1S72P

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1s72P02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1s72P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1s72P03
1YITP 3CMAP 3CPWO 1S72P 2QEXP 1Q81Q 1VQ7P 3CC4P 1VQNP 3CC2P 1YI2P 3CCVP 3CCUP 1K9MQ 1JJ2O 3CCLP 1Q7YQ 1YJNP 3CCEP 3CC7P 2OTLP 3G6EP 3I55P 3CXCO 1KQSO 1K8AQ 1NJIQ 1KD1Q 3CMEP 1YJWP 3CCQP 1M90Q 1VQ4P 3CD6P 1VQ8P 3CCSP 1VQMP 3CCRP 1YHQP 1VQLP 1YJ9P 2OTJP 1VQPP 1W2BO 1VQ5P 3I56P 1QVGO 1K73Q 3G4SP 1QVFO 3OW2O 1Q82Q 1VQ6P 3G71P 1M1KQ 1Q86Q 1KC8Q 1VQ9P 3CCJP 1N8RQ 1VQKP 1VQOP 3CCMP 2QA4P 1YIJP
chains in the Genus database with same CATH superfamily
3H1HE 3G1GA 1M1JC 3M06A 5APSA 5BU8B 1LT9A 1IC2A 3D6YA 1KQGB 3A0HE 2N1TB 2BCCE 5H2FE 2GM4A 1CI6B 5CCGC 3L71D 4CA3A 2LOLA 2WVRA 2FFDC 1H0TA 2AVAA 5KLIC 3VOPA 3H1KG 1VQOP 4GR2A 2WPRA 2QM8A 2E1MA 4PD4H 1LT9B 2NZ2A 1DEEG 3A0BH 1QLED 3QWOC 3CWBJ 2H8PD 2E74B 3EFFK 2KGEA 2XU6A 3NTEA 2KNCB 2M5AB 3TDKA 3RK3E 4C7NB 3H1HJ 2LTEA 1KILE 1ZRTD 3CMEP 1BDCA 4I7ZB 3IR9A 1HVVA 1XTGB 1QVGO 3WU2H 4WWIA 1Q82Q 3Q20A 2Z5IA 2PENA 2QRXA 3HD7C 5B66E 1T6AA 3E1RA 2M5AA 4U3FE 1PIXA 4TT3H 3H1HD 1SQVE 2WPVB 4OWFA 1RO0A 2G8YA 3Q5PA 2E5YA 2XZ0D 2PY8A 5KP6B 1KD1Q 1M90Q 5EW5E 1PEUA 3CX5H 1A02J 1BGYG 4R4LA 4DOJA 2XV5A 1PV3A 2WSFH 3PLNA 1KYOH 1AYIA 2JEEA 2QA4P 1BE3E 3B4SA 2ZYAA 3GW6A 1P84H 2N6YA 1OMIA 4I1LA 2KI7B 2FACA 2OYHA 1HWTC 1GL2B 4U0BA 1L0HA 1W5CE 2Z5HA 1SQQJ 3VRLC 1KN7A 2ZT9D 3L72J 1M1KQ 1QX8A 2L0QA 2A06E 4DZOA 2O1JA 2K92A 1PPJD 3SWKA 2OYHB 1JMBA 1L0NJ 3FWNA 2LMLA 3P32A 2MKVA 3S9OA 3L73J 2YMYA 4NPEA 4U3FJ 2BCCD 5KKZB 4DCKA 2KOQA 1J2JB 1X9VA 2KSEA 1FZCB 4IL6X 2GZGA 1YQ3C 3PJSK 1YBKA 2KG8A 4C46A 2K9JA 1Y8AA 2WSEJ 5AVVB 2ZAEB 1P84D 1MZ8A 3L72D 3DS3A 1DIPA 2K0YA 2OGUA 2KXPB 3GMAA 2HG5D 2QJPB 2JU2A 3Q1MA 1E79H 1LTJA 1BE3D 2YO2A 1ZR4A 3PHLA 1EXIA 2K9JB 5CJ0A 1M7LA 4U0DA 1Y47A 1P84E 3HZQA 1PZQA 1G2CA 2J58A 4Z1MH 5KTBA 1NTMJ 2RH0A 1Q86Q 3A2AA 3AE2C 3EWKA 3GKLC 2JB0A 4AQRD 2IZ0A 1Q81Q 3M91A 3CI9A 2JJLA 5CCGA 1DX7A 1SQVK 1VKUA 1FZEA 3NTNA 2XZ1C 1Q2NA 2Y9YA 2MR7A 1UNKA 2OYHC 3H1IE 4PD4I 3L72G 4L76A 4ZKPA 1SS1A 3U59A 4PJ0H 2VLQA 3CCEP 5KAFH 4YTPC 3TYYA 2AEFA 2AFDA 4XRQA 3AEDC 1UIXA 2K88A 1RY3A 1FOSF 3TNUB 1NU1J 4F37A 5L8RJ 5B5EE 2KIKA 2JO1A 4MRTC 4H13C 3CD6P 2VRSA 1HH0A 2FYNC 3JCUH 3G0VA 3G29A 2FVFA 1YQ4C 3OW2O 3U1CA 1GW4A 1LT1A 1HBWA 1RO2A 4L73A 4H2YC 2W83C 4RJTA 3G3ZA 2WQYC 2M0BA 3MIWA 2M3EA 4I7ZC 3L75E 2IBZD 5AW5B 3H1IJ 4HKGA 2NPSC 2LL8A 2KB7P 3LIEA 3CWBG 2O01N 1NTZK 3RK3B 3VN0A 3GHGC 3V4QA 1FJPA 2KODA 2GUVA 3CPWO 3PH0A 5KLVG 3HTKA 3G26A 2FVAA 1ZMBA 2L9FA 2FHSC 3V2QA 2N9BA 1BCCJ 4H0LC 1NU1E 2O3JA 5CBNA 4U0FA 1N2DC 4CPGA 3DS2A 1OIPA 1KZUB 2KGDA 1R8EA 1NTZG 1ZOYC 2ITAA 3V2RA 1JY3N 1NTMK 2L6EA 1KLPA 1S5LE 1IFDA 3EJBA 2PAJA 2JGPA 1BGYD 1MKMA 1J1DB 4UB6H 4RO0A 3L71E 2K0XA 1D7MA 5CMZA 5B5EH 2R3SA 3BCCE 5CCHD 2C0WA 1M56D 3AE7C 2WSSH 3N7NA 2ERHA 4KJMA 1EIAA 3L4FA 2Q1KA 2HR3A 2D2CB 3II6A 2GZJA 4PJ0E 2WSCJ 2CQ8A 5TISE 3H1KD 1G2CB 1SQQG 3HUSC 3FGAD 5F2NA 1Z56A 1S9KE 2EHSA 4WYMA 5AVRB 1KQFB 5HV8A 3CE7A 4D6TE 3RGUA 1VF5B 3M9BA 1H88A 3TF5A 2GDYA 1RF0A 1IMPA 1PPJG 3T97B 2P2UA 4RKUJ 3H1LG 5JPAA 1HQBA 1J1EC 3CLQA 4JBZA 4H0LB 4H44D 3V2NA 1Y9BA 2E5TA 5BS1A 1JY3P 4GOEA 3GJNA 3MGEA 1VQNP 3AE6C 1ZW0A 2YIUB 1G1JA 3L71G 3S1KA 4A7PA 4UB6E 5APVA 1U57A 1DNYA 1NTKE 1JTHB 2WSCH 3RL0B 1GD2E 1LTSC 4XE5B 3E2DA 2Q3EA 3H1JD 2N1TD 1RE3A 4D6TJ 1Q7YQ 2PNGA 3DS5A 1NU1K 5AVWB 4XFYA 4LGDE 1GDTA 2K0DX 3NMDA 2A45I 2E43A 1NH4A 3AE3C 1RF1A 4KT0J 1NHLA 1VQ6P 3L37A 1NWQA 1DD4A 3B8EB 1JB0J 1N7LA 2FAEA 1L0LJ 4IFMA 1BCCD 1NGMB 1T2KD 4HYTB 3CC7P 1AUMA 1E0HA 5DCKA 1FDIA 1JM0A 3WUVA 2KORA 3WMM0 2FFDA 1S2EA 1QVFO 2WT7A 2KYVA 2AFEA 2LIWA 4IL6H 3P8CE 2P7JA 