1S72P

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1s72P02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1s72P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1s72P03
3CCSP 2OTLP 1M90Q 3CD6P 1YJWP 1W2BO 1YITP 1NJIQ 3CCJP 1VQLP 3CC2P 1M1KQ 3OW2O 2QEXP 3I56P 3CCMP 1YHQP 1N8RQ 3CMAP 1QVGO 1K73Q 3CXCO 1JJ2O 1S72P 1YJNP 1YI2P 1VQOP 3G6EP 3G71P 3I55P 3CMEP 3G4SP 1QVFO 1VQ7P 1K9MQ 1VQ9P 1YJ9P 2QA4P 1VQ5P 3CPWO 3CCRP 1Q7YQ 1Q82Q 1K8AQ 1VQPP 1Q81Q 3CCLP 1KC8Q 1KD1Q 1VQ6P 3CCEP 1Q86Q 1KQSO 3CC4P 1VQ8P 1YIJP 1VQ4P 3CCUP 1VQMP 3CC7P 1VQNP 3CCQP 2OTJP 3CCVP 1VQKP
chains in the Genus database with same CATH superfamily
2LXCB 2FAEA 3L37A 1SQXE 3A0BH 3L74D 4XROA 2ROQA 1EC5A 5E79E 1EMVA 1QVFO 1HY8A 3BCCD 1HVVA 1YJ9P 3G21A 1N7SD 1OVVA 5H2FE 2HODA 3G0VA 1RF0A 1OZHA 3KHUA 3R4YA 1KILD 2CG5B 3GHGB 1QL1A 1ZR4A 3GF7A 1SVFA 3N4XA 3L71E 1W2BO 3EFFK 2Z4EA 4HH2A 2YIUB 3P05A 2KUBA 1BSHA 4XFJA 2XT1A 1P84H 2C0XA 3B4SA 1GTWA 3F89A 2QRXA 1Z56A 1JCCA 2AEJA 4H2YC 1SLQA 3MD0A 2A45I 4H0LB 3P8CE 4NPEA 2LF4A 2KOPA 2IZ0A 3B8EB 3CX5E 1KYOI 1K30A 2BEQD 1FJKA 2VSQA 3DS2A 2M0BA 5BU8B 2FFDB 1FZCB 1DNYA 2Q3IA 1N7SB 5APWA 2O1JA 3SWKA 3GMAA 1RQUA 2FADA 2LL8A 1M90Q 3RK3B 2L22A 3H4EA 1L0LJ 1D7MA 4IFMA 1G2CA 4UB8E 2EIAA 1HQBA 2EG5A 3E7KA 2K5XA 2A45G 1KB9E 2WT7B 1L4AC 1SQXJ 5AW0B 4GOEA 5CBNA 2WSCJ 1K04A 3P32A 1WMKA 3M9BA 1RO0A 5B66E 3FX0A 2QIWA 4TLFA 5KJ7C 3VMYA 2XZRA 1A8OA 3V6IA 3VTPC 2JEEA 4H13B 2KG9A 4UB6H 3L71J 3TGUE 1YIJP 5BVZA 3CCVP 1JEKA 1GPJA 1SQPJ 5EW5E 2WSSH 1SQXG 1FZAA 3AE1C 4AQRD 2JP3A 4NPDA 1WT6A 1KV4A 2N5HA 1SQBK 2FYZA 2P2UA 1JY2O 2FY8A 5KLVE 1XTGB 3WUUA 4I1LA 1N7LA 4ASVA 3FGAD 3QWOC 3L71G 5CCGA 1Y47A 3G26A 3A7OA 1ZNVA 2YKOA 2WTYA 3SSUA 2W90A 2JWAA 4WY4D 1SQPG 1M74A 1PEOA 1FAVA 2BUOA 1NTZE 4RJTA 3Q1MA 4HKZH 4QMAA 1VQKP 1T3UA 4RKUJ 2JGPA 5AVVB 1YQ4C 4H44C 4YTPC 4M0IA 3G6EP 1IFMA 3HUSB 1QLED 2H7HA 3NMDA 4PD4D 3H1HE 4IPYA 1PIXA 2KR5A 1RO2A 1BCCE 1OX3A 2PEOA 2Z5IA 5HGNA 2M5RA 3AE5C 2KS1A 2WSEJ 3V2QA 2Q5UA 2FVAA 2GZJA 2HYNA 2Z46A 2IFMA 3TGUJ 4R0MA 1JTHA 2FQ0A 1VPCA 4MN4C 4JYBA 2N5IA 4Y99B 1KYOD 1L4AA 1PPJG 1JY3N 3FXDA 3CL3D 2OYHC 5E79H 2WSCH 3G71P 1IUQA 1BSNA 2KP8A 2W6BA 5H2FH 4H2XC 2HODB 2KSEA 3L72E 5CMZA 3CE7A 1HBWA 1IMQA 3M9QA 3TGUG 3ZDMA 1FBMA 1NYHA 1SQXD 3WUVA 1KILC 1NVOA 1VF5B 2L6EA 1IK9A 4XFYA 5HGOA 3SFDC 3H32A 4WB4A 4JQ0D 1OR5A 2LR2A 3L71D 3D6YA 3MHVA 2VRSA 1ZRTD 1SQBE 3WMM0 1RHZB 4IZ6A 3H1HJ 1VQ7P 2MKVA 1RH5B 1OWAA 1SQPD 5AVZB 3CX5H 4GIFA 5AW3B 2JAZA 1SFCD 2L0QA 2Y0EA 1OIPA 2ZFCA 4JPZB 1BDDA 2PGDA 3RG2A 3A0BE 2QM7A 4RESB 5APQA 3JC22 3AEAC 2HLOA 3RL0C 1G2CB 2P67A 2YKQA 1GD2E 1EZVE 2AXTH 5KKZB 2JDIH 3RK3E 3CCUP 1NU1G 2K9JA 5APVA 1PEMA 3O8ZA 3HE5A 5APTA 2KWLA 3P7KA 4LGDE 5B66H 2NRGA 2XV5A 4JF7A 3EWKA 3WUTA 1QEXA 3L72J 3T97A 2WSEH 1PPJD 2QG4A 1P84E 3H25A 1HH0A 3VRLC 1E0HA 1M1JC 2CK3H 4OVNF 3EQ2A 2A06E 2OYHA 1BE3J 3C8VA 2OYOA 4C7NA 3KPEA 4XA4A 3RK2D 3TGUD 1EXIA 3OAKA 3H6PA 2D2CD 1AFOA 2N6YA 2Z44A 1AVOA 1CI6A 1AVYA 1JUNA 2K93A 2AFEA 3M1MA 1ZP0C 1SQBJ 1PFIA 1GXHA 2E75D 2MY5A 2JU2A 1NJIQ 3S1KA 4U3FE 2Y9YA 2FYNC 1FC2C 4PXHB 3D70A 2XV6A 1KILA 2I8DA 4W7ZA 3FWLA 1T8KA 1IFJA 1DD3A 3L75E 5C39A 5BS1A 4PV1B 2H43A 1BE3G 4WY4C 7CEIA 5KJ7D 2JO1A 2E5YA 1VQLP 1LP1A 1EDKA 1VQOP 1EZVI 3I55P 2FXPA 2K0DX 1SQBG 2JYGA 1NWQA 4UB6E 3TK1A 2M8PA 2JO0A 3C1LA 3Q5PA 2M3BA 3H1IE 3RGUA 5CCHC 3CD6P 2QEXP 3H1KJ 2KSJA 1KLPA 2KS1B 5KAIH 2RMZA 3V4QA 1RF1A 1ZR2A 1JTHB 4PJ0H 1NU1D 3H1HD 3L73J 1RE4C 1M57D 4HB1A 2BEZF 1L4AB 1VQ4P 4COPA 3U1CA 3E2DA 1AV1A 3F5HA 4RO0A 1GW4A 5TISH 2PEKA 4W7YA 3IFMA 2E5TA 2Q1KA 2KYVA 3H1KG 2IX7C 4U3FJ 2WPQA 3CC7P 3AEEC 4H44D 1M1JA 2BHVA 2P1JA 1N73A 3L73G 3L75J 2X2BA 1FZEA 2A06G 2KG8A 3MTUE 3BRTB 5KTBA 5KP6B 5AW4B 