1VQ4P

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq4P02
3CCRP 1VQ9P 1YJ9P 1NJIQ 1YITP 1YJWP 3CCEP 3G4SP 1KQSO 1KD1Q 3CC4P 3CCVP 3CCSP 3CC7P 1S72P 1YJNP 1M90Q 3CMEP 1VQ6P 1VQ7P 3CPWO 3CCUP 3CC2P 3CMAP 1YHQP 1VQNP 1Q7YQ 1VQLP 1N8RQ 3G71P 3CCJP 3CD6P 1K9MQ 3G6EP 1VQ8P 2QEXP 2QA4P 2OTLP 1YI2P 3CCQP 3OW2O 1Q81Q 3CCMP 3I56P 1M1KQ 1VQ4P 2OTJP 1KC8Q 1K8AQ 1JJ2O 1QVGO 1K73Q 3I55P 1YIJP 1QVFO 1Q86Q 1VQOP 1VQPP 1W2BO 1Q82Q 3CCLP 3CXCO 1VQ5P 1VQMP 1VQKP
chains in the Genus database with same CATH superfamily
3HZQA 3W67A 3BATA 3V2NA 3M91A 2R5DA 1NAFA 1EC5A 3L4FA 2IZ0A 1K05A 1SQBG 1EXJA 2WMMA 2V7QJ 1OW7A 3G6EP 2BUOA 5H2FE 1NWQA 4GOEA 2M8LA 3VN0A 2DGYA 3BCCE 4H13C 3FWLA 4WY4C 2QE7H 2I8DA 5B5EE 1L0LE 2UWJE 1MZ8A 1M1KQ 2Q7CA 2AF8A 2E1MA 1OW8A 1S9KE 1EDJA 2JJLA 5AW4B 4H0LB 2ZXXA 1M74A 1JOCA 3AEGC 5KLIC 3VMAA 1RE3A 3MP7B 2PEKA 1YQ4C 4F37A 2W6JH 3H1JD 3G3ZA 4YXWH 3GJNA 1S1CX 2FXMA 1NTMJ 2XDJA 3SSUA 3KDPB 2FADA 4I6MC 3FXEA 1SQVK 2AEJA 2Z5IA 1Q90D 2B87B 2PEJA 2BCCG 5AVQB 1YQ3C 5C39A 5KAIE 3C9IA 4I1LA 1NU1J 2QJYB 1YHQP 5APVA 2NRGA 4R4LA 2CPBA 2OYIB 2PENA 1VF5C 3H1LJ 2N9YB 1OVRA 2E5YA 3HD7B 2AXTH 2JU1A 1PFIA 1T2KD 2B9BA 1KYOI 2NZ2A 3L71D 1PV3A 1DIPA 3DS1A 3WBHA 2KODA 1KYOH 1FZCA 2FVAA 1S4XA 2JO1A 4C46A 1OWAA 3OAKA 1R8EA 3CE7A 2KNCB 1SQQE 3CCEP 2M3BA 4Y99B 4XE5B 4N3YB 1NHLA 1QRJA 3HUSC 4YTPC 2L5GB 1E79H 4OWFA 1YTZI 1NTZK 3VMZA 1SQVG 4GOFA 1IK9A 3FGAD 3GF3A 1DEEG 2K3RA 1EDKA 3PJSK 1G2CB 2KGAA 4UB6E 3MUDA 2ZYAA 4I7ZC 1S5LE 1W5CE 3H25A 3PRJA 4BRYB 3N4XA 2POHA 3B5NC 4YPCA 1NTKK 1UJZA 2L0QA 3LMOA 4PH0A 1LTJB 1USDA 1YJ9P 1KB9E 4LC1A 3EJEA 3L74G 4H44C 1FU1A 2WPRA 5CJ0A 5AW3B 1PPJE 5E79E 4WY4D 4K3AA 1FDIA 3K5BA 5CMZA 1EQ7A 3H1KD 3BCCJ 3H1HE 4W80A 2L9FA 3NXSA 1DEBA 2HR3A 1M1JB 2KOOA 3CMEP 1CI6A 3P05A 4WBAA 1N8RQ 3AE2C 1L0LJ 3H32B 4PXHB 1NTZG 2IBZE 1E5WA 1GW3A 1VQPP 1OR5A 4TLFA 1KILE 3IF4A 1L0IA 1Y8AA 4R4MA 2Q1KA 2W8ZA 2FYNB 3P7KA 3A2AA 2N1TA 3RK2C 2PGDA 3CXHI 3RG6C 3RL0g 1FZCB 2P58A 1NTKG 4U0CA 2YKQA 2WSCH 1AA0A 1ZNVA 5CBOA 4NPDA 2E76C 1L4AC 3CXHH 4BPGA 2O01J 5AW5B 1SQPE 2M5AA 5BVZA 1KN7A 1VF5D 2GZEA 2GZJA 2KG9A 5GTIE 5KKZB 2ROQA 1N73B 3HUSA 1R5SA 3Q2YA 3TGUG 2NPSA 1K04A 3AE4C 4LGDE 3T97A 2JGPA 1ZMEC 1K30A 4BXLA 1XTGB 2WWWA 2PY8A 4CPGA 1GTWA 3QWOC 4ZMDA 1WRGA 3E2DA 3A3YB 4U0FA 3L75G 1JY2P 2FYZA 2QEXP 3L70G 2MVUA 1KMIZ 1M57D 5AVSB 2AFEA 1YTZT 1RF1C 2LR2A 3B5NA 4OGQC 5KP8B 3G26A 3GHGB 4IOIH 2N5HA 4PD4I 4U7JA 1S3JA 1GL2C 2YMKA 1OFCX 1OX3A 1UNKA 4HKGA 3PTZA 3NTNA 3JCUH 5AW6B 4PD4H 2PEOA 1OVUA 3HE5A 1F80D 1FOSE 1KQFB 2YMYA 3B5ND 2OGUA 2KOGA 2WPSA 4QMAA 3DS3A 1LJ2A 2Y0CA 2XZ1C 1J2JB 4U0AA 5CJ4A 2JP3A 5CZDB 1FZGA 2CQ8A 4COCA 3L35A 3M9BA 4H44D 2EIAA 2KLUA 3N7NA 1EIAA 1GZLA 1RQUA 1SQXD 2HODA 3CL3D 2KSEA 3TGUD 4ZKPA 1M6NA 1HGZA 2K0YA 4XA4A 3CCUP 2H7HA 4C7RA 1BE3E 2LKIA 3DS5A 3L73G 1GK4A 2O01N 3FXDA 3H1HJ 3L75D 3L70D 1VQKP 5TISE 1D7MA 4ASVA 1LP1B 1FAVA 2C0WA 3DPHA 1BCCG 2JYGA 4GR6A 2JR8A 3AE8C 2KYVA 4U0EA 1BGYJ 4K35A 2KW2A 4PJ0H 3WU2E 1FBMA 3EJDA 3KXDA 5HGMA 3NMDA 2K37A 5DJUB 3RK2D 4DJGA 1CEIA 1LT9A 2R3CA 2HLOA 3O6QB 1QL1A 2E76D 1L4AD 4U3FD 2N98A 4DOJA 2QJPB 1JJ2O 3RK3C 4IZ6A 2A06D 4EI2A 2K93A 1SQPJ 1FE6A 2K0XA 2R5BA 1N7SB 1P84I 1RF1A 4COPA 4BPFA 2H89C 3G71P 3KHUA 3H1JE 1YI2P 1NTMK 5AVXB 2YKOA 1Q86Q 1A43A 1P84H 1NJIQ 1LWUC 3L73D 1L0ND 3EFGA 1HUCA 2FKWB 3USSA 1NU1K 3CXHD 5AW7B 1PIXA 4L73A 3G1GA 3AE1C 2LIWA 1KILB 4OGQD 3RL0B 2KS1B 5BU8B 3CCQP 2KGEA 3AE6C 2W6AA 3M1MA 4HB1A 5HVCA 2BEQD 1GL2D 2QVAA 2P2UA 2VLOA 1ZLLA 2FYUD 2OYHB 2P1JA 1AQ5A 1T8ZA 1HBWA 2MVVA 2ZT9B 2FFDA 3Q20A 2FQ2A 3L71E 1VQ8P 2XKMA 4RO0A 2LKMA 1Z56A 1IFPA 1FS0E 3CXCO 1VPCA 1EMVA 1JY3O 1IK7A 2KLVA 3GW6A 4C7NB 3Q5SA 4HJGH 2PRRA 1TU3F 1A02J 