3CCUP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccuP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccuP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccuP02
1VQ6P 1YIJP 1K73Q 1VQ5P 1YJWP 1YJNP 3CCVP 1QVGO 1KC8Q 1VQNP 3CCUP 3CCRP 1VQMP 1QVFO 1S72P 2OTJP 3G71P 3CCEP 3CD6P 2QA4P 1K8AQ 1YI2P 3CC2P 1Q86Q 3CPWO 3CC7P 3CCQP 3G4SP 1VQPP 1VQKP 1JJ2O 3CXCO 3CCMP 1VQ4P 1Q81Q 1YITP 3CMEP 3G6EP 1K9MQ 3CCLP 1Q7YQ 3I56P 1N8RQ 1VQ8P 1YJ9P 1YHQP 1M90Q 1VQLP 3CCJP 3CCSP 3OW2O 1W2BO 1KD1Q 1VQ9P 3I55P 1VQOP 3CMAP 2OTLP 2QEXP 1NJIQ 1KQSO 1M1KQ 3CC4P 1VQ7P 1Q82Q
chains in the Genus database with same CATH superfamily
3H1HE 3I5CA 2GA1A 1FDMA 2E75C 1LT1A 2GDYA 3RL0D 4H2XC 1M7LA 2LPKA 4R0MA 3TSIA 2FXMA 2WSCH 3C9IA 4U3FE 1EDKA 3K5BA 1KYOD 3JSVC 1IFPA 1AVYA 4I6MC 3HE5A 1PP9J 1AUMA 1NTMJ 3LMOA 2Z4EA 2IDBA 2I1JA 3VRLC 2P9XA 2N9YB 1PEOA 5BU8B 1ZOYC 2NZ2A 2R3CA 1RF1C 1NTKJ 1JCDA 1NKZB 4AUWA 4PXHB 3GF7A 3QH9A 1JUNA 5KTBA 2E5TA 5K5GB 2N1TC 1KQFB 2QRXA 3L70J 3PLNA 3SWYA 1T2KC 2K9JB 2JAZA 2UWJE 3L71J 3GLMA 4BRYB 3L71D 2E42A 2K92A 3FX0A 3L71E 3M9QA 4I7ZB 4RO0A 4DT0A 2JQ4A 2L22A 2Y9ZA 1SQQE 2LR2A 1FDOA 2K0DX 1YQ3C 1S1CX 4M0IA 2WSEH 3AE9C 1RHZB 1K04A 3TGUE 3GHGB 5AW3B 3AE3C 1M6EX 3A0HE 3CC2P 2ZT9B 3L74D 2YKOA 1IFIA 1L0NK 3MTUE 4L75A 1VHNA 2R5BA 3FXDA 2BHVA 1L0NJ 1FAVA 1KD1Q 3CX5D 1G1IA 3Q5SA 2W8ZA 2JDIH 2ZVNB 2NPSB 4WVZA 1OVUA 2O01H 2BEZF 3KZIH 1DH3A 3CLQA 1MFZA 4PD4I 1ZMBA 1T6AA 5KP8B 3RG2A 2FYUJ 2G3AA 3CXHI 1LTTC 2LXBA 2KOSA 2Y9YA 3HD7A 1EMVA 3NY7B 4UB8E 2JP3A 2PY8A 4C7NA 1NHLA 1N7SD 2O1KA 2Q3IA 1IZNB 1NH4A 3WU2H 1QL2A 4NPEA 1D1DA 1HTLC 1MZ9A 3CWBJ 5E79H 5CZDB 2CPSA 3TNUB 1X9VA 3E1IA 1USEA 3PP5A 2FKWB 1HJBA 2PEMA 4H2WC 3AECC 1RH5B 2N5IA 3IF4A 5KAFE 5AVSB 1NTME 1NVOA 2HPCA 3G1GA 3CCVP 3CCEP 2PEKA 1LP1A 3H1LJ 1PPJG 1DEBA 1FU1A 1KQGB 2KZJA 3L72E 3BCCJ 3WUUA 1GXHA 1KILA 4U0EA 3I55P 2QG4A 3LIDA 2RMZA 2ZXEB 3UIAA 1SFCA 3IR9A 2RN0A 1BCCD 1QGKB 1ZN5A 1BCCE 3H1LE 1E79H 3MD0A 5BS1A 2NRGA 1VF5D 3KXDA 3H32B 3DS5A 2E76D 3CCJP 3OAKA 5GTIE 3H1IG 4U0FA 2PEIA 1BXIA 2MR7A 3MGEA 1VDFA 4Z1MH 1SQVG 2IBZE 2QVAA 3USSA 2JO1A 1NTKD 2QA4P 4U3FD 1H0TA 2LF4A 2QJKC 2IFMA 2L4BA 3H1HD 2G8YA 2FYNC 3C8VA 2GZGA 1SQBJ 4U3FG 1KN7A 1SQBK 2GUSA 1RY3A 2WQYC 1EIAA 1YI2P 3CE7A 1RE4A 1VPCA 1M1JC 2FYZA 3AEFC 1NTZJ 2Y0EA 1LWUB 2P67A 4KJMA 2BASA 5AW5B 4L74A 1VQ8P 2ZT9D 1AJYA 4EI2A 1URQC 5H2FH 4PWVB 4XRQA 2EHTA 3D6ZA 3BRTB 1Q90D 3I56P 2QJYB 4PV1C 1S2EA 2LMLA 1VQ6P 1K73Q 4U0BA 3M91A 1SQXG 2IBZI 2BUOA 3SWFA 1NTZD 5BVZA 1L0LJ 1BCCG 4UB6E 2WT7B 1LT9A 5EW5E 3BCCG 2WSSH 2FADA 1PIXA 1IFJA 3L36A 3TK1A 1QX8A 1JY3O 2K9YA 1NYHA 3H1IE 1U7MA 2V7QJ 1KLPA 1SQQK 3A0BE 4OVNF 1G2CB 2JYGA 2FY8A 2P58A 3Q5PA 1JMBA 4BXLA 5GTHE 4PD4E 4H0LC 3D71A 5HVCA 2QSIA 1MKMA 1ZNVA 3H1IJ 2W6AA 3RGUA 1NAFA 1PEQA 1KFNA 3AEAC 5CJ4A 2KZIA 2LKIA 2C0XA 3VYIA 2K94A 2CK3H 3Q5RA 1LGHB 2FQ0A 1SQXJ 2M5RA 5BS2A 5CCHC 1SQXK 4W7ZA 2E76C 3G28A 1HF9A 4A7PA 1YBKA 4BPHA 1FZAA 4HKGA 2PEJA 3L72D 2QE7H 5BU5A 2FVEA 4WWIA 3L75E 4PV1D 3L75G 3GKLC 1DV5A 2IBZD 3CPWO 3CCQP 1GL2A 3A0HH 2LTEA 4NPDA 3O8ZA 4H2YC 1Y8AA 2PEQA 5EFWB 1K9MQ 2N1TB 2WMMA 3II6A 3GZMA 4JYBA 3ABVC 4ASWA 3E1RA 2SPZA 3G26A 1QVGO 1IO4A 1HVVA 1SQVD 2B9BA 3L70E 3L70D 4DOJA 3L35A 4BWNA 2IYPA 1YITP 1L2PA 2KGCA 2W90A 1N7LA 4OGQC 1FJPA 3BRVB 1GK6A 1ZR2A 4XROA 4PJ0H 4UB8H 1HGVA 1OW8A 3H1KD 3H1KE 2I8DA 4H13D 4WY4B 3SFDC 1P84H 1WRGA 3A7OA 4OH8B 4RKUJ 1WT6A 1SQBD 4IL6H 3HE4B 1IFNA 2N1TA 5AW7B 1BDDA 1BE3E 2YNYA 2JJLA 2QJPB 2CQ8A 3DS2A 1EOQA 5KJ7D 2O3JA 1MFTA 2KLUA 1VQ4P 2M5AB 3ITKA 4I2LC 3G1IA 4H13B 2PENA 1NTKG 3RBZA 2KSJA 5KAFH 1GPJA 2L91A 2BQ1E 2KG9A 2K3RA 2KWLA 1BSHA 2POHA 2YKPA 1DD4A 1JY2N 2E1MA 1VKUA 1T8KA 4Y99B 1SLQA 3B5ND 3HD7C 1JJ2O 5TISH 