1QVFO

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qvfO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1qvfO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1qvfO03
3CC2P 3CCLP 3CCVP 1K9MQ 1N8RQ 3G71P 1VQ7P 1Q82Q 3CCUP 3CMAP 3CCEP 1VQ6P 3CCRP 1NJIQ 1S72P 1VQ5P 3CMEP 1YJWP 2OTJP 3CC7P 1K8AQ 3CCQP 1YJ9P 1KC8Q 1Q7YQ 1QVGO 3CCMP 1VQMP 2QEXP 1VQNP 1YITP 2QA4P 1VQKP 1QVFO 3CXCO 1Q86Q 1K73Q 1M90Q 3G4SP 3CCJP 3CC4P 3CPWO 1Q81Q 3G6EP 3I56P 3CCSP 1YHQP 1YJNP 1VQ8P 1VQLP 1W2BO 3OW2O 1KQSO 1VQ4P 2OTLP 3I55P 1YI2P 1M1KQ 3CD6P 1VQPP 1VQOP 1YIJP 1JJ2O 1KD1Q 1VQ9P
chains in the Genus database with same CATH superfamily
3G1GA 4XROA 2IPPA 5HGLA 4Y28J 1MUUA 1G2CA 4JF7A 3CCUP 4RESB 3CMEP 2L9FA 3VP8A 2OYIC 2QJYC 3AEDC 4EDFA 5BU5A 1KYOI 1ZNVA 2MD9A 2DW3A 1QLED 1PGPA 5B5EH 2CPBA 1L0NE 2FYNC 2GUSA 2ZT9D 1IC2A 4D6TE 3CX5H 3HD7A 1NTKJ 2A45I 3LIEA 5AW3B 3EFFK 2BCCJ 1BXIA 5F2KA 1MFTA 2RMZA 3H1JD 3CCSP 1F80D 1SQVJ 2FBWC 5GTHE 5CBOA 1HJBA 1QL2A 4UB6H 1HY8A 1FZGA 1Z6MA 1M1JC 3EQ2A 5HGOA 2WPSA 2WPQA 3NY7B 3H32B 3AEFC 1LWUA 1KB9E 4WY4C 1JB0J 1A02F 1YHQP 3KZIE 3MGEA 2OTLP 4YPCA 3I55P 1YI2P 2VLQA 1GL2B 1OVUA 2R3CA 4PXHB 1CI6B 1GXGA 1URQB 5KP6B 5TJHA 2JJLA 2MJZA 2NPSD 1NU1K 2EHSA 1QRJA 3EJBA 3FXEA 1S9KD 1L4AC 1A43A 1U57A 1Q7YQ 3H6PA 1OW8A 1H0TB 2GDYA 1LJ2A 1SQQJ 4N78E 1RE4A 2C0WA 2H8PD 2ZVNB 3G71P 1T3UA 2IX7C 1G1IA 2JWAA 4EIJA 1SFCC 3L71G 2FYUE 3TNUB 4H44B 2WPVB 4UHPB 3GHGB 2J58A 4GR2A 1LTSC 1IK9A 2XZ1C 3CXHI 2H43A 3OW2O 1L0NJ 4XFZA 3HUSA 1KD1Q 1PGJA 2AEMA 5AW2B 2K5XA 4U0FA 2C0XA 3H1ID 1FOSE 3UIAA 1QEXA 1ZXGA 2QE7H 1SS1A 3SWFA 2Q3IA 1T8ZA 4LLHA 4U0CA 3P32A 1RF1A 2KNCA 2YNYA 3P8MC 4U3FD 3M91A 2N6ZA 3E2DA 5M1BA 2CNRA 5C39A 3RK3C 3M06A 1EDIA 2Q7CA 4C7NA 1YJNP 1PEMA 1URQD 2AF8A 3VMZA 1D1DA 3M0DC 1SQXG 3ITKA 1H88A 1VQOP 5AW4B 1K9MQ 2JKVA 2GUVA 1Y9BA 1LT9A 5DJUB 1HJ0A 1LNQA 1NJIQ 1GTWA 5BS2A 2OTJP 4H13C 3IF4A 1X0TA 1PEUA 1IMQA 2E1MA 3IN6A 3LW5H 2FFDC 5AVQB 3L73E 2E76C 3L37A 3B5ND 2ZJSE 4PH0A 3BCCD 1DEEG 2FYUJ 4H44D 1W2EA 1BCCG 2XZ0D 4U0EA 3V2PA 1CEIA 5CCGA 1BGYG 2LTEA 2JBGA 2JWDA 2KG6A 4Y99B 4GKGA 2O01J 2KB7P 1XTCC 1RF0A 3CCLP 3TGUJ 5APSA 1MKMA 2AXCA 1LTJA 2WSEH 2Y0EA 4U0AA 1M56D 1KYOH 1IJDB 2P58A 2KW2A 1LT1A 3MIWA 1XTGB 2ERHA 3L71D 4A7PA 3A2AA 4ASVA 2HR3A 2Y0DA 3F5HA 4O9BA 3P7KA 2IBZI 1FS0E 3CE7A 1ACPA 3AECC 1EMVA 3RL0g 1KFNA 2YO2A 1NU1G 3RK3E 2KGCA 1KMIZ 4WWIA 3RGUA 2XV5A 1YIJP 1VHNA 2YKQA 2R44A 3FXDA 5E79H 5KJ7C 3V2NA 4OH8B 3KDPB 3L70E 1VQ6P 3MZWB 2OYOA 3KHUA 4RKUJ 1GW3A 1OVVA 2KORA 2J59M 4HYTB 2FACA 3BVHA 1EZVD 3HE4B 1L0IA 3L74G 1FR2A 3LRYA 4OGQC 4N3YB 1M74A 2ZFCA 3AEAC 1YTZI 3DS2A 4IL6X 1NKNA 1PGOA 2K1AA 3CCJP 4M0IA 1KILC 5KLVG 1FDOA 1GU4A 1H8AA 3T97B 2GZEA 2E5TA 2N6YA 2FYZA 3DS5A 1PPJG 2QJKB 2CPSA 3CXHH 1L0LE 2YKOA 3CWBG 4PV1B 1S5LE 1BCCD 5BVZA 2FY8A 3M9HA 1NTZJ 1LTJC 3H1HE 1BGYD 4W7ZA 2WITA 3L75D 1NTME 1SQPG 5KKZC 5APUA 2P7JA 4PD4I 1KQFB 3D70A 3L72D 2KG8A 4W7YA 3CPWO 1L4AB 4B86A 1SQBK 4JQ0D 4BPFA 5AVSB 5AVXB 2LXBA 1HGZA 3FGAD 3AE8C 1BE3D 3H1LE 1ZMEC 4HB1A 4KJMA 1JTHB 2K0XA 1MFZA 4IFDK 1S2EA 2P67A 1JO5A 1NU1D 4BXLA 1NGMB 3MHVA 1IK7A 2WSCH 2N1TA 3JCUH 2H7HA 1G2CB 1PL5A 4ZKUA 2CWOA 3KYQA 2KLUA 2K92A 3Q20A 5KTBA 1KILE 3AE2C 2FQ0A 3GG2A 2VRSA 2CQ8A 2OYIA 2GZIA 3DS3A 2JYGA 4IFMA 4BRYA 5B5EE 2WSFJ 3PRJA 5CCHD 1BDCA 2A06E 3E1IA 3L74D 2M8NA 2L5GB 1S5LX 1VPCA 3HD7B 4PV1D 1WT6A 2P1JA 3CX5E 2E75B 1FZFA 3B8EB 1NAFA 1FAVA 2PEOA 5AW7B 3VMAA 1NH4A 1SQVK 1OZHA 2PEIA 2OGUA 2MVUA 1VQ4P 1M1KQ 2QJPB 1RO0A 1U7MA 1DD3A 2LIWA 4JYBA 3U59A 1N7SC 4H0LB 1RH5B 1EZVI 1W5CE 4PWVB 4RJTA 2YO3A 1KC8Q 1KV4A 1T3JA 2WQYC 1LWUB 1L4AD 5AVWB 3JSVC 1M1JA 1NTKE 2KI7B 2EFJA 2DNWA 3V4WA 2ONTA 1X8YA 4IOIH 3OJAB 4WY4A 4Z1MH 1S72P 3CWBD 2HPCA 