2N98A

Solution structure of acyl carrier protein lipd from actinoplanes friuliensis
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
b'GHMSDLSTAPTLDSLRVWLVDCVAGHLGLDAATIATDLPLTSYGLDSVYALSIAAELEDHLDVSLDPTLIWDHPTIDALSTALVAELRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural and dynamic characterization of a freestanding acyl carrier protein involved in the biosynthesis of cyclic lipopeptide antibiotics.
pubmed doi rcsb
source organism Actinoplanes friuliensis
molecule tags Transport protein
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n98A00
4R0MA 2JQ4A 2MY5A 3EJBA 2N6YA 2FQ2A 4HKGA 3NY7B 2KG6A 1NQ4A 2MR7A 2K93A 4MRTC 2KGEA 2N50A 2LL8A 4H2XC 2AFDA 2FAEA 1VKUA 2AVAA 4NEOA 3EJEA 2FQ0A 4BPHA 5KP8B 2JU2A 2KGAA 2EHTA 2N5HA 5KP7B 2FQ1A 4PWVB 2CQ8A 2LIUA 2KGCA 2M5RA 4H2WC 1T8KA 2LMLA 2N5IA 1L0HA 4CA3A 2KG9A 2GDWA 1HY8A 1L0IA 2ROQA 5HVCA 2KOPA 2L22A 1AF8A 1OR5A 2MVUA 2PNGA 5CZDB 2K2QA 2LOLA 2LPKA 2DNWA 3EJDA 2KG8A 1DV5A 4IZ6A 2CG5B 2GDXA 2LKIA 3GZMA 4H2YC 2XZ1C 2FVFA 2FVEA 2CGQA 1KLPA 3LMOA 2N98A 2CNRA 4BPGA 1DNYA 3GZLA 2FADA 2MVVA 2MR8A 2K94A 4PXHB 2AFEA 2L0QA 2KOSA 3RG2A 2AF8A 2VSQA 2L4BA 2KR5A 2KW2A 5HV8A 2K92A 1F80D 2FACA 2KGDA 4BPFA 2K0XA 2K0YA 2QNWA 1HQBA 2JU1A 5KP6B 2MD9A 2FHSC 2KOOA 2KORA 2XZ0D 1ACPA 1X3OA 2GDYA 2N6ZA 2LIWA 2KOQA 2X2BA 2MF4A 2LTEA 4DG9A 3CE7A 5EJDA 2KWLA 2EHSA 2FVAA 2L9FA 2JGPA
chains in the Genus database with same CATH superfamily
4GR6A 2MY5A 4U0CA 2BHVA 2P9XA 2GZJA 1YI2P 5HGMA 2KGEA 2XV6A 4H2XC 2PEOA 1QRJA 2K0DX 2JBGA 1M6NA 4XFYA 5KP8B 3DS5A 1YJ9P 2PY8A 2XT1A 2QA4P 1VQ8P 3G6EP 2KGCA 1A43A 2GZGA 1IMPA 2PEJA 1K30A 2PEIA 3CCLP 3I56P 1OR5A 2MVUA 3EJDA 1EIAA 1RO0A 1VQMP 1VQ4P 3H4EA 3B4QA 2CGQA 2JYLA 4U0BA 1KLPA 1KC8Q 2Z44A 2CNRA 4BPGA 1DNYA 2DGYA 2JO0A 1FR2A 1NJIQ 5HGOA 4F37A 4U0AA 1UJZA 2LF4A 2MR8A 3MGEA 2L0QA 1K8AQ 2AF8A 2VSQA 2OTLP 5HGLA 2KW2A 5HV8A 1F80D 4BPFA 2MD9A 2FHSC 4XRQA 1X3OA 2GDYA 3CCMP 2LIWA 4XFZA 2KWLA 2EHSA 2L9FA 2PEQA 1CEIA 4R0MA 2GZEA 4COCA 1MZ8A 1VQLP 2GYKA 3DTJA 5I4TG 2MR7A 2K93A 2LL8A 2FAEA 2VLPA 1M6EX 3EJEA 3DS2A 