1MZ8A

Crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
b'MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E7 immunity protein
publication title Metal ions and phosphate binding in the H-N-H motif: crystal structures of the nuclease domain of ColE7/Im7 in complex with a phosphate ion and different divalent metal ions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin,hydrolase/protein binding
total genus 30
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1mz8A00
3U43A 1E0HA 4QKOA 2GYKA 2VLNA 1IMQA 1EMVA 3GJNA 1CEIA 2K0DX 1IMPA 2JAZA 1UNKA 2ERHA 2JB0A 2GZGA 4F37A 1UJZA 4UHPB 2GZJA 2VLOA 2K5XA 1BXIA 7CEIA 1MZ8A 2NO8A 5EW5E 1FR2A 1ZNVA 1GXHA 1GXGA 2JBGA 2VLPA 2VLQA 2GZIA 2WPTA 2GZEA 2GZFA 1AYIA 3GKLC
chains in the Genus database with same CATH superfamily
3P05A 4BPHA 2MD9A 2KORA 1IMPA 5KP8B 3CCJP 2ROQA 5BS1A 1MZ8A 3H47A 1K73Q 2JO0A 2XXMA 2OTJP 1YIJP 3WBHA 3CC2P 1M1KQ 2K2QA 2JU2A 3LRYA 4NEOA 3HYBA 2N98A 3OW2O 1GXHA 3G1GA 3G28A 1YITP 2XZ1C 3G21A 2PENA 4U0DA 2L0QA 2KWLA 3G26A 1VQ7P 5HVCA 2M5RA 2PEJA 1N8RQ 3H4EA 4MRTC 2PEKA 2ONTA 4M0IA 2LKIA 1VQPP 2DGYA 2L4BA 2PEIA 1ACPA 1FR2A 3MGEA 1Q7YQ 3GZMA 1L0IA 1QVGO 2P9XA 2AF8A 4XFXA 1UNKA 2ERHA 1S72P 2K0XA 1ZMBA 5HGMA 2N5IA 4IZ6A 4PWVB 5HGLA 2NO8A 1HQBA 3EJBA 2VLPA 1YJWP 2VLQA 1A43A 2EHTA 2XZ0D 4BPGA 4QNBA 2XT1A 4CA3A 2EHSA 4H2WC 4QKOA 2LMLA 2KOOA 2KGAA 2K94A 5KP6B 1YJNP 4GR2A 1VQ6P 2GZGA 2N6YA 3DS2A 4U0AA 2PEOA 2FACA 1E6JP 1KC8Q 2M8LA 2LL8A 3CMEP 3EJDA 1DV5A 1KQSO 3CCQP 2FHSC 2E1MA 2GYKA 3G6EP 2PNGA 2EIAA 2Z44A 2JAZA 3DS5A 1F80D 2FVEA 1AF8A 4UHPB 1VQ5P 1M90Q 2KGEA 1AUMA 3DS1A 2KOPA 2Z45A 2KG6A 2N6ZA 2DNWA 1DNYA 2GZFA 1VQ4P 3DTJA 2PEMA 2OARA 3VRLC 2QA4P 2N50A 2FVFA 2VSQA 1Q82Q 2CGQA 2JB0A 4COPA 5KP7B 2BHVA 3CCEP 3CCSP 1ZNVA 3Q20A 7CEIA 1VQ8P 3CC4P 3U43A 4XFYA 2OTLP 3G71P 3NTEA 5HGOA 2CG5B 1M6NA 2LPKA 5HGNA 3I55P 3G4SP 2LOLA 2K5XA 5I4TG 5F2NA 2KG8A 2WPTA 1IUQA 4U0FA 1L0HA 1VQLP 2M8PA 2JU1A 2K0YA 3CXCO 4WYMA 3CE7A 3GJNA 3CCUP 3DS0A 3NY7B 1D1DA 2PY8A 2JBGA 4H2XC 4H2YC 2CNRA 3I56P 4GR6A 2KW2A 2PEQA 2K93A 3GKLC 1EOQA 2AVAA 2K92A 2FQ1A 1UJZA 5DCKA 2KODA 2GZJA 3G1IA 2KGDA 4IPYA 3GZLA 2LTEA 2MY5A 4U0EA 4XRQA 5CZDB 3DS4A 2GDXA 1VQNP 2KOQA 1VHNA 2MVVA 3CD6P 5HV8A 2EG5A 1YHQP 1GPJA 1RO0A 1CEIA 2K0DX 4HKGA 2KG9A 2CWOA 4XFZA 1KD1Q 1YJ9P 3DPHA 2FADA 3CMAP 3RG2A 2JYGA 2AFEA 2MR7A 1QRJA 4U0BA 2BUOA 2QNWA 2QEXP 2KR5A 2MVUA 2L9FA 1K30A 2GDYA 3CCVP 1NQ4A 1GXGA 5BS2A 2GZIA 1HY8A 3RG6C 1EIAA 2KOSA 5F2KA 1E0HA 2EFJA 4PH1A 1IMQA 1BAJA 2JGPA 2M8NA 1A8OA 3B4QA 