2N98A 3H1LJ 2YXQB 3O6QA 3AE7C 5KLIB 5HGMA 3KXDA 5APVA 2BHVA 2LL8A 2WWWA 2D2CC 1EOQA 3MUDA 2KG9A 1A8OA 4MN4C 5CMZA 3H25A 2HFED 3AE6C 3VN0A 1FBMA 1FZEA 1SFCA 3SFDC 5AW6B 4K35A 3TDKA 1JY2P 1KB9I 3NFQA 2KWLA 1L0NK 2UWJE 5GTIH 3HUSB 3H1IG 2KOGA 2PRRA 1DIPA 1SQQE 3A0HE 1JY2O 3HD7D 4XE5B 1BSHA 1VL2A 2E75D 2YKPA 2AXTH 4HKGA 1HQBA 1K8AQ 1CW5A 3PHLA 2O1JA 2V7QH 4GOEA 2L0QA 2IFNA 3EJDA 1ZRTE 3HZQA 1RNIA 1CSBA 1JY3P 4U3FG 4H0LD 4H2XC 4NEOA 1RF1B 2KNCB 1M6EX 1JM0A 2L91A 1NQ4A 1JY3O 1RY3A 4NPEA 1PP9D 3CXCO 3IR9A 4C7NB 4IFFA 3GZMA 5APQA 5AVYB 4DOJA 3VOPA 1R8EA 1SQXE 1L2PA 2VLOA 3A0BH 3WBHA 3OAKA 4PD4H 1LT9B 3M0DA 1GXHA 5KAFH 3V6IA 4U0DA 3AEEC 4OGQB 1KQGB 1GK4A 2HODA 2H89C 1DD4A 3BCCG 5L8RJ 4N6JA 2MVVA 1R5SA 4PH1A 5I4TG 3C8VA 4AQRD 5BU8B 3TYYA 2Z46A 1EXJA 1OVRA 2N5HA 2FYUK 2FFDA 2LXCB 3RK2C 1AQ5A 3AE1C 1P84I 3VYIA 3U1AA 1IFNA 2IBZD 1VQ5P 3USSA 2R5DA 3SWKA 2FQ1A 2ITAA 3MUDC 1BGYE 3KPEA 1AUMA 4L73A 3G4SP 2WTYA 1LTTC 2JGPA 3MTUE 2KOPA 3MGNA 2Y9YA 2HLOA 4DJGA 4I7ZB 4XFYA 2JDIH 4JYCA 1BSNA 3BRVB 1OX3A 1FU1A 3NTEA 1KYOE 2XU6A 4GOFA 2FVAA 2XV6A 1A02J 3WMM0 2NZ2A 1FZCC 1AVOA 2JB0A 1M8OB 2P10A 2E74C 4EOTA 1T2KC 2PAJA 3CMAP 3TGUE 4GDOA 3TF5A 1K04A 2XZRA 1NU1E 1DNYA 1Q2NA 1SQXJ 2Q5UA 2VLPA 1JNMA 1VQPP 4WBAA 1J1EC 5K5GB 5E79E 2QIWA 1EZVG 1CZQA 5EW5E 1YBKA 3G9RA 2FHSC 2HYNA 1YJWP 1SQBD 3Q5PA 5KJ7A 2ZVOB 3LW5J 1HVVA 3C1LA 2KIKA 1GL2D 2Q1KA 3BASA 1PGQA 3LMOA 1BCCJ 1JCDA 2YMKA 4D6TG 1N73C 1PV3A 5CCGD 2BEQD 1BGYJ 3RL0B 1UIIA 3H1KD 2P9XA 1EDJA 1Y8AA 1NWQA 4PD4D 5GTHH 5KLVE 1UNKA 2HG5D 2ZT9C 1VQ8P 1E79H 2WSEJ 1KILA 2EHTA 2KLVA 2Z5IA 1PPJE 3CCRP 1KB9H 2YIUC 2JU1A 3CXHE 4C46A 3CWBE 2QA4P 1QVFO 1HF9A 3L75G 2EG5A 2BQ1E 2E43A 3Q3DA 1KQSO 4IL6E 2Z45A 1ZP0C 1VDFA 4CA3A 1NHLA 5CHXA 1N8RQ 5HGNA 1SQPE 2KXPB 5AW8B 2BCCD 2W90A 1T8KA 4YTPC 3G1IA 1NU1J 2IYOA 1JCCA 3L72G 2OYHC 2JP3A 1EIAA 1SQVD 2K0YA 2LKIA 3P8CE 4DT0A 1PEOA 4HJGH 7CEIA 2W6AA 1Q81Q 5AVZB 3VMYA 1BE3G 3B5NA 1NTZE 2FXPA 2NPSC 4TT3H 2KS1A 2X2BA 2IDBA 4M3LA 4I6MC 1VF5B 2A45H 1RQUA 2A45G 3AE9C 3WU2H 1VQNP 5CBNA 3L74J 2R32A 3G3ZA 1J1DB 1TU3F 3O8ZA 2N1TB 3JCUE 2PEJA 3GMAA 3RL0D 5TISH 1GU5A 3CCEP 2RH0A 3B71A 2KYVA 1MZ9A 5AW9B 1RO2A 3U1CA 3WUTA 2GZGA 2P2UA 2OTKE 5KLVJ 3HTKA 2OYIB 1P84H 2QJYB 1FZBA 2NRGA 4BRYB 2BEZF 4RO0A 1ZN5A 1L0LK 1BDDA 3A5TA 3DTJA 4K3AA 2JEEA 1JOCA 2M8LA 1L0ND 3H1JE 3CWBJ 2LOLA 2FYNB 1NYHA 4D6TD 1YQ4C 4BPGA 1NTMK 1SQPJ 2ZYDA 3CD6P 2PENA 2O01N 3E7KA 3S4RA 3PH0A 1NOHA 2OQQA 2ZYGA 2K93A 1N7SA 1URQC 3L73G 1M1JB 2KOSA 3PJSK 3PP5A 2YXRB 1KB9D 3VP9A 1OW7A 3DS1A 4WY4B 1S9KE 1FJPA 1M57D 3RBXA 4BPHA 2HPCB 1VF5D 1EDLA 3B5IA 2KGAA 3O6QB 2QG4A 2L22A 4R4MA 2VLNA 4ZNCA 3G0VA 1DV5A 4IZ6A 3CX5I 5KAIE 1VQKP 3B5NC 1KZUB 2QM8A 2N1TD 2N9YB 2WSCJ 3V2QA 1IFPA 2R3SA 2E5YA 3GHGC 4N78D 2C9LY 2GDWA 3CLQA 2GZFA 1PZQA 1SFCB 2FYUD 2KZIA 2IZ0A 5AVTB 2N9BA 2K3RA 2GZJA 2K0DX 4WB4A 1S3JA 1VKUA 2H88C 1UIXA 4GR6A 5GTIE 3RG6C 2WMMA 3H1IE 4UB8H 2K9JA 3H1JJ 2IFMA 3R2PA 5B66H 4HKZH 2WT7A 1EXIA 1ZR2A 2AXTE 2XT1A 3K5BA 2POHA 2M3BA 2FAEA 2JAZA 1Z56A 2Y0CA 4U3FE 1PIXA 2XKMA 3L70G 2N50A 1PP9G 1J1EB 1P84D 1NTKK 2KOOA 3L36A 3CCQP 4QMAA 3S1KA 4WY4D 4YXWH 1AFOA 1PEQA 3G29A 3H47A 4H2YC 3RK3B 1D7MA 3A0BE 4UB6E 2PP6A 3NMDA 4AYCA 3GF7A 4PD4E 4OVNF 2M0BA 1AF8A 5KAFE 4F37A 2HODB 1YITP 4XA4A 2JU2A 2WPTA 1K30A 2B87A 3BCCE 1AQTA 4H13B 2IBZG 5APYA 1QL1A 3L73D 2FFDB 2KZJA 2M5AA 2E76B 1L0LG 1SFCD 4Y99C 5APTA 2PY8A 1LP1A 3V4QA 3H1HG 1GD2E 3H1IJ 1SQQK 3AE4C 3DPHA 1IFIA 1GPJA 1NTMG 4HH2A 2WSSH 1FDMA 1VQ7P 1X3OA 3D71A 4DZOA 1T2KD 3L71E 3ZDMA 2J5UA 2XNXA 2V7QJ 2W27A 1YJ9P 2L6EA 2EIAA 5DJTB 2GYKA 2PEMA 3HE5A 1KORA 1K73Q 2QVAA 4U3FJ 3V2RA 1FZCA 4U7JA 2LKMA 3WUVA 4EI2A 3QWOC 1LTBC 1ZR4A 2FXMA 2Z4EA 1GW4A 3A7OA 3I56P 1QGKB 