1S72P

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1s72P02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1s72P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1s72P03
3G6EP 1Q81Q 1JJ2O 3CD6P 3CXCO 1VQMP 1S72P 1Q82Q 1NJIQ 1KQSO 3CCJP 3CCSP 3G71P 1VQ7P 1M1KQ 3CCVP 1VQLP 1VQKP 1YIJP 3CC7P 1K73Q 1VQ5P 1YJNP 3CCLP 1VQ9P 3CPWO 2OTJP 1Q86Q 3OW2O 1YI2P 1YJWP 1VQPP 3CCMP 1YJ9P 1W2BO 3I55P 1YHQP 1QVFO 1N8RQ 3CC4P 1K9MQ 1VQOP 3G4SP 1KD1Q 2OTLP 1VQ8P 3CMEP 2QA4P 1YITP 3CC2P 3CCQP 1M90Q 3CMAP 1VQ4P 1VQ6P 1VQNP 1QVGO 1K8AQ 3CCRP 3CCEP 1KC8Q 3CCUP 2QEXP 3I56P 1Q7YQ
chains in the Genus database with same CATH superfamily
1NGMB 2OYHC 3L70E 1SS1A 5CCGC 3VMZA 2WPVB 1FS0E 3H1KD 1N8RQ 3AEBC 1AVYA 1KTMA 3HZQA 4NPDA 1N86A 3E2DA 3HE4A 3ITKA 2Q9IA 1FZCC 2MVUA 3AE6C 2CK3H 2AXCA 2ZT9C 2JWAA 1KYOD 2GZJA 1BXIA 2KP8A 1GU5A 1ZLLA 3CC7P 3W68A 1FZCB 1JOCA 2MY5A 2KS1A 1SQXD 1G1JA 1SQPE 4EIJA 2ZT9B 3V6IA 2IZ1A 5APUA 1NAFA 4HB1A 2CNRA 4O9BA 3L74D 4XFYA 2XZ1C 3RL0g 2Y9ZA 4IFFA 1NTZE 1EZVI 2FXPA 2FVFA 1FDMA 1NTME 2ZVOB 4U0CA 4U3FE 1A02F 4OH8B 1CEIA 2Y0CA 2XU6A 2KLVA 4NEOA 1HY8A 5BU5A 1FE6A 3MUDC 3H1HG 2BCCG 2CQ8A 3V2RA 3TGUD 3FGAD 3M9BA 5AW7B 3H1IJ 1GK4A 2EHTA 1KB9D 3Q1MA 4IOIH 1W5CE 4OVNF 3TDKA 1F80D 4KJMA 4D6TG 2KG6A 3M0DA 3RG2A 4UB8E 1SP4A 2X2BA 1PPJE 2FQ2A 1M6NA 2KR5A 1TU3F 2FXMA 2HG5D 3IR9A 2HODB 3H1HE 5APVA 5KTBA 4GT1A 4UB8H 3BRTB 3H1LE 3GLMA 1NTKE 1GXHA 5CCHD 2N6YA 1JTHA 3AECC 1GXGA 1N7SC 2I1JA 5KLVG 1HBWA 1SVFA 1YHQP 3GJNA 2O01J 1EZVG 2Z5IA 3P8CE 4NPFX 1N73A 4JF7A 1N7SB 3KDPB 3EFFK 2FACA 4WY4D 2LIWA 1RNIA 4A7PA 5TJHA 3ZDMA 1ACPA 1YJNP 1GK6A 4KT0J 1RQVA 2EIAA 2C0WA 4L73A 1KB9I 5GTIH 1M74A 1L0LD 1IMPA 4IPYA 2NRGA 1JCCA 2KOGA 2GZEA 1KZUB 3L75D 1MZ9A 2OTKE 3BATA 2A06D 2Q7CA 1IFPA 2WMMA 3DS2A 3CI9A 1JCDA 3PH0A 1Z6MA 3CCMP 3TF5A 3FX0A 4BPGA 2O1KA 3NXSA 1T3UA 3MP7B 1SQVG 1BSNA 1L0NG 1S9KE 1X8YA 2LOLA 3JCUH 1LT9C 4GR2A 1URQC 5CCGD 3A5TA 4L76A 1OVRA 3GHGB 2BEQD 2QIWA 2ONTA 3SFDC 2K94A 1GW4A 2J5UA 4R4MA 1QL2A 3CMAP 1IFDA 1VDFA 1PL5A 1EOQA 3BCCG 1YYCA 2JO0A 3H6PA 3V4QA 3HYBA 2GYKA 2JQ4A 3B4QA 5E79H 1WRGA 1VKUA 2ZT9D 4U0FA 1MFTA 1X0TA 3EFGA 2FAEA 3Q2YA 1JY3P 4WB4A 4ZKPA 1KFMA 2XZRA 2BCCJ 1DEEG 4W80A 2J59M 2XT1A 3L73G 1K30A 1OW8A 1PZQA 1ZRTE 2GZFA 3G6EP 1H0TA 2PP6A 5C39A 2DGYA 2Z44A 4M3LA 2K9JA 4QMAA 4WYMA 2FYUK 1LJ2A 2GM4A 1LTJA 3IFMA 5DCKA 2ZYDA 5EW5E 1XTCC 2QJPC 4HYTB 3E7KA 2P9XA 2WWWA 1M1JC 3G1IA 5GTHE 2KNCA 1GTWA 1PEUA 2YO2A 1T3JA 3G0VA 2QJPB 3NTNA 2OYHA 4QNBA 1J1DC 1G2CB 1M1JB 2WITA 1GL2A 1BE3G 1KC8Q 3FXEA 1J1DB 2AFEA 5I4TG 1JY2N 2JB0A 3PHLA 1T2KC 3M1MA 2AEFA 2POHA 2KW2A 3V4WA 1KMIZ 1Y8AA 3EQ2A 2WT7B 1EQ7A 1M57D 4KHXA 1N7SD 5HGNA 1BE3E 3CX5E 4N6JA 3MIWA 2YNYA 4OGQC 1SQQD 2I8DA 2XNXA 5AVZB 1BDDA 3CXCO 3CX5H 4C7NB 2PAJA 1LTTC 2FKWB 2E43A 2LR2A 4GOEA 5B5EH 5AVUB 3CPWO 2QNWA 4TT3H 3GMAA 3HUSA 3VOPA 2E5TA 1RHZB 2PRRA 3GF3A 3A7OA 1MFZA 2N1TC 3HTKA 2GZGA 2M0BA 2QRXA 2E5YA 3G71P 2GDXA 3MUDA 2KWLA 5AW9B 1HJBA 1PIXA 4Y99B 1BGYE 3TGUJ 2HODA 2N1TB 1OX3A 1ZMEC 1NU1J 2W6AA 2KXPB 2I1KA 2N9YB 1P84E 2IBZE 4ASWA 1LTSC 2WSCJ 5AVYB 2FBWC 1P84H 1FC2C 1RE4A 3DS5A 1QRJA 3H1JD 3OJAB 3V5BA 4W7YA 5JPAA 1RF0C 3H4EA 3DPHA 3L72E 2HYNA 3S1KA 2LMLA 4N78E 1ZXGA 2Q5UA 3D6ZA 2ROQA 5KJ7A 3BASA 2QJYC 5KLVK 2H88C 5TISH 1HGZA 2MD9A 1LGHB 2Y0DA 2N5IA 3GF7A 2QJYB 2WSFH 1HTLC 3F89A 3CL3D 3L70D 3Q3DA 2WVRA 3VN0A 3VMXA 5HGLA 1VF5B 3M06A 1KQLA 2KG9A 5CMZA 2DNWA 1QEXA 4PJ0E 3H25A 3O8ZA 3CCEP 3AEEC 3DS1A 3A3YB 3VRLC 2N9BA 3RK3E 1JMMA 2ZXXA 2E42A 1DIPA 4DCKA 3F5HA 1VQPP 3Q5RA 1L4AA 2G8YA 1S3JA 4LC1A 3M9HA 5HVCA 1QX8A 1LT9A 1URQA 1SQPD 1QVGO 3CCRP 2V7QJ 2L0QA 2W83C 2KGDA 1SQVK 2BHVA 2P1JA 1Q90D 4XFJA 4BPFA 4BPHA 5HV8A 1VQ9P 1NTZD 2KIKA 2PFXA 3H1IG 