2IFNA 2YIUB 1NTMG 5KP6B 7CEIA 1RNIA 5H2FH 1JO5A 4QKOA 1LTTC 3G29A 1LT9B 3GMAA 2M5RA 1JTHA 5KLVJ 1VL2A 2EHTA 5B5EH 4PV1B 1VQ9P 1NU1G 4D6TD 1SFCC 4PD4D 3B4QA 2Y0DA 3R4YA 1FZFA 5F2KA 4HYTB 1NAYA 2OTKE 2K9JB 1NKZB 3H1LG 2WSSH 2ZAEB 2K88A 5KAFH 5CCHC 2LL8A 3L72D 1GPJA 4ZNCA 3SFDC 3IN6A 4WVZA 5AVYB 1SP4A 1EZVE 1SVFA 1PP9D 1T6AA 2PAJA 1IFJA 1BDDA 4CA3A 3C1LA 2J59M 1ZV8A 2O01H 3H1KE 1Q82Q 2O3JA 1VQ5P 1PGQA 3CWBJ 5KAIH 1ZXGA 2FY8A 2ZJSE 1IZNB 1DD4A 3BVHA 3RK3D 1L0LK 2M0BA 2QJKB 3KQGA 1GDTA 1RO0A 2H88C 1J1DB 3G0VA 2VLQA 1QLED 2QG4A 2ZYGA 2N6ZA 1QVGO 3OA7A 2GYKA 1KQGB 2FXOA 3H0DA 1MUUA 2K94A 1IMQA 1ZP0C 1Y47A 3WUTA 3TNUA 2EG5A 2J58A 3P32A 2Q3IA 1NOHA 3H1JJ 3UIAA 1Y9BA 2ZXEB 2Q5UA 3WUUA 3CI9A 3MIWA 5KJ7D 1SQBD 2FHSC 1OIPA 2GZFA 4N78D 4GR2A 4QNBA 1T3UA 1HQBA 2KB7P 2C9NY 1YYCA 2HPCA 1NO4A 2YNYA 3GG2A 1JTHB 2WSEJ 3CD6P 1J1EC 1HH0A 1MFZA 1RH5B 3HRNA 4UB6H 1X79B 1LTSC 3VMXA 1IC2A 3H1IJ 3B5IA 3P8CD 3A0BE 2WPQA 2K0DX 1L0LG 3VMYA 2VLNA 2M8PA 1P84D 3L71J 2H43A 3HE4A 3VRLC 2M3EA 4AYCA 1SFCA 2FXPA 2IZ1A 3M0AA 2PEQA 1VQOP 3E7KA 1PEUA 1DV5A 3OJAB 4ASWA 1HF9A 5AVRB 5CCHA 1KFNA 3CX5E 2MR7A 2E43A 5E79H 3AEDC 3RG2A 1BXIA 1PGOA 2R44A 2BCCD 4WY4A 1SFCD 1T3JA 4U0BA 2IPPA 3II6A 1LTGC 3VP9A 1EXIA 1OXZA 1DX7A 1CZQA 5K5GB 4GT1A 1N7LA 2GUSA 5CCHD 1HY8A 3HYBA 2PEIA 3I5CA 2Z44A 1VKUA 2E74C 4LLHA 3PLNA 4RESB 1SQXE 2K5XA 1N2DC 2E75C 3IAOA 1N7SC 1S72P 3TGUE 1MV8A 3G28A 2P67A 1OW6A 2N5IA 2MD9A 5APWA 3H1KJ 3L75E 2RN0A 2HPCB 1S9KD 2FVFA 3NFQA 5HGNA 1Q2NA 1IMPA 1KD1Q 5GTIH 2AVAA 1SQVD 3BRTB 2X2BA 3M0DC 1AJYA 1Q7YQ 2C0XA 4Y28J 5APXA 5DCKA 3BASA 2BQ1E 4PWVB 1HVVA 3BRVB 2K92A 1L2PA 4XFZA 5B66E 1HGVA 2KORA 4UB8E 2NO8A 3VOPA 1M56D 3GZMA 3CCJP 4U3FE 1PEQA 2OTLP 1USEA 3L74D 3OW2O 3V4QA 1URQC 1BDCA 2A06E 1OZHA 1SQPK 3AE3C 2MJZA 2KUBA 1PPJG 1NVOA 4H13B 5EJDA 4WY4B 3IFMA 1VQNP 1JB0J 2KOQA 1LTAC 2ONTA 3H1HG 2WZ7A 3EJBA 5L8RJ 1ZRTD 1T8KA 3KZIE 3D71A 1RF0C 2M8RA 1HJBA 5BU5A 1X8YA 1PL5A 3O8ZA 5AVWB 1SQQJ 1M7LA 1NTZD 1WT6A 4KJMA 2J5UA 4IPYA 3L73E 1L0NE 4NPEA 4XRQA 2IBZG 1BGYG 5KLIB 3NY7B 3U59A 3CXHE 1EDLA 3D6ZA 2L4BA 2GDXA 4N6JA 1NGMB 2HYNA 1GK6A 1JY2O 4PH1A 4AQRD 1CI6B 2ITAA 4RKUJ 1NTKD 2AXCA 2FYUE 2KOPA 3ZDMA 3HTKA 4KT0J 1ACPA 1KYOD 1QL2A 2V7QH 2SPZA 1VQLP 1VHNA 3JSVC 4JPZB 5TISH 1IO4A 1SQPG 2V4HA 1U57A 1VF5B 3CCLP 2CK3H 2N1TB 3ABVC 4H2XC 4GIFA 4H0LC 1QGKB 2FACA 3WU2H 3P8MC 1GU4A 3L36A 2E74D 1J1DC 1NKNA 3EFFK 2E75D 5KLVK 1N7SD 4EOTA 3M0DA 2KG8A 2M5AB 1SQXJ 3V2QA 3SWYA 2QM8A 4M3LA 3EQ2A 4JYBA 3TGUJ 2QIWA 4D6TE 4PD4E 2JU2A 2AEMA 2QJYC 1X22A 1L4AA 3HUSB 1JMMA 2OYIC 2NPSB 4RJTA 1E0HA 1BGYD 4WWIA 3T97B 1XTCC 2FAEA 3H47A 5APSA 3HD7C 3CLQA 2WPTA 2IDBA 3L72E 2PFXA 1U7MA 3CCRP 1FC2C 4JBZA 2WT7A 5HV8A 4I7ZB 2OARA 1H0TA 2KK7A 2GA1A 1PP9E 3G9RA 3LIEA 3B5NB 1CW5A 3V2RA 1K73Q 4IL6H 3F89A 5KTBA 3MGNA 3PH0A 4Y99C 2LIUA 1JUNA 1RF0A 1URQD 2WSEH 3H4EA 1AVYA 3RK3E 2KXPB 2AFDA 4U3FJ 4H44B 5AVVB 5KLVG 5F2NA 3TSIA 3HE5B 2JQ4A 3MGEA 2A45I 4PJ0E 1SLQA 4H2YC 1L0HA 1GL2A 4DCKA 1FZBA 3AE5C 1RHZB 1YITP 3R2PA 1AF8A 5KJ7C 3E1IA 3KPEA 1JMBA 2A45H 3VTPC 3EWKA 1BCCD 5GTHH 1SQBE 1JNMA 5AW1B 2HODB 4N78E 1LTJC 1L0NJ 3SFEC 3A0HE 2FQ1A 2QSIA 2RKLA 3MD0A 1AFOA 1GU5A 3RK2B 2D2CB 3G21A 4GODA 1IFDA 1PEMA 1PGPA 1IFIA 2GDWA 3CWBG 1MZ9A 5I4TG 2LTEA 1AQTA 1W2BO 1BSHA 2GZIA 2Y0EA 2FYUJ 5CCGD 2E76B 1L4AB 1M1JC 4GKGA 2JWDA 4EYYQ 1P84E 3GLMA 3E1RA 1EZVI 1H8AA 4KHXA 2B87A 3DS4A 4H0LD 3NTEA 5AW0B 5JPAA 1CSBA 2LF4A 1D1DA 4IFFA 2OYIA 5KLVD 2WTYA 2C9LY 3H1JG 1EDIA 2FYNC 2R3SA 2IYPA 3CC4P 1HJ0A 4XFXA 1FZCC 5APQA 1BE3J 2BCCE 1M6EX 2Q9IA 1VQ4P 4XROA 1VDFA 2ZVOB 1ZMBA 1N86A 1GMJA 4D6TJ 4IFMA 1RF1B 1PGJA 4OGQB 1IFMA 2B88A 1FOSF 3LIDA 5HGOA 4H2WC 3PP5A 2KNCA 3HD7D 2JEEA 5KKZC 1LTIC 1KZUB 