3RK3D 1WRGA 1YQ3C 1HWTC 1RE3C 2GDXA 1SQBG 2C9NY 1EZVE 1E5WA 2JQ4A 3SWYA 4EYYQ 1JUNA 3BCCJ 1NKZB 3L70D 1Q90D 4H13D 3BRTB 3HYBA 3GW6A 5F2NA 4OWFA 2GA1A 2E76D 4PJ0H 3H1KG 3SFEC 2A06G 3U43A 3MD0A 3P05A 3E1RA 2K2QA 1N73A 2FKWB 2QSIA 3A3YB 3DS0A 2V4HA 3IFMA 1HBWA 2M3EA 2QJKC 5CCHC 2CG5B 3CL3D 1G1JA 1KILB 2PFXA 3L71J 4PV1C 5H2FH 2I1KA 1BCCE 1JEKA 3L4FA 2KODA 1J2JB 1OMIA 1ZOYC 1S1CX 1R5LA 1NTKG 3N7NA 3L75E 1E6JP 4TLFA 2BCCG 1L0LD 1SQVG 4L75A 4AUWA 2IYPA 4JPZB 2K37A 1LTJB 1L0HA 1GZLA 3H1HD 3L72E 1DH3A 1NTMD 2Y9ZA 3MP7B 3KQGA 5KKZB 3SSUA 3AEBC 2Q9IA 2MF4A 2OYHA 3B5NB 5CZDB 1BE3E 4KT0J 4MRTC 1LTAC 2KS1B 1OIPA 3FWLA 2NPSA 5KJ7D 3N4XA 1VQMP 1HGVA 3WU2E 2FADA 4U0BA 3H1LD 3EWKA 3G21A 3A0HH 1ZV8A 5AW5B 4DCKA 2B9BA 1SQQG 4D6TJ 1ZLLA 5JPAA 1JMBA 4OGQD 4R0MA 5TISE 2QRXA 4L76A 5KLVK 3B4SA 2PGDA 2B89A 4L74A 1VQLP 1W2BO 3HTKB 3M9QA 1FJKA 3L74E 1KILD 3AEGC 3HD7C 1L0NG 2MR7A 1ZMBA 3EJEA 4QKOA 1EDKA 1P84E 2ZAEB 1X79B 2E75C 4JBZA 2WPRA 1FZAA 5HVCA 2QJPC 3L75J 2A06D 1N7LA 2K9YA 5AW0B 1WMKA 3CX5D 3VMXA 1SQPK 4H0LC 2ZXEB 2WVRA 1FOSF 3F89A 3L72J 1LWUC 1IFMA 4ASWA 1SVFA 2MY5A 3GZLA 3H32A 2K88A 1NAYA 1USDA 4IPYA 4ZMDA 3CCMP 2KK7A 2W6JH 4XRQA 1N7SB 3KZIH 1NTZK 1M7LA 4GIFA 4COPA 1BE3J 1GL2A 5AVVB 2BUOA 1KFMA 1CI6A 5KLIC 1URQA 1MV8A 2LF4A 1JY2N 1NTKD 4GT1A 2QNWA 1AVYA 2KSEA 1USEA 1GK6A 1RE4C 2AFEA 1RQVA 4QNBA 1H0TA 3G26A 3W68A 4C7RA 1MZ8A 4W80A 2D2CB 1PFIA 3DS4A 1OXZA 1KN7A 3CCVP 3CI9A 1EC5A 3NTNA 1QX8A 2FYUG 2PEQA 3TNUA 1JY3N 3GHGA 2NO8A 2KGEA 3HUSC 2KUBA 1OR5A 3BATA 3VTPC 2O01H 1N2DC 5AW1B 1OFCX 2Q3EA 4UB8E 3TGUG 2K9JB 5HV8A 5APXA 2WT7B 1K05A 4CPGA 1SQQD 5B66E 2E42A 4NPFX 3D6YA 1DEBA 3OA7A 1M90Q 5BS1A 1NVOA 1RF1C 1E0HA 2SPZA 3C9IA 2WZ7A 3RG2A 4H2WC 2W83C 1ZRTD 2ZYAA 3L35A 5APWA 1PP9E 3R4YA 3S9OA 1N7SD 2AEFA 3L73J 3WUUA 1IUQA 1OWAA 1Q86Q 2G3AA 1LT9C 2KR5A 3PLNA 4KHXA 2IZ1A 4NPDA 2ZXXA 1AA0A 2JO0A 4WVZA 1IFJA 2LR2A 2L4BA 1H89A 1SQXD 2RKLA 1GL2C 2M5RA 1EQ7A 2B87B 2D2CD 3QH9A 1IFDA 3G28A 2R5BA 2LPKA 3FWNA 4COCA 1IMPA 2FVEA 3W67A 2IBZE 3CC2P 5CCGC 1LTIC 2FQ2A 1FC2C 2M5AB 2CGQA 3JC22 3II6A 3M9BA 3RK2B 2Z44A 1RF0C 4XFJA 2M8RA 1LP1B 2XNDH 4IL6H 1DX7A 3H0DA 3D6ZA 1UJZA 3TK1A 5F2OA 1YTZT 4I7ZC 1VQ9P 4H44C 2FVFA 2ROQA 1N86A 1SLQA 3I5CA 2VSQA 2O1KA 3IAOA 2K94A 2QEXP 2B88A 3HE5B 2KP8A 3Q2YA 1NTZG 1KYOD 3L70J 3PTZA 1PP9J 2XDJA 2MR8A 1FZCB 2RN0A 3Q5SA 2Q6QA 2I8DA 3GKLC 5CJ4A 5EJDA 3CC7P 2E74B 2O3JA 1KQLA 3TGUD 5KP7B 2G8YA 3AE3C 1NO4A 1JJ2O 5KP8B 3GF3A 4I1LA 2FXOA 1SQBE 2YMYA 2LIUA 5EFWB 1GDTA 4R4LA 1RE3A 3B4QA 2W8ZA 3HE4A 5AVUB 1FDIA 3M1MA 4BWNA 3LIDA 3NXSA 3RL0C 3H1KE 2KSJA 4PJ0E 1L0LJ 1SP4A 3H1JG 3RK2D 4GODA 3GLMA 1JMMA 1T6AA 1KTMA 1ZW0A 1N73B 1OW6A 1LTGC 3H1HJ 1IZNB 4I2LC 2PNGA 1NTMJ 2PEKA 3T97A 2JO1A 2KGDA 4YXDC 3FX0A 2KOQA 1U7JA 3H4EA 2WSFH 1Q82Q 2BASA 5KLVD 5CJ0A 4ZKPA 2M8PA 5CCHA 4LGDE 2ZT9B 5H2FE 1AV1A 2JR8A 2N5IA 1HTLC 1S5LH 1PPJD 2QM7A 1RHZB 3EFGA 4XFXA 3RBZA 1BAJA 2CK3H 2YIUB 2BCCE 1S4XA 3CXHD 5AVRB 1YYCA 1HH0A 2W6BA 1SQVE 3ABVC 3Q5RA 2Z5HA 2E74D 5DCKA 2AFDA 5KAIH 1AYIA 1IO4A 1SQPD 1X22A 2I1JA 3AE5C 3VRLC 1KLPA 3Q1MA 2LMLA 4DG9A 3HRNA 3CC4P 2OYHB 1L4AA 3P8CD 3G6EP 1FE6A 1AJYA 3V5BA 1SQBJ 1VF5C 2GM4A 2OARA 3M0AA 2XXMA 2JYLA 1Y47A 1GMJA 1LGHB 1NTZD 3H1LG 2MKVA 2NPSB 4LC1A 1QVGO 1JTHA 1M6NA 1J1DC 2AEJA 2DGYA 2N1TC 3TSIA 1SQXK 4WYMA 1HUCA 3GJNA 1X9VA 2AVAA 3H1KJ
chains in the Genus database with same CATH topology
