1MZ8A

Crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E7 immunity protein
publication title Metal ions and phosphate binding in the H-N-H motif: crystal structures of the nuclease domain of ColE7/Im7 in complex with a phosphate ion and different divalent metal ions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin,hydrolase/protein binding
total genus 30
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1mz8A00
1GXGA 1UJZA 2GZGA 2WPTA 2VLPA 2K5XA 7CEIA 2GZJA 4F37A 1GXHA 1EMVA 1UNKA 2VLNA 1CEIA 1FR2A 1IMPA 2ERHA 2GZFA 4UHPB 5EW5E 2K0DX 2VLQA 1AYIA 2JBGA 1BXIA 2JB0A 2GYKA 2GZIA 2VLOA 4QKOA 2GZEA 3U43A 3GKLC 2JAZA 2NO8A 1E0HA 1MZ8A 1ZNVA 1IMQA 3GJNA
chains in the Genus database with same CATH superfamily
2BHVA 2N98A 2L0QA 2M8LA 3CMEP 2LF4A 2L4BA 3RG6C 1JJ2O 1X3OA 2EFJA 1AUMA 1M74A 2AFDA 3DS3A 4QKOA 2JU1A 1ZNVA 2PEOA 1VQLP 3CC2P 1W2BO 3CCRP 3I55P 5F2NA 2PNGA 5F2OA 1YJNP 1GXHA 2GDYA 1UNKA 2KR5A 2LIWA 1RO0A 5EW5E 2K92A 2KG8A 3G0VA 2LKIA 2LPKA 2GDXA 4PH0A 2GDWA 3EJEA 3LRYA 5EJDA 2KWLA 4BPFA 2LMLA 5HGOA 1EOQA 2DGYA 2LIUA 1GPJA 1Q7YQ 3H4EA 2Z45A 2FADA 2PY8A 4QNBA 2GYKA 2EIAA 2PEKA 4U0CA 3U43A 3RG2A 4H2XC 2NO8A 2XV6A 2KOOA 1DV5A 4U0BA 2M8PA 4MRTC 3CCMP 3CCSP 1A8OA 2FQ1A 5BS1A 4XFYA 2KOSA 4XFXA 1M1KQ 1BAJA 2MY5A 3NTEA 2KGAA 3G6EP 2VLOA 1VQNP 1L0IA 1QVFO 5BS2A 1YIJP 1K8AQ 2PENA 1N8RQ 2BUOA 1AF8A 3LMOA 4UHPB 1EIAA 2ROQA 1AYIA 2CGQA 2P9XA 2JGPA 2JU2A 3P05A 4H2YC 4M0IA 2AFEA 1Q86Q 3CCVP 2CNRA 4U0FA 4NEOA 1S72P 2KOPA 1DNYA 2WPTA 3CCQP 3CCEP 3HZQA 2FACA 2VLQA 2M8NA 5I4TG 2GZIA 3DS4A 2KW2A 2JYLA 3EJBA 4U0AA 4DG9A 1VQPP 1ZMBA 2GZFA 4BPHA 3H0DA 2K93A 2M5RA 3DS0A 4IZ6A 2FQ2A 4COPA 2OTJP 1F80D 2GZGA 3CC4P 3CC7P 3G29A 2MVUA 5JPAA 1QRJA 2AF8A 4R0MA 2ONTA 2N6ZA 1VHNA 4U0EA 1E0HA 2CWOA 1VQ6P 5HV8A 4XRQA 2CG5B 2KGEA 1GXGA 1KD1Q 3DS2A 2GZJA 4F37A 2N5HA 2VLNA 4GR6A 3CMAP 4PWVB 1M6NA 5KP8B 2Z46A 3E2DA 2JB0A 1YJ9P 3CPWO 2OTLP 2GZEA 2L9FA 1IUQA 1VQ5P 4HKGA 3GJNA 2CQ8A 5KP7B 2PEIA 1NQ4A 2FQ0A 3EJDA 1A43A 3M1MA 3G26A 3CCLP 1VQ8P 4COCA 2MVVA 2EHSA 2MR7A 3CD6P 2E1MA 4U0DA 2K0XA 2MF4A 2JO0A 2FAEA 2MD9A 2VLPA 3H47A 1NJIQ 5KP6B 4GR2A 3GZLA 2XZ1C 2KG9A 3CCJP 2L6EA 1K73Q 2KORA 4XFZA 2JAZA 2K2QA 1KC8Q 1KLPA 1RNIA 4PH1A 3B5IA 1VQKP 1EMVA 3GZMA 1YJWP 2JQ4A 2LOLA 5HGNA 2JYGA 3CCUP 1IMPA 2DNWA 2JBGA 5DCKA 1K9MQ 2FVAA 1M90Q 3DS1A 2XZ0D 2N6YA 2FVEA 1UJZA 1K30A 2VSQA 2PEMA 3MGEA 5CZDB 2QEXP 2K5XA 2K0YA 2KG6A 1VKUA 1YHQP 1D1DA 3G1GA 2N50A 2ERHA 2K0DX 3G28A 1HY8A 1OR5A 4BPGA 4XROA 3I56P 2KODA 1MZ8A 1HQBA 