1QVFO

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qvfO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1qvfO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1qvfO03
3CCEP 1YITP 3I56P 1K8AQ 3CC4P 1VQ4P 3CCQP 3CCVP 1VQ7P 1VQMP 1NJIQ 1N8RQ 3CCLP 3CCUP 1QVFO 1VQNP 1KC8Q 3I55P 1VQOP 3CPWO 1JJ2O 3CC2P 1VQLP 2OTJP 1VQ8P 3G4SP 3OW2O 1Q81Q 1YJWP 1K73Q 3G71P 1YJ9P 3CD6P 3CCRP 1YHQP 1QVGO 1W2BO 2QEXP 3CXCO 3CMEP 3CMAP 1Q82Q 1VQPP 1Q86Q 1M1KQ 1VQ6P 1YJNP 2OTLP 1VQKP 1S72P 1YIJP 3CCMP 2QA4P 3G6EP 1KQSO 3CCSP 1K9MQ 1KD1Q 1VQ5P 1Q7YQ 3CC7P 3CCJP 1YI2P 1VQ9P 1M90Q
chains in the Genus database with same CATH superfamily
1URQB 2M5AB 1SFCB 4OGQC 1JY2P 2FYZA 1FDOA 5I4TG 4A7PA 1AVOA 4H44C 1BXIA 3B5IA 2WSEJ 3AEFC 4C7RA 2OARA 2XV6A 2FYUD 2OYHA 5TISH 1PGJA 1QX8A 1K9MQ 4WY4A 2E76D 5KP7B 2KLUA 3GHGB 2H88C 1GK6A 4U0DA 1BCCJ 5KLVE 4DOJA 2Y0CA 3B4QA 3CC2P 2Z4EA 4KHXA 3DS2A 4IZ6A 1L0NK 4U0EA 3HD7A 1NTZG 2KS1A 3CCMP 2V7QH 3AE7C 2FY8A 4PV1B 1RE3A 1VQ5P 3E2DA 2BQ1E 1YTZI 2KP8A 4F37A 3TK1A 1SQPK 4TT3H 2PEQA 3GLMA 1ZRTD 5KLVJ 3WBHA 1X8YA 4I2LC 1T2KD 5GTIH 2OTLP 2GZIA 2KGAA 1PIXA 4K35A 2POHA 1MKMA 2YKOA 1W2EA 3H1IE 3CWBE 2KLVA 3L70G 1BGYE 3EWKA 2FYUG 2WSEH 2BCCG 5CJ4A 2Q3IA 2ROQA 1IK9A 2FFDC 1L0HA 1SQQD 2ZVNB 2D2CB 2KR5A 2XZ1C 4U3FD 4H0LD 2WT7A 1E6JP 1CI6B 4YXDC 1LWUC 3H1HG 2CGQA 2K9JB 1S1CX 3CWBJ 3P7KA 5EFWB 1S9KE 1S3JA 1IFMA 1BGYJ 4L75A 4YPCA 2GM4A 2FXOA 1RO2A 4Z1MH 1JMBA 1PPJG 3O8ZA 3JC22 3NMDA 4QNBA 3BVHA 5APTA 2O1KA 1JUNA 1OW7A 3VMXA 1D7MA 2FYUJ 1LP1A 3AEEC 4MN4C 4IL6X 4ZKPA 4UHPB 3PLNA 1ZMEC 2MVVA 3M0DC 1FZEA 1ZRTE 1PEQA 3F89A 1GU5A 2A45G 2PFXA 1LTAC 1DD4A 2QM8A 3RK2B 1NU1E 1KILD 5H2FE 2R5BA 4HYTB 1USDA 1LTTC 2M8LA 1NO4A 1X3OA 2AFEA 2M0BA 1YJNP 3U59A 3H1KE 4U0CA 2KSEA 2J58A 5AW8B 4N78D 1PEUA 3L71E 5KKZC 3VMZA 1T3UA 3DS0A 1HGVA 1NKNA 2PGDA 1SQQE 1URQC 1SFCC 1NU1J 3H1LE 3SWKA 3RL0D 2ZT9B 1U7JA 1EXIA 2KGDA 3KDPB 3BCCD 4JYBA 2L6EA 5L8RJ 2R32A 4BRYA 3L71J 2N5IA 3HD7B 3GHGC 5APXA 1PP9D 1JTHB 1SQQJ 1GZLA 1QVGO 4ASWA 4PD4E 4U3FJ 3G1GA 5GTHH 2MR8A 2R3SA 2FXPA 3H1JG 1VQ9P 5AW0B 3S1KA 3SWYA 3Q5SA 4PV1C 3L73G 3LMOA 2AXCA 2YXRB 4HKGA 2HLOA 2KGCA 1S5LE 1QLED 3VYIA 5BVZA 5KJ7C 3WUUA 2OYOA 1IC2A 2DW3A 4HB1A 5CCGC 2J59M 1JCDA 1AJYA 1BE3D 1KILE 1S4XA 4R0MA 1VPCA 3UIAA 1JY3N 5AVZB 4NPDA 3MGNA 2W6JH 1KV4A 1D1DA 5CCHC 1NH4A 3VRLC 2FFDA 2AXTE 1KD1Q 2K88A 1SVFA 1EDJA 2RMZA 3FWLA 1PP9G 3PTZA 2W83C 2D2CC 2PEKA 2EFJA 2KGEA 2KK7A 3D71A 1LWUA 3BCCE 5B5EE 2L91A 5KAIH 2PEOA 1PL5A 1L0LE 1AQTA 2G3AA 1AF8A 2IX7C 1NTMG 1M7LA 3TGUG 2H8PD 1RQVA 2ZYGA 1FOSF 4U0FA 1YJWP 1DNYA 1UIIA 3BCCJ 3E1RA 4GT1A 3HE5B 2L0QA 1E79H 1L0LJ 1KQGB 4M0IA 3TDKA 2QSIA 2FXMA 4UB8H 4JYCA 2Q9IA 3CCQP 1AV1A 2JO1A 2E1MA 2FAEA 4COPA 1BE3E 1G1JA 1VQOP 1L0ND 5BS1A 1AQ5A 2EHSA 5AVRB 3RK2C 5BU5A 2Q3EA 1T8ZA 5JPAA 2JYGA 1FZAA 2HG5D 2IFMA 2P2UA 1ZV8A 1SQPD 3A7OA 4U7JA 1IFJA 2XZ0D 1DV5A 3L36A 5APWA 3AEDC 1BE3J 2ZFCA 2M5AA 1SFCA 4BRYB 2K3RA 1DX7A 1AFOA 2E74B 5E79H 4H13D 2KUBA 3C9IA 2ZVOB 3V2RA 5F2KA 3FX0A 1R8EA 1UNKA 2DGYA 5KAFE 1EZVG 1LGHB 2QNWA 3NY7B 4BPHA 4XFJA 5B5EH 2M8NA 1MFTA 3GHGA 2IBZG 3OAKA 3I5CA 2XZRA 2FADA 1HGZA 1S2EA 2JU2A 5CJ0A 4GDOA 4ZNCA 1L0NG 2A06D 1K8AQ 1L4AB 2RKLA 1LTJB 4IOIH 3A0HH 2CNRA 2XT1A 2N1TB 3M9HA 1SQXK 2HR3A 2P9XA 5KJ7A 4PJ0E 5CCGA 3EJEA 1M6EX 2LKMA 2NZ2A 5HGLA 1KFMA 3G21A 1SQVE 2XV5A 3GMAA 5EJDA 1OX3A 2WPQA 1FU1A 3H25A 4AYCA 5CCHA 3G6EP 5TISE 2LIUA 5HGNA 2N9YB 2H43A 1VF5D 1ZR2A 3MGEA 4W7YA 3V4WA 3ITKA 3W67A 2QRXA 1N7SD 5AW2B 1NTMK 1KN7A 3SSUA 3B8EB 2Z5IA 2PENA 2H7HA 1SQPJ 5KLIB 4GR2A 4O9BA 2KIKA 1YQ3C 1Q7YQ 1K30A 3LIEA 1S5LX 5C39A 4L76A 1NAFA 2MD9A 1CZQA 2AEFA 3AEBC 1OW8A 1YTZT 3OW2O 3WUVA 2A06E 4I7ZB 1YHQP 3VMAA 4XFYA 4GKGA 5GTIE 1KQSO 