1MZ8A

Crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin,hydrolase/protein binding
molecule keywords Colicin E7 immunity protein
publication title Metal ions and phosphate binding in the H-N-H motif: crystal structures of the nuclease domain of ColE7/Im7 in complex with a phosphate ion and different divalent metal ions
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1mz8A00
4QKOA 3GKLC 3GJNA 2GZEA 1IMQA 2ERHA 1FR2A 2VLNA 1EMVA 2JAZA 1ZNVA 2JBGA 1UNKA 1GXHA 2GYKA 2GZFA 4F37A 2GZJA 7CEIA 1UJZA 1IMPA 2WPTA 2NO8A 1AYIA 2VLOA 2K5XA 2VLPA 1E0HA 1CEIA 2GZGA 1BXIA 4UHPB 5EW5E 1MZ8A 2JB0A 2K0DX 1GXGA 3U43A 2GZIA 2VLQA
chains in the Genus database with same CATH superfamily
3DTJA 1RO0A 1YI2P 1M90Q 2JU1A 2FACA 2GZFA 2GZJA 7CEIA 1AYIA 2CQ8A 5BS1A 1KLPA 2LIUA 1JJ2O 5KP8B 2VLPA 1BAJA 2PEOA 2XT1A 1AUMA 1DNYA 2BUOA 1VQ6P 2M8LA 2CG5B 2EFJA 3CC4P 1FR2A 1IUQA 2JAZA 1Z6MA 4GR6A 2K93A 3G6EP 5KP6B 1EOQA 3DS3A 1KD1Q 2FQ0A 2CWOA 1ZMBA 4UHPB 4XFYA 3GZMA 2KOSA 4XFXA 1KC8Q 3G0VA 2PEQA 3H47A 3Q20A 1ACPA 2L0QA 3GZLA 1YJ9P 4PXHB 1VQNP 2FADA 2K94A 3HYBA 5EW5E 2XV6A 4IPYA 5I4TG 1X3OA 2MR7A 1VQKP 4PH0A 2MF4A 1M6NA 1VHNA 3DS4A 2L22A 5KP7B 1K9MQ 1K8AQ 4QNBA 2Z45A 3G26A 5BS2A 2LIWA 2FAEA 4GR2A 3G28A 2GDYA 1M6EX 3CCSP 2AF8A 2PEKA 3CD6P 3B5IA 3LMOA 2L6EA 2KGCA 3G71P 1UNKA 3RG6C 2EHSA 4U0BA 4PWVB 4U0AA 1VQMP 3E2DA 1E0HA 3CC2P 2QA4P 2PEIA 2JO0A 3DS2A 1L0IA 4PH1A 4COCA 2FHSC 4QKOA 3GJNA 2DNWA 5DCKA 3HZQA 2JBGA 2KODA 1Q82Q 3CCUP 5F2KA 2FVEA 1W2BO 4U0DA 1Q81Q 2GZGA 4U0CA 2KOQA 2ROQA 1OR5A 3CCJP 2KW2A 1GXHA 3EJEA 2BHVA 4XRQA 2KOOA 5JPAA 1UJZA 3G1IA 2OTJP 4HKGA 2KGEA 5HGOA 1NJIQ 2FQ1A 2L9FA 3P05A 2GZEA 2PEJA 3CCRP 5HGLA 1ZNVA 1KQSO 5CZDB 1VQLP 2VLOA 1DV5A 1K73Q 1QRJA 3CMAP 1M1KQ 4MRTC 1GXGA 2XXMA 1Q7YQ 2LL8A 3WBHA 2EIAA 2FVFA 2E1MA 4BPHA 2LTEA 4XROA 3LRYA 2K2QA 3EJDA 1QVFO 2N98A 2LF4A 1F80D 4BPGA 1VQ8P 3M1MA 5HGNA 2AVAA 2Z44A 3CE7A 1EMVA 2LMLA 1T8KA 3MGEA 1YIJP 3VRLC 3DS5A 5F2OA 5EJDA 1QVGO 2MVVA 3DPHA 3B4QA 1YJNP 1VQ7P 2JQ4A 2GDXA 2KORA 4WYMA 1MZ8A 2GZIA 1VQ4P 4R0MA 3G29A 2OTLP 2KGAA 4H2XC 3DS1A 4H2YC 1RNIA 2M8NA 2JGPA 4XFZA 1IMPA 2KR5A 3G4SP 3CMEP 1Q86Q 2Z46A 1D1DA 2JYLA 5HGMA 4BPFA 1N8RQ 2FVAA 1E6JP 2DGYA 4CA3A 3H4EA 3CPWO 1VKUA 2LKIA 2PEMA 2JU2A 2N6ZA 2OARA 3NTEA 3EJBA 2MVUA 1VQ5P 1A8OA 2AFDA 1A43A 2JYGA 2K92A 3U43A 3NY7B 1AF8A 2GDWA 4DG9A 4U0EA 2L4BA 1YJWP 1GPJA 2N6YA 3CCEP 2KOPA 2MY5A 3I55P 3I56P 4COPA 2KGDA 2KG9A 1YITP 2P9XA 4IZ6A 3CXCO 2K0DX 5HVCA 1M74A 1IMQA 2K0XA 2MD9A 2PNGA 2FQ2A 