1H89A 2JB0A 1J1DC 2ITAA 1NTMG 2NPSC 5B5EH 4Z1MH 2OQQA 5AVWB 2FACA 3CMAP 5BU5A 2QJKC 2KZIA 2PP6A 2MR8A 3CMEP 1IFIA 2KXPB 2QM8A 2KGAA 1W2EA 1KC8Q 4OGQC 1BE3D 3H1IJ 1UNKA 1RY3A 2WPTA 2IBZG 4WY4A 2E43A 1PEUA 2FQ2A 3A5TA 1YHQP 2PNGA 5KLVK 1SQBD 4GKGA 3DTJA 1FS0E 1EDJA 2WPSA 3GG2A 4HKGA 3L35A 2KODA 3AE6C 5GTIH 1NO4A 2JKVA 3PP5A 2K9JB 2OARA 1J1EC 3HE5B 3TYYA 1EOQA 5APXA 2LTEA 5CCHA 3H1IG 2ZXXA 1NTZK 2HPCA 4H2WC 1PGOA 5AW5B 3E1IA 3T97B 4A7PA 3FWNA 3PH0A 2NO8A 3K5BA 1LTSC 2O01H 2KOGA 1RE4A 4I2LC 2DNWA 3A0HH 3IAOA 4YXWH 2K92A 1RE3C 1KTMA 1S72P 2OYHB 1QL2A 4WVZA 2E76C 1RQVA 2OTKE 1VQ5P 2JWDA 3H1KD 1K8AQ 2QJPC 4NPFX 4C7NB 1H8AA 1MFZA 2PEMA 2OYIC 3H1JJ 1IK7A 1KMIZ 1M7LA 3RK2C 3A2AA 1S4XA 3U43A 1HJ0A 1DH3A 3L73D 2D2CC 1NTKE 1QX8A 1DIPA 2A06D 4GT1A 3MZWB 1PGJA 2YXRB 3RL0D 1JB0J 1K73Q 3CXHE 1KILB 2E75C 3HD7C 1HF9A 3TDKA 1K05A 2FYUK 2ONTA 2GUSA 2AXTE 1NTMD 4GR6A 2C0WA 4GODA 1R8EA 3PTZA 5KP8B 2GDWA 2NPSA 4R4MA 2OTLP 3VMAA 4ZMDA 4KT0J 1LP1B 4LLHA 3VMZA 1JMMA 3L4FA 3H1JG 1KQFB 1VL2A 1JOCA 3EJDA 1NHLA 1S5LH 3DS1A 1T2KC 3HE4A 2Z45A 2I1JA 5F2KA 2IBZD 2HG5D 1G1JA 3WU2E 1OW6A 1L0LG 2VLOA 1Y8AA 1J2JB 2MF4A 1SFCA 3B5ND 3G9RA 1JCDA 1OMIA 3AEGC 2QNWA 2GZEA 2JQ4A 3H47A 1RF1B 1EDLA 1S1CX 3RL0B 3EJEA 3JCUH 4ZNCA 2KOOA 1S2EA 3RBXA 3CCEP 2W6AA 3D71A 2N6ZA 2VLQA 3Q3DA 3H1ID 3AE4C 1U7JA 5AW2B 4TT3H 2J5UA 3H1LE 1G1IA 1PP9E 1L0NK 1KQGB 1GL2C 2H8PD 3CX5I 4WYMA 1NOHA 2N1TC 1HTLC 2E42A 3BRVB 5AVXB 2RKLA 4GDOA 5APSA 5APUA 3Q2YA 4I7ZB 2KGEA 2XXMA 2XZ0D 1HWTC 3GW6A 1M1JB 2K94A 3LW5H 2Q9IA 2HR3A 1N73B 5KLIC 1E6JP 3Q5SA 3B4QA 3AEDC 5KP7B 1SQQE 1KB9I 2MR7A 4EOTA 5DJUB 1UIXA 1S9KD 4PD4H 3G1GA 2OYIA 1IFNA 3W67A 5CCHD 5EFWB 4ASWA 2H89C 2AEFA 3H0DA 1PGQA 3JSVC 2GZFA 2LKIA 3GLMA 1AUMA 5KAIE 2WQYC 1VDFA 3HD7A 3M0AA 3PLNA 4PJ0E 2MJZA 4D6TE 3KZIE 2ZYDA 4K35A 3TNUA 3DS5A 1BGYE 3M91A 2W6JH 1JY2P 3CCQP 4M3LA 4WY4B 4N3YB 2M8NA 3M9HA 3H1JD 1YJWP 2FYUE 3G28A 5KJ7A 1AQ5A 2YIUC 2MD9A 5TISE 1GXGA 2GDXA 2M8RA 5KLVJ 2C9LY 3CCLP 1JM0A 2FXOA 2IYPA 3Q5RA 2LKMA 1DEEG 1L0LD 3C9IA 1BAJA 2KOSA 1Q90D 5AW1B 2O1KA 1FDOA 4H0LC 3NTEA 2DGYA 1M8OB 3OW2O 2FBWC 3W68A 3EJBA 4CPGA 3RBZA 2HPCB 1KQLA 1NTZJ 2NPSD 3II6A 2VLNA 1M6EX 2L9FA 3Q20A 5B5EE 2JYLA 1T3JA 1DV5A 2KW2A 5KLVG 1X22A 1JY3O 4AYCA 1NAFA 4EI2A 2K3RA 4OGQD 4IL6X 3DS0A 2N1TA 1CZQA 2E1MA 2OGUA 1BCCJ 1EQ7A 1YYCA 4NEOA 2QJYB 1FE6A 1L0NE 1CSBA 4XFXA 1ZW0A 2KLUA 1X3OA 1NTZG 1URQD 3L74E 3DS4A 3P8CD 3LIEA 1GK6A 1D1DA 3CXHH 3GZLA 1U7MA 4H13C 5M1BA 3BCCE 3CX5D 1BGYJ 4IFDK 3WBHA 5GTIE 3USSA 2FYUJ 2WPRA 3L70E 3H1HG 5HGLA 4OH8B 3N7NA 3VOPA 3CC2P 1BCCG 2AF8A 1LJ2A 2R32A 2N98A 2QVAA 1HGZA 1USDA 1Q7YQ 1ZN5A 2Y9ZA 1AF8A 3HE4B 1GU4A 2ZXEB 1KB9D 2K1AA 2C9NY 3OJAB 2ZT9D 2K9YA 3WU2H 1VQMP 5F2OA 1GW3A 2OTJP 3KYQA 1BGYG 1SFCB 3A0HE 1LTBC 2E76D 3B5NC 1R5SA 4BPFA 1M56D 2ERHA 1FU1A 3CC4P 1H0TA 1UJZA 1JNMA 2GM4A 3L72G 1Q2NA 4W80A 5CJ0A 1LTJC 5KAFH 3OA7A 2L91A 1J1EB 2BQ1E 3HD7D 3MUDC 3CLQA 2PEQA 2DW3A 2K0YA 1ZLLA 3MGEA 1U57A 5KLVD 1EXJA 2R3CA 1A02F 2K2QA 3BCCJ 3CCJP 3CCMP 2ZYGA 1T2KD 1L0HA 3GJNA 1S5LE 4Y28J 2LPKA 3L70J 1PZQA 1S3JA 2CPSA 2OYIB 1NTZD 3DPHA 2J58A 2EHTA 2BCCE 4L76A 4AUWA 3RK2B 2GUVA 1YTZI 2D2CB 2W8ZA 1YI2P 1LT9C 2E75B 3HD7B 2O01J 1OVRA 2CGQA 4KJMA 3JCUE 1P84I 2LMLA 3KZIH 5GTHH 2JBGA 3AEBC 1IO4A 1EZVG 3TNUB 3A3YB 4XRQA 1BCCD 2O01N 1GL2D 1VF5C 4R4LA 3L70G 2RH0A 2Y0DA 4I6MC 2N1TD 4U7JA 2KB7P 3MIWA 5AVYB 2FHSC 2O3JA 1YQ3C 1FR2A 1GDTA 4HJGH 3HTKA 5HGMA 2QE7H 2W83C 2GZIA 1NTKK 1IC2A 1ZOYC 3GZMA 1T6AA 2E74D 2AFDA 1BGYD 3BASA 5CBOA 2CPBA 3VN0A 1MUUA 1KFMA 2KGDA 4EIJA 4IFFA 3B5NA 1ZV8A 4C7RA 1VQ9P 5AW8B 2WITA 5AVUB 3L72D 4PD4E 3H32B 1AJYA 2N9BA 3CCSP 2N9YB 1AYIA 1LTJA 3KQGA 4U3FG 3MUDA 5KKZC 4ZKPA 1Q82Q 2N1TB 3ABVC 1SP4A 2BCCJ 