1AUMA

Hiv capsid c-terminal domain (cac146)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
LDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV CAPSID
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1aumA00
4XFYA 2M8NA 2XXMA 3G29A 5HGOA 3DS2A 4U0FA 4U0CA 3LRYA 2EIAA 4M0IA 2JYLA 4U0DA 4XFXA 3G28A 3MGEA 2KODA 1EOQA 1E6JP 3G1GA 3G1IA 3DS0A 4XROA 1A43A 5DCKA 1BAJA 3P05A 3H4EA 1QRJA 2M8PA 5HGMA 2XT1A 3G21A 5JPAA 1AUMA 4IPYA 3H47A 2L6EA 2XV6A 4COCA 4COPA 3DS4A 2BUOA 2LF4A 5I4TG 2JO0A 4XRQA 4PH1A 3DS1A 2M8LA 2ONTA 1D1DA 4XFZA 4U0BA 3NTEA 3DS3A 4U0EA 3VRLC 1A8OA 2JYGA 3DPHA 4WYMA 4PH0A 4QNBA 5HGNA 3DS5A 3G0VA 3G26A 5HGLA 4U0AA 1EIAA 3DTJA
chains in the Genus database with same CATH superfamily
5HGOA 4H2XC 1K9MQ 3G28A 5CZDB 2X2BA 1M1KQ 2M5RA 1MZ8A 1T8KA 2KGCA 2LF4A 1HQBA 2FACA 1VQ9P 4H2YC 1D1DA 5F2NA 2L9FA 2CNRA 3G0VA 3G26A 3CCSP 1EIAA 4XFYA 3CCQP 4U0FA 2K92A 2LKIA 2Z46A 2L0QA 1VQMP 2L6EA 2BUOA 1Z6MA 2JO0A 4WYMA 2LOLA 1M74A 3CCEP 2GZFA 2MY5A 1YITP 2FVEA 1YJWP 1KQSO 2FQ2A 2GZEA 2KGDA 5HGMA 1VQKP 5I4TG 1EMVA 2ONTA 5F2OA 5BS2A 2PENA 1IMPA 2KOOA 1N8RQ 2JYGA 4PH0A 2CGQA 3HYBA 4H2WC 4R0MA 5HVCA 1VQ6P 4COPA 2KG8A 2GYKA 3CXCO 5KP8B 1BAJA 2K94A 5KP7B 2WPTA 2KOQA 3WBHA 2K0DX 3EJEA 2FVFA 4QNBA 4IZ6A 2K5XA 2KW2A 2N5IA 1ZNVA 5KP6B 2QA4P 1VKUA 1IUQA 2XT1A 2MVUA 2PEJA 2JU1A 1KC8Q 2EG5A 4PH1A 1VQ7P 3G71P 3GZMA 4U0BA 1X3OA 2BHVA 3VRLC 2N50A 3RG6C 5EJDA 3E2DA 3U43A 1F80D 4XFXA 3MGEA 3G1GA 2FHSC 2MVVA 1A43A 4NEOA 1VQ5P 3H47A 1UJZA 1Q86Q 2M8LA 4DG9A 2LIWA 5EW5E 3CMEP 4BPHA 1A8OA 2ERHA 2GDYA 3P05A 3LMOA 3CC2P 1KLPA 2JQ4A 2KORA 3G29A 3HZQA 1L0HA 1E6JP 1YJ9P 1NJIQ 1GPJA 2N6YA 2FQ0A 3GJNA 2KGEA 2KOPA 4GR2A 2PEOA 5HGNA 2JBGA 2PEQA 2GDXA 2PEKA 1K73Q 3G6EP 1ACPA 2GDWA 2KG9A 1BXIA 4M0IA 4XROA 4HKGA 1M6NA 1DV5A 1QRJA 2FVAA 2FADA 5F2KA 1HY8A 2JB0A 2MF4A 3I56P 3CE7A 1S72P 3DS5A 2LIUA 4U0AA 2PY8A 1QVGO 2XZ0D 2KR5A 4UHPB 2AFDA 3M1MA 2VSQA 2GZJA 3CMAP 3I55P 2E1MA 2JGPA 3G21A 2VLNA 7CEIA 2MR8A 3B4QA 2AVAA 2MR7A 2DGYA 