3CC2P 3G1GA 1A8OA 3CCVP 4XROA 4PH0A 3LRYA 5HGLA 3G71P 1M74A 2PEJA 5JPAA 4U0EA 3CCUP 2PEQA 3P05A 3CCEP 2CWOA 1VQ5P 3CMEP 1RO2A 2P9XA 3DS2A 3Q20A 2PY8A 2Z44A 4GR2A 1AUMA 3G4SP 3CCJP 3DS0A 4M0IA 3H0DA 1VQLP 1W2BO 2PEKA 3OW2O 5F2OA 4XFZA 3DPHA 4GR6A 3RG6C 3DS3A 2JYGA 1KD1Q 1VQ8P 1VQ9P 3CCLP 1ZMBA 3H4EA 1VQ7P 3DS5A 1Q82Q 4U0AA 3DTJA 4U0FA 2M8NA 2M8PA 4XFYA 3CCRP 2M8LA 2KODA 1K8AQ 2XT1A 2L6EA 2EIAA 3NTEA 1YJ9P 2QEXP 2XV6A 2QA4P 1QVFO 2PEMA 2PEOA 4XFXA 2EG5A 5F2KA 1K73Q 1M90Q 1E6JP 1BAJA 2BQ1E 5BS1A 3CCSP 2PEIA 1KQSO 1VQ4P 1M1KQ 1RO0A 2Z45A 3HZQA 1RNIA 3CD6P 4U0CA 1N8RQ 5HGNA 2PENA 3G1IA 1M6EX 5HGOA 3CMAP 5DCKA 1EIAA 1PEOA 3CC7P 3CCQP 4IPYA 1KC8Q 3E2DA 3VRLC 3CCMP 1IUQA 4XRQA 3CXCO 1Q86Q 3CC4P 3CPWO 1Q81Q 3G6EP 2EFJA 3I56P 1YHQP 1YJNP 4COPA 3MGEA 1PEMA 2OTLP 1PEQA 3I55P 2ONTA 1YI2P 1D1DA 1VQPP 2BUOA 3DS1A 3G29A 1VQOP 1YIJP 1S72P 3H47A 1JJ2O 2JO0A 2OARA 2LF4A 1K9MQ 3WBHA 2XXMA 2JYLA 3B5IA 1VQ6P 1QRJA 1NJIQ 5BS2A 5HGMA 1YJWP 2OTJP 4U0DA 2BHVA 1A43A 3G0VA 1Q7YQ 1QVGO 1VQMP 1PEUA 1M6NA 1VQNP 1EOQA 2E1MA 1YITP 1VQKP 4U0BA 2DGYA 1K30A 4QNBA 3M1MA 3HYBA 3G21A 4WYMA 3G26A 3G28A 4PH1A 5F2NA 5I4TG 4COCA 2Z46A 3DS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 P;  3CCL P;  3CCV P;  1K9M Q;  1N8R Q;  3G71 P;  1VQ7 P;  1Q82 Q;  3CCU P;  3CMA P;  3CCE P;  1VQ6 P;  3CCR P;  1NJI Q;  1S72 P;  1VQ5 P;  3CME P;  1YJW P;  2OTJ P;  3CC7 P;  1K8A Q;  3CCQ P;  1YJ9 P;  1KC8 Q;  1Q7Y Q;  1QVG O;  3CCM P;  1VQM P;  2QEX P;  1VQN P;  1YIT P;  2QA4 P;  1VQK P;  1QVF O;  3CXC O;  1Q86 Q;  1K73 Q;  1M90 Q;  3G4S P;  3CCJ P;  3CC4 P;  3CPW O;  1Q81 Q;  3G6E P;  3I56 P;  3CCS P;  1YHQ P;  1YJN P;  1VQ8 P;  1VQL P;  1W2B O;  3OW2 O;  1KQS O;  1VQ4 P;  2OTL P;  3I55 P;  1YI2 P;  1M1K Q;  3CD6 P;  1VQP P;  1VQO P;  1YIJ P;  1JJ2 O;  1KD1 Q;  1VQ9 P; 
#chains in the Genus database with same CATH topology
 3G1G A;  4XRO A;  2IPP A;  5HGL A;  4Y28 J;  1MUU A;  1G2C A;  4JF7 A;  3CCU P;  4RES B;  3CME P;  2L9F A;  3VP8 A;  2OYI C;  2QJY C;  3AED C;  4EDF A;  5BU5 A;  1KYO I;  1ZNV A;  2MD9 A;  2DW3 A;  1QLE D;  1PGP A;  5B5E H;  2CPB A;  1L0N E;  2FYN C;  2GUS A;  2ZT9 D;  1IC2 A;  4D6T E;  3CX5 H;  3HD7 A;  1NTK J;  2A45 I;  3LIE A;  5AW3 B;  3EFF K;  2BCC J;  1BXI A;  5F2K A;  1MFT A;  2RMZ A;  3H1J D;  3CCS P;  1F80 D;  1SQV J;  2FBW C;  5GTH E;  5CBO A;  1HJB A;  1QL2 A;  4UB6 H;  1HY8 A;  1FZG A;  1Z6M A;  1M1J C;  3EQ2 A;  5HGO A;  2WPS A;  2WPQ A;  3NY7 B;  3H32 B;  3AEF C;  1LWU A;  1KB9 E;  4WY4 C;  1JB0 J;  1A02 F;  1YHQ P;  3KZI E;  3MGE A;  2OTL P;  4YPC A;  3I55 P;  1YI2 P;  2VLQ A;  1GL2 B;  1OVU A;  2R3C A;  4PXH B;  1CI6 B;  1GXG A;  1URQ B;  5KP6 B;  5TJH A;  2JJL A;  2MJZ A;  2NPS D;  1NU1 K;  2EHS A;  1QRJ A;  3EJB A;  3FXE A;  1S9K D;  1L4A C;  1A43 A;  1U57 A;  1Q7Y Q;  3H6P A;  1OW8 A;  1H0T B;  2GDY A;  1LJ2 A;  1SQQ J;  4N78 E;  1RE4 A;  2C0W A;  2H8P D;  2ZVN B;  3G71 P;  1T3U A;  2IX7 C;  1G1I A;  2JWA A;  4EIJ A;  1SFC C;  3L71 G;  2FYU E;  3TNU B;  4H44 B;  2WPV B;  4UHP B;  3GHG B;  2J58 A;  4GR2 A;  1LTS C;  1IK9 A;  2XZ1 C;  3CXH I;  2H43 A;  3OW2 O;  1L0N J;  4XFZ A;  3HUS A;  1KD1 Q;  1PGJ A;  2AEM A;  5AW2 B;  2K5X A;  4U0F A;  2C0X A;  3H1I D;  1FOS E;  3UIA A;  1QEX A;  1ZXG A;  2QE7 H;  1SS1 A;  3SWF A;  2Q3I A;  1T8Z A;  4LLH A;  4U0C A;  3P32 A;  1RF1 A;  2KNC A;  2YNY A;  3P8M C;  4U3F D;  3M91 A;  2N6Z A;  3E2D A;  5M1B A;  2CNR A;  5C39 A;  3RK3 C;  3M06 A;  1EDI A;  2Q7C A;  4C7N A;  1YJN P;  1PEM A;  1URQ D;  2AF8 A;  3VMZ A;  1D1D A;  3M0D C;  1SQX G;  3ITK A;  1H88 A;  1VQO P;  5AW4 B;  1K9M Q;  2JKV A;  2GUV A;  1Y9B A;  1LT9 A;  5DJU B;  1HJ0 A;  1LNQ A;  1NJI Q;  1GTW A;  5BS2 A;  2OTJ P;  4H13 C;  3IF4 A;  1X0T A;  1PEU A;  1IMQ A;  2E1M A;  3IN6 A;  3LW5 H;  2FFD C;  5AVQ B;  3L73 E;  2E76 C;  3L37 A;  3B5N D;  2ZJS E;  4PH0 A;  3BCC D;  1DEE G;  2FYU J;  4H44 D;  1W2E A;  1BCC G;  2XZ0 D;  4U0E A;  3V2P A;  1CEI A;  5CCG A;  1BGY G;  2LTE A;  2JBG A;  2JWD A;  2KG6 A;  4Y99 