2L6EA

Nmr structure of the monomeric mutant c-terminal domain of hiv-1 capsid in complex with stapled peptide inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
94
structure length
94
Chain Sequence
SGLVPRGSHMTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of a hydrocarbon stapled peptide inhibitor in complex with monomeric C-terminal domain of HIV-1 capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/inhibitor
molecule keywords Capsid protein p24
total genus 28
structure length 94
sequence length 94
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2l6eA00
2M8PA 4XRQA 3H47A 4U0FA 1EIAA 4XROA 3VRLC 4U0AA 4COCA 1D1DA 1A43A 1EOQA 2LF4A 3DS1A 1E6JP 4XFYA 5DCKA 2L6EA 3G1IA 4QNBA 3DPHA 2JYGA 2XXMA 3DTJA 2EIAA 3G0VA 3G1GA 3LRYA 3NTEA 2M8LA 3G28A 2KODA 4U0CA 1A8OA 1BAJA 1AUMA 4XFXA 5HGMA 5I4TG 2JYLA 3DS3A 3MGEA 3P05A 4IPYA 4COPA 2M8NA 3DS5A 5HGNA 2JO0A 3DS0A 4U0BA 3G21A 2XT1A 4WYMA 4PH0A 3DS4A 3G29A 2XV6A 5JPAA 4U0EA 5HGLA 2ONTA 4M0IA 5HGOA 2BUOA 3DS2A 4U0DA 4PH1A 4XFZA 3H4EA 3G26A 1QRJA
chains in the Genus database with same CATH superfamily
1FR2A 4XROA 1VQMP 2KR5A 1RO0A 3CMAP 3H0DA 1VQ4P 2MF4A 2KGEA 5EW5E 2PENA 2GZIA 4COPA 2KG6A 4PH0A 1KQSO 2K5XA 2EHTA 1VQKP 1JJ2O 1W2BO 3GZMA 2MR8A 3HYBA 2ERHA 3U43A 2DGYA 3I56P 2GZFA 3EJDA 1YJWP 2PEKA 4U0CA 3CC7P 2MD9A 3B4QA 2FAEA 3CCSP 3G21A 2K2QA 1UJZA 3EJEA 3GKLC 4U0EA 1ACPA 1KD1Q 3B5IA 2N6YA 2M5RA 1VQ9P 2K94A 1AF8A 3G28A 1A8OA 5KP6B 2KOPA 1VKUA 2AF8A 5BS2A 2MVVA 4WYMA 2FVAA 1M1KQ 2GDWA 1ZNVA 1K9MQ 3CCVP 2M8PA 3CC4P 2JB0A 1S72P 2K0DX 2L6EA 2JGPA 3DPHA 1CEIA 4DG9A 2LOLA 3G6EP 1E0HA 3CC2P 2FQ1A 2LPKA 2LMLA 4U0DA 2KOQA 2L0QA 1YITP 2KGAA 2GZGA 7CEIA 3VRLC 1BAJA 5HV8A 2FVFA 1N8RQ 2PEJA 2XT1A 1M6NA 1NJIQ 4M0IA 2BUOA 2N98A 3G26A 1BXIA 2JU2A 1RNIA 2N5HA 1L0HA 2VLNA 1DNYA 1X3OA 4IZ6A 2QA4P 2JYLA 2PEMA 2JO0A 3CMEP 5F2OA 2LTEA 4H2XC 2FACA 2AFEA 2N5IA 2N50A 2LL8A 4COCA 2EHSA 2XZ0D 5CZDB 4F37A 2K0XA 2OARA 4QNBA 1GPJA 3E2DA 1GXGA 3DS3A 5HGNA 4H2WC 2MY5A 3WBHA 1YIJP 4CA3A 2L4BA 1VQ7P 2GZJA 3HZQA 1D1DA 2AFDA 1A43A 2PNGA 2FADA 