1QVFO

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qvfO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1qvfO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1qvfO03
1VQ9P 3CMAP 1VQ6P 3I56P 1Q7YQ 1M1KQ 2OTJP 3G4SP 1JJ2O 3CCVP 1VQMP 3OW2O 1M90Q 1VQLP 1Q86Q 2QA4P 3I55P 3G6EP 3CCJP 3CCUP 1Q82Q 1QVGO 1KC8Q 3CC7P 1QVFO 1K8AQ 1VQ8P 1VQ7P 1YJNP 1YHQP 1VQPP 1Q81Q 1KQSO 1VQ5P 1YI2P 1VQKP 3CMEP 3CD6P 3CCRP 1VQOP 1W2BO 3CCMP 1K73Q 3CXCO 3CCQP 1N8RQ 3CCSP 1NJIQ 1VQ4P 3CPWO 3G71P 1YJWP 1KD1Q 3CCLP 1S72P 2OTLP 1YITP 1K9MQ 3CC4P 1YIJP 1YJ9P 3CCEP 3CC2P 1VQNP 2QEXP
chains in the Genus database with same CATH superfamily
1KTMA 1JJ2O 1J1EC 4U3FD 1ZNVA 3CE7A 4PD4E 2I1KA 4ASVA 2L22A 2K92A 1LTBC 1GL2C 5CBOA 1S5LH 2VLNA 2LIUA 3AE9C 4PJ0H 2FYNB 2D2CC 1PGJA 3DS4A 3AEDC 4KHXA 1YJ9P 2QJYC 1SQQJ 2VRSA 1LTTC 1BXIA 3JCUH 2WPRA 1JY3P 4C7NB 4I6MC 3FWLA 1BCCD 1L0NG 2R3SA 4WVZA 1ZV8A 3IN6A 1U7JA 4UB6E 1IK7A 1L0IA 4MN4C 2N1TD 3M9QA 1A02F 1FE6A 5KP6B 1X3OA 2FXOA 4D6TD 1G2CA 4B86A 2QG4A 1QVGO 3CC7P 2E76B 2WSEJ 5HGMA 1NGMB 1KORA 1L0LE 1S4XA 1RF0C 2PRRA 1UNKA 1OVUA 5AVWB 2Z4EA 3H1LG 1NTKG 3L71D 2XNXA 2Y0CA 2MR8A 1J1DC 5KLVE 3U1AA 3L37A 4GT1A 1KMIZ 1OX3A 1PP9G 1DEBA 2BASA 1VQ7P 1VF5B 3AEGC 1SQXG 2B89A 4Y99C 1M1JA 1YI2P 1BGYE 2KB7P 2LR2A 3JSVC 3RBZA 1JY2P 3CWBE 2GZFA 4PD4D 3HE5A 5AVUB 2LKIA 1QL1A 2MF4A 2ONTA 5L8RJ 2E5TA 2BUOA 4BRYA 2EFJA 1FS0E 1RQVA 2N1TA 2KI7B 1LP1A 3P8MC 4NEOA 1VQOP 4WY4B 3P05A 2PEKA 2JBGA 2Y9ZA 2QJKC 1S72P 1BE3G 5CCHD 4PH0A 4XROA 3L73E 2OYIB 1SQBG 4PD4I 3OW2O 3MP7B 3V6IA 3PTZA 2A45I 3D6ZA 1YHQP 2M8PA 5KTBA 2K94A 2IBZE 2MKVA 2KZIA 1NTKK 4GDOA 2W90A 3U59A 1L0LD 1QGKB 1TU3F 3L75J 2ZJSE 3RBXA 3W68A 3V4WA 3HTKA 3HE4A 3H1JJ 2EG5A 1SQXK 3H1KE 2LIWA 2W83C 1RO2A 1IMQA 4MRTC 2JU1A 3DS1A 2GZGA 1DD3A 2L6EA 4H13B 1QL2A 3LW5J 3H0DA 5CCHA 3CWBD 1RO0A 2P9XA 4IFFA 1NOHA 5CJ4A 5APQA 5KAIH 1HWTC 2V7QH 2FFDC 3M1MA 4N3YB 1FOSE 2GDYA 1FDOA 1L0ND 2N6ZA 2P1JA 3BRTB 1NTMD 4BXLA 1VQ6P 1W5CE 2L9FA 5F2KA 2BEQD 1IFIA 3CLQA 3DPHA 1Q86Q 2ZFCA 1X22A 2QSIA 1SQBK 5E79E 1NYHA 1R5SA 3L71J 3G29A 2OYHC 3A0HE 4F37A 2XDJA 3RL0g 4PD4H 3DS2A 3VMYA 1SP4A 2KOQA 4R4LA 2A45H 2EIAA 1KB9D 1M6EX 1AV1A 2E74C 3IAOA 3BCCE 4AYCA 5HVCA 1PEUA 2NPSB 4BPFA 3L70D 1ZMBA 2XU6A 1YYCA 3KDPB 3LRYA 4H44D 1LTJB 2IX7C 1GU4A 3W67A 3RL0D 1NU1G 2FKWB 4HKZH 1KB9I 1SQQG 1J2JB 3H1KD 2ZVOB 2PEOA 2AEMA 4PH1A 3GW6A 4QMAA 2AXCA 3RK3B 5CZDB 3H1IJ 2GA1A 2OTKE 1N73C 1JTHB 2LPKA 2XV5A 4LC1A 1PPJG 2K9JB 3KPEA 3V2NA 4XA4A 1H0TB 2PFXA 2KLVA 5AVYB 3WU2E 4XFZA 3PLNA 5KLVJ 1XTCC 1URQC 2BEZF 1PGOA 1SQPK 2WT7A 2IYOA 2WMMA 2J5UA 3L74J 1BGYJ 3Q5SA 5HGOA 1AFOA 1W2EA 2O01J 2HPCA 4H2XC 2VLOA 1NKZB 3CC2P 2DGYA 2R5DA 1RF1A 2FVAA 3G1IA 4A7PA 1GD2E 3V2PA 1X9VA 4HH2A 2VLQA 5KAFH 1NU1K 3CCJP 1K8AQ 1OVRA 1OIPA 1NJIQ 1FZFA 2KW2A 1KB9H 2PEMA 1MFTA 3NTEA 2FVFA 3N4XA 2IPPA 1M56D 4M0IA 3L73J 1KILD 2I1JA 3AE2C 1BSHA 2ERHA 1G2CB 2AXTH 2Q5UA 4DOJA 2FYUG 2LXCB 4U0CA 2KLUA 2ZXXA 2Y0DA 2XV6A 2H88C 5DJTB 4I7ZB 4U3FG 1FZBA 2R3CA 1GL2D 2QIWA 3TSIA 1AA0A 5B66H 2C9LY 2D2CD 2IFNA 1G1IA 2P58A 3VP8A 2Z5IA 3ABVC 4PXHB 2BCCE 4XFXA 3L75G 2PEQA 3P7KA 2KGEA 1GTWA 5B5EE 3H1JG 2QNWA 1IC2A 2WPQA 2KG8A 3CCEP 4LGDE 4COPA 2HODA 3WUUA 1RH5B 2QM7A 2Q7CA 3HE5B 1S2EA 5DCKA 1HTLC 2H7HA 2XZ0D 1JCDA 4GKGA 1KFMA 2E76C 2KG6A 4WWIA 2JU2A 1KILA 3CX5E 4D6TG 1SQQD 1EMVA 5E79H 1M7LA 1Q90D 2FXPA 5EJDA 3A0HH 1JMMA 3CMAP 3MZWB 3Q5PA 3EJBA 2E42A 4GIFA 5H2FE 1QVFO 4U0AA 3M06A 3B5IA 1T6AA 1W2BO 3L71G 3H25A 1KYOD 2FYUK 3RK2B 3G71P 1HBWA 5APYA 5AW7B 1ZLLA 2YKOA 1IZNB 3DS5A 1UJZA 4UB8E 1IO4A 3BCCJ 1X79B 4WY4C 2W6AA 2HG5D 1HF9A 2A45G 2VLPA 1EDLA 3G26A 2L91A 1KYOI 3C1LA 2K37A 1NTZE 1FZAA 2BCCD 2WWWA 2QA4P 3M91A 3WUVA 3TYYA 1IJDB 2N9BA 