1AUMA

Hiv capsid c-terminal domain (cac146)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
LDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV CAPSID
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1aumA00
4M0IA 4COPA 3G1GA 2JYGA 4WYMA 5I4TG 3DS5A 3VRLC 4U0EA 3G0VA 3DS3A 1BAJA 4XFXA 3DS0A 5HGMA 3P05A 5JPAA 1AUMA 1EIAA 4PH1A 4U0CA 3DS1A 4PH0A 4QNBA 5HGNA 3H47A 4U0FA 5HGLA 4COCA 3G1IA 3G26A 2XT1A 2XV6A 2LF4A 2KODA 1A43A 2EIAA 2JYLA 2BUOA 3H4EA 4U0AA 4XRQA 4XROA 5DCKA 2M8LA 3DS4A 4U0BA 3DS2A 3LRYA 4IPYA 5HGOA 3DPHA 2JO0A 3G29A 3DTJA 4XFYA 2L6EA 2M8PA 3MGEA 2ONTA 1E6JP 3G21A 1A8OA 4U0DA 1D1DA 1QRJA 1EOQA 3NTEA 2M8NA 3G28A 4XFZA 2XXMA
chains in the Genus database with same CATH superfamily
2WPTA 3G1GA 1RNIA 2CNRA 2FVEA 1YHQP 4PXHB 1M6EX 1AUMA 4UHPB 1KLPA 2KODA 4XRQA 2ROQA 3GZLA 2L22A 1KC8Q 1A8OA 2Z46A 1QRJA 1EOQA 1Z6MA 1D1DA 3G28A 2XZ0D 2NO8A 5BS2A 2MR7A 3B4QA 1IUQA 3E2DA 1BAJA 3DS0A 2N5HA 1VQKP 3CD6P 2KGAA 2PEKA 1VQOP 1DV5A 2MY5A 4QKOA 4XFYA 1RO0A 2KG9A 3CCLP 2LIUA 2PEJA 2FHSC 1MZ8A 4WYMA 5KP6B 3GZMA 4XFXA 2FQ2A 1VQ6P 2LL8A 2N6YA 2QA4P 1K8AQ 2KORA 4U0AA 1VQ7P 1FR2A 5HVCA 5KP7B 1Q7YQ 2DGYA 3NTEA 3Q20A 3EJEA 2AFEA 3CCMP 2FACA 2MR8A 2XXMA 2PNGA 3I55P 3G0VA 5JPAA 1ZNVA 4PH1A 2FAEA 3G26A 2XV6A 2LF4A 2DNWA 2L0QA 2BHVA 1IMPA 2JU1A 1BXIA 2K2QA 2PY8A 2K5XA 2PEMA 2EFJA 3DS3A 2EHTA 2K0XA 3CCQP 3H47A 2FVAA 3M1MA 2EIAA 1VQMP 2KWLA 5KP8B 3DPHA 4BPFA 2N50A 1VQPP 2ONTA 2M5RA 1UNKA 2VSQA 4U0DA 2KW2A 1S72P 2VLPA 2KOOA 2GZEA 4XFZA 1Q81Q 3CCUP 3GKLC 2L4BA 4BPGA 1VQNP 3CE7A 1YJNP 1L0IA 2KGCA 2JYLA 2VLQA 2VLNA 3G71P 2L9FA 2L6EA 2AF8A 2KGEA 2LIWA 1YJWP 2LMLA 2QNWA 2N5IA 1VKUA 1M90Q 2XZ1C 1AF8A 5HV8A 3CCEP 4NEOA 1L0HA 2CWOA 1W2BO 1OR5A 2FQ0A 3DS2A 5F2NA 2K0DX 3OW2O 2M8PA 3MGEA 5EW5E 5BS1A 2LTEA 5CZDB 2JYGA 2CGQA 1EIAA 3CXCO 1CEIA 3H0DA 2EG5A 2N98A 1YIJP 5DCKA 1K73Q 1M74A 3HYBA 4IPYA 2GZFA 2MF4A 2MD9A 2KR5A 2K92A 2AFDA 3NY7B 5F2KA 3HZQA 1EMVA 2JQ4A 5HGLA 3EJBA 3GJNA 2BUOA 3H4EA 4F37A 2LOLA 1VHNA 3CC7P 