2LTEA

Solution nmr structure of the specialized acyl carrier protein pa3334 (apo) from pseudomonas aeruginosa, northeast structural genomics consortium target pat415
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
MGSSHDHHHHSSGRENLYFQGHMPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDELDLLETVDELFQLVEKHRAAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
publication title Solution NMR structure of the specialized acyl carrier protein PA3334 (apo) from Pseudomonas aeruginosa. Northeast Structural Genomics Consortium Target PaT415.
rcsb
source organism Pseudomonas aeruginosa
total genus 21
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lteA00
2MY5A 5KP6B 2KG9A 4NEOA 2JGPA 4MRTC 5KP8B 2LKIA 3CE7A 2KG8A 1KLPA 2KR5A 1HQBA 2K2QA 4PXHB 5HV8A 2KOOA 2FVAA 2EHTA 2M5RA 2LPKA 1NQ4A 5KP7B 1L0HA 2PNGA 3NY7B 2N5HA 2CQ8A 2LIUA 4PWVB 4R0MA 2MF4A 2ROQA 4H2XC 3GZLA 2FQ2A 4CA3A 1T8KA 2K94A 2FVFA 4BPGA 2K0YA 4H2WC 2MVUA 2KW2A 2CGQA 2QNWA 1AF8A 1OR5A 2KOPA 2EHSA 3RG2A 2XZ1C 2KORA 1L0IA 1DNYA 2KGEA 2KG6A 2VSQA 2KWLA 2LL8A 2FQ1A 2JQ4A 2X2BA 4BPHA 2FHSC 5CZDB 2L4BA 2AFEA 4IZ6A 2LOLA 4DG9A 5EJDA 2LMLA 2FQ0A 2JU2A 2FVEA 2XZ0D 2GDWA 2KGCA 3GZMA 3LMOA 2CG5B 2N50A 5HVCA 2AFDA 2N6ZA 2GDXA 2K0XA 3EJBA 2MD9A 2N6YA 2L0QA 4H2YC 2AVAA 2KOQA 3EJEA 2MVVA 2MR8A 2FAEA 2KOSA 4HKGA 1VKUA 1ACPA 2K93A 2L9FA 2FADA 2KGAA 1F80D 3EJDA 2K92A 2LTEA 2N98A 2MR7A 4BPFA 2AF8A 2GDYA 2LIWA 1DV5A 2FACA 2N5IA 2JU1A 2KGDA 1HY8A 1X3OA 2CNRA 2DNWA 2L22A
chains in the Genus database with same CATH superfamily
1JJ2O 2OARA 2L6EA 2JGPA 3Q20A 4F37A 4PXHB 2K2QA 3CCRP 2VLNA 1L0HA 5F2KA 2N5HA 2CQ8A 3G1GA 3GZLA 2FQ2A 4CA3A 1T8KA 1N8RQ 1E0HA 4BPGA 2JO0A 1Q7YQ 3NTEA 2OTJP 1BXIA 1YIJP 2BUOA 1VQKP 2KODA 2M8PA 2LL8A 2E1MA 1Q81Q 2X2BA 4BPHA 5CZDB 1BAJA 4U0DA 3CCMP 2AFEA 3DS1A 5EJDA 2LMLA 3GZMA 2JU2A 3LMOA 1A43A 4U0AA 3VRLC 3G1IA 1RO2A 1KD1Q 5BS2A 2Z45A 1A8OA 4U0EA 3CCJP 4WYMA 2MD9A 1M6EX 2KOQA 2MR8A 3H4EA 2PENA 2FAEA 1QVFO 4IPYA 3RG6C 2K93A 3OW2O 1QRJA 2LTEA 4M0IA 2M8LA 3G0VA 3CCLP 2LIWA 1VQOP 2VLOA 2JB0A 4U0FA 1EIAA 1VQ5P 2MY5A 3CMEP 1CEIA 