B;  4GKG A;  2O01 J;  2KB7 P;  1XTC C;  1RF0 A;  3CCL P;  3TGU J;  5APS A;  1MKM A;  2AXC A;  1LTJ A;  2WSE H;  2Y0E A;  4U0A A;  1M56 D;  1KYO H;  1IJD B;  2P58 A;  2KW2 A;  1LT1 A;  3MIW A;  1XTG B;  2ERH A;  3L71 D;  4A7P A;  3A2A A;  4ASV A;  2HR3 A;  2Y0D A;  3F5H A;  4O9B A;  3P7K A;  2IBZ I;  1FS0 E;  3CE7 A;  1ACP A;  3AEC C;  1EMV A;  3RL0 g;  1KFN A;  2YO2 A;  1NU1 G;  3RK3 E;  2KGC A;  1KMI Z;  4WWI A;  3RGU A;  2XV5 A;  1YIJ P;  1VHN A;  2YKQ A;  2R44 A;  3FXD A;  5E79 H;  5KJ7 C;  3V2N A;  4OH8 B;  3KDP B;  3L70 E;  1VQ6 P;  3MZW B;  2OYO A;  3KHU A;  4RKU J;  1GW3 A;  1OVV A;  2KOR A;  2J59 M;  4HYT B;  2FAC A;  3BVH A;  1EZV D;  3HE4 B;  1L0I A;  3L74 G;  1FR2 A;  3LRY A;  4OGQ C;  4N3Y B;  1M74 A;  2ZFC A;  3AEA C;  1YTZ I;  3DS2 A;  4IL6 X;  1NKN A;  1PGO A;  2K1A A;  3CCJ P;  4M0I A;  1KIL C;  5KLV G;  1FDO A;  1GU4 A;  1H8A A;  3T97 B;  2GZE A;  2E5T A;  2N6Y A;  2FYZ A;  3DS5 A;  1PPJ G;  2QJK B;  2CPS A;  3CXH H;  1L0L E;  2YKO A;  3CWB G;  4PV1 B;  1S5L E;  1BCC D;  5BVZ A;  2FY8 A;  3M9H A;  1NTZ J;  1LTJ C;  3H1H E;  1BGY D;  4W7Z A;  2WIT A;  3L75 D;  1NTM E;  1SQP G;  5KKZ C;  5APU A;  2P7J A;  4PD4 I;  1KQF B;  3D70 A;  3L72 D;  2KG8 A;  4W7Y A;  3CPW O;  1L4A B;  4B86 A;  1SQB K;  4JQ0 D;  4BPF A;  5AVS B;  5AVX B;  2LXB A;  1HGZ A;  3FGA D;  3AE8 C;  1BE3 D;  3H1L E;  1ZME C;  4HB1 A;  4KJM A;  1JTH B;  2K0X A;  1MFZ A;  4IFD K;  1S2E A;  2P67 A;  1JO5 A;  1NU1 D;  4BXL A;  1NGM B;  3MHV A;  1IK7 A;  2WSC H;  2N1T A;  3JCU H;  2H7H A;  1G2C B;  1PL5 A;  4ZKU A;  2CWO A;  3KYQ A;  2KLU A;  2K92 A;  3Q20 A;  5KTB A;  1KIL E;  3AE2 C;  2FQ0 A;  3GG2 A;  2VRS A;  2CQ8 A;  2OYI A;  2GZI A;  3DS3 A;  2JYG A;  4IFM A;  4BRY A;  5B5E E;  2WSF J;  3PRJ A;  5CCH D;  1BDC A;  2A06 E;  3E1I A;  3L74 D;  2M8N A;  2L5G B;  1S5L X;  1VPC A;  3HD7 B;  4PV1 D;  1WT6 A;  2P1J A;  3CX5 E;  2E75 B;  1FZF A;  3B8E B;  1NAF A;  1FAV A;  2PEO A;  5AW7 B;  3VMA A;  1NH4 A;  1SQV K;  1OZH A;  2PEI A;  2OGU A;  2MVU A;  1VQ4 P;  1M1K Q;  2QJP B;  1RO0 A;  1U7M A;  1DD3 A;  2LIW A;  4JYB A;  3U59 A;  1N7S C;  4H0L B;  1RH5 B;  1EZV I;  1W5C E;  4PWV B;  4RJT A;  2YO3 A;  1KC8 Q;  1KV4 A;  1T3J A;  2WQY C;  1LWU B;  1L4A D;  5AVW B;  3JSV C;  1M1J A;  1NTK E;  2KI7 B;  2EFJ A;  2DNW A;  3V4W A;  2ONT A;  1X8Y A;  4IOI H;  3OJA B;  4WY4 A;  4Z1M H;  1S72 P;  3CWB D;  2HPC A;  2N98 A;  3H1L J;  2YXQ B;  3O6Q A;  3AE7 C;  5KLI B;  5HGM A;  3KXD A;  5APV A;  2BHV A;  2LL8 A;  2WWW A;  2D2C C;  1EOQ A;  3MUD A;  2KG9 A;  1A8O A;  4MN4 C;  5CMZ A;  3H25 A;  2HFE D;  3AE6 C;  3VN0 A;  1FBM A;  1FZE A;  1SFC A;  3SFD C;  5AW6 B;  4K35 A;  3TDK A;  1JY2 P;  1KB9 I;  3NFQ A;  2KWL A;  1L0N K;  2UWJ E;  5GTI H;  3HUS B;  3H1I G;  2KOG A;  2PRR A;  1DIP A;  1SQQ E;  3A0H E;  1JY2 O;  3HD7 D;  4XE5 B;  1BSH A;  1VL2 A;  2E75 D;  2YKP A;  2AXT H;  4HKG A;  1HQB A;  1K8A Q;  1CW5 A;  3PHL A;  2O1J A;  2V7Q H;  4GOE A;  2L0Q A;  2IFN A;  3EJD A;  1ZRT E;  3HZQ A;  1RNI A;  1CSB A;  1JY3 P;  4U3F G;  4H0L D;  4H2X C;  4NEO A;  1RF1 B;  2KNC B;  1M6E X;  1JM0 A;  2L91 A;  1NQ4 A;  1JY3 O;  1RY3 A;  4NPE A;  1PP9 D;  3CXC O;  3IR9 A;  4C7N B;  4IFF A;  3GZM A;  5APQ A;  5AVY B;  4DOJ A;  3VOP A;  1R8E A;  1SQX E;  1L2P A;  2VLO A;  3A0B H;  3WBH A;  3OAK A;  4PD4 H;  1LT9 B;  3M0D A;  1GXH A;  5KAF H;  3V6I A;  4U0D A;  3AEE C;  4OGQ B;  1KQG B;  1GK4 A;  2HOD A;  2H89 C;  1DD4 A;  3BCC G;  5L8R J;  4N6J A;  2MVV A;  1R5S A;  4PH1 A;  5I4T G;  3C8V A;  4AQR D;  5BU8 B;  3TYY A;  2Z46 A;  1EXJ A;  1OVR A;  2N5H A;  2FYU K;  2FFD A;  2LXC B;  3RK2 C;  1AQ5 A;  3AE1 C;  1P84 I;  3VYI A;  3U1A A;  1IFN