1EC5A 2KB7P 1CZQA 2RKLA 5KLVE 1SQQD 2HG5D 2P7JA 4O9BA 3BATA 1GU5A 4COPA 1N86A 1SFCD 5AW6B 1RE3C 1IK7A 2FVFA 1QL1A 5CCGD 1R5LA 3M0DA 2JWDA 1JY3P 5APVA 1P84I 3L75J 3G0VA 1HQBA 1OMIA 2XKMA 1CEIA 2KGAA 1RQVA 5HGMA 2QJYC 3CC7P 1CI6A 1SFCB 2HYNA 1YJNP 2K88A 1AF8A 2FXOA 1KYOH 4JQ0D 3CI9A 2B87B 4GIFA 1Y47A 2KUBA 1PGJA 3B4SA 2OYHB 1AA0A 3GJNA 2KXPB 2PEOA 3SFEC 3OA7A 1L0LK 4B86A 3MUDC 2PGDA 3CD6P 2D2CC 2ZYGA 3W67A 2QIWA 4Y28J 5AW1B 1EDJA 2C9NY 1ZMEC 5KP7B 2GZIA 3H1JD 1YTZI 3U1AA 1S5LE 2A06G 2CG5B 1XTGB 3HTKA 5KLVD 1RNIA 4CPGA 1P84E 3H1JG 1PGOA 1SQVE 1OW6A 3B71A 4U7JA 4D6TD 1KTMA 3P7KA 3M0DC 4WYMA 3O6QA 5AW9B 4R4LA 3W68A 3WBHA 2K5XA 2CPBA 3HUSC 2YKQA 1FR2A 3AE6C 1BAJA 3ZDMA 1N73C 5B66H 3CX5H 1FJKA 1GU4A 1PP9D 4IFMA 2FFDA 1ZRTE 5B66E 4W7YA 2FQ2A 2FAEA 1IC2A 1NTKE 3AEEC 1GL2C 2R5DA 3G29A 1JY3N 1FZFA 1CI6B 1TU3F 3G21A 1T3UA 1KFMA 2KYVA 3KPEA 4GT1A 2AEMA 1S3JA 1S9KD 4IPYA 5TISE 3CXHH 1NU1G 1L0IA 1FZBA 4IZ6A 3AE1C 4XFZA 3RL0B 1PGQA 3VOPA 1GL2B 2C9LY 3CXCO 1S5LH 2HLOA 1PPJD 3A2AA 2O1JA 5APYA 2EFJA 3M0AA 2WPTA 3G9RA 2OYOA 3CX5E 3RK3E 1NGMB 1OIPA 1JTHB 1Q86Q 1GL2D 5APXA 5AW0B 1PP9G 1X8YA 4WBAA 2N9BA 2XXMA 4PH0A 3CCMP 3TGUJ 1RQUA 1FZCB 2NO8A 4ZMDA 4HH2A 1VF5B 2IZ1A 3WMM0 3RG6C 1VQ5P 5AW4B 1UNKA 4L76A 1L0NE 2A06D 1K30A 2N98A 2KSEA 3LW5H 3MP7B 3P32A 1NU1K 1PZQA 5APSA 2JO0A 2NPSC 1M90Q 1X0TA 2L0QA 4PV1B 3E7KA 2KG8A 2Z44A 2Y0CA 3HZQA 1JTHA 1HUCA 2A45I 2CWOA 5KLVG 3RK2D 2BEQD 1W5CE 1L0ND 1FOSF 1ZW0A 1VQKP 4PD4D 3MIWA 4XFJA 3TGUG 2KS1A 3IAOA 3CCLP 4D6TE 1AFOA 1UIXA 3VMYA 2YMKA 1VQOP 3DPHA 3CMAP 4WB4A 2IPPA 1KORA 4D6TJ 3H47A 1YJWP 1EZVG 3P8MC 4NPFX 1QVFO 3CX5I 2FYUE 2D2CD 4NEOA 2M8LA 3H25A 1LJ2A 4IL6X 4U0CA 1L0NG 3G3ZA 2KNCB 2JGPA 1NTMG 2KG6A 1RE4C 3FWNA 4GDOA 2MR8A 2N5HA 1S72P 2YO3A 4H44B 2WVRA 1KB9E 4GOFA 1F80D 4BRYA 1J1DB 1LTGC 3B5NA 3MGNA 2KS1B 3GG2A 4C7NB 1KZUB 3H1KJ 4HB1A 1L4AB 3LIEA 1JEKA 4H0LB 1VQ9P 2L9FA 1KV4A 4IOIH 3PRJA 1LTJA 2V7QH 3D70A 2H89C 1S5LX 2XZ1C 2QM8A 4ZKPA 2W6JH 2OYIB 3M1MA 3D6YA 1FZGA 1N73B 5CCGA 2EHSA 4TT3H 4H44C 1OXZA 2E75B 1QRJA 2FHSC 2YIUC 3PH0A 2P1JA 1YHQP 1GTWA 3RL0C 2ZXXA 4MN4C 2XV5A 2N6ZA 3B5NC 3HD7D 2M5AA 4HYTB 2ZAEB 3FWLA 1URQA 3HTKB 1SQXE 3CCRP 2KNCA 2OTJP 3A3YB 1KYOI 1N7SA 1LT9C 3PHLA 1FOSE 3KHUA 2XZ0D 1JCCA 4C7RA 2MJZA 2M8RA 3F5HA 1D7MA 3AEBC 2HODB 2JEEA 5APWA 3IN6A 3HD7B 2OQQA 2X2BA 5KLVK 1PGPA 5GTHH 1NKNA 2HR3A 1KB9I 1T3JA 2GDWA 2GYKA 1NTZE 5CBOA 2FVAA 2YXQB 2WWWA 2OYHA 2R32A 1USDA 2A45H 1M1JB 4AYCA 1M8OB 1MUUA 3EWKA 2NPSA 1H89A 1ZRTD 1M1KQ 3DS4A 2KK7A 2XNXA 3AE5C 5APTA 2ITAA 1NU1E 2ZJSE 2DNWA 2KGEA 3NMDA 5AVXB 1A43A 4CA3A 1SQPD 5TJHA 3RK3B 1NO4A 2I1KA 1BE3G 1U57A 2L5GB 3GHGA 2LIUA 1R8EA 1DD3A 2AFEA 5AVWB 2GZFA 2XZRA 2IZ0A 3EFGA 3SSUA 3HYBA 1KYOE 4F37A 1JNMA 3WUTA 2K93A 1N73A 3B4QA 1NQ4A 3OJAB 5F2KA 1IFMA 2M3BA 1GW3A 2Z5IA 2OTLP 5KAIE 1Q82Q 3TYYA 3EJDA 4XFYA 1R5SA 2IFNA 5AVZB 3NTEA 3V5BA 1AQTA 3CXHD 2GZJA 5CJ0A 3KDPB 2WZ7A 2LL8A 2EIAA 3H4EA 3A0BH 4N78E 2Z5HA 4OGQB 2KR5A 1W2BO 4IFFA 2KP8A 2M8NA 1BSNA 1EXIA 2BCCJ 3V2QA 2JBGA 2D2CB 2XT1A 1AVOA 3VTPC 3CWBD 2LXCB 1VQMP 3HRNA 3M06A 5AVTB 1GW4A 5DCKA 2WPRA 7CEIA 2HFED 3L4FA 2VRSA 4LC1A 2JKVA 1NTKK 1RO0A 5KKZB 3RK3C 4XFXA 3AE7C 3JCUE 1A8OA 1NU1D 2BCCE 4KHXA 2VLNA 4H44D 4IL6E 4YTPC 3L74E 1AQ5A 1MV8A 2QM7A 3A5TA 1SQPE 1QEXA 4BPGA 3S4RA 1RF1A 1E5WA 2AEFA 4GKGA 1JOCA 1EDIA 2FYUK 1G1JA 1HH0A 2CNRA 1JO5A 2KLVA 1BGYG 3G6EP 1J1DC 2P10A 1A02F 5KLIB 1MZ8A 4TLFA 1L4AC 1KILE 4RESB 2YO2A 1SQQG 1ZP0C 3M9BA 3O6QB 2DGYA 4H13C 1NU1J 2WPVB 4MRTC 2WSCJ 1SQPK 4AQRD 2J59M 1RE3A 2ZVOB 2WT7A 1PP9E 2Q9IA 4K35A 4GOEA 2H43A 1HY8A 2Q3EA 2FFDB 2ZFCA 4I7ZC 1GMJA 3VN0A 2LKMA 3MZWB 5DJTB 1BDCA 5AVYB 1EZVI 3V4WA 2B89A 3LRYA 2EG5A 3PJSK 2ZT9C 1NJIQ 2VLOA 2MD9A 