1VQ4P

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq4P02
1YIJP 1YITP 2QA4P 1NJIQ 3CMAP 1YHQP 1K9MQ 1VQ6P 3CCEP 1VQMP 3CCUP 1KQSO 3CCQP 1YJ9P 3CCJP 1K8AQ 3G4SP 2QEXP 3CXCO 1W2BO 3G71P 1VQPP 3CC2P 2OTJP 3CMEP 1QVGO 1N8RQ 1VQKP 3CC7P 3CPWO 1YI2P 1VQ5P 1VQ4P 3CCVP 1KC8Q 1QVFO 1VQLP 2OTLP 3OW2O 1Q86Q 1Q7YQ 3I55P 1S72P 3CCMP 1Q82Q 1YJNP 1M90Q 1VQ7P 3I56P 3CCRP 1YJWP 3CC4P 3CCSP 1Q81Q 1JJ2O 1VQ8P 3CCLP 1VQNP 3CD6P 1K73Q 1VQ9P 1KD1Q 1M1KQ 3G6EP 1VQOP
chains in the Genus database with same CATH superfamily
4C7NA 3Q5RA 5CCHC 1NHLA 3V6IA 4WY4C 2LOLA 1NTZE 2CWOA 5KLIB 1HH0A 3G9RA 3QH9A 2WMMA 2IZ0A 4DZOA 3V2QA 3RL0B 3BRVB 3T97A 3CX5D 3KPEA 1T2KD 3RK3D 3V5BA 3SWFA 2QJPC 1NU1G 3C1LA 3H1LJ 2E5YA 2HR3A 1FOSF 2DNWA 1LNQA 2XZRA 3HUSB 2LXBA 3TF5A 4NPDA 2B87A 1KB9H 3SWKA 1EXIA 3OW2O 1L0NJ 2JO1A 1F80D 5CMZA 3HE5B 1FZAA 2JAZA 1QL1A 3VYIA 3G4SP 1SQPG 1X9VA 4BPGA 2LXCB 1R5LA 2LMLA 4WY4B 3PTZA 3EWKA 4KT0J 3L75G 2V4HA 2B89A 1SQQG 3D71A 2BCCJ 3GG2A 5CJ4A 1GMJA 2PEMA 1SQXE 1NVOA 2OTKE 1G2CA 2OARA 2JQ4A 1PP9J 2QRXA 3CC2P 2QJPB 2NRGA 4H2YC 1VQLP 1PIXA 2WT7B 5CJ0A 2A06D 3L75J 1SQQJ 2QA4P 4W80A 2WSFJ 5AVSB 1PL5A 1D1DA 3L74E 3H4EA 1RO0A 2YO2A 2I8DA 2E1MA 3G21A 4UHPB 2M3BA 4L74A 3Q2YA 1U7JA 3L4FA 2HPCA 2KWLA 4OH8B 2WVRA 4HKGA 1OX3A 5HGNA 2LIUA 1QVGO 3PLNA 3H1IE 2N1TC 4YPCA 1E79H 3HZQA 3Q5SA 3H1JJ 1IFIA 2KW2A 1HGZA 1N7SC 5TISE 3CWBD 2V7QJ 3AE6C 1OVVA 2WSEJ 3R4YA 2IDBA 3AE7C 1H0TB 2AF8A 1ZRTE 2M5RA 2XZ0D 2Z5HA 3HD7B 3VMXA 4PJ0E 1FOSE 1BDDA 2FKWB 2FYUD 3CX5H 5CZDB 1S72P 1EQ7A 2IZ1A 3IR9A 3V4QA 3GJNA 1OXZA 1LTAC 3RK2D 2ZFCA 1M1KQ 3BATA 2A06G 1HY8A 3U43A 1T3UA 3V2NA 1E5WA 3EFGA 3GHGB 2K5XA 2XT1A 4U3FD 1S9KE 3E7KA 3Q1MA 3H1LE 1ZLLA 2GZFA 2Z45A 1Q82Q 2FFDA 2KOOA 1YJNP 5KAFH 2Y9ZA 2N1TB 3M9HA 1SFCB 1LGHB 1L0LK 3DS3A 1BE3D 2KORA 1JCCA 1N7SB 4PV1D 5AVZB 3AE8C 1LT1A 1EDLA 1JY3P 3CI9A 5APUA 2Z4EA 1KZUB 3H1HD 1M57D 1L4AB 1BGYJ 1FBMA 3C9IA 1FZCA 1PEMA 5AVXB 1DD3A 2ZVOB 4KHXA 2XDJA 1E6JP 3MTUE 1G1IA 2VSQA 2ZT9D 4LGDE 3CWBG 2FVAA 4PD4I 2AXCA 1IO4A 1FDOA 2HODB 3RG2A 5AW5B 2Q5UA 3AEBC 2L6EA 3SWYA 1PP9E 2KS1B 5BVZA 2KZJA 1AQTA 2E76B 2FHSC 5H2FE 5APSA 1SQVK 4N78E 1OMIA 1HVVA 4RO0A 3CWBJ 2D2CD 3AE1C 1JMBA 1OW6A 4U3FG 4BRYA 3O8ZA 3CLQA 2LPKA 1SQBJ 1KILE 2Z44A 1HF9A 2A45I 1KTMA 1VDFA 2FYUJ 2VLQA 2KLUA 3WUTA 1BE3G 5KJ7C 3N4XA 1PGOA 1MKMA 2JWDA 3LRYA 2Q3IA 2EHSA 3H1HG 1L0LE 2GDWA 2QVAA 2IPPA 4NEOA 2JU2A 4D6TE 4GT1A 2BEQD 2O01N 1LWUB 3H1JE 3L73D 4ZMDA 1DH3A 1BE3J 1GTWA 1M1JA 1RF0C 3A7OA 3TNUA 2K9JA 2I1KA 1Q7YQ 2PP6A 1BXIA 3LIDA 3E1RA 2GZIA 1GZLA 2WITA 4CA3A 1KQSO 1HTLC 3G29A 2IX7C 4GR6A 1D7MA 2HYNA 3F89A 2AXTE 2LF4A 2ZYDA 2WSCJ 2O1JA 2KOQA 1Q86Q 1ZR4A 1LTTC 2FYNB 2XU6A 1JJ2O 2ZYGA 2J5UA 1URQD 2R5BA 4HYTB 2O01H 1NTKG 2OYHC 4IFMA 1X0TA 2IFNA 5B66H 5AVQB 2Y0DA 3AEEC 1UNKA 1PPJD 2K3RA 1QLED 5F2OA 3CCLP 4DCKA 4RESB 4BPHA 2OGUA 3MUDC 2L0QA 5AVVB 4ZNCA 4HB1A 2N6YA 1AF8A 3L73G 5E79H 3JCUE 1EZVD 5AW4B 5F2NA 2L5GB 4JYCA 3RL0D 2NPSC 5CBNA 1QVFO 3AEAC 2KOSA 1JMMA 3A0BE 2RKLA 3B5NA 1ZNVA 3BCCJ 1R8EA 1NOHA 3EJEA 2IBZI 2C9LY 1BSNA 1RH5B 2W27A 3CCJP 1FZEA 2WPRA 2PEJA 4NPEA 1QL2A 2WWWA 1KFNA 2FY8A 1X3OA 1SS1A 2KODA 4XROA 1GDTA 1DNYA 1KB9D 1AQ5A 2K88A 3KHUA 1Y8AA 1BCCE 1TU3F 2GZGA 1DEEG 1E0HA 3L72D 2KGCA 5CCHD 1NKZB 4AQRD 2H7HA 4WY4D 1XTCC 4H13B 3P8MC 2KGDA 1N8RQ 2EHTA 3VTPC 3L71J 1PPJG 5GTHE 3ABVC 4YTPC 3DPHA 2NPSB 2C0WA 4U0DA 2PNGA 5GTIE 1KQGB 4U0CA 4BXLA 1M56D 1W5CE 1EZVG 2YIUC 1IFPA 2QNWA 2R5DA 2KSEA 2OTLP 1J1EB 3L74G 1LTJC 1LJ2A 3G26A 3GZLA 5KLIC 3OAKA 2KOPA 2C0XA 1PGPA 1HWTC 3M0DC 1T6AA 1LP1B 1K8AQ 2ZJSE 2Z46A 3RBXA 4JF7A 1G1JA 2MY5A 2MVVA 1T8KA 3CCVP 4EYYQ 4PD4E 5BU5A 3TGUD 1M90Q 1U7MA 3DS5A 1ZP0C 3WUVA 2WPSA 1GK6A 3DS0A 2YO3A 