3U43A

Crystal structure of the colicin e2 dnase-im2 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
LKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Colicin-E2 immunity protein
publication title Structure of the Ultra-High-Affinity Colicin E2 DNase-Im2 Complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3u43A00
2GZJA 2GZIA 2K0DX 1ZNVA 2ERHA 1UNKA 2GYKA 1CEIA 2K5XA 1AYIA 1BXIA 2JAZA 2VLPA 4QKOA 1E0HA 5EW5E 1GXHA 2VLOA 1UJZA 1EMVA 4F37A 1GXGA 2GZFA 2NO8A 2VLQA 3U43A 3GJNA 2JBGA 7CEIA 2JB0A 1IMPA 2GZGA 4UHPB 2WPTA 1IMQA 3GKLC 1FR2A 2GZEA 2VLNA 1MZ8A
chains in the Genus database with same CATH superfamily
4COCA 2JQ4A 2M8PA 1JJ2O 2XXMA 4NEOA 2KOPA 2JAZA 2GZFA 1W2BO 2FVFA 4H2XC 3RG2A 2Z46A 3LMOA 5HGMA 2JYLA 3GZLA 1IMQA 4XRQA 1FR2A 2JU2A 2PEQA 3I55P 1M6EX 2N5IA 2KGEA 1M90Q 1ACPA 2KG8A 2MY5A 3MGEA 3B4QA 1DV5A 1GXHA 1VQ6P 1QVFO 3CXCO 2MR7A 2QA4P 2K2QA 2FAEA 2OTLP 2PEKA 1DNYA 2K0DX 4MRTC 2PEIA 1EOQA 4H2YC 3GZMA 2KGCA 5DCKA 1BXIA 4QKOA 1E0HA 5CZDB 3H0DA 3CCMP 1HY8A 3DS5A 4F37A 1VQ4P 2K93A 2GZGA 2PEMA 4BPGA 2FQ1A 2K94A 4U0AA 3G71P 2EG5A 2CGQA 3G28A 3EJBA 2KW2A 2KWLA 4GR2A 1AYIA 2QEXP 1K9MQ 1VQPP 2PY8A 5HV8A 1GXGA 3GJNA 2M5RA 1VQKP 2AFEA 3CMEP 1VQNP 3GKLC 2VLNA 1RO2A 2KORA 2EFJA 5F2KA 4HKGA 4H2WC 1CEIA 2MF4A 2N6YA 5KP6B 1NQ4A 3CCUP 1QRJA 2NO8A 3NTEA 3CC4P 2PEJA 3G0VA 1YHQP 1IMPA 3NY7B 3G21A 2GZEA 1Q7YQ 2OTJP 5KP8B 3G6EP 3G4SP 3CPWO 2ROQA 2GDWA 1AF8A 4U0BA 2JBGA 4XFYA 2M8NA 3B5IA 2PNGA 2X2BA 2CQ8A 2OARA 1VHNA 3RG6C 1VKUA 2KOSA 2GZJA 3M1MA 1A8OA 2FACA 1IUQA 5HVCA 1L0HA 4DG9A 3G1IA 3E2DA 5HGNA 1EMVA 1M74A 3CCRP 3CCEP 3VRLC 2BHVA 1KC8Q 1X3OA 2CWOA 1E6JP 3CD6P 2FQ0A 5HGLA 2KG9A 4U0CA 1YITP 2ERHA 2LL8A 1VQ9P 3CCQP 1BAJA 2L0QA 2LIUA 2LTEA 2M8LA 3DS4A 2DNWA 1YI2P 2AVAA 2AF8A 3CCLP 2FHSC 4GR6A 4QNBA 2WPTA 1KD1Q 3Q20A 4R0MA 1N8RQ 1RO0A 2Z44A 2JGPA 3H47A 2K5XA 2JO0A 2MR8A 2AFDA 4PWVB 2N6ZA 1VQOP 3LRYA 2Z45A 2EIAA 2XV6A 2GDYA 1D1DA 2MVVA 1KQSO 1ZNVA 2N50A 2L22A 3DPHA 5JPAA 2PENA 2KOOA 3DS3A 3CC2P 1NJIQ 5KP7B 3HYBA 4XFXA 3CCJP 3CCSP 4COPA 1K8AQ 1YIJP 2QNWA 2CG5B 2GDXA 5F2NA 4M0IA 2JU1A 1VQMP 1EIAA 3U43A 1AUMA 2FADA 2E1MA 4XFZA 1VQLP 1F80D 2XZ1C 1ZMBA 1K73Q 1K30A 2KOQA 3G29A 4PH0A 1OR5A 4PXHB 5I4TG 2K0YA 5F2OA 2VLPA 1M1KQ 2N5HA 2VLOA 2EHSA 3G1GA 2K92A 1Z6MA 5BS1A 1Q82Q 2LF4A 3EJDA 2ONTA 4BPHA 5HGOA 3DS1A 4CA3A 2K0XA 1YJ9P 2JYGA 1M6NA 1Q81Q 4PH1A 2MD9A 1UNKA 2BUOA 1Q86Q 2KG6A 2LMLA 2FVAA 3EJEA 2XT1A 4UHPB 1HQBA 1MZ8A 4IPYA 2FQ2A 2VSQA 2L9FA 4U0DA 