1VQ4P

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq4P02
3CCMP 1JJ2O 1W2BO 3I56P 1K9MQ 3CMAP 1QVFO 1YITP 2OTJP 1KD1Q 1VQ7P 1K8AQ 3CCEP 3I55P 1NJIQ 1VQMP 3CCQP 1VQKP 1Q82Q 3CMEP 3CPWO 1N8RQ 1KQSO 3CCRP 3G71P 3CC7P 3OW2O 1YJWP 1YJNP 1K73Q 3G4SP 1M1KQ 3CC2P 1VQ8P 1Q7YQ 1VQ6P 1KC8Q 2QEXP 2OTLP 1QVGO 1VQPP 3CCUP 2QA4P 3CCJP 1YI2P 1YIJP 1S72P 1VQ4P 3CCSP 3CC4P 1YJ9P 3CD6P 1Q86Q 1YHQP 1VQ5P 3CCLP 3G6EP 3CCVP 1VQLP 1Q81Q 1M90Q 1VQNP 1VQOP 3CXCO 1VQ9P
chains in the Genus database with same CATH superfamily
1MV8A 1T8KA 1W2BO 1M8OB 4HKZH 2CNRA 1NJIQ 2KUBA 2PGDA 1LTGC 1SQQK 1YJNP 1IO4A 3FXEA 3CCUP 1NVOA 1BCCJ 1FAVA 5CBOA 1YTZT 1HTLC 1SQBD 1GPJA 1HY8A 2LIUA 4H44D 4NPEA 1KN7A 2GYKA 4IFFA 4Y99C 3L74G 1FOSE 4H13B 5KLVG 1DV5A 2JO0A 3H1LJ 1EOQA 1AA0A 1N7SA 5AVZB 2H7HA 1ZRTE 3H1JE 3RL0C 3DS5A 1R5SA 1NTZG 1PIXA 4DG9A 1CW5A 1N7SB 2ROQA 1EQ7A 3IF4A 3K5BA 1F80D 5AVTB 3L73E 5KLVK 2CQ8A 2N1TA 1JY3N 2AXTH 4OGQC 5AW0B 4R4MA 3H1KE 2LIWA 1JEKA 1Q81Q 2XXMA 2E1MA 2KGEA 3Q3DA 2IBZE 1OXZA 2E74B 2LTEA 1RQUA 2FYUE 4LC1A 3H1JJ 3GZLA 2KOSA 1WRGA 2NPSA 2Q3IA 2AF8A 2C9LY 1URQA 3CXHE 5HV8A 3TGUG 5AVXB 3R4YA 2NPSB 1FR2A 1KILC 3MGNA 2GZFA 1M7LA 1X8YA 3L70D 1URQB 1VF5C 1FDMA 2KLUA 1AVYA 3V2RA 1FZCA 1SQQD 2PP6A 3S4RA 3CX5D 1FBMA 4RO0A 3H47A 1LT9C 3E1RA 2YMKA 3KQGA 3I56P 3CWBD 1SQXJ 3ABVC 3JC22 1FZCB 1DH3A 1N7LA 1SQBE 5APXA 2FY8A 1UIIA 1MZ8A 1CSBA 1NWQA 2E5TA 3B71A 1RH5B 2QJYC 3AE5C 1HJBA 3EJEA 3CCLP 3AEAC 4DOJA 2ONTA 1SQPG 2O01H 5B66H 2XU6A 5KKZB 1SVFA 4U3FG 2BASA 3RK3C 1YIJP 3L74D 5KLVD 1KFNA 2ZT9B 4WYMA 2YXQB 1PP9G 1AV1A 1H88A 3Q20A 1SQBJ 1EDKA 1FC2C 2POHA 4I7ZC 1X0TA 4WY4A 1SQPK 2P10A 2JKVA 1VQPP 4UB6H 4XFJA 5M1BA 3V2QA 2A45I 3CCSP 5JPAA 4WY4B 1NTKK 1SFCA 3G1IA 1EXJA 3AE9C 1NHLA 2RMZA 1E5WA 1AJYA 4XFZA 1NTMG 2MKVA 3IFMA 4OVNF 1SFCB 2YMYA 1A8OA 1KB9I 5KAFH 3GHGA 2L6EA 5BS1A 3SWYA 3L71G 2ZXEB 5AW4B 4K35A 3L70E 5AVRB 4BRYA 4UB8H 1KQGB 1SQQE 3TGUD 1K73Q 3CX5E 1MZ9A 2FQ1A 4BRYB 1L0LE 3CWBE 5AW6B 1P84H 2WSCJ 3GZMA 4Z1MH 1WMKA 1JTHA 3WUVA 4PJ0H 1YBKA 3L72J 4XFXA 2WT7A 1RE3C 4NEOA 3H6PA 4WWIA 1JTHB 4IOIH 1NAFA 2MR8A 1GU5A 1SQQJ 4JQ0D 2OYHA 2WT7B 1JY2N 2IFMA 3TYYA 2FVFA 1S2EA 1PL5A 3L74E 2JWAA 5KLVE 2OYHB 2MY5A 1FE6A 1KFMA 1OW8A 1GDTA 4RJTA 3GJNA 2Z5HA 5APTA 1MKMA 3H4EA 1SQPD 2M5RA 4PWVB 1KMIZ 4H44B 2EG5A 5KJ7D 2FXMA 1JCDA 1LTJC 3L4FA 1CI6A 2X2BA 1NTKD 1PP9D 3JCUE 2H43A 4BPHA 5AVQB 1NU1G 3CLQA 1CI6B 3L74J 3A0BH 2WTYA 5HGOA 2LMLA 2EIAA 1H8AA 2HODA 2PENA 4NPDA 3FXDA 3MUDC 2Z5IA 4N3YB 2ZYDA 1J1DB 1DD4A 5E79H 1IK7A 3PP5A 2E5YA 2K9YA 1NU1K 3HD7C 2HODB 2W90A 5AW7B 1FZEA 1HBWA 3U1AA 3TGUE 5KKZC 5CCHD 5E79E 1AUMA 2OTJP 1J1EC 1VQ8P 2O3JA 3L71D 1VHNA 1HJ0A 1HWTC 5KP8B 1YQ3C 2ZT9C 1JUNA 3OW2O 1S5LE 3AE8C 1IUQA 2YO3A 3KZIH 5HVCA 3F5HA 2VLOA 3MGEA 1A02F 5KAIE 3C9IA 4Y99B 2KWLA 1OW7A 3LW5H 3MP7B 3V4QA 2LR2A 2P1JA 1PGPA 2ZYGA 5APVA 3CCEP 4WY4C 3D6ZA 1NQ4A 3KPEA 1SQVK 4I6MC 4IL6H 2XZ0D 3G0VA 4W7YA 3RL0B 1PEUA 1VPCA 4U0DA 3KXDA 2E75D 3VMYA 1KB9D 1SFCC 2HFED 2AVAA 4BPFA 1JNMA 2D2CD 1SQPE 1Q82Q 3HD7D 4H2XC 3RK2D 2DNWA 1UJZA 1M56D 3P8CD 2KGAA 1VL2A 2WPSA 1UNKA 3H1HG 2XV6A 1S72P 4YXWH 2JU1A 1PP9E 3KYQA 1EIAA 1L2PA 1EZVG 3WUTA 2JGPA 1KILA 3FX0A 4IL6X 1NYHA 2R44A 3RL0g 5AW5B 1IZNB 1VDFA 1KILB 2PEJA 3NFQA 2E43A 2GZEA 1FZBA 4WB4A 3D6YA 1NU1D 2BHVA 1LT9A 2AEMA 3NTNA 4PXHB 1GW4A 2YIUC 1GW3A 2PY8A 1E0HA 1USDA 3V2NA 3CC2P 2WSEJ 1NTKJ 5H2FE 1IFPA 3D70A 4PV1D 3TNUA 2Q7CA 2MR7A 3DS0A 3L71E 4D6TG 3BVHA 1RY3A 4HB1A 2Z45A 2IFNA 4ZKPA 3M0DA 4I2LC 1LTIC 3TNUB 1USEA 2DGYA 2B9BA 2N6ZA 3PHLA 5AVSB 3CMEP 1N8RQ 1EDJA 4H44C 1P84I 5KP6B 1ZV8A 3G21A 2CGQA 2XV5A 1OIPA 1SQVD 2K0YA 2QJKC 1MUUA 1QL1A 1OVRA 4AYCA 3LMOA 2KODA 2O1JA 4O9BA 5CJ0A 1KB9E 3GG2A 