1GL2B 3H1IG 3MUDC 1A02F 1FJKA 2KOSA 1ZR2A 2OTJP 1N73C 3L72J 5BS2A 3MHVA 3CWBD 3L71G 1KQSO 3L37A 3TF5A 2W6BA 3FWNA 3W68A 3F5HA 1PP9J 2LPKA 2A45G 2XZRA 4IL6X 1G2CA 1IFNA 3U1CA 1LWUA 2JKVA 1IUQA 5KJ7A 3WMM0 4JYCA 2N6YA 4TT3H 1NTMD 4BRYA 5KAFE 1A8OA 2FFDB 3GHGC 4MN4C 2CWOA 1SQVE 1MFTA 4NEOA 1VQ6P 1LTJA 1VQ7P 3LW5J 2G3AA 1JCDA 1NU1D 3A0BH 1BAJA 2GUVA 1KC8Q 2CG5B 3H1LD 1OVVA 2VRSA 4WB4A 2Q3EA 1X3OA 1DNYA 3A7OA 4DT0A 3A5TA 2YO3A 4Z1MH 2JDIH 3CX5I 1KLPA 3RBZA 1M1JA 5TJHA 1MKMA 3B8EB 1SQBJ 2VLPA 3L74E 3BCCG 2N1TC 1K8AQ 3H32A 3CX5H 1EZVG 2Z4EA 2WQYC 3H1ID 1S5LH 1UIIA 3CCVP 5DJTB 1KB9I 4OH8B 4A7PA 3H1KG 1G1IA 2HFED 2JB0A 5M1BA 2MR8A 1QX8A 1ZRTE 2O1KA 4OVNF 3Q5PA 5APUA 1FJPA 1KB9H 2FBWC 3RK3B 1SQQK 1FDOA 2E5TA 1NTZE 3DS2A 1KFMA 2HG5D 3G1IA 2WSFJ 2AXTE 4ZKUA 2NPSC 1JY3N 3V6IA 1EOQA 3TYYA 2LMLA 2IBZI 2DW3A 3Q1MA 2MY5A 1NTKE 4L75A 2IFMA 3V2PA 1N73A 1LWUB 2DNWA 1H89A 1KYOE 1SS1A 1X9VA 5EFWB 3CPWO 1AYIA 3JC22 2KGCA 2BCCJ 5CHXA 2QJPC 3CCMP 3TNUB 2WPVB 4B86A 5AVZB 2P9XA 2JWAA 1H88A 3AECC 3BCCD 3G4SP 4UHPB 2XV5A 2BHVA 2RH0A 2PP6A 1EZVD 2N50A 2CPSA 3GHGA 2I1JA 5AW2B 4H13D 1L0LD 2CNRA 1SQQG 5B66H 1SQXK 4UB8H 2KI7B 4EIJA 1YJNP 3L70E 3GF7A 4L74A 2Q6QA 1IJDB 3C8VA 4HKZH 1GD2E 2Y9YA 3GKLC 2L22A 1KILC 3RL0C 3GZLA 1BGYE 2QA4P 3U1AA 3AEEC 1FDMA 1KTMA 1QVFO 1YIJP 3S9OA 2YO2A 2OYHC 1JCCA 1SQVJ 3HE4B 5AW8B 1DH3A 4I2LC 1RE4C 1SFCB 2ZT9C 2D2CC 3KZIH 3QH9A 3Q3DA 5AW9B 3S4RA 1RO2A 3MZWB 1RY3A 2OQQA 3SWKA 2ZYDA 1JM0A 1QEXA 1VQMP 3S1KA 1LGHB 3M06A 2RMZA 1YBKA 2Z46A 4GDOA 3IR9A 2BASA 2N1TD 2YIUC 3CMAP 1LP1A 3AE7C 1X0TA 3L74J 3TDKA 1E6JP 1S5LX 4O9BA 1LT9C 1SQXG 2K9YA 4XFYA 1RQVA 4PV1C 2KWLA 4DZOA 5APTA 2M8NA 4W7YA 1SQQD 2AEFA 5AVTB 4BWNA 2CGQA 2WVRA 2FVEA 2LXBA 4BPHA 2JAZA 2XZ0D 1HTLC 1NQ4A 1BCCE 3O6QA 2IX7C 1NYHA 3MTUE 4L76A 1NTZJ 1L0NK 2NPSD 2GDYA 3B71A 2Y9ZA 2MKVA 2G8YA 3CX5D 3D70A 2PEMA 4WYMA 3CC2P 2QRXA 5CCGC 1GW4A 5EW5E 3AEBC 4YXDC 1N7SA 3B4SA 2GM4A 1GXHA 4IFDK 2FYUK 1NTKJ 2K2QA 4U0DA 1YJWP 4U3FG 1KB9D 1M8OB 2QJKC 2A06G 2MF4A 4MRTC 3VP8A 4R0MA 1PPJD 1J1EB 1BSNA 1KILA 5KLVE 2FFDC 2KS1A 3D6YA 3H1HD 2KGDA 2IYOA 1LTBC 2FQ0A 3JCUE 2VSQA 2QNWA 1FZEA 2OYHA 2O1JA 3KYQA 2IBZD 2ERHA 1L0NG 1RE4A 1Q81Q 3I56P 2YXQB 3L75J 2XNXA 1LT1A 3L70J 1KORA 3ITKA 4JQ0D 1R5LA 1KILD 3H6PA 3RL0D 1U7JA 3DTJA 5AVUB 4M0IA 1URQA 2KSJA 3AEAC 3LW5H 2XNDH 2LXCB 1ZOYC 2E42A 2B89A 2QM7A 4C7NA 2LOLA 1ZR4A 1PZQA 2FYUG 5APYA 1PEOA 2ZT9D 2XXMA 2D2CD 4W7ZA 1GXGA 1G1JA 5BS1A 3CWBE 4XFJA 1SQPD 2L6EA 1UIXA 3RGUA 3WUVA 2WITA 3FX0A 3LRYA 3TK1A 3U43A 3A0HH 3Q5RA 3VYIA 5KP7B 1S2EA 3AEFC 2E74B 3I55P 2K9JA 2P7JA 3HTKB 1Z6MA 1NTME 3AE9C 2KR5A 2E75B 4AUWA 1BE3G 4HH2A 5CBNA 4PV1D 2EHSA 3V4WA 1KV4A 2Z45A 1NU1E 3PHLA 1DD3A 2KIKA 1RE3C 2ZFCA 4D6TG 2ZVNB 2WSCJ 5CCGA 5HGLA 3H1LE 1FZAA 3L73J 4JF7A 2WSFH 2R32A 2KG6A 3CC7P 4IL6E 2XU6A 2XT1A 1W2EA 2KZIA 2H8PD 3RBXA 3L72G 1BCCJ 2I1KA 1SQBK 1T2KC 2P10A 1AVOA 1JY3P 2Z5HA 2EFJA 3P8CE 3H1IE 4NPFX 1PP9G 2W27A 1ZW0A 1JY2N 1JEKA 1M90Q 2YKPA 2YXRB 1LNQA 2JYLA 1K9MQ 2K1AA 1ZN5A 1NH4A 3M9QA 2KZJA 2JO0A 2BEZF 2WT7B 1URQB 3M9HA 2GZGA 2W90A 1H0TB 5GTHE 1AUMA 2XV6A 3CCSP 1AV1A 4DG9A 1WMKA 1OMIA 2L91A 3HD7A 2OYOA 4EDFA 3V5BA 3SWFA 3DS0A 2PNGA 5F2OA 1FR2A 1BE3D 2KP8A 2N9BA 2JBGA 2W83C 1KQLA 1HWTC
chains in the Genus database with same CATH topology