1LTJB 3IFMA 1OVRA 2IBZG 5CBNA 4ZKUA 1SQQJ 2K2QA 2VSQA 5CCGC 1OW7A 3Q2YA 5AVUB 2XV6A 2LOLA 2Q7CA 2Q1KA 2QJPC 2E74D 1SQPG 5F2NA 3MUDA 3V2PA 1M57D 3KZIE 1GDTA 1K8AQ 3DS1A 3EQ2A 1UJZA 2KORA 1JB0J 3GW6A 2MF4A 2VLPA 1IJDB 2YIUB 1Q7YQ 3VP8A 1NAYA 2FBWC 1OR5A 1KILD 1Q2NA 3L73G 5F2OA 1IK9A 1AYIA 2O01J 2KOOA 4GR6A 2K37A 4HKZH 3G4SP 5KP6B 3AE4C 1EZVE 1Q81Q 2QNWA 1J1EB 3P05A 2QJKB 3B8EB 4DG9A 1OVVA 1URQD 2R3SA 3L72G 1PFIA 1NTZK 3T97B 2V4HA 3BVHA 1JMMA 4ZNCA 3VMXA 3H32A 4U0AA 2WSFJ 1FBMA 1A02J 3NXSA 5AW8B 1RO2A 3E2DA 4LLHA 5AW2B 1EQ7A 2OYHC 3N7NA 1SQVK 2MVUA 1KB9D 3H0DA 1HBWA 3GMAA 3L73J 3EJBA 1KB9H 2WTYA 4JBZA 2ERHA 3V6IA 3Q1MA 4EDFA 4UHPB 1BCCJ 3AEDC 3FXEA 3FGAD 1T2KD 3SWKA 3TF5A 1SQBG 2HODA 3L72J 1KILC 2N6YA 5EJDA 3AEGC 1LTAC 1ACPA 3LW5J 4D6TG 3CL3D 2Z45A 2B87A 3BCCD 4GODA 2BCCD 2FQ1A 2IYOA 2XNDH 3CCSP 1JY2O 1NTZG 3HE5B 4DCKA 1H88A 2H7HA 2ZYAA 1GZLA 3DS3A 2E74B 4M3LA 3VMAA 1SQVJ 2PRRA 2ROQA 3AE8C 1RF0C 4Y99C 1GXGA 2ONTA 2KOQA 3L70G 2E5YA 2E74C 2DW3A 1OX3A 1FZCC 1BGYE 2K0YA 2A45G 4EOTA 1LTJC 3DTJA 1HWTC 3WUVA 1M1JA 3L71G 1DNYA 2OTKE 2GUVA 5CCHA 1X79B 4U3FJ 5HGOA 4WY4D 1YYCA 3R4YA 3M9HA 5HGNA 1NWQA 2AXTH 2H88C 2W27A 3S1KA 2PNGA 5KKZC 2FFDC 2J5UA 2VLQA 3H1HJ 3QWOC 1LWUC 2GDXA 3U43A 1N7SB 2K0XA 3DS0A 1WMKA 2M3EA 1UIIA 1URQB 4U0DA 1CSBA 3L73E 3EJEA 3WU2E 1HGZA 2C0WA 4QKOA 3L75D 5CHXA 1PV3A 3P8CE 3N4XA 3BCCE 1VQNP 3V2NA 3EFFK 1PPJE 5AVRB 5APQA 1L4AD 3RBXA 2KOGA 2LIWA 4GR2A 4YPCA 2M0BA 5KAIH 1S4XA 4XE5B 1KMIZ 1SP4A 3H6PA 4KT0J 1J2JB 2JR8A 1X3OA 3U59A 1JY2P 1LTIC 1BGYD 4R4MA 4ASVA 1YTZT 1J1EC 3GZLA 2B88A 2CGQA 1GD2E 3GHGC 4HJGH 3F89A 3T97A 1SQXD 2JWAA 3HE4A 1EDLA 2KOPA 1N2DC 2W83C 2ZYDA 1E0HA 1XTCC 2E76B 4K3AA 1PL5A 3L37A 5HGLA 3JC22 3H1JJ 1HJ0A 5C39A 1EZVD 2H8PD 2KIKA 1SQBE 4IFDK 1DX7A 1IMPA 1M74A 2OYIC 3JCUH 1YJ9P 1VQLP 1YQ4C 2FACA 1L0LD 1VQ7P 1BGYJ 3B5IA 2N1TD 2HPCB 3L73D 2RH0A 3V2RA 1IUQA 2FYUG 2Q5UA 5KJ7A 1VQPP 2OGUA 2PAJA 2Y0DA 3NFQA 1ZLLA 2MY5A 3KQGA 2AF8A 1OWAA 1FC2C 2Q6QA 2JU1A 3PTZA 1E6JP 2O01N 3CC4P 1GK4A 3Q3DA 1YIJP 1DEEG 3H1HG 3HUSA 1JM0A 2YXRB 3NTNA 2J58A 3H1LD 5KJ7C 1K05A 1OZHA 5B5EH 1LWUA 4QMAA 3OW2O 1LNQA 3V4QA 1PEUA 1FZCA 1L0HA 5H2FE 5B5EE 5I4TG 1LT9B 4N3YB 4YXWH 1BE3D 2KW2A 4PD4H 2M8PA 2Z46A 2AXCA 1M56D 1N7SC 1LP1B 3TNUA 1CW5A 4PH1A 1SS1A 1PEMA 5L8RJ 3RL0g 1VL2A 2K1AA 1ZV8A 1RF0A 2MVVA 3CCUP 1T8ZA 4N78D 2JU2A 1KQLA 5KLIC 1OFCX 1L0LE 1Z6MA 1FZEA 2KODA 4RJTA 2A06E 2FYNB 3R2PA 1SVFA 1G2CA 1SQPJ 1Z56A 4WY4C 5GTIH 2PP6A 1DIPA 4W80A 1IFDA 1P84D 1S9KE 1KC8Q 2R44A 2AFDA 1IMQA 5E79E 3U1CA 2E75D 4UB6H 2IX7C 1ZR4A 1EXJA 4DZOA 1NTMD 2YMYA 3C1LA 2WSFH 3H1JE 2WPQA 3S9OA 1U7JA 4XA4A 1N8RQ 4L73A 1ZXGA 1RF1B 2PFXA 2OARA 1NOHA 2JYLA 1H0TB 1AV1A 2AEJA 4C46A 4BPFA 5HV8A 5AVQB 3MHVA 3BASA 3TDKA 1W2EA 4JYCA 2XU6A 3CXHE 3L74J 3P8CD 3AE2C 5CMZA 3TGUD 3CWBG 4DJGA 3CMEP 4COCA 2N50A 1FS0E 3G71P 2WSEJ 1Y9BA 1QLED 2WITA 5AVVB 4PJ0E 3VP9A 4EIJA 2KI7B 1M6NA 2W6BA 1SFCC 1LTBC 1KILB 2E43A 2L6EA 2JB0A 5CCHD 2OYIA 4YXDC 4WY4A 3Q20A 3H1KG 3H1LG 3RK2B 1X22A 2GM4A 4I1LA 5APUA 3L74G 1L0LG 2AXTE 4JF7A 3VMZA 2XDJA 2KGDA 3RK3D 3RK2C 5DJUB 4EYYQ 3H1ID 2FXPA 3GF3A 2FYUD 2AVAA 4QNBA 2GZEA 4LGDE 4OWFA 1BE3J 1NTMK 4JPZB 2WPSA 2BCCG 4N6JA 2NPSD 1VF5C 2P2UA 1FE6A 1KQSO 2MKVA 5KLVJ 3HUSB 1H8AA 1FDIA 5JPAA 3KYQA 1L4AA 3B5NB 1LTSC 3CWBE 4H0LD 2QEXP 2K9JA 4OGQD 5M1BA
chains in the Genus database with same CATH topology