3L72G 4R0MA 4L75A 3NTNA 2QM7A 5HV8A 1SQXK 1IFMA 1CEIA 2Y0CA 3HE4B 3JSVC 1IMPA 2SPZA 1OWAA 1OVUA 4NPFX 1BSHA 2KI7B 1L0HA 2CGQA 2KLVA 2KOGA 5KP7B 1GU4A 1LTJB 2N5IA 4WBAA 3HD7D 2YKPA 5HVCA 1PV3A 3B8EB 4LLHA 2MKVA 3L72J 2KR5A 2JKVA 1YI2P 3H1KD 3Q3DA 2GZEA 3VMYA 3GF7A 5KLVJ 3HTKB 1KQFB 5AW6B 3UIAA 3CX5I 3G28A 1KFMA 1UIXA 1A02J 4H2WC 2J58A 1S2EA 2KNCA 3PRJA 2KP8A 2FAEA 1X8YA 1EXJA 3MIWA 1CI6A 2N1TD 3TGUG 4COCA 5TISH 2PFXA 3HRNA 4JQ0D 1N7SD 4D6TD 1K30A 2AEMA 5EW5E 1A02F 2KG9A 5HGOA 1NU1J 1L4AD 4PH1A 1PGJA 2PRRA 1X22A 1KMIZ 1P84E 3WU2H 3TGUJ 5AW0B 3L71E 1KYOE 2ZXXA 3P8CD 1GU5A 2H43A 1NKNA 3B5IA 3H25A 1RF1A 4XA4A 5KKZB 2JO0A 2FQ2A 1M6EX 4K3AA 1VL2A 2MJZA 1SQPJ 1QRJA 3H1KG 1K04A 2EIAA 1GXHA 3CCSP 1WT6A 1AFOA 4GOFA 4L73A 1RNIA 2E76D 2GDXA 1GL2B 2M8LA 1SQVD 5B5EE 1FZBA 2JGPA 3GF3A 3HD7C 1YJ9P 1IK7A 2XNDH 1M6NA 1KORA 2OTJP 3LIEA 1L0NK 2GUVA 3EJDA 1RE4A 3II6A 2POHA 1KILC 1RF0A 4EDFA 3GHGC 3KYQA 4ZKPA 2C9NY 1NAYA 3VMZA 4D6TG 4XFXA 4WWIA 5KP8B 3C8VA 2IBZE 5APWA 1YTZI 1USDA 2MR8A 1SFCC 3L70E 4WB4A 3CC4P 1H8AA 1LT9C 4IL6E 3NXSA 2ROQA 4I6MC 5BU8B 5H2FH 5AVRB 2L22A 1JTHB 2QJYB 3D6ZA 1FAVA 1L4AC 3E1IA 2RN0A 1LTSC 2OYHA 2E74B 2WSFH 1AVYA 1SQQK 1GW4A 1N73A 5APTA 1NH4A 3H0DA 1SQVG 1ACPA 1MUUA 3A2AA 1HJ0A 1KILB 3EQ2A 5KJ7D 3AE3C 4RJTA 4U0AA 3MUDA 5AW9B 4Y28J 4GKGA 1ZMEC 1OFCX 2QJKB 2E76C 1KQLA 3GW6A 1H89A 2N50A 3Q20A 5KP6B 1CZQA 3CE7A 3O6QB 1L0NE 3AEDC 1LT9B 1MFTA 2OYIA 1W2BO 3KZIE 2JBGA 2WSEH 1DIPA 1JUNA 1OW8A 1VQ7P 1FR2A 1PEOA 1LTBC 2W90A 2N98A 2Q1KA 2M5AA 3G1IA 3NTEA 3A5TA 3P05A 2Y9YA 2BCCE 2AVAA 2AXTH 5CCGD 1EDJA 1VQ4P 2R3SA 2QE7H 3KQGA 4CPGA 1AVOA 1LWUC 1A8OA 3MZWB 2E42A 3Q5PA 2JP3A 3CXHE 2WPVB 5CBOA 1NTMD 3MGEA 1BCCG 1S4XA 1URQA 3G71P 3PH0A 3H32A 3L75E 1SQQE 1IZNB 1FZGA 1R5SA 1GPJA 3SSUA 3D6YA 1JM0A 1S5LE 3AE9C 2KZIA 2GM4A 3CL3D 2VLOA 2DGYA 4OVNF 2P10A 3G6EP 4C7NB 1LTIC 4H13D 4GODA 1NTKD 2FVFA 3JCUH 3CMEP 1NTZD 2PENA 2PEOA 2VLPA 2FYNC 3M0DA 4ASVA 2W83C 2NPSD 4W7YA 3A0BH 2M8PA 2VLNA 4U3FJ 3RK3E 3T97B 3S1KA 1K73Q 1RE3C 1NWQA 2K9YA 2FXMA 3HTKA 2JEEA 1BAJA 5L8RJ 2HLOA 1AV1A 2QEXP 1HUCA 4EI2A 3HUSA 4TT3H 4EIJA 3E2DA 4EOTA 2B87B 2M0BA 2HFED 1NGMB 3NMDA 3V4WA 2N9YB 4BWNA 1UIIA 1AJYA 3WUUA 4C46A 1FE6A 3H1HJ 1FC2C 3HE5A 4ZKUA 4OGQB 2CPBA 3B71A 2W6AA 1NTMG 5CCGC 2ZVNB 5CCHA 1DD4A 1SQBK 4WY4A 2M3EA 2FYUK 2UWJE 3FXEA 2FVEA 1MFZA 3GMAA 5GTHH 4MRTC 1OW7A 1GD2E 5AW3B 1X79B 2JB0A 1P84D 2KIKA 2KGEA 1G2CB 5GTIH 1PFIA 4I1LA 2KXPB 1SQXD 2P2UA 1A43A 1NTZG 5EJDA 5KAIH 4UB6E 1NTMJ 4IFDK 2A06E 3HYBA 2WT7A 1IFNA 2K93A 4WVZA 3D70A 2WPTA 1OZHA 2W8ZA 2QG4A 1MZ8A 2GYKA 1SVFA 4H13C 1YBKA 1YITP 1BGYE 3U1CA 3G3ZA 1NYHA 1VF5B 3TDKA 4K35A 3VP9A 3OA7A 4PV1B 1NTKJ 1EZVI 4PD4H 2PY8A 1ZR2A 1NTZJ 3L74D 2K92A 4IPYA 2RMZA 1VQNP 3CD6P 4ASWA 2PEIA 1EDIA 2IFMA 2MVUA 3K5BA 2FQ1A 3SFEC 2ZT9B 2HPCB 3L35A 3H6PA 1L0IA 3ZDMA 1J1EC 3P32A 5DJUB 3VN0A 4W7ZA 2H8PD 1S1CX 4Z1MH 1PEQA 3L73J 3H1ID 2LKIA 3CWBE 1BDCA 1IJDB 3L70D 1RHZB 1JNMA 3FGAD 2W6JH 5M1BA 3BVHA 1J1DB 3MP7B 1KB9I 4RKUJ 4PWVB 1H0TA 5F2KA 4IZ6A 1SQBE 3PP5A 2A45H 1SQXG 2FYUE 1ZRTD 3HD7A 2ERHA 2Y0EA 2GDYA 2AEFA 2ITAA 3V2PA 2N5HA 2QM8A 4U3FE 2WTYA 1Q2NA 1ZV8A 3GHGA 1MV8A 2P9XA 2J59M 3VOPA 1S9KD 2FFDB 1EOQA 2K0DX 3H1LD 1GL2D 1AA0A 2JDIH 2WPQA 1BE3E 3A0HE 1VHNA 2N1TA 1SFCA 4R4LA 1NJIQ 1L2PA 3ITKA 3CCEP 1JY2N 3CCUP 1MZ9A 1N7SA 1L0ND 3H1HE 4GDOA 2R3CA 1HJBA 3LW5H 3RL0g 5BS2A 2L9FA 1L4AA 4PXHB 1FZCB 3H1IG 1OR5A 2PAJA 5JPAA 1P84H 3L70G 1KD1Q 4IOIH 1Y9BA 1H88A 1KYOH 2M8RA 3L74J 3AEFC 3MGNA 1FDMA 1EMVA 4N3YB 4DT0A 4HJGH 4XRQA 4U0FA 1YQ3C 2HODA 3L37A 2BCCD 2AEJA 3PJSK 3RGUA 5DJTB 1Q81Q 2KS1A 2O3JA 1PP9D 1DEBA 4JYBA 5B5EH 1USEA 1M1JC 4H0LC 5C39A 4BRYB 4A7PA 5KTBA 4N78D 3W67A 2PEQA 1KC8Q 1FJPA 