2VLOA

K97a mutant of e9 dnase domain in complex with im9
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQGLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords COLICIN-E9 IMMUNITY PROTEIN
publication title Experimental and Computational Analyses of the Energetic Basis for Dual Recognition of Immunity Proteins by Colicin Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2vloA00
7CEIA 1BXIA 2WPTA 2VLOA 2JAZA 1FR2A 2JB0A 1IMQA 1GXHA 1GXGA 1EMVA 1UNKA 3U43A 2GZFA 2GZIA 2VLPA 2VLNA 2ERHA 2GZEA 5EW5E 3GKLC 4QKOA 4UHPB 1E0HA 2GZJA 3GJNA 2GYKA 1CEIA 1UJZA 4F37A 2K5XA 2JBGA 2GZGA 2NO8A 2VLQA 1AYIA 1ZNVA 2K0DX 1IMPA 1MZ8A
chains in the Genus database with same CATH superfamily
2P9XA 1OR5A 4PXHB 1ACPA 1F80D 1GXGA 1UNKA 2MR7A 1L0HA 4BPGA 4H2XC 1KQSO 2VLPA 2XZ1C 1AUMA 2EG5A 5HVCA 3CD6P 5EW5E 5BS1A 4IZ6A 2GZJA 2LOLA 2M5RA 3RG2A 4H2YC 2NO8A 3CCQP 1S72P 2LKIA 2KOOA 2QA4P 3DS1A 2PEQA 2PNGA 2AVAA 2MD9A 3NTEA 1VQ4P 2FADA 2KG9A 2KORA 3EJEA 1K8AQ 1X3OA 2AFEA 3M1MA 1ZMBA 1RO2A 3NY7B 2KGAA 2WPTA 1K30A 2L6EA 4COCA 4PWVB 2ONTA 2OTJP 1E6JP 1YJNP 3B5IA 2GZEA 4H2WC 3H47A 2GYKA 5F2OA 3B4QA 2K5XA 5KP8B 3H0DA 1VQOP 2DGYA 4BPFA 2ROQA 2CGQA 1IMQA 1HY8A 2PEIA 2MVVA 3G28A 4M0IA 4XFZA 1D1DA 1A43A 2LIWA 4GR2A 1MZ8A 1QVGO 1VQ8P 7CEIA 3WBHA 1VQNP 4U0DA 2FVAA 2LIUA 2GZFA 3CCEP 4U0CA 5HGMA 1Q7YQ 2LPKA 4QNBA 4WYMA 1QRJA 2EIAA 1IMPA 2JB0A 2K0YA 3GZMA 3CCUP 1M90Q 2FACA 2XT1A 3CPWO 2EHTA 2JYGA 3DS4A 4QKOA 1KD1Q 3GJNA 3DTJA 3E2DA 3CCJP 2AFDA 4COPA 2K93A 3HYBA 2QNWA 2EHSA 3GZLA 2K2QA 1GXHA 2GDWA 4HKGA 1YJ9P 1W2BO 2L0QA 1VQ7P 1DV5A 2JYLA 2CNRA 4XFYA 2PEOA 4IPYA 5KP7B 2PY8A 5CZDB 1VHNA 1VKUA 2M8NA 1AF8A 3DS3A 1EMVA 2N5IA 1NJIQ 1VQKP 2MVUA 2KOSA 2N6YA 2ERHA 3G6EP 2Z46A 1E0HA 1YI2P 1NQ4A 2GDXA 1EIAA 2JBGA 1VQ5P 2OTLP 3CCLP 2KOQA 4XRQA 4U0FA 2OARA 2X2BA 2FVFA 2N98A 4XROA 4CA3A 3G4SP 3CC7P 4MRTC 5HGNA 1VQ6P 2M8LA 3HZQA 5KP6B 1KLPA 1Q81Q 2XXMA 4BPHA 4PH1A 2L9FA 3CMEP 2FVEA 2K0XA 2PEMA 1RO0A 2FQ0A 4PH0A 1Z6MA 2PEJA 1L0IA 1Q86Q 3H4EA 1N8RQ 2JGPA 1K9MQ 4NEOA 2JO0A 2Z45A 2L4BA 3DS5A 3CCMP 2JU2A 2LF4A 4XFXA 3I56P 3P05A 2CWOA 2PENA 2MY5A 2EFJA 2E1MA 1KC8Q 1M74A 1YJWP 1M6NA 1VQPP 3I55P 1Q82Q 3G21A 2FAEA 3DS2A 2XZ0D 1FR2A 2XV6A 1HQBA 1YIJP 2GZIA 5F2NA 1A8OA 2KGDA 2Z44A 2QEXP 2AF8A 2M8PA 2GDYA 1ZNVA 5HGOA 2N5HA 1K73Q 2K92A 2KWLA 2PEKA 3DPHA 3G71P 3OW2O 3Q20A 3G1IA 3U43A 2KGCA 2KG8A 3G0VA 2VLNA 3VRLC 3G29A 1M1KQ 3CXCO 2KW2A 2DNWA 1T8KA 3CMAP 2GZGA 2JU1A 1VQ9P 2KODA 2MF4A 4GR6A 3EJBA 2JAZA 2JQ4A 5JPAA 2N50A 