3CCUP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccuP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccuP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccuP02
1YJ9P 3G71P 3CXCO 1VQ4P 1VQNP 3G6EP 1QVFO 3CMAP 3G4SP 1VQMP 3OW2O 3CCEP 2OTJP 1YIJP 1NJIQ 1Q82Q 3CCVP 1YJWP 3CD6P 1Q86Q 3CCSP 1VQKP 1VQ5P 1YJNP 1YI2P 1VQ7P 1VQPP 3CC2P 2QEXP 3CC7P 1W2BO 1YITP 3CCMP 1VQOP 1K9MQ 3CMEP 3CCUP 1S72P 1K73Q 1VQ6P 1Q7YQ 1N8RQ 1K8AQ 1YHQP 2QA4P 3I55P 3CC4P 3CCRP 1M90Q 1KQSO 1JJ2O 2OTLP 1Q81Q 1QVGO 1KC8Q 3CCJP 3CCLP 1M1KQ 1KD1Q 1VQ8P 3CPWO 1VQ9P 1VQLP 3CCQP 3I56P
chains in the Genus database with same CATH superfamily
3H47A 4R4MA 3TK1A 1VQMP 4JBZA 4H2YC 1QL2A 1G1JA 1ZMBA 2Z46A 1L0LG 2WZ7A 1M8OB 3DS1A 1KN7A 2R5DA 1LGHB 1LT9A 4WY4C 3CCJP 2KB7P 1Z56A 4WY4D 2E74D 3HE4A 4D6TG 1SS1A 3H1LJ 1NTKE 1OFCX 2OGUA 4K35A 1DIPA 3H1HJ 2E75B 2CPSA 1Q86Q 1IFPA 1SQQK 2N1TA 2FQ1A 4H2XC 2QIWA 1L0LE 5L8RJ 3RL0g 2VLOA 1PEOA 4EIJA 1SQPD 1DEEG 5KLIB 3ZDMA 3JCUE 1S9KE 1RNIA 2C0WA 2KSJA 3BRVB 2O01H 1Y47A 1HJ0A 1FE6A 1CI6A 3WU2H 1SFCB 2A45H 3O6QB 2M3EA 1KYOE 3AEGC 3P8MC 4HKGA 2B87A 2KORA 2LXCB 2O3JA 2W6BA 4RO0A 1NTZG 2K0XA 1ZLLA 4IFDK 1JY3N 1GPJA 1YQ4C 1NTKJ 3K5BA 3W67A 1L0LJ 3B5NB 3E2DA 3OJAB 2J59M 3NXSA 1QVGO 2N9YB 5AW5B 3A5TA 2K9YA 1KYOI 3OAKA 2FQ2A 2H8PD 1KQFB 1N7SC 2QRXA 1DV5A 2W90A 2GZJA 2BEQD 2FFDB 1H89A 1UIIA 3TNUA 2PGDA 1H0TA 2CWOA 1M6NA 1VQ6P 2GUVA 2JAZA 2CG5B 4TLFA 3VN0A 2YKPA 2JYLA 2L4BA 2MJZA 3M9HA 4R0MA 5KJ7A 3L71D 1VQ5P 1D1DA 1EZVG 3U1AA 1LP1B 3HUSB 1YHQP 3GHGB 4OGQC 1NTMK 2E76C 5APTA 2E76D 3V5BA 2YO3A 2JU1A 4BPFA 2I8DA 2I1KA 4H0LD 4D6TD 2FAEA 1MFTA 1VKUA 3HE5B 1RE4A 2FHSC 3H1IE 1OX3A 3GZLA 2YKQA 2ZT9B 1SFCA 2JKVA 1USEA 1U7MA 2W6AA 3O6QA 2KODA 2KSEA 3GF3A 3GJNA 3NFQA 3S9OA 3SSUA 1ZOYC 2PENA 1LTJB 3S1KA 5KLVJ 2Z4EA 1SQPK 2YXRB 3TF5A 3G3ZA 2KG9A 2ZFCA 3EQ2A 1VF5B 3V2RA 1X3OA 3G6EP 4L74A 1L0NG 2WSEH 3B5NA 2M0BA 5F2NA 2PEMA 3RG6C 3KQGA 2HPCB 3H1IJ 5APWA 2POHA 1SQXD 2Q1KA 3NY7B 3IF4A 2FYUG 3A0BE 1BAJA 4U0DA 3RL0C 3E7KA 2NPSA 2FFDA 3RL0D 4QKOA 2Q7CA 2JGPA 1KILB 4GIFA 3CXHH 4N3YB 2PEOA 1MZ9A 3L73D 4Y99C 1OVVA 3T97B 1R5LA 5AW9B 5I4TG 2KUBA 2R3SA 2FADA 3GLMA 1QRJA 2E5TA 2L5GB 1LWUC 3V4QA 3U1CA 1MFZA 1RF1B 4IL6H 1LP1A 3HUSA 1NH4A 2K94A 2PEQA 4XFZA 3GHGA 3S4RA 3L75G 2EHTA 4N78E 5AW1B 1EZVD 2LPKA 1WT6A 1N73C 2LOLA 