4XFYA 4BPFA 3Q20A 5KP7B 3CCEP 5F2NA 2Z45A 3EJBA 1YHQP 2WPTA 2CWOA 2VLPA 3CCQP 1K8AQ 2KOSA 4U0FA 2FHSC 2P9XA 3CCRP 1YJNP 2MVUA 2LF4A 2JYGA 2PEOA 2PY8A 2EG5A 2QEXP 2FQ2A 2XZ1C 2M8NA 3CCMP 3DS4A 4PXHB 1QVFO 3GZLA 2ONTA 1VQPP 4QKOA 3CCLP 2K93A 1M6EX 3CCJP 2PEIA 3DTJA 2EIAA 1VQ6P 1MZ8A 1T8KA 5JPAA 1Q7YQ 1M74A 3NY7B 2BHVA 3CE7A 2AVAA 3G4SP 3H47A 4NEOA 2CG5B 1RO2A 2KG9A 2LKIA 1YJ9P 3DS1A 5KP8B 1KLPA 1VQLP 1OR5A 1ZMBA 1GXHA 3DS0A 2KGCA 3CD6P 4MRTC 5F2KA 1EMVA 3RG6C 2KOOA 2X2BA 1K30A 2EFJA 1UNKA 1EOQA 2M8LA 1AYIA 2XXMA 1Q81Q 3G1GA 1VHNA 1KC8Q 2KODA 1YI2P 1Z6MA 2KW2A 3LMOA 1QVGO 2CQ8A 1HY8A 2DNWA 4PH1A 2JU1A 1QRJA 1IMPA 1EIAA 2LIWA 1IMQA 1HQBA 3CXCO 5BS1A 2JAZA 4UHPB 2OTLP 3MGEA 3P05A 4U0BA 2VSQA 3G29A 1Q86Q 2Z44A 5HGLA 2PEQA 2VLQA 2KORA 5EJDA 4BPGA 2MR7A 4GR2A 4R0MA 2L9FA 5DCKA 3G1IA 3I55P 2CNRA 3CCUP 2FVEA 1AUMA 2CGQA 2K0YA 2N6ZA 2Z46A 3OW2O 4H2YC 4HKGA 2FQ0A 2XV6A 2VLOA 5HGOA 3DS2A 2JBGA 2LIUA 3GJNA 1NQ4A 2L22A 1DV5A 2QNWA 2ROQA 2KWLA 4U0AA 4BPHA 2OTJP 3M1MA 3G0VA 4PWVB 1L0IA 1IUQA 4XFXA 5HGMA 2E1MA 4GR6A 2JQ4A 2GDXA 1VQNP 1K73Q 2KGDA 3LRYA 4XRQA 2KG8A 1VQ5P 2GZEA 2NO8A 2K92A 1E6JP 1M90Q 5HVCA 3NTEA 5I4TG 2GDYA 4IPYA 3DS5A 1VQOP 1VQ8P 2GYKA 3RG2A 3CPWO 3G71P 1F80D 1Q82Q 4XFZA 3H4EA
chains in the Genus database with same CATH topology
4U0FA 1EIAA 2P9XA 4XROA 3CCRP 1VQMP 1YITP 1YJNP 1RO0A 3CMAP 2LF4A 3H0DA 1VQ4P 3CXCO 5BS1A 2PENA 2JYGA 3VRLC 2PEOA 2PY8A 2EG5A 2QEXP 1BAJA 2OTLP 3MGEA 3P05A 4COPA 2M8NA 4U0BA 1N8RQ 2PEJA 2XT1A 4PH0A 3DS4A 3G29A 1M6NA 3CCMP 1Q86Q 1KQSO 2Z44A 1QVFO 5HGLA 2PEQA 2ONTA 4M0IA 1QRJA 2BUOA 1NJIQ 1VQKP 1JJ2O 1W2BO 1VQPP 3G26A 3CCLP 3HYBA 1M6EX 3CCJP 4GR2A 1RNIA 2DGYA 3I56P 1YJWP 2PEIA 5DCKA 3G1IA 3DTJA 2EIAA 3I55P 3CCUP 1VQ6P 2PEKA 4U0CA 3CC7P 1AUMA 2Z46A 2QA4P 2JYLA 2PEMA 5JPAA 3OW2O 3CCSP 2JO0A 3CMEP 5F2OA 3G21A 1Q7YQ 2XV6A 1M74A 5HGOA 3DS2A 2BHVA 4U0EA 3G4SP 1KD1Q 3H47A 3B5IA 4U0AA 4COCA 1RO2A 1YJ9P 1VQ9P 3DS1A 2OARA 2OTJP 4QNBA 3M1MA 1VQLP 3G0VA 3E2DA 3G28A 1A8OA 1IUQA 1ZMBA 4XFXA 5HGMA 3DS3A 2E1MA 5HGNA 3DS0A 5BS2A 4WYMA 4GR6A 3CD6P 1M1KQ 5F2KA 