3M1MA 3G26A 3RG6C 4COPA 1VQ6P 1K73Q 1VQ5P 1QVGO 4COCA 4U0BA 1BAJA 3DS3A 2BUOA 3HYBA 5I4TG 3G71P 1K30A 4GR6A 5BS1A 2DGYA 2ONTA 3G4SP 1ZMBA 2M8PA 3G0VA 2Z46A 1QRJA 1M6NA 1Q81Q 1YITP 5F2KA 2JO0A 4PH1A 3DS5A 1YHQP 5HGMA 1M90Q 3CCJP 3P05A 3DTJA 1AUMA 1PEMA 2OTLP 4U0FA 2Z44A 2PEIA 3CC7P 3VRLC 1Q82Q 3HZQA 2L6EA 3MGEA 4XROA 1YJNP 2P9XA 4XFYA 2JYGA 3CCUP 5HGOA 3CCRP 2CWOA 3NTEA 1PEOA 3Q20A 5HGLA 2OTJP 2PY8A 2QA4P 3G29A 5HGNA 1VQKP 2EIAA 3H4EA 4U0AA 3G21A 2KODA 1M74A 3CCLP 3LRYA 2LF4A 2EG5A 1YJ9P 1VQLP 1D1DA 1W2BO 1VQOP 3DPHA 3CMAP 2M8NA 1RO2A 3E2DA 1NJIQ 3DS0A 1PEQA 2PEOA 1VQ7P 3B5IA 3H47A 4IPYA 2XT1A 1KC8Q 1YJWP 1QVFO 1VQMP 4U0DA 3H0DA 1IUQA 3DS2A 3CD6P 4XFZA 1EIAA 5DCKA 1YI2P 1EOQA 4QNBA 1VQPP 3CXCO 5BS2A 1RO0A 2M8LA 2PEMA 3G28A 1VQ4P 4XFXA 3G1IA 4U0CA 2PENA 1N8RQ 1VQ8P 1A8OA 2XV6A 2PEJA 2BQ1E 2EFJA 1E6JP 4M0IA 1KQSO 1M1KQ 3CC4P 2OARA 3DS4A 1YIJP 3G1GA 2JYLA 3CCVP 1VQNP 5F2NA 4XRQA 1S72P 1M6EX 3CCEP 2E1MA 2PEKA 5JPAA 1K8AQ 1RNIA 3DS1A 3CC2P 1Q86Q 1A43A 2Z45A 3CPWO 3CCQP 1JJ2O 2XXMA 4PH0A 3CCMP 2BHVA 2PEQA 3CMEP 3G6EP 1K9MQ 4WYMA 1Q7YQ 3I56P 4GR2A 1KD1Q 3CCSP 3OW2O 1VQ9P 4U0EA 3I55P 3WBHA 2QEXP 5F2OA 1PEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 P;  1YIJ P;  1K73 Q;  1VQ5 P;  1YJW P;  1YJN P;  3CCV P;  1QVG O;  1KC8 Q;  1VQN P;  3CCU P;  3CCR P;  1VQM P;  1QVF O;  1S72 P;  2OTJ P;  3G71 P;  3CCE P;  3CD6 P;  2QA4 P;  1K8A Q;  1YI2 P;  3CC2 P;  1Q86 Q;  3CPW O;  3CC7 P;  3CCQ P;  3G4S P;  1VQP P;  1VQK P;  1JJ2 O;  3CXC O;  3CCM P;  1VQ4 P;  1Q81 Q;  1YIT P;  3CME P;  3G6E P;  1K9M Q;  3CCL P;  1Q7Y Q;  3I56 P;  1N8R Q;  1VQ8 P;  1YJ9 P;  1YHQ P;  1M90 Q;  1VQL P;  3CCJ P;  3CCS P;  3OW2 O;  1W2B O;  1KD1 Q;  1VQ9 P;  3I55 P;  1VQO P;  3CMA P;  2OTL P;  2QEX P;  1NJI Q;  1KQS O;  1M1K Q;  3CC4 P;  1VQ7 P;  1Q82 Q; 
#chains in the Genus database with same CATH topology
 3H1H E;  3I5C A;  2GA1 A;  1FDM A;  2E75 C;  1LT1 A;  2GDY A;  3RL0 D;  4H2X C;  1M7L A;  2LPK A;  4R0M A;  3TSI A;  2FXM A;  2WSC H;  3C9I A;  4U3F E;  1EDK A;  3K5B A;  1KYO D;  3JSV C;  1IFP A;  1AVY A;  4I6M C;  3HE5 A;  1PP9 J;  1AUM A;  1NTM J;  3LMO A;  2Z4E A;  2IDB A;  2I1J A;  3VRL C;  2P9X A;  2N9Y B;  1PEO A;  5BU8 B;  1ZOY C;  2NZ2 A;  2R3C A;  1RF1 C;  1NTK J;  1JCD A;  1NKZ B;  4AUW A;  4PXH B;  3GF7 A;  3QH9 A;  1JUN A;  5KTB A;  2E5T A;  5K5G B;  2N1T C;  1KQF B;  2QRX A;  3L70 J;  3PLN A;  3SWY A;  1T2K C;  2K9J B;  2JAZ A;  2UWJ E;  3L71 J;  3GLM A;  4BRY B;  3L71 D;  2E42 A;  2K92 A;  3FX0 A;  3L71 E;  3M9Q A;  4I7Z B;  4RO0 A;  4DT0 A;  2JQ4 A;  2L22 A;  2Y9Z A;  1SQQ E;  2LR2 A;  1FDO A;  2K0D X;  1YQ3 C;  1S1C X;  4M0I A;  2WSE H;  3AE9 C;  1RHZ B;  1K04 A;  3TGU E;  3GHG B;  5AW3 B;  3AE3 C;  1M6E X;  3A0H E;  3CC2 P;  2ZT9 B;  3L74 D;  2YKO A;  1IFI A;  1L0N K;  3MTU E;  4L75 A;  1VHN A;  2R5B A;  3FXD A;  2BHV A;  1L0N J;  1FAV A;  1KD1 Q;  3CX5 D;  1G1I A;  3Q5S A;  2W8Z A;  2JDI H;  2ZVN B;  2NPS B;  4WVZ A;  1OVU A;  2O01 H;  2BEZ F;  3KZI H;  1DH3 A;  3CLQ A;  1MFZ A;  4PD4 I;  1ZMB A;  1T6A A;  5KP8 B;  3RG2 A;  2FYU J;  2G3A A;  3CXH I;  1LTT C;  2LXB A;  2KOS A;  2Y9Y A;  3HD7 A;  1EMV A;  3NY7 B;  4UB8 E;  2JP3 A;  2PY8 A;  4C7N A;  1NHL A;  1N7S D;  2O1K A;  2Q3I A;  1IZN B;  1NH4 A;  3WU2 H;  1QL2 A;  4NPE A;  1D1D A;  1HTL C;  1MZ9 A;  3CWB J;  5E79 H;  5CZD B;  2CPS A;  3TNU B;  1X9V A;  3E1I A;  1USE A;  3PP5 A;  2FKW B;  1HJB A;  2PEM A;  4H2W C;  3AEC C;  1RH5 B;  2N5I A;  3IF4 A;  5KAF E;  5AVS B;  1NTM E;  1NVO A;  2HPC A;  3G1G A;  3CCV P;  3CCE P;  2PEK A;  1LP1 A;  3H1L J;  1PPJ G;  1DEB A;  1FU1 A;  1KQG B;  2KZJ A;  3L72 E;  3BCC J;  3WUU A;  1GXH A;  1KIL A;  4U0E A;  3I55 P;  2QG4 A;  3LID A;  2RMZ A;  2ZXE B;  3UIA A;  1SFC A;  3IR9 A;  2RN0 A;  1BCC D;  1QGK B;  1ZN5 A;  1BCC E;  3H1L E;  1E79 H;  3MD0 A;  5BS1 A;  2NRG A;  1VF5 D;  3KXD A;  3H32 B;  3DS5 A;  2E76 D;  3CCJ P;  3OAK A;  5GTI E;  3H1I G;  4U0F A;  2PEI A;  1BXI A;  2MR7 A;  3MGE A;  1VDF A;  4Z1M H;  1SQV G;  