2KR5A 1RHZB 2JEEA 2FAEA 2HFED 5AVSB 1RF0A 1AQTA 4BPHA 2CGQA 2E5YA 1DIPA 1Y9BA 5BS2A 5CJ0A 4WYMA 5EW5E 1JB0J 3AE8C 4U0DA 1IFJA 1LJ2A 2UWJE 5CCGD 4IFDK 1E79H 5APUA 3VMAA 2ZVNB 1NVOA 3B71A 2YO3A 1K73Q 1L0LG 2YXQB 2KSEA 3P8CE 2HLOA 2BQ1E 2E1MA 1U57A 5APXA 2L4BA 1IFNA 1MV8A 1ZR2A 2XXMA 2B9BA 3B5NB 4U7JA 1QX8A 3KHUA 3KXDA 1P84D 2DW3A 2JYLA 3CWBG 3L75D 1EZVD 3VMZA 3G28A 4IL6H 3U1CA 2JJLA 4M3LA 2GZJA 3H1JD 2YIUB 2FVEA 2E75B 2GZEA 1YTZT 1KYOH 2QE7H 2LTEA 2WPVB 2N5IA 3E1IA 2M5RA 1NTMG 1NAFA 3BRVB 5CCGA 5K5GB 3H1IE 4XFYA 5AW0B 2ZXEB 2WSEH 3O6QB 3HD7C 2POHA 1P84I 1YBKA 4WBAA 1EZVI 5AW5B 1FZEA 2E74D 2M3EA 1WT6A 1RQUA 1LTJC 3FX0A 1IFMA 4Z1MH 3L4FA 3GZMA 1OR5A 1L0LK 1G1JA 4C46A 3L70G 3CI9A 1YTZI 4O9BA 4H44B 2IDBA 2WT7B 2BCCJ 3L74E 1GW3A 2FFDA 4GOFA 3SWKA 3P8CD 3TGUJ 4DJGA 3H1KG 1LT9B 1FZCC 2HPCB 1K30A 4JBZA 4IPYA 1VPCA 2WPTA 3LIDA 1T8ZA 2ZT9B 5APVA 2OYHA 2IFMA 2YXRB 3BASA 3CXHE 3KYQA 2YMYA 3H4EA 1L0NK 1M57D 3M9HA 5H2FH 1NTMK 1EC5A 1N7SB 3O8ZA 1H8AA 1PL5A 3AE4C 3G4SP 1LTIC 2PEJA 3H1ID 3QH9A 2GUSA 3GF3A 2QJPB 4ZMDA 1P84H 1URQD 3TDKA 2L5GB 5CCGC 4NPDA 1QEXA 2M8NA 5BS1A 4DCKA 1AVOA 4JYBA 2FHSC 3L72J 2YO2A 1M74A 3BCCG 3A2AA 3H1LE 3LW5H 1OZHA 4IFMA 2P10A 1T3JA 2K3RA 5KLVD 2KNCA 1N73A 1CZQA 1HGZA 2KWLA 1K05A 3II6A 1A02J 2PY8A 2HODB 5KP7B 1NTZJ 4H0LC 3L74D 1BGYD 1OW6A 1CI6A 4H2WC 2QRXA 3T97A 2Q3IA 1SQVJ 2M5AA 1VQ8P 4RJTA 2PEIA 2GUVA 4HJGH 4I7ZC 2R44A 1SFCC 2K0XA 5TISH 3ITKA 2B87B 1USDA 1JMBA 1URQA 3LIEA 3HUSB 1J1EB 2JQ4A 3CXHD 5AW9B 4COCA 2C9NY 5APWA 1L4AB 1FC2C 1GL2B 4TT3H 1N2DC 4PWVB 1BE3E 1KQSO 5F2NA 3L73D 1X0TA 2KOOA 3F5HA 4JYCA 2D2CB 2P2UA 1SQBE 2AVAA 2CWOA 1DH3A 2YKPA 1KQLA 2KOGA 1GK4A 2N50A 3CCUP 4EI2A 2JWAA 3CXHI 2V4HA 2IBZD 4N78E 3PJSK 4XRQA 3MGNA 5DJUB 2E76D 3GHGC 5KLIC 3I5CA 2KS1B 5HV8A 1GPJA 2JDIH 4UB6H 2W6BA 1EQ7A 2WSCJ 3D71A 1GK6A 3AE7C 4NPEA 3H1HJ 3QWOC 3RK2C 3GG2A 2H8PD 5AVRB 1VF5D 2IBZI 3TK1A 2OQQA 3H47A 1AF8A 2VSQA 2Q3EA 4EYYQ 4C7NA 3Q1MA 4YXWH 2GYKA 5HGLA 2YKQA 1VL2A 4U0BA 3USSA 1HGVA 3PRJA 1UIIA 2Z45A 2IZ0A 3SFEC 3Q3DA 2LL8A 4PV1C 3D70A 3G9RA 2K0DX 2KXPB 4WY4D 1LWUB 4DZOA 2LF4A 1L0HA 4GR6A 2O01H 3HRNA 1CSBA 2KIKA 3OAKA 1M6NA 1MUUA 2O01N 2GDWA 4CPGA 2BCCG 5AVZB 2JO0A 2CK3H 2J59M 1SQPE 2KK7A 1FOSF 3AECC 5AVQB 3BCCD 3CXHH 1K04A 1OVVA 2K1AA 2KORA 1SQQK 4OGQB 2PENA 3FWNA 1GXGA 2K2QA 2G8YA 4K35A 3SWFA 2W6JH 2WSFJ 1NU1E 1FDMA 4OWFA 3KZIE 3GKLC 3PP5A 2EHSA 1S5LE 1KLPA 2A06E 3K5BA 4R0MA 4WY4A 3B5NC 1RNIA 3RK3E 2OARA 3EQ2A 1NWQA 2RKLA 2FYNC 1ZR4A 1PEQA 1PPJE 1A8OA 2YNYA 2YIUC 1N86A 1JY3O 3M0AA 2E75C 1X8YA 1IMPA 2LMLA 2Q6QA 1RE3C 2XKMA 1BDCA 1CW5A 3FXEA 1YJNP 3WBHA 1IK9A 1ZN5A 3CCRP 5AVTB 1EZVG 4OH8B 1M1JB 3H1LJ 1NTKJ 2AFDA 1KQGB 3E1RA 3TGUE 1ZRTE 2OTLP 2M8RA 3MIWA 1S1CX 3S1KA 1AUMA 1FJPA 1Y8AA 1PP9J 1WRGA 1LTSC 1SQXJ 2HR3A 4YXDC 1HJ0A 3A0BE 1AVYA 3HD7D 4BRYB 4NPFX 1YQ3C 2N5HA 2PP6A 2N1TB 1LP1B 2G3AA 1Z6MA 1RE4C 1N7LA 2KGCA 1VF5C 3B4QA 1M8OB 4BWNA 1JY2O 4OVNF 1BE3J 2WSSH 2X2BA 1AYIA 4QNBA 1LT9C 3CL3D 3EJDA 1GW4A 4TLFA 2A06D 5APTA 1SQBJ 2KODA 4R4MA 5AW4B 2KP8A 1JNMA 3MTUE 1JCCA 3L72E 3EWKA 2ZT9C 3AE6C 2JAZA 4U3FE 1EXJA 4GODA 3HTKB 3HE4B 1N7SC 3V5BA 2WTYA 3BATA 1PV3A 1FBMA 1N73B 3HD7A 3UIAA 2OYIC 1BSNA 4KJMA 2AFEA 4W7YA 3TNUA 4RO0A 2NPSA 2QVAA 3TGUD 1SQVE 3NTNA 1PGPA 2JYGA 3T97B 3DS3A 3NMDA 1LTJA 1BCCE 3A7OA 1E5WA 4RKUJ 3AEEC 3B4SA 1K9MQ 2C0WA 5APSA 3RGUA 3H1IG 3U43A 3MGEA 5AVVB 1S5LX 2ITAA 1GDTA 1URQB 1KC8Q 1NHLA 1S9KE 3CX5D 3WU2H 4D6TE 4BPGA 4RESB 4L74A 2AF8A 4L75A 1FZCA 1JTHA 4JPZB 1R8EA 3OA7A 1S3JA 4H13C 5KAIE 4YPCA 1OWAA 3Q2YA 5KKZB 3MD0A 3VYIA 1MZ8A 5KLVG 4Y28J 3V2QA 1H0TA 3HZQA 2K9YA 4H0LD 1LNQA 3CX5I 1JY3N 3CCLP 2KG9A 3L74G 1BGYG 2M3BA 3L72D 3RG2A 2PGDA 1SQPJ 3IR9A 3HUSC 2JGPA 1RY3A 1SFCD 