1AUMA

Hiv capsid c-terminal domain (cac146)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
b'LDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV CAPSID
publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1aumA00
3DS4A 4XROA 2KODA 2BUOA 4QNBA 1EIAA 4U0FA 4U0BA 4U0DA 4XFZA 4U0CA 5HGNA 3G1IA 3MGEA 1AUMA 3H4EA 5I4TG 1A8OA 2XV6A 3DTJA 2M8LA 4XFYA 4PH1A 3DS5A 2JO0A 2XT1A 3DS1A 3DS2A 1EOQA 2XXMA 4XFXA 4XRQA 5DCKA 3G1GA 3DS3A 5HGLA 1QRJA 4COCA 2L6EA 2EIAA 3G26A 4IPYA 5HGOA 2M8NA 4U0AA 2ONTA 4COPA 1D1DA 2JYLA 1E6JP 3G28A 4PH0A 3LRYA 2M8PA 3G0VA 2LF4A 2JYGA 5JPAA 1A43A 3H47A 3VRLC 5HGMA 3NTEA 1BAJA 3G21A 4M0IA 3DS0A 3DPHA 4WYMA 4U0EA 3G29A 3P05A
chains in the Genus database with same CATH superfamily
1Q86Q 2MF4A 1YJNP 5JPAA 1VQLP 3MGEA 1A8OA 1Z6MA 2L9FA 2CQ8A 2AFEA 2JO0A 4XFXA 5HGLA 5DCKA 2OARA 1GPJA 2JU2A 1QVFO 2Z46A 2L0QA 2BHVA 1M90Q 2M8NA 1L0IA 3G4SP 2PEQA 2AVAA 3CPWO 2K0YA 4DG9A 2OTLP 2KG9A 1CEIA 2VLQA 3P05A 2KG8A 3HZQA 2GZEA 5HV8A 3M1MA 1EOQA 3CCRP 4COPA 2JYLA 2EFJA 2ERHA 2KW2A 3H47A 3CC4P 2KOQA 2KR5A 3DPHA 4U0EA 3WBHA 1GXHA 4XFZA 3CCUP 4F37A 2MR8A 1UJZA 3G6EP 3CCEP 1YIJP 3G1GA 2MD9A 2LOLA 2EIAA 1E6JP 2E1MA 1A43A 1T8KA 2XZ0D 1BAJA 2FADA 3CE7A 3B5IA 3CCVP 4U0BA 2XZ1C 2K5XA 1X3OA 5KP8B 2XV6A 2CGQA 5EJDA 2KOOA 2CNRA 4BPFA 4BPHA 1VQ8P 3CC7P 1K73Q 4XROA 1EIAA 3GZLA 5HGNA 3HYBA 1K30A 1ACPA 3RG2A 1VQNP 2LL8A 2FVEA 1F80D 2FQ1A 4PWVB 2OTJP 2AF8A 3CCLP 4BPGA 1RO2A 2N50A 1YJWP 3CCMP 1GXGA 2KORA 3NTEA 1KLPA 2PY8A 1IUQA 1AUMA 3H4EA 3CCQP 1RNIA 4PXHB 4PH1A 3DS2A 3EJBA 7CEIA 2K0DX 2VLPA 4COCA 2K92A 2KG6A 2FVFA 2KOPA 1VQMP 2FAEA 3CC2P 4UHPB 2FHSC 5HVCA 2JU1A 2GZFA 5EW5E 2N6ZA 3CXCO 2M5RA 2VLOA 5BS2A 4U0DA 1NJIQ 1Q82Q 2GZGA 1Q81Q 2PNGA 3G71P 4MRTC 1ZMBA 2GZJA 4GR6A 2GDWA 2LPKA 1M1KQ 2PEKA 1W2BO 3GJNA 1DV5A 1NQ4A 2PEOA 4M0IA 1KQSO 1VQ6P 3NY7B 3EJDA 1YHQP 1VQ5P 2NO8A 4GR2A 1VQKP 2ONTA 3CMAP 2LKIA 1N8RQ 2FACA 3LMOA 4IZ6A 2PENA 3DTJA 4H2XC 2PEIA 2M8LA 5CZDB 3DS5A 2XXMA 2GDYA 1VQ7P 1VQ9P 2PEJA 5BS1A 1AF8A 