1ZMEC 4WWIA 2FVEA 1KYOE 3L75G 1FZFA 3O6QA 4L74A 5CHXA 4BWNA 2H88C 4N78E 1KORA 2KOQA 1OW7A 1T8ZA 4HYTB 1IFPA 1IMPA 1URQC 4H44B 2IPPA 3M06A 2B88A 1EDIA 2VLPA 4B86A 3AE2C 2WPVB 4H0LD 2QSIA 3U1AA 3BATA 1PGPA 3KXDA 2GZGA 2BCCG 1M1KQ 1FJPA 1JJ2O 4MRTC 1LT9A 2XKMA 2QA4P 2HFED 2PFXA 1EZVD 3FXEA 2K88A 1YBKA 2MVUA 3RK3D 4DT0A 2KK7A 1SQQK 3LW5J 1PEQA 3L70D 4GR2A 2L4BA 2YO3A 2BASA 2ZT9C 2R3SA 5CCGC 1ZRTE 2M3EA 4YXDC 3B71A 1SQPE 4PD4I 3CPWO 3CCRP 4PV1C 3NXSA 1MKMA 1VQ8P 1P84D 1LTTC 1H0TB 1KFNA 2G8YA 2AEMA 2V7QH 1CI6B 1N2DC 1NU1K 2W27A 1N8RQ 4H13D 2KGCA 1CW5A 2G3AA 2XNXA 2SPZA 4JYCA 4DG9A 1PL5A 3I5CA 5AW9B 1HGVA 2M8LA 1SQVK 3LRYA 4PH1A 2M5AA 4U3FD 3PJSK 2WVRA 3VYIA 5DJTB 2KG6A 1MZ9A 1VQPP 1VQ6P 1HUCA 3M0DC 3L75D 4CA3A 4F37A 1JY2N 3P8MC 3G1IA 1PPJE 1X8YA 5F2NA 1USEA 2EHSA 1E79H 5AVSB 3I56P 1OXZA 1IFDA 2B9BA 2P58A 3G3ZA 1URQA 3LIDA 2JR8A 2UWJE 1OFCX 3TSIA 2I1KA 4U0AA 5JPAA 2BCCD 2AVAA 1LWUC 3TF5A 5EJDA 5KAFE 2CNRA 1YITP 2Q3EA 2V4HA 1LGHB 1NAYA 3CI9A 3SWYA 3EFGA 3HTKB 2P7JA 5DCKA 2POHA 2PRRA 1NKNA 3ITKA 5HV8A 1KQSO 2WZ7A 2Y0CA 1NTKJ 2NZ2A 3NY7B 4GOFA 3PRJA 4L75A 2E74C 3CXHI 4BPGA 2XNDH 3V5BA 2P9XA 3B5NB 4BRYA 1RE3A 2R5BA 1LT1A 3VP9A 1L0IA 2KZJA 1LTGC 3GF3A 1AQTA 1ACPA 1LTJB 2PEJA 3HZQA 5I4TG 2WSFJ 1A02J 1NTKG 2R5DA 2FYNB 3NFQA 2LIWA 5TJHA 2A45H 1IJDB 4IL6E 4OWFA 1Q81Q 2Z5HA 1NU1E 2LIUA 5GTHE 1KYOH 3AE7C 3GHGC 5L8RJ 1VF5D 3O6QB 1FDIA 3CWBE 2Q6QA 2YO2A 2WWWA 4DOJA 1DX7A 1FOSF 4XFZA 1SQVE 2FQ1A 3M0DA 3B5IA 3H1LJ 1PP9J 4N78D 1NTMK 3HRNA 2B87A 3R2PA 1AA0A 2ZAEB 1JO5A 5AW6B 3G4SP 1LT9B 3RG6C 2FFDC 3S9OA 2RN0A 1FZCC 1MV8A 1N7SC 4QKOA 2ZJSE 1GMJA 3UIAA 1FDMA 1UIIA 2ZVNB 3RK3C 1LWUA 2YNYA 3AEFC 1SQQJ 2IDBA 2JU1A 1X79B 2KNCA 3NTNA 3U59A 1Y9BA 3H1LG 1PP9G 1LTIC 1GL2A 1WRGA 2P10A 1BE3E 4EDFA 4LC1A 3HYBA 3V2NA 3VMXA 1ZMBA 2KLVA 1KD1Q 1A43A 2PY8A 1X0TA 3IF4A 2XZ1C 4D6TJ 1NU1J 4U0DA 2YKPA 2YMKA 1SQQG 3CWBJ 2J59M 1OW8A 4K3AA 1LTAC 1KILE 1J1DB 2YXQB 2NPSB 2KORA 2PAJA 1NTKD 2M5AB 3RL0g 1SQVJ 1RF1C 4PWVB 1QVGO 1YJNP 3CXHD 4U0EA 2MVVA 2QJKB 2Q7CA 4UB8H 3AECC 1HJBA 4DCKA 1KB9H 3V2PA 2WSFH 1Q86Q 4OGQB 2GDYA 4D6TG 1RNIA 1FZBA 1VQNP 3PHLA 3GHGA 1JMBA 5CCGD 1EIAA 3CWBG 4XE5B 1JY3P 4PV1D 1KZUB 2FYUG 4L73A 1R5LA 1MZ8A 2YMYA 3IR9A 3H1KE 1URQB 1H88A 1SQVG 4I7ZC 5AW7B 3SFEC 4EYYQ 2LXBA 1M6NA 3L73E 1N73C 2XDJA 3QH9A 3HUSC 2FXMA 1QGKB 1CEIA 1L0NJ 4WBAA 1NTME 4N6JA 2FFDA 1FZCA 1N7SA 4YPCA 1FZGA 3L74J 3MGNA 1L0LK 1NKZB 2CWOA 3H1LD 1PP9D 2ZT9B 1X9VA 3SWFA 4BRYB 1L4AD 5CJ4A 1SQXK 2GA1A 1E5WA 3DS3A 2E76B 5AVQB 2WT7A 4Y99C 2IBZE 2QJPB 3IN6A 1N86A 1L0NG 4QNBA 2N50A 1LNQA 1MFTA 5AVRB 2WMMA 4IOIH 1QRJA 1L2PA 1TU3F 3CXCO 1XTCC 1DEBA 3L74G 1SQQD 2PENA 2XU6A 4IL6H 1GZLA 2FKWB 1RF0C 2EFJA 4DJGA 3BCCG 4U0CA 3L36A 5APYA 1SQPK 2AXCA 3D6ZA 3BVHA 4BPHA 1OVUA 3S4RA 5K5GB 1IZNB 4O9BA 3V2RA 4PH0A 1SS1A 1VKUA 1BXIA 1GU5A 2JJLA 4C46A 2L5GB 2V7QJ 4DZOA 4D6TD 3V4WA 4JBZA 3G29A 2K37A 3MP7B 3CWBD 3E1RA 1BDCA 1Z6MA 1FOSE 1VHNA 2FYUD 5CZDB 2B87B 2IYOA 1NTMJ 4U0FA 3VP8A 5HVCA 2GYKA 2K0XA 5AVTB 1SQVD 2ZYAA 3AE3C 2QJYC 2KIKA 3LMOA 1S9KE 1NH4A 2IFNA 1W5CE 3GKLC 1LWUB 1NQ4A 2CQ8A 4UHPB 1F80D 2KNCB 2LOLA 3KDPB 2IZ1A 2IBZI 1S5LX 1GL2B 3HUSA 4U0BA 5BS2A 2FVFA 1YTZT 2R44A 1KN7A 3AE9C 1PV3A 1GK4A 4KHXA 2KI7B 3H1JE 1DD4A 2E74B 2B89A 1NGMB 5KLIB 1K9MQ 3AE8C 4ZKUA 2PEIA 4COCA 1L0LE 2ZVOB 4BXLA 1ZXGA 1L0ND 1SFCC
chains in the Genus database with same CATH topology
