1S72P

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1s72P02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1s72P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1s72P03
3OW2O 1VQOP 1QVGO 1K9MQ 3CMAP 2QA4P 1YITP 3G71P 1YHQP 1VQ5P 1Q86Q 3CXCO 1KC8Q 3CCLP 1VQ8P 3I56P 1VQ9P 1KQSO 1N8RQ 1JJ2O 3CC4P 1W2BO 3CCSP 1QVFO 1VQ6P 3CCQP 3G6EP 1S72P 3CCJP 1YIJP 1YI2P 1KD1Q 1VQ4P 1YJWP 1Q7YQ 1Q81Q 1YJNP 1K8AQ 1Q82Q 1YJ9P 3I55P 1K73Q 2QEXP 1VQMP 3CCEP 2OTLP 1VQPP 3CC2P 1M90Q 3CMEP 3G4SP 3CCUP 1VQKP 1VQNP 1VQLP 3CD6P 3CCRP 1NJIQ 3CC7P 2OTJP 3CCMP 1VQ7P 1M1KQ 3CCVP 3CPWO
chains in the Genus database with same CATH superfamily
2HR3A 4U7JA 4BPHA 1YTZI 3RL0D 3CCLP 1OW7A 2Z46A 1T3JA 4O9BA 1VF5D 2L0QA 2XZ0D 3B5NB 2LXBA 1K8AQ 1LTJC 1Y9BA 3LIDA 1CI6B 4N78D 1FU1A 2OTJP 2VLOA 3BATA 3GF3A 4ASVA 4OGQD 4XRQA 1AF8A 2K3RA 1K9MQ 1L0NG 4JBZA 1ZN5A 3H32B 1SQQJ 1AVOA 2JO1A 5AVZB 2QJKC 1KD1Q 5AVYB 1KMIZ 2FFDC 3ZDMA 5KAFE 2O01J 3Q1MA 1LWUC 2R3SA 2W6AA 2BQ1E 1S9KD 2I1KA 3MGEA 4U3FD 2WPVB 5APVA 1ZMEC 1LT9A 2HPCB 4W7YA 2K9JA 3AEGC 2ITAA 3I56P 3RGUA 2WVRA 1KORA 1E6JP 3A5TA 1EC5A 4H2XC 3MD0A 5APQA 3V4WA 2HLOA 2FACA 1KQGB 1YYCA 3CC2P 1M90Q 2JDIH 1IJDB 1NO4A 1P84H 4RKUJ 3CXCO 1AFOA 3IR9A 3HUSA 3H47A 5CMZA 3IN6A 2AFDA 3L73D 2A45H 1W5CE 1HWTC 1VQKP 1R8EA 3G0VA 2JWAA 1PIXA 1SQQG 4JYCA 1AVYA 1KC8Q 3KZIE 1ZMBA 4NPEA 3CCQP 3G1IA 2WSCH 3TNUB 4N78E 1KB9I 2KOQA 4IZ6A 1N86A 5APTA 3TK1A 1LJ2A 1ZLLA 1X9VA 3IFMA 4GOFA 5KP6B 4PXHB 1RY3A 3CCVP 2QJKB 1UIXA 3CXHH 1BAJA 4XROA 2B9BA 3L35A 3OAKA 1OWAA 3D70A 1M6NA 3BCCD 2KODA 1LT1A 1BCCJ 4U3FE 2IX7C 1W2EA 4YXWH 3VTPC 5KKZC 2XZ1C 5F2NA 2IFMA 5KLIB 1BCCE 3AE1C 1Q86Q 5EFWB 3N7NA 5M1BA 3H1JD 1K73Q 2FXMA 4BPFA 4I7ZB 3CD6P 3M06A 3SFDC 1A43A 2CG5B 3RG2A 4U0DA 5CCHC 1E5WA 2M8RA 3L73E 1NKZB 2ROQA 2CPBA 2LIUA 2AVAA 5H2FH 1UJZA 1T3UA 2ZT9D 2VLNA 4IL6E 4D6TJ 1PP9D 1RE3A 1EIAA 5GTIE 1NU1D 2XXMA 2OGUA 1GL2A 1YBKA 3T97A 4U3FG 3CI9A 4D6TE 4IFDK 4UHPB 2RKLA 2KORA 2OARA 1BCCG 3DS3A 1LTGC 3C9IA 2C9LY 2WPRA 2K93A 3CE7A 5CJ0A 5KLVD 3FX0A 4Z1MH 1FDMA 1VQ8P 1X0TA 2KGCA 5KAIH 3L73G 2N98A 3JSVC 2LKIA 2FYUD 5CHXA 3H1KD 1G1JA 1PGQA 2J58A 4KJMA 2Q3IA 4ZMDA 3G71P 2GDWA 2KOGA 2I8DA 3H1JE 4D6TG 1URQA 1SQQK 4EYYQ 2KI7B 4N3YB 3CXHI 1JUNA 4DCKA 1N73C 3M0AA 2N1TA 1SQXD 1BGYD 3CC7P 5B66E 4WB4A 3B4QA 4UB8H 3V2QA 4H2WC 2QG4A 1TU3F 2Z44A 1KZUB 2VLPA 1M56D 5KJ7C 2FQ0A 3V2PA 2ZFCA 1YJNP 4BRYA 3HD7A 1DX7A 1JY3P 2NPSC 3TDKA 5HGMA 4GR6A 1HGZA 2EG5A 2MF4A 2GUSA 4A7PA 2M0BA 2BUOA 2E43A 1HTLC 1JTHA 1JEKA 1HH0A 1FDIA 4AUWA 4JYBA 3H1HJ 2KUBA 3TSIA 5AW3B 3D6YA 2M5RA 5KLVE 2ZYGA 4TT3H 5GTHH 2E75B 2IZ0A 1L4AB 1KB9D 4XFXA 5EJDA 1SFCC 2GZFA 2KYVA 1L0IA 1J1DC 2OYOA 1PFIA 1VF5C 2CPSA 1M8OB 5HGOA 2XNDH 3CX5H 1YQ3C 3GLMA 1T8KA 4IFFA 1LNQA 1QVFO 1W2BO 2B89A 4OGQC 2RN0A 1BGYE 2WZ7A 3B71A 2G3AA 2KP8A 4GKGA 1IFPA 3AE6C 3LW5H 3MIWA 1M1JC 2WITA 3A7OA 1EZVI 1RF1B 4RJTA 2WT7B 1QLED 2H43A 2XNXA 2R3CA 3PLNA 2OTKE 2L6EA 3TGUE 1EQ7A 2Q3EA 2MJZA 3H1HG 4HH2A 3O6QB 1SQBJ 3HTKA 2J5UA 5B5EH 5C39A 1X22A 3D6ZA 2NO8A 2JYLA 3EJBA 2R5DA 2ZVNB 3DTJA 1NTMJ 2Y9ZA 3E2DA 1URQB 1H0TA 1JOCA 5TJHA 1GW3A 2P2UA 3L72J 2W8ZA 1L0LD 2N1TB 2M8LA 4GODA 1ZW0A 2QJYC 4BXLA 3L74J 3KQGA 1NTME 4ZKUA 3KYQA 1L4AD 4R4MA 2IBZI 1BXIA 3NXSA 1NH4A 3F89A 2QNWA 2Q6QA 3PH0A 1BSNA 4PV1C 2LF4A 2HFED 1VDFA 3AECC 3TGUG 1GXHA 3HD7B 3DS2A 4DJGA 2LMLA 3B5NC 2CK3H 2YKPA 4C7NA 1SQPJ 1S3JA 3BVHA 3KPEA 1PV3A 2WSSH 3FXEA 4OWFA 1Q81Q 1JTHB 3P32A 5AW4B 1KV4A 1SQBG 1S5LH 5BVZA 1NGMB 2L22A 1M6EX 1VQ7P 3TF5A 1IK9A 3HE5B 5KJ7D 1KYOH 1SP4A 3G1GA 4YXDC 1L0NJ 5HGLA 2NRGA 2KG8A 3CXHD 2JU2A 1NTMG 2FKWB 2BHVA 3CX5I 3HRNA 2ERHA 1R5LA 4L74A 3L72G 3L74G 2KNCA 3SWKA 4H13B 1KB9H 1KQLA 1NTZD 2AEJA 1WT6A 1S72P 3RBZA 1X3OA 