2GZEA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y55a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYAPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y55A)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzeA00
2ERHA 2GZJA 1IMPA 1BXIA 1IMQA 2GZEA 2JB0A 3GKLC 1EMVA 4UHPB 2GZFA 2GZIA 2VLPA 1AYIA 1UNKA 2WPTA 1CEIA 3U43A 2VLOA 2NO8A 1UJZA 2K5XA 2JBGA 2K0DX 2GYKA 1E0HA 4QKOA 2JAZA 4F37A 1MZ8A 1GXHA 1ZNVA 7CEIA 2VLQA 2GZGA 1GXGA 2VLNA 3GJNA 1FR2A 5EW5E
chains in the Genus database with same CATH superfamily
2FAEA 2PEMA 3GKLC 2L6EA 1L0HA 3G6EP 1HY8A 2GDXA 1IUQA 1N8RQ 1E0HA 3B4QA 2AFEA 4IZ6A 5I4TG 2EHTA 2FQ0A 2KOQA 2GZGA 5F2KA 1YI2P 2PNGA 3DS0A 3CMEP 3NTEA 2GZJA 5CZDB 2CQ8A 4XFYA 2N5IA 1VQKP 2KWLA 1A43A 5BS2A 2KORA 2X2BA 1NQ4A 2FQ1A 4COPA 3G1IA 4XRQA 2EHSA 2N6YA 3DS4A 4BPHA 2N6ZA 3VRLC 1K8AQ 2VLNA 2GDYA 2PEQA 2KG6A 1AUMA 2KG9A 2KG8A 2Z44A 1GPJA 3CXCO 2XXMA 4DG9A 5HGLA 2KOSA 2QNWA 2MR7A 5HV8A 5HVCA 5KP7B 3G28A 2AVAA 3CC4P 2AF8A 2KGAA 2OTJP 3CC2P 2Z46A 1F80D 1AYIA 1CEIA 2MVUA 1VQLP 3CCEP 1GXHA 2N50A 2QEXP 3CCSP 2KW2A 2ERHA 1IMQA 3P05A 2CNRA 1EMVA 1VQ6P 1K30A 2GZIA 3GZLA 1YJNP 3CCQP 4PH1A 1Q7YQ 2M8PA 2FVEA 3DS3A 2KGEA 1E6JP 1ZNVA 2JO0A 3CE7A 5EJDA 1L0IA 2MF4A 2FVAA 1M6NA 1W2BO 2BUOA 4M0IA 3OW2O 5KP6B 1UNKA 3G21A 2FADA 2K0DX 2CG5B 2CWOA 2LMLA 2E1MA 1YJWP 2KGDA 3RG6C 4U0CA 2DGYA 1RO0A 1EIAA 4QNBA 4BPGA 4CA3A 4H2YC 1Q81Q 3CMAP 1YIJP 2GDWA 5DCKA 3I55P 3CCUP 5JPAA 4R0MA 2VLOA 2JQ4A 4BPFA 2P9XA 2XZ1C 3H0DA 7CEIA 4PH0A 1OR5A 1DV5A 1GXGA 1VQOP 3Q20A 2BHVA 2DNWA 2K2QA 4U0AA 4COCA 2JB0A 1M74A 4H2WC 2CGQA 2JBGA 2KOOA 2PY8A 1QRJA 4XFZA 1S72P 4WYMA 1KC8Q 2VSQA 1VHNA 2K94A 4GR6A 3DS5A 3G0VA 3DTJA 2JU2A 3CCMP 3G29A 1M1KQ 2JGPA 1UJZA 3DS2A 5HGOA 2N98A 1ZMBA 1VQPP 2VLQA 1RO2A 3CCJP 3CCLP 2PEKA 2JU1A 3U43A 1RNIA 2PEIA 2GYKA 3I56P 2JAZA 3DS1A 1T8KA 1VQ8P 1YITP 1VQ5P 2ONTA 3EJEA 4U0DA 4XROA 3G71P 3CD6P 1K73Q 5EW5E 3CCRP 2L0QA 3EJBA 2OTLP 2LOLA 1BAJA 1K9MQ 3CC7P 2FVFA 2NO8A 2L9FA 2N5HA 5HGNA 2LPKA 1KLPA 1VKUA 2JYGA 2XZ0D 2L22A 1VQ4P 1AF8A 2K93A 2MY5A 3MGEA 1FR2A 3G26A 4IPYA 1QVFO 1VQNP 2GZEA 1VQ9P 2Z45A 4UHPB 2LTEA 1A8OA 2FHSC 4QKOA 3CCVP 2K92A 2LF4A 5HGMA 2FQ2A 2MR8A 1VQMP 3HZQA 2M8LA 3H4EA 3HYBA 2FACA 5KP8B 1IMPA 3G1GA 4U0BA 2EIAA 4HKGA 2WPTA 2OARA 2KODA 4U0FA 1M6EX 2MVVA 1QVGO 4PXHB 5BS1A 3EJDA 3H47A 2K0XA 2KGCA 2EG5A 1Z6MA 2EFJA 2PEOA 3GZMA 2L4BA 1DNYA 2KOPA 4U0EA 2QA4P 1YJ9P 1JJ2O 2M8NA 2K0YA 2JYLA 2KR5A 2LIUA 3DPHA 1EOQA 4XFXA 4H2XC 2LL8A 2XV6A 2PEJA 3GJNA 3E2DA 1X3OA 4PWVB 3RG2A 4GR2A 1ACPA 2XT1A 3CPWO 1D1DA 1KQSO 2ROQA 3NY7B 1VQ7P 1Q86Q 1HQBA 1MZ8A 4MRTC 2MD9A 3G4SP 2AFDA 1BXIA 5F2OA 1YHQP 2GZFA 2VLPA 3LMOA 3WBHA 2LIWA 1Q82Q 2K5XA 5F2NA 4NEOA 2LKIA 1M90Q 4F37A 2M5RA 1NJIQ 1KD1Q 3LRYA 2PENA 3B5IA 3M1MA