1T2KD 2L91A 2EHSA 1NTMD 2K3RA 2AVAA 5AVVB 2A45I 2JBGA 4U3FD 2IX7C 1NHLA 1ZW0A 1SFCA 3SWFA 1NU1K 1A43A 1CSBA 3G28A 4BRYB 3H1IE 3CWBE 4K3AA 1KORA 2OYOA 3E1IA 1ZN5A 3V2PA 5HGMA 1IC2A 4U0AA 2KGEA 2XZ0D 2B88A 2B89A 4NPEA 1PPJD 4AYCA 2JR8A 1BSHA 2AXTE 3H1HD 2ITAA 3H1LD 1Q82Q 3RBZA 2FYUE 4IZ6A 1NTKD 1GU4A 2JP3A 1G2CA 2N1TD 1NAYA 1FDIA 4IL6H 3GZLA 4PD4H 3VP8A 3O6QB 1UIIA 3H32B 3P8MC 2H8PD 3BRVB 4YXDC 3I56P 1OW6A 2KUBA 3SSUA 1LTGC 3P8CD 2FQ0A 2A45G 1RO0A 3U1CA 2O01H 1WMKA 2XKMA 2L6EA 1OZHA 2WT7A 1KQFB 1BCCE 2CPSA 2K0YA 2LTEA 5APWA 2P58A 5KP7B 1SQBE 3WU2H 3V2NA 1IFIA 2KK7A 1FJKA 1IK9A 2WSEH 1LTBC 2A45H 1J1EC 1RY3A 4K35A 3FWLA 1DD4A 1JUNA 3KQGA 3BVHA 4GOFA 1T8KA 1T6AA 2P2UA 3GW6A 1J1EB 2WPSA 1RF1A 3AEDC 2GA1A 2LIUA 1RH5B 1S9KD 1VF5D 1USEA 2YKOA 2B87A 1W2BO 4RESB 4GDOA 2L5GB 1M56D 4UB6H 4HJGH 3CXHE 1CI6A 1FU1A 3W67A 1KILA 2VLNA 3CXHH 3C9IA 1CZQA 3CCJP 4U7JA 3MD0A 1LP1B 3D71A 5F2KA 1ZNVA 1KYOI 2M8LA 1PP9G 3KZIH 1YITP 2JDIH 1AVOA 1PGJA 2BCCE 3HE5A 3H47A 1ZRTD 1VL2A 4XFXA 2LF4A 1VQ7P 1OVUA 3T97A 1HUCA 4D6TE 1DNYA 2FFDC 1OMIA 1PFIA 1JNMA 4JPZB 2KI7B 3B8EB 1H88A 3G3ZA 2PEMA 3L71D 4BXLA 2FFDB 3B5NC 2JJLA 4Y28J 1GW3A 5KLVE 1W2EA 5GTIE 4DZOA 4C46A 3RK3B 5KP6B 1FZEA 1EZVE 2CWOA 3B5NB 3KHUA 3NTEA 1LWUA 2CPBA 2WSEJ 3L70J 1D1DA 4ZKUA 3QH9A 1IUQA 2YMKA 1KLPA 1DX7A 1S72P 1CW5A 3NMDA 1PGPA 1S2EA 3Q20A 4GR6A 1LTIC 1EXIA 2M8RA 3I55P 1EMVA 4I1LA 3P05A 2QG4A 2XV5A 4EYYQ 1BE3D 1R5SA 3CX5D 1S5LX 3JCUE 3GHGC 3L35A 5BU8B 1KYOH 3CCSP 3U43A 5CCHA 1SQPJ 4PWVB 2NPSC 2YKPA 1VQ5P 3M0AA 1H89A 1EDJA 1VQOP 1K04A 2ZXEB 1SQVE 5AW0B 1L0NE 3TGUG 1Q2NA 2NPSB 2WPRA 1NTZJ 1NWQA 1NU1G 2HPCA 5E79E 2Y0EA 2K9YA 2C9LY 1NTMJ 3D70A 2ZAEB 4WY4A 4GODA 1AF8A 4XFZA 3LRYA 2R5BA 4L75A 3K5BA 1AQ5A 4XE5B 1D7MA 2LKMA 3HD7C 1BGYD 3GG2A 3MHVA 2W8ZA 4WBAA 3BCCE 2KLUA 1NU1E 1JM0A 3MTUE 1P84D 2XDJA 5KAIH 2IBZD 2HFED 1JB0J 3HD7B 1KB9H 5AW4B 2O3JA 1U7JA 3KPEA 3LIEA 1PP9J 2W90A 1Q86Q 3JSVC 2FADA 3Q5SA 2WSCH 3H1LJ 2SPZA 3L73E 3M91A 2YIUB 2WQYC 2Q6QA 3PTZA 2K0DX 3GKLC 2H43A 1OXZA 2QM7A 3L72D 1M7LA 3B4SA 1USDA 4N78D 1JY2P 5CCGA 3G4SP 1E79H 2KORA 4ZNCA 1JO5A 2FYZA 1AJYA 2OYIC 2MR8A 2L22A 3DS3A 3L75G 3H1KJ 5CJ0A 2A06G 3TK1A 3EJDA 2K0XA 1FZCA 4YXWH 1K05A 3P7KA 2OYIB 1A8OA 4GKGA 2IBZI 2YXQB 4H44C 1EDIA 2MVVA 1PEQA 2RN0A 1M90Q 1HQBA 1S5LE 2Q1KA 2WSSH 1NQ4A 1N2DC 5KAFH 5B5EE 2JGPA 3JC22 4H44B 2K2QA 2PEOA 1SQXJ 2PEKA 2KOOA 1S5LH 3RK3D 2ZYGA 3B5ND 1JEKA 1NH4A 3L74J 2W6BA 4IFDK 1FR2A 1NO4A 3HE4B 1ZP0C 1GMJA 4Y99C 5AW3B 3CD6P 1NOHA 3QWOC 3VTPC 5AW2B 2YMYA 5AVWB 1NTZK 2V7QH 4HH2A 3RBXA 2LXCB 1YJWP 1BDCA 2KZIA 1NTMK 3RL0B 2KS1B 4HKZH 3GZMA 4H13B 2KYVA 1JY3O 2M3BA 1RE3C 5F2OA 3AE4C 3AEAC 3AE9C 1UNKA 3H1ID 3CWBD 3AE7C 2NPSD 1N7SA 1GDTA 1OFCX 4EOTA 2PENA 2KGCA 3PJSK 2ZVNB 2R5DA 5M1BA 1AYIA 1X9VA 5H2FH 4IL6X 3P32A 2FYUD 5TISE 3L71J 2N5HA 1R8EA 2VSQA 3CMEP 3CC2P 4ASVA 2P10A 2M8PA 3HD7D 1VF5C 4CA3A 2JYGA 4XRQA 3WUVA 2NZ2A 1OWAA 1AA0A 3S4RA 5CBNA 1L0LJ 1K73Q 1JTHB 5CZDB 2PNGA 3L75J 1BCCD 2FHSC 1SQQG 3DS0A 1SQBD 1N73B 1AV1A 1E6JP 1DEBA 2K92A 3GHGA 2AEJA 1L2PA 1SQXK 4N3YB 2OARA 2KSEA 3TNUB 5AW6B 2KB7P 5AVQB 1E5WA 2BASA 1IJDB 1KQSO 1AQTA 1AUMA 2L9FA 1Y47A 2OTJP 2FVEA 2K5XA 1GPJA 2JYLA 3CCQP 2E74B 4H44D 5APQA 1ZOYC 1S4XA 4RO0A 2GUSA 2Z45A 2QJKC 4JQ0D 1IK7A 1VQMP 2IPPA 3USSA 1VQLP 1BGYJ 3H1JG 5AVSB 2R3CA 2EFJA 2QVAA 5BS2A 2QJKB 3N7NA 3ABVC 1PGOA 1K8AQ 2N6ZA 2OQQA 3N4XA 3II6A 2BCCD 4H0LC 5AVXB 3C1LA 1M8OB 2K88A 2JWDA 3KYQA 2M5AB 4IL6E 3RL0D 4PD4E 1YIJP 1M1JA 4B86A 1IZNB 4H13D 1Y9BA 3B5IA 1HJ0A 4D6TD 2ERHA 2KOSA 1X22A 4H0LB 2DW3A 2Q3IA 3L72J 4U0EA 2PY8A 2C9NY 5CBOA 3L37A 3L70G 4DJGA 2L4BA 3EJEA 1LTJC 1H0TB 2Z5HA 2R44A 3OAKA 5DJUB 2K9JB 5KLVD 3U1AA 1X79B 3A2AA 2VLQA 3WU2E 1LTJB 1L0LK 