5AVRB 3CWBD 1E79H 3Q5PA 1KC8Q 4WYMA 2BCCE 3L4FA 1W5CE 5AVYB 1JY3P 3AE5C 1JY2O 3M0DC 1S4XA 1SQBD 3CCSP 1RO2A 4BPHA 2LF4A 3L74E 2NRGA 3L75E 3VTPC 1RF0C 3CCMP 3MTUE 1A8OA 1Q7YQ 3L70G 4ZKUA 1FZGA 2ITAA 1LTJA 2CNRA 2K0DX 1OVRA 2Q3IA 1YIJP 1YJWP 2EIAA 5AVQB 1L4AB 2W6JH 2C9NY 2R32A 1EDIA 1PP9G 3G9RA 1JJ2O 5APYA 2BCCJ 2QG4A 1JO5A 3CCQP 3UIAA 3Q1MA 3MD0A 1JTHB 2KI7B 2HPCA 3H32A 3M9QA 4U3FG 3R2PA 1NJIQ 1M1JC 2WSCH 3L74J 1NTZK 4I1LA 2Z45A 3H1JG 1PP9E 1HUCA 1KILE 2FYUD 1HVVA 5AVTB 4CA3A 1PPJE 1KILA 2JO0A 5TISH 5KTBA 2XXMA 3KXDA 2ROQA 2OQQA 4PV1D 3BVHA 3CI9A 3T97A 1URQC 4DT0A 1URQD 2VLQA 2HODB 1YITP 3PJSK 1K73Q 2KS1B 2ZVOB 2KIKA 3H1JE 1Y9BA 3G21A 3HD7D 3CLQA 2G8YA 2WPRA 1ZNVA 2PY8A 3SFDC 1FS0E 4H13B 5AVWB 4JPZB 1SLQA 1P84E 3CXHD 3H1KE 1NKNA 1M90Q 1PP9J 3BCCD 3TGUE 1A43A 1LTBC 2XNDH 5CHXA 3U43A 4NPEA 1FOSF 1PZQA 1AVOA 3IN6A 2XKMA 1GDTA 1SQQD 1EC5A 1SQBK 1H88A 1F80D 1BGYD 3PHLA 1IFJA 3AECC 4YTPC 3LW5J 4C46A 2CQ8A 1HY8A 7CEIA 3CL3D 3H1KJ 2K2QA 3SWYA 1SQVG 3TGUJ 1Z6MA 1FC2C 2QE7H 3WMM0 4GKGA 1QL1A 1OZHA 1NO4A 2J58A 3A0HE 5CCGC 4UB8E 5CCGD 4GDOA 1CW5A 2IBZD 2AFDA 3BATA 1KQLA 3GW6A 4L75A 3SFEC 3U59A 1JY2N 2WSFJ 1W2BO 1RF1C 3NTEA 1HQBA 4DOJA 3H25A 1L0NK 3V2PA 3B5IA 1KD1Q 1GL2D 3I56P 2WSSH 1GW4A 1D7MA 3H1HG 2IZ0A 1IC2A 2KZIA 1MKMA 2FYUK 1PGQA 4H0LB 3HZQA 1PL5A 5E79H 2PEKA 1EIAA 3MUDC 1X8YA 1U7JA 2ERHA 2SPZA 3VP8A 2E1MA 2BHVA 1UNKA 4W7YA 3Q20A 3DS5A 5BU8B 3KYQA 5DJUB 4I7ZB 2XT1A 2FYNB 1FDMA 2P67A 2WMMA 1L4AC 1H0TB 2OYHB 3GZMA 1KYOH 1LTTC 2KOQA 5CCHC 4LLHA 1NTKG 1NTMD 2N5HA 3MP7B 1GTWA 1EDJA 1OVUA 1AVYA 3A7OA 1H8AA 2P7JA 3B4SA 2GDYA 3RBZA 4C7RA 1ZP0C 2JP3A 3VMXA 5KAFE 4KT0J 3RG2A 2KR5A 2YMKA 1T2KC 2HLOA 1T2KD 1BCCG 1GXGA 2N5IA 2ZXXA 1KB9E 2ZVNB 4OWFA 4W7ZA 3RK3B 1JCDA 1KQGB 3FX0A 4B86A 5AW8B 5AW4B 2XZ1C 3L71E 2H89C 3FWLA 3CX5E 3OW2O 2Y9YA 3G28A 1EXJA 4HKZH 1NYHA 3JSVC 3L72G 1BCCE 4WBAA 4WWIA 3MHVA 3AE8C 1AQTA 2P10A 3DTJA 2M8LA 2HFED 5B66E 1GW3A 3LIEA 3H1LD 1DX7A 3H4EA 5KP7B 1VQPP 1KB9I 1FZCB 2PEJA 4C7NB 3L72E 1RH5B 2RN0A 2N98A 3CX5I 1J1DB 2K92A 3L71J 3CXCO 1N2DC 3RK2C 1LJ2A 3PH0A 1N7SD 1RO0A 1E5WA 2A45G 1OW7A 4XFYA 2NPSB 5KLVG 2GZEA 2OYHA 1LT9C 2KLUA 3N7NA 3P32A 4OVNF 1BCCJ 2CPBA 1NAFA 4U0BA 3M06A 4BXLA 5CJ4A 1JNMA 1R5SA 2GDWA 4XE5B 2N1TC 1KFNA 1VL2A 4PXHB 1NTKD 3WU2E 1SQXE 1ZW0A 3H1IG 1BDCA 5KLVE 3LMOA 2QEXP 