1QVFO

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qvfO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1qvfO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1qvfO03
3CC2P 1VQNP 3G6EP 1VQMP 3CC4P 3CCLP 3CCSP 1VQ5P 3CCUP 2OTLP 3CCVP 1VQPP 1YJWP 1Q81Q 3CCEP 3I55P 3CCRP 1VQ6P 1KC8Q 1YJNP 1S72P 1Q7YQ 1YHQP 1VQ4P 3CD6P 3CCJP 1VQOP 1VQ8P 1Q82Q 3CMEP 3CPWO 1QVFO 1N8RQ 3CCMP 3I56P 1QVGO 1K8AQ 1W2BO 2OTJP 1KD1Q 1YIJP 1VQ7P 3CMAP 1YI2P 3CXCO 1Q86Q 1M1KQ 1VQ9P 3CC7P 2QA4P 1K73Q 1K9MQ 1JJ2O 1VQLP 1YITP 3CCQP 3OW2O 2QEXP 1YJ9P 1NJIQ 1M90Q 1VQKP 1KQSO 3G4SP 3G71P
chains in the Genus database with same CATH superfamily
1LT9A 2WQYC 1N7SA 2FADA 3U43A 1RO2A 5KLVG 3AE7C 3CWBE 3WMM0 2R44A 1KFMA 1YQ4C 2IBZG 3AE2C 1PGQA 3NMDA 1OR5A 2KG9A 2M8PA 3DS1A 1QRJA 1GL2D 3E1RA 1DNYA 3B4QA 5APQA 1SQXE 2BCCE 5AVZB 5H2FH 3CCUP 1FJKA 2WPSA 3BRTB 3CXHD 3CWBJ 3L74G 4U0DA 2Z4EA 5E79H 2NPSB 3SFDC 3V4QA 1USEA 1NKZB 1EOQA 5BS2A 2QSIA 3CXCO 1L0NE 2K92A 4COCA 1SQXJ 2BCCJ 1Z6MA 1QGKB 4PXHB 3BCCD 1FOSE 2M5AB 2FACA 2KP8A 4H44C 1JCCA 1L4AD 1OW6A 1IO4A 1FDIA 1S1CX 1L0NJ 4U7JA 2D2CD 1BSHA 1NH4A 1HGZA 2LMLA 2K0DX 3LIDA 4N78D 1GD2E 1SQQJ 1FZCB 1HWTC 1LWUA 2ZXEB 2E75C 3H1LD 3Q2YA 3GW6A 2AEMA 1EIAA 4PWVB 2K9YA 2QNWA 2PGDA 1K30A 1USDA 1SVFA 1PPJE 2O1KA 2EIAA 1HVVA 3K5BA 3CMAP 2M8NA 3CC7P 2E42A 3CE7A 4PD4E 3Q3DA 3TNUB 2L91A 5KAIH 3GMAA 4HYTB 5HGOA 1SQPE 2OYOA 4PV1D 2FXOA 2O01N 2OYHB 3A7OA 5GTHE 1N2DC 3EFFK 2XZ0D 4JYBA 2E74C 1L0LE 1NTME 1SQPJ 2CPBA 1OVRA 2KWLA 1SFCA 2QJPC 4H13D 2KGEA 3O6QB 1N7SD 1BCCD 4KT0J 3CD6P 1L0LJ 4U0AA 3IAOA 1NTMJ 3I56P 3AE3C 4ASVA 4PD4H 3L73E 3AEDC 2RN0A 1CSBA 2JR8A 4H2XC 1LJ2A 1S4XA 2L22A 2Y0DA 3L71D 5AVWB 3HD7A 3PH0A 1OZHA 1KB9D 3M0DC 2M5RA 3L73J 2C9LY 3G0VA 1NAFA 3HUSB 5F2KA 1Q86Q 4UB8H 1T2KC 3KZIE 3PTZA 2PENA 1S3JA 4Y99B 2MY5A 1GXGA 2FYUE 1OVVA 1FZCA 1RE4A 2POHA 2HLOA 3D70A 5M1BA 2AFEA 1PPJG 3BRVB 1JTHB 1BCCE 1R8EA 1NYHA 1Q2NA 2FYUJ 2FBWC 2WT7A 4NPEA 1NU1K 3RK3D 1ZMBA 1HTLC 1SQPG 1NU1E 4LGDE 2QG4A 1S2EA 1FOSF 1VQ6P 1BCCJ 3V2NA 3QH9A 4U3FG 1RH5B 2SPZA 2LIWA 1FDOA 2WSFJ 1HGVA 1KB9E 1RO0A 4PH0A 1NTMG 3KZIH 4XFJA 1AVOA 3EJEA 1HBWA 1RNIA 2ZT9C 3R2PA 1JY2N 2M0BA 2KSJA 1NOHA 2JYGA 1KZUB 1WT6A 2GDYA 1R5SA 4EYYQ 5KJ7A 3O6QA 2GZJA 3EJDA 3U1AA 1VHNA 3A5TA 2WSFH 2KNCA 2JU2A 2MJZA 1SFCD 5CHXA 1JY2O 5KTBA 3L75G 1A02J 4AUWA 2IYPA 2KUBA 1AYIA 1M1JC 1KB9H 1M1KQ 4R4MA 2LF4A 2XV5A 2OYIB 2YNYA 3L35A 3TK1A 3L72D 1BXIA 4YXWH 1NKNA 5KLIB 3HD7D 2XU6A 2WVRA 1Y47A 1RE3C 2P2UA 2YKQA 1G1IA 3L37A 3NXSA 3B8EB 2MKVA 5APYA 1JMBA 1CI6B 3VMXA 2AVAA 1NU1G 5AW7B 2HPCA 3PRJA 4I7ZB 2LXBA 4DZOA 4OH8B 2PAJA 1RF1C 1YBKA 1EDKA 3B5NC 4O9BA 4PD4I 3JC22 2CWOA 1S9KE 4XRQA 2QE7H 4XA4A 1T8ZA 1GL2B 1MFZA 2L6EA 2N1TC 2NZ2A 5HGNA 4R0MA 2IZ0A 4D6TD 3RL0g 2KZJA 4ZKUA 3V6IA 1LT1A 4BXLA 4XE5B 2KLVA 1R5LA 3M91A 5AW1B 2AXTE 2E74D 3TGUE 1NTZK 4BPGA 2FAEA 3P8MC 1DEBA 1K73Q 2Q1KA 3G26A 2G3AA 1SQBD 5GTIE 1E0HA 1L4AB 1X3OA 1VQ5P 1G1JA 4OWFA 3CCEP 2D2CB 3G1GA 2A45G 5APUA 3TGUJ 2IX7C 1PP9E 1KILC 2VLQA 2R5BA 5DCKA 1D7MA 3GHGA 2Q5UA 1LP1A 4L73A 2N98A 1W5CE 2FYNB 2LKIA 3KPEA 4PJ0E 3I55P 3I5CA 1PP9J 5KLVD 2Z46A 4D6TE 3DTJA 3SWKA 2WWWA 3H1HG 1T2KD 4PV1B 3QWOC 2VLNA 1CZQA 3AE9C 3LW5J 1YJ9P 5GTIH 1LGHB 1A02F 3VYIA 3GZMA 3L74D 4D6TJ 1BE3G 3AEAC 3NY7B 2KODA 2UWJE 3KDPB 1MV8A 1SQVE 2KR5A 2KGCA 2L4BA 3MIWA 2KGDA 2B87A 4L74A 2XNXA 3EFGA 3Q20A 3H1JG 1LT9B 2FVEA 2RKLA 4H13B 2OARA 1T3UA 1N7SB 5EFWB 2CQ8A 2PEKA 2ZYGA 4PJ0H 3R4YA 1SQVJ 5AW9B 4NPDA 1T6AA 1KB9I 1VQ4P 3TGUG 1IMQA 2IBZE 4H2YC 4GR6A 1NTZG 4EIJA 2I1JA 1MUUA 2FVAA 2KG6A 3P7KA 4W7YA 2GA1A 3GG2A 1NQ4A 1Q7YQ 4COPA 5CCGA 2G8YA 1H0TA 3V4WA 3S4RA 3A0HH 2K88A 1NJIQ 5AW2B 2AXCA 3HE4A 1MKMA 3L74J 4RJTA 2XZ1C 2KOQA 3CWBD 