1L0LE 1PZQA 1U57A 5CCGA 1LP1B 1IUQA 3L71D 3CCRP 1NTKD 1OW6A 1JY2O 2FFDA 3CPWO 2B87A 2JU1A 1P84E 1SFCD 3GZMA 1SQPG 4PD4H 1FOSF 4WYMA 4PV1B 4LGDE 1WMKA 2CNRA 1NHLA 3L75D 1FC2C 1JB0J 1RE4C 5E79H 3AE2C 1MFZA 2SPZA 2P10A 1RQVA 1K05A 3HZQA 3HTKB 4L73A 3Q3DA 2GZIA 1Q90D 4HB1A 3H1ID 1PL5A 2KR5A 2QJPC 3DS1A 2N50A 1EXIA 2PRRA 4N6JA 3EQ2A 2BCCJ 2Q5UA 1H0TB 5KP7B 1L0LG 2IYPA 2PEMA 1DEBA 4K35A 2KLUA 2YO3A 2C0XA 3MZWB 3QWOC 4RO0A 3CXHE 3GZLA 1BE3J 1GW4A 2BCCE 2JWDA 3GHGA 2WPSA 5BU5A 3FGAD 1MZ9A 3BRTB 5APWA 5KLIC 1OX3A 1FZAA 1BE3E 3CCUP 1NTZE 3NY7B 1EZVD 1OR5A 4H13D 1FZBA 2A45G 4I7ZC 3D71A 2JGPA 3L70D 2Z45A 4COPA 3F5HA 3AE5C 3A0HH 3L71E 3KHUA 1NTKE 5EW5E 1RH5B 2GZGA 3P05A 1KYOI 2IYOA 1NOHA 5AW8B 1NQ4A 1SVFA 5HV8A 1M1KQ 2Z5IA 1SQBK 3QH9A 2GA1A 2L5GB 2QSIA 1VQ9P 4PV1D 3GW6A 3L75E 3NTNA 3Q5SA 5H2FE 1ZOYC 1SQVD 2P7JA 2BCCG 3B5ND 3ITKA 1Q82Q 4Y99B 1LT9C 3H1LD 1NTMK 2MY5A 1VHNA 3S4RA 3RL0g 2PEIA 2PP6A 3G9RA 1VKUA 5I4TG 5APYA 1KILB 1JM0A 3JCUH 1BE3G 2IPPA 4NPFX 3H1IE 2QJPB 3EFFK 4U3FJ 2IBZD 5AW2B 1LTBC 5CCHA 2FY8A 1QGKB 1YJWP 3MTUE 1N7LA 3DS4A 1T6AA 3Q5PA 1S9KE 4PD4I 1GU4A 1S5LX 3HUSC 3C8VA 4EI2A 4F37A 4MRTC 2O01H 2AXCA 1K04A 3G21A 2OYHA 1HUCA 3CC4P 3RG6C 1GZLA 1SQPK 1EDIA 1EZVE 4XA4A 5AW6B 5KAIE 2RH0A 3L75G 3L73J 3Q20A 2YXQB 3GMAA 3L70E 2ZYAA 1QX8A 2KS1A 3CX5D 5CJ4A 1L0NK 2KLVA 2LR2A 4WY4A 1JY2N 1USEA 2AEMA 1U7JA 3I5CA 4IFMA 2WPQA 2YIUB 5TISH 4PH1A 3KZIH 1E0HA 4UB8E 2KOOA 1SQVE 1LT9B 1KQSO 2E1MA 2K9JB 5AVVB 3W68A 5DJTB 3GHGB 3USSA 5HVCA 2MKVA 2GYKA 2IBZE 1KILD 3VMXA 4YTPC 1OXZA 1HF9A 1PEQA 3LRYA 2LOLA 4HKZH 3BCCE 3L70G 1WRGA 4IPYA 2E75C 3HUSB 1S2EA 1HY8A 2CQ8A 1L4AC 2EHSA 1PPJD 3H1JJ 1LGHB 4WWIA 1VPCA 5GTHE 2NPSA 3RK3B 4LLHA 1ZR4A 2KSJA 3SWYA 5CBNA 2YNYA 3CLQA 2L4BA 4EDFA 1GL2C 2R32A 2GDXA 2KGDA 5AW7B 1IFJA 1VQNP 3EJEA 3CL3D 1AQ5A 1GK6A 1DD4A 2A06D 1RQUA 3AE3C 4TLFA 2AF8A 1GPJA 3A3YB 2M5AA 2PEOA 2K88A 2E5YA 1PP9E 1N7SA 1NU1E 1RF1C 2PEJA 3E7KA 2FHSC 3BCCG 5AVQB 1CSBA 2QEXP 1HJ0A 3CCEP 1OIPA 3M1MA 1USDA 2X2BA 1SFCA 2V7QJ 2MR7A 1Q2NA 1BDDA 2EIAA 2PEQA 3AEBC 3CCSP 1GD2E 2YKOA 2JP3A 2P67A 5KLVJ 1KYOD 2KB7P 2KK7A 2OYHB 2KZJA 3U59A 4OVNF 2W83C 2NZ2A 3H1JG 1IMQA 4C7RA 2FYUJ 1VQLP 4W7ZA 1URQC 5B5EE 1RO0A 3DS5A 2N1TC 1JJ2O 1PGJA 1T2KC 3CCJP 2FYUE 1YI2P 2N9YB 4DOJA 3H1KE 1Z6MA 4U0CA 3I55P 3CWBD 2K2QA 1PP9G 2W6BA 4XFJA 1KFMA 1EOQA 1NU1G 3LMOA 3H4EA 1BGYJ 1MZ8A 1FDOA 3E1RA 1GL2B 3H0DA 2FXPA 3T97B 3HD7C 4C46A 2K0DX 1RF0A 1FZCA 1SQXE 2KG6A 1CEIA 4PD4D 2POHA 2E74C 2XU6A 1NWQA 3V5BA 3NTEA 2I1JA 3TGUJ 1X8YA 2QA4P 2WSFJ 1IFNA 1QEXA 4H0LC 5AVXB 3WUTA 2YXRB 1IMPA 2QRXA 2M8PA 2G8YA 3U1AA 5KLVG 2Y0DA 2K1AA 2UWJE 2PGDA 1Q7YQ 2FQ2A 3CMEP 1MUUA 1RHZB 2FYUG 1NJIQ 4XFYA 1S5LE 3AE4C 3H1KG 1H89A 3CCMP 3WU2H 4I6MC 2E76B 2OYIA 3GKLC 1PEOA 1KYOE 1D7MA 3PP5A 2GUVA 3VOPA 3FXDA 5F2KA 1QRJA 2PENA 4H13C 3RK2B 1CI6A 4HJGH 2H7HA 2PEKA 3DS0A 2K5XA 4QMAA 2YKQA 1SQXG 1ZXGA 1BGYG 2Y9YA 1PGPA 3H32A 1LTSC 1KB9E 2WQYC 2E75D 2H88C 1OW8A 1F80D 1VQ6P 3GF7A 2JB0A 1FOSE 3CWBE 2FXOA 3B5IA 1R5SA 3VMYA 2HG5D 5AVRB 2WSEH 3V6IA 1J1EB 1DEEG 2JR8A 3Q2YA 1GU5A 4BRYB 1MV8A 3G28A 3IF4A 1BSHA 1VQOP 3M9HA 2QM8A 1GDTA 1GL2D 1DV5A 2VLQA 3AE7C 3RL0B 1D1DA 4PD4E 4GR2A 2E74B 4DT0A 3G4SP 1FBMA 4H0LB 5E79E 4UB6H 4DG9A 4PH0A 2FBWC 1EDJA 1AA0A 4R0MA 1XTCC 1NYHA 2KZIA 3FWNA 2KG9A 1GXGA 2E42A 1N2DC 3M9QA 2KXPB 2FVFA 2FAEA 4PJ0H 4HKGA 5L8RJ 4B86A 2QE7H 1HBWA 1SQQD 1MKMA 1LTJA 1A8OA 1L0LJ 5BS1A 1NU1K 4L75A 3AEDC 2O3JA 3TNUA 3EWKA 3RK2D 1NAYA 4NEOA 2WTYA 2ZJSE 1URQD 2JQ4A 2QM7A 2PAJA 2V4HA 2N1TD 5AW5B 1GK4A 1IFDA 1T2KD 1M74A 2C0WA 1LWUA 3M0DC 4U0BA 3MHVA 2FQ1A 4JQ0D 1AJYA 3BASA 2R5BA 3A0HE 1LTAC 5KLVK 1IO4A 3PTZA 3HD7D 3II6A 3MUDC 2WSCJ 2OQQA 2XT1A 2MR8A 4Y99C 1OVVA 2FYUK 3G29A 