3HZQA 3DS2A 4U0DA 1YJWP 3G26A 1KQSO 2EG5A 3G1IA 3CMEP 3HYBA 1VQNP 3P05A 2PEIA 1N8RQ 1RO2A 2ONTA 2Z45A 3G21A 3G6EP 1RNIA 1PEMA 1EOQA 2BUOA 3G29A 1IUQA 2Z44A 3DS1A 3WBHA 5I4TG 3H47A 2KODA 1JJ2O 1VQPP 1W2BO 1VQMP 5HGLA 2PEOA 4GR2A 2M8LA 1A8OA 4QNBA 3CCRP 2DGYA 1VQ9P 4IPYA 3CCEP 2CWOA 4XRQA 3CC7P 2Z46A 1S72P 1VQ6P 2OARA 2XT1A 1VQ7P 3CPWO 1QRJA 3CMAP 3G28A 5F2KA 3RG6C 3DS3A 4COPA 3G71P 3CD6P 3DS4A 3NTEA 1E6JP 4U0AA 1YI2P 4U0CA 5JPAA 4XFYA 1Q81Q 1BAJA 4COCA 3I56P 3CCMP 1M1KQ 1KC8Q 2LF4A 1D1DA 2EFJA 4PH1A 1K73Q 1Q86Q 1A43A 2E1MA 2EIAA 2P9XA 3B5IA 5HGNA 2M8NA 1EIAA 1NJIQ 1M74A 3DTJA 3G4SP 1KD1Q 4M0IA 3CC4P 4XFXA 2BHVA 1M90Q 3H4EA 1M6NA 2PEKA 2M8PA 3CCUP 1Q7YQ 1VQLP 3G1GA 3VRLC 5DCKA 2JYLA 1K9MQ 5F2NA 2BQ1E 3CCQP 3DS5A 1M6EX 1VQ4P 3MGEA 1PEOA 2JO0A 1K8AQ 4XROA 3M1MA 2XXMA 2PEQA 1VQOP 1Q82Q 3CCLP 4PH0A 1ZMBA 1VQ5P 1YJNP 4XFZA 1VQKP 1PEUA 5BS1A 1AUMA 1YJ9P 2XV6A 1K30A 1YITP 3CCVP 2PEJA 2PY8A 3CCSP 2L6EA 2PEMA 3DPHA 2JYGA 4GR6A 5HGOA 3E2DA 4WYMA 3CC2P 1YHQP 4U0FA 1RO0A 4U0EA 3Q20A 3CCJP 3G0VA 3DS0A 1VQ8P 3LRYA 2QEXP 2QA4P 2OTLP 1PEQA 5F2OA 2PENA 3OW2O 5HGMA 2OTJP 5BS2A 4U0BA 1QVGO 3I55P 1YIJP 1QVFO 3H0DA 3CXCO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR P;  1VQ9 P;  1YJ9 P;  1NJI Q;  1YIT P;  1YJW P;  3CCE P;  3G4S P;  1KQS O;  1KD1 Q;  3CC4 P;  3CCV P;  3CCS P;  3CC7 P;  1S72 P;  1YJN P;  1M90 Q;  3CME P;  1VQ6 P;  1VQ7 P;  3CPW O;  3CCU P;  3CC2 P;  3CMA P;  1YHQ P;  1VQN P;  1Q7Y Q;  1VQL P;  1N8R Q;  3G71 P;  3CCJ P;  3CD6 P;  1K9M Q;  3G6E P;  1VQ8 P;  2QEX P;  2QA4 P;  2OTL P;  1YI2 P;  3CCQ P;  3OW2 O;  1Q81 Q;  3CCM P;  3I56 P;  1M1K Q;  1VQ4 P;  2OTJ P;  1KC8 Q;  1K8A Q;  1JJ2 O;  1QVG O;  1K73 Q;  3I55 P;  1YIJ P;  1QVF O;  1Q86 Q;  1VQO P;  1VQP P;  1W2B O;  1Q82 Q;  3CCL P;  3CXC O;  1VQ5 P;  1VQM P;  1VQK P; 
#chains in the Genus database with same CATH topology
 3HZQ A;  3W67 A;  3BAT A;  3V2N A;  3M91 A;  2R5D A;  1NAF A;  1EC5 A;  3L4F A;  2IZ0 A;  1K05 A;  1SQB G;  1EXJ A;  2WMM A;  2V7Q J;  1OW7 A;  3G6E P;  2BUO A;  5H2F E;  1NWQ A;  4GOE A;  2M8L A;  3VN0 A;  2DGY A;  3BCC E;  4H13 C;  3FWL A;  4WY4 C;  2QE7 H;  2I8D A;  5B5E E;  1L0L E;  2UWJ E;  1MZ8 A;  1M1K Q;  2Q7C A;  2AF8 A;  2E1M A;  1OW8 A;  1S9K E;  1EDJ A;  2JJL A;  5AW4 B;  4H0L B;  2ZXX A;  1M74 A;  1JOC A;  3AEG C;  5KLI C;  3VMA A;  1RE3 A;  3MP7 B;  2PEK A;  1YQ4 C;  4F37 A;  2W6J H;  3H1J D;  3G3Z A;  4YXW H;  3GJN A;  1S1C X;  2FXM A;  1NTM J;  2XDJ A;  3SSU A;  3KDP B;  2FAD A;  4I6M C;  3FXE A;  1SQV K;  2AEJ A;  2Z5I A;  1Q90 D;  2B87 B;  2PEJ A;  2BCC G;  5AVQ B;  1YQ3 C;  5C39 A;  5KAI E;  3C9I A;  4I1L A;  1NU1 J;  2QJY B;  1YHQ P;  5APV A;  2NRG A;  4R4L A;  2CPB A;  2OYI B;  2PEN A;  1VF5 C;  3H1L J;  2N9Y B;  1OVR A;  2E5Y A;  3HD7 B;  2AXT H;  2JU1 A;  1PFI A;  1T2K D;  2B9B A;  1KYO I;  2NZ2 A;  3L71 D;  1PV3 A;  1DIP A;  3DS1 A;  3WBH A;  2KOD A;  1KYO H;  1FZC A;  2FVA A;  1S4X A;  2JO1 A;  4C46 A;  1OWA A;  3OAK A;  1R8E A;  3CE7 A;  2KNC B;  1SQQ E;  3CCE P;  2M3B A;  4Y99 B;  4XE5 B;  4N3Y B;  1NHL A;  1QRJ A;  3HUS C;  4YTP C;  2L5G B;  1E79 H;  4OWF A;  1YTZ I;  1NTZ K;  3VMZ A;  1SQV G;  4GOF A;  1IK9 A;  3FGA D;  3GF3 A;  1DEE G;  2K3R A;  1EDK A;  3PJS K;  1G2C B;  2KGA A;  4UB6 E;  3MUD A;  2ZYA A;  4I7Z C;  1S5L E;  1W5C E;  3H25 A;  3PRJ A;  4BRY B;  3N4X A;  2POH A;  3B5N C;  4YPC A;  1NTK K;  1UJZ A;  2L0Q A;  3LMO A;  4PH0 A;  1LTJ B;  1USD A;  1YJ9 P;  1KB9 E;  4LC1 A;  3EJE A;  3L74 G;  4H44 C;  1FU1 A;  2WPR A;  5CJ0 A;  5AW3 B;  1PPJ E;  5E79 E;  4WY4 D;  4K3A A;  1FDI A;  3K5B A;  5CMZ A;  1EQ7 A;  3H1K D;  3BCC J;  3H1H E;  4W80 A;  2L9F A;  3NXS A;  1DEB A;  2HR3 A;  1M1J B;  2KOO A;  3CME P;  1CI6 A;  3P05 A;  4WBA A;  1N8R Q;  3AE2 C;  1L0L J;  3H32 B;  4PXH B;  1NTZ G;  2IBZ E;  1E5W A;  1GW3 A;  1VQP P;  1OR5 A;  4TLF A;  1KIL E;  3IF4 A;  1L0I A;  1Y8A A;  4R4M A;  2Q1K A;  2W8Z A;  2FYN B;  3P7K A;  3A2A A;  2N1T A;  3RK2 C;  2PGD A;  3CXH I;  3RG6 C;  3RL0 g;  1FZC B;  2P58 A;  1NTK G;  4U0C A;  2YKQ A;  2WSC H;  1AA0 A;  