A;  2IBZ D;  1VQ5 P;  3USS A;  2R5D A;  3SWK A;  2FQ1 A;  2ITA A;  3MUD C;  1BGY E;  3KPE A;  1AUM A;  4L73 A;  3G4S P;  2WTY A;  1LTT C;  2JGP A;  3MTU E;  2KOP A;  3MGN A;  2Y9Y A;  2HLO A;  4DJG A;  4I7Z B;  4XFY A;  2JDI H;  4JYC A;  1BSN A;  3BRV B;  1OX3 A;  1FU1 A;  3NTE A;  1KYO E;  2XU6 A;  4GOF A;  2FVA A;  2XV6 A;  1A02 J;  3WMM 0;  2NZ2 A;  1FZC C;  1AVO A;  2JB0 A;  1M8O B;  2P10 A;  2E74 C;  4EOT A;  1T2K C;  2PAJ A;  3CMA P;  3TGU E;  4GDO A;  3TF5 A;  1K04 A;  2XZR A;  1NU1 E;  1DNY A;  1Q2N A;  1SQX J;  2Q5U A;  2VLP A;  1JNM A;  1VQP P;  4WBA A;  1J1E C;  5K5G B;  5E79 E;  2QIW A;  1EZV G;  1CZQ A;  5EW5 E;  1YBK A;  3G9R A;  2FHS C;  2HYN A;  1YJW P;  1SQB D;  3Q5P A;  5KJ7 A;  2ZVO B;  3LW5 J;  1HVV A;  3C1L A;  2KIK A;  1GL2 D;  2Q1K A;  3BAS A;  1PGQ A;  3LMO A;  1BCC J;  1JCD A;  2YMK A;  4D6T G;  1N73 C;  1PV3 A;  5CCG D;  2BEQ D;  1BGY J;  3RL0 B;  1UII A;  3H1K D;  2P9X A;  1EDJ A;  1Y8A A;  1NWQ A;  4PD4 D;  5GTH H;  5KLV E;  1UNK A;  2HG5 D;  2ZT9 C;  1VQ8 P;  1E79 H;  2WSE J;  1KIL A;  2EHT A;  2KLV A;  2Z5I A;  1PPJ E;  3CCR P;  1KB9 H;  2YIU C;  2JU1 A;  3CXH E;  4C46 A;  3CWB E;  2QA4 P;  1QVF O;  1HF9 A;  3L75 G;  2EG5 A;  2BQ1 E;  2E43 A;  3Q3D A;  1KQS O;  4IL6 E;  2Z45 A;  1ZP0 C;  1VDF A;  4CA3 A;  1NHL A;  5CHX A;  1N8R Q;  5HGN A;  1SQP E;  2KXP B;  5AW8 B;  2BCC D;  2W90 A;  1T8K A;  4YTP C;  3G1I A;  1NU1 J;  2IYO A;  1JCC A;  3L72 G;  2OYH C;  2JP3 A;  1EIA A;  1SQV D;  2K0Y A;  2LKI A;  3P8C E;  4DT0 A;  1PEO A;  4HJG H;  7CEI A;  2W6A A;  1Q81 Q;  5AVZ B;  3VMY A;  1BE3 G;  3B5N A;  1NTZ E;  2FXP A;  2NPS C;  4TT3 H;  2KS1 A;  2X2B A;  2IDB A;  4M3L A;  4I6M C;  1VF5 B;  2A45 H;  1RQU A;  2A45 G;  3AE9 C;  3WU2 H;  1VQN P;  5CBN A;  3L74 J;  2R32 A;  3G3Z A;  1J1D B;  1TU3 F;  3O8Z A;  2N1T B;  3JCU E;  2PEJ A;  3GMA A;  3RL0 D;  5TIS H;  1GU5 A;  3CCE P;  2RH0 A;  3B71 A;  2KYV A;  1MZ9 A;  5AW9 B;  1RO2 A;  3U1C A;  3WUT A;  2GZG A;  2P2U A;  2OTK E;  5KLV J;  3HTK A;  2OYI B;  1P84 H;  2QJY B;  1FZB A;  2NRG A;  4BRY B;  2BEZ F;  4RO0 A;  1ZN5 A;  1L0L K;  1BDD A;  3A5T A;  3DTJ A;  4K3A A;  2JEE A;  1JOC A;  2M8L A;  1L0N D;  3H1J E;  3CWB J;  2LOL A;  2FYN B;  1NYH A;  4D6T D;  1YQ4 C;  4BPG A;  1NTM K;  1SQP J;  2ZYD A;  3CD6 P;  2PEN A;  2O01 N;  3E7K A;  3S4R A;  3PH0 A;  1NOH A;  2OQQ A;  2ZYG A;  2K93 A;  1N7S A;  1URQ C;  3L73 G;  1M1J B;  2KOS A;  3PJS K;  3PP5 A;  2YXR B;  1KB9 D;  3VP9 A;  1OW7 A;  3DS1 A;  4WY4 B;  1S9K E;  1FJP A;  1M57 D;  3RBX A;  4BPH A;  2HPC B;  1VF5 D;  1EDL A;  3B5I A;  2KGA A;  3O6Q B;  2QG4 A;  2L22 A;  4R4M A;  2VLN A;  4ZNC A;  3G0V A;  1DV5 A;  4IZ6 A;  3CX5 I;  5KAI E;  1VQK P;  3B5N C;  1KZU B;  2QM8 A;  2N1T D;  2N9Y B;  2WSC J;  3V2Q A;  1IFP A;  2R3S A;  2E5Y A;  3GHG C;  4N78 D;  2C9L Y;  2GDW A;  3CLQ A;  2GZF A;  1PZQ A;  1SFC B;  2FYU D;  2KZI A;  2IZ0 A;  5AVT B;  2N9B A;  2K3R A;  2GZJ A;  2K0D X;  4WB4 A;  1S3J A;  1VKU A;  2H88 C;  1UIX A;  4GR6 A;  5GTI E;  3RG6 C;  2WMM A;  3H1I E;  4UB8 H;  2K9J A;  3H1J J;  2IFM A;  3R2P A;  5B66 H;  4HKZ H;  2WT7 A;  1EXI A;  1ZR2 A;  2AXT E;  2XT1 A;  3K5B A;  2POH A;  2M3B A;  2FAE A;  2JAZ A;  1Z56 A;  2Y0C A;  4U3F E;  1PIX A;  2XKM A;  3L70 G;  2N50 A;  1PP9 G;  1J1E B;  1P84 D;  1NTK K;  2KOO A;  3L36 A;  3CCQ P;  4QMA A;  3S1K A;  4WY4 D;  4YXW H;  1AFO A;  1PEQ A;  3G29 A;  3H47 A;  4H2Y C;  3RK3 B;  1D7M A;  3A0B E;  4UB6 E;  2PP6 A;  3NMD A;  4AYC A;  3GF7 A;  4PD4 E;  4OVN F;  2M0B A;  1AF8 A;  5KAF E;  4F37 A;  2HOD B;  1YIT P;  4XA4 A;  2JU2 A;  2WPT A;  1K30 A;  2B87 A;  3BCC E;  1AQT A;  4H13 B;  2IBZ G;  5APY A;  1QL1 A;  3L73 