2N98A

Solution structure of acyl carrier protein lipd from actinoplanes friuliensis
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
GHMSDLSTAPTLDSLRVWLVDCVAGHLGLDAATIATDLPLTSYGLDSVYALSIAAELEDHLDVSLDPTLIWDHPTIDALSTALVAELRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural and dynamic characterization of a freestanding acyl carrier protein involved in the biosynthesis of cyclic lipopeptide antibiotics.
pubmed doi rcsb
source organism Actinoplanes friuliensis
molecule tags Transport protein
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n98A00
3GZLA 1NQ4A 3EJDA 1L0IA 2LOLA 2LTEA 4NEOA 4MRTC 2LMLA 2FQ2A 4HKGA 2XZ0D 1HQBA 2KW2A 2LL8A 2QNWA 2KG8A 2FVFA 2X2BA 2KGCA 2KOOA 2XZ1C 2CG5B 5CZDB 2AF8A 2LKIA 3CE7A 1AF8A 2KGAA 2PNGA 2JGPA 2AVAA 2KG9A 2AFEA 2K94A 2EHTA 2K0XA 2N6ZA 2GDYA 3LMOA 5EJDA 1KLPA 2DNWA 2FADA 4H2WC 2KWLA 2MD9A 2FQ0A 1VKUA 2GDXA 2FQ1A 1HY8A 3NY7B 2M5RA 2N50A 4R0MA 3EJEA 1L0HA 4DG9A 2GDWA 2KGEA 2MR8A 2KOSA 2JU1A 1ACPA 3EJBA 2FVAA 4BPHA 5HVCA 4PWVB 5HV8A 2VSQA 2MF4A 2JQ4A 2ROQA 2LIWA 2KR5A 1X3OA 2CNRA 2KOQA 4H2YC 2L0QA 2L9FA 1DV5A 2MR7A 2N5IA 5KP7B 2N5HA 4H2XC 2K2QA 2KORA 4CA3A 4BPFA 2FACA 5KP8B 2EHSA 2L4BA 5KP6B 2KG6A 2K0YA 2K93A 2KOPA 2KGDA 1OR5A 1DNYA 2LIUA 2FVEA 2CQ8A 2CGQA 4PXHB 2AFDA 1F80D 4IZ6A 1T8KA 2MVVA 3GZMA 2N6YA 2N98A 2JU2A 2FAEA 2K92A 3RG2A 2FHSC 2LPKA 2L22A 2MY5A 2MVUA 4BPGA
chains in the Genus database with same CATH superfamily
1VQ5P 4XRQA 1Q82Q 5HGLA 1AUMA 2GZIA 4COCA 4NEOA 3H4EA 3HZQA 3E2DA 1EIAA 2M8NA 1UJZA 1W2BO 2KG8A 2GYKA 2OTLP 4WYMA 3CCVP 2KOOA 2AF8A 3VRLC 3CXCO 2AVAA 1FR2A 2AFEA 2GZJA 1Q81Q 1RNIA 1NJIQ 3H47A 1VQ4P 3LMOA 2JBGA 4H2WC 1VKUA 2JB0A 3G21A 1VQNP 4R0MA 4U0DA 2M8LA 2MR8A 1BAJA 2KOSA 2JU1A 3P05A 2KODA 5HVCA 2XXMA 2JQ4A 2LIWA 2CNRA 2P9XA 2KOQA 4QNBA 5BS2A 5F2NA 3CCRP 2N5IA 4CA3A 4BPFA 1YI2P 5KP8B 1GXHA 2L4BA 1IUQA 5KP6B 2PEQA 1YIJP 2LIUA 2CQ8A 4IZ6A 4F37A 2FAEA 3CC2P 2K92A 1QVFO 4PH0A 2LPKA 2JO0A 2MY5A 4BPGA 5F2OA 2Z46A 1M1KQ 1M74A 3G1GA 1NQ4A 2PEMA 3H0DA 2VLQA 2KW2A 1K73Q 2EG5A 2L6EA 2LL8A 2BUOA 1Q7YQ 2X2BA 3RG6C 