3LIDA 2FVAA 3Q5PA 2YO2A 2L9FA 1BDCA 4OWFA 1OZHA 2PFXA 4XRQA 4I7ZB 2FQ2A 4W80A 1KQLA 2MF4A 3P8CE 2JQ4A 2QM7A 3II6A 1T2KD 3N7NA 4PD4H 1L0NJ 1NAYA 1L0LK 1HVVA 3VOPA 3DS4A 3VTPC 1IC2A 3H1HD 1M6EX 4L76A 2BQ1E 1BE3G 3G29A 2PRRA 3B8EB 3M0AA 4NPFX 3B5IA 3EFFK 2HPCA 2FYZA 1DX7A 3BCCJ 1NU1E 2K3RA 5F2NA 2KSJA 5DCKA 1Z56A 3MZWB 3HUSA 2ZAEB 2HPCB 3CI9A 2K37A 2KOOA 1A43A 3FWNA 3HUSB 1RE3A 1HF9A 1FDOA 1WT6A 3LRYA 3D71A 4H0LD 2W6AA 1RE4C 3AEEC 1NTZK 1BDDA 4ZKUA 4D6TD 2YKPA 1J2JB 2AXTE 2KS1A 5GTIH 1S9KD 3V6IA 3CCQP 1SQVE 2LF4A 3CL3D 2NZ2A 1LTBC 3L35A 2KS1B 4L75A 1JY3P 1NKZB 1XTCC 4YTPC 1OMIA 3L73J 4XFYA 3CCMP 1LTSC 2C0XA 5DJUB 3H1KJ 1T8ZA 1LTJA 1MFTA 2OTLP 1GZLA 2LXBA 3TF5A 2L91A 5APWA 2WZ7A 3H1IG 1IFDA 1LTJB 2J5UA 1Q86Q 1SQVJ 2FYUJ 1GK6A 2VLPA 4XE5B 5BU5A 3L75G 2K2QA 1L0LD 2JYLA 1BGYG 3B4SA 2R3CA 4IFDK 2ZFCA 2OARA 2B89A 5BVZA 3MUDA 2O1KA 1Q7YQ 3A0HH 3A2AA 3H1HE 1JCCA 3TDKA 2AEFA 2E75B 3A5TA 1PEQA 3HD7A 1JMMA 2KLVA 2I1JA 1P84D 2P7JA 1EZVE 3M0DC 4HJGH 2KORA 3GMAA 1QX8A 2D2CB 3HD7B 3RK2B 1EC5A 3FGAD 5AVUB 1OW6A 1BE3D 3F89A 1QGKB 2FXPA 3VP9A 1J1EB 2I8DA 4GIFA 3Q2YA 5APYA 5B66E 1HGZA 2HR3A 2SPZA 4JYBA 2KOQA 3M9QA 4JPZB 2PEMA 3BATA 1NTZD 2W8ZA 2KIKA 5L8RJ 4D6TE 2WPVB 5APSA 1S9KE 1HGVA 3T97A 1GTWA 5CHXA 2E76D 1ZR4A 2QNWA 1TU3F 2CK3H 2I1KA 2WPTA 4UB6E 2AFDA 3T97B 2IX7C 4IPYA 2QJPC 5EFWB 4PV1B 3N4XA 2O01J 1JY3O 3WU2H 2WSCH 1YI2P 1BAJA 2KW2A 1NKNA 5CCGD 3AECC 1OVUA 4I1LA 2KNCB 1N2DC 3WU2E 2M5AB 3KHUA 5KAFE 1KQFB 2JP3A 1NTMK 2WSFH 1ZMBA 1KYOH 5KJ7C 3P32A 4COCA 1ZP0C 1Q90D 3WUUA 4UB8E 2QG4A 3HUSC 2EHTA 3E1IA 2BCCG 4PD4I 3GKLC 4C7NA 3G71P 2EHSA 1P84E 3L75D 2V4HA 1L4AD 2O01N 1BGYD 1LTTC 3L70J 3B4QA 1GXHA 4EDFA 4GDOA 4PJ0E 1QRJA 2YIUB 4C7NB 2PEOA 3R2PA 3MIWA 1BE3E 1X9VA 1BCCG 2Q9IA 1N73C 1L0LJ 3A3YB 2NO8A 3QH9A 2XZRA 5CCHC 3CWBJ 5HGMA 5AW3B 3AE2C 1NTZE 4U3FD 1GL2C 1VQNP 1VQ9P 2K0DX 2XNDH 5AVWB 1YITP 1JY2P 2KZJA 3NXSA 2QJKB 4H13D 3V2PA 3AEDC 4N6JA 3DS2A 1HQBA 1M74A 1RO2A 2JR8A 4EIJA 5CJ4A 5KLVJ 1OFCX 2E75C 2HYNA 3JSVC 1NTZJ 3A0BE 2KYVA 3WMM0 4GR2A 2G8YA 2D2CC 1K04A 2IYPA 2FQ0A 1NTMD 2QRXA 4M3LA 5EJDA 3RK2C 2CPBA 3H1JG 2OYOA 3CCVP 2N1TD 1PPJG 1IK9A 3HYBA 2Q5UA 2FYNB 1U57A 1NOHA 3RGUA 1M1KQ 1UIXA 5CMZA 2FADA 3NMDA 1GL2D 2KSEA 3U1CA 4EOTA 3KDPB 2XNXA 1Y8AA 2GDXA 3SWFA 2ERHA 3EJBA 3P05A 3L75E 5I4TG 4AUWA 1BGYE 1EZVI 3KZIE 1D7MA 2IBZG 1ACPA 4XROA 1ZMEC 5KLIB 1URQD 3TGUJ 1JMBA 5BU8B 2QVAA 1OR5A 5AW2B 1SQXG 3V4WA 1X3OA 2R5DA 2GM4A 1ZR2A 2P67A 3ZDMA 2N6YA 4PV1C 1RE4A 4IL6E 2XDJA 5GTHH 1YQ4C 1AYIA 5KTBA 3A7OA 4ASVA 4N78E 1VQ7P 3Q5RA 3HZQA 3EJDA 1M57D 4R0MA 4JF7A 4U3FE 3SWKA 5GTHE 1SQXK 2ZVNB 1PFIA 1S5LX 2Y0CA 3C8VA 5KP7B 1PGOA 2K0XA 2GDWA 1JY2O 2C0WA 2WSEH 1FS0E 4HH2A 2V7QH 2IZ0A 2UWJE 4PD4D 4GR6A 2FXOA 1KC8Q 1SQBG 3HE4A 2P58A 5F2KA 4C7RA 4EI2A 4BWNA 1SQPJ 3Q5SA 1RO0A 4L74A 3TK1A 1LP1A 4U3FJ 2JBGA 1K9MQ 4C46A 2Y0DA 3H0DA 2PAJA 3HE4B 1NTME 3L36A 3VMXA 2XZ1C 3B5NC 1JO5A 2JWDA 2WSSH 1PP9J 3M1MA 1LP1B 1T2KC 2Y0EA 2E76B 2HLOA 2OYIA 2K94A 4A7PA 1LWUA 2BUOA 3DPHA 2B88A 1KYOI 1IFJA 3I55P 5CCGA 1PPJD 2OYIB 1AQ5A 3G3ZA 1LWUB 3MHVA 3AE4C 3EWKA 2KR5A 3VP8A 2Q1KA 1EXIA 3UIAA 1VQ4P 1S4XA 1NTMJ 2LOLA 1U7MA 1PZQA 5K5GB 3H25A 2Z44A 4RESB 1JJ2O 1LJ2A 2K9JA 2W83C 1R5LA 3L71J 2RN0A 2GUVA 1RF0A 1QEXA 4H2WC 4B86A 3DS3A 2K9JB 3L72G 1AFOA 3SFDC 1KTMA 2AFEA 1NH4A 2M3EA 3HTKB 3S1KA 2JEEA 4BPGA 3PLNA 3B5ND 2P9XA 1SQXD 4PH1A 4H0LC 3MD0A 5APUA 1L4AB 1E79H 1M1JC 4M0IA 2FYNC 2KP8A 3VYIA 2QIWA 4JBZA 3BRVB 1W5CE 2QJPB 4PD4E 2N98A 1QVFO 2W6BA 3RBZA 2YKQA 3IAOA 1EZVD 4COPA 3DTJA 4XA4A 5KJ7A 2WPQA 2M8LA 4RKUJ 2K92A 1FJKA 5KLIC 5TJHA 2KOGA 1VQ5P 1OWAA 1KV4A 1EDLA 2MVUA 1DEEG 3CMAP 1YYCA 3M91A 4ZMDA 2IYOA 1A02J 4UHPB 2DW3A 4OH8B 4IZ6A 4QMAA 2R32A 