2L6EA

Nmr structure of the monomeric mutant c-terminal domain of hiv-1 capsid in complex with stapled peptide inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
94
structure length
94
Chain Sequence
SGLVPRGSHMTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/inhibitor
molecule keywords Capsid protein p24
publication title Solution structure of a hydrocarbon stapled peptide inhibitor in complex with monomeric C-terminal domain of HIV-1 capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 28
structure length 94
sequence length 94
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2l6eA00
1D1DA 1AUMA 3LRYA 3H4EA 4XROA 3G29A 4U0CA 3DS3A 5HGLA 3G1IA 2M8PA 4XFYA 2XT1A 3P05A 2M8LA 5HGOA 3DS4A 5DCKA 3H47A 3G26A 4IPYA 5HGMA 5JPAA 4U0BA 1E6JP 2ONTA 3DS2A 4M0IA 2XV6A 1A8OA 2XXMA 4QNBA 2BUOA 2JYGA 3VRLC 2L6EA 3G28A 3DPHA 2JO0A 4U0EA 4PH0A 3G0VA 3DS1A 1A43A 4XRQA 1QRJA 1EOQA 4U0FA 4U0AA 2LF4A 5I4TG 4PH1A 3G21A 3DS5A 4XFZA 1BAJA 3DTJA 4COCA 5HGNA 4XFXA 4WYMA 1EIAA 4U0DA 3NTEA 3MGEA 4COPA 2M8NA 3G1GA 2KODA 2JYLA 2EIAA 3DS0A
chains in the Genus database with same CATH superfamily
3H4EA 2EHTA 2FQ1A 2DGYA 3DS2A 2L4BA 4U0EA 2N6ZA 1Q7YQ 2Z45A 2KW2A 3CXCO 3RG2A 4WYMA 2AVAA 1M90Q 2EIAA 3CC2P 2Z44A 4XROA 1M6NA 2N5HA 1Q86Q 2JAZA 1BXIA 3DS5A 1BAJA 4XFXA 1NJIQ 5F2KA 4CA3A 2JYLA 1Z6MA 3M1MA 1L0IA 4BPGA 4PWVB 1RO0A 3P05A 2M8LA 2LPKA 2LIWA 2EHSA 2EG5A 2XXMA 2E1MA 1FR2A 3LMOA 1VQPP 2M5RA 1K9MQ 2ERHA 5KP8B 2N5IA 1L0HA 2MD9A 2FACA 7CEIA 2PEMA 3CCQP 3H0DA 5HVCA 2GZJA 4MRTC 2PENA 2LOLA 3HZQA 4M0IA 1YJ9P 2BUOA 1AYIA 2JU1A 3WBHA 1IUQA 1EOQA 4U0FA 3B5IA 2JQ4A 5CZDB 2MVUA 2KOPA 2FAEA 3CCEP 1NQ4A 2JU2A 3I55P 1ZNVA 2N98A 4H2XC 3GZMA 2LL8A 4H2YC 1ACPA 1A8OA 2MY5A 3CCSP 3G0VA 5EJDA 2JB0A 2KOQA 1KQSO 2FVEA 2VSQA 2GZEA 3H47A 5JPAA 2FVFA 2CG5B 1K30A 4XRQA 5KP6B 4U0AA 3CE7A 2VLNA 3CMEP 2FQ2A 2K93A 1KLPA 2GDXA 3G1GA 2KODA 3G4SP 2GDWA 3G29A 4PXHB 3OW2O 2M8PA 3DS4A 2BHVA 4IPYA 3B4QA 1VQ6P 3EJDA 2VLOA 2K0YA 2K2QA 2GDYA 1HQBA 2PEOA 4PH1A 1KC8Q 3CCUP 2KORA 4QKOA 1S72P 2L22A 1W2BO 2CWOA 3NTEA 1YITP 1IMPA 