1EZVD 2Y9YA 4C7NA 2RMZA 1MKMA 5AW8B 1Q81Q 3R2PA 4F37A 2KNCB 3A0HH 1GL2C 4GIFA 3C8VA 3G26A 5APSA 1U7MA 3I5CA 2KOPA 1SQQJ 2K1AA 1RO2A 2OYHB 2FYNC 3IAOA 2BUOA 4HKGA 1SQPG 2QA4P 2WPTA 2P7JA 1GL2B 1GZLA 1FAVA 1G1IA 2IYOA 1J2JB 2FYNB 2GUVA 3DS4A 1NTZG 3MGNA 2N1TA 1NTMG 4UB6E 5BS1A 4U3FG 3HRNA 2KG8A 2MF4A 2MR7A 2LPKA 1SQVD 1FZAA 1HH0A 2KSJA 2Q3EA 1L0ND 3UIAA 2RH0A 2JAZA 1QGKB 4LLHA 1EDLA 3HUSC 3WUUA 1RE3A 3KZIE 4U0BA 5AVRB 4AUWA 2JKVA 1PPJG 3HUSB 2E76C 3H1LG 3H1JJ 1JJ2O 3BCCD 3CWBJ 1NU1D 1NTKG 3OA7A 2FY8A 3HTKB 4COCA 2ZFCA 3V2QA 1RF0A 1ZR2A 3G21A 5KP8B 2MKVA 1OR5A 2E76B 3OW2O 2UWJE 1YQ3C 2E74D 1FZGA 1PP9E 2V4HA 2W27A 2BQ1E 1IFNA 1VQ6P 2AFDA 2FYUJ 1RE4C 3L73D 3SFEC 3RK3C 4ZMDA 1E0HA 3Q5PA 3H1KG 2HLOA 5DJTB 2G3AA 2PEIA 3AE5C 2YXRB 2K93A 1KILE 4JYCA 3WUTA 2JU1A 4JBZA 3KXDA 3M9QA 5AW1B 5KJ7C 3LW5H 1IO4A 5APYA 1BCCJ 3CCVP 2AEMA 4WVZA 3H1KE 2IFNA 1OVVA 4C7RA 1XTGB 1SQXG 4H0LD 3TNUA 1DV5A 4R0MA 1SQBJ 2KOQA 1Z56A 3TYYA 3MGEA 1PEOA 2Z4EA 1KYOE 3MZWB 3CE7A 3L74G 1SQQK 3FXDA 2IDBA 1NVOA 3AE1C 3PP5A 1FOSF 5HGOA 1UIXA 1SQXE 1NKZB 4PV1C 4M0IA 3IF4A 5EFWB 4I7ZC 2R3SA 2PEQA 5F2NA 3AE8C 2VRSA 3L74E 1PEMA 5EJDA 2WTYA 3H0DA 5BVZA 5K5GB 4PV1B 1LT1A 1FDOA 4BRYA 1L4AC 1NJIQ 4I7ZB 2QM8A 4U3FJ 3VP9A 5B66E 2OGUA 2HR3A 1GL2D 2P67A 2E75C 3AEGC 1L4AB 5B66H 5KAIE 3TGUE 3NFQA 1LT9B 1URQB 1QL1A 1KB9E 1RQUA 7CEIA 2M5AA 2KZJA 2E75B 4UHPB 2IZ0A 3VYIA 1VQKP 2H89C 1MV8A 2D2CC 1GD2E 2YIUC 3CX5I 3B71A 4MRTC 1DD3A 3O6QA 3AE2C 3H32A 1KD1Q 1SFCC 3H1HJ 1IMQA 3G9RA 1IFJA 1NTKJ 1ZR4A 1MZ8A 3L71G 2D2CB 5KLIC 2VLOA 1EC5A 5AVTB 2E1MA 1QLED 1JY3N 3L36A 4D6TJ 2YO3A 3AE3C 2LKIA 1SFCB 4YTPC 1YQ4C 2C0XA 5KLIB 3LW5J 3G1GA 1L0LG 1FJPA 3L71E 1EIAA 2PGDA 1VQ4P 3TSIA 2M3EA 3WBHA 5KLVJ 2E76D 1M1KQ 5GTHH 1X3OA 1L0IA 1YJ9P 1P84I 1L0LE 2FQ1A 5KAFE 3PRJA 2N98A 4RKUJ 2FXOA 3L75E 2N50A 1SQBK 2A06E 1H8AA 3AEFC 2IFMA 1NKNA 2W6JH 1FOSE 2PEJA 4XA4A 1QVFO 1MUUA 2JO1A 4DT0A 1KN7A 4TLFA 1T8ZA 1SQPK 3RK2C 1DH3A 3VMAA 3G29A 3RL0C 2M8NA 2EG5A 1LP1A 4H2WC 2ZYAA 1HVVA 4H13C 3FWNA 4OGQB 5KJ7D 1YTZI 2XXMA 3RK2B 1ZMBA 1HWTC 3L4FA 1RF1C 1SQVJ 3CC4P 1FBMA 1BGYG 1L0NJ 2LL8A 4H2YC 1FZBA 1A02J 1FZFA 5APXA 3S9OA 4PH1A 4I2LC 2JU2A 3CCUP 1VPCA 2IBZG 2WPQA 2QSIA 1RF1B 4WWIA 4R4LA 2CG5B 3NY7B 5AW5B 1YI2P 2QE7H 2B9BA 2B87B 3BCCJ 4PH0A 3RGUA 1KILC 2BEZF 4JYBA 4PV1D 2O01N 1UJZA 2FVAA 2Z46A 2FFDA 1CI6B 1PGQA 1SLQA 5H2FE 1L0HA 3LMOA 2GDWA 4MN4C 3L72G 3M0DC 3LIDA 1KILB 5CJ4A 4BWNA 3VMYA 1NTKK 1EXJA 4XROA 3CCLP 1L4AD 3L73J 3E1RA 4PD4D 2R32A 3B5NA 2OTLP 1URQD 2JEEA 1M6EX 1HF9A 2E75D 1IFMA 1JY2O 3HE5B 5APTA 2ZJSE 1LNQA 2J58A 3EWKA 3IN6A 2KODA 3D6YA 2VLPA 1YBKA 1AFOA 3T97B 4IFMA 1N73C 2LXBA 3U59A 2D2CD 4PXHB 5KKZC 4OWFA 1R5LA 1SFCD 3PLNA 4LGDE 4W7ZA 3R4YA 5CHXA 2XV6A 1NYHA 1HGVA 5KKZB 1OW7A 4I6MC 1LWUC 1JMBA 2RKLA 1BE3J 2YKQA 2GDYA 4DG9A 2WZ7A 4CPGA 1K9MQ 4EDFA 3WMM0 1SQQE 4RJTA 2NPSA 3DTJA 1LWUB 4EI2A 2QEXP 2GZIA 4PD4I 1Q7YQ 4PJ0H 4U0DA 2E74C 4AQRD 4QKOA 1EDKA 3A0BE 3SWYA 2IYPA 5CCHC 3A0BH 3HD7A 1L0NK 1PV3A 3CXHD 2MJZA 3RG6C 3EJBA 1VHNA 3CWBG 4Z1MH 1VQ8P 1S1CX 1KILD 4WY4C 1OIPA 1KQGB 1N7LA 2O1JA 4OGQD 3RK2D 2H7HA 2HPCB 3H1JE 2FYUG 3SWKA 1WT6A 1BAJA 5L8RJ 4WY4B 3CLQA 4H2XC 1U57A 4COPA 2NO8A 1ZV8A 2AF8A 1YTZT 2KGAA 1PP9D 4DOJA 2M5RA 4L74A 1KV4A 2AXTH 2OYIA 3CXHI 2WSFJ 1BCCG 1LTAC 2XNDH 1VQNP 2K37A 2CGQA 4YPCA 1KFNA 1SQBG 3A0HE
chains in the Genus database with same CATH topology