1EDIA 1AF8A 4F37A 1FJPA 1ZNVA 1PPJE 2GUSA 3G6EP 1ZXGA 2IZ1A 2AXCA 1NU1J 2QM8A 1N73A 2Y9YA 3PRJA 5CCHA 4K3AA 4DZOA 3AE3C 4GOEA 1YTZI 2JJLA 2L22A 1N73B 5GTIE 2OQQA 4Y28J 2N1TB 2L5GB 5HGLA 5AW8B 3BASA 1GU4A 3CE7A 5AVVB 3H32A 1GL2A 2NRGA 2PEIA 1S3JA 3CXHH 4PH0A 2J58A 1X79B 5C39A 2N5HA 4IFMA 3GF3A 5AVYB 3H32B 1GL2B 3RG2A 1SQXE 4ZNCA 1GD2E 4U0AA 3GF7A 4WBAA 2QE7H 2ZYAA 3L72D 2GZGA 1PV3A 1KD1Q 2E76C 2KZIA 4QKOA 4LGDE 1ZLLA 2P2UA 1YJWP 1LNQA 5F2OA 3RL0D 1KYOD 2KGDA 3G26A 2WITA 1LGHB 2K5XA 2OYIC 1LWUC 2BEQD 3AEBC 4HKGA 3A0HE 4MRTC 1R8EA 4OGQD 3VN0A 1PEMA 5CCGC 3OJAB 2VRSA 2W6JH 1ZW0A 1JM0A 3G28A 3NY7B 2XKMA 2ZVOB 1VQLP 3SSUA 3VMAA 1M90Q 4YXDC 1KZUB 1H89A 3H1HJ 2M8NA 3RG6C 1VQKP 1VKUA 1RF0C 3GLMA 4CPGA 5BS2A 1PGJA 4MN4C 1IFMA 2WPRA 1KILD 1L4AC 1BXIA 1NTKG 1DEBA 3VRLC 1VF5D 4U0BA 2FKWB 1RF1C 1PGQA 1RNIA 1LTAC 1VQ6P 5EW5E 2IDBA 1QL2A 1XTGB 4GT1A 3AE6C 2KNCA 1HH0A 5AW1B 2M5AA 1U7JA 1L0IA 3S9OA 2N50A 5DJTB 3M9BA 2CWOA 4D6TJ 2YXRB 1BSNA 2B87A 3U59A 4DCKA 2FACA 3CCJP 3L72E 2IPPA 4H13C 3CX5H 1YHQP 3USSA 4AQRD 2B87B 3GHGB 1FU1A 1JB0J 1KYOE 3FWLA 3H1ID 3PJSK 3RK3D 1K30A 1L0HA 5HGNA 4ASWA 4BXLA 3B5NA 1N7SC 2A06G 1DNYA 2A45G 2K93A 2MD9A 1AQTA 1YJ9P 1T3JA 1CEIA 2OTKE 4U7JA 2KB7P 2C9NY 1L0NG 3B5NB 1IFIA 2M8PA 1BSHA 4QNBA 3QWOC 3MTUE 1FDIA 2N1TC 2ZJSE 3WBHA 3U43A 2WSFJ 2Y9ZA 3BRTB 1QVGO 3EFGA 2E74C 4N78D 1PEOA 1KLPA 1NO4A 1L0NK 4GODA 7CEIA 1W2EA 1S1CX 3BCCG 4H2YC 3HRNA 2FFDA 3H1LG 1DIPA 4HYTB 1G1IA 1DD3A 2G3AA 1KILE 3G4SP 1IJDB 2NPSC 4U0EA 5AW9B 1BE3J 2FFDB 3JCUH 1IMQA 3OA7A 1URQC 3AEGC 2Q6QA 5APQA 1Z6MA 2KI7B 4WVZA 2KGCA 2W27A 2LKMA 4GKGA 2LXCB 3M06A 1N7SD 2IBZI 2FVEA 1D1DA 2WVRA 2H89C 1OX3A 3CC7P 4R4LA 4W7ZA 3M9HA 3EQ2A 2PEKA 1OVVA 4LLHA 1M1JA 1FZCC 2PNGA 2VLNA 2FAEA 3TSIA 3RBXA 4H0LB 2JDIH 3CXHI 3AE7C 1IFNA 2LKIA 1M1JB 2KOPA 3G1GA 1VQMP 2E74D 4TT3H 2VLQA 2KK7A 3L73G 3C1LA 3PTZA 4TLFA 3H1IE 3H1KG 2XT1A 1FZGA 1S5LH 3RK3E 5CZDB 3AEFC 3W68A 3P8MC 4KHXA 2E42A 1VQOP 5KAIH 1JOCA 1T6AA 2NPSD 1SS1A 3IR9A 4DJGA 1Y9BA 2JYGA 2M0BA 3CPWO 1SQVG 2FYUG 1RHZB 2BCCD 3G9RA 5TISH 2Q3EA 2RH0A 2R3SA 3DS1A 1T3UA 2OGUA 1NGMB 2GDYA 2A06D 2J59M 2CG5B 2AEJA 1G2CA 4CA3A 3W67A 5TISE 4L73A 2GZIA 1Y47A 2JB0A 3H1IJ 1IMPA 2FYUK 1N86A 1L0ND 2L4BA 1FOSF 2BEZF 2GA1A 3L75J 1G2CB 1BCCD 1BGYJ 2GZJA 2CPSA 5B5EH 2N5IA 1X22A 3SFEC 2FBWC 3L37A 4DT0A 1QLED 3LIEA 3AE1C 1GK4A 2Z46A 4OGQB 2YKOA 2MJZA 2WMMA 3LW5J 3CD6P 5B5EE 2HG5D 1KQSO 2K88A 3BCCD 1KORA 3H1LD 3GHGC 2QSIA 3P7KA 3OAKA 1NTKE 1EMVA 1AVOA 3I5CA 2ZT9D 2M8RA 1LT1A 3VMZA 2WWWA 4GOFA 3O8ZA 2Z4EA 2FHSC 1HUCA 2H88C 2N9YB 3V5BA 2EFJA 1ZN5A 2KG9A 1SQBK 1M6NA 1CZQA 3E7KA 4U0CA 5H2FH 1Q2NA 4WY4D 3HE5A 1VF5B 1FZAA 3CXCO 2KXPB 1ZRTD 1E6JP 2YNYA 3H1JD 3CCRP 3GW6A 1H0TA 1SFCD 3HE5B 2LPKA 3O6QA 2V7QJ 3CX5I 1LT9B 4EYYQ 1RQVA 1ZOYC 4JYCA 1G1JA 2OYHC 1FZFA 4KJMA 3ITKA 3L73D 2KG6A 1H0TB 2N9BA 2A45H 3O6QB 3PH0A 2BCCE 3H1KD 2FFDC 2K1AA 3IN6A 2KG8A 2M3BA 3NTEA 2JU2A 2MVVA 3HTKA 1GMJA 2ZXXA 2QJYB 2JAZA 2A06E 2QEXP 2IBZD 2ITAA 3Q1MA 2R5BA 2RKLA 2FYUD 4U0FA 1KB9H 1SP4A 2PEQA 1L4AA 1L0NE 2WQYC 3L70G 1BCCE 3RK3B 1GXGA 2JO1A 1RF1A 5CBNA 1K8AQ 4YPCA 2LL8A 3CXHD 2H8PD 1SQQG 4KT0J 2L0QA 2BCCJ 2QA4P 1K05A 1L0LG 3E2DA 2VSQA 1RF1B 3CC4P 3CWBG 1J1DC 1MFZA 1SLQA 3BCCE 3H1LE
chains in the Genus database with same CATH topology