4MRTC 2XV6A 1EOQA 1HQBA 2XXMA 1UNKA 5HV8A 2KOOA 2EHTA 2M5RA 2LF4A 2PEJA 2PEQA 1NQ4A 1K30A 3NY7B 5F2OA 4PH1A 2LIUA 3WBHA 2MF4A 3B4QA 3GKLC 1IMPA 4COPA 5BS1A 3P05A 3I55P 2KW2A 4GR2A 2CGQA 1AUMA 2GZEA 1Z6MA 1OR5A 2KOPA 1YITP 1M1KQ 1DNYA 1Q82Q 2KG6A 2VSQA 1D1DA 2KWLA 2NO8A 3CC4P 5JPAA 5DCKA 4U0BA 1VQ4P 4IZ6A 2LOLA 3CCSP 7CEIA 2JAZA 3CPWO 2FQ0A 2GDWA 1K8AQ 2PEMA 2N50A 3DS4A 2P9XA 2K0DX 4U0CA 1GPJA 2K5XA 1AYIA 3M1MA 1EMVA 2EFJA 2AVAA 2MVVA 2KOSA 1GXHA 3DS2A 2Z44A 2MR7A 2CWOA 2PEKA 2QA4P 2EIAA 2FACA 4PH0A 1RO0A 2GZIA 1YI2P 3G26A 1VQLP 2WPTA 2GZGA 1VQNP 5KP6B 2KG9A 3G28A 5KP8B 3CE7A 2KG8A 2XT1A 2JBGA 2KR5A 3DS0A 3I56P 5HGNA 3CCVP 4R0MA 4PWVB 4H2XC 3B5IA 2FVFA 2K0YA 1UJZA 1AF8A 2EHSA 3H0DA 2XZ1C 1L0IA 2M8NA 1YJNP 2Z46A 2DGYA 3G71P 4XROA 2GZJA 5F2NA 2FHSC 1E6JP 2L4BA 5HGOA 4DG9A 3LRYA 2XZ0D 2KGCA 3H47A 2CG5B 4QNBA 2AFDA 3CCEP 2GDXA 1ZNVA 2PY8A 3U43A 1Q86Q 3G4SP 3G29A 1K9MQ 2L0QA 1VQPP 2OTLP 1KQSO 4QKOA 4HKGA 3HYBA 1VKUA 1ACPA 2KGAA 3EJDA 5EW5E 1VQ8P 4UHPB 2N98A 1VQ9P 2AF8A 2GDYA 2PEIA 1DV5A 2ONTA 4XRQA 1YJ9P 2CNRA 5HGMA 2L22A 1VHNA 1M90Q 1IUQA 1MZ8A 2JYLA 2GZFA 4NEOA 2LKIA 1KLPA 2FVAA 2LPKA 5HGLA 5KP7B 3DS3A 2PNGA 2ROQA 1VQ6P 1FR2A 3MGEA 2K94A 4H2WC 1VQMP 2MVUA 2QNWA 3CXCO 5I4TG 2VLPA 3CC2P 3RG2A 3G21A 1ZMBA 2KORA 3DPHA 1YHQP 2KGEA 4GR6A 1S72P 2FQ1A 2JQ4A 1GXGA 3CMAP 3CCUP 3E2DA 1NJIQ 3CC7P 1M74A 2FVEA 3DS5A 3GJNA 2ERHA 4XFXA 5HVCA 3CCQP 2N6ZA 3HZQA 2K0XA 1QVGO 3DTJA 2QEXP 1W2BO 3G6EP 3EJBA 2N6YA 4H2YC 1M6NA 3EJEA 2GYKA 2JYGA 1KC8Q 2EG5A 1K73Q 2L9FA 2BHVA 2FADA 1F80D 3CD6P 2K92A 4BPFA 4XFZA 1YJWP 2VLQA 2N5IA 2JU1A 1IMQA 2KGDA 4COCA 1HY8A 1X3OA 4XFYA 2DNWA 1RNIA 1VQ7P 2PEOA
chains in the Genus database with same CATH topology
2MY5A 5KP6B 2KG9A 4NEOA 2JGPA 4MRTC 5KP8B 2LKIA 3CE7A 2KG8A 1KLPA 2KR5A 1HQBA 2K2QA 4PXHB 5HV8A 2KOOA 2FVAA 2EHTA 2M5RA 2LPKA 1NQ4A 5KP7B 1L0HA 2PNGA 3NY7B 2N5HA 2CQ8A 2LIUA 4PWVB 4R0MA 2MF4A 2ROQA 4H2XC 3GZLA 2FQ2A 4CA3A 1T8KA 2K94A 2FVFA 4BPGA 2K0YA 4H2WC 2MVUA 2KW2A 2CGQA 2QNWA 1AF8A 1OR5A 2KOPA 2EHSA 3RG2A 2XZ1C 2KORA 1L0IA 1DNYA 2KGEA 2KG6A 2VSQA 2KWLA 2LL8A 2FQ1A 2JQ4A 2X2BA 