2K0DX

Nmr structure of a mutant colicin e7 immunity protein im7 with an extended helix iii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTALIYEAAARAAANPGGDGGGPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amino acid insertion reveals a necessary three-helical intermediate in the folding pathway of the colicin E7 immunity protein Im7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin inhibitor
molecule keywords Colicin-E7 immunity protein
total genus 31
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2k0dX00
2K5XA 1IMQA 4F37A 2VLOA 2WPTA 2VLNA 2NO8A 1CEIA 2GZJA 3GJNA 1GXGA 1EMVA 1UJZA 2GZEA 1FR2A 1ZNVA 2GZIA 5EW5E 1AYIA 7CEIA 1E0HA 4QKOA 2GZFA 2JAZA 3GKLC 2GYKA 2VLQA 4UHPB 1BXIA 2GZGA 1MZ8A 3U43A 2ERHA 2K0DX 2VLPA 2JBGA 1UNKA 2JB0A 1IMPA 1GXHA
chains in the Genus database with same CATH superfamily
2KOPA 3DS1A 1K73Q 4U0CA 1VQ5P 2CWOA 1ZMBA 1JJ2O 2FADA 3CCEP 2CGQA 1Q86Q 2VLQA 2GZGA 3EJBA 3M1MA 4PWVB 2JGPA 3NY7B 1AUMA 2LTEA 2CG5B 2FHSC 2KORA 1M6EX 2KW2A 1CEIA 2GZJA 2MVVA 3MGEA 2EFJA 2OARA 1VQ7P 2L6EA 1KC8Q 1OR5A 2XV6A 2JBGA 3VRLC 2PNGA 2MF4A 1GXHA 3G0VA 3H4EA 1NJIQ 1YJNP 1NQ4A 2X2BA 2N6YA 1VQNP 1ACPA 3CCMP 7CEIA 1QRJA 3CCVP 2LKIA 4IPYA 3CPWO 4U0EA 3I56P 2QNWA 3DS2A 2VSQA 2MR8A 5BS1A 1KLPA 1ZNVA 2GZIA 4XFXA 1Q82Q 2CNRA 2KODA 4U0BA 1KQSO 2KG8A 3H47A 4PH0A 1S72P 1VQKP 3DS4A 1M90Q 2KGCA 4COPA 1T8KA 1X3OA 3CE7A 5HVCA 2EIAA 3LRYA 3DTJA 2LF4A 2M8PA 2KOSA 3G1IA 1A8OA 5CZDB 2KWLA 1UJZA 1Z6MA 2MY5A 2JO0A 2FAEA 3GKLC 1BXIA 5DCKA 2JYLA 2JU2A 3G21A 2PEOA 5HV8A 1VQ6P 1EOQA 2BHVA 2L9FA 4BPFA 3CC7P 2P9XA 4U0AA 2GZEA 1VHNA 2AFEA 2LPKA 1VQ8P 1K9MQ 3E2DA 4H2XC 2KGEA 4BPHA 3OW2O 3CXCO 3GZLA 1AF8A 2K5XA 4F37A 3H0DA 3DS5A 1EIAA 2FACA 1GPJA 4NEOA 1AYIA 1M74A 1A43A 5HGNA 3CC4P 1DV5A 4MRTC 2PEKA 1YITP 1RO0A 2EHTA 2PEJA 2JB0A 2K93A 3NTEA 2N50A 2FVFA 3G28A 1BAJA 2FQ2A 3CCSP 1YJWP 2XZ1C 4IZ6A 4U0DA 3P05A 2GZFA 2GYKA 2LIUA 3CCJP 2XZ0D 2L22A 1IMPA 2LMLA 2K2QA 2LL8A 4XROA 2GDWA 1VQ4P 4PXHB 1EMVA 2Z46A 1VQMP 2N5IA 4HKGA 4H2YC 2K0DX 2N5HA 4XFYA 3CC2P 2FVEA 3DS0A 2E1MA 2LIWA 1N8RQ 4H2WC 1VQPP 2L4BA 2Z45A 2Z44A 1M6NA 1FR2A 2MD9A 2FQ0A 2ROQA 2PY8A 4UHPB 1YHQP 2ERHA 5I4TG 4CA3A 3WBHA 5HGOA 2N6ZA 1Q81Q 1YI2P 1KD1Q 2GDYA 4PH1A 3LMOA 2AFDA 3CCQP 3HYBA 4M0IA 5HGMA 2K94A 2KGAA 3EJDA 1VKUA 1HY8A 3G29A 1L0IA 2M8NA 4U0FA 3CCUP 4R0MA 1Q7YQ 5BS2A 5HGLA 5KP8B 2KOOA 3G4SP 1RNIA 2GDXA 4BPGA 2WPTA 2ONTA 2KG9A 4XFZA 3HZQA 5EW5E 2CQ8A 1DNYA 3EJEA 2JAZA 2KR5A 5F2KA 2AF8A 3G26A 4COCA 1QVGO 3DS3A 2EHSA 1HQBA 2L0QA 4WYMA 2LOLA 2XT1A 2VLNA 2NO8A 