1BXIA 1M6EX 2MY5A 4CA3A 1JJ2O 2Z45A 3RG6C 2K93A 3DS4A 4QNBA 4U0CA 3CD6P 5F2OA 2JAZA 4XRQA 4NEOA 2KGAA 2L22A 4PH0A 2LF4A 2KGCA 1OR5A 1VHNA 3G21A 1EMVA 2JQ4A 5I4TG 1L0HA 1IMQA 2JYGA 1DNYA 1K8AQ 2ROQA 3G29A 2PEMA 2GZIA 2K0XA 1S72P 1IMPA 2EHTA 2FQ2A 5F2KA 4R0MA 3B4QA 3DS3A 1QRJA 1HY8A 2AFDA 2QEXP 2LIWA 4QKOA 2CWOA 2K2QA 1Q7YQ 2DGYA 2JBGA 2MR7A 4WYMA 2DNWA 2QA4P 2KODA 2WPTA 2QNWA 3G1IA 1E0HA 2Z44A 2KOSA 2N98A 1K9MQ 2CG5B 1M6NA 3G28A 2N6YA 4H2WC 3I55P 2K94A 3VRLC 3GKLC 3EJEA 3DS0A 2KWLA 2FQ0A 2MVUA 2LIUA 3DS1A 3I56P 3Q20A 3OW2O 2L4BA 2JGPA 3G26A 4IPYA 1RO0A 2FVAA 2X2BA 3LRYA 2VLNA 4HKGA 2N5HA 1VKUA 1KC8Q 1M74A 1YJ9P 2EHSA 1FR2A 3GZMA 2KGDA 1AYIA 1QVGO 2XT1A 2P9XA 3U43A 1ZNVA 1YITP 1UNKA 3CCJP 2VSQA 1MZ8A 2EG5A 3CCSP 4H2YC 1YI2P 2MVVA 3H0DA 2BUOA 4U0FA 2JB0A 1VQOP 5KP6B 1VQ4P 3CMEP 4XFYA 3E2DA 2GYKA 1D1DA 1HQBA 1KD1Q 2KGEA 2N5IA 2L6EA 1VQPP 5HGOA 2LMLA 4U0AA 2LTEA 2M8PA 3G0VA 5KP7B 5F2NA 5HGMA 2GDXA
chains in the Genus database with same CATH topology
1Q86Q 4XROA 2QA4P 2KODA 1YJNP 1EIAA 5HGNA 5JPAA 1VQLP 3G1IA 3HYBA 1K30A 2PENA 3MGEA 1A8OA 1VQNP 2Z44A 3DTJA 2PEIA 2M8LA 3DS5A 2JO0A 2XXMA 4XFXA 5DCKA 5HGLA 2OARA 1VQ7P 1K9MQ 1VQ9P 1QVFO 2PEJA 2OTJP 2Z46A 2BHVA 1M90Q 5BS1A 2M8NA 3CCLP 3G4SP 1M6NA 1RO2A 3G28A 1M6EX 2PEQA 3I55P 1YJWP 3CPWO 1JJ2O 3CCMP 2OTLP 3VRLC 2Z45A 3NTEA 3DS0A 3RG6C 3P05A 2PY8A 3DS4A 4QNBA 3HZQA 1IUQA 4U0CA 3CD6P 1AUMA 3H4EA 3CCQP 1RNIA 5F2OA 4PH1A 3DS2A 3DS1A 3M1MA 3I56P 1EOQA 3Q20A 4XRQA 3OW2O 4COCA 3G26A 4IPYA 3CCRP 1VQMP 1RO0A 4COPA 3CC2P 2JYLA 4PH0A 3LRYA 2EFJA 2LF4A 3CC4P 3H47A 1KC8Q 3CXCO 3G21A 3DPHA 4U0EA 1M74A 3WBHA 1YJ9P 5BS2A 4XFZA 4U0DA 5I4TG 1NJIQ 1Q82Q 1Q81Q 3CCUP 3G6EP 1QVGO 2XT1A 3CCEP 1YIJP 3G71P 3G1GA 1ZMBA 2EIAA 4GR6A 2P9XA 1E6JP 1YITP 1M1KQ 2PEKA 1W2BO 3CCJP 2E1MA 2JYGA 1A43A 2EG5A 3CCSP 2PEOA 1K8AQ 1BAJA 4M0IA 1KQSO 1VQ6P 3B5IA 3CCVP 1YI2P 3G29A 4U0BA 2PEMA 3H0DA 2BUOA 4U0FA 1S72P 1YHQP 1VQOP 2XV6A 5F2KA 1VQ4P 4XFYA 3CMEP 1VQ5P 3E2DA 1D1DA 1KD1Q 3DS3A 4GR2A 1QRJA 