2GZEA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y55a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYAPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic/antibiotic inhibitor
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y55A)
rcsb
source organism Escherichia coli k12
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzeA00
1GXHA 2GZGA 5EW5E 2GYKA 2NO8A 1ZNVA 3GJNA 1UNKA 2GZEA 1EMVA 1MZ8A 2GZFA 2JAZA 2WPTA 7CEIA 4QKOA 3U43A 1BXIA 4F37A 2ERHA 2K5XA 2JBGA 2VLNA 2VLPA 1FR2A 1IMQA 4UHPB 1E0HA 2VLOA 2VLQA 1UJZA 1CEIA 2K0DX 1IMPA 2GZIA 2JB0A 3GKLC 1GXGA 2GZJA 1AYIA
chains in the Genus database with same CATH superfamily
3Q20A 3H0DA 2KGEA 3WBHA 5F2KA 2GZEA 1QRJA 1DNYA 4MRTC 3CD6P 5HVCA 2QA4P 3DPHA 2FQ2A 2ERHA 5HGMA 3CC7P 1VQPP 5BS2A 3CCUP 4R0MA 1A43A 3NY7B 2PEOA 2PEMA 4CA3A 2M8PA 2GYKA 2MR8A 4U0CA 2KG9A 1Q81Q 3NTEA 4BPGA 2MVUA 3U43A 4WYMA 1K8AQ 3DS1A 1YIJP 4UHPB 2PY8A 3G29A 1CEIA 2K0DX 3EJEA 1BAJA 2FQ1A 2GDXA 1EOQA 4QNBA 5HGOA 1GPJA 2MR7A 2FACA 1T8KA 4M0IA 2MY5A 3CC4P 1E0HA 1ZMBA 2FQ0A 2MF4A 4IZ6A 2KOOA 2MVVA 3CCQP 2CQ8A 1K9MQ 1RNIA 3DTJA 3CCLP 4F37A 1M6EX 2KODA 2VLPA 2JU2A 1N8RQ 4NEOA 1L0IA 1YITP 1GXGA 1VQ5P 4U0BA 2NO8A 2OTJP 1YI2P 2M8NA 2EIAA 1Q82Q 5HGLA 1KD1Q 2BHVA 1HQBA 2VLOA 2VSQA 2AF8A 2N5IA 2JB0A 3G0VA 2GZGA 1EMVA 3H47A 3G1IA 4GR2A 2QEXP 2PENA 1BXIA 1VQLP 2JBGA 1M1KQ 2FVEA 3I55P 3G4SP 1YJWP 1HY8A 2KG6A 3HYBA 2LMLA 2LTEA 1VQ4P 2PNGA 3DS5A 1VQ6P 1KQSO 2X2BA 1AUMA 2FHSC 3LMOA 2LOLA 4XRQA 1ACPA 1VKUA 1YHQP 3DS2A 2EHSA 2XZ1C 5DCKA 3VRLC 2KGCA 3CE7A 1UNKA 2KWLA 2FAEA 2OARA 3G26A 2CWOA 2WPTA 1M90Q 1VQ7P 2K5XA 4BPFA 2K2QA 4U0EA 2L0QA 2Z44A 1S72P 3MGEA 5F2OA 2QNWA 3CXCO 2MD9A 3CMAP 5JPAA 4XFZA 1A8OA 3GZLA 2OTLP 2XV6A 1ZNVA 1M6NA 2K92A 1OR5A 1F80D 2L4BA 1M74A 3M1MA 4COCA 3OW2O 2KOSA 2AFEA 2LL8A 4PWVB 4U0DA 4DG9A 3G28A 5I4TG 2GZIA 3DS4A 2KGDA 1KLPA 1Z6MA 2CGQA 1E6JP 2GZJA 1RO0A 2Z46A 5F2NA 3GJNA 3EJDA 3CCRP 2AVAA 1VQOP 3H4EA 2L6EA 2KG8A 1VHNA 4HKGA 4BPHA 2E1MA 1W2BO 4PH0A 3CPWO 2PEIA 4PH1A 2GDYA 3G71P 3HZQA 1NJIQ 3GZMA 2LKIA 2LIWA 1MZ8A 2KOQA 4H2XC 1K30A 2K93A 4XFXA 2FVAA 1IMQA 4XROA 5HGNA 3CCVP 2PEKA 2KW2A 2GDWA 5KP8B 2JYGA 3G21A 1X3OA 2KORA 1JJ2O 2N98A 4U0AA 3DS0A 3I56P 4GR6A 1D1DA 2LIUA 2N50A 2EHTA 2XXMA 5HV8A 3RG6C 4U0FA 4XFYA 2L22A 1QVFO 1L0HA 4IPYA 2N5HA 2DGYA 5EJDA 3LRYA 2JAZA 1VQNP 2M5RA 2JYLA 1QVGO 1FR2A 1VQMP 2ONTA 2XT1A 2VLQA 3CCEP 3B5IA 1AF8A 1EIAA 5KP7B 1KC8Q 1VQ8P 4PXHB 3GKLC 3CC2P 2JO0A 1AYIA 1GXHA 1VQKP 3CCSP 2LF4A 