3IAOA 3CCMP 4MN4C 3H1LG 1M7LA 1NQ4A 1J2JB 3RBZA 2FXOA 2H88C 3DS2A 7CEIA 1KILD 5KKZC 4U7JA 1ZN5A 2YNYA 1K05A 3BCCE 1JOCA 2JU1A 1YTZT 1L0NG 3U1AA 2YKQA 3AEGC 1GL2C 1SFCD 1N86A 4IL6H 1L0LD 2GUSA 3L73E 3H47A 3WBHA 1VQ6P 1LWUA 1VQMP 1HGVA 2WSSH 3M1MA 4UB8E 1VQPP 3LMOA 2K0XA 1ZOYC 3H1JD 1M1JB 4PJ0H 2BCCG 3TNUB 2E75B 2K9JB 4H0LB 2NO8A 1YYCA 1N2DC 1PP9G 1IK9A 2YXRB 3L36A 2YMYA 1DX7A 5HGLA 3B5NC 2GA1A 5KJ7A 3NFQA 1LTGC 5BS1A 2XV6A 2MF4A 5KLVK 3JC22 2CQ8A 2Q6QA 2QJYC 2K37A 4HKZH 2R32A 3M0AA 4XFYA 2GZJA 1RE3A 2E5TA 2E74C 3KZIH 4H44C 1QGKB 2YKOA 5TJHA 2KUBA 1PPJE 4B86A 4QNBA 3CC7P 2FYZA 1UJZA 2G8YA 2EFJA 1VKUA 1VPCA 1L0LG 3H1KJ 1NU1K 2HG5D 1EZVE 3S4RA 1BGYD 5K5GB 3W68A 2LKMA 4JPZB 2QJKC 2G3AA 3H1JG 1VQKP 2BQ1E 5APYA 1S3JA 4R4MA 2QSIA 5CCGA 3B5NB 2N6ZA 2B88A 3DS4A 1T2KC 3RK3C 4HH2A 1JY2O 2JYGA 1NO4A 3CXHH 5APQA 1L0LJ 1Z6MA 2X2BA 1SQPK 2O1KA 4H2XC 2XV5A 2M8NA 1RY3A 4BPFA 3PHLA 2AFEA 1S5LH 4D6TJ 1T3JA 1KB9E 3WMM0 3FXDA 4H44B 1YQ4C 3DTJA 1HBWA 1EC5A 3L72E 4OGQD 2BUOA 2XKMA 1ZW0A 4GIFA 2QIWA 1BCCD 2B9BA 2BHVA 2DW3A 3VP8A 1AYIA 1SQBD 1ZXGA 5KLVE 5EFWB 1IUQA 2OYOA 3KXDA 3TSIA 1OIPA 3VRLC 1JB0J 3FWNA 1YJWP 2IYOA 2NPSA 1OVRA 3EFFK 4U0EA 3WU2E 1YIJP 3RK3B 2K94A 1GXGA 4F37A 1RQVA 1BGYG 1SP4A 4XE5B 5DCKA 2V7QH 1SQVJ 4YXWH 1CSBA 1VQ5P 2YXQB 2Q7CA 2KSJA 1NU1E 2FBWC 5AW7B 3G1GA 1VF5D 4I2LC 2LR2A 2CK3H 1QX8A 3N7NA 2ONTA 4C7RA 1LP1A 2K0YA 3TGUE 1GK4A 4AYCA 2XZ1C 4I7ZC 3I56P 4PD4D 2K1AA 1IC2A 2KB7P 1SQPE 4Y99C 4OWFA 3CXCO 1SLQA 2Q9IA 4XFJA 4UB6H 1QEXA 1SQBG 3S9OA 3M06A 3HE4A 5AVUB 2FYUG 2N9BA 2R44A 4TLFA 4OGQC 1WRGA 2EG5A 3USSA 3NY7B 3P7KA 1Y47A 2L4BA 3QWOC 4O9BA 1LTJA 5AVWB 3F5HA 3H1KE 1KV4A 2MR7A 1BCCJ 1NAFA 3V2RA 3CX5E 3RK2C 1VQ8P 2BEZF 2KGAA 1Q90D 4COPA 2IYPA 1RF1C 5I4TG 2LIWA 2NZ2A 4I7ZB 2WQYC 2KYVA 2KNCB 3AE2C 3BASA 3BCCD 4Y99B 5CHXA 4DG9A 1CI6B 4IL6X 2Q3EA 2O01J 1VF5C 5KAFE 3IFMA 2FADA 3M91A 2CNRA 2FACA 3CMAP 1K9MQ 4PV1C 4U0BA 1FZFA 5AW2B 1RE4C 1T8ZA 3M9BA 2P58A 1JO5A 3IN6A 3CPWO 1CW5A 2KG6A 4M3LA 2ZT9C 3MHVA 3P8CE 2FXPA 3FWLA 1JY3N 3RK2B 2KK7A 4N6JA 1RF1B 3TYYA 3L71D 5AVYB 1KYOD 3IF4A 1P84I 4GOEA 2LTEA 4LC1A 1KYOI 1FU1A 1JY2P 2ZXEB 2A45G 1GW3A 2L91A 1J1DC 2YMKA 3BRTB 4IFFA 2H89C 3A0HH 1SQVE 2P7JA 1GL2A 2JYLA 2D2CC 3GKLC 2JJLA 1M74A 1M8OB 1N73C 2OQQA 3BCCG 2RH0A 3R2PA 2WSCH 1VQ9P 1U57A 4QKOA 2MD9A 2XXMA 2FFDC 4YXDC 5AVTB 2IBZD 4L76A 3B4QA 2OYIC 2JWAA 2W6BA 2KG8A 2PGDA 2CPSA 3G0VA 1ZMBA 3CCQP 1NTMK 1JTHA 1S5LX 2P67A 3L71G 3VMAA 2E75D 1PZQA 4H0LD 1FZCC 3GLMA 2OYHB 2D2CB 1RQUA 2E43A 1JEKA 3TK1A 1FJKA 1EDKA 1N73B 1W2EA 4GR2A 3I5CA 2LL8A 3MD0A 3LW5J 2P1JA 1IFDA 1NTKK 5APVA 1KILA 5AW8B 3AE4C 1NTZK 1IMQA 2PEKA 5KLVD 1N7LA 4AUWA 1SQXJ 3I55P 4QMAA 1URQC 2AFDA 1FDIA 3SFDC 4DOJA 1YHQP 2Z5IA 3O6QA 2OYIB 4UB8H 3KDPB 1LT9A 3FX0A 3DS1A 1XTGB 3AECC 5KAIE 5B66E 4XFZA 3RG6C 5AW1B 1PEUA 2IBZG 5APXA 1KN7A 2M5AB 2K2QA 2JR8A 1NU1D 5HGMA 2ZAEB 3GZMA 1PGQA 3OJAB 4PH0A 2FQ0A 3RL0C 3A3YB 3AE5C 5E79E 3M9QA 3B5ND 1Z56A 1DV5A 3B4SA 3EJBA 3CCRP 2VRSA 3U59A 1WMKA 4M0IA 1KLPA 3HUSC 1VQOP 1NTME 1HQBA 1EIAA 3H1IJ 4DJGA 4KJMA 2CG5B 3L70J 1SQPD 1URQB 3H32B 2E75C 4JBZA 2BASA 3CXHD 1IFJA 1RO2A 2E74D 1AUMA 1FS0E 4H44D 3CXHI 3L75D 2ZYAA 5KLVG 1SQQD 2YIUB 2WZ7A 1JY3O 2I1JA 4WYMA 1JCDA 2XNXA 1NTKE
chains in the Genus database with same CATH topology