2C9LY 3RK3D 3B5NA 2FYNB 2AXTE 3AE4C 1PEMA 4GT1A 2PGDA 1W2EA 2FFDB 1FDMA 4U0CA 3MP7B 4COCA 1X22A 3BASA 1OW8A 2DW3A 4ZMDA 2JO0A 3QH9A 1LGHB 4H2WC 2QJYB 4I2LC 2KWLA 4EYYQ 2ZYDA 1F80D 5M1BA 2KG6A 1JUNA 3VMAA 1IFJA 1H8AA 4H2XC 1LJ2A 4JPZB 3IN6A 3N4XA 3HD7A 4RESB 1EDIA 3RK2D 3AEGC 3HUSB 3DTJA 2Y9ZA 2XXMA 5GTIE 1A02F 4XROA 1QRJA 4D6TG 3DS1A 1EZVG 1NVOA 1KILA 3FX0A 5CCGD 1NTMG 5EJDA 2D2CD 1SQQE 4WBAA 3E1IA 2KGAA 2M3BA 3KQGA 1YITP 5CBOA 5HGMA 3A0BE 2QJKB 1HY8A 3R2PA 2RMZA 3WUTA 5KP7B 1H89A 3GHGB 3EQ2A 3CCQP 2JWDA 2ZYGA 5CJ4A 1NTKG 3LMOA 1SQVJ 4GR6A 5AVTB 3H4EA 1NTMD 2YXRB 1MFTA 1JNMA 3A0HH 5H2FH 1RH5B 2WSEH 5AW8B 3WBHA 2NRGA 2JP3A 2B89A 2JKVA 3C8VA 3GHGA 1BDDA 4WB4A 1LTGC 2FYZA 4BPFA 3BVHA 2YMKA 3RG6C 3CXHE 2K37A 2LPKA 1PEOA 2GZIA 2KUBA 2KW2A 3V2PA 2N6ZA 2VLNA 2KS1B 2Z4EA 1LTIC 1L4AC 2N9YB 1SQPG 1SQXD 1VQPP 3D6ZA 2AF8A 3CXHD 1JMMA 1RE4C 2QSIA 3A3YB 2MD9A 1AA0A 1LWUA 1SLQA 2FBWC 1BCCE 2ONTA 4PV1C 1OFCX 2FKWB 2KS1A 1E5WA 4XA4A 4GIFA 1S5LX 2OYOA 2PP6A 2J5UA 3H1LD 1BXIA 1WMKA 2K1AA 1S1CX 5HGOA 3LIDA 2P10A 3GF3A 1VQMP 1OR5A 1TU3F 3O8ZA 1N7SC 2W6BA 1M1JB 2H89C 3BCCD 1RQUA 1EOQA 3BATA 3L75J 3B5NB 4L75A 3CCUP 1RE4A 1DH3A 1PL5A 2VLPA 3MHVA 1UIIA 3SWYA 1USDA 4DG9A 1AV1A 3W68A 3L74D 3TGUJ 3VMZA 3DS0A 1GK6A 1DV5A 2N50A 5APYA 3HE4A 3RL0C 1KYOD 1NTME 1VHNA 3W67A 1VQ5P 4XFZA 3O6QA 2XZRA 3KPEA 5E79H 3H1KE 4XFJA 1KFNA 3TGUD 1RF1C 3MGNA 3R4YA 4BWNA 1JO5A 2YNYA 2MF4A 2E76C 2IBZG 3CX5I 7CEIA 2VLOA 5I4TG 1FJKA 2O1KA 4WY4B 3D71A 4PV1B 3L70D 2AEJA 4PD4E 4QMAA 1CSBA 1ACPA 1IMQA 4OGQD 3H1JE 3OAKA 4COPA 1JEKA 2W27A 3RL0D 1PP9E 2E76D 1LNQA 4NPFX 2E74D 2K2QA 1YTZI 1L0IA 3H1LJ 2HODA 3TK1A 1IFPA 1EQ7A 5AW2B 3G71P 2R3CA 1QGKB 1URQD 2CPSA 2IBZE 1GL2C 2B87B 2JAZA 5GTHE 3I55P 1CEIA 2IBZI 5BVZA 1IUQA 1S5LH 2EHTA 5AVXB 1MFZA 2HODB 4R4MA 2K5XA 3P8MC 3VP8A 3AEEC 1M57D 1GXGA 1SQXG 2HFED 2IFMA 5C39A 1OWAA 1L0NK 1VQ7P 3NXSA 3H1IG 4JYBA 3AE8C 4W7YA 1EDJA 1ZNVA 3JCUE 2C9NY 4IZ6A 3S4RA 5APQA 4N3YB 5APUA 3L73G 3D70A 1NO4A 2KR5A 1GU4A 1VF5D 2Z44A 3CCJP 1SFCD 1YYCA 2WITA 2ZVOB 1LTAC 3AECC 3NFQA 2M8LA 3V5BA 4YXDC 2WPTA 1L0NE 3Q2YA 1Q90D 3CCSP 5KAFE 3Q3DA 5AW3B 4L74A 1BGYE 3BRVB 2XNDH 4EIJA 2RN0A 5DJTB 4OGQC 2K9YA 4JF7A 3PTZA 3F89A 1SQBK 2WTYA 1JOCA 2GDXA 1DEBA 2PEQA 3VYIA 2FQ0A 2KG9A 1BE3J 3RK2B 2KP8A 2V7QJ 3FWLA 3KHUA 4HB1A 2Y0EA 3MTUE 5AW6B 1N7SD 3H1ID 1GPJA 4H13B 2H43A 1QL2A 2NPSA 5KAIE 1LT9C 2FXOA 2NO8A 3SSUA 1KYOI 4QNBA 3KYQA 1GL2A 1SQBG 2OTLP 2EFJA 5AW4B 5GTIH 3HE4B 3Q5SA 2R5DA 2WMMA 2QM7A 4B86A 1KB9H 1SQBE 2HLOA 1J1EB 1RNIA 3GG2A 3O6QB 1JCDA 2BCCJ 3NY7B 3VTPC 1S3JA 2OTKE 1OW6A 3AEBC 2RKLA 2E75C 1VDFA 4QKOA 1L4AD 5TJHA 5KJ7A 1BAJA 1FU1A 2D2CC 2KLVA 3IAOA 3L70E 1YJWP 4IPYA 1BSNA 3CCRP 2FYUJ 4U3FG 3HE5B 4W80A 2GUSA 1M6NA 1SQBD 3G21A 2VSQA 2LXBA 1NQ4A 2FADA 1NU1G 2A45H 1KTMA 2BASA 4PV1D 1A43A 1PP9G 3H1HG 1J1DC 3LW5J 1NTKJ 1VQ8P 4WVZA 2FY8A 2LR2A 1SQVG 2FXPA 1BSHA 1H0TB 3HRNA 1EZVE 1NYHA 3M0DC 1KC8Q 2DNWA 1IFIA 4PH1A 4BRYA 2V7QH 2FYUK 3GF7A 1JY2O 2WPSA 5BU5A 1NKNA 1FOSE 5CCHA 3CX5D 1NAYA 3KDPB 1X0TA 2KZIA 2BUOA 3M1MA 2KNCA 2YO3A 5EFWB 4Y99B 4C7NA 1L0LG 2FYUE 2XV6A 2KOPA 4M0IA 3B5ND 1S4XA 3CL3D 4BXLA 2V4HA 1U7JA 4NEOA 3L74J 1QL1A 2BCCG 3KZIH 2BQ1E 2DGYA 3GLMA 5DJUB 1T8ZA 3B5NC 3WU2E 2OYIC 3AE9C 2YIUC 3B5IA 1L0LK 2EG5A 2WSFJ 3L72E 1LP1A 2JBGA 1VQLP 2Q6QA 1KYOE 2IFNA 3TNUA 3L70G 2I8DA 2FYUD 1R5LA 3CX5E 1ZRTE 2PFXA 2ZXEB 1FAVA 2ZXXA 1PPJE 2GYKA 1FZGA 5KLVK 2JYLA 1SVFA 3TSIA 1KQSO 2A06D 2O01H 1LP1B 2OYIB 4U7JA 2I1JA 3RBXA 5TISH 4YPCA 1NTZJ 2ZFCA 2ZT9B 2O01J 3CC4P 5HGNA 1RE3C 5AW9B 4OGQB 1T2KC 1PGOA 2XDJA 1OX3A 1MV8A 2OYIA 1K8AQ 1PFIA 1YTZT 2PEIA 2E76B 1GMJA 4Y99C 2GZFA 1K05A 1QEXA 2WPQA 1R5SA 1NKZB 5APWA 4IFFA 3CCMP 3HTKB 3M0AA 4H44C 1YI2P 