1E6JP 3G21A 4IZ6A 3G4SP 2MVUA 1KQSO 2KOSA 1RO2A 2KG8A 1GXHA 1VQ9P 2JAZA 2PEQA 4H2XC 2PENA 1NJIQ 2LKIA 4XROA 2M8LA 4GR6A 1KD1Q 2ERHA 2GZJA 3DTJA 4DG9A 2K94A 4GR2A 2OTJP 2Z45A 1NQ4A 1YJ9P 3CCRP 1GPJA 2K93A 2EHSA 1ZMBA 2CQ8A 4PWVB 3CCSP 4MRTC 2GZIA 3DS4A 2VLOA 1F80D 4R0MA 2AVAA 1VQ8P 2JU2A 1GXGA 1YITP 4HKGA 1HQBA 5I4TG 1UJZA 4U0EA 3G6EP 2JB0A 3P05A 1YI2P 2FVFA 2QEXP 3DS1A 5F2OA 1VQ5P 1E0HA 2FQ1A 3I56P 4CA3A 2OARA 5EJDA 7CEIA 1T8KA 2CG5B 3DS5A 3EJDA 3G1IA 2JBGA 2E1MA 2K0YA 3WBHA 1K30A 3CPWO 1X3OA 2KOQA 2KOPA 3U43A 2KGDA 3VRLC 1N8RQ 3RG6C 3CC4P 5HGMA 1VQ4P 4U0FA 3CCJP 1M1KQ 1M6NA 3G29A 2GDXA 1ACPA 2KG6A 2M8NA 2GZGA 4M0IA 4H2WC 2OTLP 2N6ZA 1Q82Q 1AYIA 3CMEP 1JJ2O 1QVFO 4QNBA 5HGNA 3RG2A 4COCA 2MVVA 1A43A 1IMQA 4BPHA 2FADA 2P9XA 1K9MQ 5HGOA 1HY8A 2PEOA 2JO0A 1VQLP 2LPKA 3B5IA 3CCVP 2PEIA 3LMOA 4COPA 2GYKA 2JGPA 3CMAP 1DNYA 4PH0A 4U0CA 2Z44A 4H2YC 2XT1A 4U0BA 3LRYA 2GDWA 2X2BA 1Q86Q 1QVGO 3CC2P 2GDYA
chains in the Genus database with same CATH topology
3G1GA 1RNIA 3DS5A 1YHQP 2EFJA 3DS3A 5F2KA 1M6EX 1AUMA 3HZQA 3CCQP 3H47A 5HGLA 3G1IA 2E1MA 3M1MA 2KODA 4XRQA 2EIAA 3WBHA 2BUOA 3H4EA 1K30A 1VQMP 3CPWO 3DPHA 3CC7P 1VQPP 2ONTA 1E6JP 1KC8Q 3G21A 1A8OA 4U0DA 3G4SP 2Z46A 1QRJA 1EOQA 1S72P 1D1DA 3G28A 1KQSO 4XFZA 1Q81Q 5BS2A 1RO2A 3CCUP 3VRLC 1N8RQ 3RG6C 3CC4P 1IUQA 3E2DA 1VQ9P 1BAJA 1VQNP 3DS0A 5HGMA 2PEQA 2PENA 1YJNP 1VQ4P 4U0FA 1VQKP 1NJIQ 3CCJP 3CD6P 4XROA 2JYLA 2M8LA 4GR6A 2PEKA 1M1KQ 1KD1Q 1VQOP 1M6NA 3G71P 3G29A 3DTJA 4XFYA 2L6EA 1RO0A 4GR2A 2OTJP 2Z45A 1YJ9P 2M8NA 3CCLP 3CCRP 1YJWP 1ZMBA 4M0IA 2PEJA 4WYMA 2OTLP 1Q82Q 3CMEP 4XFXA 1JJ2O 1QVFO 3CCSP 1M90Q 4QNBA 1VQ6P 5HGNA 4COCA 2QA4P 1K8AQ 3CCEP 1A43A 4U0AA 2CWOA 3DS4A 2P9XA 3DS2A 5F2NA 5HGOA 1W2BO 2PEOA 1K9MQ 2JO0A 1VQ7P 1VQLP 3OW2O 2M8PA 3MGEA 3B5IA 1Q7YQ 3CCVP 1VQ8P 2DGYA 2PEIA 3NTEA 3Q20A 5BS1A 3CCMP 1YITP 2XXMA 4COPA 2JYGA 5I4TG 3CMAP 3I55P 4U0EA 3G6EP 3G0VA 3P05A 1YI2P 5JPAA 1EIAA 4PH0A 4PH1A 4U0CA 3DS1A 3CXCO 2QEXP 2Z44A 5F2OA 3H0DA 1VQ5P 2EG5A 