4U0FA 3CE7A 5EJDA 1S72P 5BS2A 2DGYA 2KGDA 4WYMA 4IZ6A 3HZQA 1RNIA 2MVUA 2JB0A 1GPJA 2FVEA 2KODA 1YJWP 1YJNP 1T8KA 1VQ5P 2GYKA 3CMAP 1UJZA 2P9XA 2VLQA 2L4BA 3DTJA 2L6EA 7CEIA 1VQ8P 2XZ0D 2KR5A 2CNRA 1QVGO 2LIWA 4BPFA 5EW5E 3WBHA 2GZIA 2N98A 3P05A 1L0IA 2LPKA 3CC7P 1A43A 3DS0A 3H4EA 3CCVP 1VQ7P 1KLPA 2EHTA 2KGAA 3I56P 3DS2A 4U0EA 2PEOA 2LOLA 3G26A 2LKIA 3OW2O 4XROA
chains in the Genus database with same CATH topology
2GZJA 2GZIA 2K0DX 1ZNVA 2ERHA 1UNKA 2GYKA 1CEIA 2K5XA 1AYIA 1BXIA 2JAZA 2VLPA 4QKOA 1E0HA 5EW5E 1GXHA 2VLOA 1UJZA 1EMVA 4F37A 1GXGA 2GZFA 2NO8A 2VLQA 3U43A 3GJNA 2JBGA 7CEIA 2JB0A 1IMPA 2GZGA 4UHPB 2WPTA 1IMQA 3GKLC 1FR2A 2GZEA 2VLNA 1MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZJ A;  2GZI A;  2K0D X;  1ZNV A;  2ERH A;  1UNK A;  2GYK A;  1CEI A;  2K5X A;  1AYI A;  1BXI A;  2JAZ A;  2VLP A;  4QKO A;  1E0H A;  5EW5 E;  1GXH A;  2VLO A;  1UJZ A;  1EMV A;  4F37 A;  1GXG A;  2GZF A;  2NO8 A;  2VLQ A;  3U43 A;  3GJN A;  2JBG A;  7CEI A;  2JB0 A;  1IMP A;  2GZG A;  4UHP B;  2WPT A;  1IMQ A;  3GKL C;  1FR2 A;  2GZE A;  2VLN A;  1MZ8 A; 
#chains in the Genus database with same CATH topology
 4COC A;  2JQ4 A;  2M8P A;  1JJ2 O;  2XXM A;  4NEO A;  2KOP A;  2JAZ A;  2GZF A;  1W2B O;  2FVF A;  4H2X C;  3RG2 A;  2Z46 A;  3LMO A;  5HGM A;  2JYL A;  3GZL A;  1IMQ A;  4XRQ A;  1FR2 A;  2JU2 A;  2PEQ A;  3I55 P;  1M6E X;  2N5I A;  2KGE A;  1M90 Q;  1ACP A;  2KG8 A;  2MY5 A;  3MGE A;  3B4Q A;  1DV5 A;  1GXH A;  1VQ6 P;  1QVF O;  3CXC O;  2MR7 A;  2QA4 P;  2K2Q A;  2FAE A;  2OTL P;  2PEK A;  1DNY A;  2K0D X;  4MRT C;  2PEI A;  1EOQ A;  4H2Y C;  3GZM A;  2KGC A;  5DCK A;  1BXI A;  4QKO A;  1E0H A;  5CZD B;  3H0D A;  3CCM P;  1HY8 A;  3DS5 A;  4F37 A;  1VQ4 P;  2K93 A;  2GZG A;  2PEM A;  4BPG A;  2FQ1 A;  2K94 A;  4U0A A;  3G71 P;  2EG5 A;  2CGQ A;  3G28 A;  3EJB A;  2KW2 A;  2KWL A;  4GR2 A;  1AYI A;  2QEX P;  1K9M Q;  1VQP P;  2PY8 A;  5HV8 A;  1GXG A;  3GJN A;  2M5R A;  1VQK P;  2AFE A;  3CME P;  1VQN P;  3GKL C;  2VLN A;  1RO2 A;  2KOR A;  2EFJ A;  5F2K A;  4HKG A;  4H2W C;  1CEI A;  2MF4 A;  2N6Y A;  5KP6 B;  1NQ4 A;  3CCU P;  1QRJ A;  2NO8 A;  3NTE A;  3CC4 P;  2PEJ A;  3G0V A;  1YHQ P;  1IMP A;  3NY7 B;  3G21 A;  2GZE A;  1Q7Y Q;  2OTJ P;  5KP8 B;  3G6E P;  3G4S P;  3CPW O;  2ROQ A;  2GDW A;  1AF8 A;  4U0B A;  2JBG A;  4XFY A;  2M8N A;  3B5I A;  2PNG A;  2X2B A;  2CQ8 A;  2OAR A;  1VHN A;  3RG6 C;  1VKU A;  2KOS A;  2GZJ A;  3M1M A;  