3U43A

Crystal structure of the colicin e2 dnase-im2 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
LKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E2 immunity protein
publication title Structure of the Ultra-High-Affinity Colicin E2 DNase-Im2 Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3u43A00
2GZFA 4F37A 2GZEA 2K0DX 1GXHA 1E0HA 1IMPA 1EMVA 1ZNVA 3U43A 2GYKA 1AYIA 2JAZA 2VLNA 2WPTA 5EW5E 4QKOA 2GZIA 4UHPB 3GJNA 1GXGA 2VLQA 1UJZA 2VLPA 2ERHA 2GZGA 2JBGA 2JB0A 1BXIA 2K5XA 2VLOA 1IMQA 2NO8A 1FR2A 1UNKA 1CEIA 2GZJA 1MZ8A 3GKLC 7CEIA
chains in the Genus database with same CATH superfamily
3CCUP 1ACPA 2XT1A 2WPTA 1M6NA 2FADA 2L4BA 3CCLP 3EJDA 5HGMA 1VQPP 2OTLP 2N98A 2JU2A 1Q7YQ 3GZMA 2L9FA 2KG9A 1RO0A 3RG2A 2GZFA 4GR2A 2VSQA 1S72P 1KC8Q 2FQ1A 1VQ6P 2FVAA 4NEOA 3B4QA 1E6JP 3G26A 3Q20A 3OW2O 3NTEA 3I55P 4U0CA 1L0HA 3G28A 2K0XA 2XZ1C 1HQBA 2PEKA 1HY8A 2GYKA 3DS2A 2CQ8A 2ROQA 2XV6A 2KORA 1KD1Q 4XROA 3CMAP 3VRLC 2NO8A 1D1DA 4F37A 3DS5A 2K0DX 2CWOA 4H2YC 3G1GA 1QRJA 2M8LA 3DTJA 1X3OA 3CCJP 2KOQA 4H2XC 3G6EP 2K0YA 2LOLA 1EOQA 3DS1A 4BPFA 2N5IA 3CCVP 1RNIA 1GPJA 1GXHA 2GDWA 2X2BA 5KP7B 1OR5A 5DCKA 3DS4A 5EJDA 5HGNA 4H2WC 2KOOA 2FQ0A 5HGOA 4BPHA 2CNRA 1NQ4A 1M1KQ 1VKUA 4XRQA 3CCMP 2AF8A 2MD9A 2KR5A 1K30A 2KGDA 2K94A 4U0EA 1K9MQ 1M6EX 2PEJA 3CXCO 2MR8A 2VLNA 5EW5E 2KWLA 2LIWA 3H47A 1VQ5P 1L0IA 2K2QA 4U0DA 2OARA 1IUQA 1BXIA 1T8KA 1AF8A 3B5IA 1W2BO 3CMEP 1YIJP 3LMOA 7CEIA 3G71P 3CC2P 2KGAA 1K8AQ 2DNWA 2LIUA 2KG6A 1K73Q 1GXGA 2ONTA 4U0AA 3WBHA 2E1MA 2PEOA 3EJEA 3LRYA 1YJWP 1UNKA 5HVCA 1YI2P 1MZ8A 4IZ6A 2CG5B 3CCEP 4WYMA 1VQKP 4CA3A 2QEXP 1KQSO 2L6EA 2PY8A 1M74A 4COPA 4GR6A 2FACA 3H4EA 2K92A 2EFJA 2M8NA 2LKIA 1FR2A 2XZ0D 1DNYA 4BPGA 4PXHB 1EMVA 2M8PA 1VHNA 3CCSP 3U43A 3CPWO 4UHPB 2BUOA 1UJZA 1NJIQ 4PH0A 5BS2A 5F2KA 2Z46A 2N6ZA 4PWVB 1Q86Q 2MVUA 2LPKA 1CEIA 2LMLA 2KGEA 1M90Q 2PEMA 3MGEA 2KOPA 3G4SP 2KG8A 2PEQA 3NY7B 3CE7A 1RO2A 2AFDA 5CZDB 2GZIA 1YHQP 5F2OA 5I4TG 2N5HA 1YJNP 2JQ4A 2KGCA 2GZJA 3CCRP 5KP8B 2GZEA 3GZLA 4U0BA 1BAJA 2LL8A 1IMPA 2MVVA 2QNWA 1DV5A 2N50A 1YITP 1JJ2O 1VQMP 3M1MA 1Q82Q 2VLQA 2EHTA 1KLPA 1VQ4P 2JGPA 2K5XA 2CGQA 2MF4A 1IMQA 3G21A 1F80D 2AVAA 2Z44A 4COCA 1ZMBA 4MRTC 1VQNP 4QKOA 4XFZA 2KODA 3P05A 2VLPA 2JU1A 2FAEA 2P9XA 3HYBA 4XFYA 2PENA 1AUMA 2MY5A 3E2DA 1VQ8P 1VQOP 2PNGA 2EG5A 1E0HA 4PH1A 5BS1A 2JYLA 1QVFO 2BHVA 2EHSA 1EIAA 2FVFA 1VQLP 2JBGA 3H0DA 2K93A 2JB0A 4XFXA 4U0FA 5HV8A 3DS3A 1Q81Q 2FVEA 4IPYA 3RG6C 1VQ7P 3G1IA 2DGYA 3I56P 2AFEA 3CCQP 2N6YA 2OTJP 1AYIA 3CC4P 5JPAA 3HZQA 2XXMA 1N8RQ 3EJBA 2L22A 2KW2A 2GZGA 2MR7A 2JYGA 2EIAA 4QNBA 3CC7P 2JO0A 5KP6B 2FQ2A 3CD6P 2LF4A 5HGLA 1A8OA 1ZNVA 2QA4P 2JAZA 1VQ9P 2M5RA 4DG9A 2KOSA 2Z45A 2GDYA 2GDXA 2PEIA 4R0MA 1Z6MA 2FHSC 3GKLC 2L0QA 3G0VA 1A43A 1QVGO 1YJ9P 3G29A 3GJNA 5F2NA 2ERHA 4M0IA 2VLOA 3DS0A 2LTEA 4HKGA 3DPHA