1ZNV A;  5CBO A;  4NPD A;  2E76 C;  1L4A C;  3CXH H;  4BPG A;  2O01 J;  5AW5 B;  1SQP E;  2M5A A;  5BVZ A;  1KN7 A;  1VF5 D;  2GZE A;  2GZJ A;  2KG9 A;  5GTI E;  5KKZ B;  2ROQ A;  1N73 B;  3HUS A;  1R5S A;  3Q2Y A;  3TGU G;  2NPS A;  1K04 A;  3AE4 C;  4LGD E;  3T97 A;  2JGP A;  1ZME C;  1K30 A;  4BXL A;  1XTG B;  2WWW A;  2PY8 A;  4CPG A;  1GTW A;  3QWO C;  4ZMD A;  1WRG A;  3E2D A;  3A3Y B;  4U0F A;  3L75 G;  1JY2 P;  2FYZ A;  2QEX P;  3L70 G;  2MVU A;  1KMI Z;  1M57 D;  5AVS B;  2AFE A;  1YTZ T;  1RF1 C;  2LR2 A;  3B5N A;  4OGQ C;  5KP8 B;  3G26 A;  3GHG B;  4IOI H;  2N5H A;  4PD4 I;  4U7J A;  1S3J A;  1GL2 C;  2YMK A;  1OFC X;  1OX3 A;  1UNK A;  4HKG A;  3PTZ A;  3NTN A;  3JCU H;  5AW6 B;  4PD4 H;  2PEO A;  1OVU A;  3HE5 A;  1F80 D;  1FOS E;  1KQF B;  2YMY A;  3B5N D;  2OGU A;  2KOG A;  2WPS A;  4QMA A;  3DS3 A;  1LJ2 A;  2Y0C A;  2XZ1 C;  1J2J B;  4U0A A;  5CJ4 A;  2JP3 A;  5CZD B;  1FZG A;  2CQ8 A;  4COC A;  3L35 A;  3M9B A;  4H44 D;  2EIA A;  2KLU A;  3N7N A;  1EIA A;  1GZL A;  1RQU A;  1SQX D;  2HOD A;  3CL3 D;  2KSE A;  3TGU D;  4ZKP A;  1M6N A;  1HGZ A;  2K0Y A;  4XA4 A;  3CCU P;  2H7H A;  4C7R A;  1BE3 E;  2LKI A;  3DS5 A;  3L73 G;  1GK4 A;  2O01 N;  3FXD A;  3H1H J;  3L75 D;  3L70 D;  1VQK P;  5TIS E;  1D7M A;  4ASV A;  1LP1 B;  1FAV A;  2C0W A;  3DPH A;  1BCC G;  2JYG A;  4GR6 A;  2JR8 A;  3AE8 C;  2KYV A;  4U0E A;  1BGY J;  4K35 A;  2KW2 A;  4PJ0 H;  3WU2 E;  1FBM A;  3EJD A;  3KXD A;  5HGM A;  3NMD A;  2K37 A;  5DJU B;  3RK2 D;  4DJG A;  1CEI A;  1LT9 A;  2R3C A;  2HLO A;  3O6Q B;  1QL1 A;  2E76 D;  1L4A D;  4U3F D;  2N98 A;  4DOJ A;  2QJP B;  1JJ2 O;  3RK3 C;  4IZ6 A;  2A06 D;  4EI2 A;  2K93 A;  1SQP J;  1FE6 A;  2K0X A;  2R5B A;  1N7S B;  1P84 I;  1RF1 A;  4COP A;  4BPF A;  2H89 C;  3G71 P;  3KHU A;  3H1J E;  1YI2 P;  1NTM K;  5AVX B;  2YKO A;  1Q86 Q;  1A43 A;  1P84 H;  1NJI Q;  1LWU C;  3L73 D;  1L0N D;  3EFG A;  1HUC A;  2FKW B;  3USS A;  1NU1 K;  3CXH D;  5AW7 B;  1PIX A;  4L73 A;  3G1G A;  3AE1 C;  2LIW A;  1KIL B;  4OGQ D;  3RL0 B;  2KS1 B;  5BU8 B;  3CCQ P;  2KGE A;  3AE6 C;  2W6A A;  3M1M A;  4HB1 A;  5HVC A;  2BEQ D;  1GL2 D;  2QVA A;  2P2U A;  2VLO A;  1ZLL A;  2FYU D;  2OYH B;  2P1J A;  1AQ5 A;  1T8Z A;  1HBW A;  2MVV A;  2ZT9 B;  2FFD A;  3Q20 A;  2FQ2 A;  3L71 E;  1VQ8 P;  2XKM A;  4RO0 A;  2LKM A;  1Z56 A;  1IFP A;  1FS0 E;  3CXC O;  1VPC A;  1EMV A;  1JY3 O;  1IK7 A;  2KLV A;  3GW6 A;  4C7N B;  3Q5S A;  4HJG H;  2PRR A;  1TU3 F;  1A02 J;  2IFN A;  2YIU B;  1NTM G;  5KP6 B;  7CEI A;  1RNI A;  5H2F H;  1JO5 A;  4QKO A;  1LTT C;  3G29 A;  1LT9 B;  3GMA A;  2M5R A;  1JTH A;  5KLV J;  1VL2 A;  2EHT A;  5B5E H;  4PV1 B;  1VQ9 P;  1NU1 G;  4D6T D;  1SFC C;  4PD4 D;  3B4Q A;  2Y0D A;  3R4Y A;  1FZF A;  5F2K A;  4HYT B;  1NAY A;  2OTK E;  2K9J B;  1NKZ B;  3H1L G;  2WSS H;  2ZAE B;  2K88 A;  5KAF H;  5CCH C;  2LL8 A;  3L72 D;  1GPJ A;  4ZNC A;  3SFD C;  3IN6 A;  4WVZ A;  5AVY B;  1SP4 A;  1EZV E;  1SVF A;  1PP9 D;  1T6A A;  2PAJ A;  1IFJ A;  1BDD A;  4CA3 A;  3C1L A;  2J59 M;  1ZV8 A;  2O01 H;  3H1K E;  1Q82 Q;  2O3J A;  1VQ5 P;  1PGQ A;  3CWB J;  5KAI H;  1ZXG A;  2FY8 A;  2ZJS E;  1IZN B;  1DD4 A;  3BVH A;  3RK3 D;  1L0L K;  2M0B A;  2QJK B;  3KQG A;  1GDT A;  1RO0 A;  2H88 C;  1J1D B;  3G0V A;  2VLQ A;  1QLE D;  2QG4 A;  2ZYG A;  2N6Z A;  1QVG O;  3OA7 A;  2GYK A;  1KQG B;  2FXO A;  3H0D A;  1MUU A;  2K94 A;  1IMQ A;  1ZP0 C;  1Y47 A;  3WUT A;  3TNU A;  2EG5 A;  2J58 A;  3P32 A;  2Q3I A;  1NOH A;  3H1J J;  3UIA A;  1Y9B A;  2ZXE B;  2Q5U A;  3WUU A;  3CI9 A;  3MIW A;  5KJ7 D;  1SQB D;  2FHS C;  1OIP A;  2GZF A;  4N78 D;  4GR2 A;  4QNB A;  1T3U