2IBZ E;  2QVA A;  3USS A;  2JO1 A;  1NTK D;  2QA4 P;  4U3F D;  1H0T A;  2LF4 A;  2QJK C;  2IFM A;  2L4B A;  3H1H D;  2G8Y A;  2FYN C;  3C8V A;  2GZG A;  1SQB J;  4U3F G;  1KN7 A;  1SQB K;  2GUS A;  1RY3 A;  2WQY C;  1EIA A;  1YI2 P;  3CE7 A;  1RE4 A;  1VPC A;  1M1J C;  2FYZ A;  3AEF C;  1NTZ J;  2Y0E A;  1LWU B;  2P67 A;  4KJM A;  2BAS A;  5AW5 B;  4L74 A;  1VQ8 P;  2ZT9 D;  1AJY A;  4EI2 A;  1URQ C;  5H2F H;  4PWV B;  4XRQ A;  2EHT A;  3D6Z A;  3BRT B;  1Q90 D;  3I56 P;  2QJY B;  4PV1 C;  1S2E A;  2LML A;  1VQ6 P;  1K73 Q;  4U0B A;  3M91 A;  1SQX G;  2IBZ I;  2BUO A;  3SWF A;  1NTZ D;  5BVZ A;  1L0L J;  1BCC G;  4UB6 E;  2WT7 B;  1LT9 A;  5EW5 E;  3BCC G;  2WSS H;  2FAD A;  1PIX A;  1IFJ A;  3L36 A;  3TK1 A;  1QX8 A;  1JY3 O;  2K9Y A;  1NYH A;  3H1I E;  1U7M A;  2V7Q J;  1KLP A;  1SQQ K;  3A0B E;  4OVN F;  1G2C B;  2JYG A;  2FY8 A;  2P58 A;  3Q5P A;  1JMB A;  4BXL A;  5GTH E;  4PD4 E;  4H0L C;  3D71 A;  5HVC A;  2QSI A;  1MKM A;  1ZNV A;  3H1I J;  2W6A A;  3RGU A;  1NAF A;  1PEQ A;  1KFN A;  3AEA C;  5CJ4 A;  2KZI A;  2LKI A;  2C0X A;  3VYI A;  2K94 A;  2CK3 H;  3Q5R A;  1LGH B;  2FQ0 A;  1SQX J;  2M5R A;  5BS2 A;  5CCH C;  1SQX K;  4W7Z A;  2E76 C;  3G28 A;  1HF9 A;  4A7P A;  1YBK A;  4BPH A;  1FZA A;  4HKG A;  2PEJ A;  3L72 D;  2QE7 H;  5BU5 A;  2FVE A;  4WWI A;  3L75 E;  4PV1 D;  3L75 G;  3GKL C;  1DV5 A;  2IBZ D;  3CPW O;  3CCQ P;  1GL2 A;  3A0H H;  2LTE A;  4NPD A;  3O8Z A;  4H2Y C;  1Y8A A;  2PEQ A;  5EFW B;  1K9M Q;  2N1T B;  2WMM A;  3II6 A;  3GZM A;  4JYB A;  3ABV C;  4ASW A;  3E1R A;  2SPZ A;  3G26 A;  1QVG O;  1IO4 A;  1HVV A;  1SQV D;  2B9B A;  3L70 E;  3L70 D;  4DOJ A;  3L35 A;  4BWN A;  2IYP A;  1YIT P;  1L2P A;  2KGC A;  2W90 A;  1N7L A;  4OGQ C;  1FJP A;  3BRV B;  1GK6 A;  1ZR2 A;  4XRO A;  4PJ0 H;  4UB8 H;  1HGV A;  1OW8 A;  3H1K D;  3H1K E;  2I8D A;  4H13 D;  4WY4 B;  3SFD C;  1P84 H;  1WRG A;  3A7O A;  4OH8 B;  4RKU J;  1WT6 A;  1SQB D;  4IL6 H;  3HE4 B;  1IFN A;  2N1T A;  5AW7 B;  1BDD A;  1BE3 E;  2YNY A;  2JJL A;  2QJP B;  2CQ8 A;  3DS2 A;  1EOQ A;  5KJ7 D;  2O3J A;  1MFT A;  2KLU A;  1VQ4 P;  2M5A B;  3ITK A;  4I2L C;  3G1I A;  4H13 B;  2PEN A;  1NTK G;  3RBZ A;  2KSJ A;  5KAF H;  1GPJ A;  2L91 A;  2BQ1 E;  2KG9 A;  2K3R A;  2KWL A;  1BSH A;  2POH A;  2YKP A;  1DD4 A;  1JY2 N;  2E1M A;  1VKU A;  1T8K A;  4Y99 B;  1SLQ A;  3B5N D;  3HD7 C;  1JJ2 O;  5TIS H;  1EC5 A;  2KB7 P;  1CZQ A;  2RKL A;  5KLV E;  1SQQ D;  2HG5 D;  2P7J A;  4O9B A;  3BAT A;  1GU5 A;  4COP A;  1N86 A;  1SFC D;  5AW6 B;  1RE3 C;  1IK7 A;  2FVF A;  1QL1 A;  5CCG D;  1R5L A;  3M0D A;  2JWD A;  1JY3 P;  5APV A;  1P84 I;  3L75 J;  3G0V A;  1HQB A;  1OMI A;  2XKM A;  1CEI A;  2KGA A;  1RQV A;  5HGM A;  2QJY C;  3CC7 P;  1CI6 A;  1SFC B;  2HYN A;  1YJN P;  2K88 A;  1AF8 A;  2FXO A;  1KYO H;  4JQ0 D;  3CI9 A;  2B87 B;  4GIF A;  1Y47 A;  2KUB A;  1PGJ A;  3B4S A;  2OYH B;  1AA0 A;  3GJN A;  2KXP B;  2PEO A;  3SFE C;  3OA7 A;  1L0L K;  4B86 A;  3MUD C;  2PGD A;  3CD6 P;  2D2C C;  2ZYG A;  3W67 A;  2QIW A;  4Y28 J;  5AW1 B;  1EDJ A;  2C9N Y;  1ZME C;  5KP7 B;  2GZI A;  3H1J D;  1YTZ I;  3U1A A;  1S5L E;  2A06 G;  2CG5 B;  1XTG B;  3HTK A;  5KLV D;  1RNI A;  4CPG A;  1P84 E;  3H1J G;  1PGO A;  1SQV E;  1OW6 A;  3B71 A;  4U7J A;  4D6T D;  1KTM A;  3P7K A;  3M0D C;  4WYM A;  3O6Q A;  5AW9 B;  4R4L A;  3W68 A;  3WBH A;  2K5X A;  2CPB A;  3HUS C;  2YKQ A;  1FR2 A;  3AE6 C;  1BAJ A;  3ZDM A;  1N73 C;  5B66 H;  3CX5 H;  1FJK A;  1GU4 A;  1PP9 D;  4IFM A;  2FFD A;  1ZRT E;  5B66 E;  4W7Y A;  2FQ2 A;  2FAE A;  1IC2 A;  1NTK E;  3AEE C;  1GL2 C;  2R5D A;  3G29 A;  1JY3 N;  1FZF A;  1CI6 B;  1TU3 F;  3G21 A;  