3AECC 1GU5A 3HTKA 1LWUB 3RK3B 3USSA 1YI2P 2CG5B 1SQXD 2QM7A 1FS0E 2P67A 2W6AA 2MD9A 2IFMA 3A3YB 4XFXA 3GF7A 2MVUA 3H1IG 5KAFH 1VQ7P 5AW0B 2C0XA 3AEFC 1ZP0C 2DGYA 1PGJA 1M6EX 1VL2A 2JP3A 1IZNB 1JMMA 3B5ND 3ITKA 3N4XA 3G28A 1ZN5A 5APTA 1OW7A 4ASWA 2H43A 1SFCB 1KQLA 1U7JA 1KTMA 2YIUB 2ZYDA 1LTJA 3G6EP 2BEZF 2WZ7A 1PPJD 4B86A 4KJMA 3V2RA 4QNBA 5AVUB 2K5XA 2PRRA 4PD4D 1K8AQ 4H0LB 3C1LA 2O01J 2Y0CA 4I1LA 2Z45A 1SQPD 3HD7B 2N6YA 1IFIA 3VMZA 1AJYA 3HE5A 3KYQA 5CCGD 3VN0A 1T3JA 1PGPA 2K93A 1L0LD 1NTMD 2OGUA 3RK2D 1VQ9P 2LL8A 2NPSC 2O01H 2W6BA 1AA0A 2ROQA 3H0DA 2FY8A 1JY2P 3B4SA 2WT7B 1EXIA 1N8RQ 4ZMDA 3L73D 2KORA 1EZVE 2LIUA 3DS3A 4U0FA 4WY4C 3D6YA 2YXQB 2E5YA 1VQNP 1OIPA 2R5DA 2W6JH 3CCVP 2W27A 1OFCX 3GF3A 1Y9BA 3MD0A 1FZGA 1G2CA 4U3FE 2HFED 3CCMP 3G21A 1QEXA 1KILE 5KP7B 2QA4P 2FYUD 2QJPB 3KHUA 5AVYB 5AW5B 1FJPA 2P7JA 3V5BA 3N7NA 1M56D 3TDKA 2WPRA 2N5IA 3LRYA 4U3FJ 2K1AA 2WSCJ 3WUVA 2JGPA 4OGQB 2QJKC 4I6MC 2IBZI 2BASA 1LTTC 4DT0A 1JCDA 2KNCB 1KQGB 1ZLLA 1YIJP 2OYHC 2LKMA 2ZVOB 5KP8B 5JPAA 1NU1D 2FQ1A 1GMJA 1OXZA 1VQMP 4U0BA 3AEEC 5B66E 1M8OB 1BGYG 1S72P 2FKWB 4WBAA 4UB6E 4AQRD 3F89A 1OMIA 4ZNCA 3L4FA 5GTHH 3L75E 3MP7B 1YTZT 2BEQD 5TJHA 3SWYA 2KXPB 2E76C 2EHSA 4TLFA 1NWQA 4F37A 2CPSA 2FQ0A 1VF5D 2RH0A 4MN4C 4N3YB 1DD3A 2Y9YA 2KIKA 4BRYA 5EW5E 3L75J 2AFDA 1BDCA 1U7MA 2HODA 4C7RA 1SP4A 3H1KE 1N73C 2I1KA 1EZVG 3FXEA 1N7LA 2HPCB 2VRSA 1JB0J 2Z44A 3M9QA 3HUSC 3WU2E 4I2LC 3E1IA 4Y99C 5B66H 2IZ1A 2XZRA 1X79B 2LTEA 1CEIA 1FC2C 2N50A 3G1IA 1KFNA 4DG9A 2PEJA 2JDIH 1NU1J 3H32B 3BCCG 2KB7P 2OTKE 1RQVA 1FZBA 3RG2A 1URQC 1DH3A 5B5EE 3OJAB 4C7NA 2HYNA 3H1HD 2QIWA 2Y9ZA 2ZFCA 1JY3N 2QEXP 1AV1A 3RBZA 5BVZA 3AE4C 2RMZA 1BE3D 5AVSB 3CC4P 2ONTA 2K94A 3G3ZA 3H1LG 3RBXA 5AVRB 1YJWP 2VLOA 3MZWB 1S9KD 1ACPA 3A2AA 3M0DA 3GHGB 1LP1B 3AEBC 2LXCB 4HKGA 2P9XA 3H4EA 1LTIC 3TF5A 4JQ0D 2GUSA 2KS1A 2YO3A 3E7KA 4H44D 1FDMA 4JBZA 2QVAA 1H88A 2E43A 3TGUD 3H1KG 5TISE 2JO0A 3H1HE 2PP6A 2JWDA 3SWFA 2KOSA 2GZFA 1EDLA 2E75D 2WSEJ 3GJNA 1RF0C 1U57A 5HVCA 2HG5D 2P1JA 2OYIC 1BE3E 2B87B 1PP9D 1EZVI 1GZLA 2A45H 3H1HJ 1OW8A 3PLNA 5KLIC 1GK6A 1CW5A 3NTEA 3P32A 2I8DA 3MUDC 4M3LA 4WY4D 1BDDA 3CCQP 4IZ6A 1D1DA 3H1JE 1FE6A 4BPHA 2GZGA 1BE3J 5AW3B 4GR2A 3C9IA 2KOPA 2EG5A 1VQPP 3H32A 4WVZA 1LTSC 2XV6A 4L76A 4EOTA 1S5LE 2JBGA 4I7ZC 2W8ZA 4DCKA 5TISH 3H1JJ 1HUCA 3FX0A 2E5TA 2H89C 1ZR2A 1BSNA 2MR7A 3LMOA 2Z5IA 2KG8A 1GW3A 2L5GB 1GL2C 5BS1A 2KI7B 1NTZE 1MZ9A 1VDFA 1J1EC 3HZQA 1H0TB 2XXMA 1WRGA 1SQVD 1ZXGA 3W67A 2FFDC 1L0IA 1GK4A 3G29A 3RK2B 1IUQA 2M8RA 1EXJA 2H88C 5AVXB 2OTJP 1M1JA 1NTZJ 3HE4B 2FYZA 3JCUE 3VTPC 4IFFA 3RL0C 1UIIA 3IFMA 2ZYAA 1L4AC 3HTKB 1XTCC 1RE3A 1X8YA 4IOIH 1NTKK 4HB1A 1Q90D 2IBZD 2E76D 1OWAA 2AXTH 2D2CC 4JF7A 1NGMB 1KYOE 1XTGB 1DV5A 3G71P 3CCLP 4PH1A 4XROA 1RF1A 2A06E 3B5NA 1PEUA 4IL6E 1J1DB 2C0WA 3Q5RA 3VRLC 1X9VA 3H47A 3H1IE 2Q7CA 2N1TA 1SQBK 2R3CA 4TT3H 3NFQA 3TYYA 2M8LA 2WPQA 2PEQA 1NHLA 3CC2P 4GOEA 3H6PA 5CBOA 3LW5H 4PV1C 2K9JA 2EHTA 5CBNA 3F5HA 1VPCA 3VMAA 3BATA 3H1IJ 5CCHC 3AE1C 5K5GB 2XNDH 4CA3A 1LTJB 4GOFA 5AW4B 2WSSH 2ZT9D 1LT9C 1URQD 2FFDA 2IDBA 5KLVK 2DW3A 3L72G 3H25A 1ZW0A 4H13C 1N7SC 1GW4A 1QL2A 3D71A 2O1JA 5HGLA 1KILA 1P84E 2DNWA 2MR8A 3DS0A 1VF5B 1NVOA 3SSUA 3M9HA 3HE5B 3B71A 1H89A 3S1KA 2JJLA 2A45I 1OX3A 1L2PA 2QJYB 1IJDB 3PP5A 2FQ2A 2KZIA 1QVFO 3RG6C 1RY3A 1NTKG 3O8ZA 2YKOA 1MFTA 3CX5E 1K9MQ 1AFOA 4GODA 1KQSO 4A7PA 5KKZB 3GLMA 2R3SA 2A06G 3EQ2A 1UNKA 3PJSK 2GM4A 3ABVC 2GZEA 1N86A 3AE5C 1EDIA 1FBMA 4GT1A 3DPHA 2J58A 5CZDB 1SQBG 2XT1A 1K05A 1LWUC 2YMYA 2IFNA 2N9BA 5H2FE 3T97A 3A0BE 4KHXA 5APSA 2JAZA 1G2CB 4CPGA 3OAKA 1LNQA 1FU1A 2KOGA 4W7ZA 4ZKPA 2N1TD 3CX5H 2JYLA 3AE6C 4DJGA 2GDXA 1F80D 2JKVA 1SS1A 4DOJA 1TU3F 