2K0DX

Nmr structure of a mutant colicin e7 immunity protein im7 with an extended helix iii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
b'ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTALIYEAAARAAANPGGDGGGPEGIVKEIKEWRAANGKPGFKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E7 immunity protein
publication title Amino acid insertion reveals a necessary three-helical intermediate in the folding pathway of the colicin E7 immunity protein Im7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin inhibitor
total genus 31
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2k0dX00
3GKLC 1GXGA 1MZ8A 2JB0A 2JBGA 4QKOA 1ZNVA 7CEIA 1E0HA 1AYIA 2GZGA 2K0DX 1EMVA 3GJNA 2GYKA 4UHPB 4F37A 2VLQA 2K5XA 2VLOA 1BXIA 1GXHA 2GZJA 1UNKA 1IMPA 1IMQA 2GZEA 2GZIA 2JAZA 2WPTA 5EW5E 2VLPA 2GZFA 2ERHA 1FR2A 2VLNA 1CEIA 3U43A 2NO8A 1UJZA
chains in the Genus database with same CATH superfamily
3CCLP 2PEIA 2FAEA 1MZ8A 3B4QA 4U0AA 2QEXP 2EG5A 4XRQA 2EHSA 1KC8Q 1IUQA 3CCEP 2GYKA 4F37A 1HQBA 2FADA 3CC7P 1IMQA 4U0FA 2KORA 5EW5E 2GZFA 3EJBA 1RO2A 2M8NA 5HGMA 2N98A 2PEMA 3EJEA 3G21A 1K8AQ 2JU2A 3G71P 1F80D 1AYIA 3LRYA 2JAZA 4QNBA 1YJWP 2MY5A 2PY8A 1VHNA 1YI2P 4HKGA 5F2OA 2QA4P 1D1DA 1KQSO 1RNIA 1A8OA 4XFXA 1ZMBA 5BS2A 3CCUP 2M8PA 2JU1A 2K93A 3EJDA 2L6EA 4QKOA 4U0BA 1Q86Q 1GXHA 1L0HA 2OTLP 1M74A 2KODA 2PEOA 4M0IA 3DS1A 1Q81Q 2Z44A 1M1KQ 1X3OA 2E1MA 3CD6P 2FQ1A 3CCJP 3WBHA 4MRTC 5HGNA 3LMOA 3CCRP 1EOQA 2KW2A 1K9MQ 3CC4P 3G29A 2XXMA 5HVCA 3RG6C 1UJZA 1T8KA 2VSQA 1RO0A 4U0CA 5CZDB 4NEOA 3G1IA 3NTEA 2GDYA 1OR5A 2XZ0D 3CCQP 2N5IA 2EFJA 2KOSA 2AFDA 5HGLA 4BPFA 1YJ9P 2LF4A 2GZJA 5EJDA 2XZ1C 2FVAA 1Q7YQ 3G28A 5F2KA 3I56P 1GPJA 3VRLC 3OW2O 1M6EX 3DS2A 2X2BA 2KGDA 4IZ6A 1VQNP 3CCVP 2FVEA 4XROA 2K5XA 2M5RA 1N8RQ 2KGEA 4BPGA 1M90Q 2CGQA 2GDWA 2L22A 2PEKA 2LL8A 3Q20A 1K30A 1VQOP 1QVFO 2NO8A 3CCSP 1GXGA 1S72P 2CG5B 2JO0A 2DNWA 2LMLA 2P9XA 2EIAA 2MVVA 1VQ4P 2KOQA 1A43A 2BUOA 1BXIA 1YJNP 2JYGA 2MVUA 2VLNA 1YITP 4CA3A 5HGOA 3GZLA 1VQ7P 1NQ4A 3CPWO 4WYMA 3DS5A 1ZNVA 1E0HA 2KOPA 3P05A 4UHPB 4PXHB 1DV5A 1VQ5P 2FQ2A 1L0IA 2ONTA 1VKUA 5F2NA 3CCMP 2JQ4A 2L4BA 3M1MA 5BS1A 1Z6MA 1NJIQ 3E2DA 2M8LA 2FVFA 1YHQP 4PH1A 1YIJP 2KGAA 3H47A 1KLPA 2GZEA 2GZIA 5KP6B 2K2QA 2Z45A 2LKIA 2K0YA 2XV6A 3H0DA 2OTJP 3CC2P 3DS4A 1EIAA 2KWLA 2ROQA 2GZGA 2K92A 3H4EA 4XFZA 2VLQA 5I4TG 1UNKA 2KG9A 3DS0A 2AVAA 4GR2A 5DCKA 2KR5A 3CE7A 2KG8A 4R0MA 1KD1Q 4PWVB 5HV8A 2FQ0A 2OARA 1BAJA 3HZQA 2CNRA 4COPA 4DG9A 2K94A 3I55P 4GR6A 3CMAP 1QRJA 5KP8B 1W2BO 1M6NA 1VQ8P 3U43A 3NY7B 5JPAA 3G6EP 2KOOA 2JB0A 