2VLOA

K97a mutant of e9 dnase domain in complex with im9
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQGLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental and Computational Analyses of the Energetic Basis for Dual Recognition of Immunity Proteins by Colicin Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords COLICIN-E9 IMMUNITY PROTEIN
total genus 28
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2vloA00
4F37A 1IMPA 2K5XA 1UNKA 4UHPB 1GXGA 2WPTA 1MZ8A 2GZFA 1CEIA 1AYIA 2VLNA 1E0HA 1ZNVA 3GKLC 1IMQA 3GJNA 4QKOA 1GXHA 2GZJA 2VLQA 5EW5E 2ERHA 2JAZA 2VLOA 2K0DX 2NO8A 2GZEA 2GZGA 2GYKA 1EMVA 2VLPA 2GZIA 7CEIA 3U43A 1FR2A 1BXIA 1UJZA 2JBGA 2JB0A
chains in the Genus database with same CATH superfamily
5KP8B 1NJIQ 2L9FA 3B5IA 5HGOA 3CMAP 3CCJP 3G4SP 4PH1A 3GZLA 5HGMA 2PNGA 1ZMBA 1M6EX 4BPGA 3CE7A 2EHSA 3CCVP 2CGQA 1K30A 3CC4P 2LPKA 2OARA 2MR8A 2K2QA 2KOPA 4H2YC 1FR2A 3CCEP 2LL8A 5KP6B 2AF8A 2DGYA 3DS5A 3CMEP 1UNKA 2GDYA 1GXGA 2PEIA 1JJ2O 4U0CA 1RO2A 1ZNVA 3NY7B 2GZGA 1T8KA 3DS2A 1KQSO 1VQPP 2P9XA 2PEMA 4U0FA 2PEQA 4UHPB 1VQ5P 1Q7YQ 3G29A 5CZDB 2KW2A 2GZEA 1YJNP 1Z6MA 4IPYA 1BXIA 1DNYA 2PEKA 1QRJA 1VQ7P 1D1DA 1VKUA 1GPJA 3WBHA 2WPTA 5JPAA 3DTJA 3CCMP 2Z45A 3CCSP 1VQOP 1VQ6P 2LMLA 3CD6P 2L6EA 3HYBA 5DCKA 3EJDA 1A43A 1YHQP 5HV8A 2JBGA 3DS0A 1VQLP 4MRTC 1M6NA 1E0HA 2M8PA 1L0HA 3EJEA 3GJNA 2FQ0A 1E6JP 4NEOA 2DNWA 2K94A 4BPFA 2LIWA 3G28A 2BUOA 2GZIA 1QVGO 3CC7P 5F2OA 1Q86Q 2KGDA 4XRQA 2K0XA 3DS3A 2JU2A 4F37A 1YI2P 5BS2A 2K92A 2AFDA 5HGNA 2N5HA 2VLNA 2K0YA 3G26A 2VLQA 3H0DA 2KGCA 1YITP 2FVEA 2LIUA 3RG6C 2VLPA 2X2BA 2K93A 3U43A 2KG6A 2Z46A 5F2KA 3H47A 3MGEA 2KOSA 4H2XC 1W2BO 2MF4A 5F2NA 4COCA 3GKLC 1IMQA 2JU1A 1Q81Q 2PENA 2JYGA 2L22A 5EJDA 2CG5B 1A8OA 2KWLA 3DS1A 3B4QA 4IZ6A 2GDXA 1K73Q 1EOQA 2CWOA 4QNBA 2JGPA 1VQMP 1VQ8P 2XV6A 2LF4A 1L0IA 4QKOA 1F80D 2GZJA 2VLOA 1RNIA 4U0AA 1EMVA 3Q20A 3G71P 1QVFO 3VRLC 2XT1A 2FAEA 2N98A 4XFZA 2M8NA 2KODA 2L4BA 2N6ZA 2XZ1C 1MZ8A 2GZFA 1CEIA 2XZ0D 1AUMA 2FADA 2QNWA 4GR2A 3DPHA 1VQ9P 2FVFA 3CCRP 2MVUA 1IMPA 2GDWA 2K5XA 2MR7A 3I55P 3H4EA 2FQ1A 1VQ4P 1N8RQ 4PWVB 4R0MA 2XXMA 1KLPA 3G0VA 1M74A 2N5IA 1HQBA 2FHSC 2NO8A 2E1MA 2PEOA 1BAJA 4BPHA 1EIAA 3CXCO 5I4TG 5EW5E 4HKGA 5HGLA 2FQ2A 2ONTA 2KR5A 3E2DA 2QEXP 2KGAA 1S72P 1OR5A 2AFEA 1KC8Q 2JAZA 1X3OA 2VSQA 2QA4P 5HVCA 4DG9A 2EG5A 1VQKP 2JB0A 1IUQA 4H2WC 1VQNP 1YIJP 2MY5A 2LKIA 4XROA 2MVVA 1M90Q 1M1KQ 2KG8A 2KGEA 5BS1A 3G21A 2FVAA 2LOLA 3M1MA 2LTEA 2M5RA 3CCQP 4XFYA 1K9MQ 1YJWP 3DS4A 3EJBA 