5AVTB 2OYIB 5AVSB 4EOTA 2E74D 4M0IA 1KILC 5CZDB 1NVOA 1YTZT 2GZEA 4H0LD 1ZP0C 3GJNA 1IZNB 5AW0B 3JCUE 1SQXK 1LTIC 5CCGC 3N4XA 1NTZJ 5AW9B 2XKMA 1FZEA 1A02J 2H89C 2HODA 1EXJA 1YJ9P 2AXTH 1FJKA 2WMMA 1SQQE 2N9BA 4RESB 3L71J 1NTKJ 1XTGB 3A0BH 2AEFA 3JC22 1BCCD 1PGOA 2JYGA 4C7NB 3V2NA 3V4QA 2AFEA 4XFZA 1QL2A 2VSQA 3L75J 4U0FA 2PFXA 4AQRD 2FADA 1JY3O 2KOPA 2K37A 3MP7B 2HYNA 2ZYDA 2KOSA 3FWLA 4QKOA 2ZT9B 2YIUC 1IC2A 2K92A 4CA3A 3H1IJ 4U0EA 1VQMP 5HGNA 2JBGA 4R4LA 3GHGC 5TISE 2KNCB 1VQ5P 5DCKA 2Y0CA 3M9BA 3AE8C 1AV1A 1NTZG 1LTJB 4D6TD 2GDYA 1HJBA 3WMM0 4COCA 1ACPA 5KAFH 4PWVB 2PY8A 1FE6A 3C1LA 3AEFC 3L71G 1NTKG 2XV6A 1Y47A 1IFIA 3SWFA 2FFDB 2K94A 2B87B 3B8EB 3VMZA 1LWUB 2M3BA 1U7MA 3HE4A 1Z56A 3L70J 3SFEC 3H25A 5AVUB 3KDPB 3RBXA 3RK3C 3WUUA 1EDLA 4M3LA 1EDKA 1HGVA 2B88A 3OA7A 1KTMA 4EIJA 5APSA 1L2PA 2P1JA 1T8ZA 4H44C 3VN0A 1OZHA 2W6JH 5KTBA 3H1IG 1S1CX 3VP9A 2XDJA 1S4XA 1FZFA 5K5GB 1A02F 2JO0A 1SQVJ 1Y8AA 1SLQA 2Z5HA 4WVZA 3H1LJ 1L4AA 1G2CA 1K30A 3V2RA 3OJAB 2R44A 2LIWA 2C9NY 3U1CA 1L0LK 1AQTA 2CWOA 1AUMA 3S9OA 4XE5B 1JMMA 3H1LE 1L0HA 2JJLA 4Y28J 1H88A 3P8CD 3ABVC 2HODB 1JY2P 5BU8B 3BCCJ 4GT1A 2OYHC 1M57D 2N6YA 1EZVG 1N73A 2YMKA 1DH3A 1X79B 1G1IA 3TYYA 2L9FA 2FYZA 1N8RQ 4JPZB 1P84I 2N6ZA 4L76A 2FVEA 1GTWA 1JO5A 1RF1A 5KJ7A 5CCGD 2WT7A 3A2AA 1VL2A 1PEMA 1QVGO 1JMBA 4WY4C 2A45I 5F2OA 1RE3C 2K0YA 1UIIA 5KKZB 3H1HD 2H8PD 3O6QA 3PHLA 3NMDA 2W90A 1SQVG 4H44B 3S1KA 2RMZA 1PP9J 3H1LG 2BASA 2Y0EA 1E79H 2W27A 3B4SA 1NU1J 3OW2O 1FS0E 3CX5E 4BPGA 2P9XA 1KFNA 2FVAA 1DIPA 1ZRTD 2LTEA 3G26A 2D2CC 3HYBA 1RNIA 2IBZG 4IL6H 1YIJP 3LW5J 1NTZK 2L91A 5GTIH 2K0XA 5JPAA 1JY3N 4YPCA 1J2JB 4W80A 4AYCA 2JKVA 5APXA 2MVUA 3R2PA 1NTKK 3P8CE 3PJSK 2E76C 4CPGA 3HE4B 3U43A 3TGUD 1DNYA 1KILE 5BS2A 3RK2C 2EFJA 2GM4A 3H1KJ 3WU2E 3KXDA 2BEQD 1FR2A 1M1JA 4ZKPA 1CZQA 2JEEA 2KS1B 1PPJE 2N5HA 3W67A 1SQBD 1NKNA 3L36A 3PRJA 4NPDA 2EHTA 1FZGA 1ZNVA 1M7LA 4WY4B 3HE5A 2KGAA 1SQXJ 1J1EC 2BEZF 2O1KA 1N7SC 2WSEJ 1CW5A 4I2LC 2YO2A 3H1HE 3RK3D 1G2CB 3Q5RA 4JF7A 1NTMD 4WBAA 1FJPA 3AEAC 2WPTA 2O01N 3L72D 3RL0C 4GIFA 4ASWA 3L74D 2A06E 4H44D 2MVVA 2ZXXA 3VP8A 5B66H 2D2CB 5AVWB 3UIAA 1ZRTE 3H6PA 2QIWA 1N73B 3M91A 2KW2A 1LP1A 5CCHD 2KWLA 1OVRA 2Q7CA 1HQBA 2K9YA 2ZAEB 1PPJG 1JCDA 4UB6E 3DPHA 2LPKA 4GOEA 2Q9IA 1SQPD 3VRLC 1YHQP 2FYNC 5CBOA 3EFGA 2QVAA 3B5NA 2NPSB 3SSUA 2V7QH 1ZV8A 2CGQA 2ZVOB 1UNKA 2J59M 2Z4EA 3GG2A 1OVUA 4PJ0E 2LKMA 3CWBJ 1PEUA 1HVVA 1RF0C 1FZCC 2DNWA 1L0ND 1NAFA 1SQVK 4KHXA 2IZ1A 2YMYA 2ONTA 4U0AA 2A06G 3VYIA 3EJDA 1SQBE 1ZR2A 2GZJA 2M5AB 2O1JA 5DJUB 2M8NA 1AYIA 1BDCA 1N7SB 4WY4D 3RK3E 2HPCA 1JCCA 1SFCB 3NFQA 3O8ZA 3G3ZA 2JAZA 1OFCX 2E5TA 1J1DB 1P84D 3L72E 2IDBA 2DGYA 1VF5B 3LIEA 3AEEC 1H8AA 2LXCB 3L74E 4DZOA 2OYIC 2M3EA 3R4YA 2MD9A 3K5BA 3MGNA 3AE9C 2D2CD 2VRSA 2KSEA 4OGQB 2WWWA 1QL1A 4LC1A 5AW1B 3CMAP 2P58A 1YITP 4KT0J 1IFMA 3L4FA 2KGEA 1M1JB 1DD3A 3M0DA 2WSFH 4IL6X 4ZNCA 3WBHA 1JNMA 3IAOA 1VQPP 2FYNB 3CWBG 1GMJA 1SQPE 1KN7A 1LTTC 2OTLP 2XZRA 2DW3A 3P7KA 2E76D 4IOIH 1RE4A 1SS1A 2ZXEB 1KQFB 4GDOA 4H2YC 2PNGA 3MUDA 2NPSD 3G6EP 2BCCD 7CEIA 1OMIA 1YQ4C 5APUA 4QNBA 2XV5A 1FZCB 2N5IA 2IFNA 1L0NE 2AXTE 4BWNA 1KILA 1RO2A 5KP8B 1KLPA 4OH8B 1BE3D 1IK7A 4I1LA 3P8MC 4K3AA 1MFTA 3BRVB 3E1IA 3A0BE 3VMAA 1FAVA 4HYTB 2LL8A 2Q1KA 1VQ4P 2QJYB 2KIKA 1N7SD 4MN4C 3L37A 2ZT9C 3WUVA 1EMVA
chains in the Genus database with same CATH topology