2ZXXA 1KLPA 2L0QA 1EMVA 5AVQB 2FXMA 1VQ8P 1EZVD 3CMEP 5AVVB 4QMAA 2KW2A 1QVGO 2N6ZA 4EI2A 1SQXK 2KGAA 4L75A 4H44B 1IFPA 3M0AA 1SFCC 2Q3EA 3A0BH 1HJBA 2CGQA 1PV3A 2YIUC 1BGYE 4U3FD 2KYVA 3VP9A 1YHQP 1L0NK 2YXRB 1KILD 2Z5HA 2ZAEB 1UJZA 2E75B 3FGAD 2K0XA 1HQBA 2E1MA 1SQQK 3AEGC 1GU4A 2WPVB 4BRYB 4IFDK 5KAIE 3RL0D 2B89A 4H0LC 1SQQE 3L70G 2KOOA 2HODB 3DS5A 1BGYJ 3HD7C 4Z1MH 1YQ3C 1FR2A 1JOCA 1KYOI 1A43A 1S5LX 4WY4B 2LR2A 3HRNA 2YKPA 2YO2A 1JY3P 1GXHA 2ERHA 1YJNP 2Q6QA 1KORA 3IR9A 1AQ5A 3CL3D 1FZCC 1RE4C 1AVYA 4U0EA 3L75D 1JUNA 1PEOA 2E74B 3CXHE 1JNMA 4HKZH 1WMKA 1L0HA 1SQPK 2MVVA 3M9BA 2QJKB 2JB0A 4M0IA 2Q3IA 3BCCE 4C7NB 1IC2A 3P05A 2V7QJ 1K04A 5CCHD 1JM0A 2X2BA 3CWBG 3H1KD 1VQOP 1L0LK 1LTAC 1NTMK 3MGNA 3TSIA 4UB8E 2J59M 1KV4A 1M90Q 3BCCJ 4N78E 2L9FA 4OVNF 1SQXG 2BCCG 3JSVC 3DS4A 1W2EA 3MHVA 3H1LE 1P84I 1X0TA 1YYCA 2E76B 3CXHH 4LC1A 2V7QH 3D6ZA 1M74A 2KSEA 5AW8B 4IL6X 1ZOYC 3CPWO 3GKLC 5KJ7C 2H8PD 2WSCH 2K0YA 1L0NG 4OGQC 2NO8A 4WB4A 2NPSA 3EWKA 2KS1B 1SQQG 3H1LJ 2AEFA 3FWLA 2XKMA 3WUUA 1EC5A 3PHLA 1MZ8A 4HJGH 1KMIZ 1N73B 3V2PA 1EQ7A 2M5AA 3CX5I 1IFMA 1Z56A 2FYUK 4WWIA 4QKOA 3Q5SA 4WY4A 1BAJA 2WTYA 3CCSP 2WITA 3LIEA 1DIPA 3H1KJ 4UB6H 4YPCA 3V2QA 2PFXA 1QX8A 4YTPC 2ZT9B 1NO4A 1URQB 3TNUA 2BHVA 2B9BA 2QM8A 2NRGA 4JYCA 3L71E 3WUTA 1DEEG 1PZQA 1HY8A 3KXDA 3HYBA 5BU5A 2PEOA 2K2QA 1OVUA 1L0LG 2OYHA 3IN6A 2W90A 2ZVNB 3M06A 5CMZA 3Q1MA 1IK9A 1PL5A 5KP6B 3L71J 3WU2H 3FXDA 1ZV8A 3WBHA 5HV8A 1E6JP 1M1JB 2FXPA 4GDOA 1GDTA 2GUVA 5CJ0A 1EDJA 1JO5A 3L73G 3H1JD 1JY3O 3OA7A 5HGMA 2AEJA 1QLED 5EJDA 3RK3E 2OTLP 3BASA 2VLPA 5B5EH 4IPYA 5F2OA 1FZEA 2KLUA 5C39A 2P58A 3FWNA 1KN7A 1N73A 1ZRTD 5APWA 4NPFX 2NPSD 3GHGC 1NTZD 2FYUG 4H0LD 1FZFA 4H2WC 1RF1B 3HUSA 1AUMA 3B5NB 2KK7A 4AYCA 4NEOA 4RKUJ 4W80A 3VMYA 1HH0A 1X22A 4RO0A 3U59A 1HJ0A 3C8VA 3CCJP 2N1TB 1BCCG 5CJ4A 3UIAA 1KQFB 2K37A 1JTHA 1JJ2O 4K35A 2K9JB 5APXA 3CXHI 3GZLA 2JQ4A 1IFDA 2P10A 2WSEH 1URQA 1PEMA 2BUOA 3L71G 2M3EA 2EFJA 1NTKD 3E2DA 3EJBA 3ZDMA 1KYOD 1DD4A 1QL1A 2R32A 1J1EB 4EDFA 2O3JA 3OW2O 1ZRTE 2FFDB 3II6A 3NTNA 1AQTA 1PIXA 4HH2A 2VSQA 2WPTA 2A06D 2Y0EA 2K3RA 1KILB 2YMKA 3L72E 2BQ1E 4RESB 5BU8B 3H1ID 4MRTC 2CK3H 4BPFA 3RL0B 1LTBC 2PNGA 3U1CA 1J2JB 3BVHA 3L72J 2J5UA 1T8KA 1IMPA 4U0CA 2FHSC 5CCGC 5KJ7D 1S5LH 5DJTB 5L8RJ 4OGQD 1W2BO 2M3BA 4IFMA 5I4TG 4BWNA 1NTKE 1PFIA 3RK2C 1VQLP 3Q5PA 1NAYA 3MGEA 4YXDC 1RF0A 5AVTB 2V4HA 4Y28J 2OYIA 2GYKA 1E5WA 1P84D 4C46A 1M57D 2FYNC 1Q82Q 1NTKJ 3B5IA 3G9RA 3MUDA 1FAVA 2JU1A 3T97B 3MTUE 3JCUH 5F2NA 1SQBE 1HF9A 5DJUB 3CI9A 1SQVK 1CI6A 2AF8A 1LTGC 2LOLA 1ZMEC 3A0HE 1RHZB 3L36A 3CX5D 1A8OA 3S9OA 1J1DC 1SQBJ 1GTWA 1KYOH 2Q9IA 3L70D 2IYOA 1GL2A 1ZR4A 3G4SP 1M6NA 4N6JA 1H8AA 2PEIA 1E79H 2GZIA 1PEQA 2N9YB 5AW6B 3VOPA 4IL6H 5KLVE 4GIFA 3W68A 2C9NY 1KD1Q 3CLQA 3VP8A 2N5HA 2JWAA 4XFZA 1JEKA 1YITP 1AF8A 1GPJA 1VQKP 3P8CD 2PEMA 1FZAA 1LTJC 2JEEA 5KLVJ 3L74E 3CCRP 1L4AA 3M1MA 2IPPA 4K3AA 1RQUA 1PP9G 1M7LA 2ZJSE 5KAFE 2ITAA 1UIXA 1IFJA 1VF5C 2PY8A 2FVFA 1VKUA 3L70E 1IK7A 2JO1A 4R4LA 1Q81Q 7CEIA 4D6TG 1KC8Q 2B88A 1DX7A 2LPKA 1SLQA 4UHPB 1P84H 4XFYA 2QJYC 2H7HA 2MF4A 4WYMA 2CNRA 2XDJA 2BCCD 2GDWA 3L70J 4JPZB 1YTZI 3IF4A 2W83C 3RK3C 4LLHA 2QRXA 1IFNA 2WMMA 3SFEC 1BGYD 3P8CE 3AE8C 3RGUA 1SQVG 5CCHA 2OQQA 5E79E 5KKZC 1ZNVA 1L0ND 1Y8AA 4GKGA 1SQQD 3DS2A 3KQGA 1PGOA 5APVA 2HR3A
chains in the Genus database with same CATH topology
