2LTEA

Solution nmr structure of the specialized acyl carrier protein pa3334 (apo) from pseudomonas aeruginosa, northeast structural genomics consortium target pat415
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
MGSSHDHHHHSSGRENLYFQGHMPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRAAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the specialized acyl carrier protein PA3334 (apo) from Pseudomonas aeruginosa. Northeast Structural Genomics Consortium Target PaT415.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
total genus 21
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lteA00
2KR5A 2MVUA 5HV8A 2MY5A 3CE7A 2EHSA 2LIUA 2L4BA 2GDXA 2KG9A 2CQ8A 2KGAA 2K92A 2KW2A 2N5HA 1L0IA 2LKIA 2JU2A 2KGEA 2LOLA 2LL8A 2MF4A 4HKGA 5CZDB 4H2WC 1ACPA 3RG2A 2JU1A 2M5RA 2XZ1C 2LTEA 2KG6A 2JQ4A 4DG9A 2L0QA 1L0HA 2CNRA 2FVFA 3LMOA 2CG5B 2KOPA 2LMLA 2AVAA 1F80D 2KORA 2K0XA 2KOOA 2MR7A 2QNWA 4PXHB 3NY7B 2N6ZA 2KOQA 5KP8B 3EJDA 2GDYA 3EJBA 2KG8A 5EJDA 2KWLA 5HVCA 2FQ2A 4MRTC 4BPGA 2ROQA 2KGCA 1OR5A 4BPFA 2L9FA 1DV5A 2FQ1A 2K93A 2FADA 1VKUA 2KGDA 2LIWA 1DNYA 1KLPA 1HY8A 2AFDA 2GDWA 2KOSA 2N5IA 2FAEA 2FVAA 2FHSC 2AFEA 3GZMA 1AF8A 2PNGA 2MR8A 5KP6B 4IZ6A 2K94A 2N98A 2K2QA 1T8KA 4NEOA 2FVEA 2MD9A 2DNWA 4BPHA 2FQ0A 2FACA 2MVVA 2EHTA 1X3OA 5KP7B 2AF8A 2JGPA 2X2BA 2N6YA 4H2XC 2LPKA 2N50A 4H2YC 3EJEA 2K0YA 1NQ4A 1HQBA 2VSQA 2XZ0D 4PWVB 2L22A 3GZLA 4CA3A 2CGQA 4R0MA
chains in the Genus database with same CATH superfamily
2MVUA 4GR2A 2L4BA 2KG9A 3CCRP 2CQ8A 2KGAA 2K92A 2N5HA 1VQ6P 2LKIA 2LOLA 2PEQA 1W2BO 4HKGA 5CZDB 4M0IA 1QVGO 3RG2A 2Z44A 2M8NA 2M5RA 2XZ1C 3B4QA 3CXCO 2KG6A 2JQ4A 1EOQA 1NJIQ 3GJNA 1YITP 2KOPA 2LMLA 1F80D 4PXHB 2KOOA 4COPA 3Q20A 1M90Q 4F37A 4XFYA 1EMVA 1M74A 3G4SP 3CCEP 3G0VA 4U0FA 2BUOA 2K93A 2KGDA 1KLPA 2AFDA 1YJWP 2AFEA 3GZMA 5KP6B 2K94A 5F2OA 1T8KA 1IMPA 1CEIA 3CCJP 2FVEA 2VLNA 2PEKA 4U0CA 1Q86Q 5EW5E 2GZJA 1GXGA 1Z6MA 1AYIA 2JGPA 1EIAA 2N6YA 2M8PA 3OW2O 2XV6A 2VLOA 1YIJP 1QRJA 2VSQA 1HQBA 1MZ8A 2CGQA 3CE7A 2P9XA 4GR6A 2EG5A 4PH0A 3DS0A 2KODA 1M6NA 1N8RQ 2NO8A 