2LMLA 3DS0A 2L22A 4U0BA 4R0MA 2FQ2A 3G26A 5I4TG 2KOPA 4UHPB 1YITP 1UJZA 4F37A 1GPJA 5EJDA 2LTEA 2KG6A 1VQMP 3LRYA 1QVFO 1AYIA 1BAJA 1IUQA 1BXIA 2N6ZA 3G1GA 1DNYA 4U0EA 5DCKA 3LMOA 2KGEA 2BHVA 2BUOA 5F2KA 2CG5B 2FHSC 2K94A 3GKLC 3MGEA 5HV8A 2VSQA 3CCSP 1JJ2O 2FQ1A 2VLQA 2K0DX 3RG6C 4DG9A 2VLOA 3CCRP 5BS2A 1YHQP 3CC4P 1EOQA 2CQ8A 1RNIA 3CE7A 2LL8A 4U0AA 1CEIA 2MR8A 1VQLP 1M6EX 3CCVP 5HGLA 3CC2P 2KR5A 3EJDA
chains in the Genus database with same CATH topology
7CEIA 1BXIA 2WPTA 2VLOA 2JAZA 1FR2A 2JB0A 1IMQA 1GXHA 1GXGA 1EMVA 1UNKA 3U43A 2GZFA 2GZIA 2VLPA 2VLNA 2ERHA 2GZEA 5EW5E 3GKLC 4QKOA 4UHPB 1E0HA 2GZJA 3GJNA 2GYKA 1CEIA 1UJZA 4F37A 2K5XA 2JBGA 2GZGA 2NO8A 2VLQA 1AYIA 1ZNVA 2K0DX 1IMPA 1MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7CEI A;  1BXI A;  2WPT A;  2VLO A;  2JAZ A;  1FR2 A;  2JB0 A;  1IMQ A;  1GXH A;  1GXG A;  1EMV A;  1UNK A;  3U43 A;  2GZF A;  2GZI A;  2VLP A;  2VLN A;  2ERH A;  2GZE A;  5EW5 E;  3GKL C;  4QKO A;  4UHP B;  1E0H A;  2GZJ A;  3GJN A;  2GYK A;  1CEI A;  1UJZ A;  4F37 A;  2K5X A;  2JBG A;  2GZG A;  2NO8 A;  2VLQ A;  1AYI A;  1ZNV A;  2K0D X;  1IMP A;  1MZ8 A; 
#chains in the Genus database with same CATH topology
 2P9X A;  1OR5 A;  4PXH B;  1ACP A;  1F80 D;  1GXG A;  1UNK A;  2MR7 A;  1L0H A;  4BPG A;  4H2X C;  1KQS O;  2VLP A;  2XZ1 C;  1AUM A;  2EG5 A;  5HVC A;  3CD6 P;  5EW5 E;  5BS1 A;  4IZ6 A;  2GZJ A;  2LOL A;  2M5R A;  3RG2 A;  4H2Y C;  2NO8 A;  3CCQ P;  1S72 P;  2LKI A;  2KOO A;  2QA4 P;  3DS1 A;  2PEQ A;  2PNG A;  2AVA A;  2MD9 A;  3NTE A;  1VQ4 P;  2FAD A;  2KG9 A;  2KOR A;  3EJE A;  1K8A Q;  1X3O A;  2AFE A;  3M1M A;  1ZMB A;  1RO2 A;  3NY7 B;  2KGA A;  2WPT A;  1K30 A;  2L6E A;  4COC A;  4PWV B;  2ONT A;  2OTJ P;  1E6J P;  1YJN P;  3B5I A;  2GZE A;  4H2W C;  3H47 A;  2GYK A;  5F2O A;  3B4Q A;  2K5X A;  5KP8 B;  3H0D A;  1VQO P;  2DGY A;  4BPF A;  2ROQ A;  2CGQ A;  1IMQ A;  1HY8 A;  2PEI A;  2MVV A;  3G28 A;  4M0I A;  4XFZ A;  1D1D A;  1A43 A;  2LIW A;  4GR2 A;  1MZ8 A;  1QVG O;  1VQ8 P;  7CEI A;  3WBH A;  1VQN P;  4U0D A;  2FVA A;  2LIU A;  2GZF A;  3CCE P;  4U0C A;  5HGM A;  1Q7Y Q;  2LPK A;  4QNB A;  4WYM A;  1QRJ A;  2EIA A;  1IMP A;  2JB0 A;  2K0Y A;  3GZM A;  3CCU P;  1M90 Q;  2FAC A;  2XT1 A;  3CPW O;  2EHT A;  2JYG A;  3DS4 A;  4QKO A;  1KD1 Q;  3GJN A;  3DTJ A;  3E2D A;  3CCJ P;  2AFD A;  4COP A;  2K93 A;  3HYB A;  2QNW A;  2EHS A;  3GZL A;  2K2Q A;  1GXH A;  2GDW A;  4HKG A;  1YJ9 P;  1W2B O;  2L0Q A;  1VQ7 