4BPHA 1S72P 1VQ9P 5KP7B 2FQ1A 3CC4P 2GZIA 2LIUA 2VLNA 1T8KA 2N5IA 1L0HA 1QVFO 3CCUP 2KG9A 3G71P 3GJNA 3NTEA 2M8LA 1BXIA 3G1IA 1GXGA 1Q7YQ 2Z46A 1VHNA 3CC7P 1UNKA 1M74A 2QEXP 2GDXA 2LKIA 3H47A 3OW2O 4H2YC 3G29A 2JYGA 4COPA 2GZFA 1BAJA 3CCQP 2M8NA 3DS0A 2FADA 3CCSP 2JAZA 3I55P 2MVVA 3HZQA 1JJ2O 2L4BA 2Z45A 1EMVA 2K92A 2K0YA 3CD6P 1Z6MA 1KQSO 2KOOA 2XZ0D 2ERHA 2PEMA 4PH1A 2MF4A 4DG9A 2PENA 2L6EA 2JGPA 1ZNVA 2XXMA 2PEKA 4WYMA 3DS1A 3EJBA 2N6YA 4GR2A 4IPYA 3G0VA 2FQ2A 3GKLC 4HKGA 2JB0A 2ONTA 3P05A 1K9MQ 2AFDA 1W2BO 1M90Q 4QNBA 1YIJP 4M0IA 4NEOA 1RO2A 1E0HA 1Q86Q 2JU2A 3CMEP 2EHTA 2N5HA 4PWVB 4U0EA 1D1DA 2K5XA 1VQNP 4H2WC 1IMQA 3M1MA 1KD1Q 3B5IA 2EG5A 2GDWA 1HY8A 1L0IA 5HVCA 1AUMA 1AYIA 2KOPA 2PNGA 2OTJP 5CZDB 3DS4A 1YJNP 1QVGO 2LPKA 1RNIA 5DCKA 2KG8A 1VQOP 1VQPP 2CWOA 2CG5B 3RG6C 2XZ1C 2FVFA 2FVEA 1VQ6P 3LMOA 3HYBA 3CCRP 3G1GA 3G4SP 4PH0A 4PXHB 2AFEA 1M1KQ 2KOSA 5F2KA 3RG2A 3DPHA 3CCEP 2KR5A 1E6JP 2KGDA 2QNWA 1HQBA 5EW5E 1VQ7P 5F2OA 2NO8A 2KORA 1ACPA 2N6ZA 2LTEA 1YHQP 1GXHA 5EJDA 4UHPB 2EIAA 2JQ4A 1EOQA 3LRYA 2M8PA 1ZMBA 4QKOA 3NY7B 1N8RQ 2KG6A 1NQ4A 2BUOA 4MRTC 2N50A 1IUQA 3E2DA 1VKUA 1GPJA 2WPTA 2EFJA 2AVAA 1VQ5P 2FQ0A 3DS3A 2VLQA 2E1MA 2KGAA 3WBHA 3U43A 4XROA 3CPWO 2CQ8A 2M5RA 1YITP 2LMLA 4CA3A 2OARA 1Q82Q 2ROQA 2L22A 4U0DA 1AF8A 3H0DA 3CCVP 3G28A 5BS2A 2K2QA 2LOLA 2DNWA 3G21A 1Q81Q 1K73Q 1DV5A 2KODA 4IZ6A 3GZMA 3G26A 1A8OA 5BS1A 7CEIA 3CXCO 2N98A 4XFXA 1VQKP 3GZLA 5JPAA 5F2NA 5HGNA 2K94A 3CCJP 3CC2P 2VLOA 1YJWP 2FACA 2K0XA 3VRLC 2JU1A 5KP6B 4U0FA 3Q20A 2KOQA 2X2BA 3CMAP 3CE7A 2FVAA
chains in the Genus database with same CATH topology
4R0MA 2JQ4A 2MY5A 3EJBA 2N6YA 2FQ2A 4HKGA 3NY7B 2KG6A 1NQ4A 2MR7A 2K93A 4MRTC 2KGEA 2N50A 2LL8A 4H2XC 2AFDA 2FAEA 1VKUA 2AVAA 4NEOA 3EJEA 2FQ0A 4BPHA 5KP8B 2JU2A 2KGAA 2EHTA 2N5HA 5KP7B 2FQ1A 4PWVB 2CQ8A 2LIUA 2KGCA 2M5RA 4H2WC 1T8KA 2LMLA 2N5IA 1L0HA 4CA3A 2KG9A 2GDWA 1HY8A 1L0IA 2ROQA 5HVCA 2KOPA 2L22A 1AF8A 1OR5A 2MVUA 2PNGA 5CZDB 2K2QA 2LOLA 2LPKA 2DNWA 3EJDA 2KG8A 1DV5A 4IZ6A 2CG5B 2GDXA 2LKIA 3GZMA 4H2YC 2XZ1C 2FVFA 2FVEA 2CGQA 1KLPA 3LMOA 2N98A 2CNRA 4BPGA 1DNYA 3GZLA 2FADA 2MVVA 2MR8A 2K94A 4PXHB 2AFEA 2L0QA 2KOSA 3RG2A 2AF8A 2VSQA 2L4BA 2KR5A 2KW2A 5HV8A 2K92A 1F80D 2FACA 2KGDA 4BPFA 2K0XA 2K0YA 2QNWA 1HQBA 2JU1A 5KP6B 2MD9A 2FHSC 2KOOA 2KORA 2XZ0D 1ACPA 1X3OA 2GDYA 2N6ZA 2LIWA 2KOQA 2X2BA 2MF4A 2LTEA 4DG9A 3CE7A 5EJDA 2KWLA 2EHSA 2FVAA 2L9FA 2JGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0M A;  2JQ4 A;  2MY5 A;  3EJB A;  2N6Y A;  2FQ2 A;  4HKG A;  3NY7 B;  2KG6 A;  1NQ4 A;  2MR7 A;  2K93 A;  4MRT C;  2KGE A;  2N50 A;  2LL8 A;  4H2X C;  2AFD A;  2FAE A;  1VKU A;  2AVA A;  4NEO A;  3EJE A;  2FQ0 A;  4BPH A;  5KP8 B;  2JU2 A;  2KGA A;  2EHT A;  2N5H A;  5KP7 B;  2FQ1 A;  4PWV B;  2CQ8 A;  2LIU A;  2KGC A;  2M5R A;  4H2W C;  1T8K A;  2LML A;  2N5I A;  1L0H A;  4CA3 A;  2KG9 A;  2GDW A;  1HY8 A;  1L0I A;  2ROQ A;  5HVC A;  2KOP A;  2L22 A;  1AF8 A;  1OR5 A;  2MVU A;  2PNG A;  5CZD B;  2K2Q A;  2LOL A;  2LPK A;  2DNW A;  3EJD A;  2KG8 A;  1DV5 A;  4IZ6 A;  2CG5 B;  2GDX A;  2LKI A;  3GZM A;  4H2Y C;  2XZ1 C;  2FVF A;  2FVE A;  2CGQ A;  1KLP A;  3LMO A;  2N98 A;  2CNR A;  4BPG A;  1DNY A;  3GZL A;  2FAD A;  2MVV A;  2MR8 A;  2K94 A;  4PXH B;  2AFE A;  2L0Q A;  2KOS A;  3RG2 A;  2AF8 A;  2VSQ A;  2L4B A;  2KR5 A;  2KW2 A;  5HV8 A;  2K92 A;  1F80 D;  2FAC A;  2KGD A;  4BPF A;  2K0X A;  2K0Y A;  2QNW A;  1HQB A;  2JU1 A;  5KP6 B;  2MD9 A;  2FHS C;  2KOO A;  2KOR A;  2XZ0 D;  1ACP A;  1X3O A;  2GDY A;  2N6Z A;  2LIW A;  2KOQ A;  2X2B A;  2MF4 A;  2LTE A;  4DG9 A;  3CE7 A;  5EJD A;  2KWL A;  2EHS A;  2FVA A;  2L9F A;  2JGP A; 
#chains in the Genus database with same CATH topology
 4GR6 A;  2MY5 A;  4U0C A;  2BHV A;  2P9X A;  2GZJ A;  1YI2 P;  5HGM A;  2KGE A;  2XV6 A;  4H2X C;  2PEO A;  1QRJ A;  2K0D X;  2JBG A;  1M6N A;  4XFY A;  5KP8 B;  3DS5 A;  1YJ9 P;  2PY8 A;  2XT1 A;  2QA4 P;  1VQ8 P;  3G6E P;  2KGC A;  1A43 A;  2GZG A;  1IMP A;  2PEJ A;  1K30 A;  2PEI A;  3CCL P;  3I56 P;  1OR5 A;  2MVU A;  3EJD A;  1EIA A;  1RO0 A;  1VQM P;  1VQ4 P;  3H4E A;  3B4Q A;  2CGQ A;  2JYL A;  4U0B A;  1KLP A;  1KC8 