2E1MA 2PENA 3CXCO 1VQMP 1Q82Q 4U0DA 3CCJP 3HYBA 3CCSP 3DS4A 3CCVP 1VQLP 2EFJA 4U0FA 1VQ5P 5F2KA 3CPWO 5BS2A 1YI2P 5HGLA 1A8OA 1YHQP 1N8RQ 2M8LA 1VQOP 4PH0A 5BS1A 3G1GA 3HZQA 3CMEP 1PEQA 3E2DA 1YITP 3CC2P 3MGEA 1M90Q 1PEOA 2XT1A 1EIAA 1VQ4P 1K30A 1K8AQ 3CCEP 2M8PA 2Z46A 3H47A 3DS1A 3I56P 3G6EP 3WBHA 2JYGA 4XRQA 3VRLC 2DGYA 1RO0A 2PEOA 2Z44A 4XFXA 1RNIA 2PEKA 3G71P 2L6EA 2LF4A 3RG6C 1M1KQ 4XFZA 1VQ7P 5HGOA 3LRYA 4XROA 1YIJP 3CC7P 4WYMA 1K73Q 1YJNP 3CCLP 4U0BA 4M0IA 2EIAA 1VQPP 1YJ9P 3B5IA 5DCKA 2OTLP 1M74A 1VQ8P 2PEQA 5F2NA 1M6EX 1PEMA 1QVGO 3CCRP 4U0EA 2PY8A 3DS0A 2P9XA 4IPYA 3H0DA 3G1IA 2PEMA 4XFYA 1JJ2O 3CD6P 1NJIQ 2BHVA 4COCA 1PEUA 2KODA 1BAJA 1E6JP 3G21A 3DS5A 3G0VA 1QRJA 3DS2A 4QNBA 1VQ9P 1Q86Q 3OW2O 1YJWP 4COPA 3CCMP 2PEJA 1QVFO 4U0CA 2CWOA 2OARA 3NTEA 2BQ1E 1D1DA 1VQ6P 5JPAA 1IUQA 1KC8Q 3H4EA 3DPHA 1Q81Q 3G29A 2XV6A 2M8NA 5F2OA 2EG5A 5I4TG 1S72P 1KQSO 1AUMA 1A43A 3M1MA 3G28A 1VQKP 3G26A 3Q20A 4GR6A 4GR2A 2XXMA 2OTJP 1ZMBA 1W2BO 3I55P 1RO2A 2PEIA 3CC4P 1K9MQ 3G4SP 2JYLA 1KD1Q 2ONTA 5HGMA 3P05A 4U0AA 2QEXP 2BUOA 1M6NA 5HGNA 2QA4P 3CCQP 3CMAP 1VQNP 4PH1A 3DTJA 1EOQA 3CCUP 2JO0A 3DS3A 1Q7YQ 2Z45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E P;  1Q81 Q;  1JJ2 O;  3CD6 P;  3CXC O;  1VQM P;  1S72 P;  1Q82 Q;  1NJI Q;  1KQS O;  3CCJ P;  3CCS P;  3G71 P;  1VQ7 P;  1M1K Q;  3CCV P;  1VQL P;  1VQK P;  1YIJ P;  3CC7 P;  1K73 Q;  1VQ5 P;  1YJN P;  3CCL P;  1VQ9 P;  3CPW O;  2OTJ P;  1Q86 Q;  3OW2 O;  1YI2 P;  1YJW P;  1VQP P;  3CCM P;  1YJ9 P;  1W2B O;  3I55 P;  1YHQ P;  1QVF O;  1N8R Q;  3CC4 P;  1K9M Q;  1VQO P;  3G4S P;  1KD1 Q;  2OTL P;  1VQ8 P;  3CME P;  2QA4 P;  1YIT P;  3CC2 P;  3CCQ P;  1M90 Q;  3CMA P;  1VQ4 P;  1VQ6 P;  1VQN P;  1QVG O;  1K8A Q;  3CCR P;  3CCE P;  1KC8 Q;  3CCU P;  2QEX P;  3I56 P;  1Q7Y Q; 
#chains in the Genus database with same CATH topology
 1NGM B;  2OYH C;  3L70 E;  1SS1 A;  5CCG C;  3VMZ A;  2WPV B;  1FS0 E;  3H1K D;  1N8R Q;  3AEB C;  1AVY A;  1KTM A;  3HZQ A;  4NPD A;  1N86 A;  3E2D A;  3HE4 A;  3ITK A;  2Q9I A;  1FZC C;  2MVU A;  3AE6 C;  2CK3 H;  2AXC A;  2ZT9 C;  2JWA A;  1KYO D;  2GZJ A;  1BXI A;  2KP8 A;  1GU5 A;  1ZLL A;  3CC7 P;  3W68 A;  1FZC B;  1JOC A;  2MY5 A;  2KS1 A;  1SQX D;  1G1J A;  1SQP E;  4EIJ A;  2ZT9 B;  3V6I A;  2IZ1 A;  5APU A;  1NAF A;  4HB1 A;  2CNR A;  4O9B A;  3L74 D;  4XFY A;  2XZ1 C;  3RL0 g;  2Y9Z A;  4IFF A;  1NTZ E;  1EZV I;  2FXP A;  2FVF A;  1FDM A;  1NTM E;  2ZVO B;  4U0C A;  4U3F E;  1A02 F;  4OH8 B;  1CEI A;  2Y0C A;  2XU6 A;  2KLV A;  4NEO A;  1HY8 A;  5BU5 A;  1FE6 A;  3MUD C;  3H1H G;  2BCC G;  2CQ8 A;  3V2R A;  3TGU D;  3FGA D;  3M9B A;  5AW7 B;  3H1I J;  1GK4 A;  2EHT A;  1KB9 D;  3Q1M A;  4IOI H;  1W5C E;  4OVN F;  3TDK A;  1F80 D;  4KJM A;  4D6T G;  2KG6 A;  3M0D A;  3RG2 A;  4UB8 E;  1SP4 A;  2X2B A;  1PPJ E;  2FQ2 A;  1M6N A;  2KR5 A;  1TU3 F;  2FXM A;  2HG5 D;  3IR9 A;  2HOD B;  3H1H E;  5APV A;  5KTB A;  4GT1 A;  4UB8 H;  3BRT B;  3H1L E;  3GLM A;  1NTK E;  1GXH A;  5CCH D;  2N6Y A;  1JTH A;  3AEC C;  1GXG A;  1N7S C;  2I1J A;  5KLV G;  1HBW A;  1SVF A;  1YHQ P;  3GJN A;  2O01 J;  1EZV G;  2Z5I A;  3P8C E;  4NPF X;  1N73 A;  4JF7 A;  1N7S B;  3KDP B;  3EFF K;  2FAC A;  4WY4 D;  2LIW A;  1RNI A;  4A7P A;  5TJH A;  3ZDM A;  1ACP A;  1YJN P;  1GK6 A;  4KT0 J;  1RQV A;  2EIA A;  2C0W A;  4L73 A;  1KB9 I;  5GTI H;  1M74 A;  1L0L D;  1IMP A;  4IPY A;  2NRG A;  1JCC A;  2KOG A;  2GZE A;  1KZU B;  3L75 D;  1MZ9 A;  2OTK E;  3BAT A;  2A06 D;  2Q7C A;  1IFP A;  2WMM A;  3DS2 A;  3CI9 A;  1JCD A;  3PH0 A;  1Z6M A;  3CCM P;  3TF5 A;  3FX0 A;  4BPG A;  2O1K A;  3NXS A;  1T3U A;  3MP7 B;  1SQV G;  1BSN A;  1L0N G;  1S9K E;  1X8Y A;  2LOL A;  3JCU H;  1LT9 C;  4GR2 A;  1URQ C;  5CCG D;  3A5T A;  4L76 A;  1OVR A;  3GHG B;  2BEQ D;  2QIW A;  2ONT A;  3SFD C;  2K94 A;  1GW4 A;  2J5U A;  4R4M A;  1QL2 A;  3CMA P;  1IFD A;  1VDF A;  1PL5 A;  1EOQ A;  3BCC G;  1YYC A;  2JO0 A;  3H6P A;  3V4Q A;  3HYB A;  2GYK A;  2JQ4 A;  3B4Q