5CZDB 4H2YC 2GZFA 2K0YA 2ROQA 2JGPA 7CEIA 2M8LA 4QKOA 1RO2A 2PEJA 2VLNA 1IUQA 2XZ0D 2K0XA 3G6EP 2N6ZA 1UJZA 2KOPA 2JQ4A 1IMPA 4COPA 2JU1A 2KR5A 5EW5E 1Q86Q 2KGAA 2FADA 3B4QA 5BS1A 2P9XA 3DS3A 2DNWA 3CCJP 2N6YA 5KP6B 2BUOA 2CG5B 1DV5A 2L9FA 1NQ4A 2EFJA 2PEQA 1K73Q 3CMEP 1YJ9P 3CCMP 3EJBA 2LPKA 1YJNP 1VQ9P 3RG2A 2EG5A 4H2WC 1Q7YQ 3P05A 3G1GA 2K94A 2CNRA 2FVFA 2Z45A 2AFDA 3E2DA
chains in the Genus database with same CATH topology
1GXHA 2GZGA 5EW5E 2GYKA 2NO8A 1ZNVA 3GJNA 1UNKA 2GZEA 1EMVA 1MZ8A 2GZFA 2JAZA 2WPTA 7CEIA 4QKOA 3U43A 1BXIA 4F37A 2ERHA 2K5XA 2JBGA 2VLNA 2VLPA 1FR2A 1IMQA 4UHPB 1E0HA 2VLOA 2VLQA 1UJZA 1CEIA 2K0DX 1IMPA 2GZIA 2JB0A 3GKLC 1GXGA 2GZJA 1AYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXH A;  2GZG A;  5EW5 E;  2GYK A;  2NO8 A;  1ZNV A;  3GJN A;  1UNK A;  2GZE A;  1EMV A;  1MZ8 A;  2GZF A;  2JAZ A;  2WPT A;  7CEI A;  4QKO A;  3U43 A;  1BXI A;  4F37 A;  2ERH A;  2K5X A;  2JBG A;  2VLN A;  2VLP A;  1FR2 A;  1IMQ A;  4UHP B;  1E0H A;  2VLO A;  2VLQ A;  1UJZ A;  1CEI A;  2K0D X;  1IMP A;  2GZI A;  2JB0 A;  3GKL C;  1GXG A;  2GZJ A;  1AYI A; 
#chains in the Genus database with same CATH topology
 3Q20 A;  3H0D A;  2KGE A;  3WBH A;  5F2K A;  2GZE A;  1QRJ A;  1DNY A;  4MRT C;  3CD6 P;  5HVC A;  2QA4 P;  3DPH A;  2FQ2 A;  2ERH A;  5HGM A;  3CC7 P;  1VQP P;  5BS2 A;  3CCU P;  4R0M A;  1A43 A;  3NY7 B;  2PEO A;  2PEM A;  4CA3 A;  2M8P A;  2GYK A;  2MR8 A;  4U0C A;  2KG9 A;  1Q81 Q;  3NTE A;  4BPG A;  2MVU A;  3U43 A;  4WYM A;  1K8A Q;  3DS1 A;  1YIJ P;  4UHP B;  2PY8 A;  3G29 A;  1CEI A;  2K0D X;  3EJE A;  1BAJ A;  2FQ1 A;  2GDX A;  1EOQ A;  4QNB A;  5HGO A;  1GPJ A;  2MR7 A;  2FAC A;  1T8K A;  4M0I A;  2MY5 A;  3CC4 P;  1E0H A;  1ZMB A;  2FQ0 A;  2MF4 A;  4IZ6 A;  2KOO A;  2MVV A;  3CCQ P;  2CQ8 A;  1K9M Q;  1RNI A;  3DTJ A;  3CCL P;  4F37 A;  1M6E X;  2KOD A;  2VLP A;  2JU2 A;  1N8R Q;  4NEO A;  1L0I A;  1YIT P;  1GXG A;  1VQ5 P;  4U0B A;  2NO8 A;  2OTJ P;  1YI2 P;  2M8N A;  2EIA A;  1Q82 Q;  5HGL A;  1KD1 Q;  2BHV A;  1HQB A;  2VLO A;  2VSQ A;  2AF8 A;  2N5I A;  2JB0 A;  3G0V A;  2GZG A;  1EMV A;  3H47 A;  3G1I A;  4GR2 A;  2QEX P;  2PEN A;  1BXI A;  1VQL P;  2JBG A;  1M1K Q;  2FVE A;  3I55 P;  3G4S P;  1YJW P;  1HY8 A;  2KG6 A;  3HYB A;  2LML A;  2LTE A;  1VQ4 P;  2PNG A;  3DS5 A;  1VQ6 P;  1KQS O;  2X2B A;  1AUM A;  2FHS C;  3LMO A;  2LOL A;  4XRQ A;  1ACP A;  1VKU A;  1YHQ P;  3DS2 A;  2EHS A;  2XZ1 C;  5DCK A;  3VRL C;  