1L4AC 1FR2A 4C7RA 3KZIH 5AW2B 2ROQA 3FXDA 3H1HE 2QM8A 4W7ZA 2M8LA 3F89A 3MUDC 1NTZD 1FJKA 1SS1A 1NU1J 1SQVD 3AEFC 1QLED 2RMZA 3D6YA 1GU5A 3L73G 2JB0A 4U0FA 2OYOA 5CHXA 1HQBA 3NY7B 4ZNCA 2NPSC 1PZQA 3IF4A 5AW3B 3CCMP 3Q20A 2GM4A 1Z56A 3EJEA 1LT1A 1S9KD 1VQ9P 1JY2N 3I56P 1EXIA 4QKOA 5B5EH 2IBZG 4GR2A 3C9IA 3G1GA 1NH4A 2MVVA 1KN7A 5KJ7C 2M0BA 4CA3A 3V2RA 1PEMA 5KLVK 2H89C 2MR7A 1N8RQ 2SPZA 2XZRA 1SFCA 3RK3C 3CPWO 3RL0B 2K0YA 3A0BH 2MJZA 5M1BA 3LMOA 3VP9A 5AW8B 7CEIA 3RK2D 1RF1B 3CX5H 1USEA 1PFIA 2R32A 2C0XA 2LKMA 5AVXB 1T2KC 1BDDA 2MVUA 2N9YB 2ZYAA 3H32A 2JP3A 2Z44A 1T8KA 2DNWA 3AE1C 5F2OA 1LWUC 1OW8A 3WMM0 5AW1B 4PV1D 4XE5B 3H1HD 1L2PA 1DD4A 1L0NE 5GTIE 5I4TG 2ZYDA 1NTME 2FY8A 3NFQA 2K5XA 2E43A 1VQ5P 2IYPA 2KGAA 2MY5A 5KAFE 3GHGA 1Y47A 4UB8H 1MFZA 2K88A 1GXHA 3CC4P 1HH0A 4I2LC 3G0VA 5CMZA 1ZW0A 2FYUJ 3NXSA 1KB9E 4JQ0D 1Q82Q 3S4RA 4OGQC 3VTPC 1WMKA 4U3FJ 2RN0A 4L73A 1NTKE 3L36A 4EDFA 2AXTE 1VHNA 3L70E 2QEXP 3VOPA 1PP9E 1SQXE 2O1JA 2Q1KA 4IOIH 4L76A 5B66E 4AQRD 4GOEA 1KILB 5CBNA 1BCCJ 3B5ND 3M0DA 1YIJP 3OJAB 2JO1A 1ZMEC 3HYBA 3B8EB 2WZ7A 1AJYA 1UIXA 1NAYA 3GZLA 3WUTA 1LTGC 2OGUA 4D6TJ 1M1JC 3JC22 4HYTB 3CCSP 2E75D 4EIJA 3H6PA 1OW7A 1VDFA 1OMIA 1NKNA 2QJYB 2BHVA 2V7QJ 1EIAA 2PAJA 2Y0EA 1VQPP 1FAVA 2N1TC 1EDJA 4DG9A 2WQYC 2WSCH 1PIXA 1U7MA 2OTJP 1SQPG 3HD7B 1Q2NA 2O1KA 1EDIA 3H1LD 1NTKD 3P32A 3B5NA 3TNUB 1H88A 1FU1A 4XFJA 3CMEP 1VQKP 3EFFK 3S9OA 2HYNA 1GMJA 1GZLA 3G3ZA 3CXCO 1HVVA 3L35A 5GTHE 1PP9D 2KZJA 2IZ1A 1SQXD 2B88A 4DT0A 3TF5A 2JWDA 1DX7A 4ZKUA 1J1DB 1SLQA 1RE3A 5HGNA 5KP8B 1KILE 2NZ2A 2A06G 1BAJA 4Y99B 1ZXGA 1JO5A 2ZT9D 1JUNA 1KQFB 1FZGA 1R5LA 3O6QA 2WITA 1FZCB 1D7MA 4IZ6A 2FADA 3M0DC 1N7SD 1BE3D 2O3JA 1FDIA 3G6EP 3E7KA 1DEEG 2ZYGA 5CCHC 5BU8B 1SQBD 1L0LJ 2FQ2A 2FQ0A 1HUCA 2QJKB 3TGUG 3AE5C 5C39A 3N7NA 3SWYA 3CCVP 1E6JP 1LGHB 1RE4A 2FACA 1VQLP 2WSFH 1PEOA 2AEFA 3KQGA 2MD9A 4EOTA 1HJBA 1NO4A 4N78D 1HY8A 3PH0A 2CQ8A 3A5TA 1SVFA 3AEAC 5BU5A 3VMXA 3VRLC 5GTIH 1LT9A 3VN0A 4ZKPA 1VQ4P 3CWBJ 3MHVA 4I1LA 2N98A 3M9BA 2P67A 1SQQE 2EHTA 1T3UA 2ZAEB 4WB4A 5KKZC 2KGDA 4PJ0E 1L0NJ 1ZP0C 1NTMJ 4U0EA 2KYVA 3CD6P 4H13D 1NQ4A 4IL6E 3DS0A 3G21A 1N7SA 1IFDA 3JCUE 2OYIA 1KYOE 5EFWB 2R5BA 2YMKA 5BVZA 2JR8A 4LLHA 4H0LB 2I8DA 3L72G 4AUWA 2L0QA 3BVHA 4JF7A 3IFMA 2FXMA 4W80A 1L4AD 1SFCB 1ZOYC 3SSUA 2FFDB 2GDXA 3L70J 1KZUB 3R2PA 2JKVA 2NRGA 3Q5RA 1JEKA 2FYZA 1NTZG 3A3YB 2Z46A 1SQVG 1SQPD 2OYHB 3H1KJ 3H32B 3V4QA 2NPSD 2J58A 3GJNA 1EDKA 1BCCG 1JM0A 1CEIA 2RH0A 2CPSA 1M1KQ 2W8ZA 1VQMP 4UHPB 2E74B 1F80D 2WVRA 2Q9IA 1OFCX 4H44C 2KOPA 4N6JA 1NU1D 2XNDH 3RL0C 3GMAA 1QRJA 2CPBA 3RG6C 3DTJA 5KJ7D 2KSJA 2B87A 2H43A 2Z5HA 3GHGB 1XTGB 5KLIB 3SFDC 2XT1A 3HUSA 1RF1C 3AEBC 3RK3D 3EFGA 1L4AA 2N6YA 2W27A 3GLMA 1GL2A 2FYUE 2P7JA 4H2YC 2NO8A 2CG5B 3GF7A 2FBWC 1H89A 1PPJD 1KFNA 3MUDA 4HB1A 1YJWP 1T2KD 1YITP 2K93A 1LTAC 1E0HA 4ASWA 1VQNP 2KNCB 1DNYA 2LOLA 1OXZA 5GTHH 1A43A 1P84E 1VKUA 4KT0J 3L75E 4HKGA 1EZVE 3AE3C 1CI6B 1ZRTD 3H1JE 5AW6B 2QJPC 3C8VA 1NTZK 2M5AB 1D1DA 4PV1B 3H1HG 1JOCA 1SQVK 2KS1A 2KUBA 1KV4A 3E2DA 1MKMA 1YQ4C 2Y9YA 1Q7YQ 1M90Q 5KJ7A 1PGQA 1IFPA 1Q81Q 2GZIA 1DV5A 4K3AA 1ACPA 2KOSA 1KD1Q 4IL6X 2LXBA 3ZDMA 2CNRA 4OGQD 2PNGA 3R4YA 3PHLA 2WPSA 3I55P 1EOQA 1IUQA 1MZ9A 2K9JA 3L71E 2XZ1C 5TISE 5TJHA 1KILC 3FGAD 4YTPC 3CCQP 2AEJA 5JPAA 1LWUA 2FYUD 2FQ1A 1AQ5A
chains in the Genus database with same CATH topology