3WBHA 1VQNP 1K73Q 1YIJP 1K9MQ 3CCVP 3RG6C 3LRYA 2M8PA 3CC4P 4XRQA 1VQ5P 1VQ7P 1S72P 3HZQA 1D1DA 1K30A 2EFJA 1A43A 1EOQA 1E6JP 1M90Q 4XFYA 2L6EA 3DPHA 2M8LA 2XXMA 3NTEA 3G1GA 1Q81Q 1KC8Q 3G6EP 2KODA 1YI2P 3Q20A 5I4TG 5F2NA 3CCEP 4IPYA 3DS5A 1VQOP 2Z45A 1VQ8P 3CC2P 1YHQP 1QVGO 3CPWO 2CWOA 3G71P 1Q82Q 4U0DA 3CCQP 4PH1A 4XFZA 1K8AQ 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8P A;  4XRQ A;  3H47 A;  4U0F A;  1EIA A;  4XRO A;  3VRL C;  4U0A A;  4COC A;  1D1D A;  1A43 A;  1EOQ A;  2LF4 A;  3DS1 A;  1E6J P;  4XFY A;  5DCK A;  2L6E A;  3G1I A;  4QNB A;  3DPH A;  2JYG A;  2XXM A;  3DTJ A;  2EIA A;  3G0V A;  3G1G A;  3LRY A;  3NTE A;  2M8L A;  3G28 A;  2KOD A;  4U0C A;  1A8O A;  1BAJ A;  1AUM A;  4XFX A;  5HGM A;  5I4T G;  2JYL A;  3DS3 A;  3MGE A;  3P05 A;  4IPY A;  4COP A;  2M8N A;  3DS5 A;  5HGN A;  2JO0 A;  3DS0 A;  4U0B A;  3G21 A;  2XT1 A;  4WYM A;  4PH0 A;  3DS4 A;  3G29 A;  2XV6 A;  5JPA A;  4U0E A;  5HGL A;  2ONT A;  4M0I A;  5HGO A;  2BUO A;  3DS2 A;  4U0D A;  4PH1 A;  4XFZ A;  3H4E A;  3G26 A;  1QRJ A; 
#chains in the Genus database with same CATH topology
 1FR2 A;  4XRO A;  1VQM P;  2KR5 A;  1RO0 A;  3CMA P;  3H0D A;  1VQ4 P;  2MF4 A;  2KGE A;  5EW5 E;  2PEN A;  2GZI A;  4COP A;  2KG6 A;  4PH0 A;  1KQS O;  2K5X A;  2EHT A;  1VQK P;  1JJ2 O;  1W2B O;  3GZM A;  2MR8 A;  3HYB A;  2ERH A;  3U43 A;  2DGY A;  3I56 P;  2GZF A;  3EJD A;  1YJW P;  2PEK A;  4U0C A;  3CC7 P;  2MD9 A;  3B4Q A;  2FAE A;  3CCS P;  3G21 A;  2K2Q A;  1UJZ A;  3EJE A;  3GKL C;  4U0E A;  1ACP A;  1KD1 Q;  3B5I A;  2N6Y A;  2M5R A;  1VQ9 P;  2K94 A;  1AF8 A;  3G28 A;  1A8O A;  5KP6 B;  2KOP A;  1VKU A;  2AF8 A;  5BS2 A;  2MVV A;  4WYM A;  2FVA A;  1M1K Q;  2GDW A;  1ZNV A;  1K9M Q;  3CCV P;  2M8P A;  3CC4 P;  2JB0 A;  1S72 P;  2K0D X;  2L6E A;  2JGP A;  3DPH A;  1CEI A;  4DG9 A;  2LOL A;  3G6E P;  1E0H A;  3CC2 P;  2FQ1 A;  2LPK A;  2LML A;  4U0D A;  2KOQ A;  2L0Q A;  1YIT P;  2KGA A;  2GZG A;  7CEI A;  3VRL C;  1BAJ A;  5HV8 A;  2FVF A;  1N8R Q;  2PEJ A;  2XT1 A;  1M6N A;  1NJI Q;  4M0I