1JY2P 1L0LD 1ZRTE 1IFNA 1OIPA 3L72J 4OGQD 1EDLA 1N7LA 5AW3B 1S9KD 2GZGA 4PD4H 4XFJA 1M74A 2D2CB 4EYYQ 1VQ4P 3BRTB 3TYYA 1EMVA 3RK3E 4L73A 1KYOD 1KV4A 1IMPA 4XFXA 4H44B 4HYTB 2N9BA 4I2LC 3AE3C 2QJPB 2BASA 2WPTA 2BQ1E 1LTAC 1PIXA 2V7QJ 3M0AA 5KKZB 2A45I 3VMYA 3HD7B 2O01J 5AW0B 2QSIA 5C39A 1SQXJ 3V4WA 1SQVK 2FXMA 3A3YB 2YIUB 2L0QA 4IOIH 5HV8A 1AYIA 4HJGH 1NTZD 1NGMB 3Q2YA 3CPWO 1E6JP 2AEFA 2FYNC 3JC22 5GTIH 3P7KA 1FZCA 4UB6H 4C7NA 1GU5A 4DG9A 3H32B 3C1LA 3L73J 1N8RQ 1FBMA 2HG5D 1L0HA 2P2UA 4YXWH 1RQUA 2Y0EA 3EWKA 2CK3H 5KJ7C 2MVVA 1BE3E 2RH0A 4YXDC 2JBGA 2Z5HA 3P8CD 2OYIB 1KFMA 4NPFX 1YI2P 4NPDA 1IK9A 2YNYA 3CC7P 4JYCA 4PJ0H 5HGLA 2DNWA 4U0AA 2E75C 3A2AA 1FOSE 2E75D 1RE3A 2BCCG 1A02J 1ZN5A 1NU1E 1VQNP 1JMMA 1RE4C 5KLIC 3KZIE 3L74G 1SFCC 2BEZF 2FQ0A 1K05A 4IL6X 1ZXGA 3WBHA 1HGZA 1ZR4A 2RKLA 1NTKK 2AXCA 1AJYA 1BSHA 1CZQA 3GF7A 5KAIH 3C8VA 2K1AA 1BE3J 1L0LK 2KOGA 2LTEA 4BRYB 3KHUA 1QGKB 2JU2A 3AE2C 1GL2B 2A06G 3G1IA 1JM0A 1T6AA 2K93A 1S2EA 3CC4P 1X79B 1KQSO 3GG2A 2FXPA 3HD7A 1OR5A 5BS1A 3B5NC 1EOQA 4XROA 1NU1J 2AEJA 4K3AA 4U0CA 4Z1MH 1GD2E 1KLPA 4PD4D 3P05A 2R44A 1J1EB 2C0XA 3CXHE 5JPAA 2A06E 2KG6A 5AW2B 3PTZA 5B5EH 2FFDC 1IFDA 1HBWA 1PPJG 2XU6A 1CSBA 2P9XA 4WB4A 3V2QA 4WVZA 1UIXA 2ZYDA 2QJKB 2WTYA 1L0ND 1P84H 1EDKA 1X0TA 1TU3F 1YTZI 1KZUB 4Y28J 3CCUP 2Y0CA 1MV8A 1IFMA 2P58A 3MZWB 4MRTC 5M1BA 2KGDA 1IUQA 4U7JA 3AE1C 5HGMA 2OYIA 3HUSC 2AXTE 1VPCA 3GHGC 1FAVA 3VYIA 2LXBA 2KNCB 3CXHI 4WY4B 2IZ1A 4R4LA 5KP8B 2E74B 4N78D 2AF8A 4DJGA 3DS3A 2QVAA 1JUNA 1L2PA 3AEAC 4OH8B 2N6YA 2QNWA 3DPHA 3USSA 3BCCJ 2X2BA 3H1KG 5H2FE 4F37A 3L35A 4H44C 3TGUG 1A02F 4HB1A 4EOTA 3GKLC 4TT3H 1YQ3C 1DH3A 5KLVK 2QJPC 2ZT9C 5AVVB 5AW6B 3G0VA 3L75D 2PEIA 4N6JA 2Q5UA 1SQQJ 3DS2A 1LTJC 4BPGA 2GZFA 1LTGC 4BRYA 2KW2A 1BGYJ 1GL2A 2E42A 2C9LY 2M8RA 1SP4A 1M7LA 1VF5C 4JQ0D 3AE7C 2OYOA 2IFMA 4LC1A 4AUWA 1DEBA 1J2JB 3DS4A 2FYZA 2WITA 3D6ZA 3GMAA 2KK7A 3L70D 4W80A 3BASA 2HR3A 2JYGA 1VQ9P 1OW8A 1E0HA 1NVOA 3HTKA 1S5LX 3IFMA 1NQ4A 2FKWB 1X22A 5EJDA 2EFJA 1UJZA 2QJYB 4XRQA 1KILC 1N7SB 1PP9D 1KILD 4ZMDA 2YXQB 3Q5RA 4IZ6A 1PPJD 2KOPA 2AVAA 2K3RA 4IFFA 2K37A 4U3FD 2KLVA 4JYBA 2WSCJ 3W68A 1SQPG 3H1JD 2XV6A 5DCKA 1GXHA 1GMJA 1GU4A 2KNCA 4WY4A 3AEBC 3M91A 2AFEA 2R5BA 1SVFA 2E76B 1FR2A 2Z5IA 1VQOP 3AEDC 1P84D 3H1KD 3WUTA 1SQPE 4MN4C 5KAFH 4RESB 