2VLOA 1YIJP 1OR5A 1Q7YQ 3G4SP 1E0HA 3GZLA 2K2QA 2AFEA 2OTLP 1AYIA 2KG6A 1M6EX 2AF8A 1KD1Q 4PXHB 2K93A 1EOQA 2KOSA 2N5HA 3CCUP 3DS0A 3EJDA 3CCVP 1YI2P 2VLPA 3CCRP 2DNWA 4XRQA 2QNWA 3DS1A 3DS3A 4U0EA 3NY7B 3CD6P 2Z45A 2FQ1A 1JJ2O 3CC7P 2LMLA 1AF8A 1Q81Q 3DS2A 3CPWO 5DCKA 3H4EA 4PWVB 5HV8A 2ROQA 2LPKA 2N98A 2EFJA 2CWOA 3OW2O 1GXGA 2PEMA 1YJNP 1NQ4A 2XXMA 3B5IA 2KGAA 2EIAA 2KWLA 1IMQA 3G1IA 2L4BA 2M8PA 5JPAA 1AUMA 4IPYA 2OARA 3DS4A 1M90Q 2P9XA 3Q20A 5HGLA 2PNGA 4BPGA 3GKLC 3RG2A 1RO0A 2K0XA 2Z44A 2PEIA 2NO8A 2KODA 2LL8A 1L0IA 1Q82Q 4COCA 4QKOA 1RO2A 3NTEA 2CQ8A 2CG5B 1VQOP 2GZIA 3DPHA 3EJBA 4GR6A 3CCMP 1VQ4P 1VQ8P 1VQNP 3CCLP 2EHSA 2MD9A 2JAZA 1RNIA 2K0YA 1QVFO 1FR2A 2XV6A 1W2BO 1DNYA 2LTEA 3DTJA 4CA3A 2JYLA 4U0DA 2L22A 1ZMBA 3CCJP 1VQLP 1UNKA 3CC4P 2GZGA 1GXHA 1K30A 2FAEA 2M8NA 1YHQP 4U0CA 3LRYA 1CEIA 1VHNA 2N6ZA 1VQPP 2EHTA 2VLQA 2QEXP 4F37A 5BS1A 2XZ1C 3H0DA 4MRTC 4BPFA 4XFZA 2JU2A 1K8AQ 2OTJP
chains in the Genus database with same CATH topology
1QVGO 5HGOA 3M1MA 1RO0A 2Z44A 2PEIA 3CMAP 3G28A 1K9MQ 2KODA 1Q82Q 3I55P 2E1MA 2QA4P 1M1KQ 1IUQA 2XT1A 3G21A 2PEJA 4COCA 2LF4A 1KC8Q 2EG5A 4PH1A 1VQ9P 1VQ7P 3G71P 1D1DA 4U0BA 1RO2A 3NTEA 5F2NA 1VQOP 2OTJP 2BHVA 3VRLC 2DGYA 3DPHA 1YIJP 1Q7YQ 3G4SP 4GR6A 3G0VA 3G26A 3CCMP 3CCSP 3RG6C 1EIAA 1VQ4P 4XFYA 2OTLP 3E2DA 3CCQP 4U0FA 1VQ8P 1VQNP 1M6EX 3CCLP 4XFXA 3MGEA 1KD1Q 1EOQA 3G1GA 3CCUP 3DS0A 1A43A 2Z46A 1RNIA 1VQ5P 3CCVP 1YI2P 1QVFO 1VQMP 3CCRP 3H47A 2L6EA 2XV6A 2BUOA 2JO0A 4XRQA 1W2BO 1Q86Q 3DS1A 2M8LA 3CMEP 3DS3A 4U0EA 3CD6P 1A8OA 2Z45A 4WYMA 1JJ2O 3CC7P 1M74A 3CCEP 3P05A 3CC2P 3DTJA 1Q81Q 3G29A 1YITP 3DS2A 3HZQA 3CPWO 2JYLA 4U0DA 1YJWP 1E6JP 1KQSO 1YJ9P 5DCKA 1ZMBA 3H4EA 1NJIQ 3CCJP 5HGMA 1VQKP 1VQLP 5I4TG 3CC4P 2ONTA 5F2OA 2EFJA 4GR2A 5BS2A 2PENA 1K30A 1N8RQ 2CWOA 2JYGA 2PEOA 4PH0A 3OW2O 5HGNA 2PEQA 3HYBA 2PEMA 1YJNP 2PEKA 1K73Q 1VQ6P 4COPA 2M8NA 2XXMA 3G6EP 3B5IA 1YHQP 4U0CA 3LRYA 2EIAA 4M0IA 4XROA 3CXCO 3G1IA 1BAJA 1M6NA 1QRJA 2M8PA 1VQPP 5JPAA 1AUMA 4IPYA 