A;  5E79 H;  1WRG A;  1VKU A;  2ZT9 D;  4U0F A;  1MFT A;  1X0T A;  3EFG A;  2FAE A;  3Q2Y A;  1JY3 P;  4WB4 A;  4ZKP A;  1KFM A;  2XZR A;  2BCC J;  1DEE G;  4W80 A;  2J59 M;  2XT1 A;  3L73 G;  1K30 A;  1OW8 A;  1PZQ A;  1ZRT E;  2GZF A;  3G6E P;  1H0T A;  2PP6 A;  5C39 A;  2DGY A;  2Z44 A;  4M3L A;  2K9J A;  4QMA A;  4WYM A;  2FYU K;  1LJ2 A;  2GM4 A;  1LTJ A;  3IFM A;  5DCK A;  2ZYD A;  5EW5 E;  1XTC C;  2QJP C;  4HYT B;  3E7K A;  2P9X A;  2WWW A;  1M1J C;  3G1I A;  5GTH E;  2KNC A;  1GTW A;  1PEU A;  2YO2 A;  1T3J A;  3G0V A;  2QJP B;  3NTN A;  2OYH A;  4QNB A;  1J1D C;  1G2C B;  1M1J B;  2WIT A;  1GL2 A;  1BE3 G;  1KC8 Q;  3FXE A;  1J1D B;  2AFE A;  5I4T G;  1JY2 N;  2JB0 A;  3PHL A;  1T2K C;  3M1M A;  2AEF A;  2POH A;  2KW2 A;  3V4W A;  1KMI Z;  1Y8A A;  3EQ2 A;  2WT7 B;  1EQ7 A;  1M57 D;  4KHX A;  1N7S D;  5HGN A;  1BE3 E;  3CX5 E;  4N6J A;  3MIW A;  2YNY A;  4OGQ C;  1SQQ D;  2I8D A;  2XNX A;  5AVZ B;  1BDD A;  3CXC O;  3CX5 H;  4C7N B;  2PAJ A;  1LTT C;  2FKW B;  2E43 A;  2LR2 A;  4GOE A;  5B5E H;  5AVU B;  3CPW O;  2QNW A;  4TT3 H;  3GMA A;  3HUS A;  3VOP A;  2E5T A;  1RHZ B;  2PRR A;  3GF3 A;  3A7O A;  1MFZ A;  2N1T C;  3HTK A;  2GZG A;  2M0B A;  2QRX A;  2E5Y A;  3G71 P;  2GDX A;  3MUD A;  2KWL A;  5AW9 B;  1HJB A;  1PIX A;  4Y99 B;  1BGY E;  3TGU J;  2HOD A;  2N1T B;  1OX3 A;  1ZME C;  1NU1 J;  2W6A A;  2KXP B;  2I1K A;  2N9Y B;  1P84 E;  2IBZ E;  4ASW A;  1LTS C;  2WSC J;  5AVY B;  2FBW C;  1P84 H;  1FC2 C;  1RE4 A;  3DS5 A;  1QRJ A;  3H1J D;  3OJA B;  3V5B A;  4W7Y A;  5JPA A;  1RF0 C;  3H4E A;  3DPH A;  3L72 E;  2HYN A;  3S1K A;  2LML A;  4N78 E;  1ZXG A;  2Q5U A;  3D6Z A;  2ROQ A;  5KJ7 A;  3BAS A;  2QJY C;  5KLV K;  2H88 C;  5TIS H;  1HGZ A;  2MD9 A;  1LGH B;  2Y0D A;  2N5I A;  3GF7 A;  2QJY B;  2WSF H;  1HTL C;  3F89 A;  3CL3 D;  3L70 D;  3Q3D A;  2WVR A;  3VN0 A;  3VMX A;  5HGL A;  1VF5 B;  3M06 A;  1KQL A;  2KG9 A;  5CMZ A;  2DNW A;  1QEX A;  4PJ0 E;  3H25 A;  3O8Z A;  3CCE P;  3AEE C;  3DS1 A;  3A3Y B;  3VRL C;  2N9B A;  3RK3 E;  1JMM A;  2ZXX A;  2E42 A;  1DIP A;  4DCK A;  3F5H A;  1VQP P;  3Q5R A;  1L4A A;  2G8Y A;  1S3J A;  4LC1 A;  3M9H A;  5HVC A;  1QX8 A;  1LT9 A;  1URQ A;  1SQP D;  1QVG O;  3CCR P;  2V7Q J;  2L0Q A;  2W83 C;  2KGD A;  1SQV K;  2BHV A;  2P1J A;  1Q90 D;  4XFJ A;  4BPF A;  4BPH A;  5HV8 A;  1VQ9 P;  1NTZ D;  2KIK A;  2PFX A;  3H1I G;  1T2K D;  2L91 A;  2EHS A;  1NTM D;  2K3R A;  2AVA A;  5AVV B;  2A45 I;  2JBG A;  4U3F D;  2IX7 C;  1NHL A;  1ZW0 A;  1SFC A;  3SWF A;  1NU1 K;  1A43 A;  1CSB A;  3G28 A;  4BRY B;  3H1I E;  3CWB E;  4K3A A;  1KOR A;  2OYO A;  3E1I A;  1ZN5 A;  3V2P A;  5HGM A;  1IC2 A;  4U0A A;  2KGE A;  2XZ0 D;  2B88 A;  2B89 A;  4NPE A;  1PPJ D;  4AYC A;  2JR8 A;  1BSH A;  2AXT E;  3H1H D;  2ITA A;  3H1L D;  1Q82 Q;  3RBZ A;  2FYU E;  4IZ6 A;  1NTK D;  1GU4 A;  2JP3 A;  1G2C A;  2N1T D;  1NAY A;  1FDI A;  4IL6 H;  3GZL A;  4PD4 H;  3VP8 A;  3O6Q B;  1UII A;  3H32 B;  3P8M C;  2H8P D;  3BRV B;  4YXD C;  3I56 P;  1OW6 A;  2KUB A;  3SSU A;  1LTG C;  3P8C D;  2FQ0 A;  2A45 G;  1RO0 A;  3U1C A;  2O01 H;  1WMK A;  2XKM A;  2L6E A;  1OZH A;  2WT7 A;  1KQF B;  1BCC E;  2CPS A;  2K0Y A;  2LTE A;  5APW A;  2P58 A;  5KP7 B;  1SQB E;  3WU2 H;  3V2N A;  1IFI A;  2KK7 A;  1FJK A;  1IK9 A;  2WSE H;  1LTB C;  2A45 H;  1J1E C;  1RY3 A;  4K35 A;  3FWL A;  1DD4 A;  1JUN A;  3KQG A;  3BVH A;  4GOF A;  1T8K A;  1T6A A;  2P2U A;  3GW6 A;  1J1E B;  2WPS A;  1RF1 A;  3AED C;  2GA1 A;  2LIU A;  1RH5 B;  1S9K D;  1VF5 D;  1USE A;  2YKO A;  2B87 A;  1W2B O;  4RES B;  4GDO A;  2L5G B;  1M56 D;  4UB6 H;  4HJG H;  3CXH E;  1CI6 A;  1FU1 A;  3W67 A;  1KIL