2XV6A 3G0VA 4GR6A 1PEMA 1QVGO 2QA4P 2EG5A 5F2OA 2BUOA 1KC8Q 2PEOA 2Z46A 2Z45A 3CCLP 2JYLA 4COPA 2M8PA 1ZMBA 2DGYA 3CCQP 1S72P 3G1IA 2OARA 3DTJA 2PEJA 1Q7YQ 3P05A 1K8AQ 3DS3A 1YJ9P 3E2DA 2QEXP 3CCEP 3CMEP 1IUQA 3M1MA 3CCRP 4XFYA 1NJIQ 2OTJP 2M8LA 3CCMP 1M1KQ 3CCVP 3CPWO 3OW2O 4XRQA 4PH1A 1K9MQ 3CMAP 1PEOA 1A8OA 2EIAA 1YITP 5BS1A 1BAJA 4XROA 2P9XA 4WYMA 1VQ8P 2PEQA 1VQ9P 1KQSO 3G26A 4XFXA 2E1MA 3HYBA 5F2KA 1RNIA 3CCSP 1QRJA 2PENA 1YIJP 1M6NA 1KD1Q 2JYGA 2KODA 2PEKA 3WBHA 1Q82Q 5JPAA 4XFZA 3DS0A 2LF4A 1VQPP 2JO0A 4U0FA 2BQ1E 2PEIA 3DS2A 5HGOA 3MGEA 5I4TG 1VQLP 3DPHA 2OTLP 1M74A 5F2NA 1PEQA 1K30A 3LRYA 3VRLC 3G71P 1YHQP 3HZQA 1Q86Q 1RO0A 4U0BA 3I56P 3DS5A 1QVFO 1JJ2O 1VQ6P 1W2BO 3G6EP 2CWOA 3CCJP 1AUMA 3B5IA 1YI2P 4IPYA 1E6JP 4U0CA 3DS1A 1YJWP 4QNBA 1Q81Q 3DS4A 3I55P 1K73Q 4U0EA 1VQMP 3CC2P 1M90Q 3CD6P 5BS2A 1RO2A 1EOQA 5HGNA 1A43A 3G28A 3CC7P 2EFJA 1M6EX 1VQ7P 1PEUA 3H4EA 2PEMA 1VQOP 2XT1A 4U0DA 2ONTA 4U0AA 1VQ5P 3G1GA 3G29A 5DCKA 3H0DA 3CXCO 3G21A 1D1DA 5HGLA 2Z44A 3H47A 1N8RQ 3CC4P 4GR2A 3RG6C 4M0IA 2L6EA 1VQ4P 2BHVA 4COCA 2M8NA 1YJNP 1EIAA 2PY8A 1VQNP 3Q20A 3G4SP 3CCUP 1VQKP 2XXMA 4PH0A 5HGMA 3NTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 O;  1VQO P;  1QVG O;  1K9M Q;  3CMA P;  2QA4 P;  1YIT P;  3G71 P;  1YHQ P;  1VQ5 P;  1Q86 Q;  3CXC O;  1KC8 Q;  3CCL P;  1VQ8 P;  3I56 P;  1VQ9 P;  1KQS O;  1N8R Q;  1JJ2 O;  3CC4 P;  1W2B O;  3CCS P;  1QVF O;  1VQ6 P;  3CCQ P;  3G6E P;  1S72 P;  3CCJ P;  1YIJ P;  1YI2 P;  1KD1 Q;  1VQ4 P;  1YJW P;  1Q7Y Q;  1Q81 Q;  1YJN P;  1K8A Q;  1Q82 Q;  1YJ9 P;  3I55 P;  1K73 Q;  2QEX P;  1VQM P;  3CCE P;  2OTL P;  1VQP P;  3CC2 P;  1M90 Q;  3CME P;  3G4S P;  3CCU P;  1VQK P;  1VQN P;  1VQL P;  3CD6 P;  3CCR P;  1NJI Q;  3CC7 P;  2OTJ P;  3CCM P;  1VQ7 P;  1M1K Q;  3CCV P;  3CPW O; 
#chains in the Genus database with same CATH topology
 2HR3 A;  4U7J A;  4BPH A;  1YTZ I;  3RL0 D;  3CCL P;  1OW7 A;  2Z46 A;  1T3J A;  4O9B A;  1VF5 D;  2L0Q A;  2XZ0 D;  3B5N B;  2LXB A;  1K8A Q;  1LTJ C;  1Y9B A;  3LID A;  1CI6 B;  4N78 D;  1FU1 A;  2OTJ P;  2VLO A;  3BAT A;  3GF3 A;  4ASV A;  4OGQ D;  4XRQ A;  1AF8 A;  2K3R A;  1K9M Q;  1L0N G;  4JBZ A;  1ZN5 A;  3H32 B;  1SQQ J;  1AVO A;  2JO1 A;  5AVZ B;  2QJK C;  1KD1 Q;  5AVY B;  1KMI Z;  2FFD C;  3ZDM A;  5KAF E;  2O01 J;  3Q1M A;  1LWU C;  2R3S A;  2W6A A;  2BQ1 E;  1S9K D;  2I1K A;  3MGE A;  4U3F D;  2WPV B;  5APV A;  1ZME C;  1LT9 A;  2HPC B;  4W7Y A;  2K9J A;  3AEG C;  2ITA A;  3I56 P;  3RGU A;  2WVR A;  1KOR A;  1E6J P;  3A5T A;  1EC5 A;  4H2X C;  3MD0 A;  5APQ A;  3V4W A;  2HLO A;  2FAC A;  1KQG B;  1YYC A;  3CC2 P;  1M90 Q;  2JDI H;  1IJD B;  1NO4 A;  1P84 H;  4RKU J;  3CXC O;  1AFO A;  3IR9 A;  3HUS A;  3H47 A;  5CMZ A;  3IN6 A;  2AFD A;  3L73 D;  2A45 H;  1W5C E;  1HWT C;  1VQK P;  1R8E A;  3G0V A;  2JWA A;  1PIX A;  1SQQ G;  4JYC A;  1AVY A;  1KC8 Q;  3KZI E;  1ZMB A;  4NPE A;  3CCQ P;  3G1I A;  2WSC H;  3TNU B;  4N78 E;  1KB9 I;  2KOQ A;  4IZ6 A;  1N86 A;  5APT A;  3TK1 A;  1LJ2 A;  1ZLL A;  1X9V A;  3IFM A;  4GOF A;  5KP6 B;  4PXH B;  1RY3 A;  3CCV P;  2QJK B;  1UIX A;  3CXH H;  1BAJ A;  4XRO A;  2B9B A;  3L35 A;  3OAK A;  1OWA A;  3D70 A;  1M6N A;  3BCC D;  2KOD A;  1LT1 A;  1BCC J;  4U3F E;  2IX7 C;  1W2E A;  4YXW H;  3VTP C;  5KKZ C;  2XZ1 C;  5F2N A;  2IFM A;  5KLI B;  1BCC E;  3AE1 C;  1Q86 Q;  5EFW B;  3N7N A;  5M1B A;  3H1J D;  1K73 Q;  2FXM A;  4BPF A;  4I7Z B;  3CD6 P;  3M06 A;  3SFD C;  1A43 A;  2CG5 B;  3RG2 A;  4U0D A;  5CCH C;  1E5W A;  2M8R A;  3L73 E;  1NKZ B;  2ROQ A;  2CPB A;  2LIU A;  2AVA A;  5H2F H;  1UJZ A;  1T3U A;  2ZT9 D;  2VLN A;  4IL6 E;  4D6T J;  1PP9 D;  1RE3 A;  1EIA A;  5GTI E;  1NU1 D;  2XXM A;  2OGU A;  1GL2 A;  1YBK A;  3T97 A;  4U3F G;  3CI9 A;  4D6T E;  4IFD K;  4UHP B;  2RKL A;  2KOR A;  2OAR A;  1BCC G;  3DS3 A;  1LTG C;  3C9I A;  2C9L Y;  2WPR A;  2K93 A;  3CE7 A;  5CJ0 A;  5KLV D;  3FX0 A;  4Z1M H;  1FDM A;  1VQ8 P;  1X0T A;  2KGC A;  5KAI H;  3L73 G;  2N98 A;  3JSV