2PY8A 3G0VA 4XFZA 1VQ6P 2OTJP 4U0DA 5F2KA 1JJ2O 3DPHA 1Q86Q 5DCKA 2ONTA 5HGLA 1Q82Q 2BUOA 4U0FA 4U0BA 1VQ8P 2EFJA 4U0EA 2JYGA 3G29A 3DS3A 3WBHA 1YJNP 3CMEP 3CD6P 2Z45A 1VQKP 2PEIA 3CCRP 1VQOP 3DS0A 3P05A 3CXCO 3CCMP 2PEKA 3G21A 1K73Q 3DS2A 5HGOA 1YJWP 3Q20A 1S72P 2OTLP 1YITP 3DS4A 1K9MQ 4PH0A 4XROA 1YJ9P 2EIAA 3CC2P 2DGYA 1M6EX 1K30A 2QEXP 3G1IA 1VQ9P 1AUMA 1VQNP 3CMAP 3I56P 3MGEA 4IPYA 3OW2O 2LF4A 4GR6A 4GR2A 2BQ1E 1A43A 2E1MA 3G1GA 4COCA 3CCJP 1KC8Q 1QVFO 4U0AA 5HGNA 1K8AQ 3B5IA 1M6NA 1PEUA 1PEMA 1BAJA 1YHQP 2XXMA 1KQSO 2M8PA 1W2BO 5F2NA 1N8RQ 1D1DA 1ZMBA 3H4EA 1NJIQ 3CPWO 3G71P 3E2DA 3LRYA 2PEMA 2JO0A 3NTEA 1YIJP 2JYLA 2CWOA 3HYBA 4M0IA 3G28A 1Q7YQ 3G4SP 3DS5A 1M90Q 3G6EP 3CCUP 2PEOA 1QVGO 3CC7P 2PEJA 2Z46A 4PH1A 1Q81Q 2PENA 4U0CA 3HZQA 5HGMA 2EG5A 2XV6A 3CCSP 2Z44A 4XRQA 3CCLP 1KD1Q 4QNBA 5F2OA 1RO2A 3G26A 4XFYA 2KODA 2M8NA 5BS1A 3DS1A 1M1KQ 2L6EA 3CCVP 1E6JP 1VQMP 1VQLP 2QA4P 1PEOA 3I55P 2BHVA 5I4TG 3H0DA 1EOQA 1IUQA 1EIAA 1RO0A 2P9XA 1VQ7P 1RNIA 2OARA 1VQPP 4XFXA 1M74A 1VQ5P 1YI2P 2PEQA 2M8LA 3VRLC 3CCQP 5JPAA 1QRJA 1VQ4P 3M1MA 3RG6C 3DTJA 1PEQA 3CC4P 5BS2A 3CCEP 3H47A 4COPA 4WYMA 1A8OA 2XT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 P;  3CMA P;  1VQ6 P;  3I56 P;  1Q7Y Q;  1M1K Q;  2OTJ P;  3G4S P;  1JJ2 O;  3CCV P;  1VQM P;  3OW2 O;  1M90 Q;  1VQL P;  1Q86 Q;  2QA4 P;  3I55 P;  3G6E P;  3CCJ P;  3CCU P;  1Q82 Q;  1QVG O;  1KC8 Q;  3CC7 P;  1QVF O;  1K8A Q;  1VQ8 P;  1VQ7 P;  1YJN P;  1YHQ P;  1VQP P;  1Q81 Q;  1KQS O;  1VQ5 P;  1YI2 P;  1VQK P;  3CME P;  3CD6 P;  3CCR P;  1VQO P;  1W2B O;  3CCM P;  1K73 Q;  3CXC O;  3CCQ P;  1N8R Q;  3CCS P;  1NJI Q;  1VQ4 P;  3CPW O;  3G71 P;  1YJW P;  1KD1 Q;  3CCL P;  1S72 P;  2OTL P;  1YIT P;  1K9M Q;  3CC4 P;  1YIJ P;  1YJ9 P;  3CCE P;  3CC2 P;  1VQN P;  2QEX P; 
#chains in the Genus database with same CATH topology
 1KTM A;  1JJ2 O;  1J1E C;  4U3F D;  1ZNV A;  3CE7 A;  4PD4 E;  2I1K A;  4ASV A;  2L22 A;  2K92 A;  1LTB C;  1GL2 C;  5CBO A;  1S5L H;  2VLN A;  2LIU A;  3AE9 C;  4PJ0 H;  2FYN B;  2D2C C;  1PGJ A;  3DS4 A;  3AED C;  4KHX A;  1YJ9 P;  2QJY C;  1SQQ J;  2VRS A;  1LTT C;  1BXI A;  3JCU H;  2WPR A;  1JY3 P;  4C7N B;  4I6M C;  3FWL A;  1BCC D;  1L0N G;  2R3S A;  4WVZ A;  1ZV8 A;  3IN6 A;  1U7J A;  4UB6 E;  1IK7 A;  1L0I A;  4MN4 C;  2N1T D;  3M9Q A;  1A02 F;  1FE6 A;  5KP6 B;  1X3O A;  2FXO A;  4D6T D;  1G2C A;  4B86 A;  2QG4 A;  1QVG O;  3CC7 P;  2E76 B;  2WSE J;  5HGM A;  1NGM B;  1KOR A;  1L0L E;  1S4X A;  1RF0 C;  2PRR A;  1UNK A;  1OVU A;  5AVW B;  2Z4E A;  3H1L G;  1NTK G;  3L71 D;  2XNX A;  2Y0C A;  2MR8 A;  1J1D C;  5KLV E;  3U1A A;  3L37 A;  4GT1 A;  1KMI Z;  1OX3 A;  1PP9 G;  1DEB A;  2BAS A;  1VQ7 P;  1VF5 B;  3AEG C;  1SQX G;  2B89 A;  4Y99 C;  1M1J A;  1YI2 P;  1BGY E;  2KB7 P;  2LR2 A;  3JSV C;  3RBZ A;  1JY2 P;  3CWB E;  2GZF A;  4PD4 D;  3HE5 A;  5AVU B;  2LKI A;  1QL1 A;  2MF4 A;  2ONT A;  5L8R J;  2E5T A;  2BUO A;  4BRY A;  2EFJ A;  1FS0 E;  1RQV A;  2N1T A;  2KI7 B;  1LP1 A;  3P8M C;  4NEO A;  1VQO P;  4WY4 B;  3P05 A;  2PEK A;  2JBG A;  2Y9Z A;  2QJK C;  1S72 P;  1BE3 G;  5CCH D;  4PH0 A;  4XRO A;  3L73 E;  2OYI B;  1SQB G;  4PD4 I;  3OW2 O;  3MP7 B;  3V6I A;  3PTZ A;  2A45 I;  3D6Z A;  1YHQ P;  2M8P A;  5KTB A;  2K94 A;  2IBZ E;  2MKV A;  2KZI A;  1NTK K;  4GDO A;  2W90 A;  3U59 A;  1L0L D;  1QGK B;  1TU3 F;  3L75 J;  2ZJS E;  3RBX A;  3W68 A;  3V4W A;  3HTK A;  3HE4 A;  3H1J J;  2EG5 A;  1SQX K;  3H1K E;  2LIW A;  2W83 C;  1RO2 A;  1IMQ A;  4MRT C;  2JU1 A;  3DS1 A;  2GZG A;  1DD3 A;  2L6E A;  4H13 B;  1QL2 A;  3LW5 J;  3H0D A;  5CCH A;  3CWB D;  1RO0 A;  2P9X A;  4IFF A;  1NOH A;  5CJ4 A;  5APQ A;  5KAI H;  1HWT C;  2V7Q H;  2FFD C;  3M1M A;  4N3Y B;  1FOS E;  2GDY A;  1FDO A;  1L0N D;  2N6Z A;  2P1J A;  3BRT B;  1NTM D;  4BXL A;  1VQ6 P;  1W5C E;  2L9F A;  5F2K A;  2BEQ D;  1IFI A;  3CLQ A;  3DPH A;  1Q86 Q;  2ZFC A;  1X22 A;  2QSI A;  1SQB K;  5E79 E;  1NYH A;  1R5S A;  3L71 J;  3G29 A;  2OYH C;  3A0H