1A8O A;  2FAC A;  1IUQ A;  5HVC A;  1L0H A;  4DG9 A;  3G1I A;  3E2D A;  5HGN A;  1EMV A;  1M74 A;  3CCR P;  3CCE P;  3VRL C;  2BHV A;  1KC8 Q;  1X3O A;  2CWO A;  1E6J P;  3CD6 P;  2FQ0 A;  5HGL A;  2KG9 A;  4U0C A;  1YIT P;  2ERH A;  2LL8 A;  1VQ9 P;  3CCQ P;  1BAJ A;  2L0Q A;  2LIU A;  2LTE A;  2M8L A;  3DS4 A;  2DNW A;  1YI2 P;  2AVA A;  2AF8 A;  3CCL P;  2FHS C;  4GR6 A;  4QNB A;  2WPT A;  1KD1 Q;  3Q20 A;  4R0M A;  1N8R Q;  1RO0 A;  2Z44 A;  2JGP A;  3H47 A;  2K5X A;  2JO0 A;  2MR8 A;  2AFD A;  4PWV B;  2N6Z A;  1VQO P;  3LRY A;  2Z45 A;  2EIA A;  2XV6 A;  2GDY A;  1D1D A;  2MVV A;  1KQS O;  1ZNV A;  2N50 A;  2L22 A;  3DPH A;  5JPA A;  2PEN A;  2KOO A;  3DS3 A;  3CC2 P;  1NJI Q;  5KP7 B;  3HYB A;  4XFX A;  3CCJ P;  3CCS P;  4COP A;  1K8A Q;  1YIJ P;  2QNW A;  2CG5 B;  2GDX A;  5F2N A;  4M0I A;  2JU1 A;  1VQM P;  1EIA A;  3U43 A;  1AUM A;  2FAD A;  2E1M A;  4XFZ A;  1VQL P;  1F80 D;  2XZ1 C;  1ZMB A;  1K73 Q;  1K30 A;  2KOQ A;  3G29 A;  4PH0 A;  1OR5 A;  4PXH B;  5I4T G;  2K0Y A;  5F2O A;  2VLP A;  1M1K Q;  2N5H A;  2VLO A;  2EHS A;  3G1G A;  2K92 A;  1Z6M A;  5BS1 A;  1Q82 Q;  2LF4 A;  3EJD A;  2ONT A;  4BPH A;  5HGO A;  3DS1 A;  4CA3 A;  2K0X A;  1YJ9 P;  2JYG A;  1M6N A;  1Q81 Q;  4PH1 A;  2MD9 A;  1UNK A;  2BUO A;  1Q86 Q;  2KG6 A;  2LML A;  2FVA A;  3EJE A;  2XT1 A;  4UHP B;  1HQB A;  1MZ8 A;  4IPY A;  2FQ2 A;  2VSQ A;  2L9F A;  4U0D A;  4U0F A;  3CE7 A;  5EJD A;  1S72 P;  5BS2 A;  2DGY A;  2KGD A;  4WYM A;  4IZ6 A;  3HZQ A;  1RNI A;  2MVU A;  2JB0 A;  1GPJ A;  2FVE A;  2KOD A;  1YJW P;  1YJN P;  1T8K A;  1VQ5 P;  2GYK A;  3CMA P;  1UJZ A;  2P9X A;  2VLQ A;  2L4B A;  3DTJ A;  2L6E A;  7CEI A;  1VQ8 P;  2XZ0 D;  2KR5 A;  2CNR A;  1QVG O;  2LIW A;  4BPF A;  5EW5 E;  3WBH A;  2GZI A;  2N98 A;  3P05 A;  1L0I A;  2LPK A;  3CC7 P;  1A43 A;  3DS0 A;  3H4E A;  3CCV P;  1VQ7 P;  1KLP A;  2EHT A;  2KGA A;  3I56 P;  3DS2 A;  4U0E A;  2PEO A;  2LOL A;  3G26 A;  2LKI A;  3OW2 O;  4XRO A; 
#chains in the Genus database with same CATH homology
 2GZJ A;  2GZI A;  2K0D X;  1ZNV A;  2ERH A;  1UNK A;  2GYK A;  1CEI A;  2K5X A;  1AYI A;  1BXI A;  2JAZ A;  2VLP A;  4QKO A;  1E0H A;  5EW5 E;  1GXH A;  2VLO A;  1UJZ A;  1EMV A;  4F37 A;  1GXG A;  2GZF A;  2NO8 A;  2VLQ A;  3U43 A;  3GJN A;  2JBG A;  7CEI A;  2JB0 A;  1IMP A;  2GZG A;  4UHP B;  2WPT A;  1IMQ A;  3GKL C;  1FR2 A;  2GZE A;  2VLN A;  1MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...