2QEXP 2L6EA 1VQPP 5HGOA 1VQKP 4U0AA 2ONTA 1VQ8P 3CMAP 2M8PA 3G0VA 2CWOA 3CC7P 5F2NA 1Q7YQ 5HGMA 2DGYA 1K73Q 1N8RQ 4WYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS4 A;  4XRO A;  2KOD A;  2BUO A;  4QNB A;  1EIA A;  4U0F A;  4U0B A;  4U0D A;  4XFZ A;  4U0C A;  5HGN A;  3G1I A;  3MGE A;  1AUM A;  3H4E A;  5I4T G;  1A8O A;  2XV6 A;  3DTJ A;  2M8L A;  4XFY A;  4PH1 A;  3DS5 A;  2JO0 A;  2XT1 A;  3DS1 A;  3DS2 A;  1EOQ A;  2XXM A;  4XFX A;  4XRQ A;  5DCK A;  3G1G A;  3DS3 A;  5HGL A;  1QRJ A;  4COC A;  2L6E A;  2EIA A;  3G26 A;  4IPY A;  5HGO A;  2M8N A;  4U0A A;  2ONT A;  4COP A;  1D1D A;  2JYL A;  1E6J P;  3G28 A;  4PH0 A;  3LRY A;  2M8P A;  3G0V A;  2LF4 A;  2JYG A;  5JPA A;  1A43 A;  3H47 A;  3VRL C;  5HGM A;  3NTE A;  1BAJ A;  3G21 A;  4M0I A;  3DS0 A;  3DPH A;  4WYM A;  4U0E A;  3G29 A;  3P05 A; 
#chains in the Genus database with same CATH topology
 1Q86 Q;  2MF4 A;  1YJN P;  5JPA A;  1VQL P;  3MGE A;  1A8O A;  1Z6M A;  2L9F A;  2CQ8 A;  2AFE A;  2JO0 A;  4XFX A;  5HGL A;  5DCK A;  2OAR A;  1GPJ A;  2JU2 A;  1QVF O;  2Z46 A;  2L0Q A;  2BHV A;  1M90 Q;  2M8N A;  1L0I A;  3G4S P;  2PEQ A;  2AVA A;  3CPW O;  2K0Y A;  4DG9 A;  2OTL P;  2KG9 A;  1CEI A;  2VLQ A;  3P05 A;  2KG8 A;  3HZQ A;  2GZE A;  5HV8 A;  3M1M A;  1EOQ A;  3CCR P;  4COP A;  2JYL A;  2EFJ A;  2ERH A;  2KW2 A;  3H47 A;  3CC4 P;  2KOQ A;  2KR5 A;  3DPH A;  4U0E A;  3WBH A;  1GXH A;  4XFZ A;  3CCU P;  4F37 A;  2MR8 A;  1UJZ A;  3G6E P;  3CCE P;  1YIJ P;  3G1G A;  2MD9 A;  2LOL A;  2EIA A;  1E6J P;  2E1M A;  1A43 A;  1T8K A;  2XZ0 D;  1BAJ A;  2FAD A;  3CE7 A;  3B5I A;  3CCV P;  4U0B A;  2XZ1 C;  2K5X A;  1X3O A;  5KP8 B;  2XV6 A;  2CGQ A;  5EJD A;  2KOO A;  2CNR A;  4BPF A;  4BPH A;  1VQ8 P;  3CC7 P;  1K73 Q;  4XRO A;  1EIA A;  3GZL A;  5HGN A;  3HYB A;  1K30 A;  1ACP A;  3RG2 A;  1VQN P;  2LL8 A;  2FVE A;  1F80 D;  2FQ1 A;  4PWV B;  2OTJ P;  2AF8 A;  3CCL P;  4BPG A;  1RO2 A;  2N50 A;  1YJW P;  3CCM P;  1GXG A;  2KOR A;  3NTE