1AUMA

Hiv capsid c-terminal domain (cac146)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
LDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV CAPSID
publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1aumA00
3DS0A 3DTJA 3G1GA 4XRQA 5I4TG 3G0VA 2JO0A 2M8NA 2ONTA 4U0CA 4XFYA 3DS2A 1EIAA 2XXMA 3DS5A 4XFXA 3P05A 4IPYA 4M0IA 3DS3A 3H47A 4U0EA 3DPHA 2EIAA 4QNBA 3VRLC 3G28A 2L6EA 4WYMA 4COPA 3G21A 2JYLA 3LRYA 2M8LA 4U0FA 4COCA 4U0DA 3MGEA 5HGLA 3G1IA 1A43A 4U0AA 4XFZA 4PH0A 3DS1A 5JPAA 1AUMA 5HGMA 2LF4A 3H4EA 5HGOA 1EOQA 1BAJA 2XT1A 3G26A 1QRJA 4XROA 2XV6A 3G29A 1D1DA 2BUOA 4PH1A 4U0BA 5DCKA 2KODA 3DS4A 1E6JP 2JYGA 5HGNA 3NTEA 1A8OA 2M8PA
chains in the Genus database with same CATH superfamily
1ZNVA 2LOLA 1VKUA 3P05A 3HZQA 5BS1A 2KW2A 2OTLP 2JU2A 2L4BA 1Q7YQ 2MVUA 3CC2P 1AF8A 2VLNA 2N6YA 2MY5A 1VQNP 3GJNA 5HGMA 2PNGA 1D1DA 2QNWA 2Z44A 2MD9A 1OR5A 3CE7A 2EHTA 1GXGA 2FADA 2DGYA 2K2QA 1NJIQ 3CPWO 1VQPP 5HGLA 4PH0A 2K0YA 2KORA 2XT1A 1IMPA 1FR2A 2EG5A 2KR5A 4NEOA 3CMAP 2FQ2A 2N6ZA 3H0DA 3G0VA 4H2WC 1JJ2O 2OTJP 3CCLP 1Q81Q 2AFDA 2L6EA 2KG8A 1VQ7P 3CC4P 1VQ4P 2WPTA 3MGEA 4BPFA 3DS1A 1VQ6P 1W2BO 2Z45A 4R0MA 1E0HA 3NTEA 2M8LA 1YHQP 2M8NA 2CNRA 4XFXA 3DS3A 2NO8A 2JB0A 5CZDB 2M5RA 1F80D 2PEKA 3G1IA 3EJDA 2X2BA 2GZGA 2GZEA 3GKLC 3DS4A 3RG2A 2M8PA 4CA3A 3NY7B 3HYBA 2KGAA 2FVEA 3EJEA 2N98A 2L22A 1UNKA 2N5IA 1HQBA 2MF4A 1QVGO 1IUQA 3CCJP 2LIWA 2GDWA 3G29A 5BS2A 1K73Q 5EW5E 2LPKA 2K92A 3G71P 2ERHA 1RNIA 1N8RQ 3LRYA 2KOQA 4COCA 4BPGA 1A43A 4U0AA 1YITP 2KOOA 1EOQA 2VLOA 2AFEA 1M1KQ 2FQ0A 2KOPA 4HKGA 2PY8A 1AYIA 4IPYA 2FVFA 3DPHA 1VHNA 2QA4P 2LTEA 5JPAA 3CCSP 1VQMP 5F2OA 4H2XC 1S72P 4XROA 2XV6A 5HVCA 4PXHB 2JYGA 5EJDA 5I4TG 3G1GA 1VQOP 3E2DA 2BHVA 1HY8A 1X3OA 1Q82Q 4XFZA 2CG5B 1M6EX 2PEIA 2QEXP 2LF4A 3G26A 5DCKA 2P9XA 2Z46A 2AVAA 3DTJA 2PEQA 2FVAA 3CCUP 3DS2A 2GZFA 1DNYA 2CQ8A 2JAZA 2K0XA 3H47A 4U0EA 1BXIA 3WBHA 4IZ6A 1NQ4A 2PEOA 4COPA 1GPJA 3Q20A 4F37A 2VLQA 2K0DX 1L0IA 3H4EA 2BUOA 2FQ1A 2PEJA 3OW2O 