1AUMA

Hiv capsid c-terminal domain (cac146)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
LDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV CAPSID
publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1aumA00
3G26A 2JYLA 5DCKA 3DS2A 2LF4A 3G1GA 3DTJA 2XT1A 4U0DA 5HGLA 3DS1A 2JYGA 2XXMA 3DS4A 1D1DA 3G1IA 1AUMA 4PH0A 1A43A 3DPHA 3LRYA 5HGNA 2KODA 1EIAA 2XV6A 4U0AA 2M8LA 3G21A 5HGOA 1EOQA 3MGEA 3P05A 4QNBA 3DS0A 3G28A 3VRLC 1QRJA 4PH1A 3H47A 3H4EA 1A8OA 4XFYA 4U0CA 1E6JP 3DS3A 4XFZA 3G29A 4COPA 2ONTA 5I4TG 2M8NA 2BUOA 4WYMA 5JPAA 4M0IA 4U0BA 4XRQA 5HGMA 2EIAA 4COCA 4IPYA 4XFXA 3NTEA 2M8PA 3DS5A 1BAJA 2JO0A 3G0VA 4U0EA 2L6EA 4XROA 4U0FA
chains in the Genus database with same CATH superfamily
1M6NA 2ROQA 1ZNVA 3B4QA 3G1IA 2EG5A 2CG5B 5EW5E 2L9FA 2MD9A 1Z6MA 1K8AQ 1QVGO 1A8OA 1KD1Q 2L22A 2KG9A 2DGYA 2GZEA 1NQ4A 5KP7B 2LIWA 2GDYA 3LRYA 3GJNA 3CCQP 3M1MA 2QA4P 3I55P 2LL8A 2N50A 5HGNA 2CWOA 2JQ4A 5BS2A 1MZ8A 2LKIA 3CCVP 2KG6A 2AF8A 1AF8A 2PEMA 1RO2A 2Z44A 2M8PA 4U0BA 1QVFO 4XROA 1VQOP 3CE7A 3OW2O 1UJZA 1EOQA 2GYKA 1VQNP 2JU2A 2GZFA 2N6YA 2E1MA 5HV8A 2FVEA 3GZMA 2LTEA 4BPGA 4U0FA 3G26A 5F2NA 1VQKP 2JB0A 1HY8A 1S72P 1BXIA 3GKLC 2MY5A 1VQ9P 2N6ZA 3H47A 2JBGA 2K0DX 2VSQA 5JPAA 2K5XA 3I56P 4COCA 4XFXA 1W2BO 2QEXP 2VLOA 2ERHA 2L6EA 1KLPA 2JYLA 1Q82Q 2VLPA 2K92A 3GZLA 2EHTA 1K73Q 2KWLA 2BHVA 1L0IA 2PEOA 3NY7B 3CCSP 2M8LA 1AYIA 3P05A 1VQ4P 2PEIA 1M90Q 4PH1A 4XFYA 4M0IA 4XRQA 2EIAA 5HVCA 1T8KA 1K30A 5F2OA 5DCKA 3DS2A 2DNWA 3RG6C 4DG9A 5HGOA 4R0MA 2OARA 4CA3A 3G71P 4BPFA 1UNKA 3EJBA 1NJIQ 2XZ1C 2WPTA 2PEQA 5CZDB 2JU1A 2Z45A 2NO8A 3G4SP 1M1KQ 2P9XA 1GXHA 3B5IA 2JYGA 3CCLP 1IUQA 1EIAA 2LMLA 2L0QA 1QRJA 1YI2P 1N8RQ 2KOQA 3H0DA 3NTEA 3G6EP 3E2DA 5EJDA 2OTLP 1E0HA 3G1GA 1VQ7P 1EMVA 2XT1A 3CCEP 1D1DA 3DS4A 2CQ8A 2VLQA 1M74A 2FHSC 3MGEA 2GZIA 5BS1A 4MRTC 2KGEA 4BPHA 2FQ1A 2CGQA 4IPYA 2MF4A 3DS5A 4U0EA 2KGDA 1AUMA 2GDWA 2LOLA 1IMPA 2GZGA 3CCUP 3G21A 3CCRP 4F37A 3DS0A 3WBHA 3CC2P 2FADA 2N98A 1CEIA 1Q86Q 