D;  2FFD B;  2KZJ A;  2M5A A;  2E76 B;  1L0L G;  1SFC D;  4Y99 C;  5APT A;  2PY8 A;  1LP1 A;  3V4Q A;  3H1H G;  1GD2 E;  3H1I J;  1SQQ K;  3AE4 C;  3DPH A;  1IFI A;  1GPJ A;  1NTM G;  4HH2 A;  2WSS H;  1FDM A;  1VQ7 P;  1X3O A;  3D71 A;  4DZO A;  1T2K D;  3L71 E;  3ZDM A;  2J5U A;  2XNX A;  2V7Q J;  2W27 A;  1YJ9 P;  2L6E A;  2EIA A;  5DJT B;  2GYK A;  2PEM A;  3HE5 A;  1KOR A;  1K73 Q;  2QVA A;  4U3F J;  3V2R A;  1FZC A;  4U7J A;  2LKM A;  3WUV A;  4EI2 A;  3QWO C;  1LTB C;  1ZR4 A;  2FXM A;  2Z4E A;  1GW4 A;  3A7O A;  3I56 P;  1QGK B;  3RK3 D;  1WRG A;  1YQ3 C;  1HWT C;  1RE3 C;  2GDX A;  1SQB G;  2C9N Y;  1EZV E;  1E5W A;  2JQ4 A;  3SWY A;  4EYY Q;  1JUN A;  3BCC J;  1NKZ B;  3L70 D;  1Q90 D;  4H13 D;  3BRT B;  3HYB A;  3GW6 A;  5F2N A;  4OWF A;  2GA1 A;  2E76 D;  4PJ0 H;  3H1K G;  3SFE C;  2A06 G;  3U43 A;  3MD0 A;  3P05 A;  3E1R A;  2K2Q A;  1N73 A;  2FKW B;  2QSI A;  3A3Y B;  3DS0 A;  2V4H A;  3IFM A;  1HBW A;  2M3E A;  2QJK C;  5CCH C;  2CG5 B;  3CL3 D;  1G1J A;  1KIL B;  2PFX A;  3L71 J;  4PV1 C;  5H2F H;  2I1K A;  1BCC E;  1JEK A;  3L4F A;  2KOD A;  1J2J B;  1OMI A;  1ZOY C;  1S1C X;  1R5L A;  1NTK G;  3N7N A;  3L75 E;  1E6J P;  4TLF A;  2BCC G;  1L0L D;  1SQV G;  4L75 A;  4AUW A;  2IYP A;  4JPZ B;  2K37 A;  1LTJ B;  1L0H A;  1GZL A;  3H1H D;  3L72 E;  1DH3 A;  1NTM D;  2Y9Z A;  3MP7 B;  3KQG A;  5KKZ B;  3SSU A;  3AEB C;  2Q9I A;  2MF4 A;  2OYH A;  3B5N B;  5CZD B;  1BE3 E;  4KT0 J;  4MRT C;  1LTA C;  2KS1 B;  1OIP A;  3FWL A;  2NPS A;  5KJ7 D;  3N4X A;  1VQM P;  1HGV A;  3WU2 E;  2FAD A;  4U0B A;  3H1L D;  3EWK A;  3G21 A;  3A0H H;  1ZV8 A;  5AW5 B;  4DCK A;  2B9B A;  1SQQ G;  4D6T J;  1ZLL A;  5JPA A;  1JMB A;  4OGQ D;  4R0M A;  5TIS E;  2QRX A;  4L76 A;  5KLV K;  3B4S A;  2PGD A;  2B89 A;  4L74 A;  1VQL P;  1W2B O;  3HTK B;  3M9Q A;  1FJK A;  3L74 E;  1KIL D;  3AEG C;  3HD7 C;  1L0N G;  2MR7 A;  1ZMB A;  3EJE A;  4QKO A;  1EDK A;  1P84 E;  2ZAE B;  1X79 B;  2E75 C;  4JBZ A;  2WPR A;  1FZA A;  5HVC A;  2QJP C;  3L75 J;  2A06 D;  1N7L A;  2K9Y A;  5AW0 B;  1WMK A;  3CX5 D;  3VMX A;  1SQP K;  4H0L C;  2ZXE B;  2WVR A;  1FOS F;  3F89 A;  3L72 J;  1LWU C;  1IFM A;  4ASW A;  1SVF A;  2MY5 A;  3GZL A;  3H32 A;  2K88 A;  1NAY A;  1USD A;  4IPY A;  4ZMD A;  3CCM P;  2KK7 A;  2W6J H;  4XRQ A;  1N7S B;  3KZI H;  1NTZ K;  1M7L A;  4GIF A;  4COP A;  1BE3 J;  1GL2 A;  5AVV B;  2BUO A;  1KFM A;  1CI6 A;  5KLI C;  1URQ A;  1MV8 A;  2LF4 A;  1JY2 N;  1NTK D;  4GT1 A;  2QNW A;  1AVY A;  2KSE A;  1USE A;  1GK6 A;  1RE4 C;  2AFE A;  1RQV A;  4QNB A;  1H0T A;  3G26 A;  3W68 A;  4C7R A;  1MZ8 A;  4W80 A;  2D2C B;  1PFI A;  3DS4 A;  1OXZ A;  1KN7 A;  3CCV P;  3CI9 A;  1EC5 A;  3NTN A;  1QX8 A;  2FYU G;  2PEQ A;  3TNU A;  1JY3 N;  3GHG A;  2NO8 A;  2KGE A;  3HUS C;  2KUB A;  1OR5 A;  3BAT A;  3VTP C;  2O01 H;  1N2D C;  5AW1 B;  1OFC X;  2Q3E A;  4UB8 E;  3TGU G;  2K9J B;  5HV8 A;  5APX A;  2WT7 B;  1K05 A;  4CPG A;  1SQQ D;  5B66 E;  2E42 A;  4NPF X;  3D6Y A;  1DEB A;  3OA7 A;  1M90 Q;  5BS1 A;  1NVO A;  1RF1 C;  1E0H A;  2SPZ A;  3C9I A;  2WZ7 A;  3RG2 A;  4H2W C;  2W83 C;  1ZRT D;  2ZYA A;  3L35 A;  5APW A;  1PP9 E;  3R4Y A;  3S9O A;  1N7S D;  2AEF A;  3L73 J;  3WUU A;  1IUQ A;  1OWA A;  1Q86 Q;  2G3A A;  1LT9 C;  2KR5 A;  3PLN A;  4KHX A;  2IZ1 A;  4NPD A;  2ZXX A;  1AA0 A;  2JO0 A;  4WVZ A;  1IFJ A;  2LR2 A;  2L4B A;  1H89 A;  1SQX D;  2RKL A;  1GL2 C;  2M5R A;  1EQ7 A;  2B87 B;  2D2C D;  3QH9 A;  1IFD A;  3G28 A;  2R5B A;  2LPK A;  3FWN A;  4COC A;  1IMP A;  2FVE A;  3W67 A;  2IBZ E;  3CC2 P;  5CCG C;  1LTI C;  2FQ2 A;  1FC2 C;  2M5A B;  2CGQ A;  3JC2 2;  3II6 A;  3M9B A;  3RK2 B;  2Z44 