1HWTC 2CWOA 2QG4A 5F2NA 1ZW0A 3GF3A 1NTZD 1GL2B 3A2AA 4WYMA 2IZ1A 1N73B 2LIWA 2R3CA 2Y9ZA 1JJ2O 1FS0E 1HJBA 2KI7B 3AE5C 4NPFX 1VQ6P 3A3YB 5F2OA 4NEOA 1WRGA 1CSBA 1RF0C 3LRYA 1T3JA 2P10A 4U0AA 1M6NA 2QJYB 1Q90D 2ONTA 3FXDA 4PH1A 2NO8A 3BATA 2KODA 2WITA 3M06A 3AE3C 5APVA 2N98A 4DT0A 4WBAA 2MKVA 1GDTA 3VOPA 4DJGA 3L70D 1AYIA 5AVXB 3C1LA 2BCCD 3V2QA 2A45I 2JU1A 2BEQD 3L75D 1EIAA 3CCEP 5AVYB 2E74C 2IYPA 2BEZF 1RQUA 3WU2E 2G8YA 3IR9A 4GOFA 3H6PA 3EJDA 1K73Q 3CD6P 2ZXEB 3H1HD 5AVTB 1JTHA 2WPTA 2MVUA 2I1KA 4WY4D 1SQBG 1ZN5A 1PPJD 4IFFA 2ZT9D 1KORA 3A5TA 3ABVC 2GUVA 1SP4A 5APQA 2YKPA 1L4AC 2QJKB 5HGOA 1NTZE 4C7NA 1LTJC 2B88A 1VQPP 1Q86Q 1QL2A 3HD7D 2JGPA 2N1TC 3CCSP 2LTEA 2NPSB 2O01H 2ITAA 3V2PA 3AEAC 4L74A 1J2JB 1T6AA 1MZ9A 2QIWA 2X2BA 1KFNA 3WMM0 3GF7A 4DZOA 2J5UA 4I6MC 4AUWA 3L75G 1NTZJ 2E43A 1NHLA 2FQ0A 3AE2C 1AA0A 3MP7B 2B89A 2HFED 4I1LA 5AVVB 1NVOA 1EOQA 2FYUE 2BCCE 3T97B 3CX5I 5AVWB 2OTJP 4ZKUA 4CPGA 1RY3A 3KXDA 3CMAP 1RF1A 7CEIA 3AEGC 3B5NB 4OWFA 5GTHE 1NWQA 4XFZA 2KNCB 5KLIC 1J1DB 3BRTB 3H1HE 3WU2H 3TF5A 2KZJA 2GZEA 3L70J 3AE1C 1VQLP 2BCCJ 1JY3P 2GA1A 1PPJE 2ERHA 3IAOA 3L75J 2M5RA 4I7ZC 1JB0J 5AW3B 3ZDMA 3CC7P 2E75B 4GODA 1VDFA 2IDBA 3HE5A 2YNYA 3CC4P 3MZWB 3DS5A 1ZMBA 3H1HJ 1GL2C 2JEEA 1QL1A 2FYNB 3H1JD 1N73C 1IFDA 2QJPB 2RN0A 3L73D 3AECC 3CX5D 3RK3D 2WZ7A 1JY2O 1GPJA 3AE6C 2JKVA 1RF0A 4DCKA 4PH0A 5AW9B 2KW2A 1KQFB 4H2WC 1QVFO 2E76B 2QJYC 2WQYC 3CXHI 1DEBA 1SQXD 4U3FE 1FOSE 1YJ9P 5APSA 3L74D 4WVZA 5KAIE 1DEEG 2VRSA 1G1IA 2YMYA 1IFNA 3HE4B 1X79B 1ACPA 4RO0A 3VP9A 2EHTA 2PAJA 3AE9C 3RL0g 1WMKA 1HF9A 2BUOA 1Q81Q 3GKLC 4OGQD 2WSSH 1SQBK 2K37A 1DIPA 1X9VA 3GW6A 1VQKP 4EIJA 1NGMB 4H44D 3G0VA 1N2DC 3N7NA 4C7NB 4UB8E 2K93A 1N7LA 3RGUA 1NTMD 2B9BA 3U43A 2P58A 1L4AA 3USSA 4BWNA 3TGUD 2KOOA 1K05A 2QJKC 2L9FA 1LTJA 5M1BA 1QRJA 3CXHD 3H1JE 3DS4A 5CZDB 2N1TA 2O01N 1ZLLA 1SQXG 3CX5E 2NPSC 1EZVI 1LTGC 3RK3E 1H89A 5B66H 1YQ4C 3L74G 4OVNF 4H0LB 4N78E 2IBZI 2FQ2A 1LT9B 2WVRA 1Q82Q 2PY8A 2A45H 2GZFA 1Q2NA 1BDCA 2K0YA 1LTBC 2XXMA 2DNWA 3KZIH 2KZIA 2K0XA 3H1JJ 5E79E 2KXPB 2N5HA 3DPHA 3K5BA 3D6YA 3L73J 4B86A 1RF1B 1KC8Q 3KPEA 2IFNA 3Q1MA 5K5GB 3EJBA 2L5GB 2B87B 2Z45A 1NOHA 1W2BO 1NYHA 4HH2A 1M1KQ 3CI9A 1YIJP 4CA3A 1PP9E 3B5NC 1E0HA 1JEKA 1J1DC 3HUSA 4COCA 1BDDA 3A0HE 1EZVD 4TLFA 3TSIA 3HYBA 1KILB 1NTME 2IBZD 1NU1K 1PP9J 3TGUE 2C9LY 2IZ0A 3CCLP 2E75C 2HPCA 2O3JA 4NPEA 3E1IA 5AW5B 3CXHE 1ZNVA 1PGPA 4EDFA 1GL2A 3E7KA 1N73A 2FYNC 4IFDK 3EFFK 2M8PA 2QJPC 5HGMA 1DD3A 2GDXA 5BU8B 1HBWA 3G9RA 4JBZA 1NTMJ 3RL0B 3CX5H 1LNQA 3TGUJ 4UB6H 3F5HA 4D6TD 3KYQA 3M9BA 3G4SP 1EC5A 4IFMA 1KZUB 2E76C 4HKZH 1Z56A 1FZFA 2WWWA 4JPZB 3V4QA 2I8DA 1YITP 2JR8A 2Q1KA 4PXHB 4RKUJ 1HTLC 1M57D 5HV8A 2IYOA 1RNIA 2KSJA 2WPRA 1MZ8A 5CHXA 2HYNA 1URQD 1SFCD 1VHNA 1NTKG 1XTGB 3R2PA 3CCJP 2GZGA 2AFDA 1IFPA 1EZVE 1GK4A 2M3BA 1HUCA 3IF4A 1T2KC 1IJDB 1MFZA 1FE6A 2QE7H 2IBZE 2W6AA 2HODA 1OVUA 4W80A 5AW6B 4GOEA 1RE4C 2ZAEB 2KORA 1YYCA 5AW1B 1L0NE 1G2CB 1OIPA 3QWOC 4D6TG 1MUUA 1GXGA 2K0DX 3H47A 2K5XA 3CXHH 4ASVA 3I55P 2NPSA 5CBOA 2K94A 4PV1D 1SQPE 3HRNA 3CXCO 1A02F 4H0LC 3GZLA 3M9QA 2CPSA 1LT9C 3HTKB 5KJ7D 1FZBA 5CCGD 3S9OA 3VP8A 4YTPC 3KQGA 1L0NJ 2LXBA 1L0LK 5KP8B 4RESB 2RH0A 2XU6A 1RF1C 1M1JB 2MR7A 2C0XA 3T97A 3L72G 2XDJA 2OQQA 3L4FA 3RG2A 1OXZA 5CCHD 2JO0A 3Q20A 3WUTA 3HUSB 4H2YC 1VQ4P 2WSFJ 3B5NA 2KB7P 3CPWO 2KNCA 2NRGA 2D2CD 5BS2A 5AVUB 3FXEA 1M8OB 3V2NA 1KYOH 1PGQA 3S4RA 2HPCB 1BSNA 2BASA 2FVEA 1R5LA 1GTWA 3JCUH 1KILC 1FR2A 2FVFA 2KOGA 1NJIQ 3BASA 3PJSK 3SFDC 1JMMA 1SQBD 3Q3DA 3PP5A 1EXJA 1RO0A 1JOCA 2YIUB 3MUDC 3G29A 1N86A 1PEOA 1BCCG 3JSVC 2O01J 3RL0C 2KOPA 4H13B 3P8MC 4XFXA 2PEIA 2E75D 4QKOA 4IL6H 3MHVA 3H1ID 2WPSA 1S72P 1M56D 4Y28J 3RK2D 