E;  4F37 A;  2XDJ A;  3RL0 g;  4PD4 H;  3DS2 A;  3VMY A;  1SP4 A;  2KOQ A;  4R4L A;  2A45 H;  2EIA A;  1KB9 D;  1M6E X;  1AV1 A;  2E74 C;  3IAO A;  3BCC E;  4AYC A;  5HVC A;  1PEU A;  2NPS B;  4BPF A;  3L70 D;  1ZMB A;  2XU6 A;  1YYC A;  3KDP B;  3LRY A;  4H44 D;  1LTJ B;  2IX7 C;  1GU4 A;  3W67 A;  3RL0 D;  1NU1 G;  2FKW B;  4HKZ H;  1KB9 I;  1SQQ G;  1J2J B;  3H1K D;  2ZVO B;  2PEO A;  2AEM A;  4PH1 A;  3GW6 A;  4QMA A;  2AXC A;  3RK3 B;  5CZD B;  3H1I J;  2GA1 A;  2OTK E;  1N73 C;  1JTH B;  2LPK A;  2XV5 A;  4LC1 A;  1PPJ G;  2K9J B;  3KPE A;  3V2N A;  4XA4 A;  1H0T B;  2PFX A;  2KLV A;  5AVY B;  3WU2 E;  4XFZ A;  3PLN A;  5KLV J;  1XTC C;  1URQ C;  2BEZ F;  1PGO A;  1SQP K;  2WT7 A;  2IYO A;  2WMM A;  2J5U A;  3L74 J;  1BGY J;  3Q5S A;  5HGO A;  1AFO A;  1W2E A;  2O01 J;  2HPC A;  4H2X C;  2VLO A;  1NKZ B;  3CC2 P;  2DGY A;  2R5D A;  1RF1 A;  2FVA A;  3G1I A;  4A7P A;  1GD2 E;  3V2P A;  1X9V A;  4HH2 A;  2VLQ A;  5KAF H;  1NU1 K;  3CCJ P;  1K8A Q;  1OVR A;  1OIP A;  1NJI Q;  1FZF A;  2KW2 A;  1KB9 H;  2PEM A;  1MFT A;  3NTE A;  2FVF A;  3N4X A;  2IPP A;  1M56 D;  4M0I A;  3L73 J;  1KIL D;  2I1J A;  3AE2 C;  1BSH A;  2ERH A;  1G2C B;  2AXT H;  2Q5U A;  4DOJ A;  2FYU G;  2LXC B;  4U0C A;  2KLU A;  2ZXX A;  2Y0D A;  2XV6 A;  2H88 C;  5DJT B;  4I7Z B;  4U3F G;  1FZB A;  2R3C A;  1GL2 D;  2QIW A;  3TSI A;  1AA0 A;  5B66 H;  2C9L Y;  2D2C D;  2IFN A;  1G1I A;  2P58 A;  3VP8 A;  2Z5I A;  3ABV C;  4PXH B;  2BCC E;  4XFX A;  3L75 G;  2PEQ A;  3P7K A;  2KGE A;  1GTW A;  5B5E E;  3H1J G;  2QNW A;  1IC2 A;  2WPQ A;  2KG8 A;  3CCE P;  4LGD E;  4COP A;  2HOD A;  3WUU A;  1RH5 B;  2QM7 A;  2Q7C A;  3HE5 B;  1S2E A;  5DCK A;  1HTL C;  2H7H A;  2XZ0 D;  1JCD A;  4GKG A;  1KFM A;  2E76 C;  2KG6 A;  4WWI A;  2JU2 A;  1KIL A;  3CX5 E;  4D6T G;  1SQQ D;  1EMV A;  5E79 H;  1M7L A;  1Q90 D;  2FXP A;  5EJD A;  3A0H H;  1JMM A;  3CMA P;  3MZW B;  3Q5P A;  3EJB A;  2E42 A;  4GIF A;  5H2F E;  1QVF O;  4U0A A;  3M06 A;  3B5I A;  1T6A A;  1W2B O;  3L71 G;  3H25 A;  1KYO D;  2FYU K;  3RK2 B;  3G71 P;  1HBW A;  5APY A;  5AW7 B;  1ZLL A;  2YKO A;  1IZN B;  3DS5 A;  1UJZ A;  4UB8 E;  1IO4 A;  3BCC J;  1X79 B;  4WY4 C;  2W6A A;  2HG5 D;  1HF9 A;  2A45 G;  2VLP A;  1EDL A;  3G26 A;  2L91 A;  1KYO I;  3C1L A;  2K37 A;  1NTZ E;  1FZA A;  2BCC D;  2WWW A;  2QA4 P;  3M91 A;  3WUV A;  3TYY A;  1IJD B;  2N9B A;  2KR5 A;  1RHZ B;  2JEE A;  2FAE A;  2HFE D;  5AVS B;  1RF0 A;  1AQT A;  4BPH A;  2CGQ A;  2E5Y A;  1DIP A;  1Y9B A;  5BS2 A;  5CJ0 A;  4WYM A;  5EW5 E;  1JB0 J;  3AE8 C;  4U0D A;  1IFJ A;  1LJ2 A;  2UWJ E;  5CCG D;  4IFD K;  1E79 H;  5APU A;  3VMA A;  2ZVN B;  1NVO A;  3B71 A;  2YO3 A;  1K73 Q;  1L0L G;  2YXQ B;  2KSE A;  3P8C E;  2HLO A;  2BQ1 E;  2E1M A;  1U57 A;  5APX A;  2L4B A;  1IFN A;  1MV8 A;  1ZR2 A;  2XXM A;  2B9B A;  3B5N B;  4U7J A;  1QX8 A;  3KHU A;  3KXD A;  1P84 D;  2DW3 A;  2JYL A;  3CWB G;  3L75 D;  1EZV D;  3VMZ A;  3G28 A;  4IL6 H;  3U1C A;  2JJL A;  4M3L A;  2GZJ A;  3H1J D;  2YIU B;  2FVE A;  2E75 B;  2GZE A;  1YTZ T;  1KYO H;  2QE7 H;  2LTE A;  2WPV B;  2N5I A;  3E1I A;  2M5R A;  1NTM G;  1NAF A;  3BRV B;  5CCG A;  5K5G B;  3H1I E;  4XFY A;  5AW0 B;  2ZXE B;  2WSE H;  3O6Q B;  3HD7 C;  2POH A;  1P84 I;  1YBK A;  4WBA A;  1EZV I;  5AW5 B;  1FZE A;  2E74 D;  2M3E A;  1WT6 A;  1RQU A;  1LTJ C;  3FX0 A;  1IFM A;  4Z1M H;  3L4F A;  3GZM A;  1OR5 A;  1L0L K;  1G1J A;  4C46 A;  3L70 G;  3CI9 A;  1YTZ I;  4O9B A;  4H44 B;  2IDB A;  2WT7 B;  2BCC J;  3L74 E;  1GW3 A;  2FFD A;  4GOF A;  3SWK A;  3P8C D;  3TGU J;  4DJG A;  3H1K G;  1LT9 B;  1FZC C;  2HPC B;  1K30 A;  4JBZ A;  4IPY A;  1VPC A;  2WPT