chains in the Genus database with same CATH topology
2ERHA 2GZJA 1IMPA 1BXIA 1IMQA 2GZEA 2JB0A 3GKLC 1EMVA 4UHPB 2GZFA 2GZIA 2VLPA 1AYIA 1UNKA 2WPTA 1CEIA 3U43A 2VLOA 2NO8A 1UJZA 2K5XA 2JBGA 2K0DX 2GYKA 1E0HA 4QKOA 2JAZA 4F37A 1MZ8A 1GXHA 1ZNVA 7CEIA 2VLQA 2GZGA 1GXGA 2VLNA 3GJNA 1FR2A 5EW5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERH A;  2GZJ A;  1IMP A;  1BXI A;  1IMQ A;  2GZE A;  2JB0 A;  3GKL C;  1EMV A;  4UHP B;  2GZF A;  2GZI A;  2VLP A;  1AYI A;  1UNK A;  2WPT A;  1CEI A;  3U43 A;  2VLO A;  2NO8 A;  1UJZ A;  2K5X A;  2JBG A;  2K0D X;  2GYK A;  1E0H A;  4QKO A;  2JAZ A;  4F37 A;  1MZ8 A;  1GXH A;  1ZNV A;  7CEI A;  2VLQ A;  2GZG A;  1GXG A;  2VLN A;  3GJN A;  1FR2 A;  5EW5 E; 
#chains in the Genus database with same CATH topology
 2FAE A;  2PEM A;  3GKL C;  2L6E A;  1L0H A;  3G6E P;  1HY8 A;  2GDX A;  1IUQ A;  1N8R Q;  1E0H A;  3B4Q A;  2AFE A;  4IZ6 A;  5I4T G;  2EHT A;  2FQ0 A;  2KOQ A;  2GZG A;  5F2K A;  1YI2 P;  2PNG A;  3DS0 A;  3CME P;  3NTE A;  2GZJ A;  5CZD B;  2CQ8 A;  4XFY A;  2N5I A;  1VQK P;  2KWL A;  1A43 A;  5BS2 A;  2KOR A;  2X2B A;  1NQ4 A;  2FQ1 A;  4COP A;  3G1I A;  4XRQ A;  2EHS A;  2N6Y A;  3DS4 A;  4BPH A;  2N6Z A;  3VRL C;  1K8A Q;  2VLN A;  2GDY A;  2PEQ A;  2KG6 A;  1AUM A;  2KG9 A;  2KG8 A;  2Z44 A;  1GPJ A;  3CXC O;  2XXM A;  4DG9 A;  5HGL A;  2KOS A;  2QNW A;  2MR7 A;  5HV8 A;  5HVC A;  5KP7 B;  3G28 A;  2AVA A;  3CC4 P;  2AF8 A;  2KGA A;  2OTJ P;  3CC2 P;  2Z46 A;  1F80 D;  1AYI A;  1CEI A;  2MVU A;  1VQL P;  3CCE P;  1GXH A;  2N50 A;  2QEX P;  3CCS P;  2KW2 A;  2ERH A;  1IMQ A;  3P05 A;  2CNR A;  1EMV A;  1VQ6 P;  1K30 A;  2GZI A;  3GZL A;  1YJN P;  3CCQ P;  4PH1 A;  1Q7Y Q;  2M8P A;  2FVE A;  3DS3 A;  2KGE A;  1E6J P;  1ZNV A;  2JO0 A;  3CE7 A;  5EJD A;  1L0I A;  2MF4 A;  2FVA A;  1M6N A;  1W2B O;  2BUO A;  4M0I A;  3OW2 O;  5KP6 B;  1UNK A;  3G21 A;  2FAD A;  2K0D X;  2CG5 B;  2CWO A;  2LML A;  2E1M A;  1YJW P;  2KGD A;  3RG6 C;  4U0C A;  2DGY A;  1RO0 A;  1EIA A;  4QNB A;  4BPG A;  4CA3 A;  4H2Y C;  1Q81 Q;  3CMA P;  1YIJ P;  2GDW A;  5DCK A;  3I55 P;  3CCU P;  5JPA