1AUMA

Hiv capsid c-terminal domain (cac146)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
LDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV CAPSID
publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1aumA00
1A8OA 4U0DA 3G1GA 1BAJA 4U0EA 3DTJA 3MGEA 4U0AA 3NTEA 4U0CA 1A43A 2JO0A 2XT1A 2M8PA 2KODA 2M8NA 1E6JP 1EOQA 5HGOA 5HGMA 3DS2A 4XROA 4U0FA 1EIAA 2XV6A 3DS0A 2M8LA 4PH0A 3H4EA 1QRJA 4WYMA 3DS3A 4QNBA 4COCA 3LRYA 4IPYA 5HGNA 3G21A 2JYGA 2L6EA 5I4TG 3G28A 3G29A 3DS5A 2XXMA 4XFZA 4U0BA 3G0VA 2BUOA 3DPHA 3G26A 3VRLC 3DS1A 4XFXA 2JYLA 4XRQA 3G1IA 4M0IA 1AUMA 2EIAA 2LF4A 3DS4A 4XFYA 5DCKA 4PH1A 3P05A 5HGLA 4COPA 5JPAA 2ONTA 3H47A 1D1DA
chains in the Genus database with same CATH superfamily
5EJDA 2KGAA 1IMPA 2FACA 3HYBA 2EHTA 3DS2A 1FR2A 2XV6A 3DS3A 2GDWA 1S72P 2ERHA 3G0VA 5HVCA 3G1IA 4PXHB 1RO0A 3NTEA 2KW2A 3I55P 2KOSA 2LKIA 1EIAA 2GDYA 4QKOA 1K73Q 3G21A 2L6EA 3HZQA 2MVUA 1GXHA 2X2BA 1YI2P 4XRQA 5HV8A 1AUMA 1VQ6P 3H47A 1VQNP 2LTEA 4U0CA 2GYKA 1IMQA 2KOQA 3G4SP 3CCLP 4NEOA 2EHSA 1KQSO 1CEIA 2GDXA 3DS0A 2VLQA 4BPGA 2NO8A 5I4TG 4BPHA 3CCEP 2Z45A 3CD6P 2LOLA 4M0IA 4XFYA 3CCUP 3CCVP 3CC2P 2KGCA 1L0IA 3CXCO 2FADA 2GZJA 2JU1A 1VQLP 2K0XA 2FVAA 3U43A 3CCQP 4WYMA 2OARA 2OTLP 2AVAA 3G26A 3CPWO 5HGLA 2PEKA 2N6YA 4U0DA 1A43A 2LIUA 1E6JP 1KD1Q 1EOQA 2GZGA 2PEJA 4XROA 2PENA 3LMOA 1QRJA 4IPYA 2FQ0A 1Q82Q 1Z6MA 1HY8A 2XZ1C 2KGEA 2VLPA 4XFXA 2EFJA 2OTJP 4COPA 1F80D 2MR7A 1A8OA 1VQ5P 1BAJA 3MGEA 2MY5A 2XZ0D 1L0HA 1ACPA 4H2WC 1VQ4P 3EJDA 5HGNA 3CCSP 2KWLA 2MVVA 2VSQA 3DS1A 2K94A 1IUQA 3Q20A 4IZ6A 3G71P 2PEOA 2JBGA 3NY7B 2JO0A 2JB0A 1DV5A 5HGOA 1EMVA 1YHQP 1K9MQ 2Z46A 3H4EA 4XFZA 4U0BA 2KG9A 1Q7YQ 2FVEA 3VRLC 2JYLA 3DS4A 2ONTA 1KLPA 3CCRP 2KORA 3DTJA 4GR6A 2KOPA 5F2KA 2L22A 1UJZA 1W2BO 3CMEP 1VQMP 3CC4P 2LPKA 2MR8A 4F37A 2N6ZA 1NJIQ 2FHSC 2MD9A 2N5HA 2LF4A 3RG2A 1VQ8P 1E0HA 2GZIA 5KP7B 3OW2O 2KR5A 3EJBA 2K5XA 4PH0A 4UHPB 2CQ8A 2L9FA 3GZMA 1VQKP 1HQBA 2XXMA 4H2XC 2PEIA 2EIAA 2LL8A 4PH1A 2FQ2A 3B5IA 