2K0DX

Nmr structure of a mutant colicin e7 immunity protein im7 with an extended helix iii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
ELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTALIYEAAARAAANPGGDGGGPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E7 immunity protein
publication title Amino acid insertion reveals a necessary three-helical intermediate in the folding pathway of the colicin E7 immunity protein Im7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin inhibitor
total genus 31
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2k0dX00
2ERHA 4QKOA 1IMPA 1MZ8A 2GZJA 3GKLC 1UJZA 1E0HA 1GXHA 3U43A 4F37A 2JB0A 2GYKA 2JAZA 2VLQA 1CEIA 1UNKA 2GZFA 4UHPB 1GXGA 1IMQA 5EW5E 2GZEA 2JBGA 1EMVA 3GJNA 1ZNVA 2K0DX 2NO8A 1BXIA 1AYIA 2GZIA 1FR2A 2VLNA 7CEIA 2K5XA 2VLPA 2WPTA 2GZGA 2VLOA
chains in the Genus database with same CATH superfamily
1VKUA 4U0DA 3CCMP 2KOQA 3CXCO 2JQ4A 2CQ8A 4IPYA 1VQ8P 2FVFA 2VLNA 3DS0A 4GR2A 2KOSA 2M5RA 2KOPA 1EIAA 2JU1A 1IMPA 3MGEA 2FQ1A 3DPHA 2PNGA 1DNYA 1RO2A 2GDYA 2MY5A 2CG5B 2LPKA 1K9MQ 2GZFA 4UHPB 5HVCA 2XZ0D 1IMQA 2KGEA 2KG6A 4XFYA 3G71P 3H0DA 2KGCA 1VQPP 2L9FA 3WBHA 1K8AQ 3G21A 2E1MA 4XFZA 3U43A 2PEMA 2LIWA 3CCLP 2JYGA 2AFDA 1ZMBA 2N6ZA 1VQOP 1VQMP 5F2OA 1KLPA 2VLOA 3M1MA 1UJZA 1HQBA 3VRLC 2KGAA 4U0BA 1T8KA 1VQ4P 2OTJP 1QRJA 3G4SP 1M74A 3G1GA 2FQ0A 1ZNVA 2KG8A 1BXIA 2GZIA 2ROQA 3DS3A 2VLPA 3CCUP 3CE7A 4DG9A 2BHVA 3G28A 5BS2A 4GR6A 2VSQA 3CCRP 2X2BA 1UNKA 1A8OA 3GZLA 3CPWO 5HGLA 3CCJP 2JBGA 3CCQP 3G29A 1AYIA 3G0VA 1W2BO 1Q7YQ 1S72P 3B4QA 2K0XA 3Q20A 2QEXP 3RG6C 3CD6P 2DNWA 1E0HA 2K92A 2CGQA 2K93A 2FQ2A 2L6EA 3I56P 2BUOA 1K30A 2L4BA 1FR2A 2WPTA 2KW2A 2Z46A 1RNIA 2ONTA 4BPGA 1K73Q 1D1DA 3LRYA 1VQ7P 2OARA 2MR7A 4BPFA 1YITP 2FAEA 2XT1A 2EHTA 5F2KA 2KOOA 2LOLA 1M1KQ 3EJDA 1F80D 1YHQP 1Z6MA 2PEIA 2LL8A 1NQ4A 2P9XA 5JPAA 5HGNA 3DS1A 2N5IA 3EJBA 3HZQA 4XRQA 5DCKA 2QA4P 2PENA 1VQ5P 2K5XA 3RG2A 1AF8A 2QNWA 4BPHA 1X3OA 3G6EP 1GPJA 3NTEA 1M6NA 2K94A 4QNBA 2JO0A 2K0DX 1L0IA 2FHSC 2K2QA 2N6YA 3LMOA 3DTJA 1YJ9P 1VQNP 4CA3A 2Z45A 4QKOA 1QVGO 3DS2A 5HGMA 4PH1A 2M8LA 2VLQA 2Z44A 1GXGA 2KR5A 3OW2O 1JJ2O 1RO0A 1E6JP 4U0AA 4PH0A 2PEJA 1VQ9P 2MVUA 5HGOA 4WYMA 1NJIQ 2AFEA 2EIAA 1QVFO 2CNRA 4F37A 2N5HA 4M0IA 2N98A 2PEOA 2CWOA 2N50A 4IZ6A 1KQSO 1M90Q 4XFXA 3CC4P 4COPA 1EMVA 2FVAA 1IUQA 2FADA 5BS1A 1YIJP 2KWLA 2L22A 2MD9A 2FVEA 7CEIA 1YJWP 1N8RQ 2JB0A 4H2XC 1VQLP 2XV6A 3CCEP 2GYKA 1Q86Q 1CEIA 5KP6B 2XXMA 1Q81Q 2EFJA 5EW5E 3EJEA 2JU2A 1BAJA 4R0MA 2GDXA 2FACA 2GZGA 2ERHA 4XROA 5I4TG 1L0HA 