2XXMA 1EIAA 2PEOA 1RO0A 5HGNA 2BQ1E 1YITP 1VQLP 4XROA 1E6JP 3CMAP 1K73Q 4PH0A 1A8OA 2Z46A 1VQOP 3CMEP 3I55P 3G4SP 1QVFO 1VQ9P 3DS0A 1YJ9P 3G21A 2PEQA 3CPWO 3CCRP 2E1MA 5DCKA 2ONTA 3RG6C 1KC8Q 2JYGA 3G0VA 4GR6A 3G29A 1KQSO 3MGEA 2M8PA 3G1GA 2JO0A 1VQ8P 1YIJP 3CCUP 4XFXA 1M6NA 3CCVP 3CCSP 2OTLP 1PEMA 3H0DA 3CD6P 1W2BO 1PEUA 3CCJP 3DS4A 2QEXP 1N8RQ 1YHQP 3CCMP 1AUMA 1D1DA 4U0FA 3DTJA 3G71P 2P9XA 1IUQA 1Q82Q 3P05A 3DS1A 2Z45A 3WBHA 5F2KA 2KODA 2XT1A 3HYBA 1ZMBA 3DS5A 1VQ4P 4COPA 3DPHA 2M8LA 3CCQP 2OARA 3VRLC 1RO2A 1KD1Q 3LRYA 3E2DA 1A43A 4PH1A 5HGLA 2M8NA 1EOQA 1YJWP 2PY8A 2CWOA 3CC2P 3G28A 2PEJA 3HZQA 5I4TG 2L6EA 3H47A 2LF4A 1YI2P 2PEKA 3G26A 4XFYA 5HGOA 4U0DA 1Q7YQ 4U0BA 3DS3A 1VQPP 1Q81Q 3CCLP 1VQ6P 5BS2A 1K30A 3CCEP 3G1IA 3DS2A 5F2NA 1M74A 1PEOA 2BUOA 2Z44A 1BAJA 1VQMP 3CC7P 5F2OA 4XRQA 3M1MA 2OTJP 1VQKP 4QNBA 3NTEA 1M90Q 2DGYA 2BHVA 1NJIQ 1M1KQ 3OW2O 3I56P 1QRJA 1QVGO 2XV6A 3H4EA 3CXCO 1S72P 1YJNP 1JJ2O 4M0IA 4WYMA 3G6EP 4U0EA 1VQ7P 1K9MQ 2PENA 5HGMA 2QA4P 1VQ5P 1K8AQ 2EIAA 4XFZA 2EG5A 2EFJA 2PEIA 5BS1A 2PEMA 4COCA 1M6EX 1Q86Q 4IPYA 3CC4P 3B5IA 4U0CA 1RNIA 4U0AA 1PEQA 5JPAA 3Q20A 1VQNP 2JYLA 4GR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS P;  2OTL P;  1M90 Q;  3CD6 P;  1YJW P;  1W2B O;  1YIT P;  1NJI Q;  3CCJ P;  1VQL P;  3CC2 P;  1M1K Q;  3OW2 O;  2QEX P;  3I56 P;  3CCM P;  1YHQ P;  1N8R Q;  3CMA P;  1QVG O;  1K73 Q;  3CXC O;  1JJ2 O;  1S72 P;  1YJN P;  1YI2 P;  1VQO P;  3G6E P;  3G71 P;  3I55 P;  3CME P;  3G4S P;  1QVF O;  1VQ7 P;  1K9M Q;  1VQ9 P;  1YJ9 P;  2QA4 P;  1VQ5 P;  3CPW O;  3CCR P;  1Q7Y Q;  1Q82 Q;  1K8A Q;  1VQP P;  1Q81 Q;  3CCL P;  1KC8 Q;  1KD1 Q;  1VQ6 P;  3CCE P;  1Q86 Q;  1KQS O;  3CC4 P;  1VQ8 P;  1YIJ P;  1VQ4 P;  3CCU P;  1VQM P;  3CC7 P;  1VQN P;  3CCQ P;  2OTJ P;  3CCV P;  1VQK P; 
#chains in the Genus database with same CATH topology
 2LXC B;  2FAE A;  3L37 A;  1SQX E;  3A0B H;  3L74 D;  4XRO A;  2ROQ A;  1EC5 A;  5E79 E;  1EMV A;  1QVF O;  1HY8 A;  3BCC D;  1HVV A;  1YJ9 P;  3G21 A;  1N7S D;  1OVV A;  5H2F E;  2HOD A;  3G0V A;  1RF0 A;  1OZH A;  3KHU A;  3R4Y A;  1KIL D;  2CG5 B;  3GHG B;  1QL1 A;  1ZR4 A;  3GF7 A;  1SVF A;  3N4X A;  3L71 E;  1W2B O;  3EFF K;  2Z4E A;  4HH2 A;  2YIU B;  3P05 A;  2KUB A;  1BSH A;  4XFJ A;  2XT1 A;  1P84 H;  2C0X A;  3B4S A;  1GTW A;  3F89 A;  2QRX A;  1Z56 A;  1JCC A;  2AEJ A;  4H2Y C;  1SLQ A;  3MD0 A;  2A45 I;  4H0L B;  3P8C E;  4NPE A;  2LF4 A;  2KOP A;  2IZ0 A;  3B8E B;  3CX5 E;  1KYO I;  1K30 A;  2BEQ D;  1FJK A;  2VSQ A;  3DS2 A;  2M0B A;  5BU8 B;  2FFD B;  1FZC B;  1DNY A;  2Q3I A;  1N7S B;  5APW A;  2O1J A;  3SWK A;  3GMA A;  1RQU A;  2FAD A;  2LL8 A;  1M90 Q;  3RK3 B;  2L22 A;  3H4E A;  1L0L J;  1D7M A;  4IFM A;  1G2C A;  4UB8 E;  2EIA A;  1HQB A;  2EG5 A;  3E7K A;  2K5X A;  2A45 G;  1KB9 E;  2WT7 B;  1L4A C;  1SQX J;  5AW0 B;  4GOE A;  5CBN A;  2WSC J;  1K04 A;  3P32 A;  1WMK A;  3M9B A;  1RO0 A;  5B66 E;  3FX0 A;  2QIW A;  4TLF A;  5KJ7 C;  3VMY A;  2XZR A;  1A8O A;  3V6I A;  3VTP C;  2JEE A;  4H13 B;  2KG9 A;  4UB6 H;  3L71 J;  3TGU E;  1YIJ P;  5BVZ A;  3CCV P;  1JEK A;  1GPJ A;  1SQP J;  5EW5 E;  2WSS H;  1SQX G;  1FZA A;  3AE1 C;  4AQR D;  2JP3 A;  4NPD A;  1WT6 A;  1KV4 A;  2N5H A;  1SQB K;  2FYZ A;  2P2U A;  1JY2 O;  2FY8 A;  5KLV E;  1XTG B;  3WUU A;  4I1L A;  1N7L A;  4ASV A;  3FGA D;  3QWO C;  3L71 G;  5CCG A;  1Y47 A;  3G26 A;  3A7O A;  1ZNV A;  2YKO A;  2WTY A;  3SSU A;  2W90 A;  2JWA A;  4WY4 D;  1SQP G;  1M74 A;  1PEO A;  1FAV A;  2BUO A;  1NTZ E;  4RJT A;  3Q1M A;  4HKZ H;  4QMA A;  1VQK P;  1T3U A;  4RKU J;  2JGP A;  5AVV B;  1YQ4 C;  4H44 C;  4YTP C;  4M0I A;  3G6E P;  1IFM A;  3HUS B;  1QLE D;  2H7H A;  3NMD A;  4PD4 D;  3H1H E;  4IPY A;  1PIX A;  2KR5 A;  1RO2 A;  1BCC E;  1OX3 A;  2PEO A;  2Z5I A;  5HGN A;  2M5R A;  3AE5 C;  2KS1 A;  2WSE J;  3V2Q A;  2Q5U A;  2FVA A;  2GZJ A;  2HYN A;  2Z46 A;  2IFM A;  3TGU J;  4R0M A;  1JTH A;  2FQ0 A;  1VPC A;  4MN4 C;  4JYB A;  2N5I A;  4Y99 B;  1KYO