2N98A

Solution structure of acyl carrier protein lipd from actinoplanes friuliensis
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
GHMSDLSTAPTLDSLRVWLVDCVAGHLGLDAATIATDLPLTSYGLDSVYALSIAAELEDHLDVSLDPTLIWDHPTIDALSTALVAELRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and dynamic characterization of a freestanding acyl carrier protein involved in the biosynthesis of cyclic lipopeptide antibiotics.
pubmed doi rcsb
source organism Actinoplanes friuliensis
molecule tags Transport protein
molecule keywords Acyl carrier protein
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n98A00
2KOPA 1NQ4A 4HKGA 2K0XA 2MR8A 2JQ4A 2KOQA 2N5HA 2AFEA 2CQ8A 5HVCA 2N98A 4BPGA 2FQ0A 2GDYA 2KOSA 2KGDA 2MY5A 3RG2A 4H2WC 1DNYA 4H2XC 5KP7B 2PNGA 2MD9A 2K92A 2LPKA 3GZLA 2FQ1A 2JU2A 2JGPA 2LL8A 1X3OA 1OR5A 2ROQA 3CE7A 2FHSC 4MRTC 2XZ1C 5CZDB 2LIWA 2L4BA 3LMOA 2LKIA 1HY8A 2FVAA 2XZ0D 1VKUA 2GDXA 2FADA 2LOLA 2N6ZA 2LMLA 2DNWA 1AF8A 4NEOA 2FACA 2K93A 2CG5B 2KGEA 2KORA 2M5RA 2MR7A 4IZ6A 2EHTA 2K2QA 2K0YA 2MVVA 2KOOA 2K94A 5KP6B 2L22A 2L9FA 2FAEA 4BPHA 2CGQA 4CA3A 2KW2A 2VSQA 2MF4A 5EJDA 2EHSA 2MVUA 2JU1A 2AFDA 2KGAA 2LTEA 3EJEA 5HV8A 4R0MA 1DV5A 2FQ2A 4DG9A 1ACPA 1L0HA 4H2YC 2KG9A 2FVFA 1T8KA 1HQBA 2N6YA 2CNRA 4PWVB 2L0QA 3EJDA 2GDWA 2FVEA 2KGCA 2QNWA 4BPFA 2N5IA 3NY7B 1KLPA 4PXHB 1L0IA 1F80D 2KWLA 2KG6A 2N50A 3EJBA 2KG8A 2AVAA 2LIUA 2AF8A 2X2BA 2KR5A 5KP8B 3GZMA
chains in the Genus database with same CATH superfamily
3G71P 2MR8A 2JQ4A 2KOQA 1N8RQ 4BPGA 3GKLC 3B4QA 3H0DA 2KOSA 2JYLA 3CCLP 2KGDA 5HGLA 2MY5A 3CCMP 1IMPA 4H2WC 3RG6C 2PEIA 2LPKA 1YIJP 1OR5A 1VQ6P 4U0BA 5CZDB 2LIWA 2PEJA 3CC7P 1AYIA 1EOQA 3HYBA 3CCEP 5I4TG 1RO0A 4PH0A 1MZ8A 3G0VA 1AF8A 5F2OA 3M1MA 2K93A 2CG5B 2KGEA 2KORA 4IZ6A 2K2QA 2K0YA 1ZNVA 4XFXA 2FAEA 1QVGO 2KW2A 2VSQA 2NO8A 2JO0A 3CCRP 3GJNA 2GZJA 3EJEA 1DV5A 2FQ2A 3DS0A 1M6EX 1RNIA 1K30A 4DG9A 3G4SP 1L0HA 4H2YC 3DS4A 2FVFA 1HQBA 2CNRA 2Z45A 2GDWA 2GZEA 3H47A 1YJWP 4IPYA 4PXHB 1L0IA 1NJIQ 1F80D 2KG6A 2AVAA 2LIUA 2AF8A 2X2BA 2KR5A 3GZMA 2KOPA 4HKGA 3CC2P 2PENA 2Z46A 1GXHA 3VRLC 