P;  1DV5 A;  2JYL A;  2CNR A;  4XFY A;  2PEO A;  4IPY A;  5KP7 B;  2PY8 A;  5CZD B;  1VHN A;  1VKU A;  2M8N A;  1AF8 A;  3DS3 A;  1EMV A;  2N5I A;  1NJI Q;  1VQK P;  2MVU A;  2KOS A;  2N6Y A;  2ERH A;  3G6E P;  2Z46 A;  1E0H A;  1YI2 P;  1NQ4 A;  2GDX A;  1EIA A;  2JBG A;  1VQ5 P;  2OTL P;  3CCL P;  2KOQ A;  4XRQ A;  4U0F A;  2OAR A;  2X2B A;  2FVF A;  2N98 A;  4XRO A;  4CA3 A;  3G4S P;  3CC7 P;  4MRT C;  5HGN A;  1VQ6 P;  2M8L A;  3HZQ A;  5KP6 B;  1KLP A;  1Q81 Q;  2XXM A;  4BPH A;  4PH1 A;  2L9F A;  3CME P;  2FVE A;  2K0X A;  2PEM A;  1RO0 A;  2FQ0 A;  4PH0 A;  1Z6M A;  2PEJ A;  1L0I A;  1Q86 Q;  3H4E A;  1N8R Q;  2JGP A;  1K9M Q;  4NEO A;  2JO0 A;  2Z45 A;  2L4B A;  3DS5 A;  3CCM P;  2JU2 A;  2LF4 A;  4XFX A;  3I56 P;  3P05 A;  2CWO A;  2PEN A;  2MY5 A;  2EFJ A;  2E1M A;  1KC8 Q;  1M74 A;  1YJW P;  1M6N A;  1VQP P;  3I55 P;  1Q82 Q;  3G21 A;  2FAE A;  3DS2 A;  2XZ0 D;  1FR2 A;  2XV6 A;  1HQB A;  1YIJ P;  2GZI A;  5F2N A;  1A8O A;  2KGD A;  2Z44 A;  2QEX P;  2AF8 A;  2M8P A;  2GDY A;  1ZNV A;  5HGO A;  2N5H A;  1K73 Q;  2K92 A;  2KWL A;  2PEK A;  3DPH A;  3G71 P;  3OW2 O;  3Q20 A;  3G1I A;  3U43 A;  2KGC A;  2KG8 A;  3G0V A;  2VLN A;  3VRL C;  3G29 A;  1M1K Q;  3CXC O;  2KW2 A;  2DNW A;  1T8K A;  3CMA P;  2GZG A;  2JU1 A;  1VQ9 P;  2KOD A;  2MF4 A;  4GR6 A;  3EJB A;  2JAZ A;  2JQ4 A;  5JPA A;  2N50 A;  2LML A;  3DS0 A;  2L22 A;  4U0B A;  4R0M A;  2FQ2 A;  3G26 A;  5I4T G;  2KOP A;  4UHP B;  1YIT P;  1UJZ A;  4F37 A;  1GPJ A;  5EJD A;  2LTE A;  2KG6 A;  1VQM P;  3LRY A;  1QVF O;  1AYI A;  1BAJ A;  1IUQ A;  1BXI A;  2N6Z A;  3G1G A;  1DNY A;  4U0E A;  5DCK A;  3LMO A;  2KGE A;  2BHV A;  2BUO A;  5F2K A;  2CG5 B;  2FHS C;  2K94 A;  3GKL C;  3MGE A;  5HV8 A;  2VSQ A;  3CCS P;  1JJ2 O;  2FQ1 A;  2VLQ A;  2K0D X;  3RG6 C;  4DG9 A;  2VLO A;  3CCR P;  5BS2 A;  1YHQ P;  3CC4 P;  1EOQ A;  2CQ8 A;  1RNI A;  3CE7 A;  2LL8 A;  4U0A A;  1CEI A;  2MR8 A;  1VQL P;  1M6E X;  3CCV P;  5HGL A;  3CC2 P;  2KR5 A;  3EJD A; 
#chains in the Genus database with same CATH homology
 7CEI A;  1BXI A;  2WPT A;  2VLO A;  2JAZ A;  1FR2 A;  2JB0 A;  1IMQ A;  1GXH A;  1GXG A;  1EMV A;  1UNK A;  3U43 A;  2GZF A;  2GZI A;  2VLP A;  2VLN A;  2ERH A;  2GZE A;  5EW5 E;  3GKL C;  4QKO A;  4UHP B;  1E0H A;  2GZJ A;  3GJN A;  2GYK A;  1CEI A;  1UJZ A;  4F37 A;  2K5X A;  2JBG A;  2GZG A;  2NO8 A;  2VLQ A;  1AYI A;  1ZNV A;  2K0D X;  1IMP A;  1MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...