1T3U A;  1KFM A;  2KYV A;  3KPE A;  4GT1 A;  2AEM A;  1S3J A;  1S9K D;  4IPY A;  5TIS E;  3CXH H;  1NU1 G;  1L0I A;  1FZB A;  4IZ6 A;  3AE1 C;  4XFZ A;  3RL0 B;  1PGQ A;  3VOP A;  1GL2 B;  2C9L Y;  3CXC O;  1S5L H;  2HLO A;  1PPJ D;  3A2A A;  2O1J A;  5APY A;  2EFJ A;  3M0A A;  2WPT A;  3G9R A;  2OYO A;  3CX5 E;  3RK3 E;  1NGM B;  1OIP A;  1JTH B;  1Q86 Q;  1GL2 D;  5APX A;  5AW0 B;  1PP9 G;  1X8Y A;  4WBA A;  2N9B A;  2XXM A;  4PH0 A;  3CCM P;  3TGU J;  1RQU A;  1FZC B;  2NO8 A;  4ZMD A;  4HH2 A;  1VF5 B;  2IZ1 A;  3WMM 0;  3RG6 C;  1VQ5 P;  5AW4 B;  1UNK A;  4L76 A;  1L0N E;  2A06 D;  1K30 A;  2N98 A;  2KSE A;  3LW5 H;  3MP7 B;  3P32 A;  1NU1 K;  1PZQ A;  5APS A;  2JO0 A;  2NPS C;  1M90 Q;  1X0T A;  2L0Q A;  4PV1 B;  3E7K A;  2KG8 A;  2Z44 A;  2Y0C A;  3HZQ A;  1JTH A;  1HUC A;  2A45 I;  2CWO A;  5KLV G;  3RK2 D;  2BEQ D;  1W5C E;  1L0N D;  1FOS F;  1ZW0 A;  1VQK P;  4PD4 D;  3MIW A;  4XFJ A;  3TGU G;  2KS1 A;  3IAO A;  3CCL P;  4D6T E;  1AFO A;  1UIX A;  3VMY A;  2YMK A;  1VQO P;  3DPH A;  3CMA P;  4WB4 A;  2IPP A;  1KOR A;  4D6T J;  3H47 A;  1YJW P;  1EZV G;  3P8M C;  4NPF X;  1QVF O;  3CX5 I;  2FYU E;  2D2C D;  4NEO A;  2M8L A;  3H25 A;  1LJ2 A;  4IL6 X;  4U0C A;  1L0N G;  3G3Z A;  2KNC B;  2JGP A;  1NTM G;  2KG6 A;  1RE4 C;  3FWN A;  4GDO A;  2MR8 A;  2N5H A;  1S72 P;  2YO3 A;  4H44 B;  2WVR A;  1KB9 E;  4GOF A;  1F80 D;  4BRY A;  1J1D B;  1LTG C;  3B5N A;  3MGN A;  2KS1 B;  3GG2 A;  4C7N B;  1KZU B;  3H1K J;  4HB1 A;  1L4A B;  3LIE A;  1JEK A;  4H0L B;  1VQ9 P;  2L9F A;  1KV4 A;  4IOI H;  3PRJ A;  1LTJ A;  2V7Q H;  3D70 A;  2H89 C;  1S5L X;  2XZ1 C;  2QM8 A;  4ZKP A;  2W6J H;  2OYI B;  3M1M A;  3D6Y A;  1FZG A;  1N73 B;  5CCG A;  2EHS A;  4TT3 H;  4H44 C;  1OXZ A;  2E75 B;  1QRJ A;  2FHS C;  2YIU C;  3PH0 A;  2P1J A;  1YHQ P;  1GTW A;  3RL0 C;  2ZXX A;  4MN4 C;  2XV5 A;  2N6Z A;  3B5N C;  3HD7 D;  2M5A A;  4HYT B;  2ZAE B;  3FWL A;  1URQ A;  3HTK B;  1SQX E;  3CCR P;  2KNC A;  2OTJ P;  3A3Y B;  1KYO I;  1N7S A;  1LT9 C;  3PHL A;  1FOS E;  3KHU A;  2XZ0 D;  1JCC A;  4C7R A;  2MJZ A;  2M8R A;  3F5H A;  1D7M A;  3AEB C;  2HOD B;  2JEE A;  5APW A;  3IN6 A;  3HD7 B;  2OQQ A;  2X2B A;  5KLV K;  1PGP A;  5GTH H;  1NKN A;  2HR3 A;  1KB9 I;  1T3J A;  2GDW A;  2GYK A;  1NTZ E;  5CBO A;  2FVA A;  2YXQ B;  2WWW A;  2OYH A;  2R32 A;  1USD A;  2A45 H;  1M1J B;  4AYC A;  1M8O B;  1MUU A;  3EWK A;  2NPS A;  1H89 A;  1ZRT D;  1M1K Q;  3DS4 A;  2KK7 A;  2XNX A;  3AE5 C;  5APT A;  2ITA A;  1NU1 E;  2ZJS E;  2DNW A;  2KGE A;  3NMD A;  5AVX B;  1A43 A;  4CA3 A;  1SQP D;  5TJH A;  3RK3 B;  1NO4 A;  2I1K A;  1BE3 G;  1U57 A;  2L5G B;  3GHG A;  2LIU A;  1R8E A;  1DD3 A;  2AFE A;  5AVW B;  2GZF A;  2XZR A;  2IZ0 A;  3EFG A;  3SSU A;  3HYB A;  1KYO E;  4F37 A;  1JNM A;  3WUT A;  2K93 A;  1N73 A;  3B4Q A;  1NQ4 A;  3OJA B;  5F2K A;  1IFM A;  2M3B A;  1GW3 A;  2Z5I A;  2OTL P;  5KAI E;  1Q82 Q;  3TYY A;  3EJD A;  4XFY A;  1R5S A;  2IFN A;  5AVZ B;  3NTE A;  3V5B A;  1AQT A;  3CXH D;  2GZJ A;  5CJ0 A;  3KDP B;  2WZ7 A;  2LL8 A;  2EIA A;  3H4E A;  3A0B H;  4N78 E;  2Z5H A;  4OGQ B;  2KR5 A;  1W2B O;  4IFF A;  2KP8 A;  2M8N A;  1BSN A;  1EXI A;  2BCC J;  3V2Q A;  2JBG A;  2D2C B;  2XT1 A;  1AVO A;  3VTP C;  3CWB D;  2LXC B;  1VQM P;  3HRN A;  3M06 A;  5AVT B;  1GW4 A;  5DCK A;  2WPR A;  7CEI A;  2HFE D;  3L4F A;  2VRS A;  4LC1 A;  2JKV A;  1NTK K;  1RO0 A;  5KKZ B;  3RK3 C;  4XFX A;  3AE7 C;  3JCU E;  1A8O A;  1NU1 D;  2BCC E;  4KHX A;  2VLN A;  4H44 D;  4IL6 E;  4YTP C;  3L74 E;  1AQ5 A;  1MV8 A;  2QM7 A;  3A5T A;  1SQP E;  1QEX A;  4BPG A;  3S4R A;  1RF1 A;  1E5W A;  2AEF A;  4GKG A;  1JOC A;  1EDI