3G1GA 2PEQA 2MD9A 3GJNA 2VLOA 2Z46A 3MGEA 3G4SP 2AFEA 1VQKP 1JJ2O 2MF4A 4XFYA 1E6JP 1VQMP 3CMEP 1AF8A 1HY8A 2LIWA 7CEIA 2FACA 2K0DX 2L0QA 2MR7A 5KP7B 2N50A 2EHTA 2VLPA 2GDXA 3B5IA 4IPYA 2FHSC 3GKLC 3DS3A 2JBGA 2QNWA 2KG6A 1QVGO 1VQPP 3CXCO 2LTEA 2AF8A 4H2YC 4H2WC 3RG2A 1CEIA 2PEJA 2PNGA 3GZMA 2LIUA 2CWOA 2LOLA 1DNYA 2N5HA 2CQ8A 4H2XC 1EMVA 2JYLA 1K73Q 4BPHA 3DPHA 2WPTA 2ERHA 2N6YA 1AUMA 2LPKA 4PH0A 4COCA 2L9FA 3G26A 3G0VA 3DTJA 1ACPA 4U0EA 1VQ9P 2JGPA 2BHVA 2KGCA 2MR8A 1VQLP 1Q82Q 2N6ZA 2DGYA 4U0DA 1IMPA 2PENA 2XT1A 1VQ6P 2K0XA 1FR2A 3HYBA
chains in the Genus database with same CATH topology
3GKLC 1GXGA 1MZ8A 2JB0A 2JBGA 4QKOA 1ZNVA 7CEIA 1E0HA 1AYIA 2GZGA 2K0DX 1EMVA 3GJNA 2GYKA 4UHPB 4F37A 2VLQA 2K5XA 2VLOA 1BXIA 1GXHA 2GZJA 1UNKA 1IMPA 1IMQA 2GZEA 2GZIA 2JAZA 2WPTA 5EW5E 2VLPA 2GZFA 2ERHA 1FR2A 2VLNA 1CEIA 3U43A 2NO8A 1UJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKL C;  1GXG A;  1MZ8 A;  2JB0 A;  2JBG A;  4QKO A;  1ZNV A;  7CEI A;  1E0H A;  1AYI A;  2GZG A;  2K0D X;  1EMV A;  3GJN A;  2GYK A;  4UHP B;  4F37 A;  2VLQ A;  2K5X A;  2VLO A;  1BXI A;  1GXH A;  2GZJ A;  1UNK A;  1IMP A;  1IMQ A;  2GZE A;  2GZI A;  2JAZ A;  2WPT A;  5EW5 E;  2VLP A;  2GZF A;  2ERH A;  1FR2 A;  2VLN A;  1CEI A;  3U43 A;  2NO8 A;  1UJZ A; 
#chains in the Genus database with same CATH topology
 3CCL P;  2PEI A;  2FAE A;  1MZ8 A;  3B4Q A;  4U0A A;  2QEX P;  2EG5 A;  4XRQ A;  2EHS A;  1KC8 Q;  1IUQ A;  3CCE P;  2GYK A;  4F37 A;  1HQB A;  2FAD A;  3CC7 P;  1IMQ A;  4U0F A;  2KOR A;  5EW5 E;  2GZF A;  3EJB A;  1RO2 A;  2M8N A;  5HGM A;  2N98 A;  2PEM A;  3EJE A;  3G21 A;  1K8A Q;  2JU2 A;  3G71 P;  1F80 D;  1AYI A;  3LRY A;  2JAZ A;  4QNB A;  1YJW P;  2MY5 A;  2PY8 A;  1VHN A;  1YI2 P;  4HKG A;  5F2O A;  2QA4 P;  1D1D A;  1KQS O;  1RNI A;  1A8O A;  4XFX A;  1ZMB A;  5BS2 A;  3CCU P;  2M8P A;  2JU1 A;  2K93 A;  3EJD A;  2L6E A;  4QKO A;  4U0B A;  1Q86 Q;  1GXH A;  1L0H A;  2OTL P;  1M74 A;  2KOD A;  2PEO A;  4M0I A;  3DS1 A;  1Q81 Q;  2Z44 A;  1M1K Q;  1X3O A;  2E1M A;  3CD6 P;  2FQ1 A;  3CCJ P;  3WBH A;  4MRT C;  5HGN A;  3LMO A;  3CCR P;  1EOQ A;  2KW2 A;  1K9M Q;  3CC4 P;  3G29 A;  2XXM A;  5HVC A;  3RG6 C;  1UJZ A;  1T8K A;  2VSQ A;  1RO0 A;  4U0C A;  5CZD B;  4NEO A;  3G1I A;  3NTE A;  2GDY A;  1OR5 A;  2XZ0 D;  3CCQ P;  2N5I A;  2EFJ A;  2KOS A;  2AFD A;  5HGL A;  4BPF A;  1YJ9 P;  2LF4 A;  2GZJ A;  5EJD A;  2XZ1 C;  2FVA A;  1Q7Y Q;  3G28 A;  5F2K A;  3I56 P;  1GPJ A;  3VRL C;  3OW2 O;  1M6E X;  3DS2 A;  2X2B A;  2KGD A;  4IZ6 A;  1VQN P;  