A;  4R0M A;  2VLO A;  2JQ4 A;  4BPF A;  2P9X A;  2XZ1 C;  3H0D A;  7CEI A;  4PH0 A;  1OR5 A;  1DV5 A;  1GXG A;  1VQO P;  3Q20 A;  2BHV A;  2DNW A;  2K2Q A;  4U0A A;  4COC A;  2JB0 A;  1M74 A;  4H2W C;  2CGQ A;  2JBG A;  2KOO A;  2PY8 A;  1QRJ A;  4XFZ A;  1S72 P;  4WYM A;  1KC8 Q;  2VSQ A;  1VHN A;  2K94 A;  4GR6 A;  3DS5 A;  3G0V A;  3DTJ A;  2JU2 A;  3CCM P;  3G29 A;  1M1K Q;  2JGP A;  1UJZ A;  3DS2 A;  5HGO A;  2N98 A;  1ZMB A;  1VQP P;  2VLQ A;  1RO2 A;  3CCJ P;  3CCL P;  2PEK A;  2JU1 A;  3U43 A;  1RNI A;  2PEI A;  2GYK A;  3I56 P;  2JAZ A;  3DS1 A;  1T8K A;  1VQ8 P;  1YIT P;  1VQ5 P;  2ONT A;  3EJE A;  4U0D A;  4XRO A;  3G71 P;  3CD6 P;  1K73 Q;  5EW5 E;  3CCR P;  2L0Q A;  3EJB A;  2OTL P;  2LOL A;  1BAJ A;  1K9M Q;  3CC7 P;  2FVF A;  2NO8 A;  2L9F A;  2N5H A;  5HGN A;  2LPK A;  1KLP A;  1VKU A;  2JYG A;  2XZ0 D;  2L22 A;  1VQ4 P;  1AF8 A;  2K93 A;  2MY5 A;  3MGE A;  1FR2 A;  3G26 A;  4IPY A;  1QVF O;  1VQN P;  2GZE A;  1VQ9 P;  2Z45 A;  4UHP B;  2LTE A;  1A8O A;  2FHS C;  4QKO A;  3CCV P;  2K92 A;  2LF4 A;  5HGM A;  2FQ2 A;  2MR8 A;  1VQM P;  3HZQ A;  2M8L A;  3H4E A;  3HYB A;  2FAC A;  5KP8 B;  1IMP A;  3G1G A;  4U0B A;  2EIA A;  4HKG A;  2WPT A;  2OAR A;  2KOD A;  4U0F A;  1M6E X;  2MVV A;  1QVG O;  4PXH B;  5BS1 A;  3EJD A;  3H47 A;  2K0X A;  2KGC A;  2EG5 A;  1Z6M A;  2EFJ A;  2PEO A;  3GZM A;  2L4B A;  1DNY A;  2KOP A;  4U0E A;  2QA4 P;  1YJ9 P;  1JJ2 O;  2M8N A;  2K0Y A;  2JYL A;  2KR5 A;  2LIU A;  3DPH A;  1EOQ A;  4XFX A;  4H2X C;  2LL8 A;  2XV6 A;  2PEJ A;  3GJN A;  3E2D A;  1X3O A;  4PWV B;  3RG2 A;  4GR2 A;  1ACP A;  2XT1 A;  3CPW O;  1D1D A;  1KQS O;  2ROQ A;  3NY7 B;  1VQ7 P;  1Q86 Q;  1HQB A;  1MZ8 A;  4MRT C;  2MD9 A;  3G4S P;  2AFD A;  1BXI A;  5F2O A;  1YHQ P;  2GZF A;  2VLP A;  3LMO A;  3WBH A;  2LIW A;  1Q82 Q;  2K5X A;  5F2N A;  4NEO A;  2LKI A;  1M90 Q;  4F37 A;  2M5R A;  1NJI Q;  1KD1 Q;  3LRY A;  2PEN A;  3B5I A;  3M1M A; 
#chains in the Genus database with same CATH homology
 2ERH A;  2GZJ A;  1IMP A;  1BXI A;  1IMQ A;  2GZE A;  2JB0 A;  3GKL C;  1EMV A;  4UHP B;  2GZF A;  2GZI A;  2VLP A;  1AYI A;  1UNK A;  2WPT A;  1CEI A;  3U43 A;  2VLO A;  2NO8 A;  1UJZ A;  2K5X A;  2JBG A;  2K0D X;  2GYK A;  1E0H A;  4QKO A;  2JAZ A;  4F37 A;  1MZ8 A;  1GXH A;  1ZNV A;  7CEI A;  2VLQ A;  2GZG A;  1GXG A;  2VLN A;  3GJN A;  1FR2 A;  5EW5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...