1S5LE 2B88A 5AVSB 1RQVA 1HJBA 3LRYA 1CEIA 1PGOA 1ZMEC 1NTMJ 2FVAA 1Q2NA 2M5RA 2W8ZA 2MKVA 2GYKA 2DW3A 2PAJA 1IMQA 2V4HA 3JCUH 4A7PA 2XZRA 3CX5H 2I1JA 2WPQA 1L4AD 2WQYC 2MVUA 2IDBA 1NWQA 5CCHD 2GM4A 3EJEA 4HH2A 1VQ7P 3HRNA 2Y9ZA 2WVRA 1LNQA 3C9IA 3G1GA 3FXDA 2QM8A 2QJKC 1SQPJ 2KWLA 2WWWA 4AQRD 1PFIA 3L71G 3V6IA 2B89A 2LL8A 3DS0A 2M5AB 3QH9A 4M0IA 2PNGA 1JCCA 1N7SA 1GK6A 2FVFA 3RL0B 5EW5E 2E74C 3TSIA 3PRJA 1SQVD 3CE7A 2LKMA 5E79E 2MR7A 3SWKA 4M3LA 3CMAP 4Y99B 2JQ4A 2L9FA 4GOEA 1S1CX 1LWUB 2ZYAA 5GTHE 4H13C 2V7QH 3D70A 1Q81Q 4H13D 1VDFA 1AA0A 5APUA 1N73B 3OA7A 1FZBA 4D6TE 3Q3DA 2ZAEB 3H1HD 1MZ8A 2VRSA 2E5YA 1HF9A 4PWVB 2YO2A 2KG8A 5EFWB 3CMEP 2K9JB 1WRGA 1YYCA 1JEKA 2YMYA 1HWTC 1G2CB 1M1KQ 1VQLP 1Q90D 2QM7A 5KP6B 2WPSA 2KZJA 3RK2D 4GT1A 1PEQA 1SQXG 5APVA 5AW7B 4H2WC 5HGNA 1JB0J 2O1KA 3EFGA 1NTZE 1VHNA 2OARA 3AE9C 2B9BA 5CBNA 3EJDA 1KMIZ 2QJYC 1HH0A 5BU5A 2LKIA 4D6TJ 2GUSA 2N1TD 5CMZA 2KGAA 1OMIA 3AE6C 1FZEA 2NO8A 2ZYGA 3L73G 1S72P 2FY8A 2JJLA 1KB9D 3L37A 2M5AA 3V2NA 1M1JB 1NAYA 3ABVC 2GA1A 3H0DA 3CX5D 1HTLC 3P8CE 3AEFC 4L76A 1QEXA 4JF7A 1Y8AA 1ACPA 3A0BH 1IJDB 5CBOA 1YTZT 3L73E 3CWBG 4PV1B 4PH1A 1BCCD 1NTZJ 3FWNA 1URQB 4H0LC 2M8PA 4QNBA 3EFFK 1SQBG 3NTNA 2M3BA 1LWUA 3F89A 1G1IA 3TDKA 1EZVE 1FJKA 2K0YA 2AEMA 3CWBE 1RY3A 1BSNA 3L72D 1N73A 3PP5A 3O8ZA 2PRRA 1T8ZA 3I5CA 4I7ZC 1FDIA 3KZIH 1AF8A 5CJ0A 1BE3G 2LIWA 1XTCC 3D71A 1SQBE 3CCEP 2K9JA 2XNXA 5DJTB 3CCVP 2OYHC 2WPVB 3M0DA 4ASVA 1EXIA 1IK7A 1G2CA 2FACA 3MIWA 1M57D 1RF0A 2O01N 3AEEC 1K04A 1L0IA 1IFIA 2YKOA 2L22A 2L91A 1NU1G 5KJ7D 2IX7C 3MGNA 1EZVI 4U0FA 4PD4E 5AVZB 5HGOA 4O9BA 2IPPA 5KLVD 1ZRTD 1M56D 2FBWC 2CGQA 4AYCA 3CWBJ 3H6PA 2JDIH 3G26A 1HGVA 3Q5SA 2KOSA 2Q9IA 3MGEA 2H88C 1L0NE 3RK3C 3WUUA 1SQBJ 2OTJP 3ITKA 4U0EA 3RK3D 1RHZB 4YPCA 1M1JA 3H1ID 1OXZA 1SFCD 3CCRP 2FYUE 5K5GB 1AV1A 4XA4A 1BXIA 4PD4I 2IFNA 2MY5A 2NZ2A 2M8NA 1GZLA 2K5XA 2P1JA 3RGUA 1Q82Q 3WUVA 1YBKA 5GTIE 1NOHA 2WT7B 3VMAA 1T3UA 3FXEA 1URQA 2Y0DA 4UB6E 1K8AQ 4BWNA 3BCCG 3SWFA 1WMKA 1K30A 1FZFA 2AXTH 4KHXA 1AQ5A 1FJPA 1VQ8P 3HE5A 3RBXA 1USDA 1YJ9P 1FZCC 1PV3A 1QLED 3B5ND 1QVFO 3KDPB 5HVCA 1L0NJ 1AFOA 2ZXEB 5F2OA 1JOCA 5H2FH 1J1DC 3F5HA 2IYPA 3HTKB 1T3JA 3E1IA 1K9MQ 1SQQG 1NHLA 3NMDA 2KGEA 3BCCE 2FYUJ 2NPSC 4PJ0E 2NPSD 4CPGA 1BGYG 4QMAA 3IR9A 3LW5H 1BE3D 2KP8A 1OW6A 1VQKP 2KYVA 