4PH1A 1IMQA 1UJZA 3G6EP 4H2WC 1VQKP 2JU1A 5HGNA 2BHVA 2DGYA 2LTEA 1L0HA 2FVFA 3G29A 2MR7A 3G21A 3NTEA 5BS2A 3G1GA 4QKOA 4XRQA 5F2KA 2PEMA 2EIAA 2KG8A 5EJDA 1K73Q 3H0DA 4U0DA 2XT1A 1DNYA 2FAEA 2M8LA 5HGOA 2FHSC 1GXHA 4IZ6A 2GZGA 2N98A 2JAZA 3RG6C 2MD9A 3HYBA 2FQ0A 1ZNVA 1JJ2O 4H2XC 2GZEA 4U0EA 1Q82Q 1YHQP 2N50A 7CEIA 5JPAA 3EJEA 1NQ4A 1VQ8P 2L22A 3GZLA 4WYMA 4CA3A 3U43A 4R0MA 3HZQA 3H4EA 5HV8A 2MY5A 2LIUA 2GZIA 3G71P 2KW2A 1L0IA 2JU2A 4IPYA 2KGEA 3DS3A 1E0HA 2MF4A 1VQMP 1E6JP 4UHPB 1GPJA 2L0QA 3CC7P 2AVAA 2K0XA 2PEIA 2JB0A 2PEOA 5F2NA 2PEJA 2KOQA 1BXIA 3EJDA 2GDYA 1AUMA 3EJBA 4XFZA 2KWLA 2FQ2A 1A8OA 4MRTC 4BPGA 2ROQA 2KGCA 5HGLA 2FQ1A 1VQOP 3CD6P 2FADA 1VKUA 2LIWA 3DS2A 1VQ7P 1K9MQ 2KOSA 2N5IA 2ERHA 2PY8A 2FVAA 4XFXA 3CMEP 1AF8A 1FR2A 2PNGA 2MR8A 2JBGA 3CCSP 1M1KQ 2CWOA 2GYKA 2K5XA 3M1MA 1VQ4P 1QVFO 4NEOA 2VLPA 1UNKA 2XXMA 3CC2P 3CCLP 4BPHA 1RNIA 2FACA 2EHTA 1S72P 5BS1A 1X3OA 5KP7B 1VQNP 3E2DA 2AF8A 2X2BA 1YJNP 3CCUP 2LPKA 2OARA 2PENA 3P05A 4U0BA 3CMAP 5I4TG 2EFJA 2K0YA 2E1MA 1Q7YQ 4PWVB 1K30A 2KR5A 1KQSO 2GZFA 2EHSA 4XROA 2ONTA 2LF4A 1YI2P 2GDXA 3G1IA 3VRLC 1K8AQ 5DCKA 4U0AA 1ZMBA 2L6EA 3GKLC 1IUQA 1BAJA 2LL8A 2VLQA 4COCA 3DPHA 3CPWO 1ACPA 3B5IA 3I56P 1VQ5P 3MGEA 1VQPP 4DG9A 2CNRA 3WBHA 3LMOA 2Z45A 2QNWA 5HGMA 2CG5B 2KORA 3NY7B 3G28A 2N6ZA 1VQLP 1VQ9P 5KP8B 2OTLP 1A43A 3DTJA 3I55P 2JO0A 2K0DX 3CCQP 3G26A 5HVCA 1RO0A 1OR5A 4BPFA 1KC8Q 3LRYA 2L9FA 1DV5A 3CC4P 1HY8A 2GDWA 1D1DA 2QEXP 3CCMP 2QA4P 3DS5A 1YJ9P 2OTJP 2K2QA 1VHNA 3CCVP 1RO2A 2DNWA 2WPTA 2JYLA 2MVVA 1M6EX 1KD1Q 3DS1A 4H2YC 4QNBA 2Z46A 3DS4A 1Q81Q 2JYGA 2XZ0D 3H47A
chains in the Genus database with same CATH topology
2KR5A 2MVUA 5HV8A 2MY5A 3CE7A 2EHSA 2LIUA 2L4BA 2GDXA 2KG9A 2CQ8A 2KGAA 2K92A 2KW2A 2N5HA 1L0IA 2LKIA 2JU2A 2KGEA 2LOLA 2LL8A 2MF4A 4HKGA 5CZDB 4H2WC 1ACPA 3RG2A 2JU1A 2M5RA 2XZ1C 2LTEA 2KG6A 2JQ4A 4DG9A 2L0QA 1L0HA 2CNRA 2FVFA 3LMOA 2CG5B 2KOPA 2LMLA 2AVAA 1F80D 2KORA 2K0XA 2KOOA 2MR7A 2QNWA 4PXHB 3NY7B 2N6ZA 2KOQA 5KP8B 3EJDA 2GDYA 3EJBA 2KG8A 5EJDA 2KWLA 5HVCA 2FQ2A 4MRTC 4BPGA 2ROQA 2KGCA 1OR5A 4BPFA 2L9FA 