1W2BO 3CMAP 4XFZA 4XROA 1PEMA 2PEMA 3G1GA 3I55P 1K30A 3CCQP 1VQMP 1Q82Q 1NJIQ 5HGMA 1YJNP 2LF4A 5HGNA 1A8OA 2EFJA 2L6EA 3CCUP 5BS1A 3G28A 2XV6A 1M6NA 2XT1A 1S72P 1VQ4P 1YJ9P 4XRQA 4U0CA 1EIAA 5HGOA 3G6EP 1VQLP 3H47A 2EIAA 2Z44A 1M90Q 1VQOP 3CXCO 1VQ9P 4XFYA 3CCMP 1JJ2O 1VQNP 3I56P 2M8PA 2PENA 1E6JP 4QNBA 1YITP 1VQ7P 2JYGA 2M8NA 3RG6C 1VQKP 3CPWO 3HZQA 3CCRP 3WBHA 4IPYA 1K73Q 2JO0A 2OTLP 5BS2A 1QVGO 1EOQA 3DS2A 1M74A 1YI2P 3DS3A 3DS1A 1BAJA 1PEOA 2PEJA 1RO2A 1Q86Q 3DS5A 3DS4A 5HGLA 1AUMA 1M6EX 3VRLC 3CCLP 2OTJP 2BHVA 4U0BA 1VQ8P 2P9XA 2JYLA 2BQ1E 3G29A 4PH1A 1RNIA 2PEIA 2OARA 2PY8A 1VQ6P 4PH0A 2ONTA 3NTEA 3B5IA 4XFXA 3OW2O 3CC2P 3G4SP 1Q7YQ 1IUQA 1ZMBA 4U0EA 4GR6A 1KC8Q 2QEXP 3DS0A 4M0IA 4COCA 4GR2A 3MGEA 5F2NA 5DCKA 1PEQA 4U0AA 1YIJP 5F2KA 4U0FA 2Z45A 2PEQA 4WYMA 3CCVP 1Q81Q 1RO0A 2XXMA 2Z46A 2E1MA 3Q20A 2DGYA 3HYBA 1K9MQ 3H0DA 2CWOA 1QVFO 1KD1Q 1K8AQ 3CCEP 3CMEP 3CD6P 1D1DA 1N8RQ 1KQSO 3CC7P 3G71P 1A43A 1YJWP 1M1KQ 5F2OA 3G0VA 4COPA 3DTJA 3G21A 3M1MA 2PEKA 3G26A 1VQPP 1PEUA 2QA4P 3CCJP 4U0DA 3E2DA 2M8LA 3CCSP 3H4EA 3CC4P 3LRYA 5JPAA 1QRJA 2PEOA 1YHQP 1VQ5P 3P05A 2BUOA 5I4TG 3G1IA 3DPHA 2EG5A 2KODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM P;  1JJ2 O;  1W2B O;  3I56 P;  1K9M Q;  3CMA P;  1QVF O;  1YIT P;  2OTJ P;  1KD1 Q;  1VQ7 P;  1K8A Q;  3CCE P;  3I55 P;  1NJI Q;  1VQM P;  3CCQ P;  1VQK P;  1Q82 Q;  3CME P;  3CPW O;  1N8R Q;  1KQS O;  3CCR P;  3G71 P;  3CC7 P;  3OW2 O;  1YJW P;  1YJN P;  1K73 Q;  3G4S P;  1M1K Q;  3CC2 P;  1VQ8 P;  1Q7Y Q;  1VQ6 P;  1KC8 Q;  2QEX P;  2OTL P;  1QVG O;  1VQP P;  3CCU P;  2QA4 P;  3CCJ P;  1YI2 P;  1YIJ P;  1S72 P;  1VQ4 P;  3CCS P;  3CC4 P;  1YJ9 P;  3CD6 P;  1Q86 Q;  1YHQ P;  1VQ5 P;  3CCL P;  3G6E P;  3CCV P;  1VQL P;  1Q81 Q;  1M90 Q;  1VQN P;  1VQO P;  3CXC O;  1VQ9 P; 
#chains in the Genus database with same CATH topology
 1MV8 A;  1T8K A;  1W2B O;  1M8O B;  4HKZ H;  2CNR A;  1NJI Q;  2KUB A;  2PGD A;  1LTG C;  1SQQ K;  1YJN P;  1IO4 A;  3FXE A;  3CCU P;  1NVO A;  1BCC J;  1FAV A;  5CBO A;  1YTZ T;  1HTL C;  1SQB D;  1GPJ A;  1HY8 A;  2LIU A;  4H44 D;  4NPE A;  1KN7 A;  2GYK A;  4IFF A;  4Y99 C;  3L74 G;  1FOS E;  4H13 B;  5KLV G;  1DV5 A;  2JO0 A;  3H1L J;  1EOQ A;  1AA0 A;  1N7S A;  5AVZ B;  2H7H A;  1ZRT E;  3H1J E;  3RL0 C;  3DS5 A;  1R5S A;  1NTZ G;  1PIX A;  4DG9 A;  1CW5 A;  1N7S B;  2ROQ A;  1EQ7 A;  3IF4 A;  3K5B A;  1F80 D;  5AVT B;  3L73 E;  5KLV K;  2CQ8 A;  2N1T A;  1JY3 N;  2AXT H;  4OGQ C;  5AW0 B;  4R4M A;  3H1K E;  2LIW A;  1JEK A;  1Q81 Q;  2XXM A;  2E1M A;  2KGE A;  3Q3D A;  2IBZ E;  1OXZ A;  2E74 B;  2LTE A;  1RQU A;  2FYU E;  4LC1 A;  3H1J J;  3GZL A;  2KOS A;  1WRG A;  2NPS A;  2Q3I A;  2AF8 A;  2C9L Y;  1URQ A;  3CXH E;  5HV8 A;  3TGU G;  5AVX B;  3R4Y A;  2NPS B;  1FR2 A;  1KIL C;  3MGN A;  2GZF A;  1M7L A;  1X8Y A;  3L70 D;  1URQ B;  1VF5 C;  1FDM A;  2KLU A;  1AVY A;  3V2R A;  1FZC A;  1SQQ D;  2PP6 A;  3S4R A;  3CX5 D;  1FBM A;  4RO0 A;  3H47 A;  1LT9 C;  3E1R A;  2YMK A;  3KQG A;  3I56 P;  3CWB D;  1SQX J;  3ABV C;  3JC2 2;  1FZC B;  1DH3 A;  1N7L A;  1SQB E;  5APX A;  2FY8 A;  1UII A;  1MZ8 A;  1CSB A;  1NWQ A;  2E5T A;  3B71 A;  1RH5 B;  2QJY C;  3AE5 C;  1HJB A;  3EJE A;  3CCL P;  3AEA C;  4DOJ A;  2ONT A;  1SQP G;  2O01 H;  5B66 H;  2XU6 A;  5KKZ B;  1SVF A;  4U3F G;  2BAS A;  3RK3 C;  1YIJ P;  3L74 D;  5KLV D;  1KFN A;  2ZT9 B;  4WYM A;  2YXQ B;  1PP9 G;  1AV1 A;  1H88 A;  3Q20 A;  1SQB J;  1EDK A;  1FC2 C;  2POH A;  4I7Z C;  1X0T A;  4WY4 A;  1SQP K;  2P10 A;  2JKV A;  1VQP P;  4UB6 H;  4XFJ A;  5M1B A;  3V2Q A;  2A45 I;  3CCS P;  5JPA A;  4WY4 B;  1NTK K;  1SFC A;  3G1I A;  1EXJ A;  3AE9 C;  1NHL A;  2RMZ A;  1E5W A;  1AJY A;  4XFZ A;  1NTM G;  2MKV A;  3IFM A;  4OVN F;  1SFC B;  2YMY A;  1A8O A;  1KB9 I;  5KAF H;  3GHG A;  2L6E A;  5BS1 A;  3SWY A;  3L71 G;  2ZXE B;  5AW4 B;  4K35 A;  3L70 E;  5AVR B;  4BRY A;  4UB8 H;  1KQG B;  1SQQ E;  3TGU D;  1K73 Q;  3CX5 E;  1MZ9 A;  2FQ1 A;  4BRY B;  1L0L E;  3CWB E;  5AW6 B;  1P84 H;  2WSC J;  3GZM A;  4Z1M H;  1WMK A;  