CPWO 2EIAA 1K73Q 2KOQA 2LTEA 3G6EP 4XFXA 1T8KA 2Z44A 5HGOA 3CC4P 2LIUA 2FVFA 4PH1A 1RO0A 2MVUA 3P05A 1IUQA 2PEMA 2CNRA 4F37A 2GYKA 1IMQA 1VQ8P 2PY8A 5CZDB 1F80D 2JYLA 2VLNA 3G4SP 4IZ6A 5F2KA 2L4BA 2GDXA 5I4TG 2MR7A 3CXCO 1KQSO 1HY8A 3NY7B 4COPA 2LL8A 2GZIA 3DS3A 1MZ8A 2XZ0D 2ONTA 5KP7B 2LOLA 1M90Q 2LMLA 4WYMA 2XXMA 2PEIA 5F2OA 2E1MA 2GDWA 4IPYA 3HYBA 5DCKA 4BPHA 2FVAA 1GPJA 2K92A 1AYIA 3CC7P 3CD6P 2M5RA 4XFZA 2KG9A 2KOOA 1VKUA 3DS5A 7CEIA 1JJ2O 3G0VA 4HKGA 1UNKA 3VRLC 4BPGA 1VQ9P 3G29A 1E0HA 1UJZA 4H2YC 1Q82Q 2VSQA 2KG8A 3CCQP 2PEJA 1YIJP 2M8PA 2K0YA 2N98A 3CCVP 2DNWA 2KOPA 3EJEA 1VQ6P 3DS2A 2FACA 2L22A 2FAEA 1DNYA 1VQOP 2EHTA 2MY5A 1YI2P 1M6EX 2GZFA 3Q20A 4MRTC 4H2WC 3I55P 3DS0A 1EIAA 2JB0A 2JU2A 2N6ZA 2FQ2A 2LPKA 2EHSA 5KP8B 2MR8A 1VQPP 2EFJA 2Z46A 2AVAA 2K2QA 3DTJA 4H2XC 1Q81Q 1K9MQ 4XFYA 1KLPA 3CCEP 1ZNVA 3CCSP 1QRJA 2M8LA 2EG5A 2KOSA 2N50A 1M1KQ 4PWVB 3WBHA 1AF8A 4BPFA 2DGYA 5HGLA 2CG5B 1VQ5P 3H4EA 2FQ0A 1VQ4P 2PEQA 2VLQA 1GXGA 2JQ4A 2LKIA 3GKLC 3GZLA 2L0QA 2KODA 2Z45A 2ERHA 3CCLP 2K5XA 3G1IA 3OW2O 3DS4A 1QVFO 2OTLP 2KGAA 2JYGA 5BS1A 1K8AQ 3EJBA 1ACPA
chains in the Genus database with same CATH topology
2ERHA 2K5XA 1AYIA 1BXIA 2WPTA 2JB0A 3U43A 7CEIA 2GZEA 1CEIA 2GZJA 2GZGA 5EW5E 1EMVA 1GXHA 1UNKA 4QKOA 2VLOA 1FR2A 1E0HA 2GZIA 1UJZA 2JBGA 4F37A 2VLQA 2GYKA 1IMQA 1GXGA 2K0DX 3GJNA 3GKLC 4UHPB 1MZ8A 2JAZA 1ZNVA 2NO8A 2GZFA 2VLNA 2VLPA 1IMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERH A;  2K5X A;  1AYI A;  1BXI A;  2WPT A;  2JB0 A;  3U43 A;  7CEI A;  2GZE A;  1CEI A;  2GZJ A;  2GZG A;  5EW5 E;  1EMV A;  1GXH A;  1UNK A;  4QKO A;  2VLO A;  1FR2 A;  1E0H A;  2GZI A;  1UJZ A;  2JBG A;  4F37 A;  2VLQ A;  2GYK A;  1IMQ A;  1GXG A;  2K0D X;  3GJN A;  3GKL C;  4UHP B;  1MZ8 A;  2JAZ A;  1ZNV A;  2NO8 A;  2GZF A;  2VLN A;  2VLP A;  1IMP A; 
#chains in the Genus database with same CATH topology
 2X2B A;  1VQK P;  2KWL A;  4U0A A;  5HV8 A;  3U43 A;  3LMO A;  4NEO A;  3CMA P;  3CCJ P;  1Q7Y Q;  1GXH A;  2KW2 A;  5EJD A;  1N8R Q;  2XT1 A;  2PEK A;  2KGD A;  4U0E A;  2FQ1 A;  3CCM P;  3M1M A;  1Z6M A;  1NJI Q;  1KC8 Q;  3LRY A;  2CWO A;  2BHV A;  4U0D A;  4PXH B;  3CC2 P;  1EOQ A;  4COC A;  1VQN P;  1RO2 A;  3RG6 C;  1YJW P;  2GZJ A;  4GR2 A;  2GZG A;  5KP6 B;  1YJ9 P;  1FR2 A;  3CE7 A;  2PEO A;  1NQ4 A;  2AFE A;  1A8O A;  3G71 P;  2K0D X;  1D1D A;  2BUO A;  3G21 A;  4UHP B;  1IMP A;  2K93 A;  3GZM A;  1M74 A;  2M8N A;  1K30 A;  2AF8 A;  3E2D A;  4CA3 A;  1A43 A;  5F2N A;  2GZE A;  2XZ1 C;  2OTJ P;  2QEX P;  1RNI A;  2KG6 A;  3GJN A;  3I56 P;  2FHS C;  2NO8 A;  2PEN A;  3B4Q A;  1S72 P;  2CGQ A;  1YIT P;  3H0D A;  5HGN A;  2QA4 P;  1CEI A;  2KGE A;  1W2B O;  2JU1 A;  1L0H A;  1YJN P;  2QNW A;  2MD9 A;  2L6E A;  1AUM A;  4DG9 A;  2FAD A;  2AFD A;  3RG2 A;  4QNB A;  1M6N A;  3CME P;  2FVE