5KP6B 4U0CA 1EIAA 5KP8B 1MZ8A 2GDYA 2FAEA 2JBGA 1M90Q 3G21A 2KG6A 1CEIA 2LL8A 2CWOA 4MRTC 1ZMBA 1QRJA 4U0BA 2KGEA 3DS0A 4DG9A 2JQ4A 2KGCA 2EIAA 4QNBA 3G28A 2PEMA 2KG9A 5F2KA 4U0DA 2MR7A 1YJ9P 2LIUA 2JGPA 1T8KA 2GZJA 1DV5A 2GZIA 5HGNA 4XFYA 2MVVA 1UJZA 3CCMP 3B5IA 4UHPB 4M0IA 1KC8Q 1VQ8P 3G4SP 3LMOA 3G6EP 3CD6P 2FACA 2KGDA 7CEIA 2EFJA 5HGOA 4GR6A 2VLPA 1RO2A 2KODA 1K9MQ 2ONTA 1IMQA 3RG6C 1VQ9P 2DNWA 2KOSA 1Q86Q 3M1MA 2PENA 2KWLA 2E1MA 3I56P 1AUMA 2GDXA 1YJWP 2EHSA 1M74A 3GZLA 1YI2P 2N50A 1A8OA 1M6NA 2XXMA 3VRLC 4BPHA 1K8AQ 1VQLP 3CCEP 1EMVA 3CC7P 1KD1Q 3CCQP 1Z6MA 2LKIA 1RO0A 2OARA 1VQKP 2FHSC 4H2YC 2K94A 4XRQA 5KP7B 2GYKA 2JO0A 2MR8A 3DS5A 2K93A 2N5HA 2XZ0D 1YIJP 2CGQA 1KQSO 1ACPA 5HV8A 2JYLA 2K5XA 3CCVP 1VQ5P 3CXCO 1L0HA 2XZ1C 2L9FA 4QKOA 2AF8A 1BAJA 4PH1A 3I55P 2L0QA 1E6JP 3U43A 4WYMA 1KLPA 3EJBA 2VSQA 1GXHA 1YJNP 2JU1A 4PWVB 3B4QA 5F2NA 4U0FA 2LMLA 1K30A 2ROQA 3CCRP 3CMEP 4GR2A 3GZMA 1QVFO
chains in the Genus database with same CATH topology
3DTJA 2PEQA 2ONTA 3HYBA 3CCUP 3DS2A 3P05A 3HZQA 5BS1A 2OTLP 3H47A 4U0EA 3RG6C 1VQ9P 3WBHA 1Q7YQ 2PEOA 4COPA 1Q86Q 1QVGO 3CC2P 3M1MA 1IUQA 3Q20A 2PENA 2E1MA 3I56P 1VQNP 3CCJP 1AUMA 5HGMA 3H4EA 1YJWP 1M74A 3G29A 1YI2P 5BS2A 2BUOA 1D1DA 1K73Q 2PEJA 1A8OA 2Z44A 3OW2O 4U0CA 3G71P 1EIAA 1M6NA 2XXMA 3VRLC 1K8AQ 1RNIA 2DGYA 1VQLP 3CCEP 1NJIQ 1N8RQ 3G21A 1M90Q 3LRYA 4COCA 3CPWO 1VQPP 5HGLA 3CC7P 1A43A 4U0AA 1YITP 4PH0A 1KD1Q 2CWOA 3CCQP 1ZMBA 1EOQA 2OARA 1RO0A 2XT1A 1VQKP 1QRJA 2EG5A 3CMAP 4U0BA 1M1KQ 3DS0A 4XRQA 3H0DA 3G0VA 2JO0A 2PY8A 1JJ2O 3DS5A 2OTJP 4IPYA 3DPHA 2EIAA 4QNBA 1YIJP 3G28A 2PEMA 3CCLP 1Q81Q 1KQSO 2L6EA 1VQ7P 2JYLA 3CCVP 1VQ4P 3CC4P 5F2KA 4U0DA 2QA4P 1VQ5P 3MGEA 3CXCO 3DS1A 5JPAA 3CCSP 1VQMP 1VQ6P 1W2BO 5F2OA 1BAJA 1YJ9P 1S72P 4XROA 2XV6A 2Z45A 4PH1A 3I55P 1E6JP 2JYGA 5HGNA 3NTEA 2M8LA 5I4TG 4WYMA 1YHQP 3G1GA 2M8NA 4XFYA 3CCMP 3B5IA 4XFXA 4M0IA 3DS3A 1VQOP 1YJNP 1KC8Q 1VQ8P 3G4SP 3E2DA 3G6EP 2BHVA 5F2NA 4U0FA 1Q82Q 2PEKA 3CD6P 1K30A 3G1IA 3CCRP 