2WSEJ 4IL6E 1PGPA 3M9BA 5APXA 1JMBA 1DD4A 3L70E 1RE3C 4GR6A 1SQQE 2OTLP 4GR2A 3EJBA 1IO4A 2W83C 1LT1A 1BGYE 2MD9A 1NU1D 3B4QA 2IBZG 2WSFH 1KTMA 1GK4A 5KAIE 1YJNP 3L75J 2D2CC 2VLPA 2D2CD 2J5UA 1DD3A 5CZDB 2VLNA 4GOFA 4H44D 2BCCD 1IZNB 1MUUA 2PP6A 1SQXK 2GDXA 4PV1C 4U3FE 4DZOA 1PGJA 2RMZA 2G3AA 2IBZE 5CCGA 2ZT9D 2Q3EA 2HYNA 3KPEA 2JB0A 3L74D 5F2KA 2H43A 2MR8A 5KKZC 3L70J 2KOOA 3HD7C 1RF1A 3A0HH 2DGYA 4UB8H 2N6ZA 4EI2A 4DCKA 2YIUC 1AUMA 5TJHA 5B5EE 1OWAA 2WT7A 2K88A 1DNYA 1N86A 2JWAA 4RJTA 2KGCA 2KXPB 3VP9A 1VF5D 4IFMA 3VMZA 3CC2P 2LR2A 1QX8A 2XV5A 2A06D 2ONTA 3QWOC 4NEOA 2FVEA 3MUDA 2IBZI 3E1RA 1NTMG 4U3FJ 4I6MC 2Z44A 3N4XA 5AVUB 1ZV8A 1FU1A 2GZIA 4COPA 2Q6QA 5TISE 3VOPA 1ZR2A 3R4YA 1S5LH 2LMLA 1R8EA 1NKZB 3H1JJ 3RK2B 2JO1A 1JY3O 2XZ0D 1U57A 2OYIC 1L4AA 2IYOA 1LT9B 2H7HA 1NTME 2JR8A 5CCHA 1P84I 3AE4C 3HE4B 3D6YA 1JTHA 1W2EA 2QA4P 2N1TB 4ASWA 2EHSA 5APSA 4COCA 1PEMA 1M6EX 2O1JA 3CCLP 5BVZA 3G29A 3HYBA 3CD6P 4UHPB 4OGQB 3LIDA 1CI6B 4KJMA 2XDJA 3L36A 2UWJE 5APQA 3VRLC 2B87B 1NU1K 1GL2C 1SQVE 1PEUA 3TGUD 3B8EB 2HODA 3H1LG 1LTIC 4ZKPA 1EQ7A 2KS1A 2R3CA 1KORA 4PH0A 1KB9H 4LGDE 2JWDA 2L6EA 4RKUJ 4ZNCA 2ZJSE 2EG5A 5BS2A 1S3JA 4EDFA 3B71A 1LTSC 4GODA 2LIUA 1FZAA 2FXOA 1J1EC 5AVXB 3FGAD 2E43A 3G71P 3IAOA 2BUOA 2JEEA 3G4SP 3H1LE 1T8KA 3H1HE 2PFXA 5GTHH 2MF4A 1X9VA 3M1MA 2OTKE 2VSQA 3I55P 3PLNA 1FDOA 2N50A 3TNUB 3II6A 1SQVJ 5B66H 1BDDA 1XTGB 4IPYA 2W27A
chains in the Genus database with same CATH topology
3MGEA 3H47A 3G6EP 2E1MA 3CMAP 1VQMP 3H0DA 5F2NA 2OTJP 2BHVA 4U0EA 3H4EA 1YIJP 2PEMA 1YJWP 2EIAA 3Q20A 3RG6C 3DS5A 1ZMBA 1YJNP 3G0VA 2Z46A 1VQPP 2CWOA 2PEIA 2XT1A 3DS1A 1VQOP 1M6NA 1VQ6P 3G1IA 2PEJA 2QA4P 3DS2A 4PH1A 3CC4P 3CCRP 1JJ2O 4COCA 1KQSO 1PEMA 1M6EX 1Q81Q 3CCJP 3CCLP 3CPWO 1E6JP 1BAJA 4U0DA 5BS1A 3CCQP 2M8PA 1EOQA 2JYLA 3LRYA 4QNBA 4XROA 3G29A 3CXCO 3HYBA 2M8NA 4U0CA 1NJIQ 1Q82Q 3CD6P 1RO0A 1Q86Q 1VQ5P 3P05A 4XFYA 1D1DA 3DS4A 5F2KA 2PEOA 3CMEP 1PEOA 3VRLC 1N8RQ 1K8AQ 5JPAA 1YHQP 2Z45A 1K30A 2DGYA 2JYGA 5I4TG 4U0BA 1M1KQ 1VQ8P 1VQ9P 1VQLP 1QRJA 1RNIA 2P9XA 1PEUA 1YJ9P 1AUMA 2JO0A 1QVFO 5F2OA 2XXMA 3CCEP 3CCVP 1PEQA 4XFZA 2PEQA 4PH0A 1YI2P 1VQ7P 3CC2P 2QEXP 3CC7P 1W2BO 1YITP 3G1GA 2EFJA 5HGNA 3NTEA 3CCUP 1K73Q 1K9MQ 5HGLA 2L6EA 4XRQA 2EG5A 4U0AA 5BS2A 2OARA 2ONTA 3G21A 2KODA 1KC8Q 3B5IA 4WYMA 