A;  2FYU K;  1G1J A;  1HH0 A;  2CNR A;  1JO5 A;  2KLV A;  1BGY G;  3G6E P;  1J1D C;  2P10 A;  1A02 F;  5KLI B;  1MZ8 A;  4TLF A;  1L4A C;  1KIL E;  4RES B;  2YO2 A;  1SQQ G;  1ZP0 C;  3M9B A;  3O6Q B;  2DGY A;  4H13 C;  1NU1 J;  2WPV B;  4MRT C;  2WSC J;  1SQP K;  4AQR D;  2J59 M;  1RE3 A;  2ZVO B;  2WT7 A;  1PP9 E;  2Q9I A;  4K35 A;  4GOE A;  2H43 A;  1HY8 A;  2Q3E A;  2FFD B;  2ZFC A;  4I7Z C;  1GMJ A;  3VN0 A;  2LKM A;  3MZW B;  5DJT B;  1BDC A;  5AVY B;  1EZV I;  3V4W A;  2B89 A;  3LRY A;  2EG5 A;  3PJS K;  2ZT9 C;  1NJI Q;  2VLO A;  2MD9 A;  1LTJ B;  3IFM A;  1OVR A;  2IBZ G;  5CBN A;  4ZKU A;  1SQQ J;  2K2Q A;  2VSQ A;  5CCG C;  1OW7 A;  3Q2Y A;  5AVU B;  2XV6 A;  2LOL A;  2Q7C A;  2Q1K A;  2QJP C;  2E74 D;  1SQP G;  5F2N A;  3MUD A;  3V2P A;  1M57 D;  3KZI E;  1GDT A;  1K8A Q;  3DS1 A;  3EQ2 A;  1UJZ A;  2KOR A;  1JB0 J;  3GW6 A;  2MF4 A;  2VLP A;  1IJD B;  2YIU B;  1Q7Y Q;  3VP8 A;  1NAY A;  2FBW C;  1OR5 A;  1KIL D;  1Q2N A;  3L73 G;  5F2O A;  1IK9 A;  1AYI A;  2O01 J;  2KOO A;  4GR6 A;  2K37 A;  4HKZ H;  3G4S P;  5KP6 B;  3AE4 C;  1EZV E;  1Q81 Q;  2QNW A;  1J1E B;  3P05 A;  2QJK B;  3B8E B;  4DG9 A;  1OVV A;  1URQ D;  2R3S A;  3L72 G;  1PFI A;  1NTZ K;  3T97 B;  2V4H A;  3BVH A;  1JMM A;  4ZNC A;  3VMX A;  3H32 A;  4U0A A;  2WSF J;  1FBM A;  1A02 J;  3NXS A;  5AW8 B;  1RO2 A;  3E2D A;  4LLH A;  5AW2 B;  1EQ7 A;  2OYH C;  3N7N A;  1SQV K;  2MVU A;  1KB9 D;  3H0D A;  1HBW A;  3GMA A;  3L73 J;  3EJB A;  1KB9 H;  2WTY A;  4JBZ A;  2ERH A;  3V6I A;  3Q1M A;  4EDF A;  4UHP B;  1BCC J;  3AED C;  3FXE A;  3FGA D;  1T2K D;  3SWK A;  3TF5 A;  1SQB G;  2HOD A;  3L72 J;  1KIL C;  2N6Y A;  5EJD A;  3AEG C;  1LTA C;  1ACP A;  3LW5 J;  4D6T G;  3CL3 D;  2Z45 A;  2B87 A;  3BCC D;  4GOD A;  2BCC D;  2FQ1 A;  2IYO A;  2XND H;  3CCS P;  1JY2 O;  1NTZ G;  3HE5 B;  4DCK A;  1H88 A;  2H7H A;  2ZYA A;  1GZL A;  3DS3 A;  2E74 B;  4M3L A;  3VMA A;  1SQV J;  2PRR A;  2ROQ A;  3AE8 C;  1RF0 C;  4Y99 C;  1GXG A;  2ONT A;  2KOQ A;  3L70 G;  2E5Y A;  2E74 C;  2DW3 A;  1OX3 A;  1FZC C;  1BGY E;  2K0Y A;  2A45 G;  4EOT A;  1LTJ C;  3DTJ A;  1HWT C;  3WUV A;  1M1J A;  3L71 G;  1DNY A;  2OTK E;  2GUV A;  5CCH A;  1X79 B;  4U3F J;  5HGO A;  4WY4 D;  1YYC A;  3R4Y A;  3M9H A;  5HGN A;  1NWQ A;  2AXT H;  2H88 C;  2W27 A;  3S1K A;  2PNG A;  5KKZ C;  2FFD C;  2J5U A;  2VLQ A;  3H1H J;  3QWO C;  1LWU C;  2GDX A;  3U43 A;  1N7S B;  2K0X A;  3DS0 A;  1WMK A;  2M3E A;  1UII A;  1URQ B;  4U0D A;  1CSB A;  3L73 E;  3EJE A;  3WU2 E;  1HGZ A;  2C0W A;  4QKO A;  3L75 D;  5CHX A;  1PV3 A;  3P8C E;  3N4X A;  3BCC E;  1VQN P;  3V2N A;  3EFF K;  1PPJ E;  5AVR B;  5APQ A;  1L4A D;  3RBX A;  2KOG A;  2LIW A;  4GR2 A;  4YPC A;  2M0B A;  5KAI H;  1S4X A;  4XE5 B;  1KMI Z;  1SP4 A;  3H6P A;  4KT0 J;  1J2J B;  2JR8 A;  1X3O A;  3U59 A;  1JY2 P;  1LTI C;  1BGY D;  4R4M A;  4ASV A;  1YTZ T;  1J1E C;  3GZL A;  2B88 A;  2CGQ A;  1GD2 E;  3GHG C;  4HJG H;  3F89 A;  3T97 A;  1SQX D;  2JWA A;  3HE4 A;  1EDL A;  2KOP A;  1N2D C;  2W83 C;  2ZYD A;  1E0H A;  1XTC C;  2E76 B;  4K3A A;  1PL5 A;  3L37 A;  5HGL A;  3JC2 2;  3H1J J;  1HJ0 A;  5C39 A;  1EZV D;  2H8P D;  2KIK A;  1SQB E;  4IFD K;  1DX7 A;  1IMP A;  1M74 A;  2OYI C;  3JCU H;  1YJ9 P;  1VQL P;  1YQ4 C;  2FAC A;  1L0L D;  1VQ7 P;  1BGY J;  3B5I A;  2N1T D;  2HPC B;  3L73 D;  2RH0 A;  3V2R A;  1IUQ A;  2FYU G;  2Q5U A;  5KJ7 A;  1VQP P;  2OGU A;  2PAJ A;  2Y0D A;  3NFQ A;  1ZLL A;  2MY5 A;  3KQG A;  2AF8 A;  1OWA A;  1FC2 C;  2Q6Q A;  2JU1 A;  3PTZ A;  1E6J P;  2O01 N;  3CC4 P;  1GK4 A;  3Q3D A;  1YIJ P;  1DEE G;  3H1H G;  3HUS A;  1JM0 A;  2YXR B;  3NTN A;  2J58 A;  3H1L D;  5KJ7 