A;  1RF0 C;  4XFJ A;  2M8R A;  1LP1 B;  2XND H;  4IL6 H;  1DX7 A;  3H0D A;  3D6Z A;  1UJZ A;  3TK1 A;  5F2O A;  1YTZ T;  4I7Z C;  1VQ9 P;  4H44 C;  2FVF A;  2ROQ A;  1N86 A;  1SLQ A;  3I5C A;  2VSQ A;  2O1K A;  3IAO A;  2K94 A;  2QEX P;  2B88 A;  3HE5 B;  2KP8 A;  3Q2Y A;  1NTZ G;  1KYO D;  3L70 J;  3PTZ A;  1PP9 J;  2XDJ A;  2MR8 A;  1FZC B;  2RN0 A;  3Q5S A;  2Q6Q A;  2I8D A;  3GKL C;  5CJ4 A;  5EJD A;  3CC7 P;  2E74 B;  2O3J A;  1KQL A;  3TGU D;  5KP7 B;  2G8Y A;  3AE3 C;  1NO4 A;  1JJ2 O;  5KP8 B;  3GF3 A;  4I1L A;  2FXO A;  1SQB E;  2YMY A;  2LIU A;  5EFW B;  1GDT A;  4R4L A;  1RE3 A;  3B4Q A;  2W8Z A;  3HE4 A;  5AVU B;  1FDI A;  3M1M A;  4BWN A;  3LID A;  3NXS A;  3RL0 C;  3H1K E;  2KSJ A;  4PJ0 E;  1L0L J;  1SP4 A;  3H1J G;  3RK2 D;  4GOD A;  3GLM A;  1JMM A;  1T6A A;  1KTM A;  1ZW0 A;  1N73 B;  1OW6 A;  1LTG C;  3H1H J;  1IZN B;  4I2L C;  2PNG A;  1NTM J;  2PEK A;  3T97 A;  2JO1 A;  2KGD A;  4YXD C;  3FX0 A;  2KOQ A;  1U7J A;  3H4E A;  2WSF H;  1Q82 Q;  2BAS A;  5KLV D;  5CJ0 A;  4ZKP A;  2M8P A;  5CCH A;  4LGD E;  2ZT9 B;  5H2F E;  1AV1 A;  2JR8 A;  2N5I A;  1HTL C;  1S5L H;  1PPJ D;  2QM7 A;  1RHZ B;  3EFG A;  4XFX A;  3RBZ A;  1BAJ A;  2CK3 H;  2YIU B;  2BCC E;  1S4X A;  3CXH D;  5AVR B;  1YYC A;  1HH0 A;  2W6B A;  1SQV E;  3ABV C;  3Q5R A;  2Z5H A;  2E74 D;  5DCK A;  2AFD A;  5KAI H;  1AYI A;  1IO4 A;  1SQP D;  1X22 A;  2I1J A;  3AE5 C;  3VRL C;  1KLP A;  3Q1M A;  2LML A;  4DG9 A;  3HRN A;  3CC4 P;  2OYH B;  1L4A A;  3P8C D;  3G6E P;  1FE6 A;  1AJY A;  3V5B A;  1SQB J;  1VF5 C;  2GM4 A;  2OAR A;  3M0A A;  2XXM A;  2JYL A;  1Y47 A;  1GMJ A;  1LGH B;  1NTZ D;  3H1L G;  2MKV A;  2NPS B;  4LC1 A;  1QVG O;  1JTH A;  1M6N A;  1J1D C;  2AEJ A;  2DGY A;  2N1T C;  3TSI A;  1SQX K;  4WYM A;  1HUC A;  3GJN A;  1X9V A;  2AVA A;  3H1K J; 
#chains in the Genus database with same CATH homology
 3CC2 P;  3G1G A;  1A8O A;  3CCV P;  4XRO A;  4PH0 A;  3LRY A;  5HGL A;  3G71 P;  1M74 A;  2PEJ A;  5JPA A;  4U0E A;  3CCU P;  2PEQ A;  3P05 A;  3CCE P;  2CWO A;  1VQ5 P;  3CME P;  1RO2 A;  2P9X A;  3DS2 A;  3Q20 A;  2PY8 A;  2Z44 A;  4GR2 A;  1AUM A;  3G4S P;  3CCJ P;  3DS0 A;  4M0I A;  3H0D A;  1VQL P;  1W2B O;  2PEK A;  3OW2 O;  5F2O A;  4XFZ A;  3DPH A;  4GR6 A;  3RG6 C;  3DS3 A;  2JYG A;  1KD1 Q;  1VQ8 P;  1VQ9 P;  3CCL P;  1ZMB A;  3H4E A;  1VQ7 P;  3DS5 A;  1Q82 Q;  4U0A A;  3DTJ A;  4U0F A;  2M8N A;  2M8P A;  4XFY A;  3CCR P;  2M8L A;  2KOD A;  1K8A Q;  2XT1 A;  2L6E A;  2EIA A;  3NTE A;  1YJ9 P;  2QEX P;  2XV6 A;  2QA4 P;  1QVF O;  2PEM A;  2PEO A;  4XFX A;  2EG5 A;  5F2K A;  1K73 Q;  1M90 Q;  1E6J P;  1BAJ A;  2BQ1 E;  5BS1 A;  3CCS P;  2PEI A;  1KQS O;  1VQ4 P;  1M1K Q;  1RO0 A;  2Z45 A;  3HZQ A;  1RNI A;  3CD6 P;  4U0C A;  1N8R Q;  5HGN A;  2PEN A;  3G1I A;  1M6E X;  5HGO A;  3CMA P;  5DCK A;  1EIA A;  1PEO A;  3CC7 P;  3CCQ P;  4IPY A;  1KC8 Q;  3E2D A;  3VRL C;  3CCM P;  1IUQ A;  4XRQ A;  3CXC O;  1Q86 Q;  3CC4 P;  3CPW O;  1Q81 Q;  3G6E P;  2EFJ A;  3I56 P;  1YHQ P;  1YJN P;  4COP A;  3MGE A;  1PEM A;  2OTL P;  1PEQ A;  3I55 P;  2ONT A;  1YI2 P;  1D1D A;  1VQP P;  2BUO A;  3DS1 A;  3G29 A;  1VQO P;  1YIJ P;  1S72 P;  3H47 A;  1JJ2 O;  2JO0 A;  2OAR A;  2LF4 A;  1K9M Q;  3WBH A;  2XXM A;  2JYL A;  3B5I A;  1VQ6 P;  1QRJ A;  1NJI Q;  5BS2 A;  5HGM A;  1YJW P;  2OTJ P;  4U0D A;  2BHV A;  1A43 A;  3G0V A;  1Q7Y Q;  1QVG O;  1VQM P;  1PEU A;  1M6N A;  1VQN P;  1EOQ A;  2E1M A;  1YIT P;  1VQK P;  4U0B A;  2DGY A;  1K30 A;  4QNB A;  3M1M A;  3HYB A;  3G21 A;  4WYM A;  3G26 A;  3G28 A;  4PH1 A;  5F2N A;  5I4T G;  4COC A;  2Z46 A;  3DS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...