1JTH A;  3WUV A;  4PJ0 H;  1YBK A;  3L72 J;  4XFX A;  2WT7 A;  1RE3 C;  4NEO A;  3H6P A;  4WWI A;  1JTH B;  4IOI H;  1NAF A;  2MR8 A;  1GU5 A;  1SQQ J;  4JQ0 D;  2OYH A;  2WT7 B;  1JY2 N;  2IFM A;  3TYY A;  2FVF A;  1S2E A;  1PL5 A;  3L74 E;  2JWA A;  5KLV E;  2OYH B;  2MY5 A;  1FE6 A;  1KFM A;  1OW8 A;  1GDT A;  4RJT A;  3GJN A;  2Z5H A;  5APT A;  1MKM A;  3H4E A;  1SQP D;  2M5R A;  4PWV B;  1KMI Z;  4H44 B;  2EG5 A;  5KJ7 D;  2FXM A;  1JCD A;  1LTJ C;  3L4F A;  1CI6 A;  2X2B A;  1NTK D;  1PP9 D;  3JCU E;  2H43 A;  4BPH A;  5AVQ B;  1NU1 G;  3CLQ A;  1CI6 B;  3L74 J;  3A0B H;  2WTY A;  5HGO A;  2LML A;  2EIA A;  1H8A A;  2HOD A;  2PEN A;  4NPD A;  3FXD A;  3MUD C;  2Z5I A;  4N3Y B;  2ZYD A;  1J1D B;  1DD4 A;  5E79 H;  1IK7 A;  3PP5 A;  2E5Y A;  2K9Y A;  1NU1 K;  3HD7 C;  2HOD B;  2W90 A;  5AW7 B;  1FZE A;  1HBW A;  3U1A A;  3TGU E;  5KKZ C;  5CCH D;  5E79 E;  1AUM A;  2OTJ P;  1J1E C;  1VQ8 P;  2O3J A;  3L71 D;  1VHN A;  1HJ0 A;  1HWT C;  5KP8 B;  1YQ3 C;  2ZT9 C;  1JUN A;  3OW2 O;  1S5L E;  3AE8 C;  1IUQ A;  2YO3 A;  3KZI H;  5HVC A;  3F5H A;  2VLO A;  3MGE A;  1A02 F;  5KAI E;  3C9I A;  4Y99 B;  2KWL A;  1OW7 A;  3LW5 H;  3MP7 B;  3V4Q A;  2LR2 A;  2P1J A;  1PGP A;  2ZYG A;  5APV A;  3CCE P;  4WY4 C;  3D6Z A;  1NQ4 A;  3KPE A;  1SQV K;  4I6M C;  4IL6 H;  2XZ0 D;  3G0V A;  4W7Y A;  3RL0 B;  1PEU A;  1VPC A;  4U0D A;  3KXD A;  2E75 D;  3VMY A;  1KB9 D;  1SFC C;  2HFE D;  2AVA A;  4BPF A;  1JNM A;  2D2C D;  1SQP E;  1Q82 Q;  3HD7 D;  4H2X C;  3RK2 D;  2DNW A;  1UJZ A;  1M56 D;  3P8C D;  2KGA A;  1VL2 A;  2WPS A;  1UNK A;  3H1H G;  2XV6 A;  1S72 P;  4YXW H;  2JU1 A;  1PP9 E;  3KYQ A;  1EIA A;  1L2P A;  1EZV G;  3WUT A;  2JGP A;  1KIL A;  3FX0 A;  4IL6 X;  1NYH A;  2R44 A;  3RL0 g;  5AW5 B;  1IZN B;  1VDF A;  1KIL B;  2PEJ A;  3NFQ A;  2E43 A;  2GZE A;  1FZB A;  4WB4 A;  3D6Y A;  1NU1 D;  2BHV A;  1LT9 A;  2AEM A;  3NTN A;  4PXH B;  1GW4 A;  2YIU C;  1GW3 A;  2PY8 A;  1E0H A;  1USD A;  3V2N A;  3CC2 P;  2WSE J;  1NTK J;  5H2F E;  1IFP A;  3D70 A;  4PV1 D;  3TNU A;  2Q7C A;  2MR7 A;  3DS0 A;  3L71 E;  4D6T G;  3BVH A;  1RY3 A;  4HB1 A;  2Z45 A;  2IFN A;  4ZKP A;  3M0D A;  4I2L C;  1LTI C;  3TNU B;  1USE A;  2DGY A;  2B9B A;  2N6Z A;  3PHL A;  5AVS B;  3CME P;  1N8R Q;  1EDJ A;  4H44 C;  1P84 I;  5KP6 B;  1ZV8 A;  3G21 A;  2CGQ A;  2XV5 A;  1OIP A;  1SQV D;  2K0Y A;  2QJK C;  1MUU A;  1QL1 A;  1OVR A;  4AYC A;  3LMO A;  2KOD A;  2O1J A;  4O9B A;  5CJ0 A;  1KB9 E;  3GG2 A;  3LID A;  2FVA A;  3Q5P A;  2YO2 A;  2L9F A;  1BDC A;  4OWF A;  1OZH A;  2PFX A;  4XRQ A;  4I7Z B;  2FQ2 A;  4W80 A;  1KQL A;  2MF4 A;  3P8C E;  2JQ4 A;  2QM7 A;  3II6 A;  1T2K D;  3N7N A;  4PD4 H;  1L0N J;  1NAY A;  1L0L K;  1HVV A;  3VOP A;  3DS4 A;  3VTP C;  1IC2 A;  3H1H D;  1M6E X;  4L76 A;  2BQ1 E;  1BE3 G;  3G29 A;  2PRR A;  3B8E B;  3M0A A;  4NPF X;  3B5I A;  3EFF K;  2HPC A;  2FYZ A;  1DX7 A;  3BCC J;  1NU1 E;  2K3R A;  5F2N A;  2KSJ A;  5DCK A;  1Z56 A;  3MZW B;  3HUS A;  2ZAE B;  2HPC B;  3CI9 A;  2K37 A;  2KOO A;  1A43 A;  3FWN A;  3HUS B;  1RE3 A;  1HF9 A;  1FDO A;  1WT6 A;  3LRY A;  3D71 A;  4H0L D;  2W6A A;  1RE4 C;  3AEE C;  1NTZ K;  1BDD A;  4ZKU A;  4D6T D;  2YKP A;  1J2J B;  2AXT E;  2KS1 A;  5GTI H;  1S9K D;  3V6I A;  3CCQ P;  1SQV E;  2LF4 A;  3CL3 D;  2NZ2 A;  1LTB C;  3L35 A;  2KS1 B;  4L75 A;  1JY3 P;  1NKZ B;  1XTC C;  4YTP C;  1OMI A;  3L73 J;  4XFY A;  3CCM P;  1LTS C;  2C0X A;  5DJU B;  3H1K J;  1T8Z A;  1LTJ A;  1MFT A;  2OTL P;  1GZL A;  2LXB A;  3TF5 A;  2L91 A;  5APW A;  2WZ7 A;  3H1I G;  1IFD A;  1LTJ B;  2J5U A;  1Q86 Q;  1SQV J;  2FYU J;  1GK6 A;  2VLP A;  4XE5 B;  5BU5 