2GDWA 3LMOA 1NJIQ 5EJDA 2MR8A 4BPFA 4U0CA 1RNIA 3DS3A 2FQ0A 2LF4A 2VLNA 2LIWA 4DG9A 1Q81Q 1K8AQ 1VKUA 4COCA 1KLPA 1BXIA 2CQ8A 4R0MA 3M1MA 5EW5E 2JYLA 1M6EX 1QVFO 1YI2P 1Z6MA 2X2BA 1T8KA 2L22A 2N5HA 1EMVA 1VQKP 2KGCA 1K9MQ 1VQ9P 2AFDA 2FAEA 3CCRP 1W2BO 5JPAA 2Z46A 1RO2A 5F2OA 1M74A 3CC7P 1X3OA 3H0DA 1VQOP 1AYIA 4PXHB 3EJEA 3CCLP 2MF4A 3B5IA 4XROA 3G0VA 4F37A 3HZQA 1Q86Q 1JJ2O 2FQ2A 3E2DA 2VLOA 2L6EA 3G29A 4PH0A 1VQMP 2JQ4A 3CPWO 1OR5A 2FVAA 2LIUA 2XV6A 2GZEA 3CCMP
chains in the Genus database with same CATH topology
3U43A 1E0HA 4QKOA 2GYKA 2VLNA 1IMQA 1EMVA 3GJNA 1CEIA 2K0DX 1IMPA 2JAZA 1UNKA 2ERHA 2JB0A 2GZGA 4F37A 1UJZA 4UHPB 2GZJA 2VLOA 2K5XA 1BXIA 7CEIA 1MZ8A 2NO8A 5EW5E 1FR2A 1ZNVA 1GXHA 1GXGA 2JBGA 2VLPA 2VLQA 2GZIA 2WPTA 2GZEA 2GZFA 1AYIA 3GKLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U43 A;  1E0H A;  4QKO A;  2GYK A;  2VLN A;  1IMQ A;  1EMV A;  3GJN A;  1CEI A;  2K0D X;  1IMP A;  2JAZ A;  1UNK A;  2ERH A;  2JB0 A;  2GZG A;  4F37 A;  1UJZ A;  4UHP B;  2GZJ A;  2VLO A;  2K5X A;  1BXI A;  7CEI A;  1MZ8 A;  2NO8 A;  5EW5 E;  1FR2 A;  1ZNV A;  1GXH A;  1GXG A;  2JBG A;  2VLP A;  2VLQ A;  2GZI A;  2WPT A;  2GZE A;  2GZF A;  1AYI A;  3GKL C; 
#chains in the Genus database with same CATH topology
 3P05 A;  4BPH A;  2MD9 A;  2KOR A;  1IMP A;  5KP8 B;  3CCJ P;  2ROQ A;  5BS1 A;  1MZ8 A;  3H47 A;  1K73 Q;  2JO0 A;  2XXM A;  2OTJ P;  1YIJ P;  3WBH A;  3CC2 P;  1M1K Q;  2K2Q A;  2JU2 A;  3LRY A;  4NEO A;  3HYB A;  2N98 A;  3OW2 O;  1GXH A;  3G1G A;  3G28 A;  1YIT P;  2XZ1 C;  3G21 A;  2PEN A;  4U0D A;  2L0Q A;  2KWL A;  3G26 A;  1VQ7 P;  5HVC A;  2M5R A;  2PEJ A;  1N8R Q;  3H4E A;  4MRT C;  2PEK A;  2ONT A;  4M0I A;  2LKI A;  1VQP P;  2DGY A;  2L4B A;  2PEI A;  1ACP A;  1FR2 A;  3MGE A;  1Q7Y Q;  3GZM A;  1L0I A;  1QVG O;  2P9X A;  2AF8 A;  4XFX A;  1UNK A;  2ERH A;  1S72 P;  2K0X A;  1ZMB A;  5HGM A;  2N5I A;  4IZ6 A;  4PWV B;  5HGL A;  2NO8 A;  1HQB A;  3EJB A;  2VLP A;  1YJW P;  2VLQ A;  1A43 A;  2EHT A;  2XZ0 D;  4BPG A;  4QNB A;  2XT1 A;  4CA3 A;  2EHS A;  4H2W C;  4QKO A;  2LML A;  2KOO A;  2KGA A;  2K94 A;  5KP6 B;  1YJN P;  4GR2 A;  1VQ6 P;  2GZG A;  2N6Y A;  3DS2 A;  4U0A A;  2PEO A;  2FAC A;  1E6J P;  1KC8 Q;  2M8L A;  2LL8 A;  3CME P;  3EJD A;  1DV5 A;  1KQS O;  3CCQ P;  2FHS C;  2E1M A;  2GYK A;  3G6E P;  2PNG A;  2EIA A;  2Z44 A;  2JAZ A;  3DS5 A;  1F80 D;  2FVE A;  1AF8 A;  4UHP B;  1VQ5 P;  1M90 Q;  2KGE A;  1AUM A;  3DS1 A;  2KOP A;  2Z45 A;  2KG6 A;  2N6Z A;  2DNW A;  1DNY