Q;  2Z44 A;  2CNR A;  4BPG A;  1DNY A;  2DGY A;  2JO0 A;  1FR2 A;  1NJI Q;  5HGO A;  4F37 A;  4U0A A;  1UJZ A;  2LF4 A;  2MR8 A;  3MGE A;  2L0Q A;  1K8A Q;  2AF8 A;  2VSQ A;  2OTL P;  5HGL A;  2KW2 A;  5HV8 A;  1F80 D;  4BPF A;  2MD9 A;  2FHS C;  4XRQ A;  1X3O A;  2GDY A;  3CCM P;  2LIW A;  4XFZ A;  2KWL A;  2EHS A;  2L9F A;  2PEQ A;  1CEI A;  4R0M A;  2GZE A;  4COC A;  1MZ8 A;  1VQL P;  2GYK A;  3DTJ A;  5I4T G;  2MR7 A;  2K93 A;  2LL8 A;  2FAE A;  2VLP A;  1M6E X;  3EJE A;  3DS2 A;  4BPH A;  1S72 P;  1VQ9 P;  5KP7 B;  2FQ1 A;  3CC4 P;  2GZI A;  2LIU A;  2VLN A;  1T8K A;  2N5I A;  1L0H A;  1QVF O;  3CCU P;  2KG9 A;  3G71 P;  3GJN A;  3NTE A;  2M8L A;  1BXI A;  3G1I A;  1GXG A;  1Q7Y Q;  2Z46 A;  1VHN A;  3CC7 P;  1UNK A;  1M74 A;  2QEX P;  2GDX A;  2LKI A;  3H47 A;  3OW2 O;  4H2Y C;  3G29 A;  2JYG A;  4COP A;  2GZF A;  1BAJ A;  3CCQ P;  2M8N A;  3DS0 A;  2FAD A;  3CCS P;  2JAZ A;  3I55 P;  2MVV A;  3HZQ A;  1JJ2 O;  2L4B A;  2Z45 A;  1EMV A;  2K92 A;  2K0Y A;  3CD6 P;  1Z6M A;  1KQS O;  2KOO A;  2XZ0 D;  2ERH A;  2PEM A;  4PH1 A;  2MF4 A;  4DG9 A;  2PEN A;  2L6E A;  2JGP A;  1ZNV A;  2XXM A;  2PEK A;  4WYM A;  3DS1 A;  3EJB A;  2N6Y A;  4GR2 A;  4IPY A;  3G0V A;  2FQ2 A;  3GKL C;  4HKG A;  2JB0 A;  2ONT A;  3P05 A;  1K9M Q;  2AFD A;  1W2B O;  1M90 Q;  4QNB A;  1YIJ P;  4M0I A;  4NEO A;  1RO2 A;  1E0H A;  1Q86 Q;  2JU2 A;  3CME P;  2EHT A;  2N5H A;  4PWV B;  4U0E A;  1D1D A;  2K5X A;  1VQN P;  4H2W C;  1IMQ A;  3M1M A;  1KD1 Q;  3B5I A;  2EG5 A;  2GDW A;  1HY8 A;  1L0I A;  5HVC A;  1AUM A;  1AYI A;  2KOP A;  2PNG A;  2OTJ P;  5CZD B;  3DS4 A;  1YJN P;  1QVG O;  2LPK A;  1RNI A;  5DCK A;  2KG8 A;  1VQO P;  1VQP P;  2CWO A;  2CG5 B;  3RG6 C;  2XZ1 C;  2FVF A;  2FVE A;  1VQ6 P;  3LMO A;  3HYB A;  3CCR P;  3G1G A;  3G4S P;  4PH0 A;  4PXH B;  2AFE A;  1M1K Q;  2KOS A;  5F2K A;  3RG2 A;  3DPH A;  3CCE P;  2KR5 A;  1E6J P;  2KGD A;  2QNW A;  1HQB A;  5EW5 E;  1VQ7 P;  5F2O A;  2NO8 A;  2KOR A;  1ACP A;  2N6Z A;  2LTE A;  1YHQ P;  1GXH A;  5EJD A;  4UHP B;  2EIA A;  2JQ4 A;  