C;  2LKI A;  2FYU D;  5CHX A;  3H1K D;  1G1J A;  1PGQ A;  2J58 A;  4KJM A;  2Q3I A;  4ZMD A;  3G71 P;  2GDW A;  2KOG A;  2I8D A;  3H1J E;  4D6T G;  1URQ A;  1SQQ K;  4EYY Q;  2KI7 B;  4N3Y B;  3CXH I;  1JUN A;  4DCK A;  1N73 C;  3M0A A;  2N1T A;  1SQX D;  1BGY D;  3CC7 P;  5B66 E;  4WB4 A;  3B4Q A;  4UB8 H;  3V2Q A;  4H2W C;  2QG4 A;  1TU3 F;  2Z44 A;  1KZU B;  2VLP A;  1M56 D;  5KJ7 C;  2FQ0 A;  3V2P A;  2ZFC A;  1YJN P;  4BRY A;  3HD7 A;  1DX7 A;  1JY3 P;  2NPS C;  3TDK A;  5HGM A;  4GR6 A;  1HGZ A;  2EG5 A;  2MF4 A;  2GUS A;  4A7P A;  2M0B A;  2BUO A;  2E43 A;  1HTL C;  1JTH A;  1JEK A;  1HH0 A;  1FDI A;  4AUW A;  4JYB A;  3H1H J;  2KUB A;  3TSI A;  5AW3 B;  3D6Y A;  2M5R A;  5KLV E;  2ZYG A;  4TT3 H;  5GTH H;  2E75 B;  2IZ0 A;  1L4A B;  1KB9 D;  4XFX A;  5EJD A;  1SFC C;  2GZF A;  2KYV A;  1L0I A;  1J1D C;  2OYO A;  1PFI A;  1VF5 C;  2CPS A;  1M8O B;  5HGO A;  2XND H;  3CX5 H;  1YQ3 C;  3GLM A;  1T8K A;  4IFF A;  1LNQ A;  1QVF O;  1W2B O;  2B89 A;  4OGQ C;  2RN0 A;  1BGY E;  2WZ7 A;  3B71 A;  2G3A A;  2KP8 A;  4GKG A;  1IFP A;  3AE6 C;  3LW5 H;  3MIW A;  1M1J C;  2WIT A;  3A7O A;  1EZV I;  1RF1 B;  4RJT A;  2WT7 B;  1QLE D;  2H43 A;  2XNX A;  2R3C A;  3PLN A;  2OTK E;  2L6E A;  3TGU E;  1EQ7 A;  2Q3E A;  2MJZ A;  3H1H G;  4HH2 A;  3O6Q B;  1SQB J;  3HTK A;  2J5U A;  5B5E H;  5C39 A;  1X22 A;  3D6Z A;  2NO8 A;  2JYL A;  3EJB A;  2R5D A;  2ZVN B;  3DTJ A;  1NTM J;  2Y9Z A;  3E2D A;  1URQ B;  1H0T A;  1JOC A;  5TJH A;  1GW3 A;  2P2U A;  3L72 J;  2W8Z A;  1L0L D;  2N1T B;  2M8L A;  4GOD A;  1ZW0 A;  2QJY C;  4BXL A;  3L74 J;  3KQG A;  1NTM E;  4ZKU A;  3KYQ A;  1L4A D;  4R4M A;  2IBZ I;  1BXI A;  3NXS A;  1NH4 A;  3F89 A;  2QNW A;  2Q6Q A;  3PH0 A;  1BSN A;  4PV1 C;  2LF4 A;  2HFE D;  1VDF A;  3AEC C;  3TGU G;  1GXH A;  3HD7 B;  3DS2 A;  4DJG A;  2LML A;  3B5N C;  2CK3 H;  2YKP A;  4C7N A;  1SQP J;  1S3J A;  3BVH A;  3KPE A;  1PV3 A;  2WSS H;  3FXE A;  4OWF A;  1Q81 Q;  1JTH B;  3P32 A;  5AW4 B;  1KV4 A;  1SQB G;  1S5L H;  5BVZ A;  1NGM B;  2L22 A;  1M6E X;  1VQ7 P;  3TF5 A;  1IK9 A;  3HE5 B;  5KJ7 D;  1KYO H;  1SP4 A;  3G1G A;  4YXD C;  1L0N J;  5HGL A;  2NRG A;  2KG8 A;  3CXH D;  2JU2 A;  1NTM G;  2FKW B;  2BHV A;  3CX5 I;  3HRN A;  2ERH A;  1R5L A;  4L74 A;  3L72 G;  3L74 G;  2KNC A;  3SWK A;  4H13 B;  1KB9 H;  1KQL A;  1NTZ D;  2AEJ A;  1WT6 A;  1S72 P;  3RBZ A;  1X3O A;  1L0L E;  1PZQ A;  1U57 A;  5CCG A;  1LP1 B;  1IUQ A;  3L71 D;  3CCR P;  1NTK D;  1OW6 A;  1JY2 O;  2FFD A;  3CPW O;  2B87 A;  2JU1 A;  1P84 E;  1SFC D;  3GZM A;  1SQP G;  4PD4 H;  1FOS F;  4WYM A;  4PV1 B;  4LGD E;  1WMK A;  2CNR A;  1NHL A;  3L75 D;  1FC2 C;  1JB0 J;  1RE4 C;  5E79 H;  3AE2 C;  1MFZ A;  2SPZ A;  2P10 A;  1RQV A;  1K05 A;  3HZQ A;  3HTK B;  4L73 A;  3Q3D A;  2GZI A;  1Q90 D;  4HB1 A;  3H1I D;  1PL5 A;  2KR5 A;  2QJP C;  3DS1 A;  2N50 A;  1EXI A;  2PRR A;  4N6J A;  3EQ2 A;  2BCC J;  2Q5U A;  1H0T B;  5KP7 B;  1L0L G;  2IYP A;  2PEM A;  1DEB A;  4K35 A;  2KLU A;  2YO3 A;  2C0X A;  3MZW B;  3QWO C;  4RO0 A;  3CXH E;  3GZL A;  1BE3 J;  1GW4 A;  2BCC E;  2JWD A;  3GHG A;  2WPS A;  5BU5 A;  3FGA D;  1MZ9 A;  3BRT B;  5APW A;  5KLI C;  1OX3 A;  1FZA A;  1BE3 E;  3CCU P;  1NTZ E;  3NY7 B;  1EZV D;  1OR5 A;  4H13 D;  1FZB A;  2A45 G;  4I7Z C;  3D71 A;  2JGP A;  3L70 D;  2Z45 A;  4COP A;  3F5H A;  3AE5 C;  3A0H H;  3L71 E;  3KHU A;  1NTK E;  5EW5 E;  1RH5 B;  2GZG A;  3P05 A;  1KYO I;  2IYO A;  1NOH A;  5AW8 B;  1NQ4 A;  1SVF A;  5HV8 A;  1M1K Q;  2Z5I A;  1SQB K;  3QH9 A;  2GA1 A;  2L5G B;  2QSI A;  1VQ9 P;  4PV1 D;  3GW6 A;  3L75 E;  3NTN A;  3Q5S A;  5H2F E;  1ZOY C;  1SQV D;  2P7J A;  2BCC G;  3B5N