A;  2GZF A;  1VQ4 P;  3DTJ A;  2PEM A;  2OAR A;  3VRL C;  2QA4 P;  2N50 A;  2FVF A;  2VSQ A;  1Q82 Q;  2CGQ A;  2JB0 A;  4COP A;  5KP7 B;  2BHV A;  3CCE P;  3CCS P;  1ZNV A;  3Q20 A;  7CEI A;  1VQ8 P;  3CC4 P;  3U43 A;  4XFY A;  2OTL P;  3G71 P;  3NTE A;  5HGO A;  2CG5 B;  1M6N A;  2LPK A;  5HGN A;  3I55 P;  3G4S P;  2LOL A;  2K5X A;  5I4T G;  5F2N A;  2KG8 A;  2WPT A;  1IUQ A;  4U0F A;  1L0H A;  1VQL P;  2M8P A;  2JU1 A;  2K0Y A;  3CXC O;  4WYM A;  3CE7 A;  3GJN A;  3CCU P;  3DS0 A;  3NY7 B;  1D1D A;  2PY8 A;  2JBG A;  4H2X C;  4H2Y C;  2CNR A;  3I56 P;  4GR6 A;  2KW2 A;  2PEQ A;  2K93 A;  3GKL C;  1EOQ A;  2AVA A;  2K92 A;  2FQ1 A;  1UJZ A;  5DCK A;  2KOD A;  2GZJ A;  3G1I A;  2KGD A;  4IPY A;  3GZL A;  2LTE A;  2MY5 A;  4U0E A;  4XRQ A;  5CZD B;  3DS4 A;  2GDX A;  1VQN P;  2KOQ A;  1VHN A;  2MVV A;  3CD6 P;  5HV8 A;  2EG5 A;  1YHQ P;  1GPJ A;  1RO0 A;  1CEI A;  2K0D X;  4HKG A;  2KG9 A;  2CWO A;  4XFZ A;  1KD1 Q;  1YJ9 P;  3DPH A;  2FAD A;  3CMA P;  3RG2 A;  2JYG A;  2AFE A;  2MR7 A;  1QRJ A;  4U0B A;  2BUO A;  2QNW A;  2QEX P;  2KR5 A;  2MVU A;  2L9F A;  1K30 A;  2GDY A;  3CCV P;  1NQ4 A;  1GXG A;  5BS2 A;  2GZI A;  1HY8 A;  3RG6 C;  1EIA A;  2KOS A;  5F2K A;  1E0H A;  2EFJ A;  4PH1 A;  1IMQ A;  1BAJ A;  2JGP A;  2M8N A;  1A8O A;  3B4Q A;  2GDW A;  3LMO A;  1NJI Q;  5EJD A;  2MR8 A;  4BPF A;  4U0C A;  1RNI A;  3DS3 A;  2FQ0 A;  2LF4 A;  2VLN A;  2LIW A;  4DG9 A;  1Q81 Q;  1K8A Q;  1VKU A;  4COC A;  1KLP A;  1BXI A;  2CQ8 A;  4R0M A;  3M1M A;  5EW5 E;  2JYL A;  1M6E X;  1QVF O;  1YI2 P;  1Z6M A;  2X2B A;  1T8K A;  2L22 A;  2N5H A;  1EMV A;  1VQK P;  2KGC A;  1K9M Q;  1VQ9 P;  2AFD A;  2FAE A;  3CCR P;  1W2B O;  5JPA A;  2Z46 A;  1RO2 A;  5F2O A;  1M74 A;  3CC7 P;  1X3O A;  3H0D A;  1VQO P;  1AYI A;  4PXH B;  3EJE A;  3CCL P;  2MF4 A;  3B5I A;  4XRO A;  3G0V A;  4F37 A;  3HZQ A;  1Q86 Q;  1JJ2 O;  2FQ2 A;  3E2D A;  2VLO A;  2L6E A;  3G29 A;  4PH0 A;  1VQM P;  2JQ4 A;  3CPW O;  1OR5 A;  2FVA A;  2LIU A;  2XV6 A;  2GZE A;  3CCM P; 
#chains in the Genus database with same CATH homology
 3U43 A;  1E0H A;  4QKO A;  2GYK A;  2VLN A;  1IMQ A;  1EMV A;  3GJN A;  1CEI A;  2K0D X;  1IMP A;  2JAZ A;  1UNK A;  2ERH A;  2JB0 A;  2GZG A;  4F37 A;  1UJZ A;  4UHP B;  2GZJ A;  2VLO A;  2K5X A;  1BXI A;  7CEI A;  1MZ8 A;  2NO8 A;  5EW5 E;  1FR2 A;  1ZNV A;  1GXH A;  1GXG A;  2JBG A;  2VLP A;  2VLQ A;  2GZI A;  2WPT A;  2GZE A;  2GZF A;  1AYI A;  3GKL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...