4IZ6A 4COPA 1D1DA 1QVGO 2KG8A 2GZFA 2X2BA 2PEQA 1X3OA 5HV8A 1F80D 3DS1A 1RNIA 2CQ8A 3GZLA 2LF4A 4BPFA 2VLQA 2GZIA 1VQ7P 2KGAA 3CCMP 1YJWP 2M8NA 2K0XA 3LRYA 3CCVP 1GPJA 5HGLA 1VHNA 2K5XA 2PY8A 3G1IA 2OTLP 5HGOA 5DCKA 2XV6A 4PH0A 1M1KQ 1VQKP 5F2NA 2MR7A 5EW5E 2MR8A 1VQNP 2KR5A 3CCLP 1VQLP 1AF8A 3DS3A 2XZ0D 2WPTA 3CC7P 2OARA 1K8AQ 2ROQA 3VRLC 2L6EA 2JO0A 3CD6P 1GXGA 1A43A 5F2OA 4GR2A 4COCA 2KG6A 4BPHA 3GJNA 4NEOA 2DNWA 2JBGA 2K92A 2KOOA 2JGPA 1RO2A 2FADA 3CCJP 1N8RQ 1JJ2O 4UHPB 2QA4P 5KP7B 2L0QA 1VKUA 2N6YA 1E6JP 2VLPA 2OTJP 3DPHA 2PEIA 2FQ0A 1K73Q 4F37A 4XFZA 2CGQA 1VQMP 3G71P 3MGEA 2AFDA 2LIUA 2GZGA 1VQ8P 2FVAA 4XFYA 3CCRP 3U43A 3G26A 2KGDA 2P9XA 2PEJA 1VQ4P 5I4TG 1Q81Q 3G21A 1EIAA 2N50A 2Z46A 2LKIA 1ZMBA 1HY8A 2PNGA 1UJZA 5BS1A 1VQOP 1IMQA 5HGMA 2KGEA 2AF8A 2ONTA 2NO8A 4QNBA 3I56P 1KD1Q 5BS2A 3G6EP 3Q20A 2KGCA 1VQ9P 2QEXP 2KWLA 2KOSA 3CMAP 4HKGA 3CC4P 1T8KA 1QVFO 2XT1A 2K0DX 2PEKA 4GR6A 2L9FA 4DG9A 1DV5A 2K94A 3HYBA 3G28A 1QRJA 2GYKA 1YJNP 4H2WC 1OR5A 1YI2P 3DS0A 3GKLC 1AUMA 3EJEA 2LMLA 2QNWA 1GXHA 1EMVA 2XZ1C 4R0MA 2JYGA 2KG9A 3DTJA 5HGNA 3RG6C 4U0DA 2MVVA 1MZ8A 1CEIA 1Q82Q 1M6EX 4U0CA 3CPWO 2EFJA 2FHSC 1DNYA 2AFEA 3E2DA 1M74A 4U0BA 3EJBA 1UNKA 2LTEA 1E0HA 1YHQP 1YIJP 2CNRA 1VQ5P 2MF4A 3NY7B
chains in the Genus database with same CATH topology
3LRYA 1ZMBA 3H4EA 3CCVP 5HGLA 2PY8A 3G1IA 5BS1A 1VQOP 2OTLP 5HGOA 5DCKA 5HGMA 2ONTA 2DGYA 3DS2A 2XV6A 1A8OA 4QNBA 4PH0A 3I56P 4U0EA 3CCSP 1KD1Q 1M1KQ 3G0VA 1VQKP 5BS2A 5F2NA 3G6EP 3Q20A 1Q7YQ 2Z45A 1VQ9P 3CXCO 2QEXP 1VQNP 4WYMA 1KQSO 3CCLP 1M90Q 1VQLP 2EIAA 3CC2P 2Z44A 4XROA 3CMAP 1M6NA 3DS3A 3CC4P 1QVFO 2XT1A 2PEKA 3CC7P 3H47A 4GR6A 5JPAA 2OARA 1Q86Q 1K8AQ 3HYBA 2L6EA 3G28A 3VRLC 2JO0A 3CD6P 1K30A 1A43A 4XRQA 1QRJA 5F2OA 4U0AA 4GR2A 1YJNP 3DS5A 1BAJA 3CMEP 4COCA 4XFXA 1NJIQ 5F2KA 3G1GA 1YI2P 2KODA 1RO2A 2JYLA 3G4SP 3CCJP 3DS0A 1N8RQ 1AUMA 3M1MA 3G29A 1JJ2O 1RO0A 3OW2O 2M8PA 2QA4P 3P05A 2M8LA 3DS4A 2BHVA 4IPYA 1E6JP 1VQ6P 2EG5A 2XXMA 2OTJP 2JYGA 3DPHA 2E1MA 2PEIA 1VQPP 1K9MQ 1K73Q 2PEOA 4PH1A 1KC8Q 4XFZA 3CCUP 3DTJA 5HGNA 1VQMP 