2N5HA 3Q20A 2PEKA 2KR5A 1BAJA 2JO0A 2K0XA 2LPKA 3CCMP 2EFJA 3CPWO 4H2WC 2MVUA 3G28A 3RG2A 1X3OA 4COPA 1RNIA 2ONTA 1YITP 3U43A 2OTJP 1F80D 1DV5A 2KGAA 1DNYA 5HGLA 1KQSO 2N5IA 4GR2A 2AFEA 2FQ2A 1E6JP 2KGCA 1VQMP 5HGMA 2MVVA 2X2BA 1OR5A 4NEOA 2KORA 2VLNA 2LF4A 3DTJA 2JAZA 1VQPP 2KODA 4PWVB 2GDXA 3VRLC 4QNBA 2QNWA 3CMAP 2FACA 1L0HA 7CEIA 2M8NA 2BUOA 1VQ8P 1YJNP 1VQ6P 2GZJA 4UHPB 1YHQP 1VQLP 2XXMA 1FR2A 4PH0A 3CMEP 2KG8A 2XV6A 2EHSA 4H2YC 2CNRA 2FVFA 2AFDA 3CC7P 2L4BA 1ACPA 1YJWP 1Q81Q 5KP8B 2AVAA 3CC4P 3G0VA 1ZMBA 3CD6P 3CCJP 2MR7A 3HZQA 2K0YA 3H4EA 2Z46A 3DS3A 4GR6A 1KC8Q 2KOPA 5I4TG 1RO0A 2PY8A 2FQ0A 4WYMA 2MR8A 2JGPA 1VHNA 3EJDA 3LMOA 2KOSA 2K94A 2PEJA 4U0DA 3HYBA 1M6EX 1VQ5P 1A43A 4U0AA 4HKGA 1GPJA 3EJEA 4QKOA 3CXCO 2KW2A 2M5RA 5KP6B 4PXHB 3G29A 4XFZA 1YIJP 2LIUA 1Q7YQ 2FAEA 2KOOA 2K93A 1HQBA 2K2QA 3DS1A 1YJ9P 2FVAA 3DPHA 1IMQA 2XZ0D 4H2XC 1JJ2O 1VKUA 1GXGA 4U0CA 2PNGA 2PENA 1K9MQ 4IZ6A 5F2KA
chains in the Genus database with same CATH topology
1M6NA 2JYLA 1YHQP 1Q82Q 1VQLP 2XXMA 1K73Q 3G1IA 2BHVA 1AUMA 2EG5A 4PH0A 3CMEP 2PEOA 2XV6A 3CCSP 2M8LA 3G21A 3CCRP 3CCUP 3P05A 1K8AQ 1QVGO 3DS0A 2PEIA 1VQ4P 1M90Q 3WBHA 4PH1A 1A8OA 3CC2P 4XFYA 1KD1Q 1Q86Q 2DGYA 3CC7P 3Q20A 2PEKA 1YJWP 4M0IA 4XRQA 2EIAA 1Q81Q 3CC4P 1BAJA 2JO0A 3LRYA 3G0VA 3CCQP 1K30A 5F2OA 3CCMP 5DCKA 3M1MA 3DS2A 1ZMBA 2QA4P 3I55P 3CD6P 3CCJP 2EFJA 3RG6C 3CPWO 5HGNA 5HGOA 2OARA 2CWOA 5BS2A 3G28A 3HZQA 3G71P 3H4EA 2Z46A 3DS3A 4COPA 3CCVP 1RNIA 4GR6A 2ONTA 1YITP 5I4TG 1NJIQ 1RO0A 2PY8A 1KC8Q 2PEQA 4WYMA 2OTJP 2PEMA 1RO2A 2Z45A 2Z44A 2M8PA 4U0BA 1QVFO 4XROA 3G4SP 1VQOP 1M1KQ 2P9XA 2PEJA 4U0DA 5HGLA 3B5IA 3HYBA 2JYGA 3CCLP 3OW2O 1M6EX 1IUQA 1KQSO 1VQ5P 1A43A 1EIAA 4GR2A 4U0AA 1EOQA 1QRJA 1VQNP 3CXCO 1E6JP 4XFZA 3G29A 1YI2P 1YIJP 1N8RQ 1VQMP 1Q7YQ 3H0DA 2E1MA 5HGMA 3NTEA 3G6EP 3E2DA 2OTLP 4U0FA 3G26A 5F2NA 1VQKP 2LF4A 3G1GA 3DTJA 2XT1A 1VQ7P 3DS1A 3CCEP 3DS4A 1S72P 1D1DA 1VQ9P 1VQPP 1YJ9P 3DPHA 2KODA 1M74A 3MGEA 3VRLC 1JJ2O 4QNBA 3CMAP 3H47A 