1NQ4A 3G1IA 3HZQA 4PH0A 1KD1Q 3LRYA 1VHNA 3CC2P 1AYIA 4COPA 3OW2O 2BHVA 1ACPA 2KOOA 3P05A 3RG2A 2L0QA 1YJ9P 2KG9A 2ERHA 3G6EP 4XFXA 2KORA 7CEIA 3CCLP 2AVAA 2PY8A 2EIAA 2FACA 2M8LA 2OTJP 2Z44A 2JQ4A 2EHTA 3LMOA 1HY8A 5KP7B 3CCUP 4WYMA 1GXHA 3G1GA 2MD9A 2JYLA 1K8AQ 4U0BA 4CA3A 2OTLP 3NTEA 1UJZA 1RO0A 3CPWO 3I56P 4U0DA 2N6YA 4U0EA 1Q82Q 2KOQA 4GR6A 2JO0A 2PEJA 4PXHB 4M0IA 2CQ8A 2K0DX 3GZMA 2GYKA 2CNRA 1DV5A 2EFJA 1AF8A 2N50A 2ROQA
chains in the Genus database with same CATH topology
4F37A 1IMPA 2K5XA 1UNKA 4UHPB 1GXGA 2WPTA 1MZ8A 2GZFA 1CEIA 1AYIA 2VLNA 1E0HA 1ZNVA 3GKLC 1IMQA 3GJNA 4QKOA 1GXHA 2GZJA 2VLQA 5EW5E 2ERHA 2JAZA 2VLOA 2K0DX 2NO8A 2GZEA 2GZGA 2GYKA 1EMVA 2VLPA 2GZIA 7CEIA 3U43A 1FR2A 1BXIA 1UJZA 2JBGA 2JB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F37 A;  1IMP A;  2K5X A;  1UNK A;  4UHP B;  1GXG A;  2WPT A;  1MZ8 A;  2GZF A;  1CEI A;  1AYI A;  2VLN A;  1E0H A;  1ZNV A;  3GKL C;  1IMQ A;  3GJN A;  4QKO A;  1GXH A;  2GZJ A;  2VLQ A;  5EW5 E;  2ERH A;  2JAZ A;  2VLO A;  2K0D X;  2NO8 A;  2GZE A;  2GZG A;  2GYK A;  1EMV A;  2VLP A;  2GZI A;  7CEI A;  3U43 A;  1FR2 A;  1BXI A;  1UJZ A;  2JBG A;  2JB0 A; 
#chains in the Genus database with same CATH topology
 5KP8 B;  1NJI Q;  2L9F A;  3B5I A;  5HGO A;  3CMA P;  3CCJ P;  3G4S P;  4PH1 A;  3GZL A;  5HGM A;  2PNG A;  1ZMB A;  1M6E X;  4BPG A;  3CE7 A;  2EHS A;  3CCV P;  2CGQ A;  1K30 A;  3CC4 P;  2LPK A;  2OAR A;  2MR8 A;  2K2Q A;  2KOP A;  4H2Y C;  1FR2 A;  3CCE P;  2LL8 A;  5KP6 B;  2AF8 A;  2DGY A;  3DS5 A;  3CME P;  1UNK A;  2GDY A;  1GXG A;  2PEI A;  1JJ2 O;  4U0C A;  1RO2 A;  1ZNV A;  3NY7 B;  2GZG A;  1T8K A;  3DS2 A;  1KQS O;  1VQP P;  2P9X A;  2PEM A;  4U0F A;  2PEQ A;  4UHP B;  1VQ5 P;  1Q7Y Q;  3G29 A;  5CZD B;  2KW2 A;  2GZE A;  1YJN P;  1Z6M A;  4IPY A;  1BXI A;  1DNY A;  2PEK A;  1QRJ A;  1VQ7 P;  1D1D A;  1VKU A;  1GPJ A;  3WBH A;  2WPT A;  5JPA A;  3DTJ A;  3CCM P;  2Z45 A;  3CCS P;  1VQO P;  1VQ6 P;  2LML A;  3CD6 P;  2L6E A;  3HYB A;  5DCK A;  3EJD A;  1A43 A;  1YHQ P;  5HV8 A;  2JBG A;  3DS0 A;  1VQL P;  4MRT C;  1M6N A;  1E0H A;  2M8P A;  1L0H A;  3EJE A;  3GJN A;  2FQ0 A;  1E6J P;  4NEO A;  2DNW A;  2K94 A;  4BPF A;  2LIW A;  3G28 A;  2BUO A;  2GZI A;  1QVG O;  3CC7 P;  5F2O A;  1Q86 Q;  2KGD A;  4XRQ A;  2K0X A;  3DS3 A;  2JU2 A;  4F37 A;  1YI2 P;  5BS2 A;  2K92 A;  2AFD A;  5HGN A;  2N5H A;  2VLN A;  2K0Y A;  3G26 A;  2VLQ A;  3H0D A;  2KGC A;  1YIT P;  2FVE A;  2LIU A;  3RG6 C;  2VLP A;  