A;  2VLN A;  3CXH H;  3C9I A;  1CZQ A;  3CCJ P;  4U7J A;  3MD0 A;  1LP1 B;  3D71 A;  5F2K A;  1ZNV A;  1KYO I;  2M8L A;  1PP9 G;  3KZI H;  1YIT P;  2JDI H;  1AVO A;  1PGJ A;  2BCC E;  3HE5 A;  3H47 A;  1ZRT D;  1VL2 A;  4XFX A;  2LF4 A;  1VQ7 P;  1OVU A;  3T97 A;  1HUC A;  4D6T E;  1DNY A;  2FFD C;  1OMI A;  1PFI A;  1JNM A;  4JPZ B;  2KI7 B;  3B8E B;  1H88 A;  3G3Z A;  2PEM A;  3L71 D;  4BXL A;  2FFD B;  3B5N C;  2JJL A;  4Y28 J;  1GW3 A;  5KLV E;  1W2E A;  5GTI E;  4DZO A;  4C46 A;  3RK3 B;  5KP6 B;  1FZE A;  1EZV E;  2CWO A;  3B5N B;  3KHU A;  3NTE A;  1LWU A;  2CPB A;  2WSE J;  3L70 J;  1D1D A;  4ZKU A;  3QH9 A;  1IUQ A;  2YMK A;  1KLP A;  1DX7 A;  1S72 P;  1CW5 A;  3NMD A;  1PGP A;  1S2E A;  3Q20 A;  4GR6 A;  1LTI C;  1EXI A;  2M8R A;  3I55 P;  1EMV A;  4I1L A;  3P05 A;  2QG4 A;  2XV5 A;  4EYY Q;  1BE3 D;  1R5S A;  3CX5 D;  1S5L X;  3JCU E;  3GHG C;  3L35 A;  5BU8 B;  1KYO H;  3CCS P;  3U43 A;  5CCH A;  1SQP J;  4PWV B;  2NPS C;  2YKP A;  1VQ5 P;  3M0A A;  1H89 A;  1EDJ A;  1VQO P;  1K04 A;  2ZXE B;  1SQV E;  5AW0 B;  1L0N E;  3TGU G;  1Q2N A;  2NPS B;  2WPR A;  1NTZ J;  1NWQ A;  1NU1 G;  2HPC A;  5E79 E;  2Y0E A;  2K9Y A;  2C9L Y;  1NTM J;  3D70 A;  2ZAE B;  4WY4 A;  4GOD A;  1AF8 A;  4XFZ A;  3LRY A;  2R5B A;  4L75 A;  3K5B A;  1AQ5 A;  4XE5 B;  1D7M A;  2LKM A;  3HD7 C;  1BGY D;  3GG2 A;  3MHV A;  2W8Z A;  4WBA A;  3BCC E;  2KLU A;  1NU1 E;  1JM0 A;  3MTU E;  1P84 D;  2XDJ A;  5KAI H;  2IBZ D;  2HFE D;  1JB0 J;  3HD7 B;  1KB9 H;  5AW4 B;  2O3J A;  1U7J A;  3KPE A;  3LIE A;  1PP9 J;  2W90 A;  1Q86 Q;  3JSV C;  2FAD A;  3Q5S A;  2WSC H;  3H1L J;  2SPZ A;  3L73 E;  3M91 A;  2YIU B;  2WQY C;  2Q6Q A;  3PTZ A;  2K0D X;  3GKL C;  2H43 A;  1OXZ A;  2QM7 A;  3L72 D;  1M7L A;  3B4S A;  1USD A;  4N78 D;  1JY2 P;  5CCG A;  3G4S P;  1E79 H;  2KOR A;  4ZNC A;  1JO5 A;  2FYZ A;  1AJY A;  2OYI C;  2MR8 A;  2L22 A;  3DS3 A;  3L75 G;  3H1K J;  5CJ0 A;  2A06 G;  3TK1 A;  3EJD A;  2K0X A;  1FZC A;  4YXW H;  1K05 A;  3P7K A;  2OYI B;  1A8O A;  4GKG A;  2IBZ I;  2YXQ B;  4H44 C;  1EDI A;  2MVV A;  1PEQ A;  2RN0 A;  1M90 Q;  1HQB A;  1S5L E;  2Q1K A;  2WSS H;  1NQ4 A;  1N2D C;  5KAF H;  5B5E E;  2JGP A;  3JC2 2;  4H44 B;  2K2Q A;  2PEO A;  1SQX J;  2PEK A;  2KOO A;  1S5L H;  3RK3 D;  2ZYG A;  3B5N D;  1JEK A;  1NH4 A;  3L74 J;  2W6B A;  4IFD K;  1FR2 A;  1NO4 A;  3HE4 B;  1ZP0 C;  1GMJ A;  4Y99 C;  5AW3 B;  3CD6 P;  1NOH A;  3QWO C;  3VTP C;  5AW2 B;  2YMY A;  5AVW B;  1NTZ K;  2V7Q H;  4HH2 A;  3RBX A;  2LXC B;  1YJW P;  1BDC A;  2KZI A;  1NTM K;  3RL0 B;  2KS1 B;  4HKZ H;  3GZM A;  4H13 B;  2KYV A;  1JY3 O;  2M3B A;  1RE3 C;  5F2O A;  3AE4 C;  3AEA C;  3AE9 C;  1UNK A;  3H1I D;  3CWB D;  3AE7 C;  2NPS D;  1N7S A;  1GDT A;  1OFC X;  4EOT A;  2PEN A;  2KGC A;  3PJS K;  2ZVN B;  2R5D A;  5M1B A;  1AYI A;  1X9V A;  5H2F H;  4IL6 X;  3P32 A;  2FYU D;  5TIS E;  3L71 J;  2N5H A;  1R8E A;  2VSQ A;  3CME P;  3CC2 P;  4ASV A;  2P10 A;  2M8P A;  3HD7 D;  1VF5 C;  4CA3 A;  2JYG A;  4XRQ A;  3WUV A;  2NZ2 A;  1OWA A;  1AA0 A;  3S4R A;  5CBN A;  1L0L J;  1K73 Q;  1JTH B;  5CZD B;  2PNG A;  3L75 J;  1BCC D;  2FHS C;  1SQQ G;  3DS0 A;  1SQB D;  1N73 B;  1AV1 A;  1E6J P;  1DEB A;  2K92 A;  3GHG A;  2AEJ A;  1L2P A;  1SQX K;  4N3Y B;  2OAR A;  2KSE A;  3TNU B;  5AW6 B;  2KB7 P;  5AVQ B;  1E5W A;  2BAS A;  1IJD B;  1KQS O;  1AQT A;  1AUM A;  2L9F A;  1Y47 A;  2OTJ P;  2FVE A;  2K5X A;  1GPJ A;  2JYL A;  3CCQ P;  2E74 B;  4H44 D;  5APQ A;  1ZOY C;  1S4X A;  4RO0 A;  2GUS A;  2Z45 A;  2QJK C;  4JQ0 D;  1IK7 A;  1VQM P;  2IPP A;  3USS A;  1VQL P;  1BGY J;  3H1J G;  5AVS B;  2R3C A;  2EFJ A;  2QVA A;  5BS2 A;  2QJK