1VHNA 3M1MA 2K0DX 4CA3A 2QNWA 2N50A 2CWOA 1RNIA 2N98A 2KG6A 2KOOA 2N5IA 1Q86Q 1DNYA 2FVFA 1M90Q 1Q81Q 1D1DA 1KC8Q 1M6EX 3GJNA 4U0AA 1GXGA 1VQPP 1K30A 2XT1A 1VQ9P 2KG8A 1QVFO 5KP6B 3CE7A 2Z44A 2JYGA 5F2OA 3G28A 3DPHA 5EW5E 2FQ1A 2AF8A 2K92A 3RG6C 2CNRA 2PEQA 1YJWP 2WPTA 2CGQA 1AYIA 4QNBA 2LMLA 2DGYA 1VQOP 3P05A 4HKGA 2KGDA 1YIJP 1AF8A 1M6NA 1K8AQ 1GPJA 2JAZA 2JQ4A 2M5RA 2K2QA 1M1KQ 4GR2A 3CCMP 2DNWA 4H2YC 4R0MA 1BXIA 2BUOA 4BPFA 2JGPA 3B4QA 1M74A 3I56P 3CMAP 2AFEA 3GKLC 1YITP 1YJ9P 5KP8B 2M8PA 2JU2A 2M8NA 2L4BA 1NQ4A 3WBHA 3EJEA 3LRYA 1MZ8A 3G29A 2VLNA 2L0QA 2PEMA 2ROQA 2VLOA 5DCKA 2EG5A 2QEXP 1JJ2O 3E2DA 2BHVA 4MRTC 5CZDB 2E1MA 1ZMBA 3H0DA 3GZLA 5HGMA 1T8KA 5BS2A 2CG5B 1X3OA 2K0YA 2M8LA 1VKUA 2GZEA 3CC7P 2GZFA 5BS1A 3DS5A 3CCJP 7CEIA 2PNGA 5JPAA 1RO2A 1QVGO 2QA4P 2AFDA 3G6EP 1OR5A 4DG9A 3G1GA 4PWVB 4U0EA 2PY8A 1YJNP 2KODA 1VQ7P 1ZNVA 1N8RQ 4U0FA 2LIWA 4COCA 5F2NA 2P9XA 1UNKA 2MF4A 2FAEA 2K93A
chains in the Genus database with same CATH topology
4U0DA 1YIJP 1M6NA 1A43A 3HYBA 1K8AQ 1E6JP 1KD1Q 1EOQA 3OW2O 2PEJA 3DS2A 4XROA 1M1KQ 2PENA 2XV6A 4GR2A 3CCMP 4PH0A 1QRJA 3DS3A 4IPYA 1VQKP 1Q82Q 1S72P 2XXMA 3G0VA 2BUOA 4XFXA 2EFJA 1M74A 3G1IA 2PEIA 2EIAA 2OTJP 4COPA 3I56P 4PH1A 3B5IA 1RO0A 3CMAP 1A8OA 1VQ5P 1BAJA 3M1MA 3MGEA 1YITP 3NTEA 3I55P 1YJ9P 2M8PA 2M8NA 3WBHA 1VQ4P 1EIAA 2CWOA 1RNIA 1K73Q 3LRYA 5HGNA 3CCSP 3G21A 2L6EA 3HZQA 3G29A 1Q86Q 1M90Q 3DS1A 2PEMA 1YI2P 1Q81Q 4XRQA 5DCKA 1KC8Q 1AUMA 2EG5A 1M6EX 2QEXP 1D1DA 1VQ6P 1IUQA 1JJ2O 3Q20A 3H47A 3E2DA 3G71P 1VQNP 2BHVA 2PEOA 2E1MA 1ZMBA 4U0AA 4U0CA 1VQPP 1K30A 3H0DA 2JO0A 2XT1A 1VQ9P 5HGOA 3G4SP 5HGMA 3CCLP 1KQSO 5BS2A 1QVFO 3DS0A 2M8LA 1YHQP 1K9MQ 2Z46A 3H4EA 3CC7P 2Z44A 2JYGA 5F2OA 5BS1A 5I4TG 3G28A 3CCEP 3DS5A 4XFZA 4U0BA 1Q7YQ 3DPHA 2Z45A 3CCJP 3VRLC 3CD6P 2JYLA 4M0IA 4XFYA 5JPAA 1RO2A 3DS4A 1QVGO 2ONTA 3RG6C 2QA4P 3CCRP 3G6EP 3G1GA 3CCUP 4U0EA 3DTJA 4GR6A 3CCVP 2PY8A 3CC2P 1YJNP 3CXCO 2KODA 2PEQA 5F2KA 1VQ7P 1YJWP 1VQLP 1N8RQ 1W2BO 4U0FA 3CMEP 