A;  1HQB A;  2KB7 P;  2C9N Y;  1YYC A;  2HPC A;  1NO4 A;  2YNY A;  3GG2 A;  1JTH B;  2WSE J;  3CD6 P;  1J1E C;  1HH0 A;  1MFZ A;  1RH5 B;  3HRN A;  4UB6 H;  1X79 B;  1LTS C;  3VMX A;  1IC2 A;  3H1I J;  3B5I A;  3P8C D;  3A0B E;  2WPQ A;  2K0D X;  1L0L G;  3VMY A;  2VLN A;  2M8P A;  1P84 D;  3L71 J;  2H43 A;  3HE4 A;  3VRL C;  2M3E A;  4AYC A;  1SFC A;  2FXP A;  2IZ1 A;  3M0A A;  2PEQ A;  1VQO P;  3E7K A;  1PEU A;  1DV5 A;  3OJA B;  4ASW A;  1HF9 A;  5AVR B;  5CCH A;  1KFN A;  3CX5 E;  2MR7 A;  2E43 A;  5E79 H;  3AED C;  3RG2 A;  1BXI A;  1PGO A;  2R44 A;  2BCC D;  4WY4 A;  1SFC D;  1T3J A;  4U0B A;  2IPP A;  3II6 A;  1LTG C;  3VP9 A;  1EXI A;  1OXZ A;  1DX7 A;  1CZQ A;  5K5G B;  4GT1 A;  1N7L A;  2GUS A;  5CCH D;  1HY8 A;  3HYB A;  2PEI A;  3I5C A;  2Z44 A;  1VKU A;  2E74 C;  4LLH A;  3PLN A;  4RES B;  1SQX E;  2K5X A;  1N2D C;  2E75 C;  3IAO A;  1N7S C;  1S72 P;  3TGU E;  1MV8 A;  3G28 A;  2P67 A;  1OW6 A;  2N5I A;  2MD9 A;  5APW A;  3H1K J;  3L75 E;  2RN0 A;  2HPC B;  1S9K D;  2FVF A;  3NFQ A;  5HGN A;  1Q2N A;  1IMP A;  1KD1 Q;  5GTI H;  2AVA A;  1SQV D;  3BRT B;  2X2B A;  3M0D C;  1AJY A;  1Q7Y Q;  2C0X A;  4Y28 J;  5APX A;  5DCK A;  3BAS A;  2BQ1 E;  4PWV B;  1HVV A;  3BRV B;  2K92 A;  1L2P A;  4XFZ A;  5B66 E;  1HGV A;  2KOR A;  4UB8 E;  2NO8 A;  3VOP A;  1M56 D;  3GZM A;  3CCJ P;  4U3F E;  1PEQ A;  2OTL P;  1USE A;  3L74 D;  3OW2 O;  3V4Q A;  1URQ C;  1BDC A;  2A06 E;  1OZH A;  1SQP K;  3AE3 C;  2MJZ A;  2KUB A;  1PPJ G;  1NVO A;  4H13 B;  5EJD A;  4WY4 B;  3IFM A;  1VQN P;  1JB0 J;  2KOQ A;  1LTA C;  2ONT A;  3H1H G;  2WZ7 A;  3EJB A;  5L8R J;  1ZRT D;  1T8K A;  3KZI E;  3D71 A;  1RF0 C;  2M8R A;  1HJB A;  5BU5 A;  1X8Y A;  1PL5 A;  3O8Z A;  5AVW B;  1SQQ J;  1M7L A;  1NTZ D;  1WT6 A;  4KJM A;  2J5U A;  4IPY A;  3L73 E;  1L0N E;  4NPE A;  4XRQ A;  2IBZ G;  1BGY G;  5KLI B;  3NY7 B;  3U59 A;  3CXH E;  1EDL A;  3D6Z A;  2L4B A;  2GDX A;  4N6J A;  1NGM B;  2HYN A;  1GK6 A;  1JY2 O;  4PH1 A;  4AQR D;  1CI6 B;  2ITA A;  4RKU J;  1NTK D;  2AXC A;  2FYU E;  2KOP A;  3ZDM A;  3HTK A;  4KT0 J;  1ACP A;  1KYO D;  1QL2 A;  2V7Q H;  2SPZ A;  1VQL P;  1VHN A;  3JSV C;  4JPZ B;  5TIS H;  1IO4 A;  1SQP G;  2V4H A;  1U57 A;  1VF5 B;  3CCL P;  2CK3 H;  2N1T B;  3ABV C;  4H2X C;  4GIF A;  4H0L C;  1QGK B;  2FAC A;  3WU2 H;  3P8M C;  1GU4 A;  3L36 A;  2E74 D;  1J1D C;  1NKN A;  3EFF K;  2E75 D;  5KLV K;  1N7S D;  4EOT A;  3M0D A;  2KG8 A;  2M5A B;  1SQX J;  3V2Q A;  3SWY A;  2QM8 A;  4M3L A;  3EQ2 A;  4JYB A;  3TGU J;  2QIW A;  4D6T E;  4PD4 E;  2JU2 A;  2AEM A;  2QJY C;  1X22 A;  1L4A A;  3HUS B;  1JMM A;  2OYI C;  2NPS B;  4RJT A;  1E0H A;  1BGY D;  4WWI A;  3T97 B;  1XTC C;  2FAE A;  3H47 A;  5APS A;  3HD7 C;  3CLQ A;  2WPT A;  2IDB A;  3L72 E;  2PFX A;  1U7M A;  3CCR P;  1FC2 C;  4JBZ A;  2WT7 A;  5HV8 A;  4I7Z B;  2OAR A;  1H0T A;  2KK7 A;  2GA1 A;  1PP9 E;  3G9R A;  3LIE A;  3B5N B;  1CW5 A;  3V2R A;  1K73 Q;  4IL6 H;  3F89 A;  5KTB A;  3MGN A;  3PH0 A;  4Y99 C;  2LIU A;  1JUN A;  1RF0 A;  1URQ D;  2WSE H;  3H4E A;  1AVY A;  3RK3 E;  2KXP B;  2AFD A;  4U3F J;  4H44 B;  5AVV B;  5KLV G;  5F2N A;  3TSI A;  3HE5 B;  2JQ4 A;  3MGE A;  2A45 I;  4PJ0 E;  1SLQ A;  4H2Y C;  1L0H A;  1GL2 A;  4DCK A;  1FZB A;  3AE5 C;  1RHZ B;  1YIT P;  3R2P A;  1AF8 A;  5KJ7 C;  3E1I A;  3KPE A;  1JMB A;  2A45 H;  3VTP C;  3EWK A;  1BCC D;  5GTH H;  1SQB E;  1JNM A;  5AW1 B;  2HOD B;  4N78 E;  1LTJ C;  1L0N J;  3SFE C;  3A0H E;  2FQ1 A;  2QSI A;  2RKL A;  3MD0 A;  1AFO A;  1GU5 A;  3RK2 B;  2D2C B;  3G21 A;  4GOD A;  1IFD A;  1PEM A;  1PGP A;  1IFI A;  2GDW A;  3CWB G;  1MZ9 A;  5I4T G;  2LTE A;  