1DV5A 2FQ1A 2K93A 2FADA 1VKUA 2KGDA 2LIWA 1DNYA 1KLPA 1HY8A 2AFDA 2GDWA 2KOSA 2N5IA 2FAEA 2FVAA 2FHSC 2AFEA 3GZMA 1AF8A 2PNGA 2MR8A 5KP6B 4IZ6A 2K94A 2N98A 2K2QA 1T8KA 4NEOA 2FVEA 2MD9A 2DNWA 4BPHA 2FQ0A 2FACA 2MVVA 2EHTA 1X3OA 5KP7B 2AF8A 2JGPA 2X2BA 2N6YA 4H2XC 2LPKA 2N50A 4H2YC 3EJEA 2K0YA 1NQ4A 1HQBA 2VSQA 2XZ0D 4PWVB 2L22A 3GZLA 4CA3A 2CGQA 4R0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR5 A;  2MVU A;  5HV8 A;  2MY5 A;  3CE7 A;  2EHS A;  2LIU A;  2L4B A;  2GDX A;  2KG9 A;  2CQ8 A;  2KGA A;  2K92 A;  2KW2 A;  2N5H A;  1L0I A;  2LKI A;  2JU2 A;  2KGE A;  2LOL A;  2LL8 A;  2MF4 A;  4HKG A;  5CZD B;  4H2W C;  1ACP A;  3RG2 A;  2JU1 A;  2M5R A;  2XZ1 C;  2LTE A;  2KG6 A;  2JQ4 A;  4DG9 A;  2L0Q A;  1L0H A;  2CNR A;  2FVF A;  3LMO A;  2CG5 B;  2KOP A;  2LML A;  2AVA A;  1F80 D;  2KOR A;  2K0X A;  2KOO A;  2MR7 A;  2QNW A;  4PXH B;  3NY7 B;  2N6Z A;  2KOQ A;  5KP8 B;  3EJD A;  2GDY A;  3EJB A;  2KG8 A;  5EJD A;  2KWL A;  5HVC A;  2FQ2 A;  4MRT C;  4BPG A;  2ROQ A;  2KGC A;  1OR5 A;  4BPF A;  2L9F A;  1DV5 A;  2FQ1 A;  2K93 A;  2FAD A;  1VKU A;  2KGD A;  2LIW A;  1DNY A;  1KLP A;  1HY8 A;  2AFD A;  2GDW A;  2KOS A;  2N5I A;  2FAE A;  2FVA A;  2FHS C;  2AFE A;  3GZM A;  1AF8 A;  2PNG A;  2MR8 A;  5KP6 B;  4IZ6 A;  2K94 A;  2N98 A;  2K2Q A;  1T8K A;  4NEO A;  2FVE A;  2MD9 A;  2DNW A;  4BPH A;  2FQ0 A;  2FAC A;  2MVV A;  2EHT A;  1X3O A;  5KP7 B;  2AF8 A;  2JGP A;  2X2B A;  2N6Y A;  4H2X C;  2LPK A;  2N50 A;  4H2Y C;  3EJE A;  2K0Y A;  1NQ4 A;  1HQB A;  2VSQ A;  2XZ0 D;  4PWV B;  2L22 A;  3GZL A;  4CA3 A;  2CGQ A;  4R0M A; 
#chains in the Genus database with same CATH topology
 2MVU A;  4GR2 A;  2L4B A;  2KG9 A;  3CCR P;  2CQ8 A;  2KGA A;  2K92 A;  2N5H A;  1VQ6 P;  2LKI A;  2LOL A;  2PEQ A;  1W2B O;  4HKG A;  5CZD B;  4M0I A;  1QVG O;  3RG2 A;  2Z44 A;  2M8N A;  2M5R A;  2XZ1 C;  3B4Q A;  3CXC O;  2KG6 A;  2JQ4 A;  1EOQ A;  1NJI Q;  3GJN A;  1YIT P;  2KOP A;  2LML A;  1F80 D;  4PXH B;  2KOO A;  4COP A;  3Q20 A;  1M90 Q;  4F37 A;  4XFY A;  1EMV A;  1M74 A;  3G4S P;  3CCE P;  