3G6EP 3WBHA 1A43A 1QVGO 7CEIA 1YJWP 2LKIA 2DGYA 1AYIA 1AF8A 2KGAA 1E0HA 5I4TG 2M8PA 1KLPA 2XV6A 5EW5E 3OW2O 1N8RQ 2FQ1A 2E1MA 1K9MQ 2N50A 2PENA 2QEXP 1A8OA 2GDWA 2KGEA 2K0DX 2BHVA 3CMAP 3NTEA 2FVAA 4BPHA 4PWVB 1KC8Q 2VSQA 5BS1A 2KR5A 3DS2A 3G29A 2L9FA 3CPWO 2MR7A 2PY8A 2PEIA 2K2QA 2KORA 3G1IA 2FACA 2Z44A 2KG6A 3B5IA 1EOQA 2ONTA 2KOPA 2KGDA 1OR5A 1DNYA 2CGQA 1K8AQ 2PEJA 3CD6P 3GZMA 2QA4P 2MVUA 2VLNA 3GJNA 1GPJA 1GXGA 2NO8A 3DPHA 3CCSP 2XZ0D 1VQOP 5HGMA 2QNWA 2OTJP 2LF4A 3CCUP 5CZDB 2PEOA 2PNGA 1MZ8A 3G28A 2K94A 2EHTA 3HYBA 2K0XA 1VQ6P 4XFZA 5EJDA 2FADA 2XT1A 2ERHA 1VQ8P 1HY8A 1VQPP 3DS0A 1YJ9P 3NY7B 2M5RA 3G4SP 3EJEA 3DS4A 2GZEA 1ACPA 1K30A 3EJBA 4U0EA 5HV8A 2MF4A 1M90Q 4COPA 1RO0A 2L0QA 2EIAA 1DV5A 2JYLA 4U0CA 2EHSA 1EMVA 4XFYA 2VLPA 1VQMP 3DS5A 3CCLP 1ZMBA 2FVEA 2AFDA 1F80D 2GZFA 1T8KA 2OARA 3U43A 3CMEP 1YHQP 2Z45A 2N6YA 3G0VA 1KD1Q 3M1MA 1M6EX 3DTJA 4QKOA 1VQLP 2K5XA 2L22A 3I56P 4GR2A 3CC4P 2PEKA 2JYGA 4PH1A 3GZLA 3EJDA 3B4QA 1L0IA 2LOLA 3CCEP 1VQ9P 4U0BA 1YJNP 1VQKP 1E6JP 2LTEA 4MRTC 4UHPB 2LMLA 2FQ2A 4HKGA 1VQ7P 1HQBA 1IMPA 4U0FA 2WPTA 3G71P 1M6NA 2FVFA 1Q86Q 2KGCA 2XZ1C 2CG5B 5HGOA 1ZNVA 1KQSO 3CE7A 4XROA 2JGPA 2KG9A 1BXIA 2N6ZA 2GDYA 3LRYA 3CCQP 5DCKA 2DNWA 2KWLA 2MD9A 2FQ0A 2GDXA 5F2KA 3CC7P 3CCMP 5HGNA 3I55P 1L0HA 4DG9A 1RO2A 3CCJP 1CEIA 2ROQA 3DS1A 1X3OA 4H2YC 3MGEA 2GZGA 2JAZA 2EFJA 2VLOA 5KP7B 2N5HA 4H2XC 1S72P 2CWOA 1UNKA 1QRJA 4U0AA 1JJ2O 4XFXA 4IPYA 1IMQA 2K0YA 2K93A 3DS3A 3GKLC 4GR6A 4PXHB 1Z6MA 2MVVA 5JPAA 2N98A 1VHNA 2JU2A 3G26A 3RG2A 2FHSC 1D1DA 4M0IA 3Q20A 1YITP
chains in the Genus database with same CATH topology
3GZLA 1NQ4A 3EJDA 1L0IA 2LOLA 2LTEA 4NEOA 4MRTC 2LMLA 2FQ2A 4HKGA 2XZ0D 1HQBA 2KW2A 2LL8A 2QNWA 2KG8A 2FVFA 2X2BA 2KGCA 2KOOA 2XZ1C 2CG5B 5CZDB 2AF8A 2LKIA 3CE7A 1AF8A 2KGAA 2PNGA 2JGPA 2AVAA 2KG9A 2AFEA 2K94A 2EHTA 2K0XA 2N6ZA 2GDYA 3LMOA 5EJDA 1KLPA 2DNWA 2FADA 4H2WC 2KWLA 2MD9A 2FQ0A 1VKUA 2GDXA 2FQ1A 1HY8A 3NY7B 2M5RA 2N50A 4R0MA 3EJEA 1L0HA 4DG9A 2GDWA 2KGEA 2MR8A 2KOSA 2JU1A 1ACPA 3EJBA 2FVAA 4BPHA 5HVCA 4PWVB 5HV8A 2VSQA 2MF4A 2JQ4A 