2XT1A 2XV6A 2LF4A 3G26A 1YIJP 5DCKA 1K73Q 1M74A 3I56P 3HYBA 4U0BA 3LRYA 4IPYA 3CC2P 1QVGO 1Q86Q 2BHVA 2OARA 2PY8A 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M0I A;  4COP A;  3G1G A;  2JYG A;  4WYM A;  5I4T G;  3DS5 A;  3VRL C;  4U0E A;  3G0V A;  3DS3 A;  1BAJ A;  4XFX A;  3DS0 A;  5HGM A;  3P05 A;  5JPA A;  1AUM A;  1EIA A;  4PH1 A;  4U0C A;  3DS1 A;  4PH0 A;  4QNB A;  5HGN A;  3H47 A;  4U0F A;  5HGL A;  4COC A;  3G1I A;  3G26 A;  2XT1 A;  2XV6 A;  2LF4 A;  2KOD A;  1A43 A;  2EIA A;  2JYL A;  2BUO A;  3H4E A;  4U0A A;  4XRQ A;  4XRO A;  5DCK A;  2M8L A;  3DS4 A;  4U0B A;  3DS2 A;  3LRY A;  4IPY A;  5HGO A;  3DPH A;  2JO0 A;  3G29 A;  3DTJ A;  4XFY A;  2L6E A;  2M8P A;  3MGE A;  2ONT A;  1E6J P;  3G21 A;  1A8O A;  4U0D A;  1D1D A;  1QRJ A;  1EOQ A;  3NTE A;  2M8N A;  3G28 A;  4XFZ A;  2XXM A; 
#chains in the Genus database with same CATH topology
 2WPT A;  3G1G A;  1RNI A;  2CNR A;  2FVE A;  1YHQ P;  4PXH B;  1M6E X;  1AUM A;  4UHP B;  1KLP A;  2KOD A;  4XRQ A;  2ROQ A;  3GZL A;  2L22 A;  1KC8 Q;  1A8O A;  2Z46 A;  1QRJ A;  1EOQ A;  1Z6M A;  1D1D A;  3G28 A;  2XZ0 D;  2NO8 A;  5BS2 A;  2MR7 A;  3B4Q A;  1IUQ A;  3E2D A;  1BAJ A;  3DS0 A;  2N5H A;  1VQK P;  3CD6 P;  2KGA A;  2PEK A;  1VQO P;  1DV5 A;  2MY5 A;  4QKO A;  4XFY A;  1RO0 A;  2KG9 A;  3CCL P;  2LIU A;  2PEJ A;  2FHS C;  1MZ8 A;  4WYM A;  5KP6 B;  3GZM A;  4XFX A;  2FQ2 A;  1VQ6 P;  2LL8 A;  2N6Y A;  2QA4 P;  1K8A Q;  2KOR A;  4U0A A;  1VQ7 P;  1FR2 A;  5HVC A;  5KP7 B;  1Q7Y Q;  2DGY A;  3NTE A;  3Q20 A;  3EJE A;  2AFE A;  3CCM P;  2FAC A;  2MR8 A;  2XXM A;  2PNG A;  3I55 P;  3G0V A;  5JPA A;  1ZNV A;  4PH1 A;  2FAE A;  3G26 A;  2XV6 A;  2LF4 A;  2DNW A;  2L0Q A;  2BHV A;  1IMP A;  2JU1 A;  1BXI A;  2K2Q A;  2PY8 A;  2K5X A;  2PEM A;  2EFJ A;  3DS3 A;  2EHT A;  2K0X A;  3CCQ P;  3H47 A;  2FVA A;  3M1M A;  2EIA A;  1VQM P;  2KWL A;  5KP8 B;  3DPH A;  4BPF A;  2N50 A;  1VQP P;  2ONT A;  2M5R A;  1UNK A;  2VSQ A;  4U0D A;  2KW2 