1AQT A;  1W2B O;  1BSH A;  2GZI A;  2Y0E A;  2FYU J;  5CCG D;  2E76 B;  1L4A B;  1M1J C;  4GKG A;  2JWD A;  4EYY Q;  1P84 E;  3GLM A;  3E1R A;  1EZV I;  1H8A A;  4KHX A;  2B87 A;  3DS4 A;  4H0L D;  3NTE A;  5AW0 B;  5JPA A;  1CSB A;  2LF4 A;  1D1D A;  4IFF A;  2OYI A;  5KLV D;  2WTY A;  2C9L Y;  3H1J G;  1EDI A;  2FYN C;  2R3S A;  2IYP A;  3CC4 P;  1HJ0 A;  4XFX A;  1FZC C;  5APQ A;  1BE3 J;  2BCC E;  1M6E X;  2Q9I A;  1VQ4 P;  4XRO A;  1VDF A;  2ZVO B;  1ZMB A;  1N86 A;  1GMJ A;  4D6T J;  4IFM A;  1RF1 B;  1PGJ A;  4OGQ B;  1IFM A;  2B88 A;  1FOS F;  3LID A;  5HGO A;  4H2W C;  3PP5 A;  2KNC A;  3HD7 D;  2JEE A;  5KKZ C;  1LTI C;  1KZU B;  1GL2 B;  3H1I G;  3MUD C;  1A02 F;  1FJK A;  2KOS A;  1ZR2 A;  2OTJ P;  1N73 C;  3L72 J;  5BS2 A;  3MHV A;  3CWB D;  3L71 G;  1KQS O;  3L37 A;  3TF5 A;  2W6B A;  3FWN A;  3W68 A;  3F5H A;  1PP9 J;  2LPK A;  2A45 G;  2XZR A;  4IL6 X;  1G2C A;  1IFN A;  3U1C A;  1LWU A;  2JKV A;  1IUQ A;  5KJ7 A;  3WMM 0;  4JYC A;  2N6Y A;  4TT3 H;  1NTM D;  4BRY A;  5KAF E;  1A8O A;  2FFD B;  3GHG C;  4MN4 C;  2CWO A;  1SQV E;  1MFT A;  4NEO A;  1VQ6 P;  1LTJ A;  1VQ7 P;  3LW5 J;  2G3A A;  1JCD A;  1NU1 D;  3A0B H;  1BAJ A;  2GUV A;  1KC8 Q;  2CG5 B;  3H1L D;  1OVV A;  2VRS A;  4WB4 A;  2Q3E A;  1X3O A;  1DNY A;  3A7O A;  4DT0 A;  3A5T A;  2YO3 A;  4Z1M H;  2JDI H;  3CX5 I;  1KLP A;  3RBZ A;  1M1J A;  5TJH A;  1MKM A;  3B8E B;  1SQB J;  2VLP A;  3L74 E;  3BCC G;  2N1T C;  1K8A Q;  3H32 A;  3CX5 H;  1EZV G;  2Z4E A;  2WQY C;  3H1I D;  1S5L H;  1UII A;  3CCV P;  5DJT B;  1KB9 I;  4OH8 B;  4A7P A;  3H1K G;  1G1I A;  2HFE D;  2JB0 A;  5M1B A;  2MR8 A;  1QX8 A;  1ZRT E;  2O1K A;  4OVN F;  3Q5P A;  5APU A;  1FJP A;  1KB9 H;  2FBW C;  3RK3 B;  1SQQ K;  1FDO A;  2E5T A;  1NTZ E;  3DS2 A;  1KFM A;  2HG5 D;  3G1I A;  2WSF J;  2AXT E;  4ZKU A;  2NPS C;  1JY3 N;  3V6I A;  1EOQ A;  3TYY A;  2LML A;  2IBZ I;  2DW3 A;  3Q1M A;  2MY5 A;  1NTK E;  4L75 A;  2IFM A;  3V2P A;  1N73 A;  1LWU B;  2DNW A;  1H89 A;  1KYO E;  1SS1 A;  1X9V A;  5EFW B;  3CPW O;  1AYI A;  3JC2 2;  2KGC A;  2BCC J;  5CHX A;  2QJP C;  3CCM P;  3TNU B;  2WPV B;  4B86 A;  5AVZ B;  2P9X A;  2JWA A;  1H88 A;  3AEC C;  3BCC D;  3G4S P;  4UHP B;  2XV5 A;  2BHV A;  2RH0 A;  2PP6 A;  1EZV D;  2N50 A;  2CPS A;  3GHG A;  2I1J A;  5AW2 B;  4H13 D;  1L0L D;  2CNR A;  1SQQ G;  5B66 H;  1SQX K;  4UB8 H;  2KI7 B;  4EIJ A;  1YJN P;  3L70 E;  3GF7 A;  4L74 A;  2Q6Q A;  1IJD B;  3C8V A;  4HKZ H;  1GD2 E;  2Y9Y A;  3GKL C;  2L22 A;  1KIL C;  3RL0 C;  3GZL A;  1BGY E;  2QA4 P;  3U1A A;  3AEE C;  1FDM A;  1KTM A;  1QVF O;  1YIJ P;  3S9O A;  2YO2 A;  2OYH C;  1JCC A;  1SQV J;  3HE4 B;  5AW8 B;  1DH3 A;  4I2L C;  1RE4 C;  1SFC B;  2ZT9 C;  2D2C C;  3KZI H;  3QH9 A;  3Q3D A;  5AW9 B;  3S4R A;  1RO2 A;  3MZW B;  1RY3 A;  2OQQ A;  3SWK A;  2ZYD A;  1JM0 A;  1QEX A;  1VQM P;  3S1K A;  1LGH B;  3M06 A;  2RMZ A;  1YBK A;  2Z46 A;  4GDO A;  3IR9 A;  2BAS A;  2N1T D;  2YIU C;  3CMA P;  1LP1 A;  3AE7 C;  1X0T A;  3L74 J;  3TDK A;  1E6J P;  1S5L X;  4O9B A;  1LT9 C;  1SQX G;  2K9Y A;  4XFY A;  1RQV A;  4PV1 C;  2KWL A;  4DZO A;  5APT A;  2M8N A;  4W7Y A;  1SQQ D;  2AEF A;  5AVT B;  4BWN A;  2CGQ A;  2WVR A;  2FVE A;  2LXB A;  4BPH A;  2JAZ A;  2XZ0 D;  1HTL C;  1NQ4 A;  1BCC E;  3O6Q A;  2IX7 C;  1NYH A;  3MTU E;  4L76 A;  1NTZ J;  1L0N K;  2NPS D;  2GDY A;  3B71 A;  2Y9Z A;  2MKV A;  2G8Y A;  3CX5 D;  3D70 A;  2PEM A;  4WYM A;  3CC2 P;  2QRX A;  5CCG C;  1GW4 A;  5EW5 E;  3AEB C;  4YXD C;  1N7S A;  3B4S A;  2GM4 A;  1GXH A;  4IFD K;  2FYU K;  1NTK J;  2K2Q A;  4U0D A;  1YJW P;  4U3F G;  1KB9 D;  1M8O B;  2QJK C;  2A06 G;  2MF4 