3WBHA 2OARA 5F2KA 3DS4A 2QEXP 5BS1A 3H0DA 3I56P 4XFZA 1S72P 1M90Q 2P9XA 4QNBA 1K8AQ 3DS5A 3Q20A 5HGLA 4U0AA 2PY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFY A;  2M8N A;  2XXM A;  3G29 A;  5HGO A;  3DS2 A;  4U0F A;  4U0C A;  3LRY A;  2EIA A;  4M0I A;  2JYL A;  4U0D A;  4XFX A;  3G28 A;  3MGE A;  2KOD A;  1EOQ A;  1E6J P;  3G1G A;  3G1I A;  3DS0 A;  4XRO A;  1A43 A;  5DCK A;  1BAJ A;  3P05 A;  3H4E A;  1QRJ A;  2M8P A;  5HGM A;  2XT1 A;  3G21 A;  5JPA A;  1AUM A;  4IPY A;  3H47 A;  2L6E A;  2XV6 A;  4COC A;  4COP A;  3DS4 A;  2BUO A;  2LF4 A;  5I4T G;  2JO0 A;  4XRQ A;  4PH1 A;  3DS1 A;  2M8L A;  2ONT A;  1D1D A;  4XFZ A;  4U0B A;  3NTE A;  3DS3 A;  4U0E A;  3VRL C;  1A8O A;  2JYG A;  3DPH A;  4WYM A;  4PH0 A;  4QNB A;  5HGN A;  3DS5 A;  3G0V A;  3G26 A;  5HGL A;  4U0A A;  1EIA A;  3DTJ A; 
#chains in the Genus database with same CATH topology
 5HGO A;  4H2X C;  1K9M Q;  3G28 A;  5CZD B;  2X2B A;  1M1K Q;  2M5R A;  1MZ8 A;  1T8K A;  2KGC A;  2LF4 A;  1HQB A;  2FAC A;  1VQ9 P;  4H2Y C;  1D1D A;  5F2N A;  2L9F A;  2CNR A;  3G0V A;  3G26 A;  3CCS P;  1EIA A;  4XFY A;  3CCQ P;  4U0F A;  2K92 A;  2LKI A;  2Z46 A;  2L0Q A;  1VQM P;  2L6E A;  2BUO A;  1Z6M A;  2JO0 A;  4WYM A;  2LOL A;  1M74 A;  3CCE P;  2GZF A;  2MY5 A;  1YIT P;  2FVE A;  1YJW P;  1KQS O;  2FQ2 A;  2GZE A;  2KGD A;  5HGM A;  1VQK P;  5I4T G;  1EMV A;  2ONT A;  5F2O A;  5BS2 A;  2PEN A;  1IMP A;  2KOO A;  1N8R Q;  2JYG A;  4PH0 A;  2CGQ A;  3HYB A;  4H2W C;  4R0M A;  5HVC A;  1VQ6 P;  4COP A;  2KG8 A;  2GYK A;  3CXC O;  5KP8 B;  1BAJ A;  2K94 A;  5KP7 B;  2WPT A;  2KOQ A;  3WBH A;  2K0D X;  3EJE A;  2FVF A;  4QNB A;  4IZ6 A;  2K5X A;  2KW2 A;  2N5I A;  1ZNV A;  5KP6 B;  2QA4 P;  1VKU A;  1IUQ A;  2XT1 A;  2MVU A;  2PEJ A;  2JU1 A;  1KC8 Q;  2EG5 A;  4PH1 A;  1VQ7 P;  3G71 P;  3GZM A;  4U0B A;  1X3O A;  2BHV A;  3VRL C;  2N50 A;  3RG6 C;  5EJD A;  3E2D A;  3U43 A;  1F80 D;  4XFX A;  3MGE A;  3G1G A;  2FHS C;  2MVV A;  1A43 