2X2B A;  2K93 A;  3U43 A;  2KG6 A;  2Z46 A;  5F2K A;  3H47 A;  3MGE A;  2KOS A;  4H2X C;  1W2B O;  2MF4 A;  5F2N A;  4COC A;  3GKL C;  1IMQ A;  2JU1 A;  1Q81 Q;  2PEN A;  2JYG A;  2L22 A;  5EJD A;  2CG5 B;  1A8O A;  2KWL A;  3DS1 A;  3B4Q A;  4IZ6 A;  2GDX A;  1K73 Q;  1EOQ A;  2CWO A;  4QNB A;  2JGP A;  1VQM P;  1VQ8 P;  2XV6 A;  2LF4 A;  1L0I A;  4QKO A;  1F80 D;  2GZJ A;  2VLO A;  1RNI A;  4U0A A;  1EMV A;  3Q20 A;  3G71 P;  1QVF O;  3VRL C;  2XT1 A;  2FAE A;  2N98 A;  4XFZ A;  2M8N A;  2KOD A;  2L4B A;  2N6Z A;  2XZ1 C;  1MZ8 A;  2GZF A;  1CEI A;  2XZ0 D;  1AUM A;  2FAD A;  2QNW A;  4GR2 A;  3DPH A;  1VQ9 P;  2FVF A;  3CCR P;  2MVU A;  1IMP A;  2GDW A;  2K5X A;  2MR7 A;  3I55 P;  3H4E A;  2FQ1 A;  1VQ4 P;  1N8R Q;  4PWV B;  4R0M A;  2XXM A;  1KLP A;  3G0V A;  1M74 A;  2N5I A;  1HQB A;  2FHS C;  2NO8 A;  2E1M A;  2PEO A;  1BAJ A;  4BPH A;  1EIA A;  3CXC O;  5I4T G;  5EW5 E;  4HKG A;  5HGL A;  2FQ2 A;  2ONT A;  2KR5 A;  3E2D A;  2QEX P;  2KGA A;  1S72 P;  1OR5 A;  2AFE A;  1KC8 Q;  2JAZ A;  1X3O A;  2VSQ A;  2QA4 P;  5HVC A;  4DG9 A;  2EG5 A;  1VQK P;  2JB0 A;  1IUQ A;  4H2W C;  1VQN P;  1YIJ P;  2MY5 A;  2LKI A;  4XRO A;  2MVV A;  1M90 Q;  1M1K Q;  2KG8 A;  2KGE A;  5BS1 A;  3G21 A;  2FVA A;  2LOL A;  3M1M A;  2LTE A;  2M5R A;  3CCQ P;  4XFY A;  1K9M Q;  1YJW P;  3DS4 A;  3EJB A;  1NQ4 A;  3G1I A;  3HZQ A;  4PH0 A;  1KD1 Q;  3LRY A;  1VHN A;  3CC2 P;  1AYI A;  4COP A;  3OW2 O;  2BHV A;  1ACP A;  2KOO A;  3P05 A;  3RG2 A;  2L0Q A;  1YJ9 P;  2KG9 A;  2ERH A;  3G6E P;  4XFX A;  2KOR A;  7CEI A;  3CCL P;  2AVA A;  2PY8 A;  2EIA A;  2FAC A;  2M8L A;  2OTJ P;  2Z44 A;  2JQ4 A;  2EHT A;  3LMO A;  1HY8 A;  5KP7 B;  3CCU P;  4WYM A;  1GXH A;  3G1G A;  2MD9 A;  2JYL A;  1K8A Q;  4U0B A;  4CA3 A;  2OTL P;  3NTE A;  1UJZ A;  1RO0 A;  3CPW O;  3I56 P;  4U0D A;  2N6Y A;  4U0E A;  1Q82 Q;  2KOQ A;  4GR6 A;  2JO0 A;  2PEJ A;  4PXH B;  4M0I A;  2CQ8 A;  2K0D X;  3GZM A;  2GYK A;  2CNR A;  1DV5 A;  2EFJ A;  1AF8 A;  2N50 A;  2ROQ A; 
#chains in the Genus database with same CATH homology
 4F37 A;  1IMP A;  2K5X A;  1UNK A;  4UHP B;  1GXG A;  2WPT A;  1MZ8 A;  2GZF A;  1CEI A;  1AYI A;  2VLN A;  1E0H A;  1ZNV A;  3GKL C;  1IMQ A;  3GJN A;  4QKO A;  1GXH A;  2GZJ A;  2VLQ A;  5EW5 E;  2ERH A;  2JAZ A;  2VLO A;  2K0D X;  2NO8 A;  2GZE A;  2GZG A;  2GYK A;  1EMV A;  2VLP A;  2GZI A;  7CEI A;  3U43 A;  1FR2 A;  1BXI A;  1UJZ A;  2JBG A;  2JB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...