3U43A

Crystal structure of the colicin e2 dnase-im2 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
LKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E2 immunity protein
publication title Structure of the Ultra-High-Affinity Colicin E2 DNase-Im2 Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3u43A00
1IMQA 1ZNVA 3GJNA 2K0DX 2VLOA 4QKOA 2K5XA 1GXHA 3U43A 1EMVA 2VLPA 1FR2A 1UJZA 1BXIA 2GZJA 2GZFA 4UHPB 2VLNA 1CEIA 2ERHA 1MZ8A 2VLQA 4F37A 2NO8A 2JB0A 2GZEA 1AYIA 2JBGA 3GKLC 1UNKA 1E0HA 2GZGA 2WPTA 1IMPA 2GYKA 2JAZA 1GXGA 2GZIA 5EW5E 7CEIA
chains in the Genus database with same CATH superfamily
1YIJP 2K0DX 2VLOA 2QNWA 3G1IA 3RG6C 1GXHA 2OARA 1HQBA 2VLPA 2JQ4A 1JJ2O 2FQ0A 3CCUP 2MY5A 2PEKA 2VLQA 2KODA 1QVFO 2BHVA 2XV6A 2L9FA 1KD1Q 3G0VA 3EJBA 3GKLC 1YI2P 5KP6B 2L22A 1F80D 2N6YA 2N98A 3GJNA 1K8AQ 1AF8A 2CG5B 2KGEA 1FR2A 4WYMA 2CNRA 2LIUA 2ERHA 2FVAA 4U0DA 2M8LA 4COCA 2Z45A 1W2BO 2N50A 1ACPA 5BS2A 3G6EP 4BPHA 1VQ8P 2L0QA 3GZLA 2AFDA 5HGLA 1VQPP 3CCQP 2FVFA 5HV8A 3CC4P 3B5IA 3NTEA 1VQNP 1VQOP 3G21A 4BPFA 4H2WC 5F2KA 2JYLA 4HKGA 3GZMA 2KGAA 1VKUA 1YJWP 1VHNA 1M6EX 2L6EA 5EJDA 2N6ZA 3U43A 4R0MA 1KQSO 2KOQA 1K30A 1VQ5P 1VQKP 1YHQP 2JO0A 2M5RA 2FVEA 5HVCA 5F2OA 1M1KQ 1UNKA 2GZGA 2JAZA 2LL8A 7CEIA 3G29A 2JU2A 5F2NA 1A8OA 1OR5A 2DNWA 1D1DA 2KGDA 2FHSC 4PXHB 5KP7B 3G28A 1MZ8A 2KG6A 4H2YC 2M8NA 3CD6P 2KGCA 3CCEP 2CWOA 2CQ8A 5EW5E 1VQ7P 2X2BA 2DGYA 4XRQA 1YJNP 2OTJP 1Z6MA 2VLNA 2PEOA 3E2DA 3HYBA 4GR2A 1RO0A 2CGQA 2LTEA 4NEOA 4COPA 3CCJP 3H4EA 2EIAA 4GR6A 1VQMP 2MVVA 2K2QA 3I56P 2GDXA 5HGNA 1BXIA 3H0DA 4U0FA 3G4SP 3H47A 5HGOA 4U0CA 3CC2P 2JU1A 1Q86Q 2K0YA 2PEJA 2GZIA 3HZQA 5HGMA 2KG9A 1EIAA 1X3OA 5I4TG 1T8KA 2KG8A 4U0EA 2VSQA 1E6JP 1HY8A 2JYGA 3DPHA 2EHTA 1VQLP 4PH0A 2FQ2A 2PEIA 2GDYA 1NQ4A 2K92A 2Z46A 2FAEA 2AF8A 3DS3A 1EMVA 3CCSP 3CC7P 1Q82Q 2MF4A 4PH1A 3CCVP 2LMLA 1KC8Q 1E0HA 1GXGA 2LPKA 3G26A 2PY8A 3CXCO 2GZJA 3I55P 5DCKA 4IPYA 4CA3A 4F37A 2ONTA 1AYIA 2KWLA 2FQ1A 1M6NA 2MD9A 3P05A 1AUMA 1DV5A 2AFEA 3OW2O 2JGPA 2GZFA 3DS1A 3CCLP 2LOLA 1CEIA 2BUOA 2XT1A 4PWVB 1Q81Q 1NJIQ 3G71P 2WPTA 1IMPA 5JPAA 2QEXP 1S72P 2OTLP 1Q7YQ 3RG2A 3WBHA 2KW2A 1UJZA 4BPGA 2MVUA 1BAJA 2K0XA 3CPWO 2MR7A 1K9MQ 2AVAA 2PEMA 3DTJA 2Z44A 2JB0A 4XFYA 2KR5A 2E1MA 1K73Q 1VQ6P 3NY7B 2L4BA 2EHSA 2QA4P 1IUQA 4M0IA 2FACA 3Q20A 2KOOA 3EJDA 4UHPB 1RNIA 1DNYA 2LF4A 2GZEA 1N8RQ 2JBGA 3G1GA 2PENA 3LRYA 2GYKA 1GPJA 1M90Q 1ZNVA 2P9XA 3CCRP 4MRTC 3CCMP 2XZ1C 1A43A 3DS0A 3DS2A 3B4QA 1L0IA 3MGEA 4XFZA 1KLPA 1RO2A 1QVGO 1VQ9P 1YITP 2LKIA 3M1MA 2GDWA 2PEQA 2M8PA 4IZ6A 1IMQA 3CE7A 2FADA 3DS5A 4QKOA 4QNBA 3CMAP 3EJEA 4XFXA 5KP8B 2ROQA 3LMOA 1YJ9P 1VQ4P 1ZMBA 5BS1A 2N5IA 1QRJA 2PNGA 3VRLC 2K94A 4XROA 2KOSA 2LIWA 2MR8A 2K5XA 2XZ0D 2N5HA 1M74A 2K93A 1EOQA 3CMEP 4U0BA 4DG9A 5CZDB 4H2XC 2KOPA 2EFJA 4U0AA 2NO8A 1L0HA 2XXMA 3DS4A 2KORA 2EG5A