1EOQ A;  3LRY A;  2M8P A;  1ZMB A;  4QKO A;  3NY7 B;  1N8R Q;  2KG6 A;  1NQ4 A;  2BUO A;  4MRT C;  2N50 A;  1IUQ A;  3E2D A;  1VKU A;  1GPJ A;  2WPT A;  2EFJ A;  2AVA A;  1VQ5 P;  2FQ0 A;  3DS3 A;  2VLQ A;  2E1M A;  2KGA A;  3WBH A;  3U43 A;  4XRO A;  3CPW O;  2CQ8 A;  2M5R A;  1YIT P;  2LML A;  4CA3 A;  2OAR A;  1Q82 Q;  2ROQ A;  2L22 A;  4U0D A;  1AF8 A;  3H0D A;  3CCV P;  3G28 A;  5BS2 A;  2K2Q A;  2LOL A;  2DNW A;  3G21 A;  1Q81 Q;  1K73 Q;  1DV5 A;  2KOD A;  4IZ6 A;  3GZM A;  3G26 A;  1A8O A;  5BS1 A;  7CEI A;  3CXC O;  2N98 A;  4XFX A;  1VQK P;  3GZL A;  5JPA A;  5F2N A;  5HGN A;  2K94 A;  3CCJ P;  3CC2 P;  2VLO A;  1YJW P;  2FAC A;  2K0X A;  3VRL C;  2JU1 A;  5KP6 B;  4U0F A;  3Q20 A;  2KOQ A;  2X2B A;  3CMA P;  3CE7 A;  2FVA A; 
#chains in the Genus database with same CATH homology
 4R0M A;  2JQ4 A;  2MY5 A;  3EJB A;  2N6Y A;  2FQ2 A;  4HKG A;  3NY7 B;  2KG6 A;  1NQ4 A;  2MR7 A;  2K93 A;  4MRT C;  2KGE A;  2N50 A;  2LL8 A;  4H2X C;  2AFD A;  2FAE A;  1VKU A;  2AVA A;  4NEO A;  3EJE A;  2FQ0 A;  4BPH A;  5KP8 B;  2JU2 A;  2KGA A;  2EHT A;  2N5H A;  5KP7 B;  2FQ1 A;  4PWV B;  2CQ8 A;  2LIU A;  2KGC A;  2M5R A;  4H2W C;  1T8K A;  2LML A;  2N5I A;  1L0H A;  4CA3 A;  2KG9 A;  2GDW A;  1HY8 A;  1L0I A;  2ROQ A;  5HVC A;  2KOP A;  2L22 A;  1AF8 A;  1OR5 A;  2MVU A;  2PNG A;  5CZD B;  2K2Q A;  2LOL A;  2LPK A;  2DNW A;  3EJD A;  2KG8 A;  1DV5 A;  4IZ6 A;  2CG5 B;  2GDX A;  2LKI A;  3GZM A;  4H2Y C;  2XZ1 C;  2FVF A;  2FVE A;  2CGQ A;  1KLP A;  3LMO A;  2N98 A;  2CNR A;  4BPG A;  1DNY A;  3GZL A;  2FAD A;  2MVV A;  2MR8 A;  2K94 A;  4PXH B;  2AFE A;  2L0Q A;  2KOS A;  3RG2 A;  2AF8 A;  2VSQ A;  2L4B A;  2KR5 A;  2KW2 A;  5HV8 A;  2K92 A;  1F80 D;  2FAC A;  2KGD A;  4BPF A;  2K0X A;  2K0Y A;  2QNW A;  1HQB A;  2JU1 A;  5KP6 B;  2MD9 A;  2FHS C;  2KOO A;  2KOR A;  2XZ0 D;  1ACP A;  1X3O A;  2GDY A;  2N6Z A;  2LIW A;  2KOQ A;  2X2B A;  2MF4 A;  2LTE A;  4DG9 A;  3CE7 A;  5EJD A;  2KWL A;  2EHS A;  2FVA A;  2L9F A;  2JGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...