4BPHA 2FHSC 5CZDB 2L4BA 2AFEA 4IZ6A 2LOLA 4DG9A 5EJDA 2LMLA 2FQ0A 2JU2A 2FVEA 2XZ0D 2GDWA 2KGCA 3GZMA 3LMOA 2CG5B 2N50A 5HVCA 2AFDA 2N6ZA 2GDXA 2K0XA 3EJBA 2MD9A 2N6YA 2L0QA 4H2YC 2AVAA 2KOQA 3EJEA 2MVVA 2MR8A 2FAEA 2KOSA 4HKGA 1VKUA 1ACPA 2K93A 2L9FA 2FADA 2KGAA 1F80D 3EJDA 2K92A 2LTEA 2N98A 2MR7A 4BPFA 2AF8A 2GDYA 2LIWA 1DV5A 2FACA 2N5IA 2JU1A 2KGDA 1HY8A 1X3OA 2CNRA 2DNWA 2L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MY5 A;  5KP6 B;  2KG9 A;  4NEO A;  2JGP A;  4MRT C;  5KP8 B;  2LKI A;  3CE7 A;  2KG8 A;  1KLP A;  2KR5 A;  1HQB A;  2K2Q A;  4PXH B;  5HV8 A;  2KOO A;  2FVA A;  2EHT A;  2M5R A;  2LPK A;  1NQ4 A;  5KP7 B;  1L0H A;  2PNG A;  3NY7 B;  2N5H A;  2CQ8 A;  2LIU A;  4PWV B;  4R0M A;  2MF4 A;  2ROQ A;  4H2X C;  3GZL A;  2FQ2 A;  4CA3 A;  1T8K A;  2K94 A;  2FVF A;  4BPG A;  2K0Y A;  4H2W C;  2MVU A;  2KW2 A;  2CGQ A;  2QNW A;  1AF8 A;  1OR5 A;  2KOP A;  2EHS A;  3RG2 A;  2XZ1 C;  2KOR A;  1L0I A;  1DNY A;  2KGE A;  2KG6 A;  2VSQ A;  2KWL A;  2LL8 A;  2FQ1 A;  2JQ4 A;  2X2B A;  4BPH A;  2FHS C;  5CZD B;  2L4B A;  2AFE A;  4IZ6 A;  2LOL A;  4DG9 A;  5EJD A;  2LML A;  2FQ0 A;  2JU2 A;  2FVE A;  2XZ0 D;  2GDW A;  2KGC A;  3GZM A;  3LMO A;  2CG5 B;  2N50 A;  5HVC A;  2AFD A;  2N6Z A;  2GDX A;  2K0X A;  3EJB A;  2MD9 A;  2N6Y A;  2L0Q A;  4H2Y C;  2AVA A;  2KOQ A;  3EJE A;  2MVV A;  2MR8 A;  2FAE A;  2KOS A;  4HKG A;  1VKU A;  1ACP A;  2K93 A;  2L9F A;  2FAD A;  2KGA A;  1F80 D;  3EJD A;  2K92 A;  2LTE A;  2N98 A;  2MR7 A;  4BPF A;  2AF8 A;  2GDY A;  2LIW A;  1DV5 A;  2FAC A;  2N5I A;  2JU1 A;  2KGD A;  1HY8 A;  1X3O A;  2CNR A;  2DNW A;  2L22 A; 
#chains in the Genus database with same CATH topology
 1JJ2 O;  2OAR A;  2L6E A;  2JGP A;  3Q20 A;  4F37 A;  4PXH B;  2K2Q A;  3CCR P;  2VLN A;  1L0H A;  5F2K A;  2N5H A;  2CQ8 A;  3G1G A;  3GZL A;  2FQ2 A;  4CA3 A;  1T8K A;  1N8R Q;  1E0H A;  4BPG A;  2JO0 A;  1Q7Y Q;  3NTE A;  2OTJ P;  1BXI A;  1YIJ P;  2BUO A;  1VQK P;  2KOD A;  2M8P A;  2LL8 A;  2E1M A;  1Q81 Q;  2X2B A;  4BPH A;  5CZD B;  1BAJ A;  4U0D A;  3CCM P;  2AFE A;  3DS1 