2K0DX

Nmr structure of a mutant colicin e7 immunity protein im7 with an extended helix iii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTALIYEAAARAAANPGGDGGGPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin inhibitor
molecule keywords Colicin-E7 immunity protein
publication title Amino acid insertion reveals a necessary three-helical intermediate in the folding pathway of the colicin E7 immunity protein Im7.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2k0dX00
2JB0A 1CEIA 2VLOA 5EW5E 2K0DX 4QKOA 1AYIA 1GXGA 2VLPA 2JBGA 2VLQA 2VLNA 1BXIA 2GYKA 2GZEA 2GZJA 2GZIA 2JAZA 4F37A 7CEIA 4UHPB 1MZ8A 2NO8A 1UJZA 1GXHA 1FR2A 3U43A 2K5XA 3GKLC 1IMPA 1IMQA 1UNKA 1ZNVA 1EMVA 2WPTA 1E0HA 2GZFA 2ERHA 3GJNA 2GZGA
chains in the Genus database with same CATH superfamily
3VRLC 5HGOA 2JYGA 3WBHA 1VQKP 1K30A 3G4SP 3DS5A 2LPKA 1GXGA 3CC7P 5F2NA 3G71P 1KD1Q 3DS1A 2MF4A 3GZLA 2N5IA 4PH0A 2CG5B 3DPHA 1YIJP 2AFDA 3I56P 2MVVA 1KLPA 4COCA 2JAZA 3OW2O 4U0BA 2OTJP 2FQ2A 2GDXA 2QA4P 3G28A 4XRQA 3G0VA 1M6NA 3G1IA 1E6JP 5EW5E 2K0DX 2PNGA 4U0AA 2LIUA 3RG2A 2LKIA 1BXIA 2KR5A 2P9XA 1NJIQ 5F2KA 2JQ4A 3G26A 1K8AQ 2KG9A 2KOSA 5HGLA 2JU2A 2KG8A 4WYMA 3CCUP 1RNIA 2FVAA 1VQNP 2Z44A 2PEOA 2M5RA 1K73Q 2FACA 2KGCA 2BUOA 3GKLC 3DS2A 2ROQA 3G21A 2QEXP 3EJBA 5BS1A 3G6EP 5F2OA 3CMAP 2JB0A 2LTEA 1AF8A 1A8OA 2KGAA 2ONTA 4U0CA 2KODA 2K0XA 4UHPB 2M8NA 2FVFA 2K5XA 1M90Q 1VQ5P 2DGYA 1S72P 5HGMA 4H2XC 1KQSO 1AUMA 1VQ7P 2MR7A 2XZ1C 2K2QA 2EIAA 2VLOA 4H2YC 2LIWA 4COPA 2GYKA 2XZ0D 2KWLA 2JYLA 4XFYA 3I55P 2N5HA 2L0QA 1D1DA 1VQ8P 1L0HA 4PXHB 1A43A 4XFXA 1VQPP 1X3OA 2E1MA 1YHQP 3DS3A 3B5IA 1T8KA 2N50A 2FQ0A 2VLQA 2AVAA 2GZJA 3CCQP 2DNWA 2QNWA 5HV8A 3CMEP 3CC2P 3EJDA 1EIAA 3G29A 2K92A 5DCKA 1KC8Q 3CC4P 3M1MA 3LRYA 1VQ6P 3HZQA 2AFEA 4NEOA 4XFZA 1GXHA 1EOQA 1FR2A 2PEJA 2EHTA 3B4QA 3CCRP 3GJNA 3CCVP 3CXCO 2GZGA 3NTEA 1QVGO 1DV5A 2Z46A 1Q81Q 1CEIA 1F80D 4BPFA 2JBGA 4F37A 2LL8A 1OR5A 1VQLP 4IPYA 3U43A 1Q86Q 1IMQA 1YITP 4CA3A 5BS2A 3CCSP 4PWVB 4XROA 2X2BA 2L22A 2MVUA 2EHSA 1NQ4A 2BHVA 3LMOA 2JU1A 3H4EA 1BAJA 2GZIA 2AF8A 1MZ8A 3CE7A 1M74A 2PY8A 4GR2A 1EMVA 1E0HA 3H0DA 2KOPA 1Q7YQ 2LOLA 1HQBA 3DS0A 2KGDA 2L6EA 2CWOA 4QKOA 1ZMBA 2PENA 7CEIA 1M1KQ 2M8PA 3E2DA 5KP6B 1N8RQ 3Q20A 1JJ2O 2JO0A 1QRJA 2WPTA 2FQ1A 4H2WC 1HY8A 5CZDB 5KP7B 1VQ4P 2K93A 3CCLP 2GZEA 2K0YA 4BPHA 2MD9A 1RO0A 1UJZA 4U0EA 2L9FA 1IMPA 5JPAA 4U0DA 3MGEA 1YJNP 1VKUA 2GDYA 4DG9A 1YJ9P 1L0IA 2MY5A 2FAEA 3P05A 4IZ6A 4HKGA 4BPGA 5HVCA 2M8LA 4MRTC 2VLNA 2KOOA 1IUQA 2CGQA 3CCEP 2N98A 