2WSFH 1QGKB 2P67A 3DTJA 2FQ1A 3A0BH 3I56P 1RHZB 3G28A 1XTCC 3DS1A 1HY8A 4RJTA 1VQNP 5KLVG 2MF4A 2W27A 2QVAA 5EW5E 1NTKK 2KG9A 3RBXA 1X22A 2GZJA 3MIWA 3HE4A 2C9NY 2JB0A 1SS1A 5KP6B 1X0TA 1S9KD 1IMQA 1P84I 2ZYAA 2HODB 3H32B 3L35A 1FBMA 4JF7A 1CW5A 2GDYA 1IO4A 2K2QA 4R4MA 3EFGA 3Q2YA 3CMEP 2PEJA 2JBGA 2QA4P 3M1MA 1RE4A 2P1JA 2YKQA 3TNUB 1LTIC 1SQBE 2Z5HA 5KTBA 1SQVK 5CMZA 1N8RQ 1EQ7A 3H1IG 3CWBG 1Y8AA 1YBKA 1BGYG 1LTSC 3L37A 1L2PA 1VF5B 1U7MA 4PD4I 2KG6A 1NU1D 1HJ0A 2W90A 1JCCA 1N7SB 3PH0A 1IMPA 2YO3A 1LT9A 5HVCA 2VLOA 1SQBJ 3H1KD 1VQ7P 3L70E 2GYKA 1IFIA 1KQLA 1P84D 1MV8A 3L71D 1OZHA 1Y47A 3L75E 2V4HA 3GJNA 2VLNA 3LW5J 4LLHA 3P8CD 1M1JC 5CBNA 2B87A 1PGOA 3QH9A 3H1LD 1NAYA 4Y99B 2YXQB 2W6BA 3H1IJ 3HUSC 2ZXXA 2EIAA 3Q5PA 4PWVB 1WT6A 2Q5UA 1FZCB 3EQ2A 2W8ZA 3NTEA 2VLQA 1YI2P 1E5WA 4PD4D 1JY2N 4MRTC 1KILA 3V5BA 2LF4A 4BPGA 1JNMA 1NU1G 2AEMA 4WWIA 2OTKE 4BXLA 5B66E 4N3YB 2OYIB 2JYLA 1A8OA 2GUSA 1HH0A 3H1KG 4EYYQ 4BPFA 4KJMA 2YIUC 1NKZB 3KZIE 3MUDA 1OVVA 2K9YA 3L71G 1KMIZ 3MTUE 4H2XC 1SQQG 3LW5H 2SPZA 4U3FG 3H1LG 4H13C 1RH5B 2LOLA 3HZQA 3B71A 5KLVK 1P84E 3NFQA 4ZMDA 1OWAA 2JJLA 3O6QA 3N4XA 4LGDE 1ZXGA 2K1AA 3P32A 2CG5B 2OYHB 3P8CE 3II6A 2QM7A 1OR5A 2FKWB 4WY4B 1J1EB 2OGUA 2R44A 2VSQA 3H1KJ 1LJ2A 3OJAB 1LT1A 5DJTB 4GIFA 1L0LD 1NTZK 1ZR4A 3M0AA 1VL2A 1L0IA 2KS1B 2EG5A 2E74D 3GZMA 3G1IA 1EDLA 1IUQA 1KB9I 5APUA 1USEA 3H1LJ 2BHVA 1ZP0C 3KHUA 1W5CE 1CEIA 5TJHA 1OMIA 1KYOI 3L73E 3MD0A 1GXHA 1GW4A 2JQ4A 4M3LA 4YXWH 1G2CA 1ZOYC 4UB6E 1GMJA 2CK3H 1L4AD 2FYUK 3B4SA 1VF5C 2KWLA 1HVVA 2Z46A 1SQXE 2N1TD 3IN6A 1N7SC 2CQ8A 5H2FH 3L74E 3HTKA 2E5TA 2WMMA 1BSHA 2AEJA 2LL8A 4XA4A 1FJPA 2KG8A 3BCCG 2N9BA 2WT7B 1OW6A 5DJUB 1L0LG 1P84H 4XRQA 2Y9YA 3U1CA 3AE4C 2M3EA 1JY3O 1M1JA 1KB9D 2PEMA 1IZNB 1SQXJ 1A43A 3CCUP 3AE8C 2H89C 4Y99C 3L74J 1KYOD 3G71P 2IPPA 3G3ZA 1PZQA 2N6YA 3RBZA 1FZCC 3CLQA 2ZYDA 1LP1B 4W7ZA 2KOSA 2I1JA 2KYVA 3RK3B 1Z6MA 5APYA 1NTKD 2O1JA 3R4YA 2XKMA 1BE3G 4PD4H 3FGAD 1HQBA 1QEXA 4XROA 5AW7B 2R5DA 1PFIA 4K3AA 4WB4A 2Y0EA 1H0TA 2FBWC 2OYIC 1FJKA 2ZJSE 1SQQK 4EI2A 4OH8B 3M0DA 2GDWA 2CPBA 4C46A 1KLPA 1A02J 1GU4A 1H88A 2MY5A 1FDMA 2Q6QA 3C8VA 2WPVB 1EDKA 1UJZA 1S5LH 1AVYA 1M74A 2FVAA 4KT0J 4EOTA 2N50A 1GL2D 3VMYA 4R4LA 3O6QB 2VLPA 2Y0DA 1GD2E 1Y9BA 5AW4B 1SQVD 3CE7A 3D6ZA 4OGQB 3Q5RA 3FWNA 3H4EA 4H44B 2MJZA 4XE5B 1URQA 2OYHC 1KB9E 2FACA 1OFCX 3NXSA 4WY4C 2AXTH 1EMVA 1J1EC 2LXCB 2ZT9C 2JDIH 1KYOE 2P7JA 3BRVB 3L72D 1FDIA 3JCUE 1T8KA 4IPYA 1VKUA 3HD7C 3H32A 2JWDA 4DG9A 3D70A 2L22A 2YO2A 2QEXP 4L73A 2WSCJ 3PHLA 1PEMA 1RE3C 1NTKE 4U0BA 2JP3A 1KTMA 1AUMA 1IK7A 5DCKA 3VN0A 3H0DA 3TNUA 1FAVA 1PV3A 2E5YA 4AQRD 3SWFA 4N6JA 1SQVG 2KOQA 3LIDA 1SQPG 1U57A 4IL6E 2C0WA 1BAJA 1K04A 1FC2C 1NTKJ 4D6TE 1DH3A 1FZGA 2XNXA 2LPKA 3A0BE 1N7SA 3G26A 3SFEC 1EDIA 3TYYA 1VQ8P 2FFDB 2LR2A 2NPSD 1BCCD 3DS3A 2M8RA 2XNDH 2AVAA 2FHSC 2PP6A 1LWUB 1SLQA 3M91A 4D6TJ 4QMAA 2WSCH 1KB9H 1CI6A 3L72E 1SQVJ 1UIXA 2LKIA 1OVRA 3PRJA 2K92A 2WTYA 2A06G 2K9JA 5KLVD 2UWJE 3V6IA 1F80D 4HJGH 3NTNA 4GR6A 5KAFH 1FZCA 3B5ND 3P05A 3IFMA 3RK3C 1H0TB 3OA7A 2AF8A 3CCRP 2YMKA 2Q7CA 3L72J 3U1AA 3RG6C 2Z44A 2OYIA 3GG2A 4LC1A 2E42A 1M90Q 1JO5A 2V7QJ 1JM0A 2L4BA 2JWAA 3CCVP 2PNGA 1VQMP 5AVSB 5AVQB 3CL3D 2JAZA 2PRRA 4PJ0H 3CWBD 1R5SA 5KKZB 1NQ4A 1BGYD 3W68A 3VTPC 1H8AA 2N6ZA 2LMLA 4JQ0D 1TU3F 1BCCE 1GW3A
chains in the Genus database with same CATH topology