D;  1L4A A;  1PPJ G;  1JY3 N;  3FXD A;  3CL3 D;  2OYH C;  5E79 H;  2WSC H;  3G71 P;  1IUQ A;  1BSN A;  2KP8 A;  2W6B A;  5H2F H;  4H2X C;  2HOD B;  2KSE A;  3L72 E;  5CMZ A;  3CE7 A;  1HBW A;  1IMQ A;  3M9Q A;  3TGU G;  3ZDM A;  1FBM A;  1NYH A;  1SQX D;  3WUV A;  1KIL C;  1NVO A;  1VF5 B;  2L6E A;  1IK9 A;  4XFY A;  5HGO A;  3SFD C;  3H32 A;  4WB4 A;  4JQ0 D;  1OR5 A;  2LR2 A;  3L71 D;  3D6Y A;  3MHV A;  2VRS A;  1ZRT D;  1SQB E;  3WMM 0;  1RHZ B;  4IZ6 A;  3H1H J;  1VQ7 P;  2MKV A;  1RH5 B;  1OWA A;  1SQP D;  5AVZ B;  3CX5 H;  4GIF A;  5AW3 B;  2JAZ A;  1SFC D;  2L0Q A;  2Y0E A;  1OIP A;  2ZFC A;  4JPZ B;  1BDD A;  2PGD A;  3RG2 A;  3A0B E;  2QM7 A;  4RES B;  5APQ A;  3JC2 2;  3AEA C;  2HLO A;  3RL0 C;  1G2C B;  2P67 A;  2YKQ A;  1GD2 E;  1EZV E;  2AXT H;  5KKZ B;  2JDI H;  3RK3 E;  3CCU P;  1NU1 G;  2K9J A;  5APV A;  1PEM A;  3O8Z A;  3HE5 A;  5APT A;  2KWL A;  3P7K A;  4LGD E;  5B66 H;  2NRG A;  2XV5 A;  4JF7 A;  3EWK A;  3WUT A;  1QEX A;  3L72 J;  3T97 A;  2WSE H;  1PPJ D;  2QG4 A;  1P84 E;  3H25 A;  1HH0 A;  3VRL C;  1E0H A;  1M1J C;  2CK3 H;  4OVN F;  3EQ2 A;  2A06 E;  2OYH A;  1BE3 J;  3C8V A;  2OYO A;  4C7N A;  3KPE A;  4XA4 A;  3RK2 D;  3TGU D;  1EXI A;  3OAK A;  3H6P A;  2D2C D;  1AFO A;  2N6Y A;  2Z44 A;  1AVO A;  1CI6 A;  1AVY A;  1JUN A;  2K93 A;  2AFE A;  3M1M A;  1ZP0 C;  1SQB J;  1PFI A;  1GXH A;  2E75 D;  2MY5 A;  2JU2 A;  1NJI Q;  3S1K A;  4U3F E;  2Y9Y A;  2FYN C;  1FC2 C;  4PXH B;  3D70 A;  2XV6 A;  1KIL A;  2I8D A;  4W7Z A;  3FWL A;  1T8K A;  1IFJ A;  1DD3 A;  3L75 E;  5C39 A;  5BS1 A;  4PV1 B;  2H43 A;  1BE3 G;  4WY4 C;  7CEI A;  5KJ7 D;  2JO1 A;  2E5Y A;  1VQL P;  1LP1 A;  1EDK A;  1VQO P;  1EZV I;  3I55 P;  2FXP A;  2K0D X;  1SQB G;  2JYG A;  1NWQ A;  4UB6 E;  3TK1 A;  2M8P A;  2JO0 A;  3C1L A;  3Q5P A;  2M3B A;  3H1I E;  3RGU A;  5CCH C;  3CD6 P;  2QEX P;  3H1K J;  2KSJ A;  1KLP A;  2KS1 B;  5KAI H;  2RMZ A;  3V4Q A;  1RF1 A;  1ZR2 A;  1JTH B;  4PJ0 H;  1NU1 D;  3H1H D;  3L73 J;  1RE4 C;  1M57 D;  4HB1 A;  2BEZ F;  1L4A B;  1VQ4 P;  4COP A;  3U1C A;  3E2D A;  1AV1 A;  3F5H A;  4RO0 A;  1GW4 A;  5TIS H;  2PEK A;  4W7Y A;  3IFM A;  2E5T A;  2Q1K A;  2KYV A;  3H1K G;  2IX7 C;  4U3F J;  2WPQ A;  3CC7 P;  3AEE C;  4H44 D;  1M1J A;  2BHV A;  2P1J A;  1N73 A;  3L73 G;  3L75 J;  2X2B A;  1FZE A;  2A06 G;  2KG8 A;  3MTU E;  3BRT B;  5KTB A;  5KP6 B;  5AW4 B;  1H89 A;  2JB0 A;  1J1D C;  2ITA A;  1NTM G;  2NPS C;  5B5E H;  4Z1M H;  2OQQ A;  5AVW B;  2FAC A;  3CMA P;  5BU5 A;  2QJK C;  2KZI A;  2PP6 A;  2MR8 A;  3CME P;  1IFI A;  2KXP B;  2QM8 A;  2KGA A;  1W2E A;  1KC8 Q;  4OGQ C;  1BE3 D;  3H1I J;  1UNK A;  1RY3 A;  2WPT A;  2IBZ G;  4WY4 A;  2E43 A;  1PEU A;  2FQ2 A;  3A5T A;  1YHQ P;  2PNG A;  5KLV K;  1SQB D;  4GKG A;  3DTJ A;  1FS0 E;  1EDJ A;  2WPS A;  3GG2 A;  4HKG A;  3L35 A;  2KOD A;  3AE6 C;  5GTI H;  1NO4 A;  2JKV A;  3PP5 A;  2K9J B;  2OAR A;  1J1E C;  3HE5 B;  3TYY A;  1EOQ A;  5APX A;  2LTE A;  5CCH A;  3H1I G;  2ZXX A;  1NTZ K;  2HPC A;  4H2W C;  1PGO A;  5AW5 B;  3E1I A;  3T97 B;  4A7P A;  3FWN A;  3PH0 A;  2NO8 A;  3K5B A;  1LTS C;  2O01 H;  2KOG A;  1RE4 A;  4I2L C;  2DNW A;  3A0H H;  3IAO A;  4YXW H;  2K92 A;  1RE3 C;  1KTM A;  1S72 P;  2OYH B;  1QL2 A;  4WVZ A;  2E76 C;  1RQV A;  2OTK E;  1VQ5 P;  2JWD A;  3H1K D;  1K8A Q;  2QJP C;  4NPF X;  4C7N B;  1H8A A;  1MFZ A;  2PEM A;  2OYI C;  3H1J J;  1IK7 A;  1KMI Z;  1M7L A;  3RK2 C;  3A2A A;  1S4X A;  3U43 A;  1HJ0 A;  1DH3 A;  3L73 D;  2D2C C;  1NTK E;  1QX8 A;  1DIP A;  2A06 D;  4GT1 A;  3MZW B;  1PGJ A;  2YXR B;  3RL0 D;  1JB0 J;  1K73 Q;  3CXH E;  1KIL B;  2E75 C;  3HD7 C;  1HF9 A;  3TDK A;  1K05 