1M6NA 5HGOA 3DS4A 2PEIA 3H0DA 3WBHA 2KODA 1VQ6P 2BQ1E 1PEQA 1E6JP 4XFXA 1YHQP 1RO2A 1M74A 2CWOA 4XRQA 3CPWO 1QVFO 1N8RQ 3RG6C 2JO0A 1KD1Q 1VQ7P 1RO0A 2L6EA 4PH0A 2M8PA 2E1MA 1K9MQ 5HGNA 3DS1A 4XFZA 3Q20A 1YITP 2DGYA 5HGMA 3DS3A 4U0FA 1QRJA 1M6EX 1RNIA 2Z44A 1KQSO 1VQKP 2OARA 2PEMA 3G71P 1VQNP 3CCLP 3DS5A 2PEKA 4PH1A 3CCUP 2OTLP 4XROA 3CCVP 3CCRP 2JYGA 4U0CA 4U0DA 3M1MA 4IPYA 5F2OA 1PEUA 3G28A 1VQ4P 3CD6P 1A43A 4U0AA 3VRLC 3H47A 3CCMP 3G21A 3I56P 3G1IA 1W2BO 3NTEA 5I4TG 1EOQA 5BS2A 2PEJA 3CXCO 2QA4P 1K73Q 4COCA 1VQLP 3G26A 3CCQP 3MGEA 4GR6A 3DPHA 1D1DA 2M8LA 2XT1A 2PEQA 1BAJA 2PY8A 1YJNP 3CC2P 3G6EP 1AUMA 4GR2A 3CCSP 1VQ5P 2EG5A 1VQPP 1Q81Q 3CCEP 4U0EA 3LRYA 1KC8Q 2XV6A 1PEOA 3G1GA 1Q7YQ 4COPA 4QNBA 3CCJP 1Q82Q 3B5IA 3G0VA 1K8AQ 4XFYA 1YIJP 1M1KQ 5DCKA 4WYMA 5F2KA 1Q86Q 2JYLA 1JJ2O 5JPAA 2LF4A 2PENA 2Z45A 2QEXP 1NJIQ 5BS1A 5F2NA 3CC4P 1VQMP 2ONTA 4M0IA 2BHVA 1EIAA 3HZQA 2XXMA 4U0BA 3P05A 1YJWP 1PEMA 2BUOA 3I55P 1K30A 2Z46A 1S72P 3HYBA 3DTJA 3G29A 2EFJA 1VQOP 5HGLA 1IUQA 1VQ8P 2EIAA 3CMEP 3E2DA 2PEOA 1QVGO 3DS0A 2OTJP 1A8OA 3CMAP 2M8NA 1YI2P 1VQ9P 3CC7P 3DS2A 3OW2O 2P9XA 1YJ9P 1M90Q 1ZMBA 3H4EA 3G4SP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 P;  1VQN P;  3G6E P;  1VQM P;  3CC4 P;  3CCL P;  3CCS P;  1VQ5 P;  3CCU P;  2OTL P;  3CCV P;  1VQP P;  1YJW P;  1Q81 Q;  3CCE P;  3I55 P;  3CCR P;  1VQ6 P;  1KC8 Q;  1YJN P;  1S72 P;  1Q7Y Q;  1YHQ P;  1VQ4 P;  3CD6 P;  3CCJ P;  1VQO P;  1VQ8 P;  1Q82 Q;  3CME P;  3CPW O;  1QVF O;  1N8R Q;  3CCM P;  3I56 P;  1QVG O;  1K8A Q;  1W2B O;  2OTJ P;  1KD1 Q;  1YIJ P;  1VQ7 P;  3CMA P;  1YI2 P;  3CXC O;  1Q86 Q;  1M1K Q;  1VQ9 P;  3CC7 P;  2QA4 P;  1K73 Q;  1K9M Q;  1JJ2 O;  1VQL P;  1YIT P;  3CCQ P;  3OW2 O;  2QEX P;  1YJ9 P;  1NJI Q;  1M90 Q;  1VQK P;  1KQS O;  3G4S P;  3G71 P; 
#chains in the Genus database with same CATH topology
 1LT9 A;  2WQY C;  1N7S A;  2FAD A;  3U43 A;  1RO2 A;  5KLV G;  3AE7 C;  3CWB E;  3WMM 0;  2R44 A;  1KFM A;  1YQ4 C;  2IBZ G;  3AE2 C;  1PGQ A;  3NMD A;  1OR5 A;  2KG9 A;  2M8P A;  3DS1 A;  1QRJ A;  1GL2 D;  3E1R A;  1DNY A;  3B4Q A;  5APQ A;  1SQX E;  2BCC E;  5AVZ B;  5H2F H;  3CCU P;  1FJK A;  2WPS A;  3BRT B;  3CXH D;  3CWB J;  3L74 G;  4U0D A;  2Z4E A;  5E79 H;  2NPS B;  3SFD C;  3V4Q A;  1USE A;  1NKZ B;  1EOQ A;  5BS2 A;  2QSI A;  3CXC O;  1L0N E;  2K92 A;  4COC A;  1SQX J;  2BCC J;  1Z6M A;  1QGK B;  4PXH B;  3BCC D;  1FOS E;  2M5A B;  2FAC A;  2KP8 A;  4H44 C;  1JCC A;  1L4A D;  1OW6 A;  1IO4 A;  1FDI A;  1S1C X;  1L0N J;  4U7J A;  2D2C D;  1BSH A;  1NH4 A;  1HGZ A;  2LML A;  2K0D X;  3LID A;  4N78 D;  1GD2 E;  1SQQ J;  1FZC B;  1HWT C;  1LWU A;  2ZXE B;  2E75 C;  3H1L D;  3Q2Y A;  3GW6 A;  2AEM A;  1EIA A;  4PWV B;  2K9Y A;  2QNW A;  2PGD A;  1K30 A;  1USD A;  1SVF A;  1PPJ E;  2O1K A;  2EIA A;  1HVV A;  3K5B A;  3CMA P;  2M8N A;  3CC7 P;  2E42 A;  3CE7 A;  4PD4 E;  3Q3D A;  3TNU B;  2L91 A;  5KAI H;  3GMA A;  4HYT B;  5HGO A;  1SQP E;  2OYO A;  4PV1 D;  2FXO A;  2O01 N;  2OYH B;  3A7O A;  5GTH E;  1N2D C;  3EFF K;  2XZ0 D;  4JYB A;  2E74 C;  1L0L E;  1NTM E;  1SQP J;  2CPB A;  1OVR A;  2KWL A;  1SFC A;  2QJP C;  4H13 D;  2KGE A;  3O6Q B;  1N7S D;  1BCC D;  4KT0 J;  3CD6 P;  1L0L J;  4U0A A;  3IAO A;  1NTM J;  3I56 P;  3AE3 C;  4ASV A;  4PD4 H;  3L73 E;  3AED C;  2RN0 A;  1CSB A;  2JR8 A;  4H2X C;  1LJ2 A;  1S4X A;  2L22 A;  2Y0D A;  3L71 D;  5AVW B;  3HD7 A;  3PH0 A;  1OZH A;  1KB9 D;  3M0D C;  2M5R A;  3L73 J;  2C9L Y;  3G0V A;  1NAF A;  3HUS B;  5F2K A;  1Q86 Q;  4UB8 H;  1T2K C;  3KZI E;  3PTZ A;  2PEN A;  1S3J A;  4Y99 B;  2MY5 A;  1GXG A;  2FYU E;  1OVV A;  1FZC A;  1RE4 A;  2POH A;  2HLO A;  3D70 A;  5M1B A;  2AFE A;  1PPJ G;  3BRV B;  1JTH B;  1BCC E;  1R8E A;  1NYH A;  1Q2N A;  2FYU J;  2FBW C;  2WT7 A;  4NPE A;  1NU1 K;  3RK3 D;  1ZMB A;  1HTL C;  1SQP G;  1NU1 E;  4LGD E;  2QG4 A;  1S2E A;  1FOS F;  1VQ6 P;  1BCC J;  3V2N A;  3QH9 A;  4U3F G;  1RH5 B;  2SPZ A;  2LIW A;  1FDO A;  2WSF J;  1HGV A;  1KB9 