A;  1KLP A;  2PY8 A;  1IUQ A;  1AUM A;  3H4E A;  3CCQ P;  1RNI A;  4PXH B;  4PH1 A;  3DS2 A;  3EJB A;  7CEI A;  2K0D X;  2VLP A;  4COC A;  2K92 A;  2KG6 A;  2FVF A;  2KOP A;  1VQM P;  2FAE A;  3CC2 P;  4UHP B;  2FHS C;  5HVC A;  2JU1 A;  2GZF A;  5EW5 E;  2N6Z A;  3CXC O;  2M5R A;  2VLO A;  5BS2 A;  4U0D A;  1NJI Q;  1Q82 Q;  2GZG A;  1Q81 Q;  2PNG A;  3G71 P;  4MRT C;  1ZMB A;  2GZJ A;  4GR6 A;  2GDW A;  2LPK A;  1M1K Q;  2PEK A;  1W2B O;  3GJN A;  1DV5 A;  1NQ4 A;  2PEO A;  4M0I A;  1KQS O;  1VQ6 P;  3NY7 B;  3EJD A;  1YHQ P;  1VQ5 P;  2NO8 A;  4GR2 A;  1VQK P;  2ONT A;  3CMA P;  2LKI A;  1N8R Q;  2FAC A;  3LMO A;  4IZ6 A;  2PEN A;  3DTJ A;  4H2X C;  2PEI A;  2M8L A;  5CZD B;  3DS5 A;  2XXM A;  2GDY A;  1VQ7 P;  1VQ9 P;  2PEJ A;  5BS1 A;  1AF8 A;  1BXI A;  1M6E X;  2MY5 A;  4CA3 A;  1JJ2 O;  2Z45 A;  3RG6 C;  2K93 A;  3DS4 A;  4QNB A;  4U0C A;  3CD6 P;  5F2O A;  2JAZ A;  4XRQ A;  4NEO A;  2KGA A;  2L22 A;  4PH0 A;  2LF4 A;  2KGC A;  1OR5 A;  1VHN A;  3G21 A;  1EMV A;  2JQ4 A;  5I4T G;  1L0H A;  1IMQ A;  2JYG A;  1DNY A;  1K8A Q;  2ROQ A;  3G29 A;  2PEM A;  2GZI A;  2K0X A;  1S72 P;  1IMP A;  2EHT A;  2FQ2 A;  5F2K A;  4R0M A;  3B4Q A;  3DS3 A;  1QRJ A;  1HY8 A;  2AFD A;  2QEX P;  2LIW A;  4QKO A;  2CWO A;  2K2Q A;  1Q7Y Q;  2DGY A;  2JBG A;  2MR7 A;  4WYM A;  2DNW A;  2QA4 P;  2KOD A;  2WPT A;  2QNW A;  3G1I A;  1E0H A;  2Z44 A;  2KOS A;  2N98 A;  1K9M Q;  2CG5 B;  1M6N A;  3G28 A;  2N6Y A;  4H2W C;  3I55 P;  2K94 A;  3VRL C;  3GKL C;  3EJE A;  3DS0 A;  2KWL A;  2FQ0 A;  2MVU A;  2LIU A;  3DS1 A;  3I56 P;  3Q20 A;  3OW2 O;  2L4B A;  2JGP A;  3G26 A;  4IPY A;  1RO0 A;  2FVA A;  2X2B A;  3LRY A;  2VLN A;  4HKG A;  2N5H A;  1VKU A;  1KC8 Q;  1M74 A;  1YJ9 P;  2EHS A;  1FR2 A;  3GZM A;  2KGD A;  1AYI A;  1QVG O;  2XT1 A;  2P9X A;  3U43 A;  1ZNV A;  1YIT P;  1UNK A;  3CCJ P;  2VSQ A;  1MZ8 A;  2EG5 A;  3CCS P;  4H2Y C;  1YI2 P;  2MVV A;  3H0D A;  2BUO A;  4U0F A;  2JB0 A;  1VQO P;  5KP6 B;  1VQ4 P;  3CME P;  4XFY A;  3E2D A;  2GYK A;  1D1D A;  1HQB A;  1KD1 Q;  2KGE A;  2N5I A;  2L6E A;  1VQP P;  5HGO A;  2LML A;  4U0A A;  2LTE A;  2M8P A;  3G0V A;  5KP7 B;  5F2N A;  5HGM A;  2GDX A; 