D;  3ITK A;  1Q82 Q;  4Y99 B;  1LT9 C;  3H1L D;  1NTM K;  2MY5 A;  1VHN A;  3S4R A;  3RL0 g;  2PEI A;  2PP6 A;  3G9R A;  1VKU A;  5I4T G;  5APY A;  1KIL B;  1JM0 A;  3JCU H;  1BE3 G;  2IPP A;  4NPF X;  3H1I E;  2QJP B;  3EFF K;  4U3F J;  2IBZ D;  5AW2 B;  1LTB C;  5CCH A;  2FY8 A;  1QGK B;  1YJW P;  3MTU E;  1N7L A;  3DS4 A;  1T6A A;  3Q5P A;  1S9K E;  4PD4 I;  1GU4 A;  1S5L X;  3HUS C;  3C8V A;  4EI2 A;  4F37 A;  4MRT C;  2O01 H;  2AXC A;  1K04 A;  3G21 A;  2OYH A;  1HUC A;  3CC4 P;  3RG6 C;  1GZL A;  1SQP K;  1EDI A;  1EZV E;  4XA4 A;  5AW6 B;  5KAI E;  2RH0 A;  3L75 G;  3L73 J;  3Q20 A;  2YXQ B;  3GMA A;  3L70 E;  2ZYA A;  1QX8 A;  2KS1 A;  3CX5 D;  5CJ4 A;  1L0N K;  2KLV A;  2LR2 A;  4WY4 A;  1JY2 N;  1USE A;  2AEM A;  1U7J A;  3I5C A;  4IFM A;  2WPQ A;  2YIU B;  5TIS H;  4PH1 A;  3KZI H;  1E0H A;  4UB8 E;  2KOO A;  1SQV E;  1LT9 B;  1KQS O;  2E1M A;  2K9J B;  5AVV B;  3W68 A;  5DJT B;  3GHG B;  3USS A;  5HVC A;  2MKV A;  2GYK A;  2IBZ E;  1KIL D;  3VMX A;  4YTP C;  1OXZ A;  1HF9 A;  1PEQ A;  3LRY A;  2LOL A;  4HKZ H;  3BCC E;  3L70 G;  1WRG A;  4IPY A;  2E75 C;  3HUS B;  1S2E A;  1HY8 A;  2CQ8 A;  1L4A C;  2EHS A;  1PPJ D;  3H1J J;  1LGH B;  4WWI A;  1VPC A;  5GTH E;  2NPS A;  3RK3 B;  4LLH A;  1ZR4 A;  2KSJ A;  3SWY A;  5CBN A;  2YNY A;  3CLQ A;  2L4B A;  4EDF A;  1GL2 C;  2R32 A;  2GDX A;  2KGD A;  5AW7 B;  1IFJ A;  1VQN P;  3EJE A;  3CL3 D;  1AQ5 A;  1GK6 A;  1DD4 A;  2A06 D;  1RQU A;  3AE3 C;  4TLF A;  2AF8 A;  1GPJ A;  3A3Y B;  2M5A A;  2PEO A;  2K88 A;  2E5Y A;  1PP9 E;  1N7S A;  1NU1 E;  1RF1 C;  2PEJ A;  3E7K A;  2FHS C;  3BCC G;  5AVQ B;  1CSB A;  2QEX P;  1HJ0 A;  3CCE P;  1OIP A;  3M1M A;  1USD A;  2X2B A;  1SFC A;  2V7Q J;  2MR7 A;  1Q2N A;  1BDD A;  2EIA A;  2PEQ A;  3AEB C;  3CCS P;  1GD2 E;  2YKO A;  2JP3 A;  2P67 A;  5KLV J;  1KYO D;  2KB7 P;  2KK7 A;  2OYH B;  2KZJ A;  3U59 A;  4OVN F;  2W83 C;  2NZ2 A;  3H1J G;  1IMQ A;  4C7R A;  2FYU J;  1VQL P;  4W7Z A;  1URQ C;  5B5E E;  1RO0 A;  3DS5 A;  2N1T C;  1JJ2 O;  1PGJ A;  1T2K C;  3CCJ P;  2FYU E;  1YI2 P;  2N9Y B;  4DOJ A;  3H1K E;  1Z6M A;  4U0C A;  3I55 P;  3CWB D;  2K2Q A;  1PP9 G;  2W6B A;  4XFJ A;  1KFM A;  1EOQ A;  1NU1 G;  3LMO A;  3H4E A;  1BGY J;  1MZ8 A;  1FDO A;  3E1R A;  1GL2 B;  3H0D A;  2FXP A;  3T97 B;  3HD7 C;  4C46 A;  2K0D X;  1RF0 A;  1FZC A;  1SQX E;  2KG6 A;  1CEI A;  4PD4 D;  2POH A;  2E74 C;  2XU6 A;  1NWQ A;  3V5B A;  3NTE A;  2I1J A;  3TGU J;  1X8Y A;  2QA4 P;  2WSF J;  1IFN A;  1QEX A;  4H0L C;  5AVX B;  3WUT A;  2YXR B;  1IMP A;  2QRX A;  2M8P A;  2G8Y A;  3U1A A;  5KLV G;  2Y0D A;  2K1A A;  2UWJ E;  2PGD A;  1Q7Y Q;  2FQ2 A;  3CME P;  1MUU A;  1RHZ B;  2FYU G;  1NJI Q;  4XFY A;  1S5L E;  3AE4 C;  3H1K G;  1H89 A;  3CCM P;  3WU2 H;  4I6M C;  2E76 B;  2OYI A;  3GKL C;  1PEO A;  1KYO E;  1D7M A;  3PP5 A;  2GUV A;  3VOP A;  3FXD A;  5F2K A;  1QRJ A;  2PEN A;  4H13 C;  3RK2 B;  1CI6 A;  4HJG H;  2H7H A;  2PEK A;  3DS0 A;  2K5X A;  4QMA A;  2YKQ A;  1SQX G;  1ZXG A;  1BGY G;  2Y9Y A;  1PGP A;  3H32 A;  1LTS C;  1KB9 E;  2WQY C;  2E75 D;  2H88 C;  1OW8 A;  1F80 D;  1VQ6 P;  3GF7 A;  2JB0 A;  1FOS E;  3CWB E;  2FXO A;  3B5I A;  1R5S A;  3VMY A;  2HG5 D;  5AVR B;  2WSE H;  3V6I A;  1J1E B;  1DEE G;  2JR8 A;  3Q2Y A;  1GU5 A;  4BRY B;  1MV8 A;  3G28 A;  3IF4 A;  1BSH A;  1VQO P;  3M9H A;  2QM8 A;  1GDT A;  1GL2 D;  1DV5 A;  2VLQ A;  3AE7 C;  3RL0 B;  1D1D A;  4PD4 E;  4GR2 A;  2E74 B;  4DT0 A;  3G4S P;  1FBM A;  4H0L B;  5E79 E;  4UB6 H;  4DG9 A;  4PH0 A;  2FBW C;  1EDJ A;  1AA0 A;  4R0M A;  1XTC C;  1NYH A;  2KZI A;  3FWN A;  2KG9 A;  1GXG A;  2E42 A;  1N2D C;  3M9Q A;  2KXP B;  2FVF A;  2FAE