4PH0A 1YITP 4WYMA 1E6JP 1K8AQ 3DPHA 1VQ4P 1QVFO 3G26A 1KC8Q 1M74A 1JJ2O 3CPWO 1RNIA 2LF4A 5I4TG 1VQ8P 2XT1A 4U0FA 1YJWP 2Z45A 1YJ9P 3DS3A 3B5IA 1QVGO 1W2BO 1RO2A 2OARA 2XV6A 3CMEP 2JYLA 2P9XA 2PEJA 3G1GA 1A8OA 5F2OA 5BS2A 1M1KQ 1VQ6P 1YIJP 2QA4P 1M6EX 3LRYA 3M1MA 4M0IA 1K9MQ 3CCJP 4U0AA 2Z46A 1M6NA 4QNBA 1VQ9P 5HGLA 2ONTA 4U0DA 3CCQP 1EOQA 4PH1A 2E1MA 1NJIQ 1N8RQ 3H4EA 4COPA 2KODA 1VQOP 3CC2P 2OTJP 5BS1A 3G21A 4COCA 1RO0A 2BUOA 3DS2A 1Q81Q 4U0EA 3CMAP 3HYBA 1VQKP 3HZQA 3CCMP 3G6EP 5JPAA 1PEQA 3G0VA 2JYGA 4XFZA 3E2DA 3G29A 4XRQA 1VQ5P 5HGNA 2BQ1E 4GR6A 1EIAA 2PEMA 3CCEP 1PEOA 3H47A 1VQ7P 2PEQA 3MGEA 1A43A 4IPYA 3CCLP 3CCUP 3P05A 3I55P 1VQLP 3WBHA 4XFXA 2PEIA 1K73Q 3G71P 3CD6P 3CCRP 2M8LA 2QEXP 3CXCO 1D1DA 2PENA 2OTLP 1YJNP 3VRLC 1PEMA 1S72P 4U0CA 2M8PA 5HGMA 4GR2A 1QRJA 4U0BA 1KD1Q 3DS4A 1PEUA 3RG6C 1Q7YQ 3CC7P 3DTJA 2Z44A 1K30A 3DS0A 1M90Q 5F2KA 3I56P 3CC4P 1AUMA 3DS5A 3G28A 2DGYA 3DS1A 3CCVP 2PEKA 2EFJA 5DCKA 1VQMP 1ZMBA 1VQNP 2EG5A 3H0DA 2M8NA 3G4SP 3OW2O 2EIAA 5HGOA 3G1IA 1YHQP 2PEOA 1IUQA 4XROA 1Q82Q 2PY8A 1VQPP 1Q86Q 4XFYA 1KQSO 2XXMA 3NTEA 1BAJA 2CWOA 2BHVA 3CCSP 2JO0A 5F2NA 3Q20A 2L6EA 1YI2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE P;  1YIT P;  3I56 P;  1K8A Q;  3CC4 P;  1VQ4 P;  3CCQ P;  3CCV P;  1VQ7 P;  1VQM P;  1NJI Q;  1N8R Q;  3CCL P;  3CCU P;  1QVF O;  1VQN P;  1KC8 Q;  3I55 P;  1VQO P;  3CPW O;  1JJ2 O;  3CC2 P;  1VQL P;  2OTJ P;  1VQ8 P;  3G4S P;  3OW2 O;  1Q81 Q;  1YJW P;  1K73 Q;  3G71 P;  1YJ9 P;  3CD6 P;  3CCR P;  1YHQ P;  1QVG O;  1W2B O;  2QEX P;  3CXC O;  3CME P;  3CMA P;  1Q82 Q;  1VQP P;  1Q86 Q;  1M1K Q;  1VQ6 P;  1YJN P;  2OTL P;  1VQK P;  1S72 P;  1YIJ P;  3CCM P;  2QA4 P;  3G6E P;  1KQS O;  3CCS P;  1K9M Q;  1KD1 Q;  1VQ5 P;  1Q7Y Q;  3CC7 P;  3CCJ P;  1YI2 P;  1VQ9 P;  1M90 Q; 
#chains in the Genus database with same CATH topology
 1URQ B;  2M5A B;  1SFC B;  4OGQ C;  1JY2 P;  2FYZ A;  1FDO A;  5I4T G;  4A7P A;  1AVO A;  4H44 C;  1BXI A;  3B5I A;  2WSE J;  3AEF C;  4C7R A;  2OAR A;  2XV6 A;  2FYU D;  2OYH A;  5TIS H;  1PGJ A;  1QX8 A;  1K9M Q;  4WY4 A;  2E76 D;  5KP7 B;  2KLU A;  3GHG B;  2H88 C;  1GK6 A;  4U0D A;  1BCC J;  5KLV E;  4DOJ A;  2Y0C A;  3B4Q A;  3CC2 P;  2Z4E A;  4KHX A;  3DS2 A;  4IZ6 A;  1L0N K;  4U0E A;  3HD7 A;  1NTZ G;  2KS1 A;  3CCM P;  2V7Q H;  3AE7 C;  2FY8 A;  4PV1 B;  1RE3 A;  1VQ5 P;  3E2D A;  2BQ1 E;  1YTZ I;  2KP8 A;  4F37 A;  3TK1 A;  1SQP K;  4TT3 H;  2PEQ A;  3GLM A;  1ZRT D;  5KLV J;  3WBH A;  1X8Y A;  4I2L C;  1T2K D;  5GTI H;  2OTL P;  2GZI A;  2KGA A;  1PIX A;  4K35 A;  2POH A;  1MKM A;  2YKO A;  1W2E A;  3H1I E;  3CWB E;  2KLV A;  3L70 G;  1BGY E;  3EWK A;  2FYU G;  2WSE H;  2BCC G;  5CJ4 A;  2Q3I A;  2ROQ A;  1IK9 A;  2FFD C;  1L0H A;  1SQQ D;  2ZVN B;  2D2C B;  2KR5 A;  2XZ1 C;  4U3F D;  4H0L D;  2WT7 A;  1E6J P;  1CI6 B;  4YXD C;  1LWU C;  3H1H G;  2CGQ A;  2K9J B;  1S1C X;  3CWB J;  3P7K A;  5EFW B;  1S9K E;  1S3J A;  1IFM A;  1BGY J;  4L75 A;  4YPC A;  2GM4 A;  2FXO A;  1RO2 A;  4Z1M H;  1JMB A;  1PPJ G;  3O8Z A;  3JC2 2;  3NMD A;  4QNB A;  3BVH A;  5APT A;  2O1K A;  1JUN A;  1OW7 A;  3VMX A;  1D7M A;  2FYU J;  1LP1 A;  3AEE C;  4MN4 C;  4IL6 X;  4ZKP A;  4UHP B;  3PLN A;  1ZME C;  2MVV A;  3M0D C;  1FZE A;  1ZRT E;  1PEQ A;  3F89 A;  1GU5 A;  2A45 G;  2PFX A;  1LTA C;  1DD4 A;  2QM8 A;  3RK2 B;  1NU1 E;  1KIL D;  5H2F E;  2R5B A;  4HYT B;  1USD A;  1LTT C;  2M8L A;  1NO4 A;  1X3O A;  2AFE A;  2M0B A;  1YJN P;  3U59 A;  3H1K E;  4U0C A;  2KSE A;  2J58 A;  5AW8 B;  4N78 D;  1PEU A;  3L71 E;  5KKZ C;  3VMZ A;  1T3U A;  3DS0 A;  1HGV A;  1NKN A;  2PGD A;  1SQQ E;  1URQ C;  1SFC C;  1NU1 J;  3H1L E;  3SWK A;  3RL0 D;  2ZT9 B;  1U7J A;  1EXI A;  2KGD A;  3KDP B;  3BCC D;  4JYB A;  2L6E A;  5L8R J;  2R32 A;  4BRY A;  3L71 J;  2N5I A;  3HD7 B;  3GHG C;  5APX A;  1PP9 D;  1JTH B;  1SQQ J;  1GZL A;  1QVG O;  4ASW A;  4PD4 E;  4U3F J;  3G1G A;  5GTH H;  2MR8 A;  2R3S A;  2FXP A;  3H1J G;  1VQ9 P;  5AW0 B;  3S1K A;  3SWY