A;  3L75 G;  2K2Q A;  1L0L D;  2JYL A;  1BGY G;  3B4S A;  2R3C A;  4IFD K;  2ZFC A;  2OAR A;  2B89 A;  5BVZ A;  3MUD A;  2O1K A;  1Q7Y Q;  3A0H H;  3A2A A;  3H1H E;  1JCC A;  3TDK A;  2AEF A;  2E75 B;  3A5T A;  1PEQ A;  3HD7 A;  1JMM A;  2KLV A;  2I1J A;  1P84 D;  2P7J A;  1EZV E;  3M0D C;  4HJG H;  2KOR A;  3GMA A;  1QX8 A;  2D2C B;  3HD7 B;  3RK2 B;  1EC5 A;  3FGA D;  5AVU B;  1OW6 A;  1BE3 D;  3F89 A;  1QGK B;  2FXP A;  3VP9 A;  1J1E B;  2I8D A;  4GIF A;  3Q2Y A;  5APY A;  5B66 E;  1HGZ A;  2HR3 A;  2SPZ A;  4JYB A;  2KOQ A;  3M9Q A;  4JPZ B;  2PEM A;  3BAT A;  1NTZ D;  2W8Z A;  2KIK A;  5L8R J;  4D6T E;  2WPV B;  5APS A;  1S9K E;  1HGV A;  3T97 A;  1GTW A;  5CHX A;  2E76 D;  1ZR4 A;  2QNW A;  1TU3 F;  2CK3 H;  2I1K A;  2WPT A;  4UB6 E;  2AFD A;  3T97 B;  2IX7 C;  4IPY A;  2QJP C;  5EFW B;  4PV1 B;  3N4X A;  2O01 J;  1JY3 O;  3WU2 H;  2WSC H;  1YI2 P;  1BAJ A;  2KW2 A;  1NKN A;  5CCG D;  3AEC C;  1OVU A;  4I1L A;  2KNC B;  1N2D C;  3WU2 E;  2M5A B;  3KHU A;  5KAF E;  1KQF B;  2JP3 A;  1NTM K;  2WSF H;  1ZMB A;  1KYO H;  5KJ7 C;  3P32 A;  4COC A;  1ZP0 C;  1Q90 D;  3WUU A;  4UB8 E;  2QG4 A;  3HUS C;  2EHT A;  3E1I A;  2BCC G;  4PD4 I;  3GKL C;  4C7N A;  3G71 P;  2EHS A;  1P84 E;  3L75 D;  2V4H A;  1L4A D;  2O01 N;  1BGY D;  1LTT C;  3L70 J;  3B4Q A;  1GXH A;  4EDF A;  4GDO A;  4PJ0 E;  1QRJ A;  2YIU B;  4C7N B;  2PEO A;  3R2P A;  3MIW A;  1BE3 E;  1X9V A;  1BCC G;  2Q9I A;  1N73 C;  1L0L J;  3A3Y B;  2NO8 A;  3QH9 A;  2XZR A;  5CCH C;  3CWB J;  5HGM A;  5AW3 B;  3AE2 C;  1NTZ E;  4U3F D;  1GL2 C;  1VQN P;  1VQ9 P;  2K0D X;  2XND H;  5AVW B;  1YIT P;  1JY2 P;  2KZJ A;  3NXS A;  2QJK B;  4H13 D;  3V2P A;  3AED C;  4N6J A;  3DS2 A;  1HQB A;  1M74 A;  1RO2 A;  2JR8 A;  4EIJ A;  5CJ4 A;  5KLV J;  1OFC X;  2E75 C;  2HYN A;  3JSV C;  1NTZ J;  3A0B E;  2KYV A;  3WMM 0;  4GR2 A;  2G8Y A;  2D2C C;  1K04 A;  2IYP A;  2FQ0 A;  1NTM D;  2QRX A;  4M3L A;  5EJD A;  3RK2 C;  2CPB A;  3H1J G;  2OYO A;  3CCV P;  2N1T D;  1PPJ G;  1IK9 A;  3HYB A;  2Q5U A;  2FYN B;  1U57 A;  1NOH A;  3RGU A;  1M1K Q;  1UIX A;  5CMZ A;  2FAD A;  3NMD A;  1GL2 D;  2KSE A;  3U1C A;  4EOT A;  3KDP B;  2XNX A;  1Y8A A;  2GDX A;  3SWF A;  2ERH A;  3EJB A;  3P05 A;  3L75 E;  5I4T G;  4AUW A;  1BGY E;  1EZV I;  3KZI E;  1D7M A;  2IBZ G;  1ACP A;  4XRO A;  1ZME C;  5KLI B;  1URQ D;  3TGU J;  1JMB A;  5BU8 B;  2QVA A;  1OR5 A;  5AW2 B;  1SQX G;  3V4W A;  1X3O A;  2R5D A;  2GM4 A;  1ZR2 A;  2P67 A;  3ZDM A;  2N6Y A;  4PV1 C;  1RE4 A;  4IL6 E;  2XDJ A;  5GTH H;  1YQ4 C;  1AYI A;  5KTB A;  3A7O A;  4ASV A;  4N78 E;  1VQ7 P;  3Q5R A;  3HZQ A;  3EJD A;  1M57 D;  4R0M A;  4JF7 A;  4U3F E;  3SWK A;  5GTH E;  1SQX K;  2ZVN B;  1PFI A;  1S5L X;  2Y0C A;  3C8V A;  5KP7 B;  1PGO A;  2K0X A;  2GDW A;  1JY2 O;  2C0W A;  2WSE H;  1FS0 E;  4HH2 A;  2V7Q H;  2IZ0 A;  2UWJ E;  4PD4 D;  4GR6 A;  2FXO A;  1KC8 Q;  1SQB G;  3HE4 A;  2P58 A;  5F2K A;  4C7R A;  4EI2 A;  4BWN A;  1SQP J;  3Q5S A;  1RO0 A;  4L74 A;  3TK1 A;  1LP1 A;  4U3F J;  2JBG A;  1K9M Q;  4C46 A;  2Y0D A;  3H0D A;  2PAJ A;  3HE4 B;  1NTM E;  3L36 A;  3VMX A;  2XZ1 C;  3B5N C;  1JO5 A;  2JWD A;  2WSS H;  1PP9 J;  3M1M A;  1LP1 B;  1T2K C;  2Y0E A;  2E76 B;  2HLO A;  2OYI A;  2K94 A;  4A7P A;  1LWU A;  2BUO A;  3DPH A;  2B88 A;  1KYO I;  1IFJ A;  3I55 P;  5CCG A;  1PPJ D;  2OYI B;  1AQ5 A;  3G3Z A;  1LWU B;  3MHV A;  3AE4 C;  3EWK A;  2KR5 A;  3VP8 A;  2Q1K A;  1EXI A;  3UIA A;  1VQ4 P;  1S4X A;  1NTM J;  2LOL A;  1U7M A;  1PZQ A;  5K5G B;  3H25 A;  2Z44 A;  4RES B;  1JJ2 O;  1LJ2 A;  2K9J A;  2W83 C;  1R5L A;  3L71 J;  2RN0 A;  2GUV A;  1RF0 A;  1QEX A;  4H2W C;  