A;  4PJ0 H;  4HKG A;  5L8R J;  4B86 A;  2QE7 H;  1HBW A;  1SQQ D;  1MKM A;  1LTJ A;  1A8O A;  1L0L J;  5BS1 A;  1NU1 K;  4L75 A;  3AED C;  2O3J A;  3TNU A;  3EWK A;  3RK2 D;  1NAY A;  4NEO A;  2WTY A;  2ZJS E;  1URQ D;  2JQ4 A;  2QM7 A;  2PAJ A;  2V4H A;  2N1T D;  5AW5 B;  1GK4 A;  1IFD A;  1T2K D;  1M74 A;  2C0W A;  1LWU A;  3M0D C;  4U0B A;  3MHV A;  2FQ1 A;  4JQ0 D;  1AJY A;  3BAS A;  2R5B A;  3A0H E;  1LTA C;  5KLV K;  1IO4 A;  3PTZ A;  3HD7 D;  3II6 A;  3MUD C;  2WSC J;  2OQQ A;  2XT1 A;  2MR8 A;  4Y99 C;  1OVV A;  2FYU K;  3G29 A;  5AVT B;  2OYI B;  5AVS B;  4EOT A;  2E74 D;  4M0I A;  1KIL C;  5CZD B;  1NVO A;  1YTZ T;  2GZE A;  4H0L D;  1ZP0 C;  3GJN A;  1IZN B;  5AW0 B;  3JCU E;  1SQX K;  1LTI C;  5CCG C;  3N4X A;  1NTZ J;  5AW9 B;  2XKM A;  1FZE A;  1A02 J;  2H89 C;  2HOD A;  1EXJ A;  1YJ9 P;  2AXT H;  1FJK A;  2WMM A;  1SQQ E;  2N9B A;  4RES B;  3L71 J;  1NTK J;  1XTG B;  3A0B H;  2AEF A;  3JC2 2;  1BCC D;  1PGO A;  2JYG A;  4C7N B;  3V2N A;  3V4Q A;  2AFE A;  4XFZ A;  1QL2 A;  2VSQ A;  3L75 J;  4U0F A;  2PFX A;  4AQR D;  2FAD A;  1JY3 O;  2KOP A;  2K37 A;  3MP7 B;  2HYN A;  2ZYD A;  2KOS A;  3FWL A;  4QKO A;  2ZT9 B;  2YIU C;  1IC2 A;  2K92 A;  4CA3 A;  3H1I J;  4U0E A;  1VQM P;  5HGN A;  2JBG A;  4R4L A;  3GHG C;  5TIS E;  2KNC B;  1VQ5 P;  5DCK A;  2Y0C A;  3M9B A;  3AE8 C;  1AV1 A;  1NTZ G;  1LTJ B;  4D6T D;  2GDY A;  1HJB A;  3WMM 0;  4COC A;  1ACP A;  5KAF H;  4PWV B;  2PY8 A;  1FE6 A;  3C1L A;  3AEF C;  3L71 G;  1NTK G;  2XV6 A;  1Y47 A;  1IFI A;  3SWF A;  2FFD B;  2K94 A;  2B87 B;  3B8E B;  3VMZ A;  1LWU B;  2M3B A;  1U7M A;  3HE4 A;  1Z56 A;  3L70 J;  3SFE C;  3H25 A;  5AVU B;  3KDP B;  3RBX A;  3RK3 C;  3WUU A;  1EDL A;  4M3L A;  1EDK A;  1HGV A;  2B88 A;  3OA7 A;  1KTM A;  4EIJ A;  5APS A;  1L2P A;  2P1J A;  1T8Z A;  4H44 C;  3VN0 A;  1OZH A;  2W6J H;  5KTB A;  3H1I G;  1S1C X;  3VP9 A;  2XDJ A;  1S4X A;  1FZF A;  5K5G B;  1A02 F;  2JO0 A;  1SQV J;  1Y8A A;  1SLQ A;  2Z5H A;  4WVZ A;  3H1L J;  1L4A A;  1G2C A;  1K30 A;  3V2R A;  3OJA B;  2R44 A;  2LIW A;  2C9N Y;  3U1C A;  1L0L K;  1AQT A;  2CWO A;  1AUM A;  3S9O A;  4XE5 B;  1JMM A;  3H1L E;  1L0H A;  2JJL A;  4Y28 J;  1H88 A;  3P8C D;  3ABV C;  2HOD B;  1JY2 P;  5BU8 B;  3BCC J;  4GT1 A;  2OYH C;  1M57 D;  2N6Y A;  1EZV G;  1N73 A;  2YMK A;  1DH3 A;  1X79 B;  1G1I A;  3TYY A;  2L9F A;  2FYZ A;  1N8R Q;  4JPZ B;  1P84 I;  2N6Z A;  4L76 A;  2FVE A;  1GTW A;  1JO5 A;  1RF1 A;  5KJ7 A;  5CCG D;  2WT7 A;  3A2A A;  1VL2 A;  1PEM A;  1QVG O;  1JMB A;  4WY4 C;  2A45 I;  5F2O A;  1RE3 C;  2K0Y A;  1UII A;  5KKZ B;  3H1H D;  2H8P D;  3O6Q A;  3PHL A;  3NMD A;  2W90 A;  1SQV G;  4H44 B;  3S1K A;  2RMZ A;  1PP9 J;  3H1L G;  2BAS A;  2Y0E A;  1E79 H;  2W27 A;  3B4S A;  1NU1 J;  3OW2 O;  1FS0 E;  3CX5 E;  4BPG A;  2P9X A;  1KFN A;  2FVA A;  1DIP A;  1ZRT D;  2LTE A;  3G26 A;  2D2C C;  3HYB A;  1RNI A;  2IBZ G;  4IL6 H;  1YIJ P;  3LW5 J;  1NTZ K;  2L91 A;  5GTI H;  2K0X A;  5JPA A;  1JY3 N;  4YPC A;  1J2J B;  4W80 A;  4AYC A;  2JKV A;  5APX A;  2MVU A;  3R2P A;  1NTK K;  3P8C E;  3PJS K;  2E76 C;  4CPG A;  3HE4 B;  3U43 A;  3TGU D;  1DNY A;  1KIL E;  5BS2 A;  3RK2 C;  2EFJ A;  2GM4 A;  3H1K J;  3WU2 E;  3KXD A;  2BEQ D;  1FR2 A;  1M1J A;  4ZKP A;  1CZQ A;  2JEE A;  2KS1 B;  1PPJ E;  2N5H A;  3W67 A;  1SQB D;  1NKN A;  3L36 A;  3PRJ A;  4NPD A;  2EHT A;  1FZG A;  1ZNV A;  1M7L A;  4WY4 B;  3HE5 A;  2KGA A;  1SQX J;  1J1E C;  2BEZ F;  2O1K A;  1N7S C;  2WSE J;  1CW5 A;  4I2L C;  2YO2 A;  3H1H E;  3RK3 D;  1G2C B;  3Q5R A;  4JF7 A;  1NTM D;  4WBA A;  1FJP A;  3AEA C;  2WPT A;  2O01 N;  3L72 D;  3RL0 C;  4GIF A;  4ASW A;  3L74 