2JYGA 3H47A 1YITP 2QA4P 1NJIQ 3WBHA 1VQ6P 3DS0A 3CCEP 1VQMP 2CWOA 3CCUP 3B5IA 3CCJP 3M1MA 3CXCO 1VQPP 2PEJA 1D1DA 2M8NA 2JO0A 3CMEP 4U0AA 1M6EX 2PENA 2PEOA 2PEKA 3H4EA 2KODA 1RO0A 1QRJA 5BS2A 2PY8A 2M8PA 2E1MA 4XROA 1Q7YQ 3I55P 3G21A 2EIAA 3DTJA 3CCSP 5JPAA 1PEMA 4IPYA 1RNIA 1VQNP 3CD6P 1K73Q 2PEIA 1KD1Q 1E6JP 2EG5A 1KQSO 2BUOA 2M8LA 3Q20A 1YHQP 2JYLA 3G29A 1BAJA 4GR6A 1YJ9P 2QEXP 1W2BO 1M74A 1M6NA 5HGLA 2BHVA 3DS1A 2OTJP 2LF4A 5HGNA 1QVGO 3E2DA 4U0FA 4XRQA 1N8RQ 1IUQA 1YI2P 1PEQA 2L6EA 4XFZA 3OW2O 3RG6C 3HZQA 5BS1A 3VRLC 1Q86Q 2XV6A 1PEUA 1VQ7P 3DPHA 1YJWP 1Q81Q 1JJ2O 1VQ8P 1PEOA 4COPA 1VQ9P 4U0EA 3G1IA 4U0DA 5I4TG 1YIJP 3NTEA 3P05A 5HGMA 4XFYA 3G28A 4PH0A 4U0CA 4XFXA 5F2KA 3G4SP 5DCKA 2XXMA 4QNBA 3CC7P 2PEQA 1VQ5P 1VQ4P 1KC8Q 2OTLP 1S72P 3CCMP 5F2OA 3CCRP 2EFJA 3CC4P 2Z44A 4COCA 3CCLP 1A8OA 3G26A 3G1GA 4M0IA 1M1KQ 3DS2A 1VQOP 2PEMA 1EIAA 3G0VA 3CMAP 1K9MQ 1ZMBA 1K30A 2OARA 4U0BA 3MGEA 2ONTA 3CCQP 1K8AQ 2Z46A 2XT1A 3G71P 3CC2P 5HGOA 5F2NA 1RO2A 1A43A 4PH1A 3LRYA 1AUMA 1VQKP 2BQ1E 3CPWO 2P9XA 3CCVP 1QVFO 1VQLP 2Z45A 1EOQA 3HYBA 1Q82Q 1YJNP 3DS4A 1M90Q 3I56P 4GR2A 2DGYA 3DS5A 4WYMA 3G6EP 3DS3A 3H0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ P;  1YIT P;  2QA4 P;  1NJI Q;  3CMA P;  1YHQ P;  1K9M Q;  1VQ6 P;  3CCE P;  1VQM P;  3CCU P;  1KQS O;  3CCQ P;  1YJ9 P;  3CCJ P;  1K8A Q;  3G4S P;  2QEX P;  3CXC O;  1W2B O;  3G71 P;  1VQP P;  3CC2 P;  2OTJ P;  3CME P;  1QVG O;  1N8R Q;  1VQK P;  3CC7 P;  3CPW O;  1YI2 P;  1VQ5 P;  1VQ4 P;  3CCV P;  1KC8 Q;  1QVF O;  1VQL P;  2OTL P;  3OW2 O;  1Q86 Q;  1Q7Y Q;  3I55 P;  1S72 P;  3CCM P;  1Q82 Q;  1YJN P;  1M90 Q;  1VQ7 P;  3I56 P;  3CCR P;  1YJW P;  3CC4 P;  3CCS P;  1Q81 Q;  1JJ2 O;  1VQ8 P;  3CCL P;  1VQN P;  3CD6 P;  1K73 Q;  1VQ9 P;  1KD1 Q;  1M1K Q;  3G6E P;  1VQO P; 
#chains in the Genus database with same CATH topology
 4C7N A;  3Q5R A;  5CCH C;  1NHL A;  3V6I A;  4WY4 C;  2LOL A;  1NTZ E;  2CWO A;  5KLI B;  1HH0 A;  3G9R A;  3QH9 A;  2WMM A;  2IZ0 A;  4DZO A;  3V2Q A;  3RL0 B;  3BRV B;  3T97 A;  3CX5 D;  3KPE A;  1T2K D;  3RK3 D;  3V5B A;  3SWF A;  2QJP C;  1NU1 G;  3C1L A;  3H1L J;  2E5Y A;  2HR3 A;  1FOS F;  2DNW A;  1LNQ A;  2XZR A;  3HUS B;  2LXB A;  3TF5 A;  4NPD A;  2B87 A;  1KB9 H;  3SWK A;  1EXI A;  3OW2 O;  1L0N J;  2JO1 A;  1F80 D;  5CMZ A;  3HE5 B;  1FZA A;  2JAZ A;  1QL1 A;  3VYI A;  3G4S P;  1SQP G;  1X9V A;  4BPG A;  2LXC B;  1R5L A;  2LML A;  4WY4 B;  3PTZ A;  3EWK A;  4KT0 J;  3L75 G;  2V4H A;  2B89 A;  1SQQ G;  3D71 A;  2BCC J;  3GG2 A;  5CJ4 A;  1GMJ A;  2PEM A;  1SQX E;  1NVO A;  2OTK E;  1G2C A;  2OAR A;  2JQ4 A;  1PP9 J;  2QRX A;  3CC2 P;  2QJP B;  2NRG A;  4H2Y C;  1VQL P;  1PIX A;  2WT7 B;  5CJ0 A;  2A06 D;  3L75 J;  1SQQ J;  2QA4 P;  4W80 A;  2WSF J;  5AVS B;  1PL5 A;  1D1D A;  3L74 E;  3H4E A;  1RO0 A;  2YO2 A;  2I8D A;  2E1M A;  3G21 A;  4UHP B;  2M3B A;  4L74 A;  3Q2Y A;  1U7J A;  3L4F A;  2HPC A;  2KWL A;  4OH8 B;  2WVR A;  4HKG A;  1OX3 A;  5HGN A;  2LIU A;  1QVG O;  3PLN A;  3H1I E;  2N1T C;  4YPC A;  1E79 H;  3HZQ A;  3Q5S A;  3H1J J;  1IFI A;  2KW2 A;  1HGZ A;  1N7S C;  5TIS E;  3CWB D;  2V7Q J;  3AE6 C;  1OVV A;  2WSE J;  3R4Y A;  2IDB A;  3AE7 C;  1H0T B;  2AF8 A;  1ZRT E;  2M5R A;  2XZ0 D;  2Z5H A;  3HD7 B;  3VMX A;  4PJ0 E;  1FOS E;  1BDD A;  2FKW B;  2FYU D;  3CX5 H;  5CZD B;  1S72 P;  1EQ7 A;  2IZ1 A;  3IR9 A;  3V4Q A;  3GJN A;  1OXZ A;  1LTA C;  3RK2 D;  2ZFC A;  1M1K Q;  3BAT A;  2A06 G;  1HY8 A;  3U43 A;  1T3U A;  3V2N A;  1E5W A;  3EFG A;  3GHG B;  2K5X A;  2XT1 A;  4U3F D;  1S9K E;  3E7K A;  3Q1M A;  3H1L E;  1ZLL A;  2GZF A;  2Z45 A;  1Q82 Q;  2FFD A;  2KOO A;  1YJN P;  5KAF H;  2Y9Z A;  2N1T B;  3M9H A;  1SFC B;  1LGH B;  1L0L K;  3DS3 A;  1BE3 D;  2KOR A;  1JCC A;  1N7S B;  4PV1 D;  5AVZ B;  3AE8 C;  1LT1 A;  1EDL A;  1JY3 P;  3CI9 A;  5APU A;  2Z4E A;  1KZU B;  3H1H D;  1M57 D;  1L4A B;  1BGY J;  1FBM A;  3C9I A;  1FZC A;  1PEM A;  5AVX B;  1DD3 A;  2ZVO B;  4KHX A;  2XDJ A;  1E6J P;  3MTU E;  1G1I A;  2VSQ A;  2ZT9 D;  4LGD E;  3CWB G;  2FVA A;  