1S72P 3G71P 1W2BO 3RG6C 4U0DA 2CWOA 3NTEA 1YITP 2PEMA 3MGEA 3CCQP 4COPA 3H0DA 1Q82Q 1D1DA 1M6EX 1QVGO 4U0CA 3CPWO 1VQ8P 2EFJA 4XFYA 3CCRP 2PEQA 3E2DA 3G26A 1M74A 2PENA 3HZQA 4M0IA 4U0BA 1YJ9P 2P9XA 2BUOA 2PEJA 3WBHA 3DS1A 1RNIA 1VQ4P 1IUQA 1EOQA 4U0FA 2LF4A 5I4TG 3B5IA 1Q81Q 3G21A 1YHQP 1YIJP 1EIAA 2Z46A 1VQ7P 3CCEP 1YJWP 3CCMP 1VQ5P 2M8NA 3I55P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1D A;  1AUM A;  3LRY A;  3H4E A;  4XRO A;  3G29 A;  4U0C A;  3DS3 A;  5HGL A;  3G1I A;  2M8P A;  4XFY A;  2XT1 A;  3P05 A;  2M8L A;  5HGO A;  3DS4 A;  5DCK A;  3H47 A;  3G26 A;  4IPY A;  5HGM A;  5JPA A;  4U0B A;  1E6J P;  2ONT A;  3DS2 A;  4M0I A;  2XV6 A;  1A8O A;  2XXM A;  4QNB A;  2BUO A;  2JYG A;  3VRL C;  2L6E A;  3G28 A;  3DPH A;  2JO0 A;  4U0E A;  4PH0 A;  3G0V A;  3DS1 A;  1A43 A;  4XRQ A;  1QRJ A;  1EOQ A;  4U0F A;  4U0A A;  2LF4 A;  5I4T G;  4PH1 A;  3G21 A;  3DS5 A;  4XFZ A;  1BAJ A;  3DTJ A;  4COC A;  5HGN A;  4XFX A;  4WYM A;  1EIA A;  4U0D A;  3NTE A;  3MGE A;  4COP A;  2M8N A;  3G1G A;  2KOD A;  2JYL A;  2EIA A;  3DS0 A; 
#chains in the Genus database with same CATH topology
 3H4E A;  2EHT A;  2FQ1 A;  2DGY A;  3DS2 A;  2L4B A;  4U0E A;  2N6Z A;  1Q7Y Q;  2Z45 A;  2KW2 A;  3CXC O;  3RG2 A;  4WYM A;  2AVA A;  1M90 Q;  2EIA A;  3CC2 P;  2Z44 A;  4XRO A;  1M6N A;  2N5H A;  1Q86 Q;  2JAZ A;  1BXI A;  3DS5 A;  1BAJ A;  4XFX A;  1NJI Q;  5F2K A;  4CA3 A;  2JYL A;  1Z6M A;  3M1M A;  1L0I A;  4BPG A;  4PWV B;  1RO0 A;  3P05 A;  2M8L A;  2LPK A;  2LIW A;  2EHS A;  2EG5 A;  2XXM A;  2E1M A;  1FR2 A;  3LMO A;  1VQP P;  2M5R A;  1K9M Q;  2ERH A;  5KP8 B;  2N5I A;  1L0H A;  2MD9 A;  2FAC A;  7CEI A;  2PEM A;  3CCQ P;  3H0D A;  5HVC A;  2GZJ A;  4MRT C;  2PEN A;  2LOL A;  3HZQ A;  4M0I A;  1YJ9 P;  2BUO A;  1AYI A;  2JU1 A;  3WBH A;  1IUQ A;  1EOQ A;  4U0F A;  3B5I A;  2JQ4 A;  5CZD B;  2MVU A;  2KOP A;  2FAE A;  3CCE P;  1NQ4 A;  2JU2 A;  3I55 P;  1ZNV A;  2N98 A;  4H2X C;  3GZM A;  2LL8 A;  4H2Y C;  1ACP A;  1A8O A;  2MY5 A;  3CCS P;  3G0V A;  5EJD A;  2JB0 A;  2KOQ A;  1KQS