1JY2N 3F5HA 5BS2A 3SFEC 2E74C 1HF9A 1AJYA 2KOSA 1L0LE 2AXCA 3L73E 3EFGA 3I56P 2QG4A 2W6JH 1KILC 3C9IA 1L0LD 2AXTH 4DJGA 1IFNA 1SQVD 2B9BA 2YKPA 1X8YA 1LTJB 4IL6E 2KOGA 1MZ9A 1FE6A 3G9RA 4H0LD 3T97A 5AVZB 2HPCB 3RBZA 1EZVD 2OTJP 3B71A 2Z45A 1X79B 3H1JJ 1RHZB 1GTWA 1GXHA 3CXHI 2MVVA 2PEMA 2P9XA 2IPPA 4BRYB 1FR2A 2A06G 3BCCG 3CCVP 3OA7A 1SQBJ 2GA1A 2M8PA 4M3LA 2HPCA 1YHQP 1Z6MA 5F2KA 2IDBA 1JTHA 1SQXJ 2JR8A 1VQKP 1SFCC 4OVNF 1T3JA 3CMAP 3H0DA 4WY4C 3VMYA 4UHPB 2YXQB 1JY2P 2I1KA 2H7HA 1ZN5A 2J59M 1DD3A 1P84I 4U3FD 1FZBA 2OARA 1D1DA 5AVQB 1L0ND 2ZJSE 2WWWA 5KLVE 3E7KA 3H32A 2BHVA 1N7SB 1T3UA 4Y28J 3L36A 2LKIA 1XTCC 4H13D 2R44A 3CXCO 4GODA 2IYOA 1HUCA 4GKGA 2C0XA 3H1LE 1KFMA 2KK7A 5KP8B 1JY3O 2PEOA 1N7SA 1LTJC 2NPSD 2X2BA 5AVSB 1NTKD 2FXMA 3RG2A 1VPCA 1L4AB 1BGYJ 4PD4D 1NTZD 2BEQD 4JYCA 1EDKA 5E79E 1HGZA 4DT0A 2CPBA 1ZLLA 2N5IA 4I6MC 1EXJA 3RK3C 5KLVJ 1G1IA 2AEMA 1AF8A 2N5HA 1IK7A 3UIAA 1IZNB 1PP9D 3ITKA 3A5TA 4GOFA 1L4AA 3A7OA 2Q9IA 3V6IA 3KZIE 1K73Q 3U43A 1SFCB 4EOTA 1M74A 1OVUA 1VQ9P 4EDFA 3ABVC 3MUDA 2POHA 3AEAC 3P05A 2FVEA 2IZ1A 2B88A 2LKMA 1K30A 2IX7C 2SPZA 1KILB 1VQ4P 2P67A 2KGCA 3C1LA 1L2PA 1SQXE 3GZMA 1SQPE 3P8CD 3CXHH 3H6PA 1AQTA 1BCCG 2QJPC 1SQQD 1PGJA 3CWBE 1KORA 1OXZA 3HD7B 1NTKK 1EMVA 4ZNCA 3HUSA 3DPHA 3AE1C 3USSA 3L74E 3CC2P 2L5GB 2XKMA 2E75D 1YJNP 2QE7H 2QIWA 2BEZF 2Y0CA 3TGUE 3IF4A 1N73B 2LXCB 3G4SP 2A45G 3L35A 4W7ZA 2E42A 1GZLA 1E6JP 2JDIH 1RF1B 3EJDA 1FBMA 4ASWA 2WZ7A 3MZWB 2N98A 1RF0C 1WRGA 2R32A 1PGQA 1N73A 2CGQA 2UWJE 3AE5C 3LRYA 3L74G 1ZMEC 4GDOA 4N6JA 2ZT9C 1SQPK 4HH2A 3VMXA 3H32B 4R0MA 3ZDMA 3OJAB 1YJ9P 1KB9E 2YKOA 4AUWA 2H88C 2N1TC 3I5CA 1IJDB 3CWBD 1HJ0A 2YKQA 1FDOA 1M8OB 3MD0A 1U7MA 3VP9A 1ZP0C 1FZCC 4N78E 4IFDK 1ZXGA 1T8KA 1N8RQ 3EJEA 4U0AA 5KKZC 5APXA 1ZV8A 2M5RA 1PGPA 3L75G 1MUUA 3V4WA 1N86A 1K9MQ 3CCLP 1ZR2A 1LTBC 2HYNA 3M0DA 2CG5B 1M6EX 2W90A 2IYPA 1VL2A 3LW5H 1FC2C 2EIAA 2WT7B 3H1KJ 2L22A 2ZVNB 2GDWA 2JYGA 2K3RA 4EI2A 1KB9I 3FXDA 3G6EP 4JQ0D 4K3AA 1SP4A 1HJBA 1FZFA 1SFCA 2FYUG 2Z46A 1IO4A 2LIUA 2QNWA 1NTZE 2PEKA 5AW7B 2CNRA 1S72P 2R5BA 1PP9J 1KQLA 1URQC 5CHXA 4WY4D 5KLIB 1NJIQ 5KLVD 1SQPD 1URQA 1RQVA 3HYBA 1GK4A 2W6AA 5AVUB 3P7KA 1X3OA 4PWVB 3PRJA 1EDLA 2KLUA 2MR8A 2JU1A 2CK3H 3RK2C 1AQ5A 5CZDB 4BPHA 2M8RA 2P58A 1OVRA 1EC5A 5AVYB 2KSJA 4LLHA 1CI6A 1URQB 2QJKC 4TLFA 5AW1B 3FXEA 4LC1A 3BCCJ 3B4QA 3HD7D 2QEXP 1OVVA 4D6TD 1FS0E 2B87A 2MJZA 1KB9D 4UB8H 1HGVA 3MUDC 3G1IA 4U0EA 1KMIZ 4ASVA 2E75B 3H25A 2GZEA 4HJGH 2QVAA 4N78D 3DS4A 1LWUB 1GW3A 3KXDA 5KJ7D 2JWAA 5B66H 5HGLA 1K04A 5K5GB 1SQXK 2K94A 1GU5A 1L0NG 1CZQA 1OZHA 1A8OA 4K35A 1CW5A 2KZJA 1NU1D 5APTA 1JCCA 1M1JA 3L70J 5KAIH 3K5BA 2FQ2A 4PXHB 1SQQK 2W8ZA 3L71J 4XFXA 1KV4A 3WUUA 4OH8B 1VF5C 1NOHA 2L91A 1GL2D 2XNXA 4YXWH 3BRTB 3PP5A 3TGUG 4C7RA 2Y0DA 2M8NA 1AVOA 4UB8E 1LTTC 3Q5RA 2FQ1A 1BE3G 3RL0g 2Q3IA 4PH0A 2OQQA 4IOIH 1S9KD 1W2BO 3M9HA 2Q7CA 1PEQA 5CCHC 1KILD 4O9BA 1WT6A 3M9QA 2MY5A 1IK9A 1YIJP 2P1JA 4HKZH 3U1AA 3GZLA 1SQPJ 1LWUC 1IFMA 2LF4A 1UJZA 3IFMA 4KHXA 2L4BA 2CWOA 1AVYA 4WY4A 5F2OA 1N73C 2Q5UA 1EZVI 1OW7A 3H47A 5HVCA 2KOOA 4MN4C 4NPDA 5AW0B 2XT1A 3JC22 5KJ7C 1AFOA 2MVUA 1FZCA 3SWFA 1NAFA 3JSVC 2K93A 2PEJA 4H44B 1FZAA 1JJ2O 2ROQA 4ZKUA 1USEA 1HTLC 2QJYC 2N1TA 3SFDC 3HE5A 5GTHH 2G3AA 4AYCA 2PRRA 3L73D 4BPGA 3H1JG 3G28A 3L75D 2JQ4A 2NPSB 3AEFC
chains in the Genus database with same CATH topology