A;  3LID A;  1T8Z A;  2ZT9 B;  5APV A;  2OYH A;  2IFM A;  2YXR B;  3BAS A;  3CXH E;  3KYQ A;  2YMY A;  3H4E A;  1L0N K;  1M57 D;  3M9H A;  5H2F H;  1NTM K;  1EC5 A;  1N7S B;  3O8Z A;  1H8A A;  1PL5 A;  3AE4 C;  3G4S P;  1LTI C;  2PEJ A;  3H1I D;  3QH9 A;  2GUS A;  3GF3 A;  2QJP B;  4ZMD A;  1P84 H;  1URQ D;  3TDK A;  2L5G B;  5CCG C;  4NPD A;  1QEX A;  2M8N A;  5BS1 A;  4DCK A;  1AVO A;  4JYB A;  2FHS C;  3L72 J;  2YO2 A;  1M74 A;  3BCC G;  3A2A A;  3H1L E;  3LW5 H;  1OZH A;  4IFM A;  2P10 A;  1T3J A;  2K3R A;  5KLV D;  2KNC A;  1N73 A;  1CZQ A;  1HGZ A;  2KWL A;  1K05 A;  3II6 A;  1A02 J;  2PY8 A;  2HOD B;  5KP7 B;  1NTZ J;  4H0L C;  3L74 D;  1BGY D;  1OW6 A;  1CI6 A;  4H2W C;  2QRX A;  3T97 A;  2Q3I A;  1SQV J;  2M5A A;  1VQ8 P;  4RJT A;  2PEI A;  2GUV A;  4HJG H;  4I7Z C;  2R44 A;  1SFC C;  2K0X A;  5TIS H;  3ITK A;  2B87 B;  1USD A;  1JMB A;  1URQ A;  3LIE A;  3HUS B;  1J1E B;  2JQ4 A;  3CXH D;  5AW9 B;  4COC A;  2C9N Y;  5APW A;  1L4A B;  1FC2 C;  1GL2 B;  4TT3 H;  1N2D C;  4PWV B;  1BE3 E;  1KQS O;  5F2N A;  3L73 D;  1X0T A;  2KOO A;  3F5H A;  4JYC A;  2D2C B;  2P2U A;  1SQB E;  2AVA A;  2CWO A;  1DH3 A;  2YKP A;  1KQL A;  2KOG A;  1GK4 A;  2N50 A;  3CCU P;  4EI2 A;  2JWA A;  3CXH I;  2V4H A;  2IBZ D;  4N78 E;  3PJS K;  4XRQ A;  3MGN A;  5DJU B;  2E76 D;  3GHG C;  5KLI C;  3I5C A;  2KS1 B;  5HV8 A;  1GPJ A;  2JDI H;  4UB6 H;  2W6B A;  1EQ7 A;  2WSC J;  3D71 A;  1GK6 A;  3AE7 C;  4NPE A;  3H1H J;  3QWO C;  3RK2 C;  3GG2 A;  2H8P D;  5AVR B;  1VF5 D;  2IBZ I;  3TK1 A;  2OQQ A;  3H47 A;  1AF8 A;  2VSQ A;  2Q3E A;  4EYY Q;  4C7N A;  3Q1M A;  4YXW H;  2GYK A;  5HGL A;  2YKQ A;  1VL2 A;  4U0B A;  3USS A;  1HGV A;  3PRJ A;  1UII A;  2Z45 A;  2IZ0 A;  3SFE C;  3Q3D A;  2LL8 A;  4PV1 C;  3D70 A;  3G9R A;  2K0D X;  2KXP B;  4WY4 D;  1LWU B;  4DZO A;  2LF4 A;  1L0H A;  4GR6 A;  2O01 H;  3HRN A;  1CSB A;  2KIK A;  3OAK A;  1M6N A;  1MUU A;  2O01 N;  2GDW A;  4CPG A;  2BCC G;  5AVZ B;  2JO0 A;  2CK3 H;  2J59 M;  1SQP E;  2KK7 A;  1FOS F;  3AEC C;  5AVQ B;  3BCC D;  3CXH H;  1K04 A;  1OVV A;  2K1A A;  2KOR A;  1SQQ K;  4OGQ B;  2PEN A;  3FWN A;  1GXG A;  2K2Q A;  2G8Y A;  4K35 A;  3SWF A;  2W6J H;  2WSF J;  1NU1 E;  1FDM A;  4OWF A;  3KZI E;  3GKL C;  3PP5 A;  2EHS A;  1S5L E;  1KLP A;  2A06 E;  3K5B A;  4R0M A;  4WY4 A;  3B5N C;  1RNI A;  3RK3 E;  2OAR A;  3EQ2 A;  1NWQ A;  2RKL A;  2FYN C;  1ZR4 A;  1PEQ A;  1PPJ E;  1A8O A;  2YNY A;  2YIU C;  1N86 A;  1JY3 O;  3M0A A;  2E75 C;  1X8Y A;  1IMP A;  2LML A;  2Q6Q A;  1RE3 C;  2XKM A;  1BDC A;  1CW5 A;  3FXE A;  1YJN P;  3WBH A;  1IK9 A;  1ZN5 A;  3CCR P;  5AVT B;  1EZV G;  4OH8 B;  1M1J B;  3H1L J;  1NTK J;  2AFD A;  1KQG B;  3E1R A;  3TGU E;  1ZRT E;  2OTL P;  2M8R A;  3MIW A;  1S1C X;  3S1K A;  1AUM A;  1FJP A;  1Y8A A;  1PP9 J;  1WRG A;  1LTS C;  1SQX J;  2HR3 A;  4YXD C;  1HJ0 A;  3A0B E;  1AVY A;  3HD7 D;  4BRY B;  4NPF X;  1YQ3 C;  2N5H A;  2PP6 A;  2N1T B;  1LP1 B;  2G3A A;  1Z6M A;  1RE4 C;  1N7L A;  2KGC A;  1VF5 C;  3B4Q A;  1M8O B;  4BWN A;  1JY2 O;  4OVN F;  1BE3 J;  2WSS H;  2X2B A;  1AYI A;  4QNB A;  1LT9 C;  3CL3 D;  3EJD A;  1GW4 A;  4TLF A;  2A06 D;  5APT A;  1SQB J;  2KOD A;  4R4M A;  5AW4 B;  2KP8 A;  1JNM A;  3MTU E;  1JCC A;  3L72 E;  3EWK A;  2ZT9 C;  3AE6 C;  2JAZ A;  4U3F E;  1EXJ A;  4GOD A;  3HTK B;  3HE4 B;  1N7S C;  3V5B A;  2WTY A;  3BAT A;  1PV3 A;  1FBM A;  1N73 B;  3HD7 A;  3UIA A;  2OYI C;  1BSN A;  4KJM A;  2AFE A;  4W7Y A;  3TNU A;  4RO0 A;  2NPS A;  2QVA A;  3TGU D;  1SQV E;  3NTN A;  1PGP A;  2JYG A;  3T97 B;  3DS3 A;  3NMD A;  1LTJ A;  1BCC E;  3A7O A;  1E5W A;  4RKU J;  3AEE C;  3B4S A;  1K9M Q;  2C0W