2VLOA

K97a mutant of e9 dnase domain in complex with im9
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
b'KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQGLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN-E9 IMMUNITY PROTEIN
publication title Experimental and Computational Analyses of the Energetic Basis for Dual Recognition of Immunity Proteins by Colicin Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 28
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2vloA00
2JAZA 1IMQA 4QKOA 1CEIA 3U43A 1AYIA 1IMPA 2NO8A 2GZJA 2VLNA 1BXIA 1MZ8A 3GKLC 2GZFA 7CEIA 4UHPB 1EMVA 2K0DX 5EW5E 2WPTA 1UJZA 2VLQA 3GJNA 1GXGA 2GZIA 2K5XA 4F37A 2GZGA 1FR2A 1E0HA 2VLOA 1ZNVA 1UNKA 2GYKA 2ERHA 2JB0A 2VLPA 1GXHA 2JBGA 2GZEA
chains in the Genus database with same CATH superfamily
2L9FA 2L0QA 1Q82Q 1GXGA 5CZDB 2K93A 3B5IA 3DS3A 2BUOA 3CMEP 2KORA 1ZNVA 1VQ4P 2ERHA 2EFJA 1VQ8P 2JYLA 3P05A 1YHQP 2GDYA 2GZJA 2KOOA 5DCKA 2KOPA 2N98A 2DNWA 1K30A 3GJNA 2FVFA 2MD9A 4CA3A 1A8OA 3G4SP 2LIUA 1K8AQ 2LL8A 2K0YA 1VQPP 2K92A 4XFZA 2KOSA 1NJIQ 4IPYA 1A43A 3LRYA 2LTEA 5HGOA 1FR2A 4U0BA 2FADA 1BAJA 1IUQA 1W2BO 3MGEA 2XT1A 4COPA 2DGYA 1Z6MA 2JAZA 3NY7B 4PH1A 2Z46A 2LPKA 2XXMA 4U0AA 3CCVP 1VQNP 4H2YC 1KQSO 2LIWA 4PWVB 3CE7A 2L4BA 3CCEP 2GDWA 2PEOA 2GZEA 2JO0A 3CCMP 1KC8Q 2FAEA 3EJDA 1S72P 3CCRP 2K0XA 1QVFO 7CEIA 2PEMA 3CC7P 5EJDA 1NQ4A 2P9XA 2N5HA 1VQ7P 1L0IA 2FACA 1YJNP 1VQ9P 1Q81Q 2GYKA 2L6EA 2KR5A 1DNYA 3G71P 3G26A 2K94A 1KD1Q 2N6ZA 2JGPA 5HGLA 3G21A 2E1MA 4IZ6A 1EOQA 5EW5E 2WPTA 3DTJA 2FQ0A 4MRTC 4COCA 1EIAA 4F37A 2N6YA 4U0CA 4BPFA 1GXHA 1QVGO 3H47A 2KGEA 2QNWA 2CQ8A 3G1GA 2CWOA 2GZFA 3OW2O 2KWLA 2L22A 3GZMA 5HVCA 3I56P 2PENA 2OTJP 2XZ0D 2M5RA 1AUMA 1F80D 2KGCA 4R0MA 1M74A 2Z44A 2FVEA 2JBGA 4DG9A 3CCJP 2LMLA 2QEXP 1MZ8A 4NEOA 4UHPB 3B4QA 2JU2A 2XV6A 2XZ1C 1YIJP 2OTLP 4XROA 1YJWP 2FQ1A 2VLOA 1VQKP 2M8LA 2FHSC 5KP6B 3CCQP 1E6JP 3U43A 2KG8A 1RO0A 1YITP 2CGQA 1M90Q 1BXIA 4BPHA 1JJ2O 3GKLC 4H2WC 1Q7YQ 3DPHA 3NTEA 2VLQA 5HGNA 5I4TG 5BS1A 1YI2P 1M6NA 1K73Q 2EHTA 2PEQA 2MVVA 2AFDA 2CNRA 1IMQA 4U0EA 1N8RQ 3DS4A 1M1KQ 2GZIA 1VQLP 1E0HA 2N5IA 3CC2P 5KP8B 1KLPA 5JPAA 3CC4P 1GPJA 2CG5B 1VHNA 2BHVA 1ACPA 5F2OA 1VKUA 2KG9A 3DS2A 2EIAA 2KOQA 1OR5A 3DS0A 3G6EP 4H2XC 2KGAA 2PY8A 1VQMP 2ROQA 3DS5A 3G0VA 4GR2A 1X3OA 5HGMA 2KODA 2VSQA 2NO8A 2AVAA 3RG2A 5HV8A 5KP7B 3CD6P 1EMVA 2K0DX 3G1IA 4XRQA 2MR8A 1L0HA 3WBHA 2FQ2A 1DV5A 2EHSA 3G28A 1HQBA 2LKIA 3RG6C 5F2NA 3VRLC 4QKOA 1AYIA 4U0DA 1QRJA 4U0FA 2MR7A 2LOLA 3Q20A 2EG5A 3CCSP 1RO2A 