3B4QA 5HGMA 3Q20A 2Z44A 2KOQA 2OARA 3G1IA 4H2WC 1ACPA 2L22A 2KGCA 1CEIA 2K94A 4WYMA 1VQ9P 3DS5A 3WBHA 2XT1A 3G21A 2XXMA 2KGDA 3GKLC 5HGLA 1Q82Q 7CEIA 3G71P 3OW2O 2QA4P 1KQSO 1VQ7P 2PEQA 4CA3A 3DTJA 3G4SP 1VQOP 1BXIA 1VQ4P 3CXCO 3VRLC 2LL8A 1YI2P 1M6EX 1RO2A 2LTEA 1IMQA 1Q81Q 3NY7B 1E6JP 3DPHA 2N5IA 3CE7A 5HVCA 4PXHB 2AVAA 1L0HA 1FR2A 2MR8A 1Z6MA 2FHSC 2QNWA 1T8KA 1QVGO 1VQMP 1YITP 3HYBA 4IPYA 2EHTA 2EG5A 2FVFA 5F2KA 2X2BA 2PEJA
chains in the Genus database with same CATH topology
1GXGA 1UJZA 2GZGA 2WPTA 2VLPA 2K5XA 7CEIA 2GZJA 4F37A 1GXHA 1EMVA 1UNKA 2VLNA 1CEIA 1FR2A 1IMPA 2ERHA 2GZFA 4UHPB 5EW5E 2K0DX 2VLQA 1AYIA 2JBGA 1BXIA 2JB0A 2GYKA 2GZIA 2VLOA 4QKOA 2GZEA 3U43A 3GKLC 2JAZA 2NO8A 1E0HA 1MZ8A 1ZNVA 1IMQA 3GJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXG A;  1UJZ A;  2GZG A;  2WPT A;  2VLP A;  2K5X A;  7CEI A;  2GZJ A;  4F37 A;  1GXH A;  1EMV A;  1UNK A;  2VLN A;  1CEI A;  1FR2 A;  1IMP A;  2ERH A;  2GZF A;  4UHP B;  5EW5 E;  2K0D X;  2VLQ A;  1AYI A;  2JBG A;  1BXI A;  2JB0 A;  2GYK A;  2GZI A;  2VLO A;  4QKO A;  2GZE A;  3U43 A;  3GKL C;  2JAZ A;  2NO8 A;  1E0H A;  1MZ8 A;  1ZNV A;  1IMQ A;  3GJN A; 
#chains in the Genus database with same CATH topology
 2BHV A;  2N98 A;  2L0Q A;  2M8L A;  3CME P;  2LF4 A;  2L4B A;  3RG6 C;  1JJ2 O;  1X3O A;  2EFJ A;  1AUM A;  1M74 A;  2AFD A;  3DS3 A;  4QKO A;  2JU1 A;  1ZNV A;  2PEO A;  1VQL P;  3CC2 P;  1W2B O;  3CCR P;  3I55 P;  5F2N A;  2PNG A;  5F2O A;  1YJN P;  1GXH A;  2GDY A;  1UNK A;  2KR5 A;  2LIW A;  1RO0 A;  5EW5 E;  2K92 A;  2KG8 A;  3G0V A;  2LKI A;  2LPK A;  2GDX A;  4PH0 A;  2GDW A;  3EJE A;  3LRY A;  5EJD A;  2KWL A;  4BPF A;  2LML A;  5HGO A;  1EOQ A;  2DGY A;  2LIU A;  1GPJ A;  1Q7Y Q;  3H4E A;  2Z45 A;  2FAD A;  2PY8 A;  4QNB A;  2GYK A;  2EIA A;  2PEK A;  4U0C A;  3U43 A;  3RG2 A;  4H2X C;  2NO8 A;  2XV6 A;  2KOO A;  1DV5 A;  4U0B A;  2M8P A;  4MRT C;  3CCM P;  3CCS P;  1A8O A;  2FQ1 A;  5BS1 A;  4XFY A;  2KOS A;  4XFX A;  1M1K Q;  1BAJ A;  2MY5 A;  3NTE A;  2KGA A;  3G6E P;  2VLO A;  1VQN P;  1L0I A;  1QVF O;  5BS2 A;  1YIJ P;  1K8A Q;  2PEN A;  1N8R Q;  2BUO A;  1AF8 A;  3LMO A;  4UHP B;  1EIA A;  2ROQ A;  1AYI A;  2CGQ A;  2P9X A;  2JGP A;  2JU2 A;  3P05 A;  4H2Y C;  4M0I A;  2AFE A;  1Q86 Q;  3CCV P;  2CNR A;  4U0F A;  4NEO A;  1S72 P;  2KOP A;  1DNY A;  2WPT A;  3CCQ P;  3CCE P;  3HZQ A;  2FAC A;  2VLQ A;  2M8N A;  5I4T G;  2GZI A;  3DS4 A;  2KW2 A;  2JYL A;  3EJB A;  4U0A A;  4DG9 A;  1VQP P;  1ZMB