1A43A 3G1GA 5BS1A 2JO0A 1S72P 1Q81Q 3G26A 3MGEA 1VQNP 3CCVP 1ZMBA 4U0BA 2JYLA 2M8LA 4XFXA 1KQSO 2M8PA 1NJIQ 5I4TG 1VQ8P 3CCSP 3LRYA 1YHQP 1VQPP 4U0FA 3HYBA 1K73Q 3VRLC 5F2KA 3DS2A 1M74A 1M1KQ 1KC8Q 1VQ9P 1VQKP 1VQOP 4GR2A 2ONTA 2L6EA 4PH1A 3E2DA 4COPA 1YJ9P 3DTJA 3CMAP 2E1MA 5HGNA 2XXMA 3H0DA 3P05A 2M8NA 3CC4P 2PEQA 4XROA 1Q7YQ 1QRJA 3CCEP 3DS5A 3DS1A 1K30A 1K8AQ 5HGOA 4XFYA 1VQ4P 2OARA 2PEIA 4PH0A 1D1DA 1VQMP 4XRQA 1W2BO 1PEQA 1VQ6P 3G71P 2BUOA 1EOQA 2BHVA 1N8RQ 3M1MA 3CCMP 3NTEA 4U0AA 1YIJP 1YITP 5HGMA 2QEXP 1EIAA 4QNBA 3CCUP 1YI2P 1K9MQ 3CCLP 2XV6A 3CC7P 2OTLP 2EFJA 1AUMA 3G1IA 3I55P 4M0IA 3CXCO 5BS2A 4U0EA 2LF4A 1IUQA 5DCKA 1M6EX 3CCQP 3CMEP 3CD6P 1RNIA 3G0VA 3G29A 3DS3A 2CWOA 3I56P 1QVGO 5F2OA 5F2NA 3OW2O 1QVFO 2EIAA 3DS4A 4GR6A 1Q82Q 3Q20A 3H47A 2PENA 3H4EA 1RO2A 2XT1A 4WYMA 2JYGA 3DPHA 2BQ1E 2PEOA 5HGLA 2DGYA 3DS0A 3WBHA 1VQ7P 2PEJA 3CC2P 1PEMA 1RO0A 1JJ2O 1YJNP 3G6EP 1BAJA 3B5IA 2EG5A 2PY8A 4U0DA 1A8OA 1KD1Q 1YJWP 1M90Q 4IPYA 1PEUA 4U0CA 3CCRP 3HZQA 1VQLP 4COCA 2OTJP 1VQ5P 4XFZA 5JPAA 2Z45A 3G4SP 1M6NA 2Z46A 3RG6C 1E6JP 3G21A 2Z44A 3G28A 2PEMA 1Q86Q 2P9XA 2KODA 3CCJP 1PEOA 2PEKA 3CPWO 2QA4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  3CMA P;  3CPW O;  1S72 P;  2QEX P;  1Q81 Q;  1VQ7 P;  3CC4 P;  1VQN P;  3CC2 P;  1YI2 P;  3CCV P;  3CCU P;  1K9M Q;  1JJ2 O;  3CCL P;  1Q7Y Q;  1YJN P;  3CCE P;  3CC7 P;  2OTL P;  3G6E P;  3I55 P;  3CXC O;  1KQS O;  1K8A Q;  1NJI Q;  1KD1 Q;  3CME P;  1YJW P;  3CCQ P;  1M90 Q;  1VQ4 P;  3CD6 P;  1VQ8 P;  3CCS P;  1VQM P;  3CCR P;  1YHQ P;  1VQL P;  1YJ9 P;  2OTJ P;  1VQP P;  1W2B O;  1VQ5 P;  3I56 P;  1QVG O;  1K73 Q;  3G4S P;  1QVF O;  3OW2 O;  1Q82 Q;  1VQ6 P;  3G71 P;  1M1K Q;  1Q86 Q;  1KC8 Q;  1VQ9 P;  3CCJ P;  1N8R Q;  1VQK P;  1VQO P;  3CCM P;  2QA4 P;  1YIJ P; 
#chains in the Genus database with same CATH topology
 3H1H E;  3G1G A;  1M1J C;  3M06 A;  5APS A;  5BU8 B;  1LT9 A;  1IC2 A;  3D6Y A;  1KQG B;  3A0H E;  2N1T B;  2BCC E;  5H2F E;  2GM4 A;  1CI6 B;  5CCG C;  3L71 D;  4CA3 A;  2LOL A;  2WVR A;  2FFD C;  1H0T A;  2AVA A;  5KLI C;  3VOP A;  3H1K G;  1VQO P;  4GR2 A;  2WPR A;  2QM8 A;  2E1M A;  4PD4 H;  1LT9 B;  2NZ2 A;  1DEE G;  3A0B H;  1QLE D;  3QWO C;  3CWB J;  2H8P D;  2E74 B;  3EFF K;  2KGE A;  2XU6 A;  3NTE A;  2KNC B;  2M5A B;  3TDK A;  3RK3 E;  4C7N B;  3H1H J;  2LTE A;  1KIL E;  1ZRT D;  3CME P;  1BDC A;  4I7Z B;  3IR9 A;  1HVV A;  1XTG B;  1QVG O;  3WU2 H;  4WWI A;  1Q82 Q;  3Q20 A;  2Z5I A;  2PEN A;  2QRX A;  3HD7 C;  5B66 E;  1T6A A;  3E1R A;  2M5A A;  4U3F E;  1PIX A;  4TT3 H;  3H1H D;  1SQV E;  2WPV B;  4OWF A;  1RO0 A;  2G8Y A;  3Q5P A;  2E5Y A;  2XZ0 D;  2PY8 A;  5KP6 B;  1KD1 Q;  1M90 Q;  5EW5 E;  1PEU A;  3CX5 H;  1A02 J;  1BGY G;  4R4L A;  4DOJ A;  2XV5 A;  1PV3 A;  2WSF H;  3PLN A;  1KYO H;  1AYI A;  2JEE A;  2QA4 P;  1BE3 E;  3B4S A;  2ZYA A;  3GW6 A;  1P84 H;  2N6Y A;  1OMI A;  4I1L A;  2KI7 B;  2FAC A;  2OYH A;  1HWT C;  1GL2 B;  4U0B A;  1L0H A;  1W5C E;  2Z5H A;  1SQQ J;  3VRL C;  1KN7 A;  2ZT9 D;  3L72 J;  1M1K Q;  1QX8 A;  2L0Q A;  2A06 E;  4DZO A;  2O1J A;  2K92 A;  1PPJ D;  3SWK A;  2OYH B;  1JMB A;  1L0N J;  3FWN A;  2LML A;  3P32 A;  2MKV A;  3S9O A;  3L73 J;  2YMY A;  4NPE A;  4U3F J;  2BCC D;  5KKZ B;  4DCK A;  2KOQ A;  1J2J B;  1X9V A;  2KSE A;  1FZC B;  4IL6 X;  2GZG A;  1YQ3 C;  3PJS K;  1YBK A;  2KG8 A;  4C46 A;  2K9J A;  1Y8A A;  2WSE J;  5AVV B;  2ZAE B;  1P84 D;  1MZ8 A;  3L72 D;  3DS3 A;  1DIP A;  2K0Y A;  2OGU A;  2KXP B;  3GMA A;  2HG5 D;  2QJP B;  2JU2 A;  3Q1M A;  1E79 H;  1LTJ A;  1BE3 D;  2YO2 A;  1ZR4 A;  3PHL A;  1EXI A;  2K9J B;  5CJ0 A;  1M7L A;  4U0D A;  1Y47 A;  1P84 E;  3HZQ A;  1PZQ A;  1G2C A;  2J58 A;  4Z1M H;  5KTB A;  1NTM J;  2RH0 A;  1Q86 Q;  3A2A A;  3AE2 C;  3EWK A;  3GKL C;  2JB0 A;  4AQR D;  2IZ0 A;  1Q81 Q;  3M91 A;  3CI9 A;  2JJL A;  5CCG A;  1DX7 A;  1SQV K;  1VKU A;  1FZE A;  3NTN A;  2XZ1 C;  1Q2N A;  2Y9Y A;  2MR7 A;  1UNK A;  2OYH C;  3H1I E;  4PD4 I;  3L72 