A;  1S72 P;  2VLP A;  2KOO A;  2GZE A;  4XFZ A;  1Q81 Q;  3CCU P;  3GKL C;  2L4B A;  4BPG A;  1VQN P;  3CE7 A;  1YJN P;  1L0I A;  2KGC A;  2JYL A;  2VLQ A;  2VLN A;  3G71 P;  2L9F A;  2L6E A;  2AF8 A;  2KGE A;  2LIW A;  1YJW P;  2LML A;  2QNW A;  2N5I A;  1VKU A;  1M90 Q;  2XZ1 C;  1AF8 A;  5HV8 A;  3CCE P;  4NEO A;  1L0H A;  2CWO A;  1W2B O;  1OR5 A;  2FQ0 A;  3DS2 A;  5F2N A;  2K0D X;  3OW2 O;  2M8P A;  3MGE A;  5EW5 E;  5BS1 A;  2LTE A;  5CZD B;  2JYG A;  2CGQ A;  1EIA A;  3CXC O;  1CEI A;  3H0D A;  2EG5 A;  2N98 A;  1YIJ P;  5DCK A;  1K73 Q;  1M74 A;  3HYB A;  4IPY A;  2GZF A;  2MF4 A;  2MD9 A;  2KR5 A;  2K92 A;  2AFD A;  3NY7 B;  5F2K A;  3HZQ A;  1EMV A;  2JQ4 A;  5HGL A;  3EJB A;  3GJN A;  2BUO A;  3H4E A;  4F37 A;  2LOL A;  1VHN A;  3CC7 P;  1E6J P;  3G21 A;  4IZ6 A;  3G4S P;  2MVU A;  1KQS O;  2KOS A;  1RO2 A;  2KG8 A;  1GXH A;  1VQ9 P;  2JAZ A;  2PEQ A;  4H2X C;  2PEN A;  1NJI Q;  2LKI A;  4XRO A;  2M8L A;  4GR6 A;  1KD1 Q;  2ERH A;  2GZJ A;  3DTJ A;  4DG9 A;  2K94 A;  4GR2 A;  2OTJ P;  2Z45 A;  1NQ4 A;  1YJ9 P;  3CCR P;  1GPJ A;  2K93 A;  2EHS A;  1ZMB A;  2CQ8 A;  4PWV B;  3CCS P;  4MRT C;  2GZI A;  3DS4 A;  2VLO A;  1F80 D;  4R0M A;  2AVA A;  1VQ8 P;  2JU2 A;  1GXG A;  1YIT P;  4HKG A;  1HQB A;  5I4T G;  1UJZ A;  4U0E A;  3G6E P;  2JB0 A;  3P05 A;  1YI2 P;  2FVF A;  2QEX P;  3DS1 A;  5F2O A;  1VQ5 P;  1E0H A;  2FQ1 A;  3I56 P;  4CA3 A;  2OAR A;  5EJD A;  7CEI A;  1T8K A;  2CG5 B;  3DS5 A;  3EJD A;  3G1I A;  2JBG A;  2E1M A;  2K0Y A;  3WBH A;  1K30 A;  3CPW O;  1X3O A;  2KOQ A;  2KOP A;  3U43 A;  2KGD A;  3VRL C;  1N8R Q;  3RG6 C;  3CC4 P;  5HGM A;  1VQ4 P;  4U0F A;  3CCJ P;  1M1K Q;  1M6N A;  3G29 A;  2GDX A;  1ACP A;  2KG6 A;  2M8N A;  2GZG A;  4M0I A;  4H2W C;  2OTL P;  2N6Z A;  1Q82 Q;  1AYI A;  3CME P;  1JJ2 O;  1QVF O;  4QNB A;  5HGN A;  3RG2 A;  4COC A;  2MVV A;  1A43 A;  1IMQ A;  4BPH A;  2FAD A;  2P9X A;  1K9M Q;  5HGO A;  1HY8 A;  2PEO A;  2JO0 A;  1VQL P;  2LPK A;  3B5I A;  3CCV P;  2PEI A;  3LMO A;  4COP A;  2GYK A;  2JGP A;  3CMA P;  1DNY A;  4PH0 A;  4U0C A;  2Z44 A;  4H2Y C;  2XT1 A;  4U0B A;  3LRY A;  2GDW A;  2X2B A;  1Q86 Q;  1QVG O;  3CC2 P;  2GDY A; 