5HVCA 1YHQP 3G28A 2GDYA 2XXMA 4U0AA 3CCVP 2BHVA 4H2XC 2LF4A 5KP7B 2BUOA 1A8OA 3GZLA 3DS2A 1VQOP 2FHSC 4COCA 3G29A 3DS1A 3G26A 4GR2A 2QA4P 2PEMA 2Z44A 1YJNP 2L4BA 2OARA 2XT1A 1VHNA 2PEOA 2P9XA 1K8AQ 1KC8Q 4NEOA 2ERHA 2FACA 2EHTA 4XFYA 2MVVA 2ONTA 2KOOA 2GZGA 5KP6B 1UNKA 2L9FA 4BPHA 4WYMA 1VQNP 5EJDA 1QVFO 4PH1A 4U0EA 3U43A 3CCUP 3CPWO 2WPTA 5HV8A 1VQ7P 1FR2A 1K9MQ 2CWOA 3HZQA 2OTLP 5HGOA 2KG9A 1T8KA 2N6YA 1RO2A 1GXGA 2JAZA 1S72P 1VQ8P 3NY7B 2KWLA 1Q86Q 2N50A 3I55P 1M74A 3E2DA 2L6EA 3DPHA 1NQ4A 3P05A 2VLOA 2K0XA 1Q81Q 2N5HA 1VQ9P 2AFEA 2CQ8A 2FQ0A 4GR6A 3CCSP 1YJ9P 3DS3A 3G21A 2PNGA 1VQMP 2MD9A 2EFJA 3MGEA 2OTJP 1X3OA 2ROQA 2K5XA 2PY8A 2K0DX 1KQSO 3G6EP 2M8PA 2XV6A 1VQPP 2GYKA 4UHPB 1HY8A 2XZ0D 2GDXA 2LOLA 2N6ZA 7CEIA 1Q82Q 2LMLA 1Q7YQ 1D1DA 2PEKA 2GZFA 3Q20A 2M5RA 2MR7A 4QKOA 1CEIA 2L22A 2MF4A 5HGMA 1KD1Q 1E0HA 2EHSA 2AFDA 1Z6MA 4XFZA 2LTEA 2M8NA 3CMAP 2E1MA 4U0DA 4R0MA 3B5IA 3CC4P 4U0FA 1YI2P 4XROA 2L0QA 2KODA 5EW5E 2FVEA 2KGCA 2QNWA 4BPFA 1KLPA 2VLNA 1JJ2O 4QNBA 1K73Q 2VLPA 1M6NA 5KP8B 2JYGA 2DGYA 1ZMBA 2N98A 2M8LA 3I56P 1BXIA 4M0IA 4XRQA 4F37A 3RG2A 3DS5A 3LRYA 1DNYA 2GZIA 1W2BO 2K92A 2FQ1A 2JU2A 2JGPA 5F2KA 2LL8A 3CE7A 2EG5A 3DTJA 2QEXP 5BS1A 4MRTC 2XZ1C 5HGNA 3LMOA 2LKIA 1GPJA 1EIAA 2EIAA 2FVAA 1VKUA 2FADA 1YITP 3H4EA 2DNWA 1IUQA 3CCJP 3G1IA 2VLQA 3CMEP 4U0CA 1M1KQ 1A43A 5JPAA 2JBGA 3CD6P 4COPA 2K94A 1VQ4P 1VQLP 2CGQA 4CA3A 2MVUA 2JU1A 1EMVA 1AUMA 3CCQP 2KGAA 1QRJA 2JB0A 1E6JP 1VQ5P 5DCKA 5BS2A 1ACPA 1IMQA 1VQKP 2PEQA 3CXCO 4PWVB 1M90Q 3EJDA 3WBHA 5F2NA 3OW2O 2N5IA 1BAJA 3EJBA 2KG8A 1UJZA 3NTEA 3G1GA
chains in the Genus database with same CATH topology
2KOPA 1NQ4A 4HKGA 2K0XA 2MR8A 2JQ4A 2KOQA 2N5HA 2AFEA 2CQ8A 5HVCA 2N98A 4BPGA 2FQ0A 2GDYA 2KOSA 2KGDA 2MY5A 3RG2A 4H2WC 1DNYA 4H2XC 5KP7B 2PNGA 2MD9A 2K92A 2LPKA 3GZLA 2FQ1A 2JU2A 2JGPA 2LL8A 1X3OA 1OR5A 2ROQA 3CE7A 2FHSC 4MRTC 2XZ1C 5CZDB 2LIWA 2L4BA 3LMOA 2LKIA 1HY8A 2FVAA 2XZ0D 1VKUA 2GDXA 2FADA 2LOLA 2N6ZA 2LMLA 2DNWA 1AF8A 4NEOA 2FACA 2K93A 2CG5B 2KGEA 2KORA 2M5RA 2MR7A 4IZ6A 2EHTA 2K2QA 2K0YA 2MVVA 2KOOA 2K94A 5KP6B 