2ROQA 2LIWA 2KR5A 1X3OA 2CNRA 2KOQA 4H2YC 2L0QA 2L9FA 1DV5A 2MR7A 2N5IA 5KP7B 2N5HA 4H2XC 2K2QA 2KORA 4CA3A 4BPFA 2FACA 5KP8B 2EHSA 2L4BA 5KP6B 2KG6A 2K0YA 2K93A 2KOPA 2KGDA 1OR5A 1DNYA 2LIUA 2FVEA 2CQ8A 2CGQA 4PXHB 2AFDA 1F80D 4IZ6A 1T8KA 2MVVA 3GZMA 2N6YA 2N98A 2JU2A 2FAEA 2K92A 3RG2A 2FHSC 2LPKA 2L22A 2MY5A 2MVUA 4BPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZL A;  1NQ4 A;  3EJD A;  1L0I A;  2LOL A;  2LTE A;  4NEO A;  4MRT C;  2LML A;  2FQ2 A;  4HKG A;  2XZ0 D;  1HQB A;  2KW2 A;  2LL8 A;  2QNW A;  2KG8 A;  2FVF A;  2X2B A;  2KGC A;  2KOO A;  2XZ1 C;  2CG5 B;  5CZD B;  2AF8 A;  2LKI A;  3CE7 A;  1AF8 A;  2KGA A;  2PNG A;  2JGP A;  2AVA A;  2KG9 A;  2AFE A;  2K94 A;  2EHT A;  2K0X A;  2N6Z A;  2GDY A;  3LMO A;  5EJD A;  1KLP A;  2DNW A;  2FAD A;  4H2W C;  2KWL A;  2MD9 A;  2FQ0 A;  1VKU A;  2GDX A;  2FQ1 A;  1HY8 A;  3NY7 B;  2M5R A;  2N50 A;  4R0M A;  3EJE A;  1L0H A;  4DG9 A;  2GDW A;  2KGE A;  2MR8 A;  2KOS A;  2JU1 A;  1ACP A;  3EJB A;  2FVA A;  4BPH A;  5HVC A;  4PWV B;  5HV8 A;  2VSQ A;  2MF4 A;  2JQ4 A;  2ROQ A;  2LIW A;  2KR5 A;  1X3O A;  2CNR A;  2KOQ A;  4H2Y C;  2L0Q A;  2L9F A;  1DV5 A;  2MR7 A;  2N5I A;  5KP7 B;  2N5H A;  4H2X C;  2K2Q A;  2KOR A;  4CA3 A;  4BPF A;  2FAC A;  5KP8 B;  2EHS A;  2L4B A;  5KP6 B;  2KG6 A;  2K0Y A;  2K93 A;  2KOP A;  2KGD A;  1OR5 A;  1DNY A;  2LIU A;  2FVE A;  2CQ8 A;  2CGQ A;  4PXH B;  2AFD A;  1F80 D;  4IZ6 A;  1T8K A;  2MVV A;  3GZM A;  2N6Y A;  2N98 A;  2JU2 A;  2FAE A;  2K92 A;  3RG2 A;  2FHS C;  2LPK A;  2L22 A;  2MY5 A;  2MVU A;  4BPG A; 
#chains in the Genus database with same CATH topology
 1VQ5 P;  4XRQ A;  1Q82 Q;  5HGL A;  1AUM A;  2GZI A;  4COC A;  4NEO A;  3H4E A;  3HZQ A;  3E2D A;  1EIA A;  2M8N A;  1UJZ A;  1W2B O;  2KG8 A;  2GYK A;  2OTL P;  4WYM A;  3CCV P;  2KOO A;  2AF8 A;  3VRL C;  3CXC O;  2AVA A;  1FR2 A;  2AFE A;  2GZJ A;  1Q81 Q;  1RNI A;  1NJI Q;  3H47 A;  1VQ4 P;  3LMO A;  2JBG A;  4H2W C;  1VKU A;  2JB0 A;  3G21 A;  1VQN P;  4R0M A;  4U0D A;  2M8L A;  2MR8 A;  1BAJ A;  2KOS A;  2JU1 A;  3P05 