1RO2A 1DNYA 2CQ8A 4PH1A 3CCJP 2XV6A 2VSQA 1UNKA 5HGNA 1ZNVA 3CD6P 2KOQA 2LMLA 1Q82Q 3DS4A 2MR8A 3G1GA 1K9MQ 2N6ZA 1VHNA 2FVEA 2KW2A 1YJWP 2NO8A 2OARA 2PEKA 3CPWO 5EJDA 1VQ9P 2FHSC 2PEIA 3CCMP 2GDWA 3NY7B 1Z6MA 4R0MA 2VLPA 1QVFO 5I4TG 4U0FA 3GZMA 2OTLP 2EG5A 4M0IA 2GZFA 2ERHA 3DTJA 2JGPA 1VQMP 1YI2P 2L4BA 1M6EX 1W2BO 4GR6A 1AYIA 2K94A 2XXMA 1ACPA 3RG6C 3HYBA 2PEMA 2PEQA 2N6YA 3H47A 2KGEA 2XT1A 2KORA 2CNRA 4QNBA 2FADA 2KG6A 1GPJA 2EFJA 5KP8B 2LF4A 3EJEA 1VQOP 2Z45A
chains in the Genus database with same CATH topology
2JB0A 1CEIA 2VLOA 5EW5E 2K0DX 4QKOA 1AYIA 1GXGA 2VLPA 2JBGA 2VLQA 2VLNA 1BXIA 2GYKA 2GZEA 2GZJA 2GZIA 2JAZA 4F37A 7CEIA 4UHPB 1MZ8A 2NO8A 1UJZA 1GXHA 1FR2A 3U43A 2K5XA 3GKLC 1IMPA 1IMQA 1UNKA 1ZNVA 1EMVA 2WPTA 1E0HA 2GZFA 2ERHA 3GJNA 2GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JB0 A;  1CEI A;  2VLO A;  5EW5 E;  2K0D X;  4QKO A;  1AYI A;  1GXG A;  2VLP A;  2JBG A;  2VLQ A;  2VLN A;  1BXI A;  2GYK A;  2GZE A;  2GZJ A;  2GZI A;  2JAZ A;  4F37 A;  7CEI A;  4UHP B;  1MZ8 A;  2NO8 A;  1UJZ A;  1GXH A;  1FR2 A;  3U43 A;  2K5X A;  3GKL C;  1IMP A;  1IMQ A;  1UNK A;  1ZNV A;  1EMV A;  2WPT A;  1E0H A;  2GZF A;  2ERH A;  3GJN A;  2GZG A; 
#chains in the Genus database with same CATH topology
 3VRL C;  5HGO A;  2JYG A;  3WBH A;  1VQK P;  1K30 A;  3G4S P;  3DS5 A;  2LPK A;  1GXG A;  3CC7 P;  5F2N A;  3G71 P;  1KD1 Q;  3DS1 A;  2MF4 A;  3GZL A;  2N5I A;  4PH0 A;  2CG5 B;  3DPH A;  1YIJ P;  2AFD A;  3I56 P;  2MVV A;  1KLP A;  4COC A;  2JAZ A;  3OW2 O;  4U0B A;  2OTJ P;  2FQ2 A;  2GDX A;  2QA4 P;  3G28 A;  4XRQ A;  3G0V A;  1M6N A;  3G1I A;  1E6J P;  5EW5 E;  2K0D X;  2PNG A;  4U0A A;  2LIU A;  3RG2 A;  2LKI A;  1BXI A;  2KR5 A;  2P9X A;  1NJI Q;  5F2K A;  2JQ4 A;  3G26 A;  1K8A Q;  2KG9 A;  2KOS A;  5HGL A;  2JU2 A;  2KG8 A;  4WYM A;  3CCU P;  1RNI A;  2FVA A;  1VQN P;  2Z44 A;  2PEO A;  2M5R A;  1K73 Q;  2FAC A;  2KGC A;  2BUO A;  3GKL C;  3DS2 A;  2ROQ A;  3G21 A;  2QEX P;  3EJB A;  5BS1 A;  3G6E P;  5F2O A;  3CMA P;  2JB0 A;  2LTE A;  1AF8 A;  1A8O A;  2KGA A;  2ONT A;  4U0C A;  2KOD A;  2K0X A;  4UHP B;  2M8N A;  2FVF A;  2K5X A;  1M90 Q;  1VQ5 P;  2DGY A;  1S72 P;  5HGM A;  4H2X C;  1KQS O;  1AUM A;  1VQ7 P;  2MR7 A;  2XZ1 C;  2K2Q A;  2EIA A;  2VLO A;  4H2Y C;  2LIW A;  4COP A;  2GYK A;  2XZ0 D;  2KWL A;  2JYL A;  4XFY A;  3I55 P;  2N5H A;  2L0Q A;  1D1D A;  1VQ8 P;  1L0H A;  4PXH B;  1A43 A;  4XFX A;  1VQP P;  1X3O A;  2E1M A;  1YHQ P;  3DS3 A;  3B5I A;  1T8K A;  2N50 A;  