2L22A 2L9FA 2FAEA 4BPHA 2CGQA 4CA3A 2KW2A 2VSQA 2MF4A 5EJDA 2EHSA 2MVUA 2JU1A 2AFDA 2KGAA 2LTEA 3EJEA 5HV8A 4R0MA 1DV5A 2FQ2A 4DG9A 1ACPA 1L0HA 4H2YC 2KG9A 2FVFA 1T8KA 1HQBA 2N6YA 2CNRA 4PWVB 2L0QA 3EJDA 2GDWA 2FVEA 2KGCA 2QNWA 4BPFA 2N5IA 3NY7B 1KLPA 4PXHB 1L0IA 1F80D 2KWLA 2KG6A 2N50A 3EJBA 2KG8A 2AVAA 2LIUA 2AF8A 2X2BA 2KR5A 5KP8B 3GZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOP A;  1NQ4 A;  4HKG A;  2K0X A;  2MR8 A;  2JQ4 A;  2KOQ A;  2N5H A;  2AFE A;  2CQ8 A;  5HVC A;  2N98 A;  4BPG A;  2FQ0 A;  2GDY A;  2KOS A;  2KGD A;  2MY5 A;  3RG2 A;  4H2W C;  1DNY A;  4H2X C;  5KP7 B;  2PNG A;  2MD9 A;  2K92 A;  2LPK A;  3GZL A;  2FQ1 A;  2JU2 A;  2JGP A;  2LL8 A;  1X3O A;  1OR5 A;  2ROQ A;  3CE7 A;  2FHS C;  4MRT C;  2XZ1 C;  5CZD B;  2LIW A;  2L4B A;  3LMO A;  2LKI A;  1HY8 A;  2FVA A;  2XZ0 D;  1VKU A;  2GDX A;  2FAD A;  2LOL A;  2N6Z A;  2LML A;  2DNW A;  1AF8 A;  4NEO A;  2FAC A;  2K93 A;  2CG5 B;  2KGE A;  2KOR A;  2M5R A;  2MR7 A;  4IZ6 A;  2EHT A;  2K2Q A;  2K0Y A;  2MVV A;  2KOO A;  2K94 A;  5KP6 B;  2L22 A;  2L9F A;  2FAE A;  4BPH A;  2CGQ A;  4CA3 A;  2KW2 A;  2VSQ A;  2MF4 A;  5EJD A;  2EHS A;  2MVU A;  2JU1 A;  2AFD A;  2KGA A;  2LTE A;  3EJE A;  5HV8 A;  4R0M A;  1DV5 A;  2FQ2 A;  4DG9 A;  1ACP A;  1L0H A;  4H2Y C;  2KG9 A;  2FVF A;  1T8K A;  1HQB A;  2N6Y A;  2CNR A;  4PWV B;  2L0Q A;  3EJD A;  2GDW A;  2FVE A;  2KGC A;  2QNW A;  4BPF A;  2N5I A;  3NY7 B;  1KLP A;  4PXH B;  1L0I A;  1F80 D;  2KWL A;  2KG6 A;  2N50 A;  3EJB A;  2KG8 A;  2AVA A;  2LIU A;  2AF8 A;  2X2B A;  2KR5 A;  5KP8 B;  3GZM A; 
#chains in the Genus database with same CATH topology
 3G71 P;  2MR8 A;  2JQ4 A;  2KOQ A;  1N8R Q;  4BPG A;  3GKL C;  3B4Q A;  3H0D A;  2KOS A;  2JYL A;  3CCL P;  2KGD A;  5HGL A;  2MY5 A;  3CCM P;  1IMP A;  4H2W C;  3RG6 C;  2PEI A;  2LPK A;  1YIJ P;  1OR5 A;  1VQ6 P;  4U0B A;  5CZD B;  2LIW A;  2PEJ A;  3CC7 P;  1AYI A;  1EOQ A;  3HYB A;  3CCE P;  5I4T G;  1RO0 A;  4PH0 A;  1MZ8 A;  3G0V A;  1AF8 A;  5F2O A;  3M1M A;  2K93 A;  2CG5 B;  2KGE A;  2KOR A;  4IZ6 A;  