G;  4L76 A;  4ZKP A;  1SS1 A;  3U59 A;  4PJ0 H;  2VLQ A;  3CCE P;  5KAF H;  4YTP C;  3TYY A;  2AEF A;  2AFD A;  4XRQ A;  3AED C;  1UIX A;  2K88 A;  1RY3 A;  1FOS F;  3TNU B;  1NU1 J;  4F37 A;  5L8R J;  5B5E E;  2KIK A;  2JO1 A;  4MRT C;  4H13 C;  3CD6 P;  2VRS A;  1HH0 A;  2FYN C;  3JCU H;  3G0V A;  3G29 A;  2FVF A;  1YQ4 C;  3OW2 O;  3U1C A;  1GW4 A;  1LT1 A;  1HBW A;  1RO2 A;  4L73 A;  4H2Y C;  2W83 C;  4RJT A;  3G3Z A;  2WQY C;  2M0B A;  3MIW A;  2M3E A;  4I7Z C;  3L75 E;  2IBZ D;  5AW5 B;  3H1I J;  4HKG A;  2NPS C;  2LL8 A;  2KB7 P;  3LIE A;  3CWB G;  2O01 N;  1NTZ K;  3RK3 B;  3VN0 A;  3GHG C;  3V4Q A;  1FJP A;  2KOD A;  2GUV A;  3CPW O;  3PH0 A;  5KLV G;  3HTK A;  3G26 A;  2FVA A;  1ZMB A;  2L9F A;  2FHS C;  3V2Q A;  2N9B A;  1BCC J;  4H0L C;  1NU1 E;  2O3J A;  5CBN A;  4U0F A;  1N2D C;  4CPG A;  3DS2 A;  1OIP A;  1KZU B;  2KGD A;  1R8E A;  1NTZ G;  1ZOY C;  2ITA A;  3V2R A;  1JY3 N;  1NTM K;  2L6E A;  1KLP A;  1S5L E;  1IFD A;  3EJB A;  2PAJ A;  2JGP A;  1BGY D;  1MKM A;  1J1D B;  4UB6 H;  4RO0 A;  3L71 E;  2K0X A;  1D7M A;  5CMZ A;  5B5E H;  2R3S A;  3BCC E;  5CCH D;  2C0W A;  1M56 D;  3AE7 C;  2WSS H;  3N7N A;  2ERH A;  4KJM A;  1EIA A;  3L4F A;  2Q1K A;  2HR3 A;  2D2C B;  3II6 A;  2GZJ A;  4PJ0 E;  2WSC J;  2CQ8 A;  5TIS E;  3H1K D;  1G2C B;  1SQQ G;  3HUS C;  3FGA D;  5F2N A;  1Z56 A;  1S9K E;  2EHS A;  4WYM A;  5AVR B;  1KQF B;  5HV8 A;  3CE7 A;  4D6T E;  3RGU A;  1VF5 B;  3M9B A;  1H88 A;  3TF5 A;  2GDY A;  1RF0 A;  1IMP A;  1PPJ G;  3T97 B;  2P2U A;  4RKU J;  3H1L G;  5JPA A;  1HQB A;  1J1E C;  3CLQ A;  4JBZ A;  4H0L B;  4H44 D;  3V2N A;  1Y9B A;  2E5T A;  5BS1 A;  1JY3 P;  4GOE A;  3GJN A;  3MGE A;  1VQN P;  3AE6 C;  1ZW0 A;  2YIU B;  1G1J A;  3L71 G;  3S1K A;  4A7P A;  4UB6 E;  5APV A;  1U57 A;  1DNY A;  1NTK E;  1JTH B;  2WSC H;  3RL0 B;  1GD2 E;  1LTS C;  4XE5 B;  3E2D A;  2Q3E A;  3H1J D;  2N1T D;  1RE3 A;  4D6T J;  1Q7Y Q;  2PNG A;  3DS5 A;  1NU1 K;  5AVW B;  4XFY A;  4LGD E;  1GDT A;  2K0D X;  3NMD A;  2A45 I;  2E43 A;  1NH4 A;  3AE3 C;  1RF1 A;  4KT0 J;  1NHL A;  1VQ6 P;  3L37 A;  1NWQ A;  1DD4 A;  3B8E B;  1JB0 J;  1N7L A;  2FAE A;  1L0L J;  4IFM A;  1BCC D;  1NGM B;  1T2K D;  4HYT B;  3CC7 P;  1AUM A;  1E0H A;  5DCK A;  1FDI A;  1JM0 A;  3WUV A;  2KOR A;  3WMM 0;  2FFD A;  1S2E A;  1QVF O;  2WT7 A;  2KYV A;  2AFE A;  2LIW A;  4IL6 H;  3P8C E;  2P7J A;  2C9L Y;  3RK3 D;  3B5N A;  2FYN B;  2AXT E;  3AE4 C;  1PEM A;  4GT1 A;  2PGD A;  1W2E A;  2FFD B;  1FDM A;  4U0C A;  3MP7 B;  4COC A;  1X22 A;  3BAS A;  1OW8 A;  2DW3 A;  4ZMD A;  2JO0 A;  3QH9 A;  1LGH B;  4H2W C;  2QJY B;  4I2L C;  2KWL A;  4EYY Q;  2ZYD A;  1F80 D;  5M1B A;  2KG6 A;  1JUN A;  3VMA A;  1IFJ A;  1H8A A;  4H2X C;  1LJ2 A;  4JPZ B;  3IN6 A;  3N4X A;  3HD7 A;  4RES B;  1EDI A;  3RK2 D;  3AEG C;  3HUS B;  3DTJ A;  2Y9Z A;  2XXM A;  5GTI E;  1A02 F;  4XRO A;  1QRJ A;  4D6T G;  3DS1 A;  1EZV G;  1NVO A;  1KIL A;  3FX0 A;  5CCG D;  1NTM G;  5EJD A;  2D2C D;  1SQQ E;  4WBA A;  3E1I A;  2KGA A;  2M3B A;  3KQG A;  1YIT P;  5CBO A;  5HGM A;  3A0B E;  2QJK B;  1HY8 A;  3R2P A;  2RMZ A;  3WUT A;  5KP7 B;  1H89 A;  3GHG B;  3EQ2 A;  3CCQ P;  2JWD A;  2ZYG A;  5CJ4 A;  1NTK G;  3LMO A;  1SQV J;  4GR6 A;  5AVT B;  3H4E A;  1NTM D;  2YXR B;  1MFT A;  1JNM A;  3A0H H;  5H2F H;  1RH5 B;  2WSE H;  5AW8 B;  3WBH A;  2NRG A;  2JP3 A;  2B89 A;  2JKV A;  3C8V A;  3GHG A;  1BDD A;  4WB4 A;  1LTG C;  2FYZ A;  4BPF A;  3BVH A;  2YMK A;  3RG6 C;  3CXH E;  2K37 A;  2LPK A;  1PEO A;  2GZI A;  2KUB A;  2KW2 A;  3V2P A;  2N6Z A;  2VLN A;  2KS1 B;  2Z4E A;  1LTI C;  1L4A C;  2N9Y B;  1SQP G;  1SQX D;  1VQP P;  3D6Z A;  2AF8 