2KG8A 2X2BA 3CC7P 2N5IA 5HV8A 1L0HA 3CCQP 2AFEA 2WPTA 2XZ1C 3H0DA 2MR8A 2KWLA 3DS0A 3CCLP 3G1GA 2EHTA 2VSQA 2K0YA 3CCVP 1VQOP 2VLNA 3RG2A 1NQ4A 4F37A 2ONTA 2QNWA 2N5HA 2NO8A 1VQ9P 4U0FA 4NEOA 2LPKA 1RO2A 1CEIA 2XZ0D 1K30A 2PENA 2M8PA 4M0IA 1HY8A 2PY8A 2M5RA 3GKLC 1HQBA 4H2WC 2ERHA 1YHQP 2LOLA 2GYKA 2QEXP 1EIAA 3G21A 2K5XA 2N50A 3OW2O 1VQPP 2CNRA 3CCMP 1BXIA 2EG5A 2CGQA 2JB0A 5F2NA 2VLQA 2KG6A 1S72P
chains in the Genus database with same CATH topology
4QKOA 3GKLC 3GJNA 2GZEA 1IMQA 2ERHA 1FR2A 2VLNA 1EMVA 2JAZA 1ZNVA 2JBGA 1UNKA 1GXHA 2GYKA 2GZFA 4F37A 2GZJA 7CEIA 1UJZA 1IMPA 2WPTA 2NO8A 1AYIA 2VLOA 2K5XA 2VLPA 1E0HA 1CEIA 2GZGA 1BXIA 4UHPB 5EW5E 1MZ8A 2JB0A 2K0DX 1GXGA 3U43A 2GZIA 2VLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QKO A;  3GKL C;  3GJN A;  2GZE A;  1IMQ A;  2ERH A;  1FR2 A;  2VLN A;  1EMV A;  2JAZ A;  1ZNV A;  2JBG A;  1UNK A;  1GXH A;  2GYK A;  2GZF A;  4F37 A;  2GZJ A;  7CEI A;  1UJZ A;  1IMP A;  2WPT A;  2NO8 A;  1AYI A;  2VLO A;  2K5X A;  2VLP A;  1E0H A;  1CEI A;  2GZG A;  1BXI A;  4UHP B;  5EW5 E;  1MZ8 A;  2JB0 A;  2K0D X;  1GXG A;  3U43 A;  2GZI A;  2VLQ A; 
#chains in the Genus database with same CATH topology
 3DTJ A;  1RO0 A;  1YI2 P;  1M90 Q;  2JU1 A;  2FAC A;  2GZF A;  2GZJ A;  7CEI A;  1AYI A;  2CQ8 A;  5BS1 A;  1KLP A;  2LIU A;  1JJ2 O;  5KP8 B;  2VLP A;  1BAJ A;  2PEO A;  2XT1 A;  1AUM A;  1DNY A;  2BUO A;  1VQ6 P;  2M8L A;  2CG5 B;  2EFJ A;  3CC4 P;  1FR2 A;  1IUQ A;  2JAZ A;  1Z6M A;  4GR6 A;  2K93 A;  3G6E P;  5KP6 B;  1EOQ A;  3DS3 A;  1KD1 Q;  2FQ0 A;  2CWO A;  1ZMB A;  4UHP B;  4XFY A;  3GZM A;  2KOS A;  4XFX A;  1KC8 Q;  3G0V A;  2PEQ A;  3H47 A;  3Q20 A;  1ACP A;  2L0Q A;  3GZL A;  1YJ9 P;  4PXH B;  1VQN P;  2FAD A;  2K94 A;  3HYB A;  5EW5 E;  2XV6 A;  4IPY A;  5I4T G;  1X3O A;  2MR7 A;  1VQK P;  4PH0 A;  2MF4 A;  1M6N A;  1VHN A;  3DS4 A;  2L22 A;  5KP7 B;  1K9M Q;  1K8A Q;  4QNB A;  2Z45 A;  3G26 A;  5BS2 A;  2LIW A;  2FAE A;  4GR2 A;  3G28 A;  2GDY A;  1M6E X;  3CCS P;  2AF8 A;  2PEK A;  3CD6 P;  3B5I A;  3LMO A;  2L6E A;  2KGC A;  3G71 P;  1UNK A;  3RG6 C;  2EHS A;  4U0B A;  4PWV B;  4U0A A;  1VQM P;  3E2D A;  1E0H A;  3CC2 P;  2QA4 P;  2PEI A;  2JO0 A;  3DS2 A;  1L0I A;  4PH1 A;  4COC A;  2FHS C;  4QKO A;  3GJN A;  2DNW A;  5DCK A;  3HZQ A;  2JBG A;  2KOD A;  1Q82 Q;  3CCU P;  5F2K A;  2FVE A;  1W2B O;  4U0D A;  1Q81 Q;  2GZG A;  4U0C A;  2KOQ A;  2ROQ A;  1OR5 A;  3CCJ P;  2KW2 A;  1GXH A;  3EJE A;  2BHV A;  