E;  1RO0 A;  4PH0 A;  1NTM G;  3KZI H;  4XFJ A;  1AVO A;  3EJE A;  1HBW A;  1RNI A;  2ZT9 C;  3R2P A;  1JY2 N;  2M0B A;  2KSJ A;  1NOH A;  2JYG A;  1KZU B;  1WT6 A;  2GDY A;  1R5S A;  4EYY Q;  5KJ7 A;  3O6Q A;  2GZJ A;  3EJD A;  3U1A A;  1VHN A;  3A5T A;  2WSF H;  2KNC A;  2JU2 A;  2MJZ A;  1SFC D;  5CHX A;  1JY2 O;  5KTB A;  3L75 G;  1A02 J;  4AUW A;  2IYP A;  2KUB A;  1AYI A;  1M1J C;  1KB9 H;  1M1K Q;  4R4M A;  2LF4 A;  2XV5 A;  2OYI B;  2YNY A;  3L35 A;  3TK1 A;  3L72 D;  1BXI A;  4YXW H;  1NKN A;  5KLI B;  3HD7 D;  2XU6 A;  2WVR A;  1Y47 A;  1RE3 C;  2P2U A;  2YKQ A;  1G1I A;  3L37 A;  3NXS A;  3B8E B;  2MKV A;  5APY A;  1JMB A;  1CI6 B;  3VMX A;  2AVA A;  1NU1 G;  5AW7 B;  2HPC A;  3PRJ A;  4I7Z B;  2LXB A;  4DZO A;  4OH8 B;  2PAJ A;  1RF1 C;  1YBK A;  1EDK A;  3B5N C;  4O9B A;  4PD4 I;  3JC2 2;  2CWO A;  1S9K E;  4XRQ A;  2QE7 H;  4XA4 A;  1T8Z A;  1GL2 B;  1MFZ A;  2L6E A;  2N1T C;  2NZ2 A;  5HGN A;  4R0M A;  2IZ0 A;  4D6T D;  3RL0 g;  2KZJ A;  4ZKU A;  3V6I A;  1LT1 A;  4BXL A;  4XE5 B;  2KLV A;  1R5L A;  3M91 A;  5AW1 B;  2AXT E;  2E74 D;  3TGU E;  1NTZ K;  4BPG A;  2FAE A;  3P8M C;  1DEB A;  1K73 Q;  2Q1K A;  3G26 A;  2G3A A;  1SQB D;  5GTI E;  1E0H A;  1L4A B;  1X3O A;  1VQ5 P;  1G1J A;  4OWF A;  3CCE P;  2D2C B;  3G1G A;  2A45 G;  5APU A;  3TGU J;  2IX7 C;  1PP9 E;  1KIL C;  2VLQ A;  2R5B A;  5DCK A;  1D7M A;  3GHG A;  2Q5U A;  1LP1 A;  4L73 A;  2N98 A;  1W5C E;  2FYN B;  2LKI A;  3KPE A;  4PJ0 E;  3I55 P;  3I5C A;  1PP9 J;  5KLV D;  2Z46 A;  4D6T E;  3DTJ A;  3SWK A;  2WWW A;  3H1H G;  1T2K D;  4PV1 B;  3QWO C;  2VLN A;  1CZQ A;  3AE9 C;  3LW5 J;  1YJ9 P;  5GTI H;  1LGH B;  1A02 F;  3VYI A;  3GZM A;  3L74 D;  4D6T J;  1BE3 G;  3AEA C;  3NY7 B;  2KOD A;  2UWJ E;  3KDP B;  1MV8 A;  1SQV E;  2KR5 A;  2KGC A;  2L4B A;  3MIW A;  2KGD A;  2B87 A;  4L74 A;  2XNX A;  3EFG A;  3Q20 A;  3H1J G;  1LT9 B;  2FVE A;  2RKL A;  4H13 B;  2OAR A;  1T3U A;  1N7S B;  5EFW B;  2CQ8 A;  2PEK A;  2ZYG A;  4PJ0 H;  3R4Y A;  1SQV J;  5AW9 B;  4NPD A;  1T6A A;  1KB9 I;  1VQ4 P;  3TGU G;  1IMQ A;  2IBZ E;  4H2Y C;  4GR6 A;  1NTZ G;  4EIJ A;  2I1J A;  1MUU A;  2FVA A;  2KG6 A;  3P7K A;  4W7Y A;  2GA1 A;  3GG2 A;  1NQ4 A;  1Q7Y Q;  4COP A;  5CCG A;  2G8Y A;  1H0T A;  3V4W A;  3S4R A;  3A0H H;  2K88 A;  1NJI Q;  5AW2 B;  2AXC A;  3HE4 A;  1MKM A;  3L74 J;  4RJT A;  2XZ1 C;  2KOQ A;  3CWB D;  3AEC C;  1GU5 A;  3HTK A;  1LWU B;  3RK3 B;  3USS A;  1YI2 P;  2CG5 B;  1SQX D;  2QM7 A;  1FS0 E;  2P67 A;  2W6A A;  2MD9 A;  2IFM A;  3A3Y B;  4XFX A;  3GF7 A;  2MVU A;  3H1I G;  5KAF H;  1VQ7 P;  5AW0 B;  2C0X A;  3AEF C;  1ZP0 C;  2DGY A;  1PGJ A;  1M6E X;  1VL2 A;  2JP3 A;  1IZN B;  1JMM A;  3B5N D;  3ITK A;  3N4X A;  3G28 A;  1ZN5 A;  5APT A;  1OW7 A;  4ASW A;  2H43 A;  1SFC B;  1KQL A;  1U7J A;  1KTM A;  2YIU B;  2ZYD A;  1LTJ A;  3G6E P;  2BEZ F;  2WZ7 A;  1PPJ D;  4B86 A;  4KJM A;  3V2R A;  4QNB A;  5AVU B;  2K5X A;  2PRR A;  4PD4 D;  1K8A Q;  4H0L B;  3C1L A;  2O01 J;  2Y0C A;  4I1L A;  2Z45 A;  1SQP D;  3HD7 B;  2N6Y A;  1IFI A;  3VMZ A;  1AJY A;  3HE5 A;  3KYQ A;  5CCG D;  3VN0 A;  1T3J A;  1PGP A;  2K93 A;  1L0L D;  1NTM D;  2OGU A;  3RK2 D;  1VQ9 P;  2LL8 A;  2NPS C;  2O01 H;  2W6B A;  1AA0 A;  2ROQ A;  3H0D A;  2FY8 A;  1JY2 P;  3B4S A;  2WT7 B;  1EXI A;  1N8R Q;  4ZMD A;  3L73 D;  2KOR A;  1EZV E;  2LIU A;  3DS3 A;  4U0F A;  4WY4 C;  3D6Y A;  2YXQ B;  2E5Y A;  1VQN P;  1OIP A;  2R5D A;  2W6J H;  3CCV P;  2W27 A;  1OFC X;  3GF3 A;  1Y9B A;  3MD0 A;  1FZG A;  1G2C A;  4U3F E;  2HFE D;  3CCM P;  3G21 A;  1QEX A;  1KIL E;  5KP7 B;  2QA4 P;  2FYU D;  2QJP B;  3KHU A;  5AVY B;  5AW5 B;  1FJP A;  2P7J A;  