2K2Q A;  2K0Y A;  1ZNV A;  4XFX A;  2FAE A;  1QVG O;  2KW2 A;  2VSQ A;  2NO8 A;  2JO0 A;  3CCR P;  3GJN A;  2GZJ A;  3EJE A;  1DV5 A;  2FQ2 A;  3DS0 A;  1M6E X;  1RNI A;  1K30 A;  4DG9 A;  3G4S P;  1L0H A;  4H2Y C;  3DS4 A;  2FVF A;  1HQB A;  2CNR A;  2Z45 A;  2GDW A;  2GZE A;  3H47 A;  1YJW P;  4IPY A;  4PXH B;  1L0I A;  1NJI Q;  1F80 D;  2KG6 A;  2AVA A;  2LIU A;  2AF8 A;  2X2B A;  2KR5 A;  3GZM A;  2KOP A;  4HKG A;  3CC2 P;  2PEN A;  2Z46 A;  1GXH A;  3VRL C;  5HVC A;  1YHQ P;  3G28 A;  2GDY A;  2XXM A;  4U0A A;  3CCV P;  2BHV A;  4H2X C;  2LF4 A;  5KP7 B;  2BUO A;  1A8O A;  3GZL A;  3DS2 A;  1VQO P;  2FHS C;  4COC A;  3G29 A;  3DS1 A;  3G26 A;  4GR2 A;  2QA4 P;  2PEM A;  2Z44 A;  1YJN P;  2L4B A;  2OAR A;  2XT1 A;  1VHN A;  2PEO A;  2P9X A;  1K8A Q;  1KC8 Q;  4NEO A;  2ERH A;  2FAC A;  2EHT A;  4XFY A;  2MVV A;  2ONT A;  2KOO A;  2GZG A;  5KP6 B;  1UNK A;  2L9F A;  4BPH A;  4WYM A;  1VQN P;  5EJD A;  1QVF O;  4PH1 A;  4U0E A;  3U43 A;  3CCU P;  3CPW O;  2WPT A;  5HV8 A;  1VQ7 P;  1FR2 A;  1K9M Q;  2CWO A;  3HZQ A;  2OTL P;  5HGO A;  2KG9 A;  1T8K A;  2N6Y A;  1RO2 A;  1GXG A;  2JAZ A;  1S72 P;  1VQ8 P;  3NY7 B;  2KWL A;  1Q86 Q;  2N50 A;  3I55 P;  1M74 A;  3E2D A;  2L6E A;  3DPH A;  1NQ4 A;  3P05 A;  2VLO A;  2K0X A;  1Q81 Q;  2N5H A;  1VQ9 P;  2AFE A;  2CQ8 A;  2FQ0 A;  4GR6 A;  3CCS P;  1YJ9 P;  3DS3 A;  3G21 A;  2PNG A;  1VQM P;  2MD9 A;  2EFJ A;  3MGE A;  2OTJ P;  1X3O A;  2ROQ A;  2K5X A;  2PY8 A;  2K0D X;  1KQS O;  3G6E P;  2M8P A;  2XV6 A;  1VQP P;  2GYK A;  4UHP B;  1HY8 A;  2XZ0 D;  2GDX A;  2LOL A;  2N6Z A;  7CEI A;  1Q82 Q;  2LML A;  1Q7Y Q;  1D1D A;  2PEK A;  2GZF A;  3Q20 A;  2M5R A;  2MR7 A;  4QKO A;  1CEI A;  2L22 A;  2MF4 A;  5HGM A;  1KD1 Q;  1E0H A;  2EHS A;  2AFD A;  1Z6M A;  4XFZ A;  2LTE A;  2M8N A;  3CMA P;  2E1M A;  4U0D A;  4R0M A;  3B5I A;  3CC4 P;  4U0F A;  1YI2 P;  4XRO A;  2L0Q A;  2KOD A;  5EW5 E;  2FVE A;  2KGC A;  2QNW A;  4BPF A;  1KLP A;  2VLN A;  1JJ2 O;  4QNB A;  1K73 Q;  2VLP A;  1M6N A;  5KP8 B;  2JYG A;  2DGY A;  1ZMB A;  2N98 A;  2M8L