4B86 A;  3DS3 A;  2K9J B;  3L72 G;  1AFO A;  3SFD C;  1KTM A;  2AFE A;  1NH4 A;  2M3E A;  3HTK B;  3S1K A;  2JEE A;  4BPG A;  3PLN A;  3B5N D;  2P9X A;  1SQX D;  4PH1 A;  4H0L C;  3MD0 A;  5APU A;  1L4A B;  1E79 H;  1M1J C;  4M0I A;  2FYN C;  2KP8 A;  3VYI A;  2QIW A;  4JBZ A;  3BRV B;  1W5C E;  2QJP B;  4PD4 E;  2N98 A;  1QVF O;  2W6B A;  3RBZ A;  2YKQ A;  3IAO A;  1EZV D;  4COP A;  3DTJ A;  4XA4 A;  5KJ7 A;  2WPQ A;  2M8L A;  4RKU J;  2K92 A;  1FJK A;  5KLI C;  5TJH A;  2KOG A;  1VQ5 P;  1OWA A;  1KV4 A;  1EDL A;  2MVU A;  1DEE G;  3CMA P;  1YYC A;  3M91 A;  4ZMD A;  2IYO A;  1A02 J;  4UHP B;  2DW3 A;  4OH8 B;  4IZ6 A;  4QMA A;  2R32 A;  1EDI A;  1AF8 A;  4F37 A;  1FJP A;  1ZNV A;  1PPJ E;  2GUS A;  3G6E P;  1ZXG A;  2IZ1 A;  2AXC A;  1NU1 J;  2QM8 A;  1N73 A;  2Y9Y A;  3PRJ A;  5CCH A;  4K3A A;  4DZO A;  3AE3 C;  4GOE A;  1YTZ I;  2JJL A;  2L22 A;  1N73 B;  5GTI E;  2OQQ A;  4Y28 J;  2N1T B;  2L5G B;  5HGL A;  5AW8 B;  3BAS A;  1GU4 A;  3CE7 A;  5AVV B;  3H32 A;  1GL2 A;  2NRG A;  2PEI A;  1S3J A;  3CXH H;  4PH0 A;  2J58 A;  1X79 B;  5C39 A;  2N5H A;  4IFM A;  3GF3 A;  5AVY B;  3H32 B;  1GL2 B;  3RG2 A;  1SQX E;  4ZNC A;  1GD2 E;  4U0A A;  3GF7 A;  4WBA A;  2QE7 H;  2ZYA A;  3L72 D;  2GZG A;  1PV3 A;  1KD1 Q;  2E76 C;  2KZI A;  4QKO A;  4LGD E;  1ZLL A;  2P2U A;  1YJW P;  1LNQ A;  5F2O A;  3RL0 D;  1KYO D;  2KGD A;  3G26 A;  2WIT A;  1LGH B;  2K5X A;  2OYI C;  1LWU C;  2BEQ D;  3AEB C;  4HKG A;  3A0H E;  4MRT C;  1R8E A;  4OGQ D;  3VN0 A;  1PEM A;  5CCG C;  3OJA B;  2VRS A;  2W6J H;  1ZW0 A;  1JM0 A;  3G28 A;  3NY7 B;  2XKM A;  2ZVO B;  1VQL P;  3SSU A;  3VMA A;  1M90 Q;  4YXD C;  1KZU B;  1H89 A;  3H1H J;  2M8N A;  3RG6 C;  1VQK P;  1VKU A;  1RF0 C;  3GLM A;  4CPG A;  5BS2 A;  1PGJ A;  4MN4 C;  1IFM A;  2WPR A;  1KIL D;  1L4A C;  1BXI A;  1NTK G;  1DEB A;  3VRL C;  1VF5 D;  4U0B A;  2FKW B;  1RF1 C;  1PGQ A;  1RNI A;  1LTA C;  1VQ6 P;  5EW5 E;  2IDB A;  1QL2 A;  1XTG B;  4GT1 A;  3AE6 C;  2KNC A;  1HH0 A;  5AW1 B;  2M5A A;  1U7J A;  1L0I A;  3S9O A;  2N50 A;  5DJT B;  3M9B A;  2CWO A;  4D6T J;  2YXR B;  1BSN A;  2B87 A;  3U59 A;  4DCK A;  2FAC A;  3CCJ P;  3L72 E;  2IPP A;  4H13 C;  3CX5 H;  1YHQ P;  3USS A;  4AQR D;  2B87 B;  3GHG B;  1FU1 A;  1JB0 J;  1KYO E;  3FWL A;  3H1I D;  3PJS K;  3RK3 D;  1K30 A;  1L0H A;  5HGN A;  4ASW A;  4BXL A;  3B5N A;  1N7S C;  2A06 G;  1DNY A;  2A45 G;  2K93 A;  2MD9 A;  1AQT A;  1YJ9 P;  1T3J A;  1CEI A;  2OTK E;  4U7J A;  2KB7 P;  2C9N Y;  1L0N G;  3B5N B;  1IFI A;  2M8P A;  1BSH A;  4QNB A;  3QWO C;  3MTU E;  1FDI A;  2N1T C;  2ZJS E;  3WBH A;  3U43 A;  2WSF J;  2Y9Z A;  3BRT B;  1QVG O;  3EFG A;  2E74 C;  4N78 D;  1PEO A;  1KLP A;  1NO4 A;  1L0N K;  4GOD A;  7CEI A;  1W2E A;  1S1C X;  3BCC G;  4H2Y C;  3HRN A;  2FFD A;  3H1L G;  1DIP A;  4HYT B;  1G1I A;  1DD3 A;  2G3A A;  1KIL E;  3G4S P;  1IJD B;  2NPS C;  4U0E A;  5AW9 B;  1BE3 J;  2FFD B;  3JCU H;  1IMQ A;  3OA7 A;  1URQ C;  3AEG C;  2Q6Q A;  5APQ A;  1Z6M A;  2KI7 B;  4WVZ A;  2KGC A;  2W27 A;  2LKM A;  4GKG A;  2LXC B;  3M06 A;  1N7S D;  2IBZ I;  2FVE A;  1D1D A;  2WVR A;  2H89 C;  1OX3 A;  3CC7 P;  4R4L A;  4W7Z A;  3M9H A;  3EQ2 A;  2PEK A;  1OVV A;  4LLH A;  1M1J A;  1FZC C;  2PNG A;  2VLN A;  2FAE A;  3TSI A;  3RBX A;  4H0L B;  2JDI H;  3CXH I;  3AE7 C;  1IFN A;  2LKI A;  1M1J B;  2KOP A;  3G1G A;  1VQM P;  2E74 D;  4TT3 H;  2VLQ A;  2KK7 A;  3L73 G;  3C1L A;  3PTZ A;  4TLF A;  3H1I E;  3H1K G;  2XT1 A;  1FZG A;  1S5L H;  3RK3 E;  5CZD B;  3AEF C;  3W68 A;  3P8M C;  4KHX A;  2E42 A;  1VQO P;  5KAI H;  1JOC A;  1T6A A;  2NPS D;  1SS1 A;  3IR9 A;  4DJG A;  1Y9B A;  