2VLOA

K97a mutant of e9 dnase domain in complex with im9
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQGLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN-E9 IMMUNITY PROTEIN
publication title Experimental and Computational Analyses of the Energetic Basis for Dual Recognition of Immunity Proteins by Colicin Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 28
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2vloA00
1EMVA 1GXHA 1MZ8A 1BXIA 1AYIA 1UJZA 1ZNVA 1IMPA 1E0HA 4QKOA 1IMQA 1UNKA 1CEIA 1GXGA 3U43A 2K0DX 4UHPB 2VLOA 5EW5E 2GYKA 2GZGA 2VLNA 2NO8A 2GZEA 7CEIA 1FR2A 2K5XA 4F37A 2JB0A 3GJNA 2WPTA 2JBGA 2JAZA 2GZIA 2VLPA 2VLQA 2GZJA 2GZFA 2ERHA 3GKLC
chains in the Genus database with same CATH superfamily
4H2XC 1RO0A 5F2NA 3OW2O 2MY5A 1BAJA 1NJIQ 2N5IA 2JU1A 3CPWO 3CC4P 1YJWP 2LPKA 1X3OA 2M5RA 3GKLC 3RG6C 2N98A 4PXHB 3WBHA 1BXIA 2KGCA 2PEQA 1ZNVA 3Q20A 3DS2A 2PEKA 1K8AQ 2KGDA 1VQ9P 1VQLP 1EOQA 3GJNA 3H0DA 4MRTC 1K9MQ 5F2KA 2K2QA 1AYIA 3CCUP 5HGMA 3U43A 2KG6A 2VLOA 4GR6A 3CCQP 5BS2A 3MGEA 2FQ2A 1HY8A 4F37A 1M1KQ 1M90Q 2N6ZA 1OR5A 2DGYA 5JPAA 1YJ9P 1RNIA 2CNRA 2L4BA 1GXHA 2FADA 2PENA 2OARA 3B4QA 4UHPB 3CMAP 3B5IA 1M74A 1W2BO 1VQNP 7CEIA 1K30A 5EJDA 2AFEA 2XV6A 2JBGA 4GR2A 1M6NA 2GDXA 2JO0A 4PH1A 1E6JP 2FVAA 1VQOP 3NTEA 2K93A 2EHSA 1DNYA 4PWVB 5HV8A 5KP8B 2XZ1C 3G4SP 3VRLC 1QVFO 3G28A 2M8NA 2VLPA 3P05A 1NQ4A 1EMVA 5KP6B 1RO2A 2Z45A 3CMEP 2VSQA 1IMPA 3CD6P 3G21A 2XT1A 4XFXA 2JQ4A 2K0DX 3G1GA 1IUQA 4U0FA 2L22A 2WPTA 2FVEA 2X2BA 4COCA 2OTJP 1HQBA 2FAEA 1M6EX 2K92A 1IMQA 4BPGA 4XFZA 3G71P 1L0HA 4NEOA 2KOPA 2L6EA 1KC8Q 3EJBA 2JGPA 3G1IA 4DG9A 3CC2P 1VHNA 3HYBA 4WYMA 4H2YC 2LTEA 2N6YA 3LRYA 1Q86Q 2KOQA 5HGLA 1VQ7P 2AFDA 1MZ8A 4HKGA 4XRQA 2QA4P 2QEXP 3EJEA 2AF8A 2EIAA 1VQKP 3CCJP 4U0AA 5EW5E 3CXCO 4BPFA 3GZMA 2K0XA 3G29A 3CCEP 2EG5A 3H47A 2CG5B 2GZIA 1YHQP 1L0IA 1D1DA 1EIAA 5F2OA 1JJ2O 2JYGA 1GXGA 1ZMBA 4U0CA 1VQ5P 1N8RQ 5KP7B 2NO8A 2GZEA 2QNWA 4CA3A 4COPA 2K5XA 1VQMP 1DV5A 2PEIA 5BS1A 2GZFA 3G6EP 2ERHA 3CC7P 3DPHA 1K73Q 2FQ1A 1GPJA 3CCMP 2LL8A 1YIJP 1UNKA 2KODA 3DS3A 1AUMA 5HGNA 3DS0A 2MR7A 3DS5A 2KORA 2KGAA 4XROA 2KWLA 1T8KA 2L9FA 2PEMA 2XXMA 2MVVA 4BPHA 1VKUA 2EHTA 3E2DA 2BHVA 1QVGO 2N50A 3I55P 3RG2A 2L0QA 2Z46A 3DS1A 3CCLP 2DNWA 3I56P 2LKIA 1ACPA 4H2WC 2PEOA 1QRJA 3G26A 2XZ0D 3M1MA 4XFYA 2CGQA 2OTLP 3GZLA 1FR2A 2LMLA 1Q82Q 5HVCA 1KQSO 1YI2P 2KOSA 4IZ6A 5HGOA 2JYLA 1Q81Q 1YITP 2ONTA 2KR5A 3CCSP 4U0BA 2M8PA 2MR8A 2FHSC 1S72P 2AVAA 1CEIA 2K94A 4PH0A 3NY7B 1KD1Q 