A;  4NEO A;  1VQ5 P;  3H47 A;  1UJZ A;  1Q86 Q;  2M8L A;  4DG9 A;  2LIW A;  5EW5 E;  3CME P;  4BPH A;  1A8O A;  2ERH A;  2GDY A;  3P05 A;  3LMO A;  3CC2 P;  1KLP A;  2JQ4 A;  2KOR A;  3G29 A;  3HZQ A;  1L0H A;  1E6J P;  1YJ9 P;  1NJI Q;  1GPJ A;  2N6Y A;  2FQ0 A;  3GJN A;  2KGE A;  2KOP A;  4GR2 A;  2PEO A;  5HGN A;  2JBG A;  2PEQ A;  2GDX A;  2PEK A;  1K73 Q;  3G6E P;  1ACP A;  2GDW A;  2KG9 A;  1BXI A;  4M0I A;  4XRO A;  4HKG A;  1M6N A;  1DV5 A;  1QRJ A;  2FVA A;  2FAD A;  5F2K A;  1HY8 A;  2JB0 A;  2MF4 A;  3I56 P;  3CE7 A;  1S72 P;  3DS5 A;  2LIU A;  4U0A A;  2PY8 A;  1QVG O;  2XZ0 D;  2KR5 A;  4UHP B;  2AFD A;  3M1M A;  2VSQ A;  2GZJ A;  3CMA P;  3I55 P;  2E1M A;  2JGP A;  3G21 A;  2VLN A;  7CEI A;  2MR8 A;  3B4Q A;  2AVA A;  2MR7 A;  2DGY A;  2VLO A;  1YIJ P;  1OR5 A;  1Q7Y Q;  3G4S P;  1E0H A;  3GZL A;  2K2Q A;  2AFE A;  2OTL P;  1AYI A;  2KG6 A;  1M6E X;  2AF8 A;  1KD1 Q;  4PXH B;  2K93 A;  1EOQ A;  2KOS A;  2N5H A;  3CCU P;  3DS0 A;  3EJD A;  3CCV P;  1YI2 P;  2VLP A;  3CCR P;  2DNW A;  4XRQ A;  2QNW A;  3DS1 A;  3DS3 A;  4U0E A;  3NY7 B;  3CD6 P;  2Z45 A;  2FQ1 A;  1JJ2 O;  3CC7 P;  2LML A;  1AF8 A;  1Q81 Q;  3DS2 A;  3CPW O;  5DCK A;  3H4E A;  4PWV B;  5HV8 A;  2ROQ A;  2LPK A;  2N98 A;  2EFJ A;  2CWO A;  3OW2 O;  1GXG A;  2PEM A;  1YJN P;  1NQ4 A;  2XXM A;  3B5I A;  2KGA A;  2EIA A;  2KWL A;  1IMQ A;  3G1I A;  2L4B A;  2M8P A;  5JPA A;  1AUM A;  4IPY A;  2OAR A;  3DS4 A;  1M90 Q;  2P9X A;  3Q20 A;  5HGL A;  2PNG A;  4BPG A;  3GKL C;  3RG2 A;  1RO0 A;  2K0X A;  2Z44 A;  2PEI A;  2NO8 A;  2KOD A;  2LL8 A;  1L0I A;  1Q82 Q;  4COC A;  4QKO A;  1RO2 A;  3NTE A;  2CQ8 A;  2CG5 B;  1VQO P;  2GZI A;  3DPH A;  3EJB A;  4GR6 A;  3CCM P;  1VQ4 P;  1VQ8 P;  1VQN P;  3CCL P;  2EHS A;  2MD9 A;  2JAZ A;  1RNI A;  2K0Y A;  1QVF O;  1FR2 A;  2XV6 A;  1W2B O;  1DNY A;  2LTE A;  3DTJ A;  4CA3 A;  2JYL A;  4U0D A;  2L22 A;  1ZMB A;  3CCJ P;  1VQL P;  1UNK A;  3CC4 P;  2GZG A;  1GXH A;  1K30 A;  2FAE A;  2M8N A;  1YHQ P;  4U0C A;  3LRY A;  1CEI A;  1VHN A;  2N6Z A;  1VQP P;  2EHT A;  2VLQ A;  2QEX P;  4F37 A;  5BS1 A;  2XZ1 C;  3H0D A;  4MRT C;  4BPF A;  4XFZ A;  2JU2 A;  1K8A Q;  2OTJ P; 