1KD1Q 1IUQA 3I56P 1M74A 3G71P 5HGMA 2BUOA 1VQ4P 1VQNP 3DS0A 2Z44A 3G4SP 4M0IA 3OW2O 2PY8A 4U0FA 2PENA 5HGOA 3CCSP 1VQKP 3G28A 4XFXA 1RO2A 2LF4A 4COPA 3DS3A 3HZQA 3CCMP 3M1MA 1S72P 1A8OA 1Q7YQ 3DPHA 3E2DA 4GR6A 3I55P 3WBHA 2PEKA 1EIAA 1M90Q 3G26A 2BQ1E 2OTLP 2XV6A 5DCKA 1QVGO 3DTJA 2M8LA 4GR2A 4IPYA 1A43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 P;  3G71 P;  3CXC O;  1VQ4 P;  1VQN P;  3G6E P;  1QVF O;  3CMA P;  3G4S P;  1VQM P;  3OW2 O;  3CCE P;  2OTJ P;  1YIJ P;  1NJI Q;  1Q82 Q;  3CCV P;  1YJW P;  3CD6 P;  1Q86 Q;  3CCS P;  1VQK P;  1VQ5 P;  1YJN P;  1YI2 P;  1VQ7 P;  1VQP P;  3CC2 P;  2QEX P;  3CC7 P;  1W2B O;  1YIT P;  3CCM P;  1VQO P;  1K9M Q;  3CME P;  3CCU P;  1S72 P;  1K73 Q;  1VQ6 P;  1Q7Y Q;  1N8R Q;  1K8A Q;  1YHQ P;  2QA4 P;  3I55 P;  3CC4 P;  3CCR P;  1M90 Q;  1KQS O;  1JJ2 O;  2OTL P;  1Q81 Q;  1QVG O;  1KC8 Q;  3CCJ P;  3CCL P;  1M1K Q;  1KD1 Q;  1VQ8 P;  3CPW O;  1VQ9 P;  1VQL P;  3CCQ P;  3I56 P; 
#chains in the Genus database with same CATH topology
 3H47 A;  4R4M A;  3TK1 A;  1VQM P;  4JBZ A;  4H2Y C;  1QL2 A;  1G1J A;  1ZMB A;  2Z46 A;  1L0L G;  2WZ7 A;  1M8O B;  3DS1 A;  1KN7 A;  2R5D A;  1LGH B;  1LT9 A;  4WY4 C;  3CCJ P;  2KB7 P;  1Z56 A;  4WY4 D;  2E74 D;  3HE4 A;  4D6T G;  1SS1 A;  3H1L J;  1NTK E;  1OFC X;  2OGU A;  4K35 A;  1DIP A;  3H1H J;  2E75 B;  2CPS A;  1Q86 Q;  1IFP A;  1SQQ K;  2N1T A;  2FQ1 A;  4H2X C;  2QIW A;  1L0L E;  5L8R J;  3RL0 g;  2VLO A;  1PEO A;  4EIJ A;  1SQP D;  1DEE G;  5KLI B;  3ZDM A;  3JCU E;  1S9K E;  1RNI A;  2C0W A;  2KSJ A;  3BRV B;  2O01 H;  1Y47 A;  1HJ0 A;  1FE6 A;  1CI6 A;  3WU2 H;  1SFC B;  2A45 H;  3O6Q B;  2M3E A;  1KYO E;  3AEG C;  3P8M C;  4HKG A;  2B87 A;  2KOR A;  2LXC B;  2O3J A;  2W6B A;  4RO0 A;  1NTZ G;  2K0X A;  1ZLL A;  4IFD K;  1JY3 N;  1GPJ A;  1YQ4 C;  1NTK J;  3K5B A;  3W67 A;  1L0L J;  3B5N B;  3E2D A;  3OJA B;  2J59 M;  3NXS A;  1QVG O;  2N9Y B;  5AW5 B;  3A5T A;  2K9Y A;  1KYO I;  3OAK A;  2FQ2 A;  2H8P D;  1KQF B;  1N7S C;  2QRX A;  1DV5 A;  2W90 A;  2GZJ A;  2BEQ D;  2FFD B;  1H89 A;  1UII A;  3TNU A;  2PGD A;  1H0T A;  2CWO A;  1M6N A;  1VQ6 P;  2GUV A;  2JAZ A;  2CG5 B;  4TLF A;  3VN0 A;  2YKP A;  2JYL A;  2L4B A;  2MJZ A;  3M9H A;  4R0M A;  5KJ7 A;  3L71 D;  1VQ5 P;  1D1D A;  1EZV G;  3U1A A;  