5EJDA 4HKGA 1MZ8A 4H2WC 2LTEA 4U0CA 4NEOA 2AF8A 2K0YA 4U0FA 3DS4A 2KGDA 1YJNP 1OR5A 2MF4A 2KODA 3DS5A 2MVVA 5CZDB 2PY8A 3CMEP 3CMAP 1GXHA 2DGYA 2JYLA 2JAZA 2LIUA 1EOQA 4PXHB 2KG9A 1DV5A 3P05A 1ACPA 5HV8A 3B5IA 2GDWA 1KD1Q 2LF4A 4H2YC 1VQ6P 5KP8B 3HYBA 1Q82Q 1YI2P 2EG5A 2PEKA 1AUMA 3GZMA 2AVAA 3CCVP 3CC2P 1HY8A 3G26A 2GZEA 1A43A 3I55P 1VHNA 2M8NA 2NO8A 2EHSA 2KORA 1KC8Q 2PEQA 3NY7B 2L0QA 4COCA 1VQKP 3CC7P 4MRTC 3H47A 4PWVB 3H4EA 2GZJA 3E2DA 3GKLC 4U0EA 2JGPA 5F2NA 2OTLP 3G1IA 2M8PA 2LMLA 5KP7B 2MR8A 2XZ1C 1M6EX 3CCSP 3GJNA 2LKIA
chains in the Genus database with same CATH topology
2ERHA 4QKOA 1IMPA 1MZ8A 2GZJA 3GKLC 1UJZA 1E0HA 1GXHA 3U43A 4F37A 2JB0A 2GYKA 2JAZA 2VLQA 1CEIA 1UNKA 2GZFA 4UHPB 1GXGA 1IMQA 5EW5E 2GZEA 2JBGA 1EMVA 3GJNA 1ZNVA 2K0DX 2NO8A 1BXIA 1AYIA 2GZIA 1FR2A 2VLNA 7CEIA 2K5XA 2VLPA 2WPTA 2GZGA 2VLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERH A;  4QKO A;  1IMP A;  1MZ8 A;  2GZJ A;  3GKL C;  1UJZ A;  1E0H A;  1GXH A;  3U43 A;  4F37 A;  2JB0 A;  2GYK A;  2JAZ A;  2VLQ A;  1CEI A;  1UNK A;  2GZF A;  4UHP B;  1GXG A;  1IMQ A;  5EW5 E;  2GZE A;  2JBG A;  1EMV A;  3GJN A;  1ZNV A;  2K0D X;  2NO8 A;  1BXI A;  1AYI A;  2GZI A;  1FR2 A;  2VLN A;  7CEI A;  2K5X A;  2VLP A;  2WPT A;  2GZG A;  2VLO A; 
#chains in the Genus database with same CATH topology
 1VKU A;  4U0D A;  3CCM P;  2KOQ A;  3CXC O;  2JQ4 A;  2CQ8 A;  4IPY A;  1VQ8 P;  2FVF A;  2VLN A;  3DS0 A;  4GR2 A;  2KOS A;  2M5R A;  2KOP A;  1EIA A;  2JU1 A;  1IMP A;  3MGE A;  2FQ1 A;  3DPH A;  2PNG A;  1DNY A;  1RO2 A;  2GDY A;  2MY5 A;  2CG5 B;  2LPK A;  1K9M Q;  2GZF A;  4UHP B;  5HVC A;  2XZ0 D;  1IMQ A;  2KGE A;  2KG6 A;  4XFY A;  3G71 P;  3H0D A;  2KGC A;  1VQP P;  2L9F A;  3WBH A;  1K8A Q;  3G21 A;  2E1M A;  4XFZ A;  3U43 A;  2PEM A;  2LIW A;  3CCL P;  2JYG A;  2AFD A;  1ZMB A;  2N6Z A;  1VQO P;  1VQM P;  5F2O A;  1KLP A;  2VLO A;  3M1M A;  1UJZ A;  1HQB A;  3VRL C;  2KGA A;  4U0B A;  1T8K A;  1VQ4 P;  2OTJ P;  1QRJ A;  3G4S P;  1M74 A;  3G1G A;  2FQ0 A;  1ZNV A;  2KG8 A;  1BXI A;  2GZI A;  2ROQ A;  3DS3 A;  2VLP A;  3CCU P;  3CE7 A;  4DG9 A;  2BHV A;  3G28 A;  5BS2 A;  4GR6 A;  2VSQ A;  3CCR P;  2X2B A;  1UNK A;  1A8O A;  3GZL A;  3CPW O;  5HGL A;  3CCJ P;  2JBG A;  3CCQ P;  3G29 A;  1AYI A;  3G0V A;  1W2B O;  1Q7Y Q;  1S72 P;  3B4Q A;  2K0X A;  3Q20 A;  2QEX P;  3RG6 C;  3CD6 P;  2DNW A;  1E0H A;  2K92 A;  2CGQ A;  2K93 A;  2FQ2 A;  2L6E A;  3I56 P;  2BUO A;  1K30 A;  2L4B A;  1FR2 A;  2WPT A;  2KW2 A;  2Z46 A;  1RNI A;  2ONT A;  4BPG A;  1K73 Q;  1D1D A;  3LRY A;  1VQ7 P;  2OAR A;  2MR7 A;  4BPF A;  1YIT P;  2FAE A;  2XT1 A;  2EHT A;  5F2K A;  2KOO A;  2LOL A;  1M1K Q;  3EJD A;  1F80 D;  1YHQ P;  1Z6M A;  2PEI A;  2LL8 A;  1NQ4 A;  2P9X A;  5JPA A;  5HGN A;  3DS1 A;  2N5I A;  3EJB A;  3HZQ A;  4XRQ A;  5DCK A;  2QA4 P;  2PEN A;  1VQ5 P;  2K5X A;  3RG2 A;  1AF8 A;  2QNW A;  4BPH A;  1X3O A;  3G6E P;  1GPJ A;  3NTE A;  1M6N A;  2K94 A;  4QNB A;  2JO0 A;  2K0D X;  1L0I A;  2FHS C;  2K2Q A;  2N6Y A;  3LMO A;  3DTJ A;  1YJ9 P;  1VQN P;  4CA3 A;  2Z45 A;  4QKO A;  1QVG O;  3DS2 A;  5HGM A;  4PH1 A;  2M8L A;  2VLQ A;  2Z44 A;  1GXG A;  2KR5 A;  3OW2 O;  1JJ2 O;  1RO0 A;  1E6J P;  4U0A A;  4PH0 A;  2PEJ A;  1VQ9 P;  2MVU A;  5HGO A;  4WYM A;  1NJI Q;  2AFE A;  2EIA A;  1QVF O;  2CNR A;  4F37 A;  2N5H A;  4M0I A;  2N98 A;  2PEO A;  2CWO A;  2N50 A;  4IZ6 A;  1KQS O;  1M90 Q;  4XFX A;  3CC4 P;  4COP A;  1EMV A;  2FVA A;  1IUQ A;  2FAD A;  5BS1 A;  1YIJ P;  2KWL A;  2L22 A;  2MD9 A;  2FVE A;  7CEI A;  1YJW P;  1N8R Q;  2JB0 A;  4H2X C;  1VQL P;  2XV6 A;  3CCE P;  2GYK A;  1Q86 Q;  1CEI A;  5KP6 B;  2XXM A;  1Q81 Q;  2EFJ A;  5EW5 E;  3EJE A;  2JU2 A;  1BAJ A;  4R0M A;  2GDX A;  2FAC A;  2GZG A;  2ERH A;  4XRO A;  5I4T G;  1L0H A;  5EJD A;  4HKG A;  1MZ8 A;  4H2W C;  2LTE A;  4U0C A;  4NEO A;  2AF8 A;  2K0Y A;  4U0F A;  3DS4 A;  2KGD A;  1YJN P;  1OR5 A;  2MF4 A;  2KOD A;  3DS5 A;  2MVV A;  5CZD B;  2PY8 A;  3CME P;  3CMA P;  1GXH A;  2DGY A;  2JYL A;  2JAZ A;  2LIU A;  1EOQ A;  4PXH B;  2KG9 A;  1DV5 A;  3P05 A;  1ACP A;  5HV8 A;  3B5I A;  2GDW A;  1KD1 Q;  2LF4 A;  4H2Y C;  1VQ6 P;  5KP8 B;  3HYB A;  1Q82 Q;  1YI2 P;  2EG5 A;  2PEK A;  1AUM A;  3GZM A;  2AVA A;  3CCV P;  3CC2 P;  1HY8 A;  3G26 A;  2GZE A;  1A43 A;  3I55 P;  1VHN A;  2M8N A;  2NO8 A;  2EHS A;  2KOR A;  1KC8 Q;  2PEQ A;  3NY7 B;  2L0Q A;  4COC A;  1VQK P;  3CC7 P;  4MRT C;  3H47 A;  4PWV B;  3H4E A;  2GZJ A;  3E2D A;  3GKL C;  4U0E A;  2JGP A;  5F2N A;  2OTL P;  3G1I A;  2M8P A;  2LML A;  5KP7 B;  2MR8 A;  2XZ1 C;  1M6E X;  3CCS P;  3GJN A;  2LKI A; 
#chains in the Genus database with same CATH homology
 2ERH A;  4QKO A;  1IMP A;  1MZ8 A;  2GZJ A;  3GKL C;  1UJZ A;  1E0H A;  1GXH A;  3U43 A;  4F37 A;  2JB0 A;  2GYK A;  2JAZ A;  2VLQ A;  1CEI A;  1UNK A;  2GZF A;  4UHP B;  1GXG A;  1IMQ A;  5EW5 E;  2GZE A;  2JBG A;  1EMV A;  3GJN A;  1ZNV A;  2K0D X;  2NO8 A;  1BXI A;  1AYI A;  2GZI A;  1FR2 A;  2VLN A;  7CEI A;  2K5X A;  2VLP A;  2WPT A;  2GZG A;  2VLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...