3V5B A;  3N7N A;  1M56 D;  3TDK A;  2WPR A;  2N5I A;  3LRY A;  4U3F J;  2K1A A;  2WSC J;  3WUV A;  2JGP A;  4OGQ B;  2QJK C;  4I6M C;  2IBZ I;  2BAS A;  1LTT C;  4DT0 A;  1JCD A;  2KNC B;  1KQG B;  1ZLL A;  1YIJ P;  2OYH C;  2LKM A;  2ZVO B;  5KP8 B;  5JPA A;  1NU1 D;  2FQ1 A;  1GMJ A;  1OXZ A;  1VQM P;  4U0B A;  3AEE C;  5B66 E;  1M8O B;  1BGY G;  1S72 P;  2FKW B;  4WBA A;  4UB6 E;  4AQR D;  3F89 A;  1OMI A;  4ZNC A;  3L4F A;  5GTH H;  3L75 E;  3MP7 B;  1YTZ T;  2BEQ D;  5TJH A;  3SWY A;  2KXP B;  2E76 C;  2EHS A;  4TLF A;  1NWQ A;  4F37 A;  2CPS A;  2FQ0 A;  1VF5 D;  2RH0 A;  4MN4 C;  4N3Y B;  1DD3 A;  2Y9Y A;  2KIK A;  4BRY A;  5EW5 E;  3L75 J;  2AFD A;  1BDC A;  1U7M A;  2HOD A;  4C7R A;  1SP4 A;  3H1K E;  1N73 C;  2I1K A;  1EZV G;  3FXE A;  1N7L A;  2HPC B;  2VRS A;  1JB0 J;  2Z44 A;  3M9Q A;  3HUS C;  3WU2 E;  4I2L C;  3E1I A;  4Y99 C;  5B66 H;  2IZ1 A;  2XZR A;  1X79 B;  2LTE A;  1CEI A;  1FC2 C;  2N50 A;  3G1I A;  1KFN A;  4DG9 A;  2PEJ A;  2JDI H;  1NU1 J;  3H32 B;  3BCC G;  2KB7 P;  2OTK E;  1RQV A;  1FZB A;  3RG2 A;  1URQ C;  1DH3 A;  5B5E E;  3OJA B;  4C7N A;  2HYN A;  3H1H D;  2QIW A;  2Y9Z A;  2ZFC A;  1JY3 N;  2QEX P;  1AV1 A;  3RBZ A;  5BVZ A;  3AE4 C;  2RMZ A;  1BE3 D;  5AVS B;  3CC4 P;  2ONT A;  2K94 A;  3G3Z A;  3H1L G;  3RBX A;  5AVR B;  1YJW P;  2VLO A;  3MZW B;  1S9K D;  1ACP A;  3A2A A;  3M0D A;  3GHG B;  1LP1 B;  3AEB C;  2LXC B;  4HKG A;  2P9X A;  3H4E A;  1LTI C;  3TF5 A;  4JQ0 D;  2GUS A;  2KS1 A;  2YO3 A;  3E7K A;  4H44 D;  1FDM A;  4JBZ A;  2QVA A;  1H88 A;  2E43 A;  3TGU D;  3H1K G;  5TIS E;  2JO0 A;  3H1H E;  2PP6 A;  2JWD A;  3SWF A;  2KOS A;  2GZF A;  1EDL A;  2E75 D;  2WSE J;  3GJN A;  1RF0 C;  1U57 A;  5HVC A;  2HG5 D;  2P1J A;  2OYI C;  1BE3 E;  2B87 B;  1PP9 D;  1EZV I;  1GZL A;  2A45 H;  3H1H J;  1OW8 A;  3PLN A;  5KLI C;  1GK6 A;  1CW5 A;  3NTE A;  3P32 A;  2I8D A;  3MUD C;  4M3L A;  4WY4 D;  1BDD A;  3CCQ P;  4IZ6 A;  1D1D A;  3H1J E;  1FE6 A;  4BPH A;  2GZG A;  1BE3 J;  5AW3 B;  4GR2 A;  3C9I A;  2KOP A;  2EG5 A;  1VQP P;  3H32 A;  4WVZ A;  1LTS C;  2XV6 A;  4L76 A;  4EOT A;  1S5L E;  2JBG A;  4I7Z C;  2W8Z A;  4DCK A;  5TIS H;  3H1J J;  1HUC A;  3FX0 A;  2E5T A;  2H89 C;  1ZR2 A;  1BSN A;  2MR7 A;  3LMO A;  2Z5I A;  2KG8 A;  1GW3 A;  2L5G B;  1GL2 C;  5BS1 A;  2KI7 B;  1NTZ E;  1MZ9 A;  1VDF A;  1J1E C;  3HZQ A;  1H0T B;  2XXM A;  1WRG A;  1SQV D;  1ZXG A;  3W67 A;  2FFD C;  1L0I A;  1GK4 A;  3G29 A;  3RK2 B;  1IUQ A;  2M8R A;  1EXJ A;  2H88 C;  5AVX B;  2OTJ P;  1M1J A;  1NTZ J;  3HE4 B;  2FYZ A;  3JCU E;  3VTP C;  4IFF A;  3RL0 C;  1UII A;  3IFM A;  2ZYA A;  1L4A C;  3HTK B;  1XTC C;  1RE3 A;  1X8Y A;  4IOI H;  1NTK K;  4HB1 A;  1Q90 D;  2IBZ D;  2E76 D;  1OWA A;  2AXT H;  2D2C C;  4JF7 A;  1NGM B;  1KYO E;  1XTG B;  1DV5 A;  3G71 P;  3CCL P;  4PH1 A;  4XRO A;  1RF1 A;  2A06 E;  3B5N A;  1PEU A;  4IL6 E;  1J1D B;  2C0W A;  3Q5R A;  3VRL C;  1X9V A;  3H47 A;  3H1I E;  2Q7C A;  2N1T A;  1SQB K;  2R3C A;  4TT3 H;  3NFQ A;  3TYY A;  2M8L A;  2WPQ A;  2PEQ A;  1NHL A;  3CC2 P;  4GOE A;  3H6P A;  5CBO A;  3LW5 H;  4PV1 C;  2K9J A;  2EHT A;  5CBN A;  3F5H A;  1VPC A;  3VMA A;  3BAT A;  3H1I J;  5CCH C;  3AE1 C;  5K5G B;  2XND H;  4CA3 A;  1LTJ B;  4GOF A;  5AW4 B;  2WSS H;  2ZT9 D;  1LT9 C;  1URQ D;  2FFD A;  2IDB A;  5KLV K;  2DW3 A;  3L72 G;  3H25 A;  1ZW0 A;  4H13 C;  1N7S C;  1GW4 A;  1QL2 A;  3D71 A;  2O1J A;  5HGL A;  1KIL A;  1P84 E;  2DNW A;  2MR8 A;  3DS0 A;  1VF5 B;  1NVO A;  3SSU A;  3M9H A;  3HE5 B;  3B71 A;  1H89 A;  3S1K A;  2JJL A;  2A45 I;  1OX3 A;  1L2P A;  2QJY B;  1IJD B;  3PP5 A;  2FQ2 A;  2KZI A;  1QVF O;  3RG6 C;  1RY3 A;  