4XFZA 3CMEP 4GR2A 1M6EX 2PEIA 2EFJA 2QEXP 2LF4A 5HGOA 4GR6A 3G26A 5DCKA 1RO2A 2KODA 2P9XA 3DS4A 1QVFO 1K9MQ 2Z46A 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS0 A;  3DTJ A;  3G1G A;  4XRQ A;  5I4T G;  3G0V A;  2JO0 A;  2M8N A;  2ONT A;  4U0C A;  4XFY A;  3DS2 A;  1EIA A;  2XXM A;  3DS5 A;  4XFX A;  3P05 A;  4IPY A;  4M0I A;  3DS3 A;  3H47 A;  4U0E A;  3DPH A;  2EIA A;  4QNB A;  3VRL C;  3G28 A;  2L6E A;  4WYM A;  4COP A;  3G21 A;  2JYL A;  3LRY A;  2M8L A;  4U0F A;  4COC A;  4U0D A;  3MGE A;  5HGL A;  3G1I A;  1A43 A;  4U0A A;  4XFZ A;  4PH0 A;  3DS1 A;  5JPA A;  1AUM A;  5HGM A;  2LF4 A;  3H4E A;  5HGO A;  1EOQ A;  1BAJ A;  2XT1 A;  3G26 A;  1QRJ A;  4XRO A;  2XV6 A;  3G29 A;  1D1D A;  2BUO A;  4PH1 A;  4U0B A;  5DCK A;  2KOD A;  3DS4 A;  1E6J P;  2JYG A;  5HGN A;  3NTE A;  1A8O A;  2M8P A; 
#chains in the Genus database with same CATH topology
 1ZNV A;  2LOL A;  1VKU A;  3P05 A;  3HZQ A;  5BS1 A;  2KW2 A;  2OTL P;  2JU2 A;  2L4B A;  1Q7Y Q;  2MVU A;  3CC2 P;  1AF8 A;  2VLN A;  2N6Y A;  2MY5 A;  1VQN P;  3GJN A;  5HGM A;  2PNG A;  1D1D A;  2QNW A;  2Z44 A;  2MD9 A;  1OR5 A;  3CE7 A;  2EHT A;  1GXG A;  2FAD A;  2DGY A;  2K2Q A;  1NJI Q;  3CPW O;  1VQP P;  5HGL A;  4PH0 A;  2K0Y A;  2KOR A;  2XT1 A;  1IMP A;  1FR2 A;  2EG5 A;  2KR5 A;  4NEO A;  3CMA P;  2FQ2 A;  2N6Z A;  3H0D A;  3G0V A;  4H2W C;  1JJ2 O;  2OTJ P;  3CCL P;  1Q81 Q;  2AFD A;  2L6E A;  2KG8 A;  1VQ7 P;  3CC4 P;  1VQ4 P;  2WPT A;  3MGE A;  4BPF A;  3DS1 A;  1VQ6 P;  1W2B O;  2Z45 A;  4R0M A;  1E0H A;  3NTE A;  2M8L A;  1YHQ P;  2M8N A;  2CNR A;  4XFX A;  3DS3 A;  2NO8 A;  2JB0 A;  5CZD B;  2M5R A;  1F80 D;  2PEK A;  3G1I A;  3EJD A;  2X2B A;  2GZG A;  2GZE A;  3GKL C;  3DS4 A;  3RG2 A;  2M8P A;  4CA3 A;  3NY7 B;  3HYB A;  2KGA A;  2FVE A;  3EJE A;  2N98 A;  2L22 A;  1UNK A;  2N5I A;  1HQB A;  2MF4 A;  1QVG O;  1IUQ A;  3CCJ P;  2LIW A;  2GDW A;  3G29 A;  5BS2 A;  1K73 Q;  5EW5 E;  2LPK A;  2K92 A;  3G71 P;  2ERH A;  