#chains in the Genus database with same CATH homology
 1QVG O;  5HGO A;  3M1M A;  1RO0 A;  2Z44 A;  2PEI A;  3CMA P;  3G28 A;  1K9M Q;  2KOD A;  1Q82 Q;  3I55 P;  2E1M A;  2QA4 P;  1M1K Q;  1IUQ A;  2XT1 A;  3G21 A;  2PEJ A;  4COC A;  2LF4 A;  1KC8 Q;  2EG5 A;  4PH1 A;  1VQ9 P;  1VQ7 P;  3G71 P;  1D1D A;  4U0B A;  1RO2 A;  3NTE A;  5F2N A;  1VQO P;  2OTJ P;  2BHV A;  3VRL C;  2DGY A;  3DPH A;  1YIJ P;  1Q7Y Q;  3G4S P;  4GR6 A;  3G0V A;  3G26 A;  3CCM P;  3CCS P;  3RG6 C;  1EIA A;  1VQ4 P;  4XFY A;  2OTL P;  3E2D A;  3CCQ P;  4U0F A;  1VQ8 P;  1VQN P;  1M6E X;  3CCL P;  4XFX A;  3MGE A;  1KD1 Q;  1EOQ A;  3G1G A;  3CCU P;  3DS0 A;  1A43 A;  2Z46 A;  1RNI A;  1VQ5 P;  3CCV P;  1YI2 P;  1QVF O;  1VQM P;  3CCR P;  3H47 A;  2L6E A;  2XV6 A;  2BUO A;  2JO0 A;  4XRQ A;  1W2B O;  1Q86 Q;  3DS1 A;  2M8L A;  3CME P;  3DS3 A;  4U0E A;  3CD6 P;  1A8O A;  2Z45 A;  4WYM A;  1JJ2 O;  3CC7 P;  1M74 A;  3CCE P;  3P05 A;  3CC2 P;  3DTJ A;  1Q81 Q;  3G29 A;  1YIT P;  3DS2 A;  3HZQ A;  3CPW O;  2JYL A;  4U0D A;  1YJW P;  1E6J P;  1KQS O;  1YJ9 P;  5DCK A;  1ZMB A;  3H4E A;  1NJI Q;  3CCJ P;  5HGM A;  1VQK P;  1VQL P;  5I4T G;  3CC4 P;  2ONT A;  5F2O A;  2EFJ A;  4GR2 A;  5BS2 A;  2PEN A;  1K30 A;  1N8R Q;  2CWO A;  2JYG A;  2PEO A;  4PH0 A;  3OW2 O;  5HGN A;  2PEQ A;  3HYB A;  2PEM A;  1YJN P;  2PEK A;  1K73 Q;  1VQ6 P;  4COP A;  2M8N A;  2XXM A;  3G6E P;  3B5I A;  1YHQ P;  4U0C A;  3LRY A;  2EIA A;  4M0I A;  4XRO A;  3CXC O;  3G1I A;  1BAJ A;  1M6N A;  1QRJ A;  2M8P A;  1VQP P;  5JPA A;  1AUM A;  4IPY A;  3WBH A;  2OAR A;  5F2K A;  3DS4 A;  2QEX P;  5BS1 A;  3H0D A;  3I56 P;  4XFZ A;  1S72 P;  1M90 Q;  2P9X A;  4QNB A;  1K8A Q;  3DS5 A;  3Q20 A;  5HGL A;  4U0A A;  2PY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...