C;  1K05 A;  1OZH A;  5B5E H;  1LWU A;  4QMA A;  3OW2 O;  1LNQ A;  3V4Q A;  1PEU A;  1FZC A;  1L0H A;  5H2F E;  5B5E E;  5I4T G;  1LT9 B;  4N3Y B;  4YXW H;  1BE3 D;  2KW2 A;  4PD4 H;  2M8P A;  2Z46 A;  2AXC A;  1M56 D;  1N7S C;  1LP1 B;  3TNU A;  1CW5 A;  4PH1 A;  1SS1 A;  1PEM A;  5L8R J;  3RL0 g;  1VL2 A;  2K1A A;  1ZV8 A;  1RF0 A;  2MVV A;  3CCU P;  1T8Z A;  4N78 D;  2JU2 A;  1KQL A;  5KLI C;  1OFC X;  1L0L E;  1Z6M A;  1FZE A;  2KOD A;  4RJT A;  2A06 E;  2FYN B;  3R2P A;  1SVF A;  1G2C A;  1SQP J;  1Z56 A;  4WY4 C;  5GTI H;  2PP6 A;  1DIP A;  4W80 A;  1IFD A;  1P84 D;  1S9K E;  1KC8 Q;  2R44 A;  2AFD A;  1IMQ A;  5E79 E;  3U1C A;  2E75 D;  4UB6 H;  2IX7 C;  1ZR4 A;  1EXJ A;  4DZO A;  1NTM D;  2YMY A;  3C1L A;  2WSF H;  3H1J E;  2WPQ A;  3S9O A;  1U7J A;  4XA4 A;  1N8R Q;  4L73 A;  1ZXG A;  1RF1 B;  2PFX A;  2OAR A;  1NOH A;  2JYL A;  1H0T B;  1AV1 A;  2AEJ A;  4C46 A;  4BPF A;  5HV8 A;  5AVQ B;  3MHV A;  3BAS A;  3TDK A;  1W2E A;  4JYC A;  2XU6 A;  3CXH E;  3L74 J;  3P8C D;  3AE2 C;  5CMZ A;  3TGU D;  3CWB G;  4DJG A;  3CME P;  4COC A;  2N50 A;  1FS0 E;  3G71 P;  2WSE J;  1Y9B A;  1QLE D;  2WIT A;  5AVV B;  4PJ0 E;  3VP9 A;  4EIJ A;  2KI7 B;  1M6N A;  2W6B A;  1SFC C;  1LTB C;  1KIL B;  2E43 A;  2L6E A;  2JB0 A;  5CCH D;  2OYI A;  4YXD C;  4WY4 A;  3Q20 A;  3H1K G;  3H1L G;  3RK2 B;  1X22 A;  2GM4 A;  4I1L A;  5APU A;  3L74 G;  1L0L G;  2AXT E;  4JF7 A;  3VMZ A;  2XDJ A;  2KGD A;  3RK3 D;  3RK2 C;  5DJU B;  4EYY Q;  3H1I D;  2FXP A;  3GF3 A;  2FYU D;  2AVA A;  4QNB A;  2GZE A;  4LGD E;  4OWF A;  1BE3 J;  1NTM K;  4JPZ B;  2WPS A;  2BCC G;  4N6J A;  2NPS D;  1VF5 C;  2P2U A;  1FE6 A;  1KQS O;  2MKV A;  5KLV J;  3HUS B;  1H8A A;  1FDI A;  5JPA A;  3KYQ A;  1L4A A;  3B5N B;  1LTS C;  3CWB E;  4H0L D;  2QEX P;  2K9J A;  4OGQ D;  5M1B A; 
#chains in the Genus database with same CATH homology
 3M1M A;  3G26 A;  3RG6 C;  4COP A;  1VQ6 P;  1K73 Q;  1VQ5 P;  1QVG O;  4COC A;  4U0B A;  1BAJ A;  3DS3 A;  2BUO A;  3HYB A;  5I4T G;  3G71 P;  1K30 A;  4GR6 A;  5BS1 A;  2DGY A;  2ONT A;  3G4S P;  1ZMB A;  2M8P A;  3G0V A;  2Z46 A;  1QRJ A;  1M6N A;  1Q81 Q;  1YIT P;  5F2K A;  2JO0 A;  4PH1 A;  3DS5 A;  1YHQ P;  5HGM A;  1M90 Q;  3CCJ P;  3P05 A;  3DTJ A;  1AUM A;  1PEM A;  2OTL P;  4U0F A;  2Z44 A;  2PEI A;  3CC7 P;  3VRL C;  1Q82 Q;  3HZQ A;  2L6E A;  3MGE A;  4XRO A;  1YJN P;  2P9X A;  4XFY A;  2JYG A;  3CCU P;  5HGO A;  3CCR P;  2CWO A;  3NTE A;  1PEO A;  3Q20 A;  5HGL A;  2OTJ P;  2PY8 A;  2QA4 P;  3G29 A;  5HGN A;  1VQK P;  2EIA A;  3H4E A;  4U0A A;  3G21 A;  2KOD A;  1M74 A;  3CCL P;  3LRY A;  2LF4 A;  2EG5 A;  1YJ9 P;  1VQL P;  1D1D A;  1W2B O;  1VQO P;  3DPH A;  3CMA P;  2M8N A;  1RO2 A;  3E2D A;  1NJI Q;  3DS0 A;  1PEQ A;  2PEO A;  1VQ7 P;  3B5I A;  3H47 A;  4IPY A;  2XT1 A;  1KC8 Q;  1YJW P;  1QVF O;  1VQM P;  4U0D A;  3H0D A;  1IUQ A;  3DS2 A;  3CD6 P;  4XFZ A;  1EIA A;  5DCK A;  1YI2 P;  1EOQ A;  4QNB A;  1VQP P;  3CXC O;  5BS2 A;  1RO0 A;  2M8L A;  2PEM A;  3G28 A;  1VQ4 P;  4XFX A;  3G1I A;  4U0C A;  2PEN A;  1N8R Q;  1VQ8 P;  1A8O A;  2XV6 A;  2PEJ A;  2BQ1 E;  2EFJ A;  1E6J P;  4M0I A;  1KQS O;  1M1K Q;  3CC4 P;  2OAR A;  3DS4 A;  1YIJ P;  3G1G A;  2JYL A;  3CCV P;  1VQN P;  5F2N A;  4XRQ A;  1S72 P;  1M6E X;  3CCE P;  2E1M A;  2PEK A;  5JPA A;  1K8A Q;  1RNI A;  3DS1 A;  3CC2 P;  1Q86 Q;  1A43 A;  2Z45 A;  3CPW O;  3CCQ P;  1JJ2 O;  2XXM A;  4PH0 A;  3CCM P;  2BHV A;  2PEQ A;  3CME P;  3G6E P;  1K9M Q;  4WYM A;  1Q7Y Q;  3I56 P;  4GR2 A;  1KD1 Q;  3CCS P;  3OW2 O;  1VQ9 P;  4U0E A;  3I55 P;  3WBH A;  2QEX P;  5F2O A;  1PEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...