4PD4 I;  2AXC A;  1IO4 A;  1FDO A;  2HOD B;  3RG2 A;  5AW5 B;  2Q5U A;  3AEB C;  2L6E A;  3SWY A;  1PP9 E;  2KS1 B;  5BVZ A;  2KZJ A;  1AQT A;  2E76 B;  2FHS C;  5H2F E;  5APS A;  1SQV K;  4N78 E;  1OMI A;  1HVV A;  4RO0 A;  3CWB J;  2D2C D;  3AE1 C;  1JMB A;  1OW6 A;  4U3F G;  4BRY A;  3O8Z A;  3CLQ A;  2LPK A;  1SQB J;  1KIL E;  2Z44 A;  1HF9 A;  2A45 I;  1KTM A;  1VDF A;  2FYU J;  2VLQ A;  2KLU A;  3WUT A;  1BE3 G;  5KJ7 C;  3N4X A;  1PGO A;  1MKM A;  2JWD A;  3LRY A;  2Q3I A;  2EHS A;  3H1H G;  1L0L E;  2GDW A;  2QVA A;  2IPP A;  4NEO A;  2JU2 A;  4D6T E;  4GT1 A;  2BEQ D;  2O01 N;  1LWU B;  3H1J E;  3L73 D;  4ZMD A;  1DH3 A;  1BE3 J;  1GTW A;  1M1J A;  1RF0 C;  3A7O A;  3TNU A;  2K9J A;  2I1K A;  1Q7Y Q;  2PP6 A;  1BXI A;  3LID A;  3E1R A;  2GZI A;  1GZL A;  2WIT A;  4CA3 A;  1KQS O;  1HTL C;  3G29 A;  2IX7 C;  4GR6 A;  1D7M A;  2HYN A;  3F89 A;  2AXT E;  2LF4 A;  2ZYD A;  2WSC J;  2O1J A;  2KOQ A;  1Q86 Q;  1ZR4 A;  1LTT C;  2FYN B;  2XU6 A;  1JJ2 O;  2ZYG A;  2J5U A;  1URQ D;  2R5B A;  4HYT B;  2O01 H;  1NTK G;  2OYH C;  4IFM A;  1X0T A;  2IFN A;  5B66 H;  5AVQ B;  2Y0D A;  3AEE C;  1UNK A;  1PPJ D;  2K3R A;  1QLE D;  5F2O A;  3CCL P;  4DCK A;  4RES B;  4BPH A;  2OGU A;  3MUD C;  2L0Q A;  5AVV B;  4ZNC A;  4HB1 A;  2N6Y A;  1AF8 A;  3L73 G;  5E79 H;  3JCU E;  1EZV D;  5AW4 B;  5F2N A;  2L5G B;  4JYC A;  3RL0 D;  2NPS C;  5CBN A;  1QVF O;  3AEA C;  2KOS A;  1JMM A;  3A0B E;  2RKL A;  3B5N A;  1ZNV A;  3BCC J;  1R8E A;  1NOH A;  3EJE A;  2IBZ I;  2C9L Y;  1BSN A;  1RH5 B;  2W27 A;  3CCJ P;  1FZE A;  2WPR A;  2PEJ A;  4NPE A;  1QL2 A;  2WWW A;  1KFN A;  2FY8 A;  1X3O A;  1SS1 A;  2KOD A;  4XRO A;  1GDT A;  1DNY A;  1KB9 D;  1AQ5 A;  2K88 A;  3KHU A;  1Y8A A;  1BCC E;  1TU3 F;  2GZG A;  1DEE G;  1E0H A;  3L72 D;  2KGC A;  5CCH D;  1NKZ B;  4AQR D;  2H7H A;  4WY4 D;  1XTC C;  4H13 B;  3P8M C;  2KGD A;  1N8R Q;  2EHT A;  3VTP C;  3L71 J;  1PPJ G;  5GTH E;  3ABV C;  4YTP C;  3DPH A;  2NPS B;  2C0W A;  4U0D A;  2PNG A;  5GTI E;  1KQG B;  4U0C A;  4BXL A;  1M56 D;  1W5C E;  1EZV G;  2YIU C;  1IFP A;  2QNW A;  2R5D A;  2KSE A;  2OTL P;  1J1E B;  3L74 G;  1LTJ C;  1LJ2 A;  3G26 A;  3GZL A;  5KLI C;  3OAK A;  2KOP A;  2C0X A;  1PGP A;  1HWT C;  3M0D C;  1T6A A;  1LP1 B;  1K8A Q;  2ZJS E;  2Z46 A;  3RBX A;  4JF7 A;  1G1J A;  2MY5 A;  2MVV A;  1T8K A;  3CCV P;  4EYY Q;  4PD4 E;  5BU5 A;  3TGU D;  1M90 Q;  1U7M A;  3DS5 A;  1ZP0 C;  3WUV A;  2WPS A;  1GK6 A;  3DS0 A;  2YO3 A;  3L72 G;  4R0M A;  4L75 A;  3NTN A;  2QM7 A;  5HV8 A;  1SQX K;  1IFM A;  1CEI A;  2Y0C A;  3HE4 B;  3JSV C;  1IMP A;  2SPZ A;  1OWA A;  1OVU A;  4NPF X;  1BSH A;  2KI7 B;  1L0H A;  2CGQ A;  2KLV A;  2KOG A;  5KP7 B;  1GU4 A;  1LTJ B;  2N5I A;  4WBA A;  3HD7 D;  2YKP A;  5HVC A;  1PV3 A;  3B8E B;  4LLH A;  2MKV A;  3L72 J;  2KR5 A;  2JKV A;  1YI2 P;  3H1K D;  3Q3D A;  2GZE A;  3VMY A;  3GF7 A;  5KLV J;  3HTK B;  1KQF B;  5AW6 B;  3UIA A;  3CX5 I;  3G28 A;  1KFM A;  1UIX A;  1A02 J;  4H2W C;  2J58 A;  1S2E A;  2KNC A;  3PRJ A;  2KP8 A;  2FAE A;  1X8Y A;  1EXJ A;  3MIW A;  1CI6 A;  2N1T D;  3TGU G;  4COC A;  5TIS H;  2PFX A;  3HRN A;  4JQ0 D;  1N7S D;  4D6T D;  1K30 A;  2AEM A;  5EW5 E;  1A02 F;  2KG9 A;  5HGO A;  1NU1 J;  1L4A D;  4PH1 A;  1PGJ A;  2PRR A;  1X22 A;  1KMI Z;  1P84 E;  3WU2 H;  3TGU J;  5AW0 B;  3L71 E;  1KYO E;  2ZXX A;  3P8C D;  1GU5 A;  2H43 A;  1NKN A;  3B5I A;  3H25 A;  1RF1 A;  4XA4 A;  5KKZ B;  2JO0 A;  2FQ2 A;  1M6E X;  4K3A A;  1VL2 A;  2MJZ A;  1SQP J;  1QRJ A;  3H1K G;  1K04 A;  2EIA A;  1GXH A;  3CCS P;  1WT6 A;  1AFO A;  4GOF A;  4L73 A;  1RNI A;  2E76 D;  2GDX A;  1GL2 B;  2M8L