A;  3CXH D;  1JMM A;  1RE4 C;  2QSI A;  3A3Y B;  2MD9 A;  1AA0 A;  1LWU A;  1SLQ A;  2FBW C;  1BCC E;  2ONT A;  4PV1 C;  1OFC X;  2FKW B;  2KS1 A;  1E5W A;  4XA4 A;  4GIF A;  1S5L X;  2OYO A;  2PP6 A;  2J5U A;  3H1L D;  1BXI A;  1WMK A;  2K1A A;  1S1C X;  5HGO A;  3LID A;  2P10 A;  3GF3 A;  1VQM P;  1OR5 A;  1TU3 F;  3O8Z A;  1N7S C;  2W6B A;  1M1J B;  2H89 C;  3BCC D;  1RQU A;  1EOQ A;  3BAT A;  3L75 J;  3B5N B;  4L75 A;  3CCU P;  1RE4 A;  1DH3 A;  1PL5 A;  2VLP A;  3MHV A;  1UII A;  3SWY A;  1USD A;  4DG9 A;  1AV1 A;  3W68 A;  3L74 D;  3TGU J;  3VMZ A;  3DS0 A;  1GK6 A;  1DV5 A;  2N50 A;  5APY A;  3HE4 A;  3RL0 C;  1KYO D;  1NTM E;  1VHN A;  3W67 A;  1VQ5 P;  4XFZ A;  3O6Q A;  2XZR A;  3KPE A;  5E79 H;  3H1K E;  4XFJ A;  1KFN A;  3TGU D;  1RF1 C;  3MGN A;  3R4Y A;  4BWN A;  1JO5 A;  2YNY A;  2MF4 A;  2E76 C;  2IBZ G;  3CX5 I;  7CEI A;  2VLO A;  5I4T G;  1FJK A;  2O1K A;  4WY4 B;  3D71 A;  4PV1 B;  3L70 D;  2AEJ A;  4PD4 E;  4QMA A;  1CSB A;  1ACP A;  1IMQ A;  4OGQ D;  3H1J E;  3OAK A;  4COP A;  1JEK A;  2W27 A;  3RL0 D;  1PP9 E;  2E76 D;  1LNQ A;  4NPF X;  2E74 D;  2K2Q A;  1YTZ I;  1L0I A;  3H1L J;  2HOD A;  3TK1 A;  1IFP A;  1EQ7 A;  5AW2 B;  3G71 P;  2R3C A;  1QGK B;  1URQ D;  2CPS A;  2IBZ E;  1GL2 C;  2B87 B;  2JAZ A;  5GTH E;  3I55 P;  1CEI A;  2IBZ I;  5BVZ A;  1IUQ A;  1S5L H;  2EHT A;  5AVX B;  1MFZ A;  2HOD B;  4R4M A;  2K5X A;  3P8M C;  3VP8 A;  3AEE C;  1M57 D;  1GXG A;  1SQX G;  2HFE D;  2IFM A;  5C39 A;  1OWA A;  1L0N K;  1VQ7 P;  3NXS A;  3H1I G;  4JYB A;  3AE8 C;  4W7Y A;  1EDJ A;  1ZNV A;  3JCU E;  2C9N Y;  4IZ6 A;  3S4R A;  5APQ A;  4N3Y B;  5APU A;  3L73 G;  3D70 A;  1NO4 A;  2KR5 A;  1GU4 A;  1VF5 D;  2Z44 A;  3CCJ P;  1SFC D;  1YYC A;  2WIT A;  2ZVO B;  1LTA C;  3AEC C;  3NFQ A;  2M8L A;  3V5B A;  4YXD C;  2WPT A;  1L0N E;  3Q2Y A;  1Q90 D;  3CCS P;  5KAF E;  3Q3D A;  5AW3 B;  4L74 A;  1BGY E;  3BRV B;  2XND H;  4EIJ A;  2RN0 A;  5DJT B;  4OGQ C;  2K9Y A;  4JF7 A;  3PTZ A;  3F89 A;  1SQB K;  2WTY A;  1JOC A;  2GDX A;  1DEB A;  2PEQ A;  3VYI A;  2FQ0 A;  2KG9 A;  1BE3 J;  3RK2 B;  2KP8 A;  2V7Q J;  3FWL A;  3KHU A;  4HB1 A;  2Y0E A;  3MTU E;  5AW6 B;  1N7S D;  3H1I D;  1GPJ A;  4H13 B;  2H43 A;  1QL2 A;  2NPS A;  5KAI E;  1LT9 C;  2FXO A;  2NO8 A;  3SSU A;  1KYO I;  4QNB A;  3KYQ A;  1GL2 A;  1SQB G;  2OTL P;  2EFJ A;  5AW4 B;  5GTI H;  3HE4 B;  3Q5S A;  2R5D A;  2WMM A;  2QM7 A;  4B86 A;  1KB9 H;  1SQB E;  2HLO A;  1J1E B;  1RNI A;  3GG2 A;  3O6Q B;  1JCD A;  2BCC J;  3NY7 B;  3VTP C;  1S3J A;  2OTK E;  1OW6 A;  3AEB C;  2RKL A;  2E75 C;  1VDF A;  4QKO A;  1L4A D;  5TJH A;  5KJ7 A;  1BAJ A;  1FU1 A;  2D2C C;  2KLV A;  3IAO A;  3L70 E;  1YJW P;  4IPY A;  1BSN A;  3CCR P;  2FYU J;  4U3F G;  3HE5 B;  4W80 A;  2GUS A;  1M6N A;  1SQB D;  3G21 A;  2VSQ A;  2LXB A;  1NQ4 A;  2FAD A;  1NU1 G;  2A45 H;  1KTM A;  2BAS A;  4PV1 D;  1A43 A;  1PP9 G;  3H1H G;  1J1D C;  3LW5 J;  1NTK J;  1VQ8 P;  4WVZ A;  2FY8 A;  2LR2 A;  1SQV G;  2FXP A;  1BSH A;  1H0T B;  3HRN A;  1EZV E;  1NYH A;  3M0D C;  1KC8 Q;  2DNW A;  1IFI A;  4PH1 A;  4BRY A;  2V7Q H;  2FYU K;  3GF7 A;  1JY2 O;  2WPS A;  5BU5 A;  1NKN A;  1FOS E;  5CCH A;  3CX5 D;  1NAY A;  3KDP B;  1X0T A;  2KZI A;  2BUO A;  3M1M A;  2KNC A;  2YO3 A;  5EFW B;  4Y99 B;  4C7N A;  1L0L G;  2FYU E;  2XV6 A;  2KOP A;  4M0I A;  3B5N D;  1S4X A;  3CL3 D;  4BXL A;  2V4H A;  1U7J A;  4NEO A;  3L74 J;  1QL1 A;  2BCC G;  3KZI H;  2BQ1 E;  2DGY A;  3GLM A;  5DJU B;  1T8Z A;  3B5N C;  3WU2 E;  2OYI C;  3AE9 C;  2YIU C;  3B5I A;  1L0L K;  2EG5 A;  2WSF J;  3L72 E;  1LP1 A;  2JBG A;  1VQL P;  2Q6Q A;  1KYO E;  2IFN A;  3TNU A;  3L70 G;  2I8D