1RNI A;  1N8R Q;  3LRY A;  2KOQ A;  4COC A;  4BPG A;  1A43 A;  4U0A A;  1YIT P;  2KOO A;  1EOQ A;  2VLO A;  2AFE A;  1M1K Q;  2FQ0 A;  2KOP A;  4HKG A;  2PY8 A;  1AYI A;  4IPY A;  2FVF A;  3DPH A;  1VHN A;  2QA4 P;  2LTE A;  5JPA A;  3CCS P;  1VQM P;  5F2O A;  4H2X C;  1S72 P;  4XRO A;  2XV6 A;  5HVC A;  4PXH B;  2JYG A;  5EJD A;  5I4T G;  3G1G A;  1VQO P;  3E2D A;  2BHV A;  1HY8 A;  1X3O A;  1Q82 Q;  4XFZ A;  2CG5 B;  1M6E X;  2PEI A;  2QEX P;  2LF4 A;  3G26 A;  5DCK A;  2P9X A;  2Z46 A;  2AVA A;  3DTJ A;  2PEQ A;  2FVA A;  3CCU P;  3DS2 A;  2GZF A;  1DNY A;  2CQ8 A;  2JAZ A;  2K0X A;  3H47 A;  4U0E A;  1BXI A;  3WBH A;  4IZ6 A;  1NQ4 A;  2PEO A;  4COP A;  1GPJ A;  3Q20 A;  4F37 A;  2VLQ A;  2K0D X;  1L0I A;  3H4E A;  2BUO A;  2FQ1 A;  2PEJ A;  3OW2 O;  5KP6 B;  4U0C A;  1EIA A;  5KP8 B;  1MZ8 A;  2GDY A;  2FAE A;  2JBG A;  1M90 Q;  3G21 A;  2KG6 A;  1CEI A;  2LL8 A;  2CWO A;  4MRT C;  1ZMB A;  1QRJ A;  4U0B A;  2KGE A;  3DS0 A;  4DG9 A;  2JQ4 A;  2KGC A;  2EIA A;  4QNB A;  3G28 A;  2PEM A;  2KG9 A;  5F2K A;  4U0D A;  2MR7 A;  1YJ9 P;  2LIU A;  2JGP A;  1T8K A;  2GZJ A;  1DV5 A;  2GZI A;  5HGN A;  4XFY A;  2MVV A;  1UJZ A;  3CCM P;  3B5I A;  4UHP B;  4M0I A;  1KC8 Q;  1VQ8 P;  3G4S P;  3LMO A;  3G6E P;  3CD6 P;  2FAC A;  2KGD A;  7CEI A;  2EFJ A;  5HGO A;  4GR6 A;  2VLP A;  1RO2 A;  2KOD A;  1K9M Q;  2ONT A;  1IMQ A;  3RG6 C;  1VQ9 P;  2DNW A;  2KOS A;  1Q86 Q;  3M1M A;  2PEN A;  2KWL A;  2E1M A;  3I56 P;  1AUM A;  2GDX A;  1YJW P;  2EHS A;  1M74 A;  3GZL A;  1YI2 P;  2N50 A;  1A8O A;  1M6N A;  2XXM A;  3VRL C;  4BPH A;  1K8A Q;  1VQL P;  3CCE P;  1EMV A;  3CC7 P;  1KD1 Q;  3CCQ P;  1Z6M A;  2LKI A;  1RO0 A;  2OAR A;  1VQK P;  2FHS C;  4H2Y C;  2K94 A;  4XRQ A;  5KP7 B;  2GYK A;  2JO0 A;  2MR8 A;  3DS5 A;  2K93 A;  2N5H A;  2XZ0 D;  1YIJ P;  2CGQ A;  1KQS O;  1ACP A;  5HV8 A;  2JYL A;  2K5X A;  3CCV P;  1VQ5 P;  3CXC O;  1L0H A;  2XZ1 C;  2L9F A;  4QKO A;  2AF8 A;  1BAJ A;  4PH1 A;  3I55 P;  2L0Q A;  1E6J P;  3U43 A;  4WYM A;  1KLP A;  3EJB A;  2VSQ A;  1GXH A;  1YJN P;  2JU1 A;  4PWV B;  3B4Q A;  5F2N A;  4U0F A;  2LML A;  1K30 A;  2ROQ A;  3CCR P;  3CME P;  4GR2 A;  3GZM A;  1QVF O; 