3CCV P;  2FVE A;  4XRO A;  2K5X A;  2M5R A;  1N8R Q;  2KGE A;  4BPG A;  1M90 Q;  2CGQ A;  2GDW A;  2L22 A;  2PEK A;  2LL8 A;  3Q20 A;  1K30 A;  1VQO P;  1QVF O;  2NO8 A;  3CCS P;  1GXG A;  1S72 P;  2CG5 B;  2JO0 A;  2DNW A;  2LML A;  2P9X A;  2EIA A;  2MVV A;  1VQ4 P;  2KOQ A;  1A43 A;  2BUO A;  1BXI A;  1YJN P;  2JYG A;  2MVU A;  2VLN A;  1YIT P;  4CA3 A;  5HGO A;  3GZL A;  1VQ7 P;  1NQ4 A;  3CPW O;  4WYM A;  3DS5 A;  1ZNV A;  1E0H A;  2KOP A;  3P05 A;  4UHP B;  4PXH B;  1DV5 A;  1VQ5 P;  2FQ2 A;  1L0I A;  2ONT A;  1VKU A;  5F2N A;  3CCM P;  2JQ4 A;  2L4B A;  3M1M A;  5BS1 A;  1Z6M A;  1NJI Q;  3E2D A;  2M8L A;  2FVF A;  1YHQ P;  4PH1 A;  1YIJ P;  2KGA A;  3H47 A;  1KLP A;  2GZE A;  2GZI A;  5KP6 B;  2K2Q A;  2Z45 A;  2LKI A;  2K0Y A;  2XV6 A;  3H0D A;  2OTJ P;  3CC2 P;  3DS4 A;  1EIA A;  2KWL A;  2ROQ A;  2GZG A;  2K92 A;  3H4E A;  4XFZ A;  2VLQ A;  5I4T G;  1UNK A;  2KG9 A;  3DS0 A;  2AVA A;  4GR2 A;  5DCK A;  2KR5 A;  3CE7 A;  2KG8 A;  4R0M A;  1KD1 Q;  4PWV B;  5HV8 A;  2FQ0 A;  2OAR A;  1BAJ A;  3HZQ A;  2CNR A;  4COP A;  4DG9 A;  2K94 A;  3I55 P;  4GR6 A;  3CMA P;  1QRJ A;  5KP8 B;  1W2B O;  1M6N A;  1VQ8 P;  3U43 A;  3NY7 B;  5JPA A;  3G6E P;  2KOO A;  2JB0 A;  3G1G A;  2PEQ A;  2MD9 A;  3GJN A;  2VLO A;  2Z46 A;  3MGE A;  3G4S P;  2AFE A;  1VQK P;  1JJ2 O;  2MF4 A;  4XFY A;  1E6J P;  1VQM P;  3CME P;  1AF8 A;  1HY8 A;  2LIW A;  7CEI A;  2FAC A;  2K0D X;  2L0Q A;  2MR7 A;  5KP7 B;  2N50 A;  2EHT A;  2VLP A;  2GDX A;  3B5I A;  4IPY A;  2FHS C;  3GKL C;  3DS3 A;  2JBG A;  2QNW A;  2KG6 A;  1QVG O;  1VQP P;  3CXC O;  2LTE A;  2AF8 A;  4H2Y C;  4H2W C;  3RG2 A;  1CEI A;  2PEJ A;  2PNG A;  3GZM A;  2LIU A;  2CWO A;  2LOL A;  1DNY A;  2N5H A;  2CQ8 A;  4H2X C;  1EMV A;  2JYL A;  1K73 Q;  4BPH A;  3DPH A;  2WPT A;  2ERH A;  2N6Y A;  1AUM A;  2LPK A;  4PH0 A;  4COC A;  2L9F A;  3G26 A;  3G0V A;  3DTJ A;  1ACP A;  4U0E A;  1VQ9 P;  2JGP A;  2BHV A;  2KGC A;  2MR8 A;  1VQL P;  1Q82 Q;  2N6Z A;  2DGY A;  4U0D A;  1IMP A;  2PEN A;  2XT1 A;  1VQ6 P;  2K0X A;  1FR2 A;  3HYB A; 
#chains in the Genus database with same CATH homology
 3GKL C;  1GXG A;  1MZ8 A;  2JB0 A;  2JBG A;  4QKO A;  1ZNV A;  7CEI A;  1E0H A;  1AYI A;  2GZG A;  2K0D X;  1EMV A;  3GJN A;  2GYK A;  4UHP B;  4F37 A;  2VLQ A;  2K5X A;  2VLO A;  1BXI A;  1GXH A;  2GZJ A;  1UNK A;  1IMP A;  1IMQ A;  2GZE A;  2GZI A;  2JAZ A;  2WPT A;  5EW5 E;  2VLP A;  2GZF A;  2ERH A;  1FR2 A;  2VLN A;  1CEI A;  3U43 A;  2NO8 A;  1UJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...