A;  2KOD A;  5HVC A;  2XXM A;  2JQ4 A;  2LIW A;  2CNR A;  2P9X A;  2KOQ A;  4QNB A;  5BS2 A;  5F2N A;  3CCR P;  2N5I A;  4CA3 A;  4BPF A;  1YI2 P;  5KP8 B;  1GXH A;  2L4B A;  1IUQ A;  5KP6 B;  2PEQ A;  1YIJ P;  2LIU A;  2CQ8 A;  4IZ6 A;  4F37 A;  2FAE A;  3CC2 P;  2K92 A;  1QVF O;  4PH0 A;  2LPK A;  2JO0 A;  2MY5 A;  4BPG A;  5F2O A;  2Z46 A;  1M1K Q;  1M74 A;  3G1G A;  1NQ4 A;  2PEM A;  3H0D A;  2VLQ A;  2KW2 A;  1K73 Q;  2EG5 A;  2L6E A;  2LL8 A;  2BUO A;  1Q7Y Q;  2X2B A;  3RG6 C;  3G6E P;  3WBH A;  1A43 A;  1QVG O;  7CEI A;  1YJW P;  2LKI A;  2DGY A;  1AYI A;  1AF8 A;  2KGA A;  1E0H A;  5I4T G;  2M8P A;  1KLP A;  2XV6 A;  5EW5 E;  3OW2 O;  1N8R Q;  2FQ1 A;  2E1M A;  1K9M Q;  2N50 A;  2PEN A;  2QEX P;  1A8O A;  2GDW A;  2KGE A;  2K0D X;  2BHV A;  3CMA P;  3NTE A;  2FVA A;  4BPH A;  4PWV B;  1KC8 Q;  2VSQ A;  5BS1 A;  2KR5 A;  3DS2 A;  3G29 A;  2L9F A;  3CPW O;  2MR7 A;  2PY8 A;  2PEI A;  2K2Q A;  2KOR A;  3G1I A;  2FAC A;  2Z44 A;  2KG6 A;  3B5I A;  1EOQ A;  2ONT A;  2KOP A;  2KGD A;  1OR5 A;  1DNY A;  2CGQ A;  1K8A Q;  2PEJ A;  3CD6 P;  3GZM A;  2QA4 P;  2MVU A;  2VLN A;  3GJN A;  1GPJ A;  1GXG A;  2NO8 A;  3DPH A;  3CCS P;  2XZ0 D;  1VQO P;  5HGM A;  2QNW A;  2OTJ P;  2LF4 A;  3CCU P;  5CZD B;  2PEO A;  2PNG A;  1MZ8 A;  3G28 A;  2K94 A;  2EHT A;  3HYB A;  2K0X A;  1VQ6 P;  4XFZ A;  5EJD A;  2FAD A;  2XT1 A;  2ERH A;  1VQ8 P;  1HY8 A;  1VQP P;  3DS0 A;  1YJ9 P;  3NY7 B;  2M5R A;  3G4S P;  3EJE A;  3DS4 A;  2GZE A;  1ACP A;  1K30 A;  3EJB A;  4U0E A;  5HV8 A;  2MF4 A;  1M90 Q;  4COP A;  1RO0 A;  2L0Q A;  2EIA A;  1DV5 A;  2JYL A;  4U0C A;  2EHS A;  1EMV A;  4XFY A;  2VLP A;  1VQM P;  3DS5 A;  3CCL P;  1ZMB A;  2FVE A;  2AFD A;  1F80 D;  2GZF A;  1T8K A;  2OAR A;  3U43 A;  3CME P;  1YHQ P;  2Z45 A;  2N6Y A;  3G0V A;  1KD1 Q;  3M1M A;  1M6E X;  3DTJ A;  4QKO A;  1VQL P;  2K5X A;  2L22 A;  3I56 P;  4GR2 A;  3CC4 P;  2PEK A;  2JYG A;  4PH1 A;  3GZL A;  3EJD A;  3B4Q A;  1L0I A;  2LOL A;  3CCE P;  1VQ9 P;  4U0B A;  1YJN P;  1VQK P;  1E6J P;  2LTE A;  4MRT C;  4UHP B;  