A;  5APS A;  3RGU A;  3H1I G;  3U43 A;  3MGE A;  5AVV B;  1S5L X;  2ITA A;  1GDT A;  1URQ B;  1KC8 Q;  1NHL A;  1S9K E;  3CX5 D;  3WU2 H;  4D6T E;  4BPG A;  4RES B;  4L74 A;  2AF8 A;  4L75 A;  1FZC A;  1JTH A;  4JPZ B;  1R8E A;  3OA7 A;  1S3J A;  4H13 C;  5KAI E;  4YPC A;  1OWA A;  3Q2Y A;  5KKZ B;  3MD0 A;  3VYI A;  1MZ8 A;  5KLV G;  4Y28 J;  3V2Q A;  1H0T A;  3HZQ A;  2K9Y A;  4H0L D;  1LNQ A;  3CX5 I;  1JY3 N;  3CCL P;  2KG9 A;  3L74 G;  1BGY G;  2M3B A;  3L72 D;  3RG2 A;  2PGD A;  1SQP J;  3IR9 A;  3HUS C;  2JGP A;  1RY3 A;  1SFC D;  1L4A C;  1FR2 A;  4C7R A;  3KZI H;  5AW2 B;  2ROQ A;  3FXD A;  3H1H E;  2QM8 A;  4W7Z A;  2M8L A;  3F89 A;  3MUD C;  1NTZ D;  1FJK A;  1SS1 A;  1NU1 J;  1SQV D;  3AEF C;  1QLE D;  2RMZ A;  3D6Y A;  1GU5 A;  3L73 G;  2JB0 A;  4U0F A;  2OYO A;  5CHX A;  1HQB A;  3NY7 B;  4ZNC A;  2NPS C;  1PZQ A;  3IF4 A;  5AW3 B;  3CCM P;  3Q20 A;  2GM4 A;  1Z56 A;  3EJE A;  1LT1 A;  1S9K D;  1VQ9 P;  1JY2 N;  3I56 P;  1EXI A;  4QKO A;  5B5E H;  2IBZ G;  4GR2 A;  3C9I A;  3G1G A;  1NH4 A;  2MVV A;  1KN7 A;  5KJ7 C;  2M0B A;  4CA3 A;  3V2R A;  1PEM A;  5KLV K;  2H89 C;  2MR7 A;  1N8R Q;  2SPZ A;  2XZR A;  1SFC A;  3RK3 C;  3CPW O;  3RL0 B;  2K0Y A;  3A0B H;  2MJZ A;  5M1B A;  3LMO A;  3VP9 A;  5AW8 B;  7CEI A;  3RK2 D;  1RF1 B;  3CX5 H;  1USE A;  1PFI A;  2R32 A;  2C0X A;  2LKM A;  5AVX B;  1T2K C;  1BDD A;  2MVU A;  2N9Y B;  2ZYA A;  3H32 A;  2JP3 A;  2Z44 A;  1T8K A;  2DNW A;  3AE1 C;  5F2O A;  1LWU C;  1OW8 A;  3WMM 0;  5AW1 B;  4PV1 D;  4XE5 B;  3H1H D;  1L2P A;  1DD4 A;  1L0N E;  5GTI E;  5I4T G;  2ZYD A;  1NTM E;  2FY8 A;  3NFQ A;  2K5X A;  2E43 A;  1VQ5 P;  2IYP A;  2KGA A;  2MY5 A;  5KAF E;  3GHG A;  1Y47 A;  4UB8 H;  1MFZ A;  2K88 A;  1GXH A;  3CC4 P;  1HH0 A;  4I2L C;  3G0V A;  5CMZ A;  1ZW0 A;  2FYU J;  3NXS A;  1KB9 E;  4JQ0 D;  1Q82 Q;  3S4R A;  4OGQ C;  3VTP C;  1WMK A;  4U3F J;  2RN0 A;  4L73 A;  1NTK E;  3L36 A;  4EDF A;  2AXT E;  1VHN A;  3L70 E;  2QEX P;  3VOP A;  1PP9 E;  1SQX E;  2O1J A;  2Q1K A;  4IOI H;  4L76 A;  5B66 E;  4AQR D;  4GOE A;  1KIL B;  5CBN A;  1BCC J;  3B5N D;  3M0D A;  1YIJ P;  3OJA B;  2JO1 A;  1ZME C;  3HYB A;  3B8E B;  2WZ7 A;  1AJY A;  1UIX A;  1NAY A;  3GZL A;  3WUT A;  1LTG C;  2OGU A;  4D6T J;  1M1J C;  3JC2 2;  4HYT B;  3CCS P;  2E75 D;  4EIJ A;  3H6P A;  1OW7 A;  1VDF A;  1OMI A;  1NKN A;  2QJY B;  2BHV A;  2V7Q J;  1EIA A;  2PAJ A;  2Y0E A;  1VQP P;  1FAV A;  2N1T C;  1EDJ A;  4DG9 A;  2WQY C;  2WSC H;  1PIX A;  1U7M A;  2OTJ P;  1SQP G;  3HD7 B;  1Q2N A;  2O1K A;  1EDI A;  3H1L D;  1NTK D;  3P32 A;  3B5N A;  3TNU B;  1H88 A;  1FU1 A;  4XFJ A;  3CME P;  1VQK P;  3EFF K;  3S9O A;  2HYN A;  1GMJ A;  1GZL A;  3G3Z A;  3CXC O;  1HVV A;  3L35 A;  5GTH E;  1PP9 D;  2KZJ A;  2IZ1 A;  1SQX D;  2B88 A;  4DT0 A;  3TF5 A;  2JWD A;  1DX7 A;  4ZKU A;  1J1D B;  1SLQ A;  1RE3 A;  5HGN A;  5KP8 B;  1KIL E;  2NZ2 A;  2A06 G;  1BAJ A;  4Y99 B;  1ZXG A;  1JO5 A;  2ZT9 D;  1JUN A;  1KQF B;  1FZG A;  1R5L A;  3O6Q A;  2WIT A;  1FZC B;  1D7M A;  4IZ6 A;  2FAD A;  3M0D C;  1N7S D;  1BE3 D;  2O3J A;  1FDI A;  3G6E P;  3E7K A;  1DEE G;  2ZYG A;  5CCH C;  5BU8 B;  1SQB D;  1L0L J;  2FQ2 A;  2FQ0 A;  1HUC A;  2QJK B;  3TGU G;  3AE5 C;  5C39 A;  3N7N A;  3SWY A;  3CCV P;  1E6J P;  1LGH B;  1RE4 A;  2FAC A;  1VQL P;  2WSF H;  1PEO A;  2AEF A;  3KQG A;  2MD9 A;  4EOT A;  1HJB A;  1NO4 A;  4N78 D;  1HY8 A;  3PH0 A;  2CQ8 A;  3A5T A;  1SVF A;  3AEA C;  5BU5 A;  3VMX A;  3VRL C;  5GTI H;  1LT9 A;  3VN0 A;  4ZKP A;  1VQ4 P;  3CWB J;  3MHV A;  4I1L A;  2N98 A;  3M9B A;  2P67 A;  1SQQ E;  2EHT A;  1T3U A;  2ZAE B;  4WB4 A;  5KKZ C;  2KGD A;  4PJ0 E;  1L0N