1NTK G;  3O8Z A;  2YKO A;  1MFT A;  3CX5 E;  1K9M Q;  1AFO A;  4GOD A;  1KQS O;  4A7P A;  5KKZ B;  3GLM A;  2R3S A;  2A06 G;  3EQ2 A;  1UNK A;  3PJS K;  2GM4 A;  3ABV C;  2GZE A;  1N86 A;  3AE5 C;  1EDI A;  1FBM A;  4GT1 A;  3DPH A;  2J58 A;  5CZD B;  1SQB G;  2XT1 A;  1K05 A;  1LWU C;  2YMY A;  2IFN A;  2N9B A;  5H2F E;  3T97 A;  3A0B E;  4KHX A;  5APS A;  2JAZ A;  1G2C B;  4CPG A;  3OAK A;  1LNQ A;  1FU1 A;  2KOG A;  4W7Z A;  4ZKP A;  2N1T D;  3CX5 H;  2JYL A;  3AE6 C;  4DJG A;  2GDX A;  1F80 D;  2JKV A;  1SS1 A;  4DOJ A;  1TU3 F;  2ZXX A;  1KLP A;  2L0Q A;  1EMV A;  5AVQ B;  2FXM A;  1VQ8 P;  1EZV D;  3CME P;  5AVV B;  4QMA A;  2KW2 A;  1QVG O;  2N6Z A;  4EI2 A;  1SQX K;  2KGA A;  4L75 A;  4H44 B;  1IFP A;  3M0A A;  1SFC C;  2Q3E A;  3A0B H;  1HJB A;  2CGQ A;  1PV3 A;  2YIU C;  1BGY E;  4U3F D;  2KYV A;  3VP9 A;  1YHQ P;  1L0N K;  2YXR B;  1KIL D;  2Z5H A;  2ZAE B;  1UJZ A;  2E75 B;  3FGA D;  2K0X A;  1HQB A;  2E1M A;  1SQQ K;  3AEG C;  1GU4 A;  2WPV B;  4BRY B;  4IFD K;  5KAI E;  3RL0 D;  2B89 A;  4H0L C;  1SQQ E;  3L70 G;  2KOO A;  2HOD B;  3DS5 A;  1BGY J;  3HD7 C;  4Z1M H;  1YQ3 C;  1FR2 A;  1JOC A;  1KYO I;  1A43 A;  1S5L X;  4WY4 B;  2LR2 A;  3HRN A;  2YKP A;  2YO2 A;  1JY3 P;  1GXH A;  2ERH A;  1YJN P;  2Q6Q A;  1KOR A;  3IR9 A;  1AQ5 A;  3CL3 D;  1FZC C;  1RE4 C;  1AVY A;  4U0E A;  3L75 D;  1JUN A;  1PEO A;  2E74 B;  3CXH E;  1JNM A;  4HKZ H;  1WMK A;  1L0H A;  1SQP K;  2MVV A;  3M9B A;  2QJK B;  2JB0 A;  4M0I A;  2Q3I A;  3BCC E;  4C7N B;  1IC2 A;  3P05 A;  2V7Q J;  1K04 A;  5CCH D;  1JM0 A;  2X2B A;  3CWB G;  3H1K D;  1VQO P;  1L0L K;  1LTA C;  1NTM K;  3MGN A;  3TSI A;  4UB8 E;  2J59 M;  1KV4 A;  1M90 Q;  3BCC J;  4N78 E;  2L9F A;  4OVN F;  1SQX G;  2BCC G;  3JSV C;  3DS4 A;  1W2E A;  3MHV A;  3H1L E;  1P84 I;  1X0T A;  1YYC A;  2E76 B;  3CXH H;  4LC1 A;  2V7Q H;  3D6Z A;  1M74 A;  2KSE A;  5AW8 B;  4IL6 X;  1ZOY C;  3CPW O;  3GKL C;  5KJ7 C;  2H8P D;  2WSC H;  2K0Y A;  1L0N G;  4OGQ C;  2NO8 A;  4WB4 A;  2NPS A;  3EWK A;  2KS1 B;  1SQQ G;  3H1L J;  2AEF A;  3FWL A;  2XKM A;  3WUU A;  1EC5 A;  3PHL A;  1MZ8 A;  4HJG H;  1KMI Z;  1N73 B;  3V2P A;  1EQ7 A;  2M5A A;  3CX5 I;  1IFM A;  1Z56 A;  2FYU K;  4WWI A;  4QKO A;  3Q5S A;  4WY4 A;  1BAJ A;  2WTY A;  3CCS P;  2WIT A;  3LIE A;  1DIP A;  3H1K J;  4UB6 H;  4YPC A;  3V2Q A;  2PFX A;  1QX8 A;  4YTP C;  2ZT9 B;  1NO4 A;  1URQ B;  3TNU A;  2BHV A;  2B9B A;  2QM8 A;  2NRG A;  4JYC A;  3L71 E;  3WUT A;  1DEE G;  1PZQ A;  1HY8 A;  3KXD A;  3HYB A;  5BU5 A;  2PEO A;  2K2Q A;  1OVU A;  1L0L G;  2OYH A;  3IN6 A;  2W90 A;  2ZVN B;  3M06 A;  5CMZ A;  3Q1M A;  1IK9 A;  1PL5 A;  5KP6 B;  3L71 J;  3WU2 H;  3FXD A;  1ZV8 A;  3WBH A;  5HV8 A;  1E6J P;  1M1J B;  2FXP A;  4GDO A;  1GDT A;  2GUV A;  5CJ0 A;  1EDJ A;  1JO5 A;  3L73 G;  3H1J D;  1JY3 O;  3OA7 A;  5HGM A;  2AEJ A;  1QLE D;  5EJD A;  3RK3 E;  2OTL P;  3BAS A;  2VLP A;  5B5E H;  4IPY A;  5F2O A;  1FZE A;  2KLU A;  5C39 A;  2P58 A;  3FWN A;  1KN7 A;  1N73 A;  1ZRT D;  5APW A;  4NPF X;  2NPS D;  3GHG C;  1NTZ D;  2FYU G;  4H0L D;  1FZF A;  4H2W C;  1RF1 B;  3HUS A;  1AUM A;  3B5N B;  2KK7 A;  4AYC A;  4NEO A;  4RKU J;  4W80 A;  3VMY A;  1HH0 A;  1X22 A;  4RO0 A;  3U59 A;  1HJ0 A;  3C8V A;  3CCJ P;  2N1T B;  1BCC G;  5CJ4 A;  3UIA A;  1KQF B;  2K37 A;  1JTH A;  1JJ2 O;  4K35 A;  2K9J B;  5APX A;  3CXH I;  3GZL A;  2JQ4 A;  1IFD A;  2P10 A;  2WSE H;  1URQ A;  1PEM A;  2BUO A;  3L71 G;  2M3E A;  2EFJ A;  1NTK D;  3E2D A;  3EJB A;  3ZDM A;  1KYO D;  1DD4 A;  1QL1 A;  2R32 A;  1J1E B;  4EDF A;  2O3J A;  3OW2 O;  1ZRT E;  2FFD B;  3II6 A;  3NTN A;  1AQT A;  1PIX A;  4HH2 A;  2VSQ A;  