2JYG A;  2M0B A;  3CPW O;  1SQV G;  2FYU G;  1RHZ B;  2BCC D;  3G9R A;  5TIS H;  2Q3E A;  2RH0 A;  2R3S A;  3DS1 A;  1T3U A;  2OGU A;  1NGM B;  2GDY A;  2A06 D;  2J59 M;  2CG5 B;  2AEJ A;  1G2C A;  4CA3 A;  3W67 A;  5TIS E;  4L73 A;  2GZI A;  1Y47 A;  2JB0 A;  3H1I J;  1IMP A;  2FYU K;  1N86 A;  1L0N D;  2L4B A;  1FOS F;  2BEZ F;  2GA1 A;  3L75 J;  1G2C B;  1BCC D;  1BGY J;  2GZJ A;  2CPS A;  5B5E H;  2N5I A;  1X22 A;  3SFE C;  2FBW C;  3L37 A;  4DT0 A;  1QLE D;  3LIE A;  3AE1 C;  1GK4 A;  2Z46 A;  4OGQ B;  2YKO A;  2MJZ A;  2WMM A;  3LW5 J;  3CD6 P;  5B5E E;  2HG5 D;  1KQS O;  2K88 A;  3BCC D;  1KOR A;  3H1L D;  3GHG C;  2QSI A;  3P7K A;  3OAK A;  1NTK E;  1EMV A;  1AVO A;  3I5C A;  2ZT9 D;  2M8R A;  1LT1 A;  3VMZ A;  2WWW A;  4GOF A;  3O8Z A;  2Z4E A;  2FHS C;  1HUC A;  2H88 C;  2N9Y B;  3V5B A;  2EFJ A;  1ZN5 A;  2KG9 A;  1SQB K;  1M6N A;  1CZQ A;  3E7K A;  4U0C A;  5H2F H;  1Q2N A;  4WY4 D;  3HE5 A;  1VF5 B;  1FZA A;  3CXC O;  2KXP B;  1ZRT D;  1E6J P;  2YNY A;  3H1J D;  3CCR P;  3GW6 A;  1H0T A;  1SFC D;  3HE5 B;  2LPK A;  3O6Q A;  2V7Q J;  3CX5 I;  1LT9 B;  4EYY Q;  1RQV A;  1ZOY C;  4JYC A;  1G1J A;  2OYH C;  1FZF A;  4KJM A;  3ITK A;  3L73 D;  2KG6 A;  1H0T B;  2N9B A;  2A45 H;  3O6Q B;  3PH0 A;  2BCC E;  3H1K D;  2FFD C;  2K1A A;  3IN6 A;  2KG8 A;  2M3B A;  3NTE A;  2JU2 A;  2MVV A;  3HTK A;  1GMJ A;  2ZXX A;  2QJY B;  2JAZ A;  2A06 E;  2QEX P;  2IBZ D;  2ITA A;  3Q1M A;  2R5B A;  2RKL A;  2FYU D;  4U0F A;  1KB9 H;  1SP4 A;  2PEQ A;  1L4A A;  1L0N E;  2WQY C;  3L70 G;  1BCC E;  3RK3 B;  1GXG A;  2JO1 A;  1RF1 A;  5CBN A;  1K8A Q;  4YPC A;  2LL8 A;  3CXH D;  2H8P D;  1SQQ G;  4KT0 J;  2L0Q A;  2BCC J;  2QA4 P;  1K05 A;  1L0L G;  3E2D A;  2VSQ A;  1RF1 B;  3CC4 P;  3CWB G;  1J1D C;  1MFZ A;  1SLQ A;  3BCC E;  3H1L E; 
#chains in the Genus database with same CATH homology
 1W2B O;  3CMA P;  4XFZ A;  4XRO A;  1PEM A;  2PEM A;  3G1G A;  3I55 P;  1K30 A;  3CCQ P;  1VQM P;  1Q82 Q;  1NJI Q;  5HGM A;  1YJN P;  2LF4 A;  5HGN A;  1A8O A;  2EFJ A;  2L6E A;  3CCU P;  5BS1 A;  3G28 A;  2XV6 A;  1M6N A;  2XT1 A;  1S72 P;  1VQ4 P;  1YJ9 P;  4XRQ A;  4U0C A;  1EIA A;  5HGO A;  3G6E P;  1VQL P;  3H47 A;  2EIA A;  2Z44 A;  1M90 Q;  1VQO P;  3CXC O;  1VQ9 P;  4XFY A;  3CCM P;  1JJ2 O;  1VQN P;  3I56 P;  2M8P A;  2PEN A;  1E6J P;  4QNB A;  1YIT P;  1VQ7 P;  2JYG A;  2M8N A;  3RG6 C;  1VQK P;  3CPW O;  3HZQ A;  3CCR P;  3WBH A;  4IPY A;  1K73 Q;  2JO0 A;  2OTL P;  5BS2 A;  1QVG O;  1EOQ A;  3DS2 A;  1M74 A;  1YI2 P;  3DS3 A;  3DS1 A;  1BAJ A;  1PEO A;  2PEJ A;  1RO2 A;  1Q86 Q;  3DS5 A;  3DS4 A;  5HGL A;  1AUM A;  1M6E X;  3VRL C;  3CCL P;  2OTJ P;  2BHV A;  4U0B A;  1VQ8 P;  2P9X A;  2JYL A;  2BQ1 E;  3G29 A;  4PH1 A;  1RNI A;  2PEI A;  2OAR A;  2PY8 A;  1VQ6 P;  4PH0 A;  2ONT A;  3NTE A;  3B5I A;  4XFX A;  3OW2 O;  3CC2 P;  3G4S P;  1Q7Y Q;  1IUQ A;  1ZMB A;  4U0E A;  4GR6 A;  1KC8 Q;  2QEX P;  3DS0 A;  4M0I A;  4COC A;  4GR2 A;  3MGE A;  5F2N A;  5DCK A;  1PEQ A;  4U0A A;  1YIJ P;  5F2K A;  4U0F A;  2Z45 A;  2PEQ A;  4WYM A;  3CCV P;  1Q81 Q;  1RO0 A;  2XXM A;  2Z46 A;  2E1M A;  3Q20 A;  2DGY A;  3HYB A;  1K9M Q;  3H0D A;  2CWO A;  1QVF O;  1KD1 Q;  1K8A Q;  3CCE P;  3CME P;  3CD6 P;  1D1D A;  1N8R Q;  1KQS O;  3CC7 P;  3G71 P;  1A43 A;  1YJW P;  1M1K Q;  5F2O A;  3G0V A;  4COP A;  3DTJ A;  3G21 A;  3M1M A;  2PEK A;  3G26 A;  1VQP P;  1PEU A;  2QA4 P;  3CCJ P;  4U0D A;  3E2D A;  2M8L A;  3CCS P;  3H4E A;  3CC4 P;  3LRY A;  5JPA A;  1QRJ A;  2PEO A;  1YHQ P;  1VQ5 P;  3P05 A;  2BUO A;  5I4T G;  3G1I A;  3DPH A;  2EG5 A;  2KOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...