A;  3Q5S A;  4PV1 C;  3L73 G;  3LMO A;  2AXC A;  2YXR B;  4HKG A;  2HLO A;  2KGC A;  1S5L E;  1QLE D;  3VYI A;  5BVZ A;  5KJ7 C;  3WUU A;  2OYO A;  1IC2 A;  2DW3 A;  4HB1 A;  5CCG C;  2J59 M;  1JCD A;  1AJY A;  1BE3 D;  1KIL E;  1S4X A;  4R0M A;  1VPC A;  3UIA A;  1JY3 N;  5AVZ B;  4NPD A;  3MGN A;  2W6J H;  1KV4 A;  1D1D A;  5CCH C;  1NH4 A;  3VRL C;  2FFD A;  2AXT E;  1KD1 Q;  2K88 A;  1SVF A;  1EDJ A;  2RMZ A;  3FWL A;  1PP9 G;  3PTZ A;  2W83 C;  2D2C C;  2PEK A;  2EFJ A;  2KGE A;  2KK7 A;  3D71 A;  1LWU A;  3BCC E;  5B5E E;  2L91 A;  5KAI H;  2PEO A;  1PL5 A;  1L0L E;  1AQT A;  2G3A A;  1AF8 A;  2IX7 C;  1NTM G;  1M7L A;  3TGU G;  2H8P D;  1RQV A;  2ZYG A;  1FOS F;  4U0F A;  1YJW P;  1DNY A;  1UII A;  3BCC J;  3E1R A;  4GT1 A;  3HE5 B;  2L0Q A;  1E79 H;  1L0L J;  1KQG B;  4M0I A;  3TDK A;  2QSI A;  2FXM A;  4UB8 H;  4JYC A;  2Q9I A;  3CCQ P;  1AV1 A;  2JO1 A;  2E1M A;  2FAE A;  4COP A;  1BE3 E;  1G1J A;  1VQO P;  1L0N D;  5BS1 A;  1AQ5 A;  2EHS A;  5AVR B;  3RK2 C;  5BU5 A;  2Q3E A;  1T8Z A;  5JPA A;  2JYG A;  1FZA A;  2HG5 D;  2IFM A;  2P2U A;  1ZV8 A;  1SQP D;  3A7O A;  4U7J A;  1IFJ A;  2XZ0 D;  1DV5 A;  3L36 A;  5APW A;  3AED C;  1BE3 J;  2ZFC A;  2M5A A;  1SFC A;  4BRY B;  2K3R A;  1DX7 A;  1AFO A;  2E74 B;  5E79 H;  4H13 D;  2KUB A;  3C9I A;  2ZVO B;  3V2R A;  5F2K A;  3FX0 A;  1R8E A;  1UNK A;  2DGY A;  5KAF E;  1EZV G;  1LGH B;  2QNW A;  3NY7 B;  4BPH A;  4XFJ A;  5B5E H;  2M8N A;  1MFT A;  3GHG A;  2IBZ G;  3OAK A;  3I5C A;  2XZR A;  2FAD A;  1HGZ A;  1S2E A;  2JU2 A;  5CJ0 A;  4GDO A;  4ZNC A;  1L0N G;  2A06 D;  1K8A Q;  1L4A B;  2RKL A;  1LTJ B;  4IOI H;  3A0H H;  2CNR A;  2XT1 A;  2N1T B;  3M9H A;  1SQX K;  2HR3 A;  2P9X A;  5KJ7 A;  4PJ0 E;  5CCG A;  3EJE A;  1M6E X;  2LKM A;  2NZ2 A;  5HGL A;  1KFM A;  3G21 A;  1SQV E;  2XV5 A;  3GMA A;  5EJD A;  1OX3 A;  2WPQ A;  1FU1 A;  3H25 A;  4AYC A;  5CCH A;  3G6E P;  5TIS E;  2LIU A;  5HGN A;  2N9Y B;  2H43 A;  1VF5 D;  1ZR2 A;  3MGE A;  4W7Y A;  3V4W A;  3ITK A;  3W67 A;  2QRX A;  1N7S D;  5AW2 B;  1NTM K;  1KN7 A;  3SSU A;  3B8E B;  2Z5I A;  2PEN A;  2H7H A;  1SQP J;  5KLI B;  4GR2 A;  4O9B A;  2KIK A;  1YQ3 C;  1Q7Y Q;  1K30 A;  3LIE A;  1S5L X;  5C39 A;  4L76 A;  1NAF A;  2MD9 A;  1CZQ A;  2AEF A;  3AEB C;  1OW8 A;  1YTZ T;  3OW2 O;  3WUV A;  2A06 E;  4I7Z B;  1YHQ P;  3VMA A;  4XFY A;  4GKG A;  5GTI E;  1KQS O;  1HWT C;  2CWO A;  2QG4 A;  5F2N A;  1ZW0 A;  3GF3 A;  1NTZ D;  1GL2 B;  3A2A A;  4WYM A;  2IZ1 A;  1N73 B;  2LIW A;  2R3C A;  2Y9Z A;  1JJ2 O;  1FS0 E;  1HJB A;  2KI7 B;  3AE5 C;  4NPF X;  1VQ6 P;  3A3Y B;  5F2O A;  4NEO A;  1WRG A;  1CSB A;  1RF0 C;  3LRY A;  1T3J A;  2P10 A;  4U0A A;  1M6N A;  2QJY B;  1Q90 D;  2ONT A;  3FXD A;  4PH1 A;  2NO8 A;  3BAT A;  2KOD A;  2WIT A;  3M06 A;  3AE3 C;  5APV A;  2N98 A;  4DT0 A;  4WBA A;  2MKV A;  1GDT A;  3VOP A;  4DJG A;  3L70 D;  1AYI A;  5AVX B;  3C1L A;  2BCC D;  3V2Q A;  2A45 I;  2JU1 A;  2BEQ D;  3L75 D;  1EIA A;  3CCE P;  5AVY B;  2E74 C;  2IYP A;  2BEZ F;  1RQU A;  3WU2 E;  2G8Y A;  3IR9 A;  4GOF A;  3H6P A;  3EJD A;  1K73 Q;  3CD6 P;  2ZXE B;  3H1H D;  5AVT B;  1JTH A;  2WPT A;  2MVU A;  2I1K A;  4WY4 D;  1SQB G;  1ZN5 A;  1PPJ D;  4IFF A;  2ZT9 D;  1KOR A;  3A5T A;  3ABV C;  2GUV A;  1SP4 A;  5APQ A;  2YKP A;  1L4A C;  2QJK B;  5HGO A;  1NTZ E;  4C7N A;  1LTJ C;  2B88 A;  1VQP P;  1Q86 Q;  1QL2 A;  3HD7 D;  2JGP A;  2N1T C;  3CCS P;  2LTE A;  2NPS B;  2O01 H;  2ITA A;  3V2P A;  3AEA C;  4L74 A;  1J2J B;  1T6A A;  1MZ9 A;  2QIW A;  2X2B A;  1KFN A;  3WMM 0;  3GF7 A;  4DZO A;  2J5U A;  4I6M C;  4AUW A;  3L75 G;  1NTZ J;  2E43 A;  1NHL A;  2FQ0 A;  3AE2 C;  1AA0 