1UJZA 2X2BA 4XFXA 3CPWO 2KG6A 1AF8A 1YJ9P 2MY5A 1VQOP 4XFYA 2Z45A 2JB0A 2MVUA 4BPGA 4GR6A 3H4EA 2MF4A 3HZQA 2FVAA 2QA4P 2PEJA 2JU1A 2OARA 2JYGA 1ZMBA 3DS1A 3CCUP 3GZLA 2KW2A 4PH0A 1M6EX 3H0DA 2LF4A 2GDXA 1CEIA 3EJEA 2M8PA 4M0IA 3G29A 2VLNA 1K9MQ 2ONTA 4WYMA 1VQ6P 4HKGA 2K2QA 2N50A 2PEIA 1RNIA 5F2KA 2AF8A 2GZGA 3LMOA 2KGDA 1VQ5P 1HY8A 1UNKA 3EJBA 2VLPA 3CXCO 5BS2A 4PXHB 1IMPA 1T8KA 3CMAP 3HYBA 4QNBA 2M8NA 2PEKA 1D1DA 1Q86Q 2K5XA 3M1MA 2AFEA 3I55P 2PNGA 3E2DA 3CCLP 2JQ4A
chains in the Genus database with same CATH topology
2JAZA 1IMQA 4QKOA 1CEIA 3U43A 1AYIA 1IMPA 2NO8A 2GZJA 2VLNA 1BXIA 1MZ8A 3GKLC 2GZFA 7CEIA 4UHPB 1EMVA 2K0DX 5EW5E 2WPTA 1UJZA 2VLQA 3GJNA 1GXGA 2GZIA 2K5XA 4F37A 2GZGA 1FR2A 1E0HA 2VLOA 1ZNVA 1UNKA 2GYKA 2ERHA 2JB0A 2VLPA 1GXHA 2JBGA 2GZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAZ A;  1IMQ A;  4QKO A;  1CEI A;  3U43 A;  1AYI A;  1IMP A;  2NO8 A;  2GZJ A;  2VLN A;  1BXI A;  1MZ8 A;  3GKL C;  2GZF A;  7CEI A;  4UHP B;  1EMV A;  2K0D X;  5EW5 E;  2WPT A;  1UJZ A;  2VLQ A;  3GJN A;  1GXG A;  2GZI A;  2K5X A;  4F37 A;  2GZG A;  1FR2 A;  1E0H A;  2VLO A;  1ZNV A;  1UNK A;  2GYK A;  2ERH A;  2JB0 A;  2VLP A;  1GXH A;  2JBG A;  2GZE A; 
#chains in the Genus database with same CATH topology
 2L9F A;  2L0Q A;  1Q82 Q;  1GXG A;  5CZD B;  2K93 A;  3B5I A;  3DS3 A;  2BUO A;  3CME P;  2KOR A;  1ZNV A;  1VQ4 P;  2ERH A;  2EFJ A;  1VQ8 P;  2JYL A;  3P05 A;  1YHQ P;  2GDY A;  2GZJ A;  2KOO A;  5DCK A;  2KOP A;  2N98 A;  2DNW A;  1K30 A;  3GJN A;  2FVF A;  2MD9 A;  4CA3 A;  1A8O A;  3G4S P;  2LIU A;  1K8A Q;  2LL8 A;  2K0Y A;  1VQP P;  2K92 A;  4XFZ A;  2KOS A;  1NJI Q;  4IPY A;  1A43 A;  3LRY A;  2LTE A;  5HGO A;  1FR2 A;  4U0B A;  2FAD A;  1BAJ A;  1IUQ A;  1W2B O;  3MGE A;  2XT1 A;  4COP A;  2DGY A;  1Z6M A;  2JAZ A;  3NY7 B;  4PH1 A;  2Z46 A;  2LPK A;  2XXM A;  4U0A A;  3CCV P;  1VQN P;  4H2Y C;  1KQS O;  2LIW A;  4PWV B;  3CE7 A;  2L4B A;  3CCE P;  2GDW A;  2PEO A;  2GZE A;  2JO0 A;  3CCM P;  1KC8 Q;  2FAE A;  3EJD A;  1S72 P;  3CCR P;  2K0X A;  1QVF O;  7CEI A;  2PEM A;  3CC7 P;  5EJD A;  1NQ4 A;  2P9X A;  2N5H A;  1VQ7 P;  1L0I A;  2FAC A;  1YJN P;  1VQ9 P;  1Q81 Q;  2GYK A;  2L6E A;  2KR5 A;  1DNY A;  3G71 P;  3G26 A;  2K94 A;  1KD1 Q;  2N6Z A;  2JGP A;  5HGL A;  3G21 A;  2E1M A;  4IZ6 A;  1EOQ A;  5EW5 E;  2WPT A;  3DTJ A;  2FQ0 A;  4MRT C;  4COC A;  1EIA A;  4F37 A;  2N6Y A;  4U0C A;  4BPF A;  1GXH A;  1QVG O;  3H47 A;  2KGE A;  2QNW A;  2CQ8 A;  3G1G A;  2CWO A;  2GZF A;  