O;  2FVE A;  2VSQ A;  2GZE A;  3H47 A;  5JPA A;  2FVF A;  2CG5 B;  1K30 A;  4XRQ A;  5KP6 B;  4U0A A;  3CE7 A;  2VLN A;  3CME P;  2FQ2 A;  2K93 A;  1KLP A;  2GDX A;  3G1G A;  2KOD A;  3G4S P;  2GDW A;  3G29 A;  4PXH B;  3OW2 O;  2M8P A;  3DS4 A;  2BHV A;  4IPY A;  3B4Q A;  1VQ6 P;  3EJD A;  2VLO A;  2K0Y A;  2K2Q A;  2GDY A;  1HQB A;  2PEO A;  4PH1 A;  1KC8 Q;  3CCU P;  2KOR A;  4QKO A;  1S72 P;  2L22 A;  1W2B O;  2CWO A;  3NTE A;  1YIT P;  1IMP A;  4IZ6 A;  4COP A;  1D1D A;  1QVG O;  2KG8 A;  2GZF A;  2X2B A;  2PEQ A;  1X3O A;  5HV8 A;  1F80 D;  3DS1 A;  1RNI A;  2CQ8 A;  3GZL A;  2LF4 A;  4BPF A;  2VLQ A;  2GZI A;  1VQ7 P;  2KGA A;  3CCM P;  1YJW P;  2M8N A;  2K0X A;  3LRY A;  3CCV P;  1GPJ A;  5HGL A;  1VHN A;  2K5X A;  2PY8 A;  3G1I A;  2OTL P;  5HGO A;  5DCK A;  2XV6 A;  4PH0 A;  1M1K Q;  1VQK P;  5F2N A;  2MR7 A;  5EW5 E;  2MR8 A;  1VQN P;  2KR5 A;  3CCL P;  1VQL P;  1AF8 A;  3DS3 A;  2XZ0 D;  2WPT A;  3CC7 P;  2OAR A;  1K8A Q;  2ROQ A;  3VRL C;  2L6E A;  2JO0 A;  3CD6 P;  1GXG A;  1A43 A;  5F2O A;  4GR2 A;  4COC A;  2KG6 A;  4BPH A;  3GJN A;  4NEO A;  2DNW A;  2JBG A;  2K92 A;  2KOO A;  2JGP A;  1RO2 A;  2FAD A;  3CCJ P;  1N8R Q;  1JJ2 O;  4UHP B;  2QA4 P;  5KP7 B;  2L0Q A;  1VKU A;  2N6Y A;  1E6J P;  2VLP A;  2OTJ P;  3DPH A;  2PEI A;  2FQ0 A;  1K73 Q;  4F37 A;  4XFZ A;  2CGQ A;  1VQM P;  3G71 P;  3MGE A;  2AFD A;  2LIU A;  2GZG A;  1VQ8 P;  2FVA A;  4XFY A;  3CCR P;  3U43 A;  3G26 A;  2KGD A;  2P9X A;  2PEJ A;  1VQ4 P;  5I4T G;  1Q81 Q;  3G21 A;  1EIA A;  2N50 A;  2Z46 A;  2LKI A;  1ZMB A;  1HY8 A;  2PNG A;  1UJZ A;  5BS1 A;  1VQO P;  1IMQ A;  5HGM A;  2KGE A;  2AF8 A;  2ONT A;  2NO8 A;  4QNB A;  3I56 P;  1KD1 Q;  5BS2 A;  3G6E P;  3Q20 A;  2KGC A;  1VQ9 P;  2QEX P;  2KWL A;  2KOS A;  3CMA P;  4HKG A;  3CC4 P;  1T8K A;  1QVF O;  2XT1 A;  2K0D X;  2PEK A;  4GR6 A;  2L9F A;  4DG9 A;  1DV5 A;  2K94 A;  3HYB A;  3G28 A;  1QRJ A;  2GYK A;  1YJN P;  4H2W C;  1OR5 A;  1YI2 P;  3DS0 A;  3GKL C;  1AUM A;  3EJE A;  2LML A;  2QNW A;  1GXH A;  1EMV A;  2XZ1 C;  4R0M A;  2JYG A;  2KG9 A;  3DTJ A;  5HGN A;  3RG6 C;  4U0D A;  2MVV A;  1MZ8 A;  1CEI A;  1Q82 Q;  1M6E X;  4U0C A;  3CPW O;  2EFJ A;  2FHS C;  1DNY A;  2AFE A;  3E2D A;  1M74 A;  4U0B A;  3EJB A;  1UNK A;  2LTE A;  1E0H A;  1YHQ P;  1YIJ P;  2CNR A;  1VQ5 P;  2MF4 A;  3NY7 B; 