A;  2FYU K;  2ONT A;  2GUS A;  2AXT E;  1NTM D;  4GR6 A;  2C0W A;  4GOD A;  1R8E A;  3PTZ A;  5KP8 B;  2GDW A;  2NPS A;  4R4M A;  2OTL P;  3VMA A;  4ZMD A;  4KT0 J;  1LP1 B;  4LLH A;  3VMZ A;  1JMM A;  3L4F A;  3H1J G;  1KQF B;  1VL2 A;  1JOC A;  3EJD A;  1NHL A;  1S5L H;  3DS1 A;  1T2K C;  3HE4 A;  2Z45 A;  2I1J A;  5F2K A;  2IBZ D;  2HG5 D;  1G1J A;  3WU2 E;  1OW6 A;  1L0L G;  2VLO A;  1Y8A A;  1J2J B;  2MF4 A;  1SFC A;  3B5N D;  3G9R A;  1JCD A;  1OMI A;  3AEG C;  2QNW A;  2GZE A;  2JQ4 A;  3H47 A;  1RF1 B;  1EDL A;  1S1C X;  3RL0 B;  3EJE A;  3JCU H;  4ZNC A;  2KOO A;  1S2E A;  3RBX A;  3CCE P;  2W6A A;  3D71 A;  2N6Z A;  2VLQ A;  3Q3D A;  3H1I D;  3AE4 C;  1U7J A;  5AW2 B;  4TT3 H;  2J5U A;  3H1L E;  1G1I A;  1PP9 E;  1L0N K;  1KQG B;  1GL2 C;  2H8P D;  3CX5 I;  4WYM A;  1NOH A;  2N1T C;  1HTL C;  2E42 A;  3BRV B;  5AVX B;  2RKL A;  4GDO A;  5APS A;  5APU A;  3Q2Y A;  4I7Z B;  2KGE A;  2XXM A;  2XZ0 D;  1HWT C;  3GW6 A;  1M1J B;  2K94 A;  3LW5 H;  2Q9I A;  2HR3 A;  1N73 B;  5KLI C;  1E6J P;  3Q5S A;  3B4Q A;  3AED C;  5KP7 B;  1SQQ E;  1KB9 I;  2MR7 A;  4EOT A;  5DJU B;  1UIX A;  1S9K D;  4PD4 H;  3G1G A;  2OYI A;  1IFN A;  3W67 A;  5CCH D;  5EFW B;  4ASW A;  2H89 C;  2AEF A;  3H0D A;  1PGQ A;  3JSV C;  2GZF A;  2LKI A;  3GLM A;  1AUM A;  5KAI E;  2WQY C;  1VDF A;  3HD7 A;  3M0A A;  3PLN A;  4PJ0 E;  2MJZ A;  4D6T E;  3KZI E;  2ZYD A;  4K35 A;  3TNU A;  3DS5 A;  1BGY E;  3M91 A;  2W6J H;  1JY2 P;  3CCQ P;  4M3L A;  4WY4 B;  4N3Y B;  2M8N A;  3M9H A;  3H1J D;  1YJW P;  2FYU E;  3G28 A;  5KJ7 A;  1AQ5 A;  2YIU C;  2MD9 A;  5TIS E;  1GXG A;  2GDX A;  2M8R A;  5KLV J;  2C9L Y;  3CCL P;  1JM0 A;  2FXO A;  2IYP A;  3Q5R A;  2LKM A;  1DEE G;  1L0L D;  3C9I A;  1BAJ A;  2KOS A;  1Q90 D;  5AW1 B;  2O1K A;  1FDO A;  4H0L C;  3NTE A;  2DGY A;  1M8O B;  3OW2 O;  2FBW C;  3W68 A;  3EJB A;  4CPG A;  3RBZ A;  2HPC B;  1KQL A;  1NTZ J;  2NPS D;  3II6 A;  2VLN A;  1M6E X;  2L9F A;  3Q20 A;  5B5E E;  2JYL A;  1T3J A;  1DV5 A;  2KW2 A;  5KLV G;  1X22 A;  1JY3 O;  4AYC A;  1NAF A;  4EI2 A;  2K3R A;  4OGQ D;  4IL6 X;  3DS0 A;  2N1T A;  1CZQ A;  2E1M A;  2OGU A;  1BCC J;  1EQ7 A;  1YYC A;  4NEO A;  2QJY B;  1FE6 A;  1L0N E;  1CSB A;  4XFX A;  1ZW0 A;  2KLU A;  1X3O A;  1NTZ G;  1URQ D;  3L74 E;  3DS4 A;  3P8C D;  3LIE A;  1GK6 A;  1D1D A;  3CXH H;  3GZL A;  1U7M A;  4H13 C;  5M1B A;  3BCC E;  3CX5 D;  1BGY J;  4IFD K;  3WBH A;  5GTI E;  3USS A;  2FYU J;  2WPR A;  3L70 E;  3H1H G;  5HGL A;  4OH8 B;  3N7N A;  3VOP A;  3CC2 P;  1BCC G;  2AF8 A;  1LJ2 A;  2R32 A;  2N98 A;  2QVA A;  1HGZ A;  1USD A;  1Q7Y Q;  1ZN5 A;  2Y9Z A;  1AF8 A;  3HE4 B;  1GU4 A;  2ZXE B;  1KB9 D;  2K1A A;  2C9N Y;  3OJA B;  2ZT9 D;  2K9Y A;  3WU2 H;  1VQM P;  5F2O A;  1GW3 A;  2OTJ P;  3KYQ A;  1BGY G;  1SFC B;  3A0H E;  1LTB C;  2E76 D;  3B5N C;  1R5S A;  4BPF A;  1M56 D;  2ERH A;  1FU1 A;  3CC4 P;  1H0T A;  1UJZ A;  1JNM A;  2GM4 A;  3L72 G;  1Q2N A;  4W80 A;  5CJ0 A;  1LTJ C;  5KAF H;  3OA7 A;  2L91 A;  1J1E B;  2BQ1 E;  3HD7 D;  3MUD C;  3CLQ A;  2PEQ A;  2DW3 A;  2K0Y A;  1ZLL A;  3MGE A;  1U57 A;  5KLV D;  1EXJ A;  2R3C A;  1A02 F;  2K2Q A;  3BCC J;  3CCJ P;  3CCM P;  2ZYG A;  1T2K D;  1L0H A;  3GJN A;  1S5L E;  4Y28 J;  2LPK A;  3L70 J;  1PZQ A;  1S3J A;  2CPS A;  2OYI B;  1NTZ D;  3DPH A;  2J58 A;  2EHT A;  2BCC E;  4L76 A;  4AUW A;  3RK2 B;  2GUV A;  1YTZ I;  2D2C B;  2W8Z A;  1YI2 P;  1LT9 C;  2E75 B;  3HD7 B;  2O01 J;  1OVR A;  2CGQ A;  4KJM A;  3JCU E;  1P84 I;  2LML A;  3KZI H;  5GTH H;  2JBG A;  3AEB C;  1IO4 A;  1EZV G;  3TNU B;  3A3Y B;  4XRQ A;  1BCC D;  2O01 N;  1GL2 D;  1VF5 C;  4R4L A;  3L70 G;  2RH0 A;  2Y0D