1VQMP 3CC4P 3CCQP 4WYMA 2OARA 4QNBA 4COCA 2OTLP 1NJIQ 5F2NA 2DGYA 3G26A 2P9XA 3CPWO 5HGLA 2LF4A 2PEKA 1VQOP 1VQ8P 3P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8O A;  4U0D A;  3G1G A;  1BAJ A;  4U0E A;  3DTJ A;  3MGE A;  4U0A A;  3NTE A;  4U0C A;  1A43 A;  2JO0 A;  2XT1 A;  2M8P A;  2KOD A;  2M8N A;  1E6J P;  1EOQ A;  5HGO A;  5HGM A;  3DS2 A;  4XRO A;  4U0F A;  1EIA A;  2XV6 A;  3DS0 A;  2M8L A;  4PH0 A;  3H4E A;  1QRJ A;  4WYM A;  3DS3 A;  4QNB A;  4COC A;  3LRY A;  4IPY A;  5HGN A;  3G21 A;  2JYG A;  2L6E A;  5I4T G;  3G28 A;  3G29 A;  3DS5 A;  2XXM A;  4XFZ A;  4U0B A;  3G0V A;  2BUO A;  3DPH A;  3G26 A;  3VRL C;  3DS1 A;  4XFX A;  2JYL A;  4XRQ A;  3G1I A;  4M0I A;  1AUM A;  2EIA A;  2LF4 A;  3DS4 A;  4XFY A;  5DCK A;  4PH1 A;  3P05 A;  5HGL A;  4COP A;  5JPA A;  2ONT A;  3H47 A;  1D1D A; 
#chains in the Genus database with same CATH topology
 5EJD A;  2KGA A;  1IMP A;  2FAC A;  3HYB A;  2EHT A;  3DS2 A;  1FR2 A;  2XV6 A;  3DS3 A;  2GDW A;  1S72 P;  2ERH A;  3G0V A;  5HVC A;  3G1I A;  4PXH B;  1RO0 A;  3NTE A;  2KW2 A;  3I55 P;  2KOS A;  2LKI A;  1EIA A;  2GDY A;  4QKO A;  1K73 Q;  3G21 A;  2L6E A;  3HZQ A;  2MVU A;  1GXH A;  2X2B A;  1YI2 P;  4XRQ A;  5HV8 A;  1AUM A;  1VQ6 P;  3H47 A;  1VQN P;  2LTE A;  4U0C A;  2GYK A;  1IMQ A;  2KOQ A;  3G4S P;  3CCL P;  4NEO A;  2EHS A;  1KQS O;  1CEI A;  2GDX A;  3DS0 A;  2VLQ A;  4BPG A;  2NO8 A;  5I4T G;  4BPH A;  3CCE P;  2Z45 A;  3CD6 P;  2LOL A;  4M0I A;  4XFY A;  3CCU P;  3CCV P;  3CC2 P;  2KGC A;  1L0I A;  3CXC O;  2FAD A;  2GZJ A;  2JU1 A;  1VQL P;  2K0X A;  2FVA A;  3U43 A;  3CCQ P;  4WYM A;  2OAR A;  2OTL P;  2AVA A;  3G26 A;  3CPW O;  5HGL A;  2PEK A;  2N6Y A;  4U0D A;  1A43 A;  2LIU A;  1E6J P;  1KD1 Q;  1EOQ A;  2GZG A;  2PEJ A;  4XRO A;  2PEN A;  3LMO A;  1QRJ A;  4IPY A;  2FQ0 A;  1Q82 Q;  1Z6M A;  1HY8 A;  2XZ1 C;  2KGE A;  2VLP A;  4XFX A;  2EFJ A;  2OTJ P;  4COP A;  1F80 D;  2MR7 A;  1A8O A;  1VQ5 P;  1BAJ A;  3MGE A;  2MY5 