chains in the Genus database with same CATH topology
2GZFA 4F37A 2GZEA 2K0DX 1GXHA 1E0HA 1IMPA 1EMVA 1ZNVA 3U43A 2GYKA 1AYIA 2JAZA 2VLNA 2WPTA 5EW5E 4QKOA 2GZIA 4UHPB 3GJNA 1GXGA 2VLQA 1UJZA 2VLPA 2ERHA 2GZGA 2JBGA 2JB0A 1BXIA 2K5XA 2VLOA 1IMQA 2NO8A 1FR2A 1UNKA 1CEIA 2GZJA 1MZ8A 3GKLC 7CEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZF A;  4F37 A;  2GZE A;  2K0D X;  1GXH A;  1E0H A;  1IMP A;  1EMV A;  1ZNV A;  3U43 A;  2GYK A;  1AYI A;  2JAZ A;  2VLN A;  2WPT A;  5EW5 E;  4QKO A;  2GZI A;  4UHP B;  3GJN A;  1GXG A;  2VLQ A;  1UJZ A;  2VLP A;  2ERH A;  2GZG A;  2JBG A;  2JB0 A;  1BXI A;  2K5X A;  2VLO A;  1IMQ A;  2NO8 A;  1FR2 A;  1UNK A;  1CEI A;  2GZJ A;  1MZ8 A;  3GKL C;  7CEI A; 
#chains in the Genus database with same CATH topology
 3CCU P;  1ACP A;  2XT1 A;  2WPT A;  1M6N A;  2FAD A;  2L4B A;  3CCL P;  3EJD A;  5HGM A;  1VQP P;  2OTL P;  2N98 A;  2JU2 A;  1Q7Y Q;  3GZM A;  2L9F A;  2KG9 A;  1RO0 A;  3RG2 A;  2GZF A;  4GR2 A;  2VSQ A;  1S72 P;  1KC8 Q;  2FQ1 A;  1VQ6 P;  2FVA A;  4NEO A;  3B4Q A;  1E6J P;  3G26 A;  3Q20 A;  3OW2 O;  3NTE A;  3I55 P;  4U0C A;  1L0H A;  3G28 A;  2K0X A;  2XZ1 C;  1HQB A;  2PEK A;  1HY8 A;  2GYK A;  3DS2 A;  2CQ8 A;  2ROQ A;  2XV6 A;  2KOR A;  1KD1 Q;  4XRO A;  3CMA P;  3VRL C;  2NO8 A;  1D1D A;  4F37 A;  3DS5 A;  2K0D X;  2CWO A;  4H2Y C;  3G1G A;  1QRJ A;  2M8L A;  3DTJ A;  1X3O A;  3CCJ P;  2KOQ A;  4H2X C;  3G6E P;  2K0Y A;  2LOL A;  1EOQ A;  3DS1 A;  4BPF A;  2N5I A;  3CCV P;  1RNI A;  1GPJ A;  1GXH A;  2GDW A;  2X2B A;  5KP7 B;  1OR5 A;  5DCK A;  3DS4 A;  5EJD A;  5HGN A;  4H2W C;  2KOO A;  2FQ0 A;  5HGO A;  4BPH A;  2CNR A;  1NQ4 A;  1M1K Q;  1VKU A;  4XRQ A;  3CCM P;  2AF8 A;  2MD9 A;  2KR5 A;  1K30 A;  2KGD A;  2K94 A;  4U0E A;  1K9M Q;  1M6E X;  2PEJ A;  3CXC O;  2MR8 A;  2VLN A;  5EW5 E;  2KWL A;  2LIW A;  3H47 A;  1VQ5 P;  1L0I A;  2K2Q A;  4U0D A;  2OAR A;  1IUQ A;  1BXI A;  1T8K A;  1AF8 A;  3B5I A;  1W2B O;  3CME P;  1YIJ P;  3LMO A;  7CEI A;  3G71 P;  3CC2 P;  2KGA A;  1K8A Q;  2DNW A;  2LIU A;  2KG6 A;  1K73 Q;  1GXG A;  2ONT