5BS1A 4U0CA 2PENA 1K9MQ 2M8NA 2BUOA 5JPAA 1VQ8P 1YJNP 3I56P 4COCA 4IPYA 5F2KA 1VQ6P 4XFXA 1W2BO 2QEXP 3DS5A 4U0EA 2L6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G26 A;  2JYL A;  5DCK A;  3DS2 A;  2LF4 A;  3G1G A;  3DTJ A;  2XT1 A;  4U0D A;  5HGL A;  3DS1 A;  2JYG A;  2XXM A;  3DS4 A;  1D1D A;  3G1I A;  1AUM A;  4PH0 A;  1A43 A;  3DPH A;  3LRY A;  5HGN A;  2KOD A;  1EIA A;  2XV6 A;  4U0A A;  2M8L A;  3G21 A;  5HGO A;  1EOQ A;  3MGE A;  3P05 A;  4QNB A;  3DS0 A;  3G28 A;  3VRL C;  1QRJ A;  4PH1 A;  3H47 A;  3H4E A;  1A8O A;  4XFY A;  4U0C A;  1E6J P;  3DS3 A;  4XFZ A;  3G29 A;  4COP A;  2ONT A;  5I4T G;  2M8N A;  2BUO A;  4WYM A;  5JPA A;  4M0I A;  4U0B A;  4XRQ A;  5HGM A;  2EIA A;  4COC A;  4IPY A;  4XFX A;  3NTE A;  2M8P A;  3DS5 A;  1BAJ A;  2JO0 A;  3G0V A;  4U0E A;  2L6E A;  4XRO A;  4U0F A; 
#chains in the Genus database with same CATH topology
 1M6N A;  2ROQ A;  1ZNV A;  3B4Q A;  3G1I A;  2EG5 A;  2CG5 B;  5EW5 E;  2L9F A;  2MD9 A;  1Z6M A;  1K8A Q;  1QVG O;  1A8O A;  1KD1 Q;  2L22 A;  2KG9 A;  2DGY A;  2GZE A;  1NQ4 A;  5KP7 B;  2LIW A;  2GDY A;  3LRY A;  3GJN A;  3CCQ P;  3M1M A;  2QA4 P;  3I55 P;  2LL8 A;  2N50 A;  5HGN A;  2CWO A;  2JQ4 A;  5BS2 A;  1MZ8 A;  2LKI A;  3CCV P;  2KG6 A;  2AF8 A;  1AF8 A;  2PEM A;  1RO2 A;  2Z44 A;  2M8P A;  4U0B A;  1QVF O;  4XRO A;  1VQO P;  3CE7 A;  3OW2 O;  1UJZ A;  1EOQ A;  2GYK A;  1VQN P;  2JU2 A;  2GZF A;  2N6Y A;  2E1M A;  5HV8 A;  2FVE A;  3GZM A;  2LTE A;  4BPG A;  4U0F A;  3G26 A;  5F2N A;  1VQK P;  2JB0 A;  1HY8 A;  1S72 P;  1BXI A;  3GKL C;  2MY5 A;  1VQ9 P;  2N6Z A;  3H47 A;  2JBG A;  2K0D X;  2VSQ A;  5JPA A;  2K5X A;  3I56 P;  4COC A;  4XFX A;  1W2B O;  2QEX P;  2VLO A;  2ERH A;  2L6E A;  1KLP A;  2JYL A;  1Q82 Q;  2VLP A;  2K92 A;  3GZL A;  2EHT A;  1K73 Q;  2KWL A;  2BHV A;  1L0I A;  2PEO A;  3NY7 B;  3CCS P;  2M8L A;  1AYI A;  3P05 A;  1VQ4 P;  2PEI A;  1M90 Q;  4PH1 A;  4XFY A;  4M0I A;  4XRQ A;  2EIA A;  5HVC A;  1T8K A;  1K30 