#chains in the Genus database with same CATH homology
 1Q86 Q;  4XRO A;  2QA4 P;  2KOD A;  1YJN P;  1EIA A;  5HGN A;  5JPA A;  1VQL P;  3G1I A;  3HYB A;  1K30 A;  2PEN A;  3MGE A;  1A8O A;  1VQN P;  2Z44 A;  3DTJ A;  2PEI A;  2M8L A;  3DS5 A;  2JO0 A;  2XXM A;  4XFX A;  5DCK A;  5HGL A;  2OAR A;  1VQ7 P;  1K9M Q;  1VQ9 P;  1QVF O;  2PEJ A;  2OTJ P;  2Z46 A;  2BHV A;  1M90 Q;  5BS1 A;  2M8N A;  3CCL P;  3G4S P;  1M6N A;  1RO2 A;  3G28 A;  1M6E X;  2PEQ A;  3I55 P;  1YJW P;  3CPW O;  1JJ2 O;  3CCM P;  2OTL P;  3VRL C;  2Z45 A;  3NTE A;  3DS0 A;  3RG6 C;  3P05 A;  2PY8 A;  3DS4 A;  4QNB A;  3HZQ A;  1IUQ A;  4U0C A;  3CD6 P;  1AUM A;  3H4E A;  3CCQ P;  1RNI A;  5F2O A;  4PH1 A;  3DS2 A;  3DS1 A;  3M1M A;  3I56 P;  1EOQ A;  3Q20 A;  4XRQ A;  3OW2 O;  4COC A;  3G26 A;  4IPY A;  3CCR P;  1VQM P;  1RO0 A;  4COP A;  3CC2 P;  2JYL A;  4PH0 A;  3LRY A;  2EFJ A;  2LF4 A;  3CC4 P;  3H47 A;  1KC8 Q;  3CXC O;  3G21 A;  3DPH A;  4U0E A;  1M74 A;  3WBH A;  1YJ9 P;  5BS2 A;  4XFZ A;  4U0D A;  5I4T G;  1NJI Q;  1Q82 Q;  1Q81 Q;  3CCU P;  3G6E P;  1QVG O;  2XT1 A;  3CCE P;  1YIJ P;  3G71 P;  3G1G A;  1ZMB A;  2EIA A;  4GR6 A;  2P9X A;  1E6J P;  1YIT P;  1M1K Q;  2PEK A;  1W2B O;  3CCJ P;  2E1M A;  2JYG A;  1A43 A;  2EG5 A;  3CCS P;  2PEO A;  1K8A Q;  1BAJ A;  4M0I A;  1KQS O;  1VQ6 P;  3B5I A;  3CCV P;  1YI2 P;  3G29 A;  4U0B A;  2PEM A;  3H0D A;  2BUO A;  4U0F A;  1S72 P;  1YHQ P;  1VQO P;  2XV6 A;  5F2K A;  1VQ4 P;  4XFY A;  3CME P;  1VQ5 P;  3E2D A;  1D1D A;  1KD1 Q;  3DS3 A;  4GR2 A;  1QRJ A;  2QEX P;  2L6E A;  1VQP P;  5HGO A;  1VQK P;  4U0A A;  2ONT A;  1VQ8 P;  3CMA P;  2M8P A;  3G0V A;  2CWO A;  3CC7 P;  5F2N A;  1Q7Y Q;  5HGM A;  2DGY A;  1K73 Q;  1N8R Q;  4WYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...