B;  3N7N A;  3ABV C;  1PGO A;  1K8A Q;  2N6Z A;  2OQQ A;  3N4X A;  3II6 A;  2BCC D;  4H0L C;  5AVX B;  3C1L A;  1M8O B;  2K88 A;  2JWD A;  3KYQ A;  2M5A B;  4IL6 E;  3RL0 D;  4PD4 E;  1YIJ P;  1M1J A;  4B86 A;  1IZN B;  4H13 D;  1Y9B A;  3B5I A;  1HJ0 A;  4D6T D;  2ERH A;  2KOS A;  1X22 A;  4H0L B;  2DW3 A;  2Q3I A;  3L72 J;  4U0E A;  2PY8 A;  2C9N Y;  5CBO A;  3L37 A;  3L70 G;  4DJG A;  2L4B A;  3EJE A;  1LTJ C;  1H0T B;  2Z5H A;  2R44 A;  3OAK A;  5DJU B;  2K9J B;  5KLV D;  3U1A A;  1X79 B;  3A2A A;  2VLQ A;  3WU2 E;  1LTJ B;  1L0L K;  1EZV D;  2Y9Y A;  4C7N A;  2RMZ A;  1MKM A;  5AW8 B;  1Q81 Q;  3R2P A;  4F37 A;  2KNC B;  3A0H H;  1GL2 C;  4GIF A;  3C8V A;  3G26 A;  5APS A;  1U7M A;  3I5C A;  2KOP A;  1SQQ J;  2K1A A;  1RO2 A;  2OYH B;  2FYN C;  3IAO A;  2BUO A;  4HKG A;  1SQP G;  2QA4 P;  2WPT A;  2P7J A;  1GL2 B;  1GZL A;  1FAV A;  1G1I A;  2IYO A;  1J2J B;  2FYN B;  2GUV A;  3DS4 A;  1NTZ G;  3MGN A;  2N1T A;  1NTM G;  4UB6 E;  5BS1 A;  4U3F G;  3HRN A;  2KG8 A;  2MF4 A;  2MR7 A;  2LPK A;  1SQV D;  1FZA A;  1HH0 A;  2KSJ A;  2Q3E A;  1L0N D;  3UIA A;  2RH0 A;  2JAZ A;  1QGK B;  4LLH A;  1EDL A;  3HUS C;  3WUU A;  1RE3 A;  3KZI E;  4U0B A;  5AVR B;  4AUW A;  2JKV A;  1PPJ G;  3HUS B;  2E76 C;  3H1L G;  3H1J J;  1JJ2 O;  3BCC D;  3CWB J;  1NU1 D;  1NTK G;  3OA7 A;  2FY8 A;  3HTK B;  4COC A;  2ZFC A;  3V2Q A;  1RF0 A;  1ZR2 A;  3G21 A;  5KP8 B;  2MKV A;  1OR5 A;  2E76 B;  3OW2 O;  2UWJ E;  1YQ3 C;  2E74 D;  1FZG A;  1PP9 E;  2V4H A;  2W27 A;  2BQ1 E;  1IFN A;  1VQ6 P;  2AFD A;  2FYU J;  1RE4 C;  3L73 D;  3SFE C;  3RK3 C;  4ZMD A;  1E0H A;  3Q5P A;  3H1K G;  2HLO A;  5DJT B;  2G3A A;  2PEI A;  3AE5 C;  2YXR B;  2K93 A;  1KIL E;  4JYC A;  3WUT A;  2JU1 A;  4JBZ A;  3KXD A;  3M9Q A;  5AW1 B;  5KJ7 C;  3LW5 H;  1IO4 A;  5APY A;  1BCC J;  3CCV P;  2AEM A;  4WVZ A;  3H1K E;  2IFN A;  1OVV A;  4C7R A;  1XTG B;  1SQX G;  4H0L D;  3TNU A;  1DV5 A;  4R0M A;  1SQB J;  2KOQ A;  1Z56 A;  3TYY A;  3MGE A;  1PEO A;  2Z4E A;  1KYO E;  3MZW B;  3CE7 A;  3L74 G;  1SQQ K;  3FXD A;  2IDB A;  1NVO A;  3AE1 C;  3PP5 A;  1FOS F;  5HGO A;  1UIX A;  1SQX E;  1NKZ B;  4PV1 C;  4M0I A;  3IF4 A;  5EFW B;  4I7Z C;  2R3S A;  2PEQ A;  5F2N A;  3AE8 C;  2VRS A;  3L74 E;  1PEM A;  5EJD A;  2WTY A;  3H0D A;  5BVZ A;  5K5G B;  4PV1 B;  1LT1 A;  1FDO A;  4BRY A;  1L4A C;  1NJI Q;  4I7Z B;  2QM8 A;  4U3F J;  3VP9 A;  5B66 E;  2OGU A;  2HR3 A;  1GL2 D;  2P67 A;  2E75 C;  3AEG C;  1L4A B;  5B66 H;  5KAI E;  3TGU E;  3NFQ A;  1LT9 B;  1URQ B;  1QL1 A;  1KB9 E;  1RQU A;  7CEI A;  2M5A A;  2KZJ A;  2E75 B;  4UHP B;  2IZ0 A;  3VYI A;  1VQK P;  2H89 C;  1MV8 A;  2D2C C;  1GD2 E;  2YIU C;  3CX5 I;  3B71 A;  4MRT C;  1DD3 A;  3O6Q A;  3AE2 C;  3H32 A;  1KD1 Q;  1SFC C;  3H1H J;  1IMQ A;  3G9R A;  1IFJ A;  1NTK J;  1ZR4 A;  1MZ8 A;  3L71 G;  2D2C B;  5KLI C;  2VLO A;  1EC5 A;  5AVT B;  2E1M A;  1QLE D;  1JY3 N;  3L36 A;  4D6T J;  2YO3 A;  3AE3 C;  2LKI A;  1SFC B;  4YTP C;  1YQ4 C;  2C0X A;  5KLI B;  3LW5 J;  3G1G A;  1L0L G;  1FJP A;  3L71 E;  1EIA A;  2PGD A;  1VQ4 P;  3TSI A;  2M3E A;  3WBH A;  5KLV J;  2E76 D;  1M1K Q;  5GTH H;  1X3O A;  1L0I A;  1YJ9 P;  1P84 I;  1L0L E;  2FQ1 A;  5KAF E;  3PRJ A;  2N98 A;  4RKU J;  2FXO A;  3L75 E;  2N50 A;  1SQB K;  2A06 E;  1H8A A;  3AEF C;  2IFM A;  1NKN A;  2W6J H;  1FOS E;  2PEJ A;  4XA4 A;  1QVF O;  1MUU A;  2JO1 A;  4DT0 A;  1KN7 A;  4TLF A;  1T8Z A;  1SQP K;  3RK2 C;  1DH3 A;  3VMA A;  3G29 A;  3RL0 C;  2M8N A;  2EG5 A;  1LP1 A;  4H2W C;  2ZYA A;  1HVV A;  4H13 C;  3FWN A;  4OGQ B;  5KJ7 D;  1YTZ I;  2XXM A;  3RK2 B;  1ZMB A;  1HWT C;  3L4F A;  1RF1 C;  1SQV J;  3CC4 P;  1FBM