A;  4I6M C;  2N1T D;  4U7J A;  2KB7 P;  3MIW A;  5AVY B;  2FHS C;  2O3J A;  1YQ3 C;  1FR2 A;  1GDT A;  4HJG H;  3HTK A;  5HGM A;  2QE7 H;  2W83 C;  2GZI A;  1NTK K;  1IC2 A;  1ZOY C;  3GZM A;  1T6A A;  2E74 D;  2AFD A;  1BGY D;  3BAS A;  5CBO A;  2CPB A;  3VN0 A;  1MUU A;  1KFM A;  2KGD A;  4EIJ A;  4IFF A;  3B5N A;  1ZV8 A;  4C7R A;  1VQ9 P;  5AW8 B;  2WIT A;  5AVU B;  3L72 D;  4PD4 E;  3H32 B;  1AJY A;  2N9B A;  3CCS P;  2N9Y B;  1AYI A;  1LTJ A;  3KQG A;  4U3F G;  3MUD A;  5KKZ C;  4ZKP A;  1Q82 Q;  2N1T B;  3ABV C;  1SP4 A;  2BCC J;  1ZME C;  4WWI A;  2FVE A;  1KYO E;  3L75 G;  1FZF A;  3O6Q A;  4L74 A;  5CHX A;  4BWN A;  2H88 C;  4N78 E;  1KOR A;  2KOQ A;  1OW7 A;  1T8Z A;  4HYT B;  1IFP A;  1IMP A;  1URQ C;  4H44 B;  2IPP A;  3M06 A;  2B88 A;  1EDI A;  2VLP A;  4B86 A;  3AE2 C;  2WPV B;  4H0L D;  2QSI A;  3U1A A;  3BAT A;  1PGP A;  3KXD A;  2GZG A;  2BCC G;  1M1K Q;  1FJP A;  1JJ2 O;  4MRT C;  1LT9 A;  2XKM A;  2QA4 P;  2HFE D;  2PFX A;  1EZV D;  3FXE A;  2K88 A;  1YBK A;  2MVU A;  3RK3 D;  4DT0 A;  2KK7 A;  1SQQ K;  3LW5 J;  1PEQ A;  3L70 D;  4GR2 A;  2L4B A;  2YO3 A;  2BAS A;  2ZT9 C;  2R3S A;  5CCG C;  1ZRT E;  2M3E A;  4YXD C;  3B71 A;  1SQP E;  4PD4 I;  3CPW O;  3CCR P;  4PV1 C;  3NXS A;  1MKM A;  1VQ8 P;  1P84 D;  1LTT C;  1H0T B;  1KFN A;  2G8Y A;  2AEM A;  2V7Q H;  1CI6 B;  1N2D C;  1NU1 K;  2W27 A;  1N8R Q;  4H13 D;  2KGC A;  1CW5 A;  2G3A A;  2XNX A;  2SPZ A;  4JYC A;  4DG9 A;  1PL5 A;  3I5C A;  5AW9 B;  1HGV A;  2M8L A;  1SQV K;  3LRY A;  4PH1 A;  2M5A A;  4U3F D;  3PJS K;  2WVR A;  3VYI A;  5DJT B;  2KG6 A;  1MZ9 A;  1VQP P;  1VQ6 P;  1HUC A;  3M0D C;  3L75 D;  4CA3 A;  4F37 A;  1JY2 N;  3P8M C;  3G1I A;  1PPJ E;  1X8Y A;  5F2N A;  1USE A;  2EHS A;  1E79 H;  5AVS B;  3I56 P;  1OXZ A;  1IFD A;  2B9B A;  2P58 A;  3G3Z A;  1URQ A;  3LID A;  2JR8 A;  2UWJ E;  1OFC X;  3TSI A;  2I1K A;  4U0A A;  5JPA A;  2BCC D;  2AVA A;  1LWU C;  3TF5 A;  5EJD A;  5KAF E;  2CNR A;  1YIT P;  2Q3E A;  2V4H A;  1LGH B;  1NAY A;  3CI9 A;  3SWY A;  3EFG A;  3HTK B;  2P7J A;  5DCK A;  2POH A;  2PRR A;  1NKN A;  3ITK A;  5HV8 A;  1KQS O;  2WZ7 A;  2Y0C A;  1NTK J;  2NZ2 A;  3NY7 B;  4GOF A;  3PRJ A;  4L75 A;  2E74 C;  3CXH I;  4BPG A;  2XND H;  3V5B A;  2P9X A;  3B5N B;  4BRY A;  1RE3 A;  2R5B A;  1LT1 A;  3VP9 A;  1L0I A;  2KZJ A;  1LTG C;  3GF3 A;  1AQT A;  1ACP A;  1LTJ B;  2PEJ A;  3HZQ A;  5I4T G;  2WSF J;  1A02 J;  1NTK G;  2R5D A;  2FYN B;  3NFQ A;  2LIW A;  5TJH A;  2A45 H;  1IJD B;  4IL6 E;  4OWF A;  1Q81 Q;  2Z5H A;  1NU1 E;  2LIU A;  5GTH E;  1KYO H;  3AE7 C;  3GHG C;  5L8R J;  1VF5 D;  3O6Q B;  1FDI A;  3CWB E;  2Q6Q A;  2YO2 A;  2WWW A;  4DOJ A;  1DX7 A;  1FOS F;  4XFZ A;  1SQV E;  2FQ1 A;  3M0D A;  3B5I A;  3H1L J;  1PP9 J;  4N78 D;  1NTM K;  3HRN A;  2B87 A;  3R2P A;  1AA0 A;  2ZAE B;  1JO5 A;  5AW6 B;  3G4S P;  1LT9 B;  3RG6 C;  2FFD C;  3S9O A;  2RN0 A;  1FZC C;  1MV8 A;  1N7S C;  4QKO A;  2ZJS E;  1GMJ A;  3UIA A;  1FDM A;  1UII A;  2ZVN B;  3RK3 C;  1LWU A;  2YNY A;  3AEF C;  1SQQ J;  2IDB A;  2JU1 A;  1X79 B;  2KNC A;  3NTN A;  3U59 A;  1Y9B A;  3H1L G;  1PP9 G;  1LTI C;  1GL2 A;  1WRG A;  2P10 A;  1BE3 E;  4EDF A;  4LC1 A;  3HYB A;  3V2N A;  3VMX A;  1ZMB A;  2KLV A;  1KD1 Q;  1A43 A;  2PY8 A;  1X0T A;  3IF4 A;  2XZ1 C;  4D6T J;  1NU1 J;  4U0D A;  2YKP A;  2YMK A;  1SQQ G;  3CWB J;  2J59 M;  1OW8 A;  4K3A A;  1LTA C;  1KIL E;  1J1D B;  2YXQ B;  2NPS B;  2KOR A;  2PAJ A;  1NTK D;  2M5A B;  3RL0 g;  1SQV J;  1RF1 C;  4PWV B;  1QVG O;  1YJN P;  3CXH D;  4U0E A;  2MVV A;  2QJK B;  2Q7C A;  4UB8 H;  3AEC C;  1HJB A;  4DCK A;  1KB9 H;  3V2P A;  2WSF H;  1Q86 Q;  4OGQ B;  2GDY