A;  1SQV D;  5B5E E;  1FZB A;  2JGP A;  3GF3 A;  3HD7 C;  1YJ9 P;  1IK7 A;  2XND H;  1M6N A;  1KOR A;  2OTJ P;  3LIE A;  1L0N K;  2GUV A;  3EJD A;  1RE4 A;  3II6 A;  2POH A;  1KIL C;  1RF0 A;  4EDF A;  3GHG C;  3KYQ A;  4ZKP A;  2C9N Y;  1NAY A;  3VMZ A;  4D6T G;  4XFX A;  4WWI A;  5KP8 B;  3C8V A;  2IBZ E;  5APW A;  1YTZ I;  1USD A;  2MR8 A;  1SFC C;  3L70 E;  4WB4 A;  3CC4 P;  1H8A A;  1LT9 C;  4IL6 E;  3NXS A;  2ROQ A;  4I6M C;  5BU8 B;  5H2F H;  5AVR B;  2L22 A;  1JTH B;  2QJY B;  3D6Z A;  1FAV A;  1L4A C;  3E1I A;  2RN0 A;  1LTS C;  2OYH A;  2E74 B;  2WSF H;  1AVY A;  1SQQ K;  1GW4 A;  1N73 A;  5APT A;  1NH4 A;  3H0D A;  1SQV G;  1ACP A;  1MUU A;  3A2A A;  1HJ0 A;  1KIL B;  3EQ2 A;  5KJ7 D;  3AE3 C;  4RJT A;  4U0A A;  3MUD A;  5AW9 B;  4Y28 J;  4GKG A;  1ZME C;  1OFC X;  2QJK B;  2E76 C;  1KQL A;  3GW6 A;  1H89 A;  2N50 A;  3Q20 A;  5KP6 B;  1CZQ A;  3CE7 A;  3O6Q B;  1L0N E;  3AED C;  1LT9 B;  1MFT A;  2OYI A;  1W2B O;  3KZI E;  2JBG A;  2WSE H;  1DIP A;  1JUN A;  1OW8 A;  1VQ7 P;  1FR2 A;  1PEO A;  1LTB C;  2W90 A;  2N98 A;  2Q1K A;  2M5A A;  3G1I A;  3NTE A;  3A5T A;  3P05 A;  2Y9Y A;  2BCC E;  2AVA A;  2AXT H;  5CCG D;  1EDJ A;  1VQ4 P;  2R3S A;  2QE7 H;  3KQG A;  4CPG A;  1AVO A;  1LWU C;  1A8O A;  3MZW B;  2E42 A;  3Q5P A;  2JP3 A;  3CXH E;  2WPV B;  5CBO A;  1NTM D;  3MGE A;  1BCC G;  1S4X A;  1URQ A;  3G71 P;  3PH0 A;  3H32 A;  3L75 E;  1SQQ E;  1IZN B;  1FZG A;  1R5S A;  1GPJ A;  3SSU A;  3D6Y A;  1JM0 A;  1S5L E;  3AE9 C;  2KZI A;  2GM4 A;  3CL3 D;  2VLO A;  2DGY A;  4OVN F;  2P10 A;  3G6E P;  4C7N B;  1LTI C;  4H13 D;  4GOD A;  1NTK D;  2FVF A;  3JCU H;  3CME P;  1NTZ D;  2PEN A;  2PEO A;  2VLP A;  2FYN C;  3M0D A;  4ASV A;  2W83 C;  2NPS D;  4W7Y A;  3A0B H;  2M8P A;  2VLN A;  4U3F J;  3RK3 E;  3T97 B;  3S1K A;  1K73 Q;  1RE3 C;  1NWQ A;  2K9Y A;  2FXM A;  3HTK A;  2JEE A;  1BAJ A;  5L8R J;  2HLO A;  1AV1 A;  2QEX P;  1HUC A;  4EI2 A;  3HUS A;  4TT3 H;  4EIJ A;  3E2D A;  4EOT A;  2B87 B;  2M0B A;  2HFE D;  1NGM B;  3NMD A;  3V4W A;  2N9Y B;  4BWN A;  1UII A;  1AJY A;  3WUU A;  4C46 A;  1FE6 A;  3H1H J;  1FC2 C;  3HE5 A;  4ZKU A;  4OGQ B;  2CPB A;  3B71 A;  2W6A A;  1NTM G;  5CCG C;  2ZVN B;  5CCH A;  1DD4 A;  1SQB K;  4WY4 A;  2M3E A;  2FYU K;  2UWJ E;  3FXE A;  2FVE A;  1MFZ A;  3GMA A;  5GTH H;  4MRT C;  1OW7 A;  1GD2 E;  5AW3 B;  1X79 B;  2JB0 A;  1P84 D;  2KIK A;  2KGE A;  1G2C B;  5GTI H;  1PFI A;  4I1L A;  2KXP B;  1SQX D;  2P2U A;  1A43 A;  1NTZ G;  5EJD A;  5KAI H;  4UB6 E;  1NTM J;  4IFD K;  2A06 E;  3HYB A;  2WT7 A;  1IFN A;  2K93 A;  4WVZ A;  3D70 A;  2WPT A;  1OZH A;  2W8Z A;  2QG4 A;  1MZ8 A;  2GYK A;  1SVF A;  4H13 C;  1YBK A;  1YIT P;  1BGY E;  3U1C A;  3G3Z A;  1NYH A;  1VF5 B;  3TDK A;  4K35 A;  3VP9 A;  3OA7 A;  4PV1 B;  1NTK J;  1EZV I;  4PD4 H;  2PY8 A;  1ZR2 A;  1NTZ J;  3L74 D;  2K92 A;  4IPY A;  2RMZ A;  1VQN P;  3CD6 P;  4ASW A;  2PEI A;  1EDI A;  2IFM A;  2MVU A;  3K5B A;  2FQ1 A;  3SFE C;  2ZT9 B;  2HPC B;  3L35 A;  3H6P A;  1L0I A;  3ZDM A;  1J1E C;  3P32 A;  5DJU B;  3VN0 A;  4W7Z A;  2H8P D;  1S1C X;  4Z1M H;  1PEQ A;  3L73 J;  3H1I D;  2LKI A;  3CWB E;  1BDC A;  1IJD B;  3L70 D;  1RHZ B;  1JNM A;  3FGA D;  2W6J H;  5M1B A;  3BVH A;  1J1D B;  3MP7 B;  1KB9 I;  4RKU J;  4PWV B;  1H0T A;  5F2K A;  4IZ6 A;  1SQB E;  3PP5 A;  2A45 H;  1SQX G;  2FYU E;  1ZRT D;  3HD7 A;  2ERH A;  2Y0E A;  2GDY A;  2AEF A;  2ITA A;  3V2P A;  2N5H A;  2QM8 A;  4U3F E;  2WTY A;  1Q2N A;  1ZV8 A;  3GHG A;  1MV8 A;  2P9X A;  2J59 M;  3VOP A;  1S9K D;  2FFD B;  1EOQ A;  2K0D X;  3H1L D;  1GL2 D;  1AA0 A;  2JDI H;  2WPQ A;  1BE3 E;  3A0H E;  1VHN A;  