3OW2 O;  2KWL A;  2L22 A;  3GZM A;  5HVC A;  3I56 P;  2PEN A;  2OTJ P;  2XZ0 D;  2M5R A;  1AUM A;  1F80 D;  2KGC A;  4R0M A;  1M74 A;  2Z44 A;  2FVE A;  2JBG A;  4DG9 A;  3CCJ P;  2LML A;  2QEX P;  1MZ8 A;  4NEO A;  4UHP B;  3B4Q A;  2JU2 A;  2XV6 A;  2XZ1 C;  1YIJ P;  2OTL P;  4XRO A;  1YJW P;  2FQ1 A;  2VLO A;  1VQK P;  2M8L A;  2FHS C;  5KP6 B;  3CCQ P;  1E6J P;  3U43 A;  2KG8 A;  1RO0 A;  1YIT P;  2CGQ A;  1M90 Q;  1BXI A;  4BPH A;  1JJ2 O;  3GKL C;  4H2W C;  1Q7Y Q;  3DPH A;  3NTE A;  2VLQ A;  5HGN A;  5I4T G;  5BS1 A;  1YI2 P;  1M6N A;  1K73 Q;  2EHT A;  2PEQ A;  2MVV A;  2AFD A;  2CNR A;  1IMQ A;  4U0E A;  1N8R Q;  3DS4 A;  1M1K Q;  2GZI A;  1VQL P;  1E0H A;  2N5I A;  3CC2 P;  5KP8 B;  1KLP A;  5JPA A;  3CC4 P;  1GPJ A;  2CG5 B;  1VHN A;  2BHV A;  1ACP A;  5F2O A;  1VKU A;  2KG9 A;  3DS2 A;  2EIA A;  2KOQ A;  1OR5 A;  3DS0 A;  3G6E P;  4H2X C;  2KGA A;  2PY8 A;  1VQM P;  2ROQ A;  3DS5 A;  3G0V A;  4GR2 A;  1X3O A;  5HGM A;  2KOD A;  2VSQ A;  2NO8 A;  2AVA A;  3RG2 A;  5HV8 A;  5KP7 B;  3CD6 P;  1EMV A;  2K0D X;  3G1I A;  4XRQ A;  2MR8 A;  1L0H A;  3WBH A;  2FQ2 A;  1DV5 A;  2EHS A;  3G28 A;  1HQB A;  2LKI A;  3RG6 C;  5F2N A;  3VRL C;  4QKO A;  1AYI A;  4U0D A;  1QRJ A;  4U0F A;  2MR7 A;  2LOL A;  3Q20 A;  2EG5 A;  3CCS P;  1RO2 A;  1UJZ A;  2X2B A;  4XFX A;  3CPW O;  2KG6 A;  1AF8 A;  1YJ9 P;  2MY5 A;  1VQO P;  4XFY A;  2Z45 A;  2JB0 A;  2MVU A;  4BPG A;  4GR6 A;  3H4E A;  2MF4 A;  3HZQ A;  2FVA A;  2QA4 P;  2PEJ A;  2JU1 A;  2OAR A;  2JYG A;  1ZMB A;  3DS1 A;  3CCU P;  3GZL A;  2KW2 A;  4PH0 A;  1M6E X;  3H0D A;  2LF4 A;  2GDX A;  1CEI A;  3EJE A;  2M8P A;  4M0I A;  3G29 A;  2VLN A;  1K9M Q;  2ONT A;  4WYM A;  1VQ6 P;  4HKG A;  2K2Q A;  2N50 A;  2PEI A;  1RNI A;  5F2K A;  2AF8 A;  2GZG A;  3LMO A;  2KGD A;  1VQ5 P;  1HY8 A;  1UNK A;  3EJB A;  2VLP A;  3CXC O;  5BS2 A;  4PXH B;  1IMP A;  1T8K A;  3CMA P;  3HYB A;  4QNB A;  2M8N A;  2PEK A;  1D1D A;  1Q86 Q;  2K5X A;  3M1M A;  2AFE A;  3I55 P;  2PNG A;  3E2D A;  3CCL P;  2JQ4 A; 
#chains in the Genus database with same CATH homology
 2JAZ A;  1IMQ A;  4QKO A;  1CEI A;  3U43 A;  1AYI A;  1IMP A;  2NO8 A;  2GZJ A;  2VLN A;  1BXI A;  1MZ8 A;  3GKL C;  2GZF A;  7CEI A;  4UHP B;  1EMV A;  2K0D X;  5EW5 E;  2WPT A;  1UJZ A;  2VLQ A;  3GJN A;  1GXG A;  2GZI A;  2K5X A;  4F37 A;  2GZG A;  1FR2 A;  1E0H A;  2VLO A;  1ZNV A;  1UNK A;  2GYK A;  2ERH A;  2JB0 A;  2VLP A;  1GXH A;  2JBG A;  2GZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...