4XRQ A;  2KOO A;  5JPA A;  1UJZ A;  3G1I A;  2OTJ P;  4HKG A;  2KGE A;  5HGO A;  1NJI Q;  2FQ1 A;  2L9F A;  3P05 A;  2GZE A;  2PEJ A;  3CCR P;  5HGL A;  1ZNV A;  1KQS O;  5CZD B;  1VQL P;  2VLO A;  1DV5 A;  1K73 Q;  1QRJ A;  3CMA P;  1M1K Q;  4MRT C;  1GXG A;  2XXM A;  1Q7Y Q;  2LL8 A;  3WBH A;  2EIA A;  2FVF A;  2E1M A;  4BPH A;  2LTE A;  4XRO A;  3LRY A;  2K2Q A;  3EJD A;  1QVF O;  2N98 A;  2LF4 A;  1F80 D;  4BPG A;  1VQ8 P;  3M1M A;  5HGN A;  2AVA A;  2Z44 A;  3CE7 A;  1EMV A;  2LML A;  1T8K A;  3MGE A;  1YIJ P;  3VRL C;  3DS5 A;  5F2O A;  5EJD A;  1QVG O;  2MVV A;  3DPH A;  3B4Q A;  1YJN P;  1VQ7 P;  2JQ4 A;  2GDX A;  2KOR A;  4WYM A;  1MZ8 A;  2GZI A;  1VQ4 P;  4R0M A;  3G29 A;  2OTL P;  2KGA A;  4H2X C;  3DS1 A;  4H2Y C;  1RNI A;  2M8N A;  2JGP A;  4XFZ A;  1IMP A;  2KR5 A;  3G4S P;  3CME P;  1Q86 Q;  2Z46 A;  1D1D A;  2JYL A;  5HGM A;  4BPF A;  1N8R Q;  2FVA A;  1E6J P;  2DGY A;  4CA3 A;  3H4E A;  3CPW O;  1VKU A;  2LKI A;  2PEM A;  2JU2 A;  2N6Z A;  2OAR A;  3NTE A;  3EJB A;  2MVU A;  1VQ5 P;  1A8O A;  2AFD A;  1A43 A;  2JYG A;  2K92 A;  3U43 A;  3NY7 B;  1AF8 A;  2GDW A;  4DG9 A;  4U0E A;  2L4B A;  1YJW P;  1GPJ A;  2N6Y A;  3CCE P;  2KOP A;  2MY5 A;  3I55 P;  3I56 P;  4COP A;  2KGD A;  2KG9 A;  1YIT P;  2P9X A;  4IZ6 A;  3CXC O;  2K0D X;  5HVC A;  1M74 A;  1IMQ A;  2K0X A;  2MD9 A;  2PNG A;  2FQ2 A;  2KG8 A;  2X2B A;  3CC7 P;  2N5I A;  5HV8 A;  1L0H A;  3CCQ P;  2AFE A;  2WPT A;  2XZ1 C;  3H0D A;  2MR8 A;  2KWL A;  3DS0 A;  3CCL P;  3G1G A;  2EHT A;  2VSQ A;  2K0Y A;  3CCV P;  1VQO P;  2VLN A;  3RG2 A;  1NQ4 A;  4F37 A;  2ONT A;  2QNW A;  2N5H A;  2NO8 A;  1VQ9 P;  4U0F A;  4NEO A;  2LPK A;  1RO2 A;  1CEI A;  2XZ0 D;  1K30 A;  2PEN A;  2M8P A;  4M0I A;  1HY8 A;  2PY8 A;  2M5R A;  3GKL C;  1HQB A;  4H2W C;  2ERH A;  1YHQ P;  2LOL A;  2GYK A;  2QEX P;  1EIA A;  3G21 A;  2K5X A;  2N50 A;  3OW2 O;  1VQP P;  2CNR A;  3CCM P;  1BXI A;  2EG5 A;  2CGQ A;  2JB0 A;  5F2N A;  2VLQ A;  2KG6 A;  1S72 P; 
#chains in the Genus database with same CATH homology
 4QKO A;  3GKL C;  3GJN A;  2GZE A;  1IMQ A;  2ERH A;  1FR2 A;  2VLN A;  1EMV A;  2JAZ A;  1ZNV A;  2JBG A;  1UNK A;  1GXH A;  2GYK A;  2GZF A;  4F37 A;  2GZJ A;  7CEI A;  1UJZ A;  1IMP A;  2WPT A;  2NO8 A;  1AYI A;  2VLO A;  2K5X A;  2VLP A;  1E0H A;  1CEI A;  2GZG A;  1BXI A;  4UHP B;  5EW5 E;  1MZ8 A;  2JB0 A;  2K0D X;  1GXG A;  3U43 A;  2GZI A;  2VLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...