#chains in the Genus database with same CATH homology
 3LRY A;  1ZMB A;  3H4E A;  3CCV P;  5HGL A;  2PY8 A;  3G1I A;  5BS1 A;  1VQO P;  2OTL P;  5HGO A;  5DCK A;  5HGM A;  2ONT A;  2DGY A;  3DS2 A;  2XV6 A;  1A8O A;  4QNB A;  4PH0 A;  3I56 P;  4U0E A;  3CCS P;  1KD1 Q;  1M1K Q;  3G0V A;  1VQK P;  5BS2 A;  5F2N A;  3G6E P;  3Q20 A;  1Q7Y Q;  2Z45 A;  1VQ9 P;  3CXC O;  2QEX P;  1VQN P;  4WYM A;  1KQS O;  3CCL P;  1M90 Q;  1VQL P;  2EIA A;  3CC2 P;  2Z44 A;  4XRO A;  3CMA P;  1M6N A;  3DS3 A;  3CC4 P;  1QVF O;  2XT1 A;  2PEK A;  3CC7 P;  3H47 A;  4GR6 A;  5JPA A;  2OAR A;  1Q86 Q;  1K8A Q;  3HYB A;  2L6E A;  3G28 A;  3VRL C;  2JO0 A;  3CD6 P;  1K30 A;  1A43 A;  4XRQ A;  1QRJ A;  5F2O A;  4U0A A;  4GR2 A;  1YJN P;  3DS5 A;  1BAJ A;  3CME P;  4COC A;  4XFX A;  1NJI Q;  5F2K A;  3G1G A;  1YI2 P;  2KOD A;  1RO2 A;  2JYL A;  3G4S P;  3CCJ P;  3DS0 A;  1N8R Q;  1AUM A;  3M1M A;  3G29 A;  1JJ2 O;  1RO0 A;  3OW2 O;  2M8P A;  2QA4 P;  3P05 A;  2M8L A;  3DS4 A;  2BHV A;  4IPY A;  1E6J P;  1VQ6 P;  2EG5 A;  2XXM A;  2OTJ P;  2JYG A;  3DPH A;  2E1M A;  2PEI A;  1VQP P;  1K9M Q;  1K73 Q;  2PEO A;  4PH1 A;  1KC8 Q;  4XFZ A;  3CCU P;  3DTJ A;  5HGN A;  1VQM P;  1S72 P;  3G71 P;  1W2B O;  3RG6 C;  4U0D A;  2CWO A;  3NTE A;  1YIT P;  2PEM A;  3MGE A;  3CCQ P;  4COP A;  3H0D A;  1Q82 Q;  1D1D A;  1M6E X;  1QVG O;  4U0C A;  3CPW O;  1VQ8 P;  2EFJ A;  4XFY A;  3CCR P;  2PEQ A;  3E2D A;  3G26 A;  1M74 A;  2PEN A;  3HZQ A;  4M0I A;  4U0B A;  1YJ9 P;  2P9X A;  2BUO A;  2PEJ A;  3WBH A;  3DS1 A;  1RNI A;  1VQ4 P;  1IUQ A;  1EOQ A;  4U0F A;  2LF4 A;  5I4T G;  3B5I A;  1Q81 Q;  3G21 A;  1YHQ P;  1YIJ P;  1EIA A;  2Z46 A;  1VQ7 P;  3CCE P;  1YJW P;  3CCM P;  1VQ5 P;  2M8N A;  3I55 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...