3RG6C 2BUOA 1GXGA 2MVUA 1M1KQ 2EG5A 1VQLP 2DNWA 1L0HA 3CMAP 2DGYA 1IUQA 5F2OA 2KGDA 1QVFO 3GZMA 1E6JP 3CMEP 3G1GA 4GR2A 2PEQA 1K8AQ 4GR6A 3CCLP 2OTJP 2K0YA 3B5IA 1YIJP 1K30A 1E0HA 3I55P 2AVAA 1YJ9P 1MZ8A 3U43A 2XXMA 4QNBA 2FVAA 2VLPA 1VQ9P 2K92A 5KP7B 2QA4P 2OTLP 2MR7A 1W2BO 5EJDA 1RO2A 3B4QA 2JYGA 2JU1A 3G6EP 3RG2A 2PEIA 1UNKA 2QEXP 4XRQA 1IMQA 5JPAA 2PEMA 2VLOA 1D1DA 3GJNA 5F2NA 4DG9A 3G71P 2JQ4A 2M8LA 2KOQA 4QKOA 3CCRP 2M5RA 2N98A 3DPHA 3Q20A 2PENA 1F80D 2FQ1A 2K0XA 5KP6B 3CD6P 1VQOP 2KG6A
chains in the Genus database with same CATH topology
2K5XA 1IMQA 4F37A 2VLOA 2WPTA 2VLNA 2NO8A 1CEIA 2GZJA 3GJNA 1GXGA 1EMVA 1UJZA 2GZEA 1FR2A 1ZNVA 2GZIA 5EW5E 1AYIA 7CEIA 1E0HA 4QKOA 2GZFA 2JAZA 3GKLC 2GYKA 2VLQA 4UHPB 1BXIA 2GZGA 1MZ8A 3U43A 2ERHA 2K0DX 2VLPA 2JBGA 1UNKA 2JB0A 1IMPA 1GXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5X A;  1IMQ A;  4F37 A;  2VLO A;  2WPT A;  2VLN A;  2NO8 A;  1CEI A;  2GZJ A;  3GJN A;  1GXG A;  1EMV A;  1UJZ A;  2GZE A;  1FR2 A;  1ZNV A;  2GZI A;  5EW5 E;  1AYI A;  7CEI A;  1E0H A;  4QKO A;  2GZF A;  2JAZ A;  3GKL C;  2GYK A;  2VLQ A;  4UHP B;  1BXI A;  2GZG A;  1MZ8 A;  3U43 A;  2ERH A;  2K0D X;  2VLP A;  2JBG A;  1UNK A;  2JB0 A;  1IMP A;  1GXH A; 
#chains in the Genus database with same CATH topology
 2KOP A;  3DS1 A;  1K73 Q;  4U0C A;  1VQ5 P;  2CWO A;  1ZMB A;  1JJ2 O;  2FAD A;  3CCE P;  2CGQ A;  1Q86 Q;  2VLQ A;  2GZG A;  3EJB A;  3M1M A;  4PWV B;  2JGP A;  3NY7 B;  1AUM A;  2LTE A;  2CG5 B;  2FHS C;  2KOR A;  1M6E X;  2KW2 A;  1CEI A;  2GZJ A;  2MVV A;  3MGE A;  2EFJ A;  2OAR A;  1VQ7 P;  2L6E A;  1KC8 Q;  1OR5 A;  2XV6 A;  2JBG A;  3VRL C;  2PNG A;  2MF4 A;  1GXH A;  3G0V A;  3H4E A;  1NJI Q;  1YJN P;  1NQ4 A;  2X2B A;  2N6Y A;  1VQN P;  1ACP A;  3CCM P;  7CEI A;  1QRJ A;  3CCV P;  2LKI A;  4IPY A;  3CPW O;  4U0E A;  3I56 P;  2QNW A;  3DS2 A;  2VSQ A;  2MR8 A;  5BS1 A;  1KLP A;  1ZNV A;  2GZI A;  4XFX A;  1Q82 Q;  2CNR A;  2KOD A;  4U0B A;  1KQS O;  2KG8 A;  3H47 A;  4PH0 A;  1S72 P;  1VQK P;  3DS4 A;  1M90 Q;  2KGC A;  4COP A;  1T8K A;  1X3O A;  3CE7 A;  5HVC A;  2EIA A;  3LRY A;  3DTJ A;  2LF4 A;  2M8P A;  2KOS A;  3G1I A;  1A8O A;  5CZD B;  2KWL A;  1UJZ A;  1Z6M A;  2MY5 A;  2JO0 A;  2FAE A;  3GKL C;  1BXI A;  5DCK A;  2JYL A;  2JU2 A;  3G21 A;  2PEO A;  5HV8 A;  1VQ6 P;  1EOQ A;  2BHV A;  2L9F A;  4BPF A;  3CC7 P;  2P9X A;  4U0A A;  2GZE A;  1VHN A;  2AFE A;  2LPK A;  1VQ8 P;  1K9M Q;  3E2D A;  4H2X C;  2KGE A;  4BPH A;  3OW2 O;  3CXC O;  3GZL A;  1AF8 A;  2K5X