#chains in the Genus database with same CATH homology
 3G1G A;  1RNI A;  3DS5 A;  1YHQ P;  2EFJ A;  3DS3 A;  5F2K A;  1M6E X;  1AUM A;  3HZQ A;  3CCQ P;  3H47 A;  5HGL A;  3G1I A;  2E1M A;  3M1M A;  2KOD A;  4XRQ A;  2EIA A;  3WBH A;  2BUO A;  3H4E A;  1K30 A;  1VQM P;  3CPW O;  3DPH A;  3CC7 P;  1VQP P;  2ONT A;  1E6J P;  1KC8 Q;  3G21 A;  1A8O A;  4U0D A;  3G4S P;  2Z46 A;  1QRJ A;  1EOQ A;  1S72 P;  1D1D A;  3G28 A;  1KQS O;  4XFZ A;  1Q81 Q;  5BS2 A;  1RO2 A;  3CCU P;  3VRL C;  1N8R Q;  3RG6 C;  3CC4 P;  1IUQ A;  3E2D A;  1VQ9 P;  1BAJ A;  1VQN P;  3DS0 A;  5HGM A;  2PEQ A;  2PEN A;  1YJN P;  1VQ4 P;  4U0F A;  1VQK P;  1NJI Q;  3CCJ P;  3CD6 P;  4XRO A;  2JYL A;  2M8L A;  4GR6 A;  2PEK A;  1M1K Q;  1KD1 Q;  1VQO P;  1M6N A;  3G71 P;  3G29 A;  3DTJ A;  4XFY A;  2L6E A;  1RO0 A;  4GR2 A;  2OTJ P;  2Z45 A;  1YJ9 P;  2M8N A;  3CCL P;  3CCR P;  1YJW P;  1ZMB A;  4M0I A;  2PEJ A;  4WYM A;  2OTL P;  1Q82 Q;  3CME P;  4XFX A;  1JJ2 O;  1QVF O;  3CCS P;  1M90 Q;  4QNB A;  1VQ6 P;  5HGN A;  4COC A;  2QA4 P;  1K8A Q;  3CCE P;  1A43 A;  4U0A A;  2CWO A;  3DS4 A;  2P9X A;  3DS2 A;  5F2N A;  5HGO A;  1W2B O;  2PEO A;  1K9M Q;  2JO0 A;  1VQ7 P;  1VQL P;  3OW2 O;  2M8P A;  3MGE A;  3B5I A;  1Q7Y Q;  3CCV P;  1VQ8 P;  2DGY A;  2PEI A;  3NTE A;  3Q20 A;  5BS1 A;  3CCM P;  1YIT P;  2XXM A;  4COP A;  2JYG A;  5I4T G;  3CMA P;  3I55 P;  4U0E A;  3G6E P;  3G0V A;  3P05 A;  1YI2 P;  5JPA A;  1EIA A;  4PH0 A;  4PH1 A;  4U0C A;  3DS1 A;  3CXC O;  2QEX P;  2Z44 A;  5F2O A;  3H0D A;  1VQ5 P;  2EG5 A;  2XT1 A;  2XV6 A;  2LF4 A;  3G26 A;  1YIJ P;  5DCK A;  1K73 Q;  1M74 A;  3I56 P;  3HYB A;  4U0B A;  3LRY A;  4IPY A;  3CC2 P;  1QVG O;  1Q86 Q;  2BHV A;  2OAR A;  2PY8 A;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...