A;  5F2O A;  5DCK A;  3DS2 A;  2DNW A;  3RG6 C;  4DG9 A;  5HGO A;  4R0M A;  2OAR A;  4CA3 A;  3G71 P;  4BPF A;  1UNK A;  3EJB A;  1NJI Q;  2XZ1 C;  2WPT A;  2PEQ A;  5CZD B;  2JU1 A;  2Z45 A;  2NO8 A;  3G4S P;  1M1K Q;  2P9X A;  1GXH A;  3B5I A;  2JYG A;  3CCL P;  1IUQ A;  1EIA A;  2LML A;  2L0Q A;  1QRJ A;  1YI2 P;  1N8R Q;  2KOQ A;  3H0D A;  3NTE A;  3G6E P;  3E2D A;  5EJD A;  2OTL P;  1E0H A;  3G1G A;  1VQ7 P;  1EMV A;  2XT1 A;  3CCE P;  1D1D A;  3DS4 A;  2CQ8 A;  2VLQ A;  1M74 A;  2FHS C;  3MGE A;  2GZI A;  5BS1 A;  4MRT C;  2KGE A;  4BPH A;  2FQ1 A;  2CGQ A;  4IPY A;  2MF4 A;  3DS5 A;  4U0E A;  2KGD A;  1AUM A;  2GDW A;  2LOL A;  1IMP A;  2GZG A;  3CCU P;  3G21 A;  3CCR P;  4F37 A;  3DS0 A;  3WBH A;  3CC2 P;  2FAD A;  2N98 A;  1CEI A;  1Q86 Q;  2N5H A;  3Q20 A;  2PEK A;  2KR5 A;  1BAJ A;  2JO0 A;  2K0X A;  2LPK A;  3CCM P;  2EFJ A;  3CPW O;  4H2W C;  2MVU A;  3G28 A;  3RG2 A;  1X3O A;  4COP A;  1RNI A;  2ONT A;  1YIT P;  3U43 A;  2OTJ P;  1F80 D;  1DV5 A;  2KGA A;  1DNY A;  5HGL A;  1KQS O;  2N5I A;  4GR2 A;  2AFE A;  2FQ2 A;  1E6J P;  2KGC A;  1VQM P;  5HGM A;  2MVV A;  2X2B A;  1OR5 A;  4NEO A;  2KOR A;  2VLN A;  2LF4 A;  3DTJ A;  2JAZ A;  1VQP P;  2KOD A;  4PWV B;  2GDX A;  3VRL C;  4QNB A;  2QNW A;  3CMA P;  2FAC A;  1L0H A;  7CEI A;  2M8N A;  2BUO A;  1VQ8 P;  1YJN P;  1VQ6 P;  2GZJ A;  4UHP B;  1YHQ P;  1VQL P;  2XXM A;  1FR2 A;  4PH0 A;  3CME P;  2KG8 A;  2XV6 A;  2EHS A;  4H2Y C;  2CNR A;  2FVF A;  2AFD A;  3CC7 P;  2L4B A;  1ACP A;  1YJW P;  1Q81 Q;  5KP8 B;  2AVA A;  3CC4 P;  3G0V A;  1ZMB A;  3CD6 P;  3CCJ P;  2MR7 A;  3HZQ A;  2K0Y A;  3H4E A;  2Z46 A;  3DS3 A;  4GR6 A;  1KC8 Q;  2KOP A;  5I4T G;  1RO0 A;  2PY8 A;  2FQ0 A;  4WYM A;  2MR8 A;  2JGP A;  1VHN A;  3EJD A;  3LMO A;  2KOS A;  2K94 A;  2PEJ A;  4U0D A;  3HYB A;  1M6E X;  1VQ5 P;  1A43 A;  4U0A A;  4HKG A;  1GPJ A;  3EJE A;  4QKO A;  3CXC O;  2KW2 A;  2M5R A;  5KP6 B;  4PXH B;  3G29 A;  4XFZ A;  1YIJ P;  2LIU A;  1Q7Y Q;  2FAE A;  2KOO A;  2K93 A;  1HQB A;  2K2Q A;  3DS1 A;  1YJ9 P;  2FVA A;  3DPH A;  1IMQ A;  2XZ0 D;  4H2X C;  1JJ2 O;  1VKU A;  1GXG A;  4U0C A;  2PNG A;  2PEN A;  1K9M Q;  4IZ6 A;  5F2K A; 