A;  2FYU D;  1R5L A;  3CX5 E;  1ZRT E;  2PFX A;  2ZXE B;  1FAV A;  2ZXX A;  1PPJ E;  2GYK A;  1FZG A;  5KLV K;  2JYL A;  1SVF A;  3TSI A;  1KQS O;  2A06 D;  2O01 H;  1LP1 B;  2OYI B;  4U7J A;  2I1J A;  3RBX A;  5TIS H;  4YPC A;  1NTZ J;  2ZFC A;  2ZT9 B;  2O01 J;  3CC4 P;  5HGN A;  1RE3 C;  5AW9 B;  4OGQ B;  1T2K C;  1PGO A;  2XDJ A;  1OX3 A;  1MV8 A;  2OYI A;  1K8A Q;  1PFI A;  1YTZ T;  2PEI A;  2E76 B;  1GMJ A;  4Y99 C;  2GZF A;  1K05 A;  1QEX A;  2WPQ A;  1R5S A;  1NKZ B;  5APW A;  4IFF A;  3CCM P;  3HTK B;  3M0A A;  4H44 C;  1YI2 P;  1JY2 N;  3F5H A;  5BS2 A;  3SFE C;  2E74 C;  1HF9 A;  1AJY A;  2KOS A;  1L0L E;  2AXC A;  3L73 E;  3EFG A;  3I56 P;  2QG4 A;  2W6J H;  1KIL C;  3C9I A;  1L0L D;  2AXT H;  4DJG A;  1IFN A;  1SQV D;  2B9B A;  2YKP A;  1X8Y A;  1LTJ B;  4IL6 E;  2KOG A;  1MZ9 A;  1FE6 A;  3G9R A;  4H0L D;  3T97 A;  5AVZ B;  2HPC B;  3RBZ A;  1EZV D;  2OTJ P;  3B71 A;  2Z45 A;  1X79 B;  3H1J J;  1RHZ B;  1GTW A;  1GXH A;  3CXH I;  2MVV A;  2PEM A;  2P9X A;  2IPP A;  4BRY B;  1FR2 A;  2A06 G;  3BCC G;  3CCV P;  3OA7 A;  1SQB J;  2GA1 A;  2M8P A;  4M3L A;  2HPC A;  1YHQ P;  1Z6M A;  5F2K A;  2IDB A;  1JTH A;  1SQX J;  2JR8 A;  1VQK P;  1SFC C;  4OVN F;  1T3J A;  3CMA P;  3H0D A;  4WY4 C;  3VMY A;  4UHP B;  2YXQ B;  1JY2 P;  2I1K A;  2H7H A;  1ZN5 A;  2J59 M;  1DD3 A;  1P84 I;  4U3F D;  1FZB A;  2OAR A;  1D1D A;  5AVQ B;  1L0N D;  2ZJS E;  2WWW A;  5KLV E;  3E7K A;  3H32 A;  2BHV A;  1N7S B;  1T3U A;  4Y28 J;  3L36 A;  2LKI A;  1XTC C;  4H13 D;  2R44 A;  3CXC O;  4GOD A;  2IYO A;  1HUC A;  4GKG A;  2C0X A;  3H1L E;  1KFM A;  2KK7 A;  5KP8 B;  1JY3 O;  2PEO A;  1N7S A;  1LTJ C;  2NPS D;  2X2B A;  5AVS B;  1NTK D;  2FXM A;  3RG2 A;  1VPC A;  1L4A B;  1BGY J;  4PD4 D;  1NTZ D;  2BEQ D;  4JYC A;  1EDK A;  5E79 E;  1HGZ A;  4DT0 A;  2CPB A;  1ZLL A;  2N5I A;  4I6M C;  1EXJ A;  3RK3 C;  5KLV J;  1G1I A;  2AEM A;  1AF8 A;  2N5H A;  1IK7 A;  3UIA A;  1IZN B;  1PP9 D;  3ITK A;  3A5T A;  4GOF A;  1L4A A;  3A7O A;  2Q9I A;  3V6I A;  3KZI E;  1K73 Q;  3U43 A;  1SFC B;  4EOT A;  1M74 A;  1OVU A;  1VQ9 P;  4EDF A;  3ABV C;  3MUD A;  2POH A;  3AEA C;  3P05 A;  2FVE A;  2IZ1 A;  2B88 A;  2LKM A;  1K30 A;  2IX7 C;  2SPZ A;  1KIL B;  1VQ4 P;  2P67 A;  2KGC A;  3C1L A;  1L2P A;  1SQX E;  3GZM A;  1SQP E;  3P8C D;  3CXH H;  3H6P A;  1AQT A;  1BCC G;  2QJP C;  1SQQ D;  1PGJ A;  3CWB E;  1KOR A;  1OXZ A;  3HD7 B;  1NTK K;  1EMV A;  4ZNC A;  3HUS A;  3DPH A;  3AE1 C;  3USS A;  3L74 E;  3CC2 P;  2L5G B;  2XKM A;  2E75 D;  1YJN P;  2QE7 H;  2QIW A;  2BEZ F;  2Y0C A;  3TGU E;  3IF4 A;  1N73 B;  2LXC B;  3G4S P;  2A45 G;  3L35 A;  4W7Z A;  2E42 A;  1GZL A;  1E6J P;  2JDI H;  1RF1 B;  3EJD A;  1FBM A;  4ASW A;  2WZ7 A;  3MZW B;  2N98 A;  1RF0 C;  1WRG A;  2R32 A;  1PGQ A;  1N73 A;  2CGQ A;  2UWJ E;  3AE5 C;  3LRY A;  3L74 G;  1ZME C;  4GDO A;  4N6J A;  2ZT9 C;  1SQP K;  4HH2 A;  3VMX A;  3H32 B;  4R0M A;  3ZDM A;  3OJA B;  1YJ9 P;  1KB9 E;  2YKO A;  4AUW A;  2H88 C;  2N1T C;  3I5C A;  1IJD B;  3CWB D;  1HJ0 A;  2YKQ A;  1FDO A;  1M8O B;  3MD0 A;  1U7M A;  3VP9 A;  1ZP0 C;  1FZC C;  4N78 E;  4IFD K;  1ZXG A;  1T8K A;  1N8R Q;  3EJE A;  4U0A A;  5KKZ C;  5APX A;  1ZV8 A;  2M5R A;  1PGP A;  3L75 G;  1MUU A;  3V4W A;  1N86 A;  1K9M Q;  3CCL P;  1ZR2 A;  1LTB C;  2HYN A;  3M0D A;  2CG5 B;  1M6E X;  2W90 A;  2IYP A;  1VL2 A;  3LW5 H;  1FC2 C;  2EIA A;  2WT7 B;  3H1K J;  2L22 A;  2ZVN B;  2GDW A;  2JYG A;  2K3R A;  4EI2 A;  1KB9 I;  3FXD A;  3G6E P;  4JQ0 D;  4K3A A;  1SP4 A;  1HJB A;  1FZF A;  1SFC A;  2FYU G;  2Z46 A;  1IO4 A;  2LIU A;  2QNW A;  1NTZ E;  2PEK A;  5AW7 B;  2CNR A;  1S72 P;  2R5B A;  1PP9 