2N1T A;  1SFC A;  4R4L A;  1NJI Q;  1L2P A;  3ITK A;  3CCE P;  1JY2 N;  3CCU P;  1MZ9 A;  1N7S A;  1L0N D;  3H1H E;  4GDO A;  2R3C A;  1HJB A;  3LW5 H;  3RL0 g;  5BS2 A;  2L9F A;  1L4A A;  4PXH B;  1FZC B;  3H1I G;  1OR5 A;  2PAJ A;  5JPA A;  1P84 H;  3L70 G;  1KD1 Q;  4IOI H;  1Y9B A;  1H88 A;  1KYO H;  2M8R A;  3L74 J;  3AEF C;  3MGN A;  1FDM A;  1EMV A;  4N3Y B;  4DT0 A;  4HJG H;  4XRQ A;  4U0F A;  1YQ3 C;  2HOD A;  3L37 A;  2BCC D;  2AEJ A;  3PJS K;  3RGU A;  5DJT B;  1Q81 Q;  2KS1 A;  2O3J A;  1PP9 D;  1DEB A;  4JYB A;  5B5E H;  1USE A;  1M1J C;  4H0L C;  5C39 A;  4BRY B;  4A7P A;  5KTB A;  4N78 D;  3W67 A;  2PEQ A;  1KC8 Q;  1FJP A;  3IAO A;  3CCM P;  4MN4 C;  3H1L G;  1M7L A;  1NQ4 A;  1J2J B;  3RBZ A;  2FXO A;  2H88 C;  3DS2 A;  7CEI A;  1KIL D;  5KKZ C;  4U7J A;  1ZN5 A;  2YNY A;  1K05 A;  3BCC E;  1JOC A;  2JU1 A;  1YTZ T;  1L0N G;  3U1A A;  2YKQ A;  3AEG C;  1GL2 C;  1SFC D;  1N86 A;  4IL6 H;  1L0L D;  2GUS A;  3L73 E;  3H47 A;  3WBH A;  1VQ6 P;  1LWU A;  1VQM P;  1HGV A;  2WSS H;  3M1M A;  4UB8 E;  1VQP P;  3LMO A;  2K0X A;  1ZOY C;  3H1J D;  1M1J B;  4PJ0 H;  2BCC G;  3TNU B;  2E75 B;  2K9J B;  4H0L B;  2NO8 A;  1YYC A;  1N2D C;  1PP9 G;  1IK9 A;  2YXR B;  3L36 A;  2YMY A;  1DX7 A;  5HGL A;  3B5N C;  2GA1 A;  5KJ7 A;  3NFQ A;  1LTG C;  5BS1 A;  2XV6 A;  2MF4 A;  5KLV K;  3JC2 2;  2CQ8 A;  2Q6Q A;  2QJY C;  2K37 A;  4HKZ H;  2R32 A;  3M0A A;  4XFY A;  2GZJ A;  1RE3 A;  2E5T A;  2E74 C;  3KZI H;  4H44 C;  1QGK B;  2YKO A;  5TJH A;  2KUB A;  1PPJ E;  4B86 A;  4QNB A;  3CC7 P;  2FYZ A;  1UJZ A;  2G8Y A;  2EFJ A;  1VKU A;  1VPC A;  1L0L G;  3H1K J;  1NU1 K;  2HG5 D;  1EZV E;  3S4R A;  1BGY D;  5K5G B;  3W68 A;  2LKM A;  4JPZ B;  2QJK C;  2G3A A;  3H1J G;  1VQK P;  2BQ1 E;  5APY A;  1S3J A;  4R4M A;  2QSI A;  5CCG A;  3B5N B;  2N6Z A;  2B88 A;  3DS4 A;  1T2K C;  3RK3 C;  4HH2 A;  1JY2 O;  2JYG A;  1NO4 A;  3CXH H;  5APQ A;  1L0L J;  1Z6M A;  2X2B A;  1SQP K;  2O1K A;  4H2X C;  2XV5 A;  2M8N A;  1RY3 A;  4BPF A;  3PHL A;  2AFE A;  1S5L H;  4D6T J;  1T3J A;  1KB9 E;  3WMM 0;  3FXD A;  4H44 B;  1YQ4 C;  3DTJ A;  1HBW A;  1EC5 A;  3L72 E;  4OGQ D;  2BUO A;  2XKM A;  1ZW0 A;  4GIF A;  2QIW A;  1BCC D;  2B9B A;  2BHV A;  2DW3 A;  3VP8 A;  1AYI A;  1SQB D;  1ZXG A;  5KLV E;  5EFW B;  1IUQ A;  2OYO A;  3KXD A;  3TSI A;  1OIP A;  3VRL C;  1JB0 J;  3FWN A;  1YJW P;  2IYO A;  2NPS A;  1OVR A;  3EFF K;  4U0E A;  3WU2 E;  1YIJ P;  3RK3 B;  2K94 A;  1GXG A;  4F37 A;  1RQV A;  1BGY G;  1SP4 A;  4XE5 B;  5DCK A;  2V7Q H;  1SQV J;  4YXW H;  1CSB A;  1VQ5 P;  2YXQ B;  2Q7C A;  2KSJ A;  1NU1 E;  2FBW C;  5AW7 B;  3G1G A;  1VF5 D;  4I2L C;  2LR2 A;  2CK3 H;  1QX8 A;  3N7N A;  2ONT A;  4C7R A;  1LP1 A;  2K0Y A;  3TGU E;  1GK4 A;  4AYC A;  2XZ1 C;  4I7Z C;  3I56 P;  4PD4 D;  2K1A A;  1IC2 A;  2KB7 P;  1SQP E;  4Y99 C;  4OWF A;  3CXC O;  1SLQ A;  2Q9I A;  4XFJ A;  4UB6 H;  1QEX A;  1SQB G;  3S9O A;  3M06 A;  3HE4 A;  5AVU B;  2FYU G;  2N9B A;  2R44 A;  4TLF A;  4OGQ C;  1WRG A;  2EG5 A;  3USS A;  3NY7 B;  3P7K A;  1Y47 A;  2L4B A;  3QWO C;  4O9B A;  1LTJ A;  5AVW B;  3F5H A;  3H1K E;  1KV4 A;  2MR7 A;  1BCC J;  1NAF A;  3V2R A;  3CX5 E;  3RK2 C;  1VQ8 P;  2BEZ F;  2KGA A;  1Q90 D;  4COP A;  2IYP A;  1RF1 C;  5I4T G;  2LIW A;  2NZ2 A;  4I7Z B;  2WQY C;  2KYV A;  2KNC B;  3AE2 C;  3BAS A;  3BCC D;  4Y99 B;  5CHX A;  4DG9 A;  1CI6 B;  4IL6 X;  2Q3E A;  2O01 J;  1VF5 C;  5KAF E;  3IFM A;  2FAD A;  3M91 A;  2CNR A;  2FAC A;  3CMA P;  1K9M Q;  4PV1 C;  4U0B A;  1FZF A;  5AW2 B;  1RE4 C;  1T8Z A;  3M9B A;  2P58 A;  1JO5 A;  3IN6 A;  3CPW O;  1CW5 A;  2KG6 A;  4M3L A;  2ZT9 C;  3MHV A;  3P8C