J;  1ZP0 C;  1NTM J;  4U0E A;  2KYV A;  3CD6 P;  4H13 D;  1NQ4 A;  4IL6 E;  3DS0 A;  3G21 A;  1N7S A;  1IFD A;  3JCU E;  2OYI A;  1KYO E;  5EFW B;  2R5B A;  2YMK A;  5BVZ A;  2JR8 A;  4LLH A;  4H0L B;  2I8D A;  3L72 G;  4AUW A;  2L0Q A;  3BVH A;  4JF7 A;  3IFM A;  2FXM A;  4W80 A;  1L4A D;  1SFC B;  1ZOY C;  3SSU A;  2FFD B;  2GDX A;  3L70 J;  1KZU B;  3R2P A;  2JKV A;  2NRG A;  3Q5R A;  1JEK A;  2FYZ A;  1NTZ G;  3A3Y B;  2Z46 A;  1SQV G;  1SQP D;  2OYH B;  3H1K J;  3H32 B;  3V4Q A;  2NPS D;  2J58 A;  3GJN A;  1EDK A;  1BCC G;  1JM0 A;  1CEI A;  2RH0 A;  2CPS A;  1M1K Q;  2W8Z A;  1VQM P;  4UHP B;  2E74 B;  1F80 D;  2WVR A;  2Q9I A;  1OFC X;  4H44 C;  2KOP A;  4N6J A;  1NU1 D;  2XND H;  3RL0 C;  3GMA A;  1QRJ A;  2CPB A;  3RG6 C;  3DTJ A;  5KJ7 D;  2KSJ A;  2B87 A;  2H43 A;  2Z5H A;  3GHG B;  1XTG B;  5KLI B;  3SFD C;  2XT1 A;  3HUS A;  1RF1 C;  3AEB C;  3RK3 D;  3EFG A;  1L4A A;  2N6Y A;  2W27 A;  3GLM A;  1GL2 A;  2FYU E;  2P7J A;  4H2Y C;  2NO8 A;  2CG5 B;  3GF7 A;  2FBW C;  1H89 A;  1PPJ D;  1KFN A;  3MUD A;  4HB1 A;  1YJW P;  1T2K D;  1YIT P;  2K93 A;  1LTA C;  1E0H A;  4ASW A;  1VQN P;  2KNC B;  1DNY A;  2LOL A;  1OXZ A;  5GTH H;  1A43 A;  1P84 E;  1VKU A;  4KT0 J;  3L75 E;  4HKG A;  1EZV E;  3AE3 C;  1CI6 B;  1ZRT D;  3H1J E;  5AW6 B;  2QJP C;  3C8V A;  1NTZ K;  2M5A B;  1D1D A;  4PV1 B;  3H1H G;  1JOC A;  1SQV K;  2KS1 A;  2KUB A;  1KV4 A;  3E2D A;  1MKM A;  1YQ4 C;  2Y9Y A;  1Q7Y Q;  1M90 Q;  5KJ7 A;  1PGQ A;  1IFP A;  1Q81 Q;  2GZI A;  1DV5 A;  4K3A A;  1ACP A;  2KOS A;  1KD1 Q;  4IL6 X;  2LXB A;  3ZDM A;  2CNR A;  4OGQ D;  2PNG A;  3R4Y A;  3PHL A;  2WPS A;  3I55 P;  1EOQ A;  1IUQ A;  1MZ9 A;  2K9J A;  3L71 E;  2XZ1 C;  5TIS E;  5TJH A;  1KIL C;  3FGA D;  4YTP C;  3CCQ P;  2AEJ A;  5JPA A;  1LWU A;  2FYU D;  2FQ1 A;  1AQ5 A; 
#chains in the Genus database with same CATH homology
 2PY8 A;  3G0V A;  4XFZ A;  1VQ6 P;  2OTJ P;  4U0D A;  5F2K A;  1JJ2 O;  3DPH A;  1Q86 Q;  5DCK A;  2ONT A;  5HGL A;  1Q82 Q;  2BUO A;  4U0F A;  4U0B A;  1VQ8 P;  2EFJ A;  4U0E A;  2JYG A;  3G29 A;  3DS3 A;  3WBH A;  1YJN P;  3CME P;  3CD6 P;  2Z45 A;  1VQK P;  2PEI A;  3CCR P;  1VQO P;  3DS0 A;  3P05 A;  3CXC O;  3CCM P;  2PEK A;  3G21 A;  1K73 Q;  3DS2 A;  5HGO A;  1YJW P;  3Q20 A;  1S72 P;  2OTL P;  1YIT P;  3DS4 A;  1K9M Q;  4PH0 A;  4XRO A;  1YJ9 P;  2EIA A;  3CC2 P;  2DGY A;  1M6E X;  1K30 A;  2QEX P;  3G1I A;  1VQ9 P;  1AUM A;  1VQN P;  3CMA P;  3I56 P;  3MGE A;  4IPY A;  3OW2 O;  2LF4 A;  4GR6 A;  4GR2 A;  2BQ1 E;  1A43 A;  2E1M A;  3G1G A;  4COC A;  3CCJ P;  1KC8 Q;  1QVF O;  4U0A A;  5HGN A;  1K8A Q;  3B5I A;  1M6N A;  1PEU A;  1PEM A;  1BAJ A;  1YHQ P;  2XXM A;  1KQS O;  2M8P A;  1W2B O;  5F2N A;  1N8R Q;  1D1D A;  1ZMB A;  3H4E A;  1NJI Q;  3CPW O;  3G71 P;  3E2D A;  3LRY A;  2PEM A;  2JO0 A;  3NTE A;  1YIJ P;  2JYL A;  2CWO A;  3HYB A;  4M0I A;  3G28 A;  1Q7Y Q;  3G4S P;  3DS5 A;  1M90 Q;  3G6E P;  3CCU P;  2PEO A;  1QVG O;  3CC7 P;  2PEJ A;  2Z46 A;  4PH1 A;  1Q81 Q;  2PEN A;  4U0C A;  3HZQ A;  5HGM A;  2EG5 A;  2XV6 A;  3CCS P;  2Z44 A;  4XRQ A;  3CCL P;  1KD1 Q;  4QNB A;  5F2O A;  1RO2 A;  3G26 A;  4XFY A;  2KOD A;  2M8N A;  5BS1 A;  3DS1 A;  1M1K Q;  2L6E A;  3CCV P;  1E6J P;  1VQM P;  1VQL P;  2QA4 P;  1PEO A;  3I55 P;  2BHV A;  5I4T G;  3H0D A;  1EOQ A;  1IUQ A;  1EIA A;  1RO0 A;  2P9X A;  1VQ7 P;  1RNI A;  2OAR A;  1VQP P;  4XFX A;  1M74 A;  1VQ5 P;  1YI2 P;  2PEQ A;  2M8L A;  3VRL C;  3CCQ P;  5JPA A;  1QRJ A;  1VQ4 P;  3M1M A;  3RG6 C;  3DTJ A;  1PEQ A;  3CC4 P;  5BS2 A;  3CCE P;  3H47 A;  4COP A;  4WYM A;  1A8O A;  2XT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...