A;  4MRT C;  3VP8 A;  4R0M A;  1PPJ D;  1J1E B;  1BSN A;  1KIL A;  5KLV E;  2FFD C;  2KS1 A;  3D6Y A;  3H1H D;  2KGD A;  2IYO A;  1LTB C;  2FQ0 A;  3JCU E;  2VSQ A;  2QNW A;  1FZE A;  2OYH A;  2O1J A;  3KYQ A;  2IBZ D;  2ERH A;  1L0N G;  1RE4 A;  1Q81 Q;  3I56 P;  2YXQ B;  3L75 J;  2XNX A;  1LT1 A;  3L70 J;  1KOR A;  3ITK A;  4JQ0 D;  1R5L A;  1KIL D;  3H6P A;  3RL0 D;  1U7J A;  3DTJ A;  5AVU B;  4M0I A;  1URQ A;  2KSJ A;  3AEA C;  3LW5 H;  2XND H;  2LXC B;  1ZOY C;  2E42 A;  2B89 A;  2QM7 A;  4C7N A;  2LOL A;  1ZR4 A;  1PZQ A;  2FYU G;  5APY A;  1PEO A;  2ZT9 D;  2XXM A;  2D2C D;  4W7Z A;  1GXG A;  1G1J A;  5BS1 A;  3CWB E;  4XFJ A;  1SQP D;  2L6E A;  1UIX A;  3RGU A;  3WUV A;  2WIT A;  3FX0 A;  3LRY A;  3TK1 A;  3U43 A;  3A0H H;  3Q5R A;  3VYI A;  5KP7 B;  1S2E A;  3AEF C;  2E74 B;  3I55 P;  2K9J A;  2P7J A;  3HTK B;  1Z6M A;  1NTM E;  3AE9 C;  2KR5 A;  2E75 B;  4AUW A;  1BE3 G;  4HH2 A;  5CBN A;  4PV1 D;  2EHS A;  3V4W A;  1KV4 A;  2Z45 A;  1NU1 E;  3PHL A;  1DD3 A;  2KIK A;  1RE3 C;  2ZFC A;  4D6T G;  2ZVN B;  2WSC J;  5CCG A;  5HGL A;  3H1L E;  1FZA A;  3L73 J;  4JF7 A;  2WSF H;  2R32 A;  2KG6 A;  3CC7 P;  4IL6 E;  2XU6 A;  2XT1 A;  1W2E A;  2KZI A;  2H8P D;  3RBX A;  3L72 G;  1BCC J;  2I1K A;  1SQB K;  1T2K C;  2P10 A;  1AVO A;  1JY3 P;  2Z5H A;  2EFJ A;  3P8C E;  3H1I E;  4NPF X;  1PP9 G;  2W27 A;  1ZW0 A;  1JY2 N;  1JEK A;  1M90 Q;  2YKP A;  2YXR B;  1LNQ A;  2JYL A;  1K9M Q;  2K1A A;  1ZN5 A;  1NH4 A;  3M9Q A;  2KZJ A;  2JO0 A;  2BEZ F;  2WT7 B;  1URQ B;  3M9H A;  2GZG A;  2W90 A;  1H0T B;  5GTH E;  1AUM A;  2XV6 A;  3CCS P;  1AV1 A;  4DG9 A;  1WMK A;  1OMI A;  2L91 A;  3HD7 A;  2OYO A;  4EDF A;  3V5B A;  3SWF A;  3DS0 A;  2PNG A;  5F2O A;  1FR2 A;  1BE3 D;  2KP8 A;  2N9B A;  2JBG A;  2W83 C;  1KQL A;  1HWT C; 
#chains in the Genus database with same CATH homology
 3HZQ A;  3DS2 A;  4U0D A;  1YJW P;  3G26 A;  1KQS O;  2EG5 A;  3G1I A;  3CME P;  3HYB A;  1VQN P;  3P05 A;  2PEI A;  1N8R Q;  1RO2 A;  2ONT A;  2Z45 A;  3G21 A;  3G6E P;  1RNI A;  1PEM A;  1EOQ A;  2BUO A;  3G29 A;  1IUQ A;  2Z44 A;  3DS1 A;  3WBH A;  5I4T G;  3H47 A;  2KOD A;  1JJ2 O;  1VQP P;  1W2B O;  1VQM P;  5HGL A;  2PEO A;  4GR2 A;  2M8L A;  1A8O A;  4QNB A;  3CCR P;  2DGY A;  1VQ9 P;  4IPY A;  3CCE P;  2CWO A;  4XRQ A;  3CC7 P;  2Z46 A;  1S72 P;  1VQ6 P;  2OAR A;  2XT1 A;  1VQ7 P;  3CPW O;  1QRJ A;  3CMA P;  3G28 A;  5F2K A;  3RG6 C;  3DS3 A;  4COP A;  3G71 P;  3CD6 P;  3DS4 A;  3NTE A;  1E6J P;  4U0A A;  1YI2 P;  4U0C A;  5JPA A;  4XFY A;  1Q81 Q;  1BAJ A;  4COC A;  3I56 P;  3CCM P;  1M1K Q;  1KC8 Q;  2LF4 A;  1D1D A;  2EFJ A;  4PH1 A;  1K73 Q;  1Q86 Q;  1A43 A;  2E1M A;  2EIA A;  2P9X A;  3B5I A;  5HGN A;  2M8N A;  1EIA A;  1NJI Q;  1M74 A;  3DTJ A;  3G4S P;  1KD1 Q;  4M0I A;  3CC4 P;  4XFX A;  2BHV A;  1M90 Q;  3H4E A;  1M6N A;  2PEK A;  2M8P A;  3CCU P;  1Q7Y Q;  1VQL P;  3G1G A;  3VRL C;  5DCK A;  2JYL A;  1K9M Q;  5F2N A;  2BQ1 E;  3CCQ P;  3DS5 A;  1M6E X;  1VQ4 P;  3MGE A;  1PEO A;  2JO0 A;  1K8A Q;  4XRO A;  3M1M A;  2XXM A;  2PEQ A;  1VQO P;  1Q82 Q;  3CCL P;  4PH0 A;  1ZMB A;  1VQ5 P;  1YJN P;  4XFZ A;  1VQK P;  1PEU A;  5BS1 A;  1AUM A;  1YJ9 P;  2XV6 A;  1K30 A;  1YIT P;  3CCV P;  2PEJ A;  2PY8 A;  3CCS P;  2L6E A;  2PEM A;  3DPH A;  2JYG A;  4GR6 A;  5HGO A;  3E2D A;  4WYM A;  3CC2 P;  1YHQ P;  4U0F A;  1RO0 A;  4U0E A;  3Q20 A;  3CCJ P;  3G0V A;  3DS0 A;  1VQ8 P;  3LRY A;  2QEX P;  2QA4 P;  2OTL P;  1PEQ A;  5F2O A;  2PEN A;  3OW2 O;  5HGM A;  2OTJ P;  5BS2 A;  4U0B A;  1QVG O;  3I55 P;  1YIJ P;  1QVF O;  3H0D A;  3CXC O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...