3G0V A;  4U0F A;  2BUO A;  2K93 A;  2KGD A;  1KLP A;  2AFD A;  1YJW P;  2AFE A;  3GZM A;  5KP6 B;  2K94 A;  5F2O A;  1T8K A;  1IMP A;  1CEI A;  3CCJ P;  2FVE A;  2VLN A;  2PEK A;  4U0C A;  1Q86 Q;  5EW5 E;  2GZJ A;  1GXG A;  1Z6M A;  1AYI A;  2JGP A;  1EIA A;  2N6Y A;  2M8P A;  3OW2 O;  2XV6 A;  2VLO A;  1YIJ P;  1QRJ A;  2VSQ A;  1HQB A;  1MZ8 A;  2CGQ A;  3CE7 A;  2P9X A;  4GR6 A;  2EG5 A;  4PH0 A;  3DS0 A;  2KOD A;  1M6N A;  1N8R Q;  2NO8 A;  4PH1 A;  1IMQ A;  1UJZ A;  3G6E P;  4H2W C;  1VQK P;  2JU1 A;  5HGN A;  2BHV A;  2DGY A;  2LTE A;  1L0H A;  2FVF A;  3G29 A;  2MR7 A;  3G21 A;  3NTE A;  5BS2 A;  3G1G A;  4QKO A;  4XRQ A;  5F2K A;  2PEM A;  2EIA A;  2KG8 A;  5EJD A;  1K73 Q;  3H0D A;  4U0D A;  2XT1 A;  1DNY A;  2FAE A;  2M8L A;  5HGO A;  2FHS C;  1GXH A;  4IZ6 A;  2GZG A;  2N98 A;  2JAZ A;  3RG6 C;  2MD9 A;  3HYB A;  2FQ0 A;  1ZNV A;  1JJ2 O;  4H2X C;  2GZE A;  4U0E A;  1Q82 Q;  1YHQ P;  2N50 A;  7CEI A;  5JPA A;  3EJE A;  1NQ4 A;  1VQ8 P;  2L22 A;  3GZL A;  4WYM A;  4CA3 A;  3U43 A;  4R0M A;  3HZQ A;  3H4E A;  5HV8 A;  2MY5 A;  2LIU A;  2GZI A;  3G71 P;  2KW2 A;  1L0I A;  2JU2 A;  4IPY A;  2KGE A;  3DS3 A;  1E0H A;  2MF4 A;  1VQM P;  1E6J P;  4UHP B;  1GPJ A;  2L0Q A;  3CC7 P;  2AVA A;  2K0X A;  2PEI A;  2JB0 A;  2PEO A;  5F2N A;  2PEJ A;  2KOQ A;  1BXI A;  3EJD A;  2GDY A;  1AUM A;  3EJB A;  4XFZ A;  2KWL A;  2FQ2 A;  1A8O A;  4MRT C;  4BPG A;  2ROQ A;  2KGC A;  5HGL A;  2FQ1 A;  1VQO P;  3CD6 P;  2FAD A;  1VKU A;  2LIW A;  3DS2 A;  1VQ7 P;  1K9M Q;  2KOS A;  2N5I A;  2ERH A;  2PY8 A;  2FVA A;  4XFX A;  3CME P;  1AF8 A;  1FR2 A;  2PNG A;  2MR8 A;  2JBG A;  3CCS P;  1M1K Q;  2CWO A;  2GYK A;  2K5X A;  3M1M A;  1VQ4 P;  1QVF O;  4NEO A;  2VLP A;  1UNK A;  2XXM A;  3CC2 P;  3CCL P;  4BPH A;  1RNI A;  2FAC A;  2EHT A;  1S72 P;  5BS1 A;  1X3O A;  5KP7 B;  1VQN P;  3E2D A;  2AF8 A;  2X2B A;  1YJN P;  3CCU P;  2LPK A;  2OAR A;  2PEN A;  3P05 A;  4U0B A;  3CMA P;  5I4T G;  2EFJ A;  2K0Y A;  2E1M A;  1Q7Y Q;  4PWV B;  1K30 A;  2KR5 A;  1KQS O;  2GZF A;  2EHS A;  4XRO A;  2ONT A;  