A;  2VLO A;  5HGM A;  1YHQ P;  3G28 A;  1Q86 Q;  3G1G A;  2MVV A;  3G26 A;  2KOR A;  2P9X A;  3H47 A;  3DPH A;  2VLP A;  3EJD A;  4XRO A;  1OR5 A;  2KR5 A;  4XRQ A;  1DV5 A;  3B5I A;  4PH0 A;  2OAR A;  3CCU P;  1BAJ A;  2N5H A;  4QKO A;  4GR6 A;  2JBG A;  2XV6 A;  1L0I A;  2L9F A;  2JAZ A;  1E6J P;  1X3O A;  2JGP A;  2LF4 A;  1KD1 Q;  4U0C A;  1VHN A;  2GDY A;  2N5I A;  2N6Y A;  2K94 A;  3MGE A;  1QVG O;  3HZQ A;  1EMV A;  2LIW A;  5BS2 A;  2K0X A;  3NTE A;  5HVC A;  1HQB A;  2MF4 A;  2PNG A;  2CQ8 A;  4R0M A;  5JPA A;  1BXI A;  2WPT A;  4U0F A;  2ROQ A;  4M0I A;  1ZMB A;  4U0B A;  5EW5 E;  1VQM P;  2KGC A;  3CCR P;  1VQ7 P;  1VQL P;  2JO0 A;  3DS1 A;  3CPW O;  2EIA A;  1K73 Q;  2KOQ A;  2LTE A;  3G6E P;  4XFX A;  1T8K A;  2Z44 A;  5HGO A;  3CC4 P;  2LIU A;  2FVF A;  4PH1 A;  1RO0 A;  2MVU A;  3P05 A;  1IUQ A;  2PEM A;  2CNR A;  4F37 A;  2GYK A;  1IMQ A;  1VQ8 P;  2PY8 A;  5CZD B;  1F80 D;  2JYL A;  2VLN A;  3G4S P;  4IZ6 A;  5F2K A;  2L4B A;  2GDX A;  5I4T G;  2MR7 A;  3CXC O;  1KQS O;  1HY8 A;  3NY7 B;  4COP A;  2LL8 A;  2GZI A;  3DS3 A;  1MZ8 A;  2XZ0 D;  2ONT A;  5KP7 B;  2LOL A;  1M90 Q;  2LML A;  4WYM A;  2XXM A;  2PEI A;  5F2O A;  2E1M A;  2GDW A;  4IPY A;  3HYB A;  5DCK A;  4BPH A;  2FVA A;  1GPJ A;  2K92 A;  1AYI A;  3CC7 P;  3CD6 P;  2M5R A;  4XFZ A;  2KG9 A;  2KOO A;  1VKU A;  3DS5 A;  7CEI A;  1JJ2 O;  3G0V A;  4HKG A;  1UNK A;  3VRL C;  4BPG A;  1VQ9 P;  3G29 A;  1E0H A;  1UJZ A;  4H2Y C;  1Q82 Q;  2VSQ A;  2KG8 A;  3CCQ P;  2PEJ A;  1YIJ P;  2M8P A;  2K0Y A;  2N98 A;  3CCV P;  2DNW A;  2KOP A;  3EJE A;  1VQ6 P;  3DS2 A;  2FAC A;  2L22 A;  2FAE A;  1DNY A;  1VQO P;  2EHT A;  2MY5 A;  1YI2 P;  1M6E X;  2GZF A;  3Q20 A;  4MRT C;  4H2W C;  3I55 P;  3DS0 A;  1EIA A;  2JB0 A;  2JU2 A;  2N6Z A;  2FQ2 A;  2LPK A;  2EHS A;  5KP8 B;  2MR8 A;  1VQP P;  2EFJ A;  2Z46 A;  2AVA A;  2K2Q A;  3DTJ A;  4H2X C;  1Q81 Q;  1K9M Q;  4XFY A;  1KLP A;  3CCE P;  1ZNV A;  3CCS P;  1QRJ A;  2M8L A;  2EG5 A;  2KOS A;  2N50 A;  1M1K Q;  4PWV B;  3WBH A;  1AF8 A;  4BPF A;  2DGY A;  5HGL A;  2CG5 B;  1VQ5 P;  3H4E A;  2FQ0 A;  1VQ4 P;  2PEQ A;  2VLQ A;  1GXG A;  2JQ4 A;  2LKI A;  3GKL C;  3GZL A;  2L0Q A;  2KOD A;  2Z45 A;  2ERH A;  3CCL P;  2K5X A;  3G1I A;  3OW2 O;  3DS4 A;  1QVF O;  2OTL P;  2KGA A;  2JYG A;  5BS1 A;  1K8A Q;  3EJB A;  1ACP A; 
#chains in the Genus database with same CATH homology
 2ERH A;  2K5X A;  1AYI A;  1BXI A;  2WPT A;  2JB0 A;  3U43 A;  7CEI A;  2GZE A;  1CEI A;  2GZJ A;  2GZG A;  5EW5 E;  1EMV A;  1GXH A;  1UNK A;  4QKO A;  2VLO A;  1FR2 A;  1E0H A;  2GZI A;  1UJZ A;  2JBG A;  4F37 A;  2VLQ A;  2GYK A;  1IMQ A;  1GXG A;  2K0D X;  3GJN A;  3GKL C;  4UHP B;  1MZ8 A;  2JAZ A;  1ZNV A;  2NO8 A;  2GZF A;  2VLN A;  2VLP A;  1IMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...