A;  2BUO A;  2N98 A;  3G26 A;  1BXI A;  2JU2 A;  1RNI A;  2N5H A;  1L0H A;  2VLN A;  1DNY A;  1X3O A;  4IZ6 A;  2QA4 P;  2JYL A;  2PEM A;  2JO0 A;  3CME P;  5F2O A;  2LTE A;  4H2X C;  2FAC A;  2AFE A;  2N5I A;  2N50 A;  2LL8 A;  4COC A;  2EHS A;  2XZ0 D;  5CZD B;  4F37 A;  2K0X A;  2OAR A;  4QNB A;  1GPJ A;  3E2D A;  1GXG A;  3DS3 A;  5HGN A;  4H2W C;  2MY5 A;  3WBH A;  1YIJ P;  4CA3 A;  2L4B A;  1VQ7 P;  2GZJ A;  3HZQ A;  1D1D A;  2AFD A;  1A43 A;  2PNG A;  2FAD A;  4XFY A;  4BPF A;  3Q20 A;  5KP7 B;  3CCE P;  5F2N A;  2Z45 A;  3EJB A;  1YHQ P;  2WPT A;  2CWO A;  2VLP A;  3CCQ P;  1K8A Q;  2KOS A;  4U0F A;  2FHS C;  2P9X A;  3CCR P;  1YJN P;  2MVU A;  2LF4 A;  2JYG A;  2PEO A;  2PY8 A;  2EG5 A;  2QEX P;  2FQ2 A;  2XZ1 C;  2M8N A;  3CCM P;  3DS4 A;  4PXH B;  1QVF O;  3GZL A;  2ONT A;  1VQP P;  4QKO A;  3CCL P;  2K93 A;  1M6E X;  3CCJ P;  2PEI A;  3DTJ A;  2EIA A;  1VQ6 P;  1MZ8 A;  1T8K A;  5JPA A;  1Q7Y Q;  1M74 A;  3NY7 B;  2BHV A;  3CE7 A;  2AVA A;  3G4S P;  3H47 A;  4NEO A;  2CG5 B;  1RO2 A;  2KG9 A;  2LKI A;  1YJ9 P;  3DS1 A;  5KP8 B;  1KLP A;  1VQL P;  1OR5 A;  1ZMB A;  1GXH A;  3DS0 A;  2KGC A;  3CD6 P;  4MRT C;  5F2K A;  1EMV A;  3RG6 C;  2KOO A;  2X2B A;  1K30 A;  2EFJ A;  1UNK A;  1EOQ A;  2M8L A;  1AYI A;  2XXM A;  1Q81 Q;  3G1G A;  1VHN A;  1KC8 Q;  2KOD A;  1YI2 P;  1Z6M A;  2KW2 A;  3LMO A;  1QVG O;  2CQ8 A;  1HY8 A;  2DNW A;  4PH1 A;  2JU1 A;  1QRJ A;  1IMP A;  1EIA A;  2LIW A;  1IMQ A;  1HQB A;  3CXC O;  5BS1 A;  2JAZ A;  4UHP B;  2OTL P;  3MGE A;  3P05 A;  4U0B A;  2VSQ A;  3G29 A;  1Q86 Q;  2Z44 A;  5HGL A;  2PEQ A;  2VLQ A;  2KOR A;  5EJD A;  4BPG A;  2MR7 A;  4GR2 A;  4R0M A;  2L9F A;  5DCK A;  3G1I A;  3I55 P;  2CNR A;  3CCU P;  2FVE A;  1AUM A;  2CGQ A;  2K0Y A;  2N6Z A;  2Z46 A;  3OW2 O;  4H2Y C;  4HKG A;  2FQ0 A;  2XV6 A;  2VLO A;  5HGO A;  3DS2 A;  2JBG A;  2LIU A;  3GJN A;  1NQ4 A;  2L22 A;  1DV5 A;  2QNW A;  2ROQ A;  2KWL A;  4U0A A;  4BPH A;  2OTJ P;  3M1M A;  3G0V A;  4PWV B;  1L0I A;  1IUQ A;  4XFX A;  5HGM A;  2E1M A;  4GR6 A;  2JQ4 A;  2GDX A;  1VQN P;  1K73 Q;  2KGD A;  3LRY A;  4XRQ A;  2KG8 A;  1VQ5 P;  2GZE A;  2NO8 A;  2K92 A;  1E6J P;  1M90 Q;  5HVC A;  3NTE A;  5I4T G;  2GDY A;  4IPY A;  3DS5 A;  1VQO P;  1VQ8 P;  2GYK A;  3RG2 A;  3CPW O;  3G71 P;  1F80 D;  1Q82 Q;  4XFZ A;  3H4E A; 