A;  2XZ0 D;  1L0H A;  1ACP A;  4H2W C;  1VQ4 P;  3EJD A;  5HGN A;  3CCS P;  2KWL A;  2MVV A;  2VSQ A;  3DS1 A;  2K94 A;  1IUQ A;  3Q20 A;  4IZ6 A;  3G71 P;  2PEO A;  2JBG A;  3NY7 B;  2JO0 A;  2JB0 A;  1DV5 A;  5HGO A;  1EMV A;  1YHQ P;  1K9M Q;  2Z46 A;  3H4E A;  4XFZ A;  4U0B A;  2KG9 A;  1Q7Y Q;  2FVE A;  3VRL C;  2JYL A;  3DS4 A;  2ONT A;  1KLP A;  3CCR P;  2KOR A;  3DTJ A;  4GR6 A;  2KOP A;  5F2K A;  2L22 A;  1UJZ A;  1W2B O;  3CME P;  1VQM P;  3CC4 P;  2LPK A;  2MR8 A;  4F37 A;  2N6Z A;  1NJI Q;  2FHS C;  2MD9 A;  2N5H A;  2LF4 A;  3RG2 A;  1VQ8 P;  1E0H A;  2GZI A;  5KP7 B;  3OW2 O;  2KR5 A;  3EJB A;  2K5X A;  4PH0 A;  4UHP B;  2CQ8 A;  2L9F A;  3GZM A;  1VQK P;  1HQB A;  2XXM A;  4H2X C;  2PEI A;  2EIA A;  2LL8 A;  4PH1 A;  2FQ2 A;  3B5I A;  1VHN A;  3M1M A;  2K0D X;  4CA3 A;  2QNW A;  2N50 A;  2CWO A;  1RNI A;  2N98 A;  2KG6 A;  2KOO A;  2N5I A;  1Q86 Q;  1DNY A;  2FVF A;  1M90 Q;  1Q81 Q;  1D1D A;  1KC8 Q;  1M6E X;  3GJN A;  4U0A A;  1GXG A;  1VQP P;  1K30 A;  2XT1 A;  1VQ9 P;  2KG8 A;  1QVF O;  5KP6 B;  3CE7 A;  2Z44 A;  2JYG A;  5F2O A;  3G28 A;  3DPH A;  5EW5 E;  2FQ1 A;  2AF8 A;  2K92 A;  3RG6 C;  2CNR A;  2PEQ A;  1YJW P;  2WPT A;  2CGQ A;  1AYI A;  4QNB A;  2LML A;  2DGY A;  1VQO P;  3P05 A;  4HKG A;  2KGD A;  1YIJ P;  1AF8 A;  1M6N A;  1K8A Q;  1GPJ A;  2JAZ A;  2JQ4 A;  2M5R A;  2K2Q A;  1M1K Q;  4GR2 A;  3CCM P;  2DNW A;  4H2Y C;  4R0M A;  1BXI A;  2BUO A;  4BPF A;  2JGP A;  3B4Q A;  1M74 A;  3I56 P;  3CMA P;  2AFE A;  3GKL C;  1YIT P;  1YJ9 P;  5KP8 B;  2M8P A;  2JU2 A;  2M8N A;  2L4B A;  1NQ4 A;  3WBH A;  3EJE A;  3LRY A;  1MZ8 A;  3G29 A;  2VLN A;  2L0Q A;  2PEM A;  2ROQ A;  2VLO A;  5DCK A;  2EG5 A;  2QEX P;  1JJ2 O;  3E2D A;  2BHV A;  4MRT C;  5CZD B;  2E1M A;  1ZMB A;  3H0D A;  3GZL A;  5HGM A;  1T8K A;  5BS2 A;  2CG5 B;  1X3O A;  2K0Y A;  2M8L A;  1VKU A;  2GZE A;  3CC7 P;  2GZF A;  5BS1 A;  3DS5 A;  3CCJ P;  7CEI A;  2PNG A;  5JPA A;  1RO2 A;  1QVG O;  2QA4 P;  2AFD A;  3G6E P;  1OR5 A;  4DG9 A;  3G1G A;  4PWV B;  4U0E A;  2PY8 A;  1YJN P;  2KOD A;  1VQ7 P;  1ZNV A;  1N8R Q;  4U0F A;  2LIW A;  4COC A;  5F2N A;  2P9X A;  1UNK A;  2MF4 A;  2FAE A;  2K93 A; 