2FQ0 A;  2VLQ A;  2AVA A;  2GZJ A;  3CCQ P;  2DNW A;  2QNW A;  5HV8 A;  3CME P;  3CC2 P;  3EJD A;  1EIA A;  3G29 A;  2K92 A;  5DCK A;  1KC8 Q;  3CC4 P;  3M1M A;  3LRY A;  1VQ6 P;  3HZQ A;  2AFE A;  4NEO A;  4XFZ A;  1GXH A;  1EOQ A;  1FR2 A;  2PEJ A;  2EHT A;  3B4Q A;  3CCR P;  3GJN A;  3CCV P;  3CXC O;  2GZG A;  3NTE A;  1QVG O;  1DV5 A;  2Z46 A;  1Q81 Q;  1CEI A;  1F80 D;  4BPF A;  2JBG A;  4F37 A;  2LL8 A;  1OR5 A;  1VQL P;  4IPY A;  3U43 A;  1Q86 Q;  1IMQ A;  1YIT P;  4CA3 A;  5BS2 A;  3CCS P;  4PWV B;  4XRO A;  2X2B A;  2L22 A;  2MVU A;  2EHS A;  1NQ4 A;  2BHV A;  3LMO A;  2JU1 A;  3H4E A;  1BAJ A;  2GZI A;  2AF8 A;  1MZ8 A;  3CE7 A;  1M74 A;  2PY8 A;  4GR2 A;  1EMV A;  1E0H A;  3H0D A;  2KOP A;  1Q7Y Q;  2LOL A;  1HQB A;  3DS0 A;  2KGD A;  2L6E A;  2CWO A;  4QKO A;  1ZMB A;  2PEN A;  7CEI A;  1M1K Q;  2M8P A;  3E2D A;  5KP6 B;  1N8R Q;  3Q20 A;  1JJ2 O;  2JO0 A;  1QRJ A;  2WPT A;  2FQ1 A;  4H2W C;  1HY8 A;  5CZD B;  5KP7 B;  1VQ4 P;  2K93 A;  3CCL P;  2GZE A;  2K0Y A;  4BPH A;  2MD9 A;  1RO0 A;  1UJZ A;  4U0E A;  2L9F A;  1IMP A;  5JPA A;  4U0D A;  3MGE A;  1YJN P;  1VKU A;  2GDY A;  4DG9 A;  1YJ9 P;  1L0I A;  2MY5 A;  2FAE A;  3P05 A;  4IZ6 A;  4HKG A;  4BPG A;  5HVC A;  2M8L A;  4MRT C;  2VLN A;  2KOO A;  1IUQ A;  2CGQ A;  3CCE P;  2N98 A;  1RO2 A;  1DNY A;  2CQ8 A;  4PH1 A;  3CCJ P;  2XV6 A;  2VSQ A;  1UNK A;  5HGN A;  1ZNV A;  3CD6 P;  2KOQ A;  2LML A;  1Q82 Q;  3DS4 A;  2MR8 A;  3G1G A;  1K9M Q;  2N6Z A;  1VHN A;  2FVE A;  2KW2 A;  1YJW P;  2NO8 A;  2OAR A;  2PEK A;  3CPW O;  5EJD A;  1VQ9 P;  2FHS C;  2PEI A;  3CCM P;  2GDW A;  3NY7 B;  1Z6M A;  4R0M A;  2VLP A;  1QVF O;  5I4T G;  4U0F A;  3GZM A;  2OTL P;  2EG5 A;  4M0I A;  2GZF A;  2ERH A;  3DTJ A;  2JGP A;  1VQM P;  1YI2 P;  2L4B A;  1M6E X;  1W2B O;  4GR6 A;  1AYI A;  2K94 A;  2XXM A;  1ACP A;  3RG6 C;  3HYB A;  2PEM A;  2PEQ A;  2N6Y A;  3H47 A;  2KGE A;  2XT1 A;  2KOR A;  2CNR A;  4QNB A;  2FAD A;  2KG6 A;  1GPJ A;  2EFJ A;  5KP8 B;  2LF4 A;  3EJE A;  1VQO P;  2Z45 A; 
#chains in the Genus database with same CATH homology
 2JB0 A;  1CEI A;  2VLO A;  5EW5 E;  2K0D X;  4QKO A;  1AYI A;  1GXG A;  2VLP A;  2JBG A;  2VLQ A;  2VLN A;  1BXI A;  2GYK A;  2GZE A;  2GZJ A;  2GZI A;  2JAZ A;  4F37 A;  7CEI A;  4UHP B;  1MZ8 A;  2NO8 A;  1UJZ A;  1GXH A;  1FR2 A;  3U43 A;  2K5X A;  3GKL C;  1IMP A;  1IMQ A;  1UNK A;  1ZNV A;  1EMV A;  2WPT A;  1E0H A;  2GZF A;  2ERH A;  3GJN A;  2GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...