2LF4 A;  1YI2 P;  2GDX A;  3G1I A;  3VRL C;  1K8A Q;  5DCK A;  4U0A A;  1ZMB A;  2L6E A;  3GKL C;  1IUQ A;  1BAJ A;  2LL8 A;  2VLQ A;  4COC A;  3DPH A;  3CPW O;  1ACP A;  3B5I A;  3I56 P;  1VQ5 P;  3MGE A;  1VQP P;  4DG9 A;  2CNR A;  3WBH A;  3LMO A;  2Z45 A;  2QNW A;  5HGM A;  2CG5 B;  2KOR A;  3NY7 B;  3G28 A;  2N6Z A;  1VQL P;  1VQ9 P;  5KP8 B;  2OTL P;  1A43 A;  3DTJ A;  3I55 P;  2JO0 A;  2K0D X;  3CCQ P;  3G26 A;  5HVC A;  1RO0 A;  1OR5 A;  4BPF A;  1KC8 Q;  3LRY A;  2L9F A;  1DV5 A;  3CC4 P;  1HY8 A;  2GDW A;  1D1D A;  2QEX P;  3CCM P;  2QA4 P;  3DS5 A;  1YJ9 P;  2OTJ P;  2K2Q A;  1VHN A;  3CCV P;  1RO2 A;  2DNW A;  2WPT A;  2JYL A;  2MVV A;  1M6E X;  1KD1 Q;  3DS1 A;  4H2Y C;  4QNB A;  2Z46 A;  3DS4 A;  1Q81 Q;  2JYG A;  2XZ0 D;  3H47 A; 
#chains in the Genus database with same CATH homology
 2KR5 A;  2MVU A;  5HV8 A;  2MY5 A;  3CE7 A;  2EHS A;  2LIU A;  2L4B A;  2GDX A;  2KG9 A;  2CQ8 A;  2KGA A;  2K92 A;  2KW2 A;  2N5H A;  1L0I A;  2LKI A;  2JU2 A;  2KGE A;  2LOL A;  2LL8 A;  2MF4 A;  4HKG A;  5CZD B;  4H2W C;  1ACP A;  3RG2 A;  2JU1 A;  2M5R A;  2XZ1 C;  2LTE A;  2KG6 A;  2JQ4 A;  4DG9 A;  2L0Q A;  1L0H A;  2CNR A;  2FVF A;  3LMO A;  2CG5 B;  2KOP A;  2LML A;  2AVA A;  1F80 D;  2KOR A;  2K0X A;  2KOO A;  2MR7 A;  2QNW A;  4PXH B;  3NY7 B;  2N6Z A;  2KOQ A;  5KP8 B;  3EJD A;  2GDY A;  3EJB A;  2KG8 A;  5EJD A;  2KWL A;  5HVC A;  2FQ2 A;  4MRT C;  4BPG A;  2ROQ A;  2KGC A;  1OR5 A;  4BPF A;  2L9F A;  1DV5 A;  2FQ1 A;  2K93 A;  2FAD A;  1VKU A;  2KGD A;  2LIW A;  1DNY A;  1KLP A;  1HY8 A;  2AFD A;  2GDW A;  2KOS A;  2N5I A;  2FAE A;  2FVA A;  2FHS C;  2AFE A;  3GZM A;  1AF8 A;  2PNG A;  2MR8 A;  5KP6 B;  4IZ6 A;  2K94 A;  2N98 A;  2K2Q A;  1T8K A;  4NEO A;  2FVE A;  2MD9 A;  2DNW A;  4BPH A;  2FQ0 A;  2FAC A;  2MVV A;  2EHT A;  1X3O A;  5KP7 B;  2AF8 A;  2JGP A;  2X2B A;  2N6Y A;  4H2X C;  2LPK A;  2N50 A;  4H2Y C;  3EJE A;  2K0Y A;  1NQ4 A;  1HQB A;  2VSQ A;  2XZ0 D;  4PWV B;  2L22 A;  3GZL A;  4CA3 A;  2CGQ A;  4R0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...