2KGC A;  3CE7 A;  1UNK A;  2KWL A;  2FAE A;  2OAR A;  3G26 A;  2CWO A;  2WPT A;  1M90 Q;  1VQ7 P;  2K5X A;  4BPF A;  2K2Q A;  4U0E A;  2L0Q A;  2Z44 A;  1S72 P;  3MGE A;  5F2O A;  2QNW A;  3CXC O;  2MD9 A;  3CMA P;  5JPA A;  4XFZ A;  1A8O A;  3GZL A;  2OTL P;  2XV6 A;  1ZNV A;  1M6N A;  2K92 A;  1OR5 A;  1F80 D;  2L4B A;  1M74 A;  3M1M A;  4COC A;  3OW2 O;  2KOS A;  2AFE A;  2LL8 A;  4PWV B;  4U0D A;  4DG9 A;  3G28 A;  5I4T G;  2GZI A;  3DS4 A;  2KGD A;  1KLP A;  1Z6M A;  2CGQ A;  1E6J P;  2GZJ A;  1RO0 A;  2Z46 A;  5F2N A;  3GJN A;  3EJD A;  3CCR P;  2AVA A;  1VQO P;  3H4E A;  2L6E A;  2KG8 A;  1VHN A;  4HKG A;  4BPH A;  2E1M A;  1W2B O;  4PH0 A;  3CPW O;  2PEI A;  4PH1 A;  2GDY A;  3G71 P;  3HZQ A;  1NJI Q;  3GZM A;  2LKI A;  2LIW A;  1MZ8 A;  2KOQ A;  4H2X C;  1K30 A;  2K93 A;  4XFX A;  2FVA A;  1IMQ A;  4XRO A;  5HGN A;  3CCV P;  2PEK A;  2KW2 A;  2GDW A;  5KP8 B;  2JYG A;  3G21 A;  1X3O A;  2KOR A;  1JJ2 O;  2N98 A;  4U0A A;  3DS0 A;  3I56 P;  4GR6 A;  1D1D A;  2LIU A;  2N50 A;  2EHT A;  2XXM A;  5HV8 A;  3RG6 C;  4U0F A;  4XFY A;  2L22 A;  1QVF O;  1L0H A;  4IPY A;  2N5H A;  2DGY A;  5EJD A;  3LRY A;  2JAZ A;  1VQN P;  2M5R A;  2JYL A;  1QVG O;  1FR2 A;  1VQM P;  2ONT A;  2XT1 A;  2VLQ A;  3CCE P;  3B5I A;  1AF8 A;  1EIA A;  5KP7 B;  1KC8 Q;  1VQ8 P;  4PXH B;  3GKL C;  3CC2 P;  2JO0 A;  1AYI A;  1GXH A;  1VQK P;  3CCS P;  2LF4 A;  5CZD B;  4H2Y C;  2GZF A;  2K0Y A;  2ROQ A;  2JGP A;  7CEI A;  2M8L A;  4QKO A;  1RO2 A;  2PEJ A;  2VLN A;  1IUQ A;  2XZ0 D;  2K0X A;  3G6E P;  2N6Z A;  1UJZ A;  2KOP A;  2JQ4 A;  1IMP A;  4COP A;  2JU1 A;  2KR5 A;  5EW5 E;  1Q86 Q;  2KGA A;  2FAD A;  3B4Q A;  5BS1 A;  2P9X A;  3DS3 A;  2DNW A;  3CCJ P;  2N6Y A;  5KP6 B;  2BUO A;  2CG5 B;  1DV5 A;  2L9F A;  1NQ4 A;  2EFJ A;  2PEQ A;  1K73 Q;  3CME P;  1YJ9 P;  3CCM P;  3EJB A;  2LPK A;  1YJN P;  1VQ9 P;  3RG2 A;  2EG5 A;  4H2W C;  1Q7Y Q;  3P05 A;  3G1G A;  2K94 A;  2CNR A;  2FVF A;  2Z45 A;  2AFD A;  3E2D A; 
#chains in the Genus database with same CATH homology
 1GXH A;  2GZG A;  5EW5 E;  2GYK A;  2NO8 A;  1ZNV A;  3GJN A;  1UNK A;  2GZE A;  1EMV A;  1MZ8 A;  2GZF A;  2JAZ A;  2WPT A;  7CEI A;  4QKO A;  3U43 A;  1BXI A;  4F37 A;  2ERH A;  2K5X A;  2JBG A;  2VLN A;  2VLP A;  1FR2 A;  1IMQ A;  4UHP B;  1E0H A;  2VLO A;  2VLQ A;  1UJZ A;  1CEI A;  2K0D X;  1IMP A;  2GZI A;  2JB0 A;  3GKL C;  1GXG A;  2GZJ A;  1AYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...