A;  3I56 P;  1BXI A;  4M0I A;  4XRQ A;  4F37 A;  3RG2 A;  3DS5 A;  3LRY A;  1DNY A;  2GZI A;  1W2B O;  2K92 A;  2FQ1 A;  2JU2 A;  2JGP A;  5F2K A;  2LL8 A;  3CE7 A;  2EG5 A;  3DTJ A;  2QEX P;  5BS1 A;  4MRT C;  2XZ1 C;  5HGN A;  3LMO A;  2LKI A;  1GPJ A;  1EIA A;  2EIA A;  2FVA A;  1VKU A;  2FAD A;  1YIT P;  3H4E A;  2DNW A;  1IUQ A;  3CCJ P;  3G1I A;  2VLQ A;  3CME P;  4U0C A;  1M1K Q;  1A43 A;  5JPA A;  2JBG A;  3CD6 P;  4COP A;  2K94 A;  1VQ4 P;  1VQL P;  2CGQ A;  4CA3 A;  2MVU A;  2JU1 A;  1EMV A;  1AUM A;  3CCQ P;  2KGA A;  1QRJ A;  2JB0 A;  1E6J P;  1VQ5 P;  5DCK A;  5BS2 A;  1ACP A;  1IMQ A;  1VQK P;  2PEQ A;  3CXC O;  4PWV B;  1M90 Q;  3EJD A;  3WBH A;  5F2N A;  3OW2 O;  2N5I A;  1BAJ A;  3EJB A;  2KG8 A;  1UJZ A;  3NTE A;  3G1G A; 
#chains in the Genus database with same CATH homology
 2KOP A;  1NQ4 A;  4HKG A;  2K0X A;  2MR8 A;  2JQ4 A;  2KOQ A;  2N5H A;  2AFE A;  2CQ8 A;  5HVC A;  2N98 A;  4BPG A;  2FQ0 A;  2GDY A;  2KOS A;  2KGD A;  2MY5 A;  3RG2 A;  4H2W C;  1DNY A;  4H2X C;  5KP7 B;  2PNG A;  2MD9 A;  2K92 A;  2LPK A;  3GZL A;  2FQ1 A;  2JU2 A;  2JGP A;  2LL8 A;  1X3O A;  1OR5 A;  2ROQ A;  3CE7 A;  2FHS C;  4MRT C;  2XZ1 C;  5CZD B;  2LIW A;  2L4B A;  3LMO A;  2LKI A;  1HY8 A;  2FVA A;  2XZ0 D;  1VKU A;  2GDX A;  2FAD A;  2LOL A;  2N6Z A;  2LML A;  2DNW A;  1AF8 A;  4NEO A;  2FAC A;  2K93 A;  2CG5 B;  2KGE A;  2KOR A;  2M5R A;  2MR7 A;  4IZ6 A;  2EHT A;  2K2Q A;  2K0Y A;  2MVV A;  2KOO A;  2K94 A;  5KP6 B;  2L22 A;  2L9F A;  2FAE A;  4BPH A;  2CGQ A;  4CA3 A;  2KW2 A;  2VSQ A;  2MF4 A;  5EJD A;  2EHS A;  2MVU A;  2JU1 A;  2AFD A;  2KGA A;  2LTE A;  3EJE A;  5HV8 A;  4R0M A;  1DV5 A;  2FQ2 A;  4DG9 A;  1ACP A;  1L0H A;  4H2Y C;  2KG9 A;  2FVF A;  1T8K A;  1HQB A;  2N6Y A;  2CNR A;  4PWV B;  2L0Q A;  3EJD A;  2GDW A;  2FVE A;  2KGC A;  2QNW A;  4BPF A;  2N5I A;  3NY7 B;  1KLP A;  4PXH B;  1L0I A;  1F80 D;  2KWL A;  2KG6 A;  2N50 A;  3EJB A;  2KG8 A;  2AVA A;  2LIU A;  2AF8 A;  2X2B A;  2KR5 A;  5KP8 B;  3GZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...