2LML A;  2FQ2 A;  4HKG A;  1VQ7 P;  1HQB A;  1IMP A;  4U0F A;  2WPT A;  3G71 P;  1M6N A;  2FVF A;  1Q86 Q;  2KGC A;  2XZ1 C;  2CG5 B;  5HGO A;  1ZNV A;  1KQS O;  3CE7 A;  4XRO A;  2JGP A;  2KG9 A;  1BXI A;  2N6Z A;  2GDY A;  3LRY A;  3CCQ P;  5DCK A;  2DNW A;  2KWL A;  2MD9 A;  2FQ0 A;  2GDX A;  5F2K A;  3CC7 P;  3CCM P;  5HGN A;  3I55 P;  1L0H A;  4DG9 A;  1RO2 A;  3CCJ P;  1CEI A;  2ROQ A;  3DS1 A;  1X3O A;  4H2Y C;  3MGE A;  2GZG A;  2JAZ A;  2EFJ A;  2VLO A;  5KP7 B;  2N5H A;  4H2X C;  1S72 P;  2CWO A;  1UNK A;  1QRJ A;  4U0A A;  1JJ2 O;  4XFX A;  4IPY A;  1IMQ A;  2K0Y A;  2K93 A;  3DS3 A;  3GKL C;  4GR6 A;  4PXH B;  1Z6M A;  2MVV A;  5JPA A;  2N98 A;  1VHN A;  2JU2 A;  3G26 A;  3RG2 A;  2FHS C;  1D1D A;  4M0I A;  3Q20 A;  1YIT P; 
#chains in the Genus database with same CATH homology
 3GZL A;  1NQ4 A;  3EJD A;  1L0I A;  2LOL A;  2LTE A;  4NEO A;  4MRT C;  2LML A;  2FQ2 A;  4HKG A;  2XZ0 D;  1HQB A;  2KW2 A;  2LL8 A;  2QNW A;  2KG8 A;  2FVF A;  2X2B A;  2KGC A;  2KOO A;  2XZ1 C;  2CG5 B;  5CZD B;  2AF8 A;  2LKI A;  3CE7 A;  1AF8 A;  2KGA A;  2PNG A;  2JGP A;  2AVA A;  2KG9 A;  2AFE A;  2K94 A;  2EHT A;  2K0X A;  2N6Z A;  2GDY A;  3LMO A;  5EJD A;  1KLP A;  2DNW A;  2FAD A;  4H2W C;  2KWL A;  2MD9 A;  2FQ0 A;  1VKU A;  2GDX A;  2FQ1 A;  1HY8 A;  3NY7 B;  2M5R A;  2N50 A;  4R0M A;  3EJE A;  1L0H A;  4DG9 A;  2GDW A;  2KGE A;  2MR8 A;  2KOS A;  2JU1 A;  1ACP A;  3EJB A;  2FVA A;  4BPH A;  5HVC A;  4PWV B;  5HV8 A;  2VSQ A;  2MF4 A;  2JQ4 A;  2ROQ A;  2LIW A;  2KR5 A;  1X3O A;  2CNR A;  2KOQ A;  4H2Y C;  2L0Q A;  2L9F A;  1DV5 A;  2MR7 A;  2N5I A;  5KP7 B;  2N5H A;  4H2X C;  2K2Q A;  2KOR A;  4CA3 A;  4BPF A;  2FAC A;  5KP8 B;  2EHS A;  2L4B A;  5KP6 B;  2KG6 A;  2K0Y A;  2K93 A;  2KOP A;  2KGD A;  1OR5 A;  1DNY A;  2LIU A;  2FVE A;  2CQ8 A;  2CGQ A;  4PXH B;  2AFD A;  1F80 D;  4IZ6 A;  1T8K A;  2MVV A;  3GZM A;  2N6Y A;  2N98 A;  2JU2 A;  2FAE A;  2K92 A;  3RG2 A;  2FHS C;  2LPK A;  2L22 A;  2MY5 A;  2MVU A;  4BPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...