1A43A 3LMOA 2MD9A 2GZJA 2KW2A 4M0IA 1Q7YQ 3HZQA 2CQ8A 1AF8A 4QKOA 1KLPA 1A8OA 1YJNP 2M8LA 2LF4A 2EFJA 2JU2A 2JAZA 4IPYA 2VLQA 2K0YA 4U0DA 4U0EA 1F80D 2PEJA 2Z44A 1VQPP 4R0MA 2PY8A 2N5HA 2GDYA 1Z6MA 2E1MA 2LIWA 3DTJA 4QNBA 5DCKA 1VQ6P 2MF4A 3CCRP 2BUOA 2MVUA 2PNGA 1VQ8P 3G0VA 5I4TG 3H4EA 2ROQA 2P9XA 2FVFA 3CCVP 1UJZA 1E0HA 3DS4A 2KG8A 2KG9A 2CWOA 2KGEA 2FQ0A 3EJDA 2GYKA 2GZGA 2VLNA 2GDWA 2JB0A 2KOOA 2LOLA 1VQ4P 2LIUA 3CE7A 2FACA 5CZDB
chains in the Genus database with same CATH topology
1EMVA 1GXHA 1MZ8A 1BXIA 1AYIA 1UJZA 1ZNVA 1IMPA 1E0HA 4QKOA 1IMQA 1UNKA 1CEIA 1GXGA 3U43A 2K0DX 4UHPB 2VLOA 5EW5E 2GYKA 2GZGA 2VLNA 2NO8A 2GZEA 7CEIA 1FR2A 2K5XA 4F37A 2JB0A 3GJNA 2WPTA 2JBGA 2JAZA 2GZIA 2VLPA 2VLQA 2GZJA 2GZFA 2ERHA 3GKLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EMV A;  1GXH A;  1MZ8 A;  1BXI A;  1AYI A;  1UJZ A;  1ZNV A;  1IMP A;  1E0H A;  4QKO A;  1IMQ A;  1UNK A;  1CEI A;  1GXG A;  3U43 A;  2K0D X;  4UHP B;  2VLO A;  5EW5 E;  2GYK A;  2GZG A;  2VLN A;  2NO8 A;  2GZE A;  7CEI A;  1FR2 A;  2K5X A;  4F37 A;  2JB0 A;  3GJN A;  2WPT A;  2JBG A;  2JAZ A;  2GZI A;  2VLP A;  2VLQ A;  2GZJ A;  2GZF A;  2ERH A;  3GKL C; 
#chains in the Genus database with same CATH topology
 4H2X C;  1RO0 A;  5F2N A;  3OW2 O;  2MY5 A;  1BAJ A;  1NJI Q;  2N5I A;  2JU1 A;  3CPW O;  3CC4 P;  1YJW P;  2LPK A;  1X3O A;  2M5R A;  3GKL C;  3RG6 C;  2N98 A;  4PXH B;  3WBH A;  1BXI A;  2KGC A;  2PEQ A;  1ZNV A;  3Q20 A;  3DS2 A;  2PEK A;  1K8A Q;  2KGD A;  1VQ9 P;  1VQL P;  1EOQ A;  3GJN A;  3H0D A;  4MRT C;  1K9M Q;  5F2K A;  2K2Q A;  1AYI A;  3CCU P;  5HGM A;  3U43 A;  2KG6 A;  2VLO A;  4GR6 A;  3CCQ P;  5BS2 A;  3MGE A;  2FQ2 A;  1HY8 A;  4F37 A;  1M1K Q;  1M90 Q;  2N6Z A;  1OR5 A;  2DGY A;  5JPA A;  1YJ9 P;  1RNI A;  2CNR A;  2L4B A;  1GXH A;  2FAD A;  2PEN A;  2OAR A;  3B4Q A;  4UHP B;  3CMA P;  3B5I A;  1M74 A;  1W2B O;  1VQN P;  7CEI A;  1K30 A;  5EJD A;  2AFE A;  2XV6 A;  2JBG A;  4GR2 A;  1M6N A;  2GDX A;  2JO0 A;  4PH1 A;  1E6J P;  2FVA A;  1VQO P;  3NTE A;  2K93 A;  2EHS A;  1DNY A;  4PWV B;  5HV8 A;  5KP8 B;  2XZ1 C;  3G4S P;  3VRL C;  1QVF O;  3G28 A;  2M8N A;  2VLP A;  3P05 A;  1NQ4 A;  1EMV A;  5KP6 B;  1RO2 A;  2Z45 A;  3CME P;  2VSQ A;  1IMP A;  3CD6 P;  3G21 A;  2XT1 A;  4XFX A;  2JQ4 A;  2K0D X;  3G1G A;  1IUQ A;  4U0F A;  2L22 A;  2WPT A;  2FVE A;  2X2B A;  4COC A;  2OTJ P;  1HQB A;  2FAE A;  1M6E X;  2K92 A;  1IMQ A;  4BPG A;  4XFZ A;  3G71 P;  1L0H A;  4NEO A;  2KOP A;  2L6E A;  