#chains in the Genus database with same CATH homology
 3DTJ A;  2PEQ A;  2ONT A;  3HYB A;  3CCU P;  3DS2 A;  3P05 A;  3HZQ A;  5BS1 A;  2OTL P;  3H47 A;  4U0E A;  3RG6 C;  1VQ9 P;  3WBH A;  1Q7Y Q;  2PEO A;  4COP A;  1Q86 Q;  1QVG O;  3CC2 P;  3M1M A;  1IUQ A;  3Q20 A;  2PEN A;  2E1M A;  3I56 P;  1VQN P;  3CCJ P;  1AUM A;  5HGM A;  3H4E A;  1YJW P;  1M74 A;  3G29 A;  1YI2 P;  5BS2 A;  2BUO A;  1D1D A;  1K73 Q;  2PEJ A;  1A8O A;  2Z44 A;  3OW2 O;  4U0C A;  3G71 P;  1EIA A;  1M6N A;  2XXM A;  3VRL C;  1K8A Q;  1RNI A;  2DGY A;  1VQL P;  3CCE P;  1NJI Q;  1N8R Q;  3G21 A;  1M90 Q;  3LRY A;  4COC A;  3CPW O;  1VQP P;  5HGL A;  3CC7 P;  1A43 A;  4U0A A;  1YIT P;  4PH0 A;  1KD1 Q;  2CWO A;  3CCQ P;  1ZMB A;  1EOQ A;  2OAR A;  1RO0 A;  2XT1 A;  1VQK P;  1QRJ A;  2EG5 A;  3CMA P;  4U0B A;  1M1K Q;  3DS0 A;  4XRQ A;  3H0D A;  3G0V A;  2JO0 A;  2PY8 A;  1JJ2 O;  3DS5 A;  2OTJ P;  4IPY A;  3DPH A;  2EIA A;  4QNB A;  1YIJ P;  3G28 A;  2PEM A;  3CCL P;  1Q81 Q;  1KQS O;  2L6E A;  1VQ7 P;  2JYL A;  3CCV P;  1VQ4 P;  3CC4 P;  5F2K A;  4U0D A;  2QA4 P;  1VQ5 P;  3MGE A;  3CXC O;  3DS1 A;  5JPA A;  3CCS P;  1VQM P;  1VQ6 P;  1W2B O;  5F2O A;  1BAJ A;  1YJ9 P;  1S72 P;  4XRO A;  2XV6 A;  2Z45 A;  4PH1 A;  3I55 P;  1E6J P;  2JYG A;  5HGN A;  3NTE A;  2M8L A;  5I4T G;  4WYM A;  1YHQ P;  3G1G A;  2M8N A;  4XFY A;  3CCM P;  3B5I A;  4XFX A;  4M0I A;  3DS3 A;  1VQO P;  1YJN P;  1KC8 Q;  1VQ8 P;  3G4S P;  3E2D A;  3G6E P;  2BHV A;  5F2N A;  4U0F A;  1Q82 Q;  2PEK A;  3CD6 P;  1K30 A;  3G1I A;  3CCR P;  4XFZ A;  3CME P;  4GR2 A;  1M6E X;  2PEI A;  2EFJ A;  2QEX P;  2LF4 A;  5HGO A;  4GR6 A;  3G26 A;  5DCK A;  1RO2 A;  2KOD A;  2P9X A;  3DS4 A;  1QVF O;  1K9M Q;  2Z46 A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...