A;  4D6T G;  1RNI A;  1FZB A;  1VQN P;  3PHL A;  3GHG A;  1JMB A;  5CCG D;  1EIA A;  3CWB G;  4XE5 B;  1JY3 P;  4PV1 D;  1KZU B;  2FYU G;  4L73 A;  1R5L A;  1MZ8 A;  2YMY A;  3IR9 A;  3H1K E;  1URQ B;  1H88 A;  1SQV G;  4I7Z C;  5AW7 B;  3SFE C;  4EYY Q;  2LXB A;  1M6N A;  3L73 E;  1N73 C;  2XDJ A;  3QH9 A;  3HUS C;  2FXM A;  1QGK B;  1CEI A;  1L0N J;  4WBA A;  1NTM E;  4N6J A;  2FFD A;  1FZC A;  1N7S A;  4YPC A;  1FZG A;  3L74 J;  3MGN A;  1L0L K;  1NKZ B;  2CWO A;  3H1L D;  1PP9 D;  2ZT9 B;  1X9V A;  3SWF A;  4BRY B;  1L4A D;  5CJ4 A;  1SQX K;  2GA1 A;  1E5W A;  3DS3 A;  2E76 B;  5AVQ B;  2WT7 A;  4Y99 C;  2IBZ E;  2QJP B;  3IN6 A;  1N86 A;  1L0N G;  4QNB A;  2N50 A;  1LNQ A;  1MFT A;  5AVR B;  2WMM A;  4IOI H;  1QRJ A;  1L2P A;  1TU3 F;  3CXC O;  1XTC C;  1DEB A;  3L74 G;  1SQQ D;  2PEN A;  2XU6 A;  4IL6 H;  1GZL A;  2FKW B;  1RF0 C;  2EFJ A;  4DJG A;  3BCC G;  4U0C A;  3L36 A;  5APY A;  1SQP K;  2AXC A;  3D6Z A;  3BVH A;  4BPH A;  1OVU A;  3S4R A;  5K5G B;  1IZN B;  4O9B A;  3V2R A;  4PH0 A;  1SS1 A;  1VKU A;  1BXI A;  1GU5 A;  2JJL A;  4C46 A;  2L5G B;  2V7Q J;  4DZO A;  4D6T D;  3V4W A;  4JBZ A;  3G29 A;  2K37 A;  3MP7 B;  3CWB D;  3E1R A;  1BDC A;  1Z6M A;  1FOS E;  1VHN A;  2FYU D;  5CZD B;  2B87 B;  2IYO A;  1NTM J;  4U0F A;  3VP8 A;  5HVC A;  2GYK A;  2K0X A;  5AVT B;  1SQV D;  2ZYA A;  3AE3 C;  2QJY C;  2KIK A;  3LMO A;  1S9K E;  1NH4 A;  2IFN A;  1W5C E;  3GKL C;  1LWU B;  1NQ4 A;  2CQ8 A;  4UHP B;  1F80 D;  2KNC B;  2LOL A;  3KDP B;  2IZ1 A;  2IBZ I;  1S5L X;  1GL2 B;  3HUS A;  4U0B A;  5BS2 A;  2FVF A;  1YTZ T;  2R44 A;  1KN7 A;  3AE9 C;  1PV3 A;  1GK4 A;  4KHX A;  2KI7 B;  3H1J E;  1DD4 A;  2E74 B;  2B89 A;  1NGM B;  5KLI B;  1K9M Q;  3AE8 C;  4ZKU A;  2PEI A;  4COC A;  1L0L E;  2ZVO B;  4BXL A;  1ZXG A;  1L0N D;  1SFC C; 
#chains in the Genus database with same CATH homology
 2XXM A;  1EIA A;  2PEO A;  1RO0 A;  5HGN A;  2BQ1 E;  1YIT P;  1VQL P;  4XRO A;  1E6J P;  3CMA P;  1K73 Q;  4PH0 A;  1A8O A;  2Z46 A;  1VQO P;  3CME P;  3I55 P;  3G4S P;  1QVF O;  1VQ9 P;  3DS0 A;  1YJ9 P;  3G21 A;  2PEQ A;  3CPW O;  3CCR P;  2E1M A;  5DCK A;  2ONT A;  3RG6 C;  1KC8 Q;  2JYG A;  3G0V A;  4GR6 A;  3G29 A;  1KQS O;  3MGE A;  2M8P A;  3G1G A;  2JO0 A;  1VQ8 P;  1YIJ P;  3CCU P;  4XFX A;  1M6N A;  3CCV P;  3CCS P;  2OTL P;  1PEM A;  3H0D A;  3CD6 P;  1W2B O;  1PEU A;  3CCJ P;  3DS4 A;  2QEX P;  1N8R Q;  1YHQ P;  3CCM P;  1AUM A;  1D1D A;  4U0F A;  3DTJ A;  3G71 P;  2P9X A;  1IUQ A;  1Q82 Q;  3P05 A;  3DS1 A;  2Z45 A;  3WBH A;  5F2K A;  2KOD A;  2XT1 A;  3HYB A;  1ZMB A;  3DS5 A;  1VQ4 P;  4COP A;  3DPH A;  2M8L A;  3CCQ P;  2OAR A;  3VRL C;  1RO2 A;  1KD1 Q;  3LRY A;  3E2D A;  1A43 A;  4PH1 A;  5HGL A;  2M8N A;  1EOQ A;  1YJW P;  2PY8 A;  2CWO A;  3CC2 P;  3G28 A;  2PEJ A;  3HZQ A;  5I4T G;  2L6E A;  3H47 A;  2LF4 A;  1YI2 P;  2PEK A;  3G26 A;  4XFY A;  5HGO A;  4U0D A;  1Q7Y Q;  4U0B A;  3DS3 A;  1VQP P;  1Q81 Q;  3CCL P;  1VQ6 P;  5BS2 A;  1K30 A;  3CCE P;  3G1I A;  3DS2 A;  5F2N A;  1M74 A;  1PEO A;  2BUO A;  2Z44 A;  1BAJ A;  1VQM P;  3CC7 P;  5F2O A;  4XRQ A;  3M1M A;  2OTJ P;  1VQK P;  4QNB A;  3NTE A;  1M90 Q;  2DGY A;  2BHV A;  1NJI Q;  1M1K Q;  3OW2 O;  3I56 P;  1QRJ A;  1QVG O;  2XV6 A;  3H4E A;  3CXC O;  1S72 P;  1YJN P;  1JJ2 O;  4M0I A;  4WYM A;  3G6E P;  4U0E A;  1VQ7 P;  1K9M Q;  2PEN A;  5HGM A;  2QA4 P;  1VQ5 P;  1K8A Q;  2EIA A;  4XFZ A;  2EG5 A;  2EFJ A;  2PEI A;  5BS1 A;  2PEM A;  4COC A;  1M6E X;  1Q86 Q;  4IPY A;  3CC4 P;  3B5I A;  4U0C A;  1RNI A;  4U0A A;  1PEQ A;  5JPA A;  3Q20 A;  1VQN P;  2JYL A;  4GR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...