chains in the Genus database with same CATH topology
1IMQA 1ZNVA 3GJNA 2K0DX 2VLOA 4QKOA 2K5XA 1GXHA 3U43A 1EMVA 2VLPA 1FR2A 1UJZA 1BXIA 2GZJA 2GZFA 4UHPB 2VLNA 1CEIA 2ERHA 1MZ8A 2VLQA 4F37A 2NO8A 2JB0A 2GZEA 1AYIA 2JBGA 3GKLC 1UNKA 1E0HA 2GZGA 2WPTA 1IMPA 2GYKA 2JAZA 1GXGA 2GZIA 5EW5E 7CEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMQ A;  1ZNV A;  3GJN A;  2K0D X;  2VLO A;  4QKO A;  2K5X A;  1GXH A;  3U43 A;  1EMV A;  2VLP A;  1FR2 A;  1UJZ A;  1BXI A;  2GZJ A;  2GZF A;  4UHP B;  2VLN A;  1CEI A;  2ERH A;  1MZ8 A;  2VLQ A;  4F37 A;  2NO8 A;  2JB0 A;  2GZE A;  1AYI A;  2JBG A;  3GKL C;  1UNK A;  1E0H A;  2GZG A;  2WPT A;  1IMP A;  2GYK A;  2JAZ A;  1GXG A;  2GZI A;  5EW5 E;  7CEI A; 
#chains in the Genus database with same CATH topology
 1YIJ P;  2K0D X;  2VLO A;  2QNW A;  3G1I A;  3RG6 C;  1GXH A;  2OAR A;  1HQB A;  2VLP A;  2JQ4 A;  1JJ2 O;  2FQ0 A;  3CCU P;  2MY5 A;  2PEK A;  2VLQ A;  2KOD A;  1QVF O;  2BHV A;  2XV6 A;  2L9F A;  1KD1 Q;  3G0V A;  3EJB A;  3GKL C;  1YI2 P;  5KP6 B;  2L22 A;  1F80 D;  2N6Y A;  2N98 A;  3GJN A;  1K8A Q;  1AF8 A;  2CG5 B;  2KGE A;  1FR2 A;  4WYM A;  2CNR A;  2LIU A;  2ERH A;  2FVA A;  4U0D A;  2M8L A;  4COC A;  2Z45 A;  1W2B O;  2N50 A;  1ACP A;  5BS2 A;  3G6E P;  4BPH A;  1VQ8 P;  2L0Q A;  3GZL A;  2AFD A;  5HGL A;  1VQP P;  3CCQ P;  2FVF A;  5HV8 A;  3CC4 P;  3B5I A;  3NTE A;  1VQN P;  1VQO P;  3G21 A;  4BPF A;  4H2W C;  5F2K A;  2JYL A;  4HKG A;  3GZM A;  2KGA A;  1VKU A;  1YJW P;  1VHN A;  1M6E X;  2L6E A;  5EJD A;  2N6Z A;  3U43 A;  4R0M A;  1KQS O;  2KOQ A;  1K30 A;  1VQ5 P;  1VQK P;  1YHQ P;  2JO0 A;  2M5R A;  2FVE A;  5HVC A;  5F2O A;  1M1K Q;  1UNK A;  2GZG A;  2JAZ A;  2LL8 A;  7CEI A;  3G29 A;  2JU2 A;  5F2N A;  1A8O A;  1OR5 A;  2DNW A;  1D1D A;  2KGD A;  2FHS C;  4PXH B;  5KP7 B;  3G28 A;  1MZ8 A;  2KG6 A;  4H2Y C;  2M8N A;  3CD6 P;  2KGC A;  3CCE P;  2CWO A;  2CQ8 A;  5EW5 E;  1VQ7 P;  2X2B A;  2DGY A;  4XRQ A;  1YJN P;  2OTJ P;  1Z6M A;  2VLN A;  2PEO A;  3E2D A;  3HYB A;  4GR2 A;  1RO0 A;  2CGQ A;  2LTE A;  4NEO A;  4COP A;  3CCJ P;  3H4E A;  2EIA A;  4GR6 A;  1VQM P;  2MVV A;  2K2Q A;  3I56 P;  2GDX A;  5HGN A;  1BXI A;  3H0D A;  4U0F A;  3G4S P;  3H47 A;  5HGO A;  4U0C A;  3CC2 P;  2JU1 A;  1Q86 Q;  2K0Y A;  2PEJ A;  2GZI A;  3HZQ A;  5HGM A;  2KG9 A;  1EIA A;  1X3O A;  5I4T G;  1T8K A;  2KG8 A;  4U0E A;  2VSQ A;  1E6J P;  1HY8 A;  2JYG A;  3DPH A;  2EHT A;  1VQL P;  4PH0 A;  2FQ2 A;  2PEI A;  2GDY A;  1NQ4 A;  2K92 A;  2Z46 A;  2FAE A;  2AF8 A;  3DS3 A;  1EMV A;  3CCS P;  3CC7 P;  1Q82 Q;  2MF4 A;  4PH1 A;  3CCV P;  2LML A;  1KC8 Q;  1E0H A;  1GXG A;  2LPK A;  3G26 A;  2PY8 A;  3CXC O;  2GZJ A;  3I55 P;  5DCK A;  4IPY A;  4CA3 A;  4F37 A;  2ONT A;  1AYI A;  2KWL A;  2FQ1 A;  1M6N A;  2MD9 A;  3P05 A;  1AUM A;  1DV5 A;  2AFE A;  3OW2 O;  2JGP A;  2GZF A;  3DS1 A;  3CCL P;  2LOL A;  1CEI A;  2BUO A;  2XT1 A;  4PWV B;  1Q81 Q;  1NJI Q;  3G71 P;  2WPT A;  1IMP A;  5JPA A;  2QEX P;  1S72 P;  2OTL P;  1Q7Y Q;  3RG2 A;  3WBH A;  2KW2 A;  1UJZ A;  4BPG A;  2MVU A;  1BAJ A;  2K0X A;  3CPW O;  2MR7 A;  1K9M Q;  2AVA A;  2PEM A;  3DTJ A;  2Z44 A;  2JB0 A;  4XFY A;  2KR5 A;  2E1M A;  1K73 Q;  1VQ6 P;  3NY7 B;  2L4B A;  2EHS A;  2QA4 P;  1IUQ A;  4M0I A;  2FAC A;  3Q20 A;  2KOO A;  3EJD A;  4UHP B;  1RNI A;  1DNY A;  2LF4 A;  2GZE A;  1N8R Q;  2JBG A;  3G1G A;  2PEN A;  3LRY A;  2GYK A;  1GPJ A;  1M90 Q;  1ZNV A;  2P9X A;  3CCR P;  4MRT C;  3CCM P;  2XZ1 C;  1A43 A;  3DS0 A;  3DS2 A;  3B4Q A;  1L0I A;  3MGE A;  4XFZ A;  1KLP A;  1RO2 A;  1QVG O;  1VQ9 P;  1YIT P;  2LKI A;  3M1M A;  2GDW A;  2PEQ A;  2M8P A;  4IZ6 A;  1IMQ A;  3CE7 A;  2FAD A;  3DS5 A;  4QKO A;  4QNB A;  3CMA P;  3EJE A;  4XFX A;  5KP8 B;  2ROQ A;  3LMO A;  1YJ9 P;  1VQ4 P;  1ZMB A;  5BS1 A;  2N5I A;  1QRJ A;  2PNG A;  3VRL C;  2K94 A;  4XRO A;  2KOS A;  2LIW A;  2MR8 A;  2K5X A;  2XZ0 D;  2N5H A;  1M74 A;  2K93 A;  1EOQ A;  3CME P;  4U0B A;  4DG9 A;  5CZD B;  4H2X C;  2KOP A;  2EFJ A;  4U0A A;  2NO8 A;  1L0H A;  2XXM A;  3DS4 A;  2KOR A;  2EG5 A; 
#chains in the Genus database with same CATH homology
 1IMQ A;  1ZNV A;  3GJN A;  2K0D X;  2VLO A;  4QKO A;  2K5X A;  1GXH A;  3U43 A;  1EMV A;  2VLP A;  1FR2 A;  1UJZ A;  1BXI A;  2GZJ A;  2GZF A;  4UHP B;  2VLN A;  1CEI A;  2ERH A;  1MZ8 A;  2VLQ A;  4F37 A;  2NO8 A;  2JB0 A;  2GZE A;  1AYI A;  2JBG A;  3GKL C;  1UNK A;  1E0H A;  2GZG A;  2WPT A;  1IMP A;  2GYK A;  2JAZ A;  1GXG A;  2GZI A;  5EW5 E;  7CEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...