A;  4U0A A;  3WBH A;  2E1M A;  2PEO A;  3EJE A;  3LRY A;  1YJW P;  1UNK A;  5HVC A;  1YI2 P;  1MZ8 A;  4IZ6 A;  2CG5 B;  3CCE P;  4WYM A;  1VQK P;  4CA3 A;  2QEX P;  1KQS O;  2L6E A;  2PY8 A;  1M74 A;  4COP A;  4GR6 A;  2FAC A;  3H4E A;  2K92 A;  2EFJ A;  2M8N A;  2LKI A;  1FR2 A;  2XZ0 D;  1DNY A;  4BPG A;  4PXH B;  1EMV A;  2M8P A;  1VHN A;  3CCS P;  3U43 A;  3CPW O;  4UHP B;  2BUO A;  1UJZ A;  1NJI Q;  4PH0 A;  5BS2 A;  5F2K A;  2Z46 A;  2N6Z A;  4PWV B;  1Q86 Q;  2MVU A;  2LPK A;  1CEI A;  2LML A;  2KGE A;  1M90 Q;  2PEM A;  3MGE A;  2KOP A;  3G4S P;  2KG8 A;  2PEQ A;  3NY7 B;  3CE7 A;  1RO2 A;  2AFD A;  5CZD B;  2GZI A;  1YHQ P;  5F2O A;  5I4T G;  2N5H A;  1YJN P;  2JQ4 A;  2KGC A;  2GZJ A;  3CCR P;  5KP8 B;  2GZE A;  3GZL A;  4U0B A;  1BAJ A;  2LL8 A;  1IMP A;  2MVV A;  2QNW A;  1DV5 A;  2N50 A;  1YIT P;  1JJ2 O;  1VQM P;  3M1M A;  1Q82 Q;  2VLQ A;  2EHT A;  1KLP A;  1VQ4 P;  2JGP A;  2K5X A;  2CGQ A;  2MF4 A;  1IMQ A;  3G21 A;  1F80 D;  2AVA A;  2Z44 A;  4COC A;  1ZMB A;  4MRT C;  1VQN P;  4QKO A;  4XFZ A;  2KOD A;  3P05 A;  2VLP A;  2JU1 A;  2FAE A;  2P9X A;  3HYB A;  4XFY A;  2PEN A;  1AUM A;  2MY5 A;  3E2D A;  1VQ8 P;  1VQO P;  2PNG A;  2EG5 A;  1E0H A;  4PH1 A;  5BS1 A;  2JYL A;  1QVF O;  2BHV A;  2EHS A;  1EIA A;  2FVF A;  1VQL P;  2JBG A;  3H0D A;  2K93 A;  2JB0 A;  4XFX A;  4U0F A;  5HV8 A;  3DS3 A;  1Q81 Q;  2FVE A;  4IPY A;  3RG6 C;  1VQ7 P;  3G1I A;  2DGY A;  3I56 P;  2AFE A;  3CCQ P;  2N6Y A;  2OTJ P;  1AYI A;  3CC4 P;  5JPA A;  3HZQ A;  2XXM A;  1N8R Q;  3EJB A;  2L22 A;  2KW2 A;  2GZG A;  2MR7 A;  2JYG A;  2EIA A;  4QNB A;  3CC7 P;  2JO0 A;  5KP6 B;  2FQ2 A;  3CD6 P;  2LF4 A;  5HGL A;  1A8O A;  1ZNV A;  2QA4 P;  2JAZ A;  1VQ9 P;  2M5R A;  4DG9 A;  2KOS A;  2Z45 A;  2GDY A;  2GDX A;  2PEI A;  4R0M A;  1Z6M A;  2FHS C;  3GKL C;  2L0Q A;  3G0V A;  1A43 A;  1QVG O;  1YJ9 P;  3G29 A;  3GJN A;  5F2N A;  2ERH A;  4M0I A;  2VLO A;  3DS0 A;  2LTE A;  4HKG A;  3DPH A; 
#chains in the Genus database with same CATH homology
 2GZF A;  4F37 A;  2GZE A;  2K0D X;  1GXH A;  1E0H A;  1IMP A;  1EMV A;  1ZNV A;  3U43 A;  2GYK A;  1AYI A;  2JAZ A;  2VLN A;  2WPT A;  5EW5 E;  4QKO A;  2GZI A;  4UHP B;  3GJN A;  1GXG A;  2VLQ A;  1UJZ A;  2VLP A;  2ERH A;  2GZG A;  2JBG A;  2JB0 A;  1BXI A;  2K5X A;  2VLO A;  1IMQ A;  2NO8 A;  1FR2 A;  1UNK A;  1CEI A;  2GZJ A;  1MZ8 A;  3GKL C;  7CEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...