2WPT A;  2A06 D;  2Y0E A;  2K3R A;  1KIL B;  2YMK A;  3L72 E;  2BQ1 E;  4RES B;  5BU8 B;  3H1I D;  4MRT C;  2CK3 H;  4BPF A;  3RL0 B;  1LTB C;  2PNG A;  3U1C A;  1J2J B;  3BVH A;  3L72 J;  2J5U A;  1T8K A;  1IMP A;  4U0C A;  2FHS C;  5CCG C;  5KJ7 D;  1S5L H;  5DJT B;  5L8R J;  4OGQ D;  1W2B O;  2M3B A;  4IFM A;  5I4T G;  4BWN A;  1NTK E;  1PFI A;  3RK2 C;  1VQL P;  3Q5P A;  1NAY A;  3MGE A;  4YXD C;  1RF0 A;  5AVT B;  2V4H A;  4Y28 J;  2OYI A;  2GYK A;  1E5W A;  1P84 D;  4C46 A;  1M57 D;  2FYN C;  1Q82 Q;  1NTK J;  3B5I A;  3G9R A;  3MUD A;  1FAV A;  2JU1 A;  3T97 B;  3MTU E;  3JCU H;  5F2N A;  1SQB E;  1HF9 A;  5DJU B;  3CI9 A;  1SQV K;  1CI6 A;  2AF8 A;  1LTG C;  2LOL A;  1ZME C;  3A0H E;  1RHZ B;  3L36 A;  3CX5 D;  1A8O A;  3S9O A;  1J1D C;  1SQB J;  1GTW A;  1KYO H;  2Q9I A;  3L70 D;  2IYO A;  1GL2 A;  1ZR4 A;  3G4S P;  1M6N A;  4N6J A;  1H8A A;  2PEI A;  1E79 H;  2GZI A;  1PEQ A;  2N9Y B;  5AW6 B;  3VOP A;  4IL6 H;  5KLV E;  4GIF A;  3W68 A;  2C9N Y;  1KD1 Q;  3CLQ A;  3VP8 A;  2N5H A;  2JWA A;  4XFZ A;  1JEK A;  1YIT P;  1AF8 A;  1GPJ A;  1VQK P;  3P8C D;  2PEM A;  1FZA A;  1LTJ C;  2JEE A;  5KLV J;  3L74 E;  3CCR P;  1L4A A;  3M1M A;  2IPP A;  4K3A A;  1RQU A;  1PP9 G;  1M7L A;  2ZJS E;  5KAF E;  2ITA A;  1UIX A;  1IFJ A;  1VF5 C;  2PY8 A;  2FVF A;  1VKU A;  3L70 E;  1IK7 A;  2JO1 A;  4R4L A;  1Q81 Q;  7CEI A;  4D6T G;  1KC8 Q;  2B88 A;  1DX7 A;  2LPK A;  1SLQ A;  4UHP B;  1P84 H;  4XFY A;  2QJY C;  2H7H A;  2MF4 A;  4WYM A;  2CNR A;  2XDJ A;  2BCC D;  2GDW A;  3L70 J;  4JPZ B;  1YTZ I;  3IF4 A;  2W83 C;  3RK3 C;  4LLH A;  2QRX A;  1IFN A;  2WMM A;  3SFE C;  1BGY D;  3P8C E;  3AE8 C;  3RGU A;  1SQV G;  5CCH A;  2OQQ A;  5E79 E;  5KKZ C;  1ZNV A;  1L0N D;  1Y8A A;  4GKG A;  1SQQ D;  3DS2 A;  3KQG A;  1PGO A;  5APV A;  2HR3 A; 
#chains in the Genus database with same CATH homology
 1M6N A;  5HGO A;  3DS4 A;  2PEI A;  3H0D A;  3WBH A;  2KOD A;  1VQ6 P;  2BQ1 E;  1PEQ A;  1E6J P;  4XFX A;  1YHQ P;  1RO2 A;  1M74 A;  2CWO A;  4XRQ A;  3CPW O;  1QVF O;  1N8R Q;  3RG6 C;  2JO0 A;  1KD1 Q;  1VQ7 P;  1RO0 A;  2L6E A;  4PH0 A;  2M8P A;  2E1M A;  1K9M Q;  5HGN A;  3DS1 A;  4XFZ A;  3Q20 A;  1YIT P;  2DGY A;  5HGM A;  3DS3 A;  4U0F A;  1QRJ A;  1M6E X;  1RNI A;  2Z44 A;  1KQS O;  1VQK P;  2OAR A;  2PEM A;  3G71 P;  1VQN P;  3CCL P;  3DS5 A;  2PEK A;  4PH1 A;  3CCU P;  2OTL P;  4XRO A;  3CCV P;  3CCR P;  2JYG A;  4U0C A;  4U0D A;  3M1M A;  4IPY A;  5F2O A;  1PEU A;  3G28 A;  1VQ4 P;  3CD6 P;  1A43 A;  4U0A A;  3VRL C;  3H47 A;  3CCM P;  3G21 A;  3I56 P;  3G1I A;  1W2B O;  3NTE A;  5I4T G;  1EOQ A;  5BS2 A;  2PEJ A;  3CXC O;  2QA4 P;  1K73 Q;  4COC A;  1VQL P;  3G26 A;  3CCQ P;  3MGE A;  4GR6 A;  3DPH A;  1D1D A;  2M8L A;  2XT1 A;  2PEQ A;  1BAJ A;  2PY8 A;  1YJN P;  3CC2 P;  3G6E P;  1AUM A;  4GR2 A;  3CCS P;  1VQ5 P;  2EG5 A;  1VQP P;  1Q81 Q;  3CCE P;  4U0E A;  3LRY A;  1KC8 Q;  2XV6 A;  1PEO A;  3G1G A;  1Q7Y Q;  4COP A;  4QNB A;  3CCJ P;  1Q82 Q;  3B5I A;  3G0V A;  1K8A Q;  4XFY A;  1YIJ P;  1M1K Q;  5DCK A;  4WYM A;  5F2K A;  1Q86 Q;  2JYL A;  1JJ2 O;  5JPA A;  2LF4 A;  2PEN A;  2Z45 A;  2QEX P;  1NJI Q;  5BS1 A;  5F2N A;  3CC4 P;  1VQM P;  2ONT A;  4M0I A;  2BHV A;  1EIA A;  3HZQ A;  2XXM A;  4U0B A;  3P05 A;  1YJW P;  1PEM A;  2BUO A;  3I55 P;  1K30 A;  2Z46 A;  1S72 P;  3HYB A;  3DTJ A;  3G29 A;  2EFJ A;  1VQO P;  5HGL A;  1IUQ A;  1VQ8 P;  2EIA A;  3CME P;  3E2D A;  2PEO A;  1QVG O;  3DS0 A;  2OTJ P;  1A8O A;  3CMA P;  2M8N A;  1YI2 P;  1VQ9 P;  3CC7 P;  3DS2 A;  3OW2 O;  2P9X A;  1YJ9 P;  1M90 Q;  1ZMB A;  3H4E A;  3G4S P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...