A;  1BGY G;  1L0N J;  2LL8 A;  4H2Y C;  1FZB A;  1A02 J;  1FZF A;  5APX A;  3S9O A;  4PH1 A;  4I2L C;  2JU2 A;  3CCU P;  1VPC A;  2IBZ G;  2WPQ A;  2QSI A;  1RF1 B;  4WWI A;  4R4L A;  2CG5 B;  3NY7 B;  5AW5 B;  1YI2 P;  2QE7 H;  2B9B A;  2B87 B;  3BCC J;  4PH0 A;  3RGU A;  1KIL C;  2BEZ F;  4JYB A;  4PV1 D;  2O01 N;  1UJZ A;  2FVA A;  2Z46 A;  2FFD A;  1CI6 B;  1PGQ A;  1SLQ A;  5H2F E;  1L0H A;  3LMO A;  2GDW A;  4MN4 C;  3L72 G;  3M0D C;  3LID A;  1KIL B;  5CJ4 A;  4BWN A;  3VMY A;  1NTK K;  1EXJ A;  4XRO A;  3CCL P;  1L4A D;  3L73 J;  3E1R A;  4PD4 D;  2R32 A;  3B5N A;  2OTL P;  1URQ D;  2JEE A;  1M6E X;  1HF9 A;  2E75 D;  1IFM A;  1JY2 O;  3HE5 B;  5APT A;  2ZJS E;  1LNQ A;  2J58 A;  3EWK A;  3IN6 A;  2KOD A;  3D6Y A;  2VLP A;  1YBK A;  1AFO A;  3T97 B;  4IFM A;  1N73 C;  2LXB A;  3U59 A;  2D2C D;  4PXH B;  5KKZ C;  4OWF A;  1R5L A;  1SFC D;  3PLN A;  4LGD E;  4W7Z A;  3R4Y A;  5CHX A;  2XV6 A;  1NYH A;  1HGV A;  5KKZ B;  1OW7 A;  4I6M C;  1LWU C;  1JMB A;  2RKL A;  1BE3 J;  2YKQ A;  2GDY A;  4DG9 A;  2WZ7 A;  4CPG A;  1K9M Q;  4EDF A;  3WMM 0;  1SQQ E;  4RJT A;  2NPS A;  3DTJ A;  1LWU B;  4EI2 A;  2QEX P;  2GZI A;  4PD4 I;  1Q7Y Q;  4PJ0 H;  4U0D A;  2E74 C;  4AQR D;  4QKO A;  1EDK A;  3A0B E;  3SWY A;  2IYP A;  5CCH C;  3A0B H;  3HD7 A;  1L0N K;  1PV3 A;  3CXH D;  2MJZ A;  3RG6 C;  3EJB A;  1VHN A;  3CWB G;  4Z1M H;  1VQ8 P;  1S1C X;  1KIL D;  4WY4 C;  1OIP A;  1KQG B;  1N7L A;  2O1J A;  4OGQ D;  3RK2 D;  2H7H A;  2HPC B;  3H1J E;  2FYU G;  3SWK A;  1WT6 A;  1BAJ A;  5L8R J;  4WY4 B;  3CLQ A;  4H2X C;  1U57 A;  4COP A;  2NO8 A;  1ZV8 A;  2AF8 A;  1YTZ T;  2KGA A;  1PP9 D;  4DOJ A;  2M5R A;  4L74 A;  1KV4 A;  2AXT H;  2OYI A;  3CXH I;  2WSF J;  1BCC G;  1LTA C;  2XND H;  1VQN P;  2K37 A;  2CGQ A;  4YPC A;  1KFN A;  1SQB G;  3A0H E; 
#chains in the Genus database with same CATH homology
 2E1M A;  2PEN A;  3CXC O;  1VQM P;  1Q82 Q;  4U0D A;  3CCJ P;  3HYB A;  3CCS P;  3DS4 A;  3CCV P;  1VQL P;  2EFJ A;  4U0F A;  1VQ5 P;  5F2K A;  3CPW O;  5BS2 A;  1YI2 P;  5HGL A;  1A8O A;  1YHQ P;  1N8R Q;  2M8L A;  1VQO P;  4PH0 A;  5BS1 A;  3G1G A;  3HZQ A;  3CME P;  1PEQ A;  3E2D A;  1YIT P;  3CC2 P;  3MGE A;  1M90 Q;  1PEO A;  2XT1 A;  1EIA A;  1VQ4 P;  1K30 A;  1K8A Q;  3CCE P;  2M8P A;  2Z46 A;  3H47 A;  3DS1 A;  3I56 P;  3G6E P;  3WBH A;  2JYG A;  4XRQ A;  3VRL C;  2DGY A;  1RO0 A;  2PEO A;  2Z44 A;  4XFX A;  1RNI A;  2PEK A;  3G71 P;  2L6E A;  2LF4 A;  3RG6 C;  1M1K Q;  4XFZ A;  1VQ7 P;  5HGO A;  3LRY A;  4XRO A;  1YIJ P;  3CC7 P;  4WYM A;  1K73 Q;  1YJN P;  3CCL P;  4U0B A;  4M0I A;  2EIA A;  1VQP P;  1YJ9 P;  3B5I A;  5DCK A;  2OTL P;  1M74 A;  1VQ8 P;  2PEQ A;  5F2N A;  1M6E X;  1PEM A;  1QVG O;  3CCR P;  4U0E A;  2PY8 A;  3DS0 A;  2P9X A;  4IPY A;  3H0D A;  3G1I A;  2PEM A;  4XFY A;  1JJ2 O;  3CD6 P;  1NJI Q;  2BHV A;  4COC A;  1PEU A;  2KOD A;  1BAJ A;  1E6J P;  3G21 A;  3DS5 A;  3G0V A;  1QRJ A;  3DS2 A;  4QNB A;  1VQ9 P;  1Q86 Q;  3OW2 O;  1YJW P;  4COP A;  3CCM P;  2PEJ A;  1QVF O;  4U0C A;  2CWO A;  2OAR A;  3NTE A;  2BQ1 E;  1D1D A;  1VQ6 P;  5JPA A;  1IUQ A;  1KC8 Q;  3H4E A;  3DPH A;  1Q81 Q;  3G29 A;  2XV6 A;  2M8N A;  5F2O A;  2EG5 A;  5I4T G;  1S72 P;  1KQS O;  1AUM A;  1A43 A;  3M1M A;  3G28 A;  1VQK P;  3G26 A;  3Q20 A;  4GR6 A;  4GR2 A;  2XXM A;  2OTJ P;  1ZMB A;  1W2B O;  3I55 P;  1RO2 A;  2PEI A;  3CC4 P;  1K9M Q;  3G4S P;  2JYL A;  1KD1 Q;  2ONT A;  5HGM A;  3P05 A;  4U0A A;  2QEX P;  2BUO A;  1M6N A;  5HGN A;  2QA4 P;  3CCQ P;  3CMA P;  1VQN P;  4PH1 A;  3DTJ A;  1EOQ A;  3CCU P;  2JO0 A;  3DS3 A;  1Q7Y Q;  2Z45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...