A;  5EJD A;  2LML A;  3GZM A;  2JU2 A;  3LMO A;  1A43 A;  4U0A A;  3VRL C;  3G1I A;  1RO2 A;  1KD1 Q;  5BS2 A;  2Z45 A;  1A8O A;  4U0E A;  3CCJ P;  4WYM A;  2MD9 A;  1M6E X;  2KOQ A;  2MR8 A;  3H4E A;  2PEN A;  2FAE A;  1QVF O;  4IPY A;  3RG6 C;  2K93 A;  3OW2 O;  1QRJ A;  2LTE A;  4M0I A;  2M8L A;  3G0V A;  3CCL P;  2LIW A;  1VQO P;  2VLO A;  2JB0 A;  4U0F A;  1EIA A;  1VQ5 P;  2MY5 A;  3CME P;  1CEI A;  4MRT C;  2XV6 A;  1EOQ A;  1HQB A;  2XXM A;  1UNK A;  5HV8 A;  2KOO A;  2EHT A;  2M5R A;  2LF4 A;  2PEJ A;  2PEQ A;  1NQ4 A;  1K30 A;  3NY7 B;  5F2O A;  4PH1 A;  2LIU A;  3WBH A;  2MF4 A;  3B4Q A;  3GKL C;  1IMP A;  4COP A;  5BS1 A;  3P05 A;  3I55 P;  2KW2 A;  4GR2 A;  2CGQ A;  1AUM A;  2GZE A;  1Z6M A;  1OR5 A;  2KOP A;  1YIT P;  1M1K Q;  1DNY A;  1Q82 Q;  2KG6 A;  2VSQ A;  1D1D A;  2KWL A;  2NO8 A;  3CC4 P;  5JPA A;  5DCK A;  4U0B A;  1VQ4 P;  4IZ6 A;  2LOL A;  3CCS P;  7CEI A;  2JAZ A;  3CPW O;  2FQ0 A;  2GDW A;  1K8A Q;  2PEM A;  2N50 A;  3DS4 A;  2P9X A;  2K0D X;  4U0C A;  1GPJ A;  2K5X A;  1AYI A;  3M1M A;  1EMV A;  2EFJ A;  2AVA A;  2MVV A;  2KOS A;  1GXH A;  3DS2 A;  2Z44 A;  2MR7 A;  2CWO A;  2PEK A;  2QA4 P;  2EIA A;  2FAC A;  4PH0 A;  1RO0 A;  2GZI A;  1YI2 P;  3G26 A;  1VQL P;  2WPT A;  2GZG A;  1VQN P;  5KP6 B;  2KG9 A;  3G28 A;  5KP8 B;  3CE7 A;  2KG8 A;  2XT1 A;  2JBG A;  2KR5 A;  3DS0 A;  3I56 P;  5HGN A;  3CCV P;  4R0M A;  4PWV B;  4H2X C;  3B5I A;  2FVF A;  2K0Y A;  1UJZ A;  1AF8 A;  2EHS A;  3H0D A;  2XZ1 C;  1L0I A;  2M8N A;  1YJN P;  2Z46 A;  2DGY A;  3G71 P;  4XRO A;  2GZJ A;  5F2N A;  2FHS C;  1E6J P;  2L4B A;  5HGO A;  4DG9 A;  3LRY A;  2XZ0 D;  2KGC A;  3H47 A;  2CG5 B;  4QNB A;  2AFD A;  3CCE P;  2GDX A;  1ZNV A;  2PY8 A;  3U43 A;  1Q86 Q;  3G4S P;  3G29 A;  1K9M Q;  2L0Q A;  1VQP P;  2OTL P;  1KQS O;  4QKO A;  4HKG A;  3HYB A;  1VKU A;  1ACP A;  2KGA A;  3EJD A;  5EW5 E;  1VQ8 P;  4UHP B;  2N98 A;  1VQ9 P;  2AF8 A;  2GDY A;  2PEI A;  1DV5 A;  2ONT A;  4XRQ A;  1YJ9 P;  2CNR A;  5HGM A;  2L22 A;  1VHN A;  1M90 Q;  1IUQ A;  1MZ8 A;  2JYL A;  2GZF A;  4NEO A;  2LKI