#chains in the Genus database with same CATH homology
 1M6N A;  2JYL A;  1YHQ P;  1Q82 Q;  1VQL P;  2XXM A;  1K73 Q;  3G1I A;  2BHV A;  1AUM A;  2EG5 A;  4PH0 A;  3CME P;  2PEO A;  2XV6 A;  3CCS P;  2M8L A;  3G21 A;  3CCR P;  3CCU P;  3P05 A;  1K8A Q;  1QVG O;  3DS0 A;  2PEI A;  1VQ4 P;  1M90 Q;  3WBH A;  4PH1 A;  1A8O A;  3CC2 P;  4XFY A;  1KD1 Q;  1Q86 Q;  2DGY A;  3CC7 P;  3Q20 A;  2PEK A;  1YJW P;  4M0I A;  4XRQ A;  2EIA A;  1Q81 Q;  3CC4 P;  1BAJ A;  2JO0 A;  3LRY A;  3G0V A;  3CCQ P;  1K30 A;  5F2O A;  3CCM P;  5DCK A;  3M1M A;  3DS2 A;  1ZMB A;  2QA4 P;  3I55 P;  3CD6 P;  3CCJ P;  2EFJ A;  3RG6 C;  3CPW O;  5HGN A;  5HGO A;  2OAR A;  2CWO A;  5BS2 A;  3G28 A;  3HZQ A;  3G71 P;  3H4E A;  2Z46 A;  3DS3 A;  4COP A;  3CCV P;  1RNI A;  4GR6 A;  2ONT A;  1YIT P;  5I4T G;  1NJI Q;  1RO0 A;  2PY8 A;  1KC8 Q;  2PEQ A;  4WYM A;  2OTJ P;  2PEM A;  1RO2 A;  2Z45 A;  2Z44 A;  2M8P A;  4U0B A;  1QVF O;  4XRO A;  3G4S P;  1VQO P;  1M1K Q;  2P9X A;  2PEJ A;  4U0D A;  5HGL A;  3B5I A;  3HYB A;  2JYG A;  3CCL P;  3OW2 O;  1M6E X;  1IUQ A;  1KQS O;  1VQ5 P;  1A43 A;  1EIA A;  4GR2 A;  4U0A A;  1EOQ A;  1QRJ A;  1VQN P;  3CXC O;  1E6J P;  4XFZ A;  3G29 A;  1YI2 P;  1YIJ P;  1N8R Q;  1VQM P;  1Q7Y Q;  3H0D A;  2E1M A;  5HGM A;  3NTE A;  3G6E P;  3E2D A;  2OTL P;  4U0F A;  3G26 A;  5F2N A;  1VQK P;  2LF4 A;  3G1G A;  3DTJ A;  2XT1 A;  1VQ7 P;  3DS1 A;  3CCE P;  3DS4 A;  1S72 P;  1D1D A;  1VQ9 P;  1VQP P;  1YJ9 P;  3DPH A;  2KOD A;  1M74 A;  3MGE A;  3VRL C;  1JJ2 O;  4QNB A;  3CMA P;  3H47 A;  5BS1 A;  4U0C A;  2PEN A;  1K9M Q;  2M8N A;  2BUO A;  5JPA A;  1VQ8 P;  1YJN P;  3I56 P;  4COC A;  4IPY A;  5F2K A;  1VQ6 P;  4XFX A;  1W2B O;  2QEX P;  3DS5 A;  4U0E A;  2L6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...