A;  3MP7 B;  2B89 A;  2HFE D;  4I1L A;  5AVV B;  1NVO A;  1EOQ A;  2FYU E;  2BCC E;  3T97 B;  3CX5 I;  5AVW B;  2OTJ P;  4ZKU A;  4CPG A;  1RY3 A;  3KXD A;  3CMA P;  1RF1 A;  7CEI A;  3AEG C;  3B5N B;  4OWF A;  5GTH E;  1NWQ A;  4XFZ A;  2KNC B;  5KLI C;  1J1D B;  3BRT B;  3H1H E;  3WU2 H;  3TF5 A;  2KZJ A;  2GZE A;  3L70 J;  3AE1 C;  1VQL P;  2BCC J;  1JY3 P;  2GA1 A;  1PPJ E;  2ERH A;  3IAO A;  3L75 J;  2M5R A;  4I7Z C;  1JB0 J;  5AW3 B;  3ZDM A;  3CC7 P;  2E75 B;  4GOD A;  1VDF A;  2IDB A;  3HE5 A;  2YNY A;  3CC4 P;  3MZW B;  3DS5 A;  1ZMB A;  3H1H J;  1GL2 C;  2JEE A;  1QL1 A;  2FYN B;  3H1J D;  1N73 C;  1IFD A;  2QJP B;  2RN0 A;  3L73 D;  3AEC C;  3CX5 D;  3RK3 D;  2WZ7 A;  1JY2 O;  1GPJ A;  3AE6 C;  2JKV A;  1RF0 A;  4DCK A;  4PH0 A;  5AW9 B;  2KW2 A;  1KQF B;  4H2W C;  1QVF O;  2E76 B;  2QJY C;  2WQY C;  3CXH I;  1DEB A;  1SQX D;  4U3F E;  1FOS E;  1YJ9 P;  5APS A;  3L74 D;  4WVZ A;  5KAI E;  1DEE G;  2VRS A;  1G1I A;  2YMY A;  1IFN A;  3HE4 B;  1X79 B;  1ACP A;  4RO0 A;  3VP9 A;  2EHT A;  2PAJ A;  3AE9 C;  3RL0 g;  1WMK A;  1HF9 A;  2BUO A;  1Q81 Q;  3GKL C;  4OGQ D;  2WSS H;  1SQB K;  2K37 A;  1DIP A;  1X9V A;  3GW6 A;  1VQK P;  4EIJ A;  1NGM B;  4H44 D;  3G0V A;  1N2D C;  3N7N A;  4C7N B;  4UB8 E;  2K93 A;  1N7L A;  3RGU A;  1NTM D;  2B9B A;  3U43 A;  2P58 A;  1L4A A;  3USS A;  4BWN A;  3TGU D;  2KOO A;  1K05 A;  2QJK C;  2L9F A;  1LTJ A;  5M1B A;  1QRJ A;  3CXH D;  3H1J E;  3DS4 A;  5CZD B;  2N1T A;  2O01 N;  1ZLL A;  1SQX G;  3CX5 E;  2NPS C;  1EZV I;  1LTG C;  3RK3 E;  1H89 A;  5B66 H;  1YQ4 C;  3L74 G;  4OVN F;  4H0L B;  4N78 E;  2IBZ I;  2FQ2 A;  1LT9 B;  2WVR A;  1Q82 Q;  2PY8 A;  2A45 H;  2GZF A;  1Q2N A;  1BDC A;  2K0Y A;  1LTB C;  2XXM A;  2DNW A;  3KZI H;  2KZI A;  2K0X A;  3H1J J;  5E79 E;  2KXP B;  2N5H A;  3DPH A;  3K5B A;  3D6Y A;  3L73 J;  4B86 A;  1RF1 B;  1KC8 Q;  3KPE A;  2IFN A;  3Q1M A;  5K5G B;  3EJB A;  2L5G B;  2B87 B;  2Z45 A;  1NOH A;  1W2B O;  1NYH A;  4HH2 A;  1M1K Q;  3CI9 A;  1YIJ P;  4CA3 A;  1PP9 E;  3B5N C;  1E0H A;  1JEK A;  1J1D C;  3HUS A;  4COC A;  1BDD A;  3A0H E;  1EZV D;  4TLF A;  3TSI A;  3HYB A;  1KIL B;  1NTM E;  2IBZ D;  1NU1 K;  1PP9 J;  3TGU E;  2C9L Y;  2IZ0 A;  3CCL P;  2E75 C;  2HPC A;  2O3J A;  4NPE A;  3E1I A;  5AW5 B;  3CXH E;  1ZNV A;  1PGP A;  4EDF A;  1GL2 A;  3E7K A;  1N73 A;  2FYN C;  4IFD K;  3EFF K;  2M8P A;  2QJP C;  5HGM A;  1DD3 A;  2GDX A;  5BU8 B;  1HBW A;  3G9R A;  4JBZ A;  1NTM J;  3RL0 B;  3CX5 H;  1LNQ A;  3TGU J;  4UB6 H;  3F5H A;  4D6T D;  3KYQ A;  3M9B A;  3G4S P;  1EC5 A;  4IFM A;  1KZU B;  2E76 C;  4HKZ H;  1Z56 A;  1FZF A;  2WWW A;  4JPZ B;  3V4Q A;  2I8D A;  1YIT P;  2JR8 A;  2Q1K A;  4PXH B;  4RKU J;  1HTL C;  1M57 D;  5HV8 A;  2IYO A;  1RNI A;  2KSJ A;  2WPR A;  1MZ8 A;  5CHX A;  2HYN A;  1URQ D;  1SFC D;  1VHN A;  1NTK G;  1XTG B;  3R2P A;  3CCJ P;  2GZG A;  2AFD A;  1IFP A;  1EZV E;  1GK4 A;  2M3B A;  1HUC A;  3IF4 A;  1T2K C;  1IJD B;  1MFZ A;  1FE6 A;  2QE7 H;  2IBZ E;  2W6A A;  2HOD A;  1OVU A;  4W80 A;  5AW6 B;  4GOE A;  1RE4 C;  2ZAE B;  2KOR A;  1YYC A;  5AW1 B;  1L0N E;  1G2C B;  1OIP A;  3QWO C;  4D6T G;  1MUU A;  1GXG A;  2K0D X;  3H47 A;  2K5X A;  3CXH H;  4ASV A;  3I55 P;  2NPS A;  5CBO A;  2K94 A;  4PV1 D;  1SQP E;  3HRN A;  3CXC O;  1A02 F;  4H0L C;  3GZL A;  3M9Q A;  2CPS A;  1LT9 C;  3HTK B;  5KJ7 D;  1FZB A;  5CCG D;  3S9O A;  3VP8 A;  4YTP C;  3KQG A;  1L0N J;  2LXB A;  1L0L K;  5KP8 B;  4RES B;  2RH0 A;  2XU6 A;  1RF1 C;  1M1J B;  2MR7 A;  2C0X A;  3T97 A;  3L72 G;  2XDJ A;  2OQQ A;  3L4F A;  3RG2 A;  1OXZ A;  5CCH D;  2JO0 A;  3Q20 A;  3WUT A;  3HUS B;  4H2Y C;  1VQ4 P;  2WSF