A;  1KLP A;  2FVA A;  2LPK A;  5HGL A;  5KP7 B;  3DS3 A;  2PNG A;  2ROQ A;  1VQ6 P;  1FR2 A;  3MGE A;  2K94 A;  4H2W C;  1VQM P;  2MVU A;  2QNW A;  3CXC O;  5I4T G;  2VLP A;  3CC2 P;  3RG2 A;  3G21 A;  1ZMB A;  2KOR A;  3DPH A;  1YHQ P;  2KGE A;  4GR6 A;  1S72 P;  2FQ1 A;  2JQ4 A;  1GXG A;  3CMA P;  3CCU P;  3E2D A;  1NJI Q;  3CC7 P;  1M74 A;  2FVE A;  3DS5 A;  3GJN A;  2ERH A;  4XFX A;  5HVC A;  3CCQ P;  2N6Z A;  3HZQ A;  2K0X A;  1QVG O;  3DTJ A;  2QEX P;  1W2B O;  3G6E P;  3EJB A;  2N6Y A;  4H2Y C;  1M6N A;  3EJE A;  2GYK A;  2JYG A;  1KC8 Q;  2EG5 A;  1K73 Q;  2L9F A;  2BHV A;  2FAD A;  1F80 D;  3CD6 P;  2K92 A;  4BPF A;  4XFZ A;  1YJW P;  2VLQ A;  2N5I A;  2JU1 A;  1IMQ A;  2KGD A;  4COC A;  1HY8 A;  1X3O A;  4XFY A;  2DNW A;  1RNI A;  1VQ7 P;  2PEO A; 
#chains in the Genus database with same CATH homology
 2MY5 A;  5KP6 B;  2KG9 A;  4NEO A;  2JGP A;  4MRT C;  5KP8 B;  2LKI A;  3CE7 A;  2KG8 A;  1KLP A;  2KR5 A;  1HQB A;  2K2Q A;  4PXH B;  5HV8 A;  2KOO A;  2FVA A;  2EHT A;  2M5R A;  2LPK A;  1NQ4 A;  5KP7 B;  1L0H A;  2PNG A;  3NY7 B;  2N5H A;  2CQ8 A;  2LIU A;  4PWV B;  4R0M A;  2MF4 A;  2ROQ A;  4H2X C;  3GZL A;  2FQ2 A;  4CA3 A;  1T8K A;  2K94 A;  2FVF A;  4BPG A;  2K0Y A;  4H2W C;  2MVU A;  2KW2 A;  2CGQ A;  2QNW A;  1AF8 A;  1OR5 A;  2KOP A;  2EHS A;  3RG2 A;  2XZ1 C;  2KOR A;  1L0I A;  1DNY A;  2KGE A;  2KG6 A;  2VSQ A;  2KWL A;  2LL8 A;  2FQ1 A;  2JQ4 A;  2X2B A;  4BPH A;  2FHS C;  5CZD B;  2L4B A;  2AFE A;  4IZ6 A;  2LOL A;  4DG9 A;  5EJD A;  2LML A;  2FQ0 A;  2JU2 A;  2FVE A;  2XZ0 D;  2GDW A;  2KGC A;  3GZM A;  3LMO A;  2CG5 B;  2N50 A;  5HVC A;  2AFD A;  2N6Z A;  2GDX A;  2K0X A;  3EJB A;  2MD9 A;  2N6Y A;  2L0Q A;  4H2Y C;  2AVA A;  2KOQ A;  3EJE A;  2MVV A;  2MR8 A;  2FAE A;  2KOS A;  4HKG A;  1VKU A;  1ACP A;  2K93 A;  2L9F A;  2FAD A;  2KGA A;  1F80 D;  3EJD A;  2K92 A;  2LTE A;  2N98 A;  2MR7 A;  4BPF A;  2AF8 A;  2GDY A;  2LIW A;  1DV5 A;  2FAC A;  2N5I A;  2JU1 A;  2KGD A;  1HY8 A;  1X3O A;  2CNR A;  2DNW A;  2L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...