A;  2GZF A;  4BPH A;  3H0D A;  2K93 A;  2M5R A;  3DS0 A;  4IZ6 A;  2FQ2 A;  4COP A;  2OTJ P;  1F80 D;  2GZG A;  3CC4 P;  3CC7 P;  3G29 A;  2MVU A;  5JPA A;  1QRJ A;  2AF8 A;  4R0M A;  2ONT A;  2N6Z A;  1VHN A;  4U0E A;  1E0H A;  2CWO A;  1VQ6 P;  5HV8 A;  4XRQ A;  2CG5 B;  2KGE A;  1GXG A;  1KD1 Q;  3DS2 A;  2GZJ A;  4F37 A;  2N5H A;  2VLN A;  4GR6 A;  3CMA P;  4PWV B;  1M6N A;  5KP8 B;  2Z46 A;  3E2D A;  2JB0 A;  1YJ9 P;  3CPW O;  2OTL P;  2GZE A;  2L9F A;  1IUQ A;  1VQ5 P;  4HKG A;  3GJN A;  2CQ8 A;  5KP7 B;  2PEI A;  1NQ4 A;  2FQ0 A;  3EJD A;  1A43 A;  3M1M A;  3G26 A;  3CCL P;  1VQ8 P;  4COC A;  2MVV A;  2EHS A;  2MR7 A;  3CD6 P;  2E1M A;  4U0D A;  2K0X A;  2MF4 A;  2JO0 A;  2FAE A;  2MD9 A;  2VLP A;  3H47 A;  1NJI Q;  5KP6 B;  4GR2 A;  3GZL A;  2XZ1 C;  2KG9 A;  3CCJ P;  2L6E A;  1K73 Q;  2KOR A;  4XFZ A;  2JAZ A;  2K2Q A;  1KC8 Q;  1KLP A;  1RNI A;  4PH1 A;  3B5I A;  1VQK P;  1EMV A;  3GZM A;  1YJW P;  2JQ4 A;  2LOL A;  5HGN A;  2JYG A;  3CCU P;  1IMP A;  2DNW A;  2JBG A;  5DCK A;  1K9M Q;  2FVA A;  1M90 Q;  3DS1 A;  2XZ0 D;  2N6Y A;  2FVE A;  1UJZ A;  1K30 A;  2VSQ A;  2PEM A;  3MGE A;  5CZD B;  2QEX P;  2K5X A;  2K0Y A;  2KG6 A;  1VKU A;  1YHQ P;  1D1D A;  3G1G A;  2N50 A;  2ERH A;  2K0D X;  3G28 A;  1HY8 A;  1OR5 A;  4BPG A;  4XRO A;  3I56 P;  2KOD A;  1MZ8 A;  1HQB A;  3B4Q A;  5HGM A;  3Q20 A;  2Z44 A;  2KOQ A;  2OAR A;  3G1I A;  4H2W C;  1ACP A;  2L22 A;  2KGC A;  1CEI A;  2K94 A;  4WYM A;  1VQ9 P;  3DS5 A;  3WBH A;  2XT1 A;  3G21 A;  2XXM A;  2KGD A;  3GKL C;  5HGL A;  1Q82 Q;  7CEI A;  3G71 P;  3OW2 O;  2QA4 P;  1KQS O;  1VQ7 P;  2PEQ A;  4CA3 A;  3DTJ A;  3G4S P;  1VQO P;  1BXI A;  1VQ4 P;  3CXC O;  3VRL C;  2LL8 A;  1YI2 P;  1M6E X;  1RO2 A;  2LTE A;  1IMQ A;  1Q81 Q;  3NY7 B;  1E6J P;  3DPH A;  2N5I A;  3CE7 A;  5HVC A;  4PXH B;  2AVA A;  1L0H A;  1FR2 A;  2MR8 A;  1Z6M A;  2FHS C;  2QNW A;  1T8K A;  1QVG O;  1VQM P;  1YIT P;  3HYB A;  4IPY A;  2EHT A;  2EG5 A;  2FVF A;  5F2K A;  2X2B A;  2PEJ A; 
#chains in the Genus database with same CATH homology
 1GXG A;  1UJZ A;  2GZG A;  2WPT A;  2VLP A;  2K5X A;  7CEI A;  2GZJ A;  4F37 A;  1GXH A;  1EMV A;  1UNK A;  2VLN A;  1CEI A;  1FR2 A;  1IMP A;  2ERH A;  2GZF A;  4UHP B;  5EW5 E;  2K0D X;  2VLQ A;  1AYI A;  2JBG A;  1BXI A;  2JB0 A;  2GYK A;  2GZI A;  2VLO A;  4QKO A;  2GZE A;  3U43 A;  3GKL C;  2JAZ A;  2NO8 A;  1E0H A;  1MZ8 A;  1ZNV A;  1IMQ A;  3GJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...