#chains in the Genus database with same CATH homology
 4U0F A;  1EIA A;  2P9X A;  4XRO A;  3CCR P;  1VQM P;  1YIT P;  1YJN P;  1RO0 A;  3CMA P;  2LF4 A;  3H0D A;  1VQ4 P;  3CXC O;  5BS1 A;  2PEN A;  2JYG A;  3VRL C;  2PEO A;  2PY8 A;  2EG5 A;  2QEX P;  1BAJ A;  2OTL P;  3MGE A;  3P05 A;  4COP A;  2M8N A;  4U0B A;  1N8R Q;  2PEJ A;  2XT1 A;  4PH0 A;  3DS4 A;  3G29 A;  1M6N A;  3CCM P;  1Q86 Q;  1KQS O;  2Z44 A;  1QVF O;  5HGL A;  2PEQ A;  2ONT A;  4M0I A;  1QRJ A;  2BUO A;  1NJI Q;  1VQK P;  1JJ2 O;  1W2B O;  1VQP P;  3G26 A;  3CCL P;  3HYB A;  1M6E X;  3CCJ P;  4GR2 A;  1RNI A;  2DGY A;  3I56 P;  1YJW P;  2PEI A;  5DCK A;  3G1I A;  3DTJ A;  2EIA A;  3I55 P;  3CCU P;  1VQ6 P;  2PEK A;  4U0C A;  3CC7 P;  1AUM A;  2Z46 A;  2QA4 P;  2JYL A;  2PEM A;  5JPA A;  3OW2 O;  3CCS P;  2JO0 A;  3CME P;  5F2O A;  3G21 A;  1Q7Y Q;  2XV6 A;  1M74 A;  5HGO A;  3DS2 A;  2BHV A;  4U0E A;  3G4S P;  1KD1 Q;  3H47 A;  3B5I A;  4U0A A;  4COC A;  1RO2 A;  1YJ9 P;  1VQ9 P;  3DS1 A;  2OAR A;  2OTJ P;  4QNB A;  3M1M A;  1VQL P;  3G0V A;  3E2D A;  3G28 A;  1A8O A;  1IUQ A;  1ZMB A;  4XFX A;  5HGM A;  3DS3 A;  2E1M A;  5HGN A;  3DS0 A;  5BS2 A;  4WYM A;  4GR6 A;  3CD6 P;  1M1K Q;  5F2K A;  3WBH A;  1VQN P;  1K73 Q;  1YIJ P;  1K9M Q;  3CCV P;  3RG6 C;  3LRY A;  2M8P A;  3CC4 P;  4XRQ A;  1VQ5 P;  1VQ7 P;  1S72 P;  3HZQ A;  1D1D A;  1K30 A;  2EFJ A;  1A43 A;  1EOQ A;  1E6J P;  1M90 Q;  4XFY A;  2L6E A;  3DPH A;  2M8L A;  2XXM A;  3NTE A;  3G1G A;  1Q81 Q;  1KC8 Q;  3G6E P;  2KOD A;  1YI2 P;  3Q20 A;  5I4T G;  5F2N A;  3CCE P;  4IPY A;  3DS5 A;  1VQO P;  2Z45 A;  1VQ8 P;  3CC2 P;  1YHQ P;  1QVG O;  3CPW O;  2CWO A;  3G71 P;  1Q82 Q;  4U0D A;  3CCQ P;  4PH1 A;  4XFZ A;  1K8A Q;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...