E;  2FXP A;  3FWL A;  1JY3 N;  3RK2 B;  2KK7 A;  4N6J A;  1RF1 B;  3TYY A;  3L71 D;  5AVY B;  1KYO D;  3IF4 A;  1P84 I;  4GOE A;  2LTE A;  4LC1 A;  1KYO I;  1FU1 A;  1JY2 P;  2ZXE B;  2A45 G;  1GW3 A;  2L91 A;  1J1D C;  2YMK A;  3BRT B;  4IFF A;  2H89 C;  3A0H H;  1SQV E;  2P7J A;  1GL2 A;  2JYL A;  2D2C C;  3GKL C;  2JJL A;  1M74 A;  1M8O B;  1N73 C;  2OQQ A;  3BCC G;  2RH0 A;  3R2P A;  2WSC H;  1VQ9 P;  1U57 A;  4QKO A;  2MD9 A;  2XXM A;  2FFD C;  4YXD C;  5AVT B;  2IBZ D;  4L76 A;  3B4Q A;  2OYI C;  2JWA A;  2W6B A;  2KG8 A;  2PGD A;  2CPS A;  3G0V A;  1ZMB A;  3CCQ P;  1NTM K;  1JTH A;  1S5L X;  2P67 A;  3L71 G;  3VMA A;  2E75 D;  1PZQ A;  4H0L D;  1FZC C;  3GLM A;  2OYH B;  2D2C B;  1RQU A;  2E43 A;  1JEK A;  3TK1 A;  1FJK A;  1EDK A;  1N73 B;  1W2E A;  4GR2 A;  3I5C A;  2LL8 A;  3MD0 A;  3LW5 J;  2P1J A;  1IFD A;  1NTK K;  5APV A;  1KIL A;  5AW8 B;  3AE4 C;  1NTZ K;  1IMQ A;  2PEK A;  5KLV D;  1N7L A;  4AUW A;  1SQX J;  3I55 P;  4QMA A;  1URQ C;  2AFD A;  1FDI A;  3SFD C;  4DOJ A;  1YHQ P;  2Z5I A;  3O6Q A;  2OYI B;  4UB8 H;  3KDP B;  1LT9 A;  3FX0 A;  3DS1 A;  1XTG B;  3AEC C;  5KAI E;  5B66 E;  4XFZ A;  3RG6 C;  5AW1 B;  1PEU A;  2IBZ G;  5APX A;  1KN7 A;  2M5A B;  2K2Q A;  2JR8 A;  1NU1 D;  5HGM A;  2ZAE B;  3GZM A;  1PGQ A;  3OJA B;  4PH0 A;  2FQ0 A;  3RL0 C;  3A3Y B;  3AE5 C;  5E79 E;  3M9Q A;  3B5N D;  1Z56 A;  1DV5 A;  3B4S A;  3EJB A;  3CCR P;  2VRS A;  3U59 A;  1WMK A;  4M0I A;  1KLP A;  3HUS C;  1VQO P;  1NTM E;  1HQB A;  1EIA A;  3H1I J;  4DJG A;  4KJM A;  2CG5 B;  3L70 J;  1SQP D;  1URQ B;  3H32 B;  2E75 C;  4JBZ A;  2BAS A;  3CXH D;  1IFJ A;  1RO2 A;  2E74 D;  1AUM A;  1FS0 E;  4H44 D;  3CXH I;  3L75 D;  2ZYA A;  5KLV G;  1SQQ D;  2YIU B;  2WZ7 A;  1JY3 O;  2I1J A;  4WYM A;  1JCD A;  2XNX A;  1NTK E; 
#chains in the Genus database with same CATH homology
 2JYG A;  3H47 A;  1YIT P;  2QA4 P;  1NJI Q;  3WBH A;  1VQ6 P;  3DS0 A;  3CCE P;  1VQM P;  2CWO A;  3CCU P;  3B5I A;  3CCJ P;  3M1M A;  3CXC O;  1VQP P;  2PEJ A;  1D1D A;  2M8N A;  2JO0 A;  3CME P;  4U0A A;  1M6E X;  2PEN A;  2PEO A;  2PEK A;  3H4E A;  2KOD A;  1RO0 A;  1QRJ A;  5BS2 A;  2PY8 A;  2M8P A;  2E1M A;  4XRO A;  1Q7Y Q;  3I55 P;  3G21 A;  2EIA A;  3DTJ A;  3CCS P;  5JPA A;  1PEM A;  4IPY A;  1RNI A;  1VQN P;  3CD6 P;  1K73 Q;  2PEI A;  1KD1 Q;  1E6J P;  2EG5 A;  1KQS O;  2BUO A;  2M8L A;  3Q20 A;  1YHQ P;  2JYL A;  3G29 A;  1BAJ A;  4GR6 A;  1YJ9 P;  2QEX P;  1W2B O;  1M74 A;  1M6N A;  5HGL A;  2BHV A;  3DS1 A;  2OTJ P;  2LF4 A;  5HGN A;  1QVG O;  3E2D A;  4U0F A;  4XRQ A;  1N8R Q;  1IUQ A;  1YI2 P;  1PEQ A;  2L6E A;  4XFZ A;  3OW2 O;  3RG6 C;  3HZQ A;  5BS1 A;  3VRL C;  1Q86 Q;  2XV6 A;  1PEU A;  1VQ7 P;  3DPH A;  1YJW P;  1Q81 Q;  1JJ2 O;  1VQ8 P;  1PEO A;  4COP A;  1VQ9 P;  4U0E A;  3G1I A;  4U0D A;  5I4T G;  1YIJ P;  3NTE A;  3P05 A;  5HGM A;  4XFY A;  3G28 A;  4PH0 A;  4U0C A;  4XFX A;  5F2K A;  3G4S P;  5DCK A;  2XXM A;  4QNB A;  3CC7 P;  2PEQ A;  1VQ5 P;  1VQ4 P;  1KC8 Q;  2OTL P;  1S72 P;  3CCM P;  5F2O A;  3CCR P;  2EFJ A;  3CC4 P;  2Z44 A;  4COC A;  3CCL P;  1A8O A;  3G26 A;  3G1G A;  4M0I A;  1M1K Q;  3DS2 A;  1VQO P;  2PEM A;  1EIA A;  3G0V A;  3CMA P;  1K9M Q;  1ZMB A;  1K30 A;  2OAR A;  4U0B A;  3MGE A;  2ONT A;  3CCQ P;  1K8A Q;  2Z46 A;  2XT1 A;  3G71 P;  3CC2 P;  5HGO A;  5F2N A;  1RO2 A;  1A43 A;  4PH1 A;  3LRY A;  1AUM A;  1VQK P;  2BQ1 E;  3CPW O;  2P9X A;  3CCV P;  1QVF O;  1VQL P;  2Z45 A;  1EOQ A;  3HYB A;  1Q82 Q;  1YJN P;  3DS4 A;  1M90 Q;  3I56 P;  4GR2 A;  2DGY A;  3DS5 A;  4WYM A;  3G6E P;  3DS3 A;  3H0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...