J;  1KQL A;  1URQ C;  5CHX A;  4WY4 D;  5KLI B;  1NJI Q;  5KLV D;  1SQP D;  1URQ A;  1RQV A;  3HYB A;  1GK4 A;  2W6A A;  5AVU B;  3P7K A;  1X3O A;  4PWV B;  3PRJ A;  1EDL A;  2KLU A;  2MR8 A;  2JU1 A;  2CK3 H;  3RK2 C;  1AQ5 A;  5CZD B;  4BPH A;  2M8R A;  2P58 A;  1OVR A;  1EC5 A;  5AVY B;  2KSJ A;  4LLH A;  1CI6 A;  1URQ B;  2QJK C;  4TLF A;  5AW1 B;  3FXE A;  4LC1 A;  3BCC J;  3B4Q A;  3HD7 D;  2QEX P;  1OVV A;  4D6T D;  1FS0 E;  2B87 A;  2MJZ A;  1KB9 D;  4UB8 H;  1HGV A;  3MUD C;  3G1I A;  4U0E A;  1KMI Z;  4ASV A;  2E75 B;  3H25 A;  2GZE A;  4HJG H;  2QVA A;  4N78 D;  3DS4 A;  1LWU B;  1GW3 A;  3KXD A;  5KJ7 D;  2JWA A;  5B66 H;  5HGL A;  1K04 A;  5K5G B;  1SQX K;  2K94 A;  1GU5 A;  1L0N G;  1CZQ A;  1OZH A;  1A8O A;  4K35 A;  1CW5 A;  2KZJ A;  1NU1 D;  5APT A;  1JCC A;  1M1J A;  3L70 J;  5KAI H;  3K5B A;  2FQ2 A;  4PXH B;  1SQQ K;  2W8Z A;  3L71 J;  4XFX A;  1KV4 A;  3WUU A;  4OH8 B;  1VF5 C;  1NOH A;  2L91 A;  1GL2 D;  2XNX A;  4YXW H;  3BRT B;  3PP5 A;  3TGU G;  4C7R A;  2Y0D A;  2M8N A;  1AVO A;  4UB8 E;  1LTT C;  3Q5R A;  2FQ1 A;  1BE3 G;  3RL0 g;  2Q3I A;  4PH0 A;  2OQQ A;  4IOI H;  1S9K D;  1W2B O;  3M9H A;  2Q7C A;  1PEQ A;  5CCH C;  1KIL D;  4O9B A;  1WT6 A;  3M9Q A;  2MY5 A;  1IK9 A;  1YIJ P;  2P1J A;  4HKZ H;  3U1A A;  3GZL A;  1SQP J;  1LWU C;  1IFM A;  2LF4 A;  1UJZ A;  3IFM A;  4KHX A;  2L4B A;  2CWO A;  1AVY A;  4WY4 A;  5F2O A;  1N73 C;  2Q5U A;  1EZV I;  1OW7 A;  3H47 A;  5HVC A;  2KOO A;  4MN4 C;  4NPD A;  5AW0 B;  2XT1 A;  3JC2 2;  5KJ7 C;  1AFO A;  2MVU A;  1FZC A;  3SWF A;  1NAF A;  3JSV C;  2K93 A;  2PEJ A;  4H44 B;  1FZA A;  1JJ2 O;  2ROQ A;  4ZKU A;  1USE A;  1HTL C;  2QJY C;  2N1T A;  3SFD C;  3HE5 A;  5GTH H;  2G3A A;  4AYC A;  2PRR A;  3L73 D;  4BPG A;  3H1J G;  3G28 A;  3L75 D;  2JQ4 A;  2NPS B;  3AEF C; 
#chains in the Genus database with same CATH homology
 1A43 A;  3G1G A;  5BS1 A;  2JO0 A;  1S72 P;  1Q81 Q;  3G26 A;  3MGE A;  1VQN P;  3CCV P;  1ZMB A;  4U0B A;  2JYL A;  2M8L A;  4XFX A;  1KQS O;  2M8P A;  1NJI Q;  5I4T G;  1VQ8 P;  3CCS P;  3LRY A;  1YHQ P;  1VQP P;  4U0F A;  3HYB A;  1K73 Q;  3VRL C;  5F2K A;  3DS2 A;  1M74 A;  1M1K Q;  1KC8 Q;  1VQ9 P;  1VQK P;  1VQO P;  4GR2 A;  2ONT A;  2L6E A;  4PH1 A;  3E2D A;  4COP A;  1YJ9 P;  3DTJ A;  3CMA P;  2E1M A;  5HGN A;  2XXM A;  3H0D A;  3P05 A;  2M8N A;  3CC4 P;  2PEQ A;  4XRO A;  1Q7Y Q;  1QRJ A;  3CCE P;  3DS5 A;  3DS1 A;  1K30 A;  1K8A Q;  5HGO A;  4XFY A;  1VQ4 P;  2OAR A;  2PEI A;  4PH0 A;  1D1D A;  1VQM P;  4XRQ A;  1W2B O;  1PEQ A;  1VQ6 P;  3G71 P;  2BUO A;  1EOQ A;  2BHV A;  1N8R Q;  3M1M A;  3CCM P;  3NTE A;  4U0A A;  1YIJ P;  1YIT P;  5HGM A;  2QEX P;  1EIA A;  4QNB A;  3CCU P;  1YI2 P;  1K9M Q;  3CCL P;  2XV6 A;  3CC7 P;  2OTL P;  2EFJ A;  1AUM A;  3G1I A;  3I55 P;  4M0I A;  3CXC O;  5BS2 A;  4U0E A;  2LF4 A;  1IUQ A;  5DCK A;  1M6E X;  3CCQ P;  3CME P;  3CD6 P;  1RNI A;  3G0V A;  3G29 A;  3DS3 A;  2CWO A;  3I56 P;  1QVG O;  5F2O A;  5F2N A;  3OW2 O;  1QVF O;  2EIA A;  3DS4 A;  4GR6 A;  1Q82 Q;  3Q20 A;  3H47 A;  2PEN A;  3H4E A;  1RO2 A;  2XT1 A;  4WYM A;  2JYG A;  3DPH A;  2BQ1 E;  2PEO A;  5HGL A;  2DGY A;  3DS0 A;  3WBH A;  1VQ7 P;  2PEJ A;  3CC2 P;  1PEM A;  1RO0 A;  1JJ2 O;  1YJN P;  3G6E P;  1BAJ A;  3B5I A;  2EG5 A;  2PY8 A;  4U0D A;  1A8O A;  1KD1 Q;  1YJW P;  1M90 Q;  4IPY A;  1PEU A;  4U0C A;  3CCR P;  3HZQ A;  1VQL P;  4COC A;  2OTJ P;  1VQ5 P;  4XFZ A;  5JPA A;  2Z45 A;  3G4S P;  1M6N A;  2Z46 A;  3RG6 C;  1E6J P;  3G21 A;  2Z44 A;  3G28 A;  2PEM A;  1Q86 Q;  2P9X A;  2KOD A;  3CCJ P;  1PEO A;  2PEK A;  3CPW O;  2QA4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...