#chains in the Genus database with same CATH homology
 4U0D A;  1YIJ P;  1M6N A;  1A43 A;  3HYB A;  1K8A Q;  1E6J P;  1KD1 Q;  1EOQ A;  3OW2 O;  2PEJ A;  3DS2 A;  4XRO A;  1M1K Q;  2PEN A;  2XV6 A;  4GR2 A;  3CCM P;  4PH0 A;  1QRJ A;  3DS3 A;  4IPY A;  1VQK P;  1Q82 Q;  1S72 P;  2XXM A;  3G0V A;  2BUO A;  4XFX A;  2EFJ A;  1M74 A;  3G1I A;  2PEI A;  2EIA A;  2OTJ P;  4COP A;  3I56 P;  4PH1 A;  3B5I A;  1RO0 A;  3CMA P;  1A8O A;  1VQ5 P;  1BAJ A;  3M1M A;  3MGE A;  1YIT P;  3NTE A;  3I55 P;  1YJ9 P;  2M8P A;  2M8N A;  3WBH A;  1VQ4 P;  1EIA A;  2CWO A;  1RNI A;  1K73 Q;  3LRY A;  5HGN A;  3CCS P;  3G21 A;  2L6E A;  3HZQ A;  3G29 A;  1Q86 Q;  1M90 Q;  3DS1 A;  2PEM A;  1YI2 P;  1Q81 Q;  4XRQ A;  5DCK A;  1KC8 Q;  1AUM A;  2EG5 A;  1M6E X;  2QEX P;  1D1D A;  1VQ6 P;  1IUQ A;  1JJ2 O;  3Q20 A;  3H47 A;  3E2D A;  3G71 P;  1VQN P;  2BHV A;  2PEO A;  2E1M A;  1ZMB A;  4U0A A;  4U0C A;  1VQP P;  1K30 A;  3H0D A;  2JO0 A;  2XT1 A;  1VQ9 P;  5HGO A;  3G4S P;  5HGM A;  3CCL P;  1KQS O;  5BS2 A;  1QVF O;  3DS0 A;  2M8L A;  1YHQ P;  1K9M Q;  2Z46 A;  3H4E A;  3CC7 P;  2Z44 A;  2JYG A;  5F2O A;  5BS1 A;  5I4T G;  3G28 A;  3CCE P;  3DS5 A;  4XFZ A;  4U0B A;  1Q7Y Q;  3DPH A;  2Z45 A;  3CCJ P;  3VRL C;  3CD6 P;  2JYL A;  4M0I A;  4XFY A;  5JPA A;  1RO2 A;  3DS4 A;  1QVG O;  2ONT A;  3RG6 C;  2QA4 P;  3CCR P;  3G6E P;  3G1G A;  3CCU P;  4U0E A;  3DTJ A;  4GR6 A;  3CCV P;  2PY8 A;  3CC2 P;  1YJN P;  3CXC O;  2KOD A;  2PEQ A;  5F2K A;  1VQ7 P;  1YJW P;  1VQL P;  1N8R Q;  1W2B O;  4U0F A;  3CME P;  1VQM P;  3CC4 P;  3CCQ P;  4WYM A;  2OAR A;  4QNB A;  4COC A;  2OTL P;  1NJI Q;  5F2N A;  2DGY A;  3G26 A;  2P9X A;  3CPW O;  5HGL A;  2LF4 A;  2PEK A;  1VQO P;  1VQ8 P;  3P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...