D;  2A06 E;  4H44 D;  2MVV A;  2ZXX A;  3VP8 A;  5B66 H;  2D2C B;  5AVW B;  3UIA A;  1ZRT E;  3H6P A;  2QIW A;  1N73 B;  3M91 A;  2KW2 A;  1LP1 A;  5CCH D;  2KWL A;  1OVR A;  2Q7C A;  1HQB A;  2K9Y A;  2ZAE B;  1PPJ G;  1JCD A;  4UB6 E;  3DPH A;  2LPK A;  4GOE A;  2Q9I A;  1SQP D;  3VRL C;  1YHQ P;  2FYN C;  5CBO A;  3EFG A;  2QVA A;  3B5N A;  2NPS B;  3SSU A;  2V7Q H;  1ZV8 A;  2CGQ A;  2ZVO B;  1UNK A;  2J59 M;  2Z4E A;  3GG2 A;  1OVU A;  4PJ0 E;  2LKM A;  3CWB J;  1PEU A;  1HVV A;  1RF0 C;  1FZC C;  2DNW A;  1L0N D;  1NAF A;  1SQV K;  4KHX A;  2IZ1 A;  2YMY A;  2ONT A;  4U0A A;  2A06 G;  3VYI A;  3EJD A;  1SQB E;  1ZR2 A;  2GZJ A;  2M5A B;  2O1J A;  5DJU B;  2M8N A;  1AYI A;  1BDC A;  1N7S B;  4WY4 D;  3RK3 E;  2HPC A;  1JCC A;  1SFC B;  3NFQ A;  3O8Z A;  3G3Z A;  2JAZ A;  1OFC X;  2E5T A;  1J1D B;  1P84 D;  3L72 E;  2IDB A;  2DGY A;  1VF5 B;  3LIE A;  3AEE C;  1H8A A;  2LXC B;  3L74 E;  4DZO A;  2OYI C;  2M3E A;  3R4Y A;  2MD9 A;  3K5B A;  3MGN A;  3AE9 C;  2D2C D;  2VRS A;  2KSE A;  4OGQ B;  2WWW A;  1QL1 A;  4LC1 A;  5AW1 B;  3CMA P;  2P58 A;  1YIT P;  4KT0 J;  1IFM A;  3L4F A;  2KGE A;  1M1J B;  1DD3 A;  3M0D A;  2WSF H;  4IL6 X;  4ZNC A;  3WBH A;  1JNM A;  3IAO A;  1VQP P;  2FYN B;  3CWB G;  1GMJ A;  1SQP E;  1KN7 A;  1LTT C;  2OTL P;  2XZR A;  2DW3 A;  3P7K A;  2E76 D;  4IOI H;  1RE4 A;  1SS1 A;  2ZXE B;  1KQF B;  4GDO A;  4H2Y C;  2PNG A;  3MUD A;  2NPS D;  3G6E P;  2BCC D;  7CEI A;  1OMI A;  1YQ4 C;  5APU A;  4QNB A;  2XV5 A;  1FZC B;  2N5I A;  2IFN A;  1L0N E;  2AXT E;  4BWN A;  1KIL A;  1RO2 A;  5KP8 B;  1KLP A;  4OH8 B;  1BE3 D;  1IK7 A;  4I1L A;  3P8M C;  4K3A A;  1MFT A;  3BRV B;  3E1I A;  3A0B E;  3VMA A;  1FAV A;  4HYT B;  2LL8 A;  2Q1K A;  1VQ4 P;  2QJY B;  2KIK A;  1N7S D;  4MN4 C;  3L37 A;  2ZT9 C;  3WUV A;  1EMV A; 
#chains in the Genus database with same CATH homology
 2XV6 A;  3G0V A;  4GR6 A;  1PEM A;  1QVG O;  2QA4 P;  2EG5 A;  5F2O A;  2BUO A;  1KC8 Q;  2PEO A;  2Z46 A;  2Z45 A;  3CCL P;  2JYL A;  4COP A;  2M8P A;  1ZMB A;  2DGY A;  3CCQ P;  1S72 P;  3G1I A;  2OAR A;  3DTJ A;  2PEJ A;  1Q7Y Q;  3P05 A;  1K8A Q;  3DS3 A;  1YJ9 P;  3E2D A;  2QEX P;  3CCE P;  3CME P;  1IUQ A;  3M1M A;  3CCR P;  4XFY A;  1NJI Q;  2OTJ P;  2M8L A;  3CCM P;  1M1K Q;  3CCV P;  3CPW O;  3OW2 O;  4XRQ A;  4PH1 A;  1K9M Q;  3CMA P;  1PEO A;  1A8O A;  2EIA A;  1YIT P;  5BS1 A;  1BAJ A;  4XRO A;  2P9X A;  4WYM A;  1VQ8 P;  2PEQ A;  1VQ9 P;  1KQS O;  3G26 A;  4XFX A;  2E1M A;  3HYB A;  5F2K A;  1RNI A;  3CCS P;  1QRJ A;  2PEN A;  1YIJ P;  1M6N A;  1KD1 Q;  2JYG A;  2KOD A;  2PEK A;  3WBH A;  1Q82 Q;  5JPA A;  4XFZ A;  3DS0 A;  2LF4 A;  1VQP P;  2JO0 A;  4U0F A;  2BQ1 E;  2PEI A;  3DS2 A;  5HGO A;  3MGE A;  5I4T G;  1VQL P;  3DPH A;  2OTL P;  1M74 A;  5F2N A;  1PEQ A;  1K30 A;  3LRY A;  3VRL C;  3G71 P;  1YHQ P;  3HZQ A;  1Q86 Q;  1RO0 A;  4U0B A;  3I56 P;  3DS5 A;  1QVF O;  1JJ2 O;  1VQ6 P;  1W2B O;  3G6E P;  2CWO A;  3CCJ P;  1AUM A;  3B5I A;  1YI2 P;  4IPY A;  1E6J P;  4U0C A;  3DS1 A;  1YJW P;  4QNB A;  1Q81 Q;  3DS4 A;  3I55 P;  1K73 Q;  4U0E A;  1VQM P;  3CC2 P;  1M90 Q;  3CD6 P;  5BS2 A;  1RO2 A;  1EOQ A;  5HGN A;  1A43 A;  3G28 A;  3CC7 P;  2EFJ A;  1M6E X;  1VQ7 P;  1PEU A;  3H4E A;  2PEM A;  1VQO P;  2XT1 A;  4U0D A;  2ONT A;  4U0A A;  1VQ5 P;  3G1G A;  3G29 A;  5DCK A;  3H0D A;  3CXC O;  3G21 A;  1D1D A;  5HGL A;  2Z44 A;  3H47 A;  1N8R Q;  3CC4 P;  4GR2 A;  3RG6 C;  4M0I A;  2L6E A;  1VQ4 P;  2BHV A;  4COC A;  2M8N A;  1YJN P;  1EIA A;  2PY8 A;  1VQN P;  3Q20 A;  3G4S P;  3CCU P;  1VQK P;  2XXM A;  4PH0 A;  5HGM A;  3NTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...