A;  4F37 A;  3H0D A;  3DS5 A;  1EIA A;  2FAC A;  1GPJ A;  4NEO A;  1AYI A;  1M74 A;  1A43 A;  5HGN A;  3CC4 P;  1DV5 A;  4MRT C;  2PEK A;  1YIT P;  1RO0 A;  2EHT A;  2PEJ A;  2JB0 A;  2K93 A;  3NTE A;  2N50 A;  2FVF A;  3G28 A;  1BAJ A;  2FQ2 A;  3CCS P;  1YJW P;  2XZ1 C;  4IZ6 A;  4U0D A;  3P05 A;  2GZF A;  2GYK A;  2LIU A;  3CCJ P;  2XZ0 D;  2L22 A;  1IMP A;  2LML A;  2K2Q A;  2LL8 A;  4XRO A;  2GDW A;  1VQ4 P;  4PXH B;  1EMV A;  2Z46 A;  1VQM P;  2N5I A;  4HKG A;  4H2Y C;  2K0D X;  2N5H A;  4XFY A;  3CC2 P;  2FVE A;  3DS0 A;  2E1M A;  2LIW A;  1N8R Q;  4H2W C;  1VQP P;  2L4B A;  2Z45 A;  2Z44 A;  1M6N A;  1FR2 A;  2MD9 A;  2FQ0 A;  2ROQ A;  2PY8 A;  4UHP B;  1YHQ P;  2ERH A;  5I4T G;  4CA3 A;  3WBH A;  5HGO A;  2N6Z A;  1Q81 Q;  1YI2 P;  1KD1 Q;  2GDY A;  4PH1 A;  3LMO A;  2AFD A;  3CCQ P;  3HYB A;  4M0I A;  5HGM A;  2K94 A;  2KGA A;  3EJD A;  1VKU A;  1HY8 A;  3G29 A;  1L0I A;  2M8N A;  4U0F A;  3CCU P;  4R0M A;  1Q7Y Q;  5BS2 A;  5HGL A;  5KP8 B;  2KOO A;  3G4S P;  1RNI A;  2GDX A;  4BPG A;  2WPT A;  2ONT A;  2KG9 A;  4XFZ A;  3HZQ A;  5EW5 E;  2CQ8 A;  1DNY A;  3EJE A;  2JAZ A;  2KR5 A;  5F2K A;  2AF8 A;  3G26 A;  4COC A;  1QVG O;  3DS3 A;  2EHS A;  1HQB A;  2L0Q A;  4WYM A;  2LOL A;  2XT1 A;  2VLN A;  2NO8 A;  3RG6 C;  2BUO A;  1GXG A;  2MVU A;  1M1K Q;  2EG5 A;  1VQL P;  2DNW A;  1L0H A;  3CMA P;  2DGY A;  1IUQ A;  5F2O A;  2KGD A;  1QVF O;  3GZM A;  1E6J P;  3CME P;  3G1G A;  4GR2 A;  2PEQ A;  1K8A Q;  4GR6 A;  3CCL P;  2OTJ P;  2K0Y A;  3B5I A;  1YIJ P;  1K30 A;  1E0H A;  3I55 P;  2AVA A;  1YJ9 P;  1MZ8 A;  3U43 A;  2XXM A;  4QNB A;  2FVA A;  2VLP A;  1VQ9 P;  2K92 A;  5KP7 B;  2QA4 P;  2OTL P;  2MR7 A;  1W2B O;  5EJD A;  1RO2 A;  3B4Q A;  2JYG A;  2JU1 A;  3G6E P;  3RG2 A;  2PEI A;  1UNK A;  2QEX P;  4XRQ A;  1IMQ A;  5JPA A;  2PEM A;  2VLO A;  1D1D A;  3GJN A;  5F2N A;  4DG9 A;  3G71 P;  2JQ4 A;  2M8L A;  2KOQ A;  4QKO A;  3CCR P;  2M5R A;  2N98 A;  3DPH A;  3Q20 A;  2PEN A;  1F80 D;  2FQ1 A;  2K0X A;  5KP6 B;  3CD6 P;  1VQO P;  2KG6 A; 
#chains in the Genus database with same CATH homology
 2K5X A;  1IMQ A;  4F37 A;  2VLO A;  2WPT A;  2VLN A;  2NO8 A;  1CEI A;  2GZJ A;  3GJN A;  1GXG A;  1EMV A;  1UJZ A;  2GZE A;  1FR2 A;  1ZNV A;  2GZI A;  5EW5 E;  1AYI A;  7CEI A;  1E0H A;  4QKO A;  2GZF A;  2JAZ A;  3GKL C;  2GYK A;  2VLQ A;  4UHP B;  1BXI A;  2GZG A;  1MZ8 A;  3U43 A;  2ERH A;  2K0D X;  2VLP A;  2JBG A;  1UNK A;  2JB0 A;  1IMP A;  1GXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...