J;  3B5N A;  2KB7 P;  3CPW O;  2KNC A;  2NRG A;  2D2C D;  5BS2 A;  5AVU B;  3FXE A;  1M8O B;  3V2N A;  1KYO H;  1PGQ A;  3S4R A;  2HPC B;  1BSN A;  2BAS A;  2FVE A;  1R5L A;  1GTW A;  3JCU H;  1KIL C;  1FR2 A;  2FVF A;  2KOG A;  1NJI Q;  3BAS A;  3PJS K;  3SFD C;  1JMM A;  1SQB D;  3Q3D A;  3PP5 A;  1EXJ A;  1RO0 A;  1JOC A;  2YIU B;  3MUD C;  3G29 A;  1N86 A;  1PEO A;  1BCC G;  3JSV C;  2O01 J;  3RL0 C;  2KOP A;  4H13 B;  3P8M C;  4XFX A;  2PEI A;  2E75 D;  4QKO A;  4IL6 H;  3MHV A;  3H1I D;  2WPS A;  1S72 P;  1M56 D;  4Y28 J;  3RK2 D;  2WSF H;  1QGK B;  2P67 A;  3DTJ A;  2FQ1 A;  3A0B H;  3I56 P;  1RHZ B;  3G28 A;  1XTC C;  3DS1 A;  1HY8 A;  4RJT A;  1VQN P;  5KLV G;  2MF4 A;  2W27 A;  2QVA A;  5EW5 E;  1NTK K;  2KG9 A;  3RBX A;  1X22 A;  2GZJ A;  3MIW A;  3HE4 A;  2C9N Y;  2JB0 A;  1SS1 A;  5KP6 B;  1X0T A;  1S9K D;  1IMQ A;  1P84 I;  2ZYA A;  2HOD B;  3H32 B;  3L35 A;  1FBM A;  4JF7 A;  1CW5 A;  2GDY A;  1IO4 A;  2K2Q A;  4R4M A;  3EFG A;  3Q2Y A;  3CME P;  2PEJ A;  2JBG A;  2QA4 P;  3M1M A;  1RE4 A;  2P1J A;  2YKQ A;  3TNU B;  1LTI C;  1SQB E;  2Z5H A;  5KTB A;  1SQV K;  5CMZ A;  1N8R Q;  1EQ7 A;  3H1I G;  3CWB G;  1Y8A A;  1YBK A;  1BGY G;  1LTS C;  3L37 A;  1L2P A;  1VF5 B;  1U7M A;  4PD4 I;  2KG6 A;  1NU1 D;  1HJ0 A;  2W90 A;  1JCC A;  1N7S B;  3PH0 A;  1IMP A;  2YO3 A;  1LT9 A;  5HVC A;  2VLO A;  1SQB J;  3H1K D;  1VQ7 P;  3L70 E;  2GYK A;  1IFI A;  1KQL A;  1P84 D;  1MV8 A;  3L71 D;  1OZH A;  1Y47 A;  3L75 E;  2V4H A;  3GJN A;  2VLN A;  3LW5 J;  4LLH A;  3P8C D;  1M1J C;  5CBN A;  2B87 A;  1PGO A;  3QH9 A;  3H1L D;  1NAY A;  4Y99 B;  2YXQ B;  2W6B A;  3H1I J;  3HUS C;  2ZXX A;  2EIA A;  3Q5P A;  4PWV B;  1WT6 A;  2Q5U A;  1FZC B;  3EQ2 A;  2W8Z A;  3NTE A;  2VLQ A;  1YI2 P;  1E5W A;  4PD4 D;  1JY2 N;  4MRT C;  1KIL A;  3V5B A;  2LF4 A;  4BPG A;  1JNM A;  1NU1 G;  2AEM A;  4WWI A;  2OTK E;  4BXL A;  5B66 E;  4N3Y B;  2OYI B;  2JYL A;  1A8O A;  2GUS A;  1HH0 A;  3H1K G;  4EYY Q;  4BPF A;  4KJM A;  2YIU C;  1NKZ B;  3KZI E;  3MUD A;  1OVV A;  2K9Y A;  3L71 G;  1KMI Z;  3MTU E;  4H2X C;  1SQQ G;  3LW5 H;  2SPZ A;  4U3F G;  3H1L G;  4H13 C;  1RH5 B;  2LOL A;  3HZQ A;  3B71 A;  5KLV K;  1P84 E;  3NFQ A;  4ZMD A;  1OWA A;  2JJL A;  3O6Q A;  3N4X A;  4LGD E;  1ZXG A;  2K1A A;  3P32 A;  2CG5 B;  2OYH B;  3P8C E;  3II6 A;  2QM7 A;  1OR5 A;  2FKW B;  4WY4 B;  1J1E B;  2OGU A;  2R44 A;  2VSQ A;  3H1K J;  1LJ2 A;  3OJA B;  1LT1 A;  5DJT B;  4GIF A;  1L0L D;  1NTZ K;  1ZR4 A;  3M0A A;  1VL2 A;  1L0I A;  2KS1 B;  2EG5 A;  2E74 D;  3GZM A;  3G1I A;  1EDL A;  1IUQ A;  1KB9 I;  5APU A;  1USE A;  3H1L J;  2BHV A;  1ZP0 C;  3KHU A;  1W5C E;  1CEI A;  5TJH A;  1OMI A;  1KYO I;  3L73 E;  3MD0 A;  1GXH A;  1GW4 A;  2JQ4 A;  4M3L A;  4YXW H;  1G2C A;  1ZOY C;  4UB6 E;  1GMJ A;  2CK3 H;  1L4A D;  2FYU K;  3B4S A;  1VF5 C;  2KWL A;  1HVV A;  2Z46 A;  1SQX E;  2N1T D;  3IN6 A;  1N7S C;  2CQ8 A;  5H2F H;  3L74 E;  3HTK A;  2E5T A;  2WMM A;  1BSH A;  2AEJ A;  2LL8 A;  4XA4 A;  1FJP A;  2KG8 A;  3BCC G;  2N9B A;  2WT7 B;  1OW6 A;  5DJU B;  1L0L G;  1P84 H;  4XRQ A;  2Y9Y A;  3U1C A;  3AE4 C;  2M3E A;  1JY3 O;  1M1J A;  1KB9 D;  2PEM A;  1IZN B;  1SQX J;  1A43 A;  3CCU P;  3AE8 C;  2H89 C;  4Y99 C;  3L74 J;  1KYO D;  3G71 P;  2IPP A;  3G3Z A;  1PZQ A;  2N6Y A;  3RBZ A;  1FZC C;  3CLQ A;  2ZYD A;  1LP1 B;  4W7Z A;  2KOS A;  2I1J A;  2KYV A;  3RK3 B;  1Z6M A;  5APY A;  1NTK D;  2O1J A;  3R4Y A;  2XKM A;  1BE3 G;  4PD4 H;  3FGA D;  1HQB A;  1QEX A;  4XRO A;  5AW7 B;  2R5D A;  1PFI A;  4K3A A;  4WB4 A;  2Y0E A;  1H0T A;  2FBW C;  2OYI C;  1FJK A;  2ZJS E;  1SQQ K;  4EI2 A;  4OH8 B;  3M0D A;  2GDW A;  2CPB