1KC8 Q;  3EJB A;  2JGP A;  3G1I A;  4DG9 A;  3CC2 P;  1VHN A;  3HYB A;  4WYM A;  4H2Y C;  2LTE A;  2N6Y A;  3LRY A;  1Q86 Q;  2KOQ A;  5HGL A;  1VQ7 P;  2AFD A;  1MZ8 A;  4HKG A;  4XRQ A;  2QA4 P;  2QEX P;  3EJE A;  2AF8 A;  2EIA A;  1VQK P;  3CCJ P;  4U0A A;  5EW5 E;  3CXC O;  4BPF A;  3GZM A;  2K0X A;  3G29 A;  3CCE P;  2EG5 A;  3H47 A;  2CG5 B;  2GZI A;  1YHQ P;  1L0I A;  1D1D A;  1EIA A;  5F2O A;  1JJ2 O;  2JYG A;  1GXG A;  1ZMB A;  4U0C A;  1VQ5 P;  1N8R Q;  5KP7 B;  2NO8 A;  2GZE A;  2QNW A;  4CA3 A;  4COP A;  2K5X A;  1VQM P;  1DV5 A;  2PEI A;  5BS1 A;  2GZF A;  3G6E P;  2ERH A;  3CC7 P;  3DPH A;  1K73 Q;  2FQ1 A;  1GPJ A;  3CCM P;  2LL8 A;  1YIJ P;  1UNK A;  2KOD A;  3DS3 A;  1AUM A;  5HGN A;  3DS0 A;  2MR7 A;  3DS5 A;  2KOR A;  2KGA A;  4XRO A;  2KWL A;  1T8K A;  2L9F A;  2PEM A;  2XXM A;  2MVV A;  4BPH A;  1VKU A;  2EHT A;  3E2D A;  2BHV A;  1QVG O;  2N50 A;  3I55 P;  3RG2 A;  2L0Q A;  2Z46 A;  3DS1 A;  3CCL P;  2DNW A;  3I56 P;  2LKI A;  1ACP A;  4H2W C;  2PEO A;  1QRJ A;  3G26 A;  2XZ0 D;  3M1M A;  4XFY A;  2CGQ A;  2OTL P;  3GZL A;  1FR2 A;  2LML A;  1Q82 Q;  5HVC A;  1KQS O;  1YI2 P;  2KOS A;  4IZ6 A;  5HGO A;  2JYL A;  1Q81 Q;  1YIT P;  2ONT A;  2KR5 A;  3CCS P;  4U0B A;  2M8P A;  2MR8 A;  2FHS C;  1S72 P;  2AVA A;  1CEI A;  2K94 A;  4PH0 A;  3NY7 B;  1KD1 Q;  1A43 A;  3LMO A;  2MD9 A;  2GZJ A;  2KW2 A;  4M0I A;  1Q7Y Q;  3HZQ A;  2CQ8 A;  1AF8 A;  4QKO A;  1KLP A;  1A8O A;  1YJN P;  2M8L A;  2LF4 A;  2EFJ A;  2JU2 A;  2JAZ A;  4IPY A;  2VLQ A;  2K0Y A;  4U0D A;  4U0E A;  1F80 D;  2PEJ A;  2Z44 A;  1VQP P;  4R0M A;  2PY8 A;  2N5H A;  2GDY A;  1Z6M A;  2E1M A;  2LIW A;  3DTJ A;  4QNB A;  5DCK A;  1VQ6 P;  2MF4 A;  3CCR P;  2BUO A;  2MVU A;  2PNG A;  1VQ8 P;  3G0V A;  5I4T G;  3H4E A;  2ROQ A;  2P9X A;  2FVF A;  3CCV P;  1UJZ A;  1E0H A;  3DS4 A;  2KG8 A;  2KG9 A;  2CWO A;  2KGE A;  2FQ0 A;  3EJD A;  2GYK A;  2GZG A;  2VLN A;  2GDW A;  2JB0 A;  2KOO A;  2LOL A;  1VQ4 P;  2LIU A;  3CE7 A;  2FAC A;  5CZD B; 
#chains in the Genus database with same CATH homology
 1EMV A;  1GXH A;  1MZ8 A;  1BXI A;  1AYI A;  1UJZ A;  1ZNV A;  1IMP A;  1E0H A;  4QKO A;  1IMQ A;  1UNK A;  1CEI A;  1GXG A;  3U43 A;  2K0D X;  4UHP B;  2VLO A;  5EW5 E;  2GYK A;  2GZG A;  2VLN A;  2NO8 A;  2GZE A;  7CEI A;  1FR2 A;  2K5X A;  4F37 A;  2JB0 A;  3GJN A;  2WPT A;  2JBG A;  2JAZ A;  2GZI A;  2VLP A;  2VLQ A;  2GZJ A;  2GZF A;  2ERH A;  3GKL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...