A;  4C46 A;  1KLP A;  1A02 J;  1GU4 A;  1H88 A;  2MY5 A;  1FDM A;  2Q6Q A;  3C8V A;  2WPV B;  1EDK A;  1UJZ A;  1S5L H;  1AVY A;  1M74 A;  2FVA A;  4KT0 J;  4EOT A;  2N50 A;  1GL2 D;  3VMY A;  4R4L A;  3O6Q B;  2VLP A;  2Y0D A;  1GD2 E;  1Y9B A;  5AW4 B;  1SQV D;  3CE7 A;  3D6Z A;  4OGQ B;  3Q5R A;  3FWN A;  3H4E A;  4H44 B;  2MJZ A;  4XE5 B;  1URQ A;  2OYH C;  1KB9 E;  2FAC A;  1OFC X;  3NXS A;  4WY4 C;  2AXT H;  1EMV A;  1J1E C;  2LXC B;  2ZT9 C;  2JDI H;  1KYO E;  2P7J A;  3BRV B;  3L72 D;  1FDI A;  3JCU E;  1T8K A;  4IPY A;  1VKU A;  3HD7 C;  3H32 A;  2JWD A;  4DG9 A;  3D70 A;  2L22 A;  2YO2 A;  2QEX P;  4L73 A;  2WSC J;  3PHL A;  1PEM A;  1RE3 C;  1NTK E;  4U0B A;  2JP3 A;  1KTM A;  1AUM A;  1IK7 A;  5DCK A;  3VN0 A;  3H0D A;  3TNU A;  1FAV A;  1PV3 A;  2E5Y A;  4AQR D;  3SWF A;  4N6J A;  1SQV G;  2KOQ A;  3LID A;  1SQP G;  1U57 A;  4IL6 E;  2C0W A;  1BAJ A;  1K04 A;  1FC2 C;  1NTK J;  4D6T E;  1DH3 A;  1FZG A;  2XNX A;  2LPK A;  3A0B E;  1N7S A;  3G26 A;  3SFE C;  1EDI A;  3TYY A;  1VQ8 P;  2FFD B;  2LR2 A;  2NPS D;  1BCC D;  3DS3 A;  2M8R A;  2XND H;  2AVA A;  2FHS C;  2PP6 A;  1LWU B;  1SLQ A;  3M91 A;  4D6T J;  4QMA A;  2WSC H;  1KB9 H;  1CI6 A;  3L72 E;  1SQV J;  1UIX A;  2LKI A;  1OVR A;  3PRJ A;  2K92 A;  2WTY A;  2A06 G;  2K9J A;  5KLV D;  2UWJ E;  3V6I A;  1F80 D;  4HJG H;  3NTN A;  4GR6 A;  5KAF H;  1FZC A;  3B5N D;  3P05 A;  3IFM A;  3RK3 C;  1H0T B;  3OA7 A;  2AF8 A;  3CCR P;  2YMK A;  2Q7C A;  3L72 J;  3U1A A;  3RG6 C;  2Z44 A;  2OYI A;  3GG2 A;  4LC1 A;  2E42 A;  1M90 Q;  1JO5 A;  2V7Q J;  1JM0 A;  2L4B A;  2JWA A;  3CCV P;  2PNG A;  1VQM P;  5AVS B;  5AVQ B;  3CL3 D;  2JAZ A;  2PRR A;  4PJ0 H;  3CWB D;  1R5S A;  5KKZ B;  1NQ4 A;  1BGY D;  3W68 A;  3VTP C;  1H8A A;  2N6Z A;  2LML A;  4JQ0 D;  1TU3 F;  1BCC E;  1GW3 A; 
#chains in the Genus database with same CATH homology
 4PH0 A;  1YIT P;  4WYM A;  1E6J P;  1K8A Q;  3DPH A;  1VQ4 P;  1QVF O;  3G26 A;  1KC8 Q;  1M74 A;  1JJ2 O;  3CPW O;  1RNI A;  2LF4 A;  5I4T G;  1VQ8 P;  2XT1 A;  4U0F A;  1YJW P;  2Z45 A;  1YJ9 P;  3DS3 A;  3B5I A;  1QVG O;  1W2B O;  1RO2 A;  2OAR A;  2XV6 A;  3CME P;  2JYL A;  2P9X A;  2PEJ A;  3G1G A;  1A8O A;  5F2O A;  5BS2 A;  1M1K Q;  1VQ6 P;  1YIJ P;  2QA4 P;  1M6E X;  3LRY A;  3M1M A;  4M0I A;  1K9M Q;  3CCJ P;  4U0A A;  2Z46 A;  1M6N A;  4QNB A;  1VQ9 P;  5HGL A;  2ONT A;  4U0D A;  3CCQ P;  1EOQ A;  4PH1 A;  2E1M A;  1NJI Q;  1N8R Q;  3H4E A;  4COP A;  2KOD A;  1VQO P;  3CC2 P;  2OTJ P;  5BS1 A;  3G21 A;  4COC A;  1RO0 A;  2BUO A;  3DS2 A;  1Q81 Q;  4U0E A;  3CMA P;  3HYB A;  1VQK P;  3HZQ A;  3CCM P;  3G6E P;  5JPA A;  1PEQ A;  3G0V A;  2JYG A;  4XFZ A;  3E2D A;  3G29 A;  4XRQ A;  1VQ5 P;  5HGN A;  2BQ1 E;  4GR6 A;  1EIA A;  2PEM A;  3CCE P;  1PEO A;  3H47 A;  1VQ7 P;  2PEQ A;  3MGE A;  1A43 A;  4IPY A;  3CCL P;  3CCU P;  3P05 A;  3I55 P;  1VQL P;  3WBH A;  4XFX A;  2PEI A;  1K73 Q;  3G71 P;  3CD6 P;  3CCR P;  2M8L A;  2QEX P;  3CXC O;  1D1D A;  2PEN A;  2OTL P;  1YJN P;  3VRL C;  1PEM A;  1S72 P;  4U0C A;  2M8P A;  5HGM A;  4GR2 A;  1QRJ A;  4U0B A;  1KD1 Q;  3DS4 A;  1PEU A;  3RG6 C;  1Q7Y Q;  3CC7 P;  3DTJ A;  2Z44 A;  1K30 A;  3DS0 A;  1M90 Q;  5F2K A;  3I56 P;  3CC4 P;  1AUM A;  3DS5 A;  3G28 A;  2DGY A;  3DS1 A;  3CCV P;  2PEK A;  2EFJ A;  5DCK A;  1VQM P;  1ZMB A;  1VQN P;  2EG5 A;  3H0D A;  2M8N A;  3G4S P;  3OW2 O;  2EIA A;  5HGO A;  3G1I A;  1YHQ P;  2PEO A;  1IUQ A;  4XRO A;  1Q82 Q;  2PY8 A;  1VQP P;  1Q86 Q;  4XFY A;  1KQS O;  2XXM A;  3NTE A;  1BAJ A;  2CWO A;  2BHV A;  3CCS P;  2JO0 A;  5F2N A;  3Q20 A;  2L6E A;  1YI2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...