1LP1 B;  3HUS B;  1YHQ P;  3GHG B;  4OGQ C;  1NTM K;  2E76 C;  5APT A;  2E76 D;  3V5B A;  2YO3 A;  2JU1 A;  4BPF A;  2I8D A;  2I1K A;  4H0L D;  4D6T D;  2FAE A;  1MFT A;  1VKU A;  3HE5 B;  1RE4 A;  2FHS C;  3H1I E;  1OX3 A;  3GZL A;  2YKQ A;  2ZT9 B;  1SFC A;  2JKV A;  1USE A;  1U7M A;  2W6A A;  3O6Q A;  2KOD A;  2KSE A;  3GF3 A;  3GJN A;  3NFQ A;  3S9O A;  3SSU A;  1ZOY C;  2PEN A;  1LTJ B;  3S1K A;  5KLV J;  2Z4E A;  1SQP K;  2YXR B;  3TF5 A;  3G3Z A;  2KG9 A;  2ZFC A;  3EQ2 A;  1VF5 B;  3V2R A;  1X3O A;  3G6E P;  4L74 A;  1L0N G;  2WSE H;  3B5N A;  2M0B A;  5F2N A;  2PEM A;  3RG6 C;  3KQG A;  2HPC B;  3H1I J;  5APW A;  2POH A;  1SQX D;  2Q1K A;  3NY7 B;  3IF4 A;  2FYU G;  3A0B E;  1BAJ A;  4U0D A;  3RL0 C;  3E7K A;  2NPS A;  2FFD A;  3RL0 D;  4QKO A;  2Q7C A;  2JGP A;  1KIL B;  4GIF A;  3CXH H;  4N3Y B;  2PEO A;  1MZ9 A;  3L73 D;  4Y99 C;  1OVV A;  3T97 B;  1R5L A;  5AW9 B;  5I4T G;  2KUB A;  2R3S A;  2FAD A;  3GLM A;  1QRJ A;  2E5T A;  2L5G B;  1LWU C;  3V4Q A;  3U1C A;  1MFZ A;  1RF1 B;  4IL6 H;  1LP1 A;  3HUS A;  1NH4 A;  2K94 A;  2PEQ A;  4XFZ A;  3GHG A;  3S4R A;  3L75 G;  2EHT A;  4N78 E;  5AW1 B;  1EZV D;  2LPK A;  1WT6 A;  1N73 C;  2LOL A;  5AVR B;  3CWB D;  1E79 H;  3Q5P A;  1KC8 Q;  4WYM A;  2BCC E;  3L4F A;  1W5C E;  5AVY B;  1JY3 P;  3AE5 C;  1JY2 O;  3M0D C;  1S4X A;  1SQB D;  3CCS P;  1RO2 A;  4BPH A;  2LF4 A;  3L74 E;  2NRG A;  3L75 E;  3VTP C;  1RF0 C;  3CCM P;  3MTU E;  1A8O A;  1Q7Y Q;  3L70 G;  4ZKU A;  1FZG A;  2ITA A;  1LTJ A;  2CNR A;  2K0D X;  1OVR A;  2Q3I A;  1YIJ P;  1YJW P;  2EIA A;  5AVQ B;  1L4A B;  2W6J H;  2C9N Y;  2R32 A;  1EDI A;  1PP9 G;  3G9R A;  1JJ2 O;  5APY A;  2BCC J;  2QG4 A;  1JO5 A;  3CCQ P;  3UIA A;  3Q1M A;  3MD0 A;  1JTH B;  2KI7 B;  2HPC A;  3H32 A;  3M9Q A;  4U3F G;  3R2P A;  1NJI Q;  1M1J C;  2WSC H;  3L74 J;  1NTZ K;  4I1L A;  2Z45 A;  3H1J G;  1PP9 E;  1HUC A;  1KIL E;  2FYU D;  1HVV A;  5AVT B;  4CA3 A;  1PPJ E;  1KIL A;  2JO0 A;  5TIS H;  5KTB A;  2XXM A;  3KXD A;  2ROQ A;  2OQQ A;  4PV1 D;  3BVH A;  3CI9 A;  3T97 A;  1URQ C;  4DT0 A;  1URQ D;  2VLQ A;  2HOD B;  1YIT P;  3PJS K;  1K73 Q;  2KS1 B;  2ZVO B;  2KIK A;  3H1J E;  1Y9B A;  3G21 A;  3HD7 D;  3CLQ A;  2G8Y A;  2WPR A;  1ZNV A;  2PY8 A;  3SFD C;  1FS0 E;  4H13 B;  5AVW B;  4JPZ B;  1SLQ A;  1P84 E;  3CXH D;  3H1K E;  1NKN A;  1M90 Q;  1PP9 J;  3BCC D;  3TGU E;  1A43 A;  1LTB C;  2XND H;  5CHX A;  3U43 A;  4NPE A;  1FOS F;  1PZQ A;  1AVO A;  3IN6 A;  2XKM A;  1GDT A;  1SQQ D;  1EC5 A;  1SQB K;  1H88 A;  1F80 D;  1BGY D;  3PHL A;  1IFJ A;  3AEC C;  4YTP C;  3LW5 J;  4C46 A;  2CQ8 A;  1HY8 A;  7CEI A;  3CL3 D;  3H1K J;  2K2Q A;  3SWY A;  1SQV G;  3TGU J;  1Z6M A;  1FC2 C;  2QE7 H;  3WMM 0;  4GKG A;  1QL1 A;  1OZH A;  1NO4 A;  2J58 A;  3A0H E;  5CCG C;  4UB8 E;  5CCG D;  4GDO A;  1CW5 A;  2IBZ D;  2AFD A;  3BAT A;  1KQL A;  3GW6 A;  4L75 A;  3SFE C;  3U59 A;  1JY2 N;  2WSF J;  1W2B O;  1RF1 C;  3NTE A;  1HQB A;  4DOJ A;  3H25 A;  1L0N K;  3V2P A;  3B5I A;  1KD1 Q;  1GL2 D;  3I56 P;  2WSS H;  1GW4 A;  1D7M A;  3H1H G;  2IZ0 A;  1IC2 A;  2KZI A;  1MKM A;  2FYU K;  1PGQ A;  4H0L B;  3HZQ A;  1PL5 A;  5E79 H;  2PEK A;  1EIA A;  3MUD C;  1X8Y A;  1U7J A;  2ERH A;  2SPZ A;  3VP8 A;  2E1M A;  2BHV A;  1UNK A;  4W7Y A;  3Q20 A;  3DS5 A;  5BU8 B;  3KYQ A;  5DJU B;  4I7Z B;  2XT1 A;  2FYN B;  1FDM A;  2P67 A;  2WMM A;  1L4A C;  1H0T B;  2OYH B;  3GZM A;  1KYO H;  1LTT C;  2KOQ A;  5CCH C;  4LLH A;  1NTK G;  1NTM D;  2N5H A;  3MP7 B;  1GTW A;  1EDJ A;  1OVU A;  1AVY A;  3A7O A;  1H8A A;  2P7J A;  3B4S A;  2GDY A;  3RBZ A;  4C7R A;  1ZP0 C;  2JP3 A;  3VMX A;  5KAF E;  4KT0 J;  3RG2 A;  2KR5 A;  2YMK A;  1T2K C;  2HLO A;  1T2K D;  1BCC G;  1GXG A;  2N5I A;  2ZXX A;  1KB9 E;  2ZVN B;  4OWF A;  4W7Z A;  3RK3 B;  1JCD A;  1KQG B;  3FX0 A;  4B86 A;  5AW8 B;  5AW4 B;  2XZ1 C;  3L71 E;  2H89 C;  3FWL A;  3CX5 E;  3OW2 O;  2Y9Y A;  3G28 A;  1EXJ A;  4HKZ H;  1NYH A;  3JSV C;  3L72 G;  1BCC E;  4WBA A;  4WWI A;  3MHV A;  3AE8 C;  1AQT A;  2P10 A;  3DTJ A;  2M8L A;  2HFE D;  5B66 E;  1GW3 A;  3LIE A;  3H1L D;  1DX7 A;  3H4E A;  5KP7 B;  1VQP P;  1KB9 I;  1FZC B;  2PEJ A;  4C7N B;  3L72 E;  1RH5 B;  2RN0 A;  2N98 A;  3CX5 I;  1J1D B;  2K92 A;  3L71 J;  3CXC O;  1N2D C;  3RK2 C;  1LJ2 A;  3PH0 A;  1N7S D;  1RO0 A;  1E5W A;  2A45 G;  1OW7 A;  4XFY A;  2NPS B;  5KLV G;  2GZE A;  2OYH A;  1LT9 C;  2KLU A;  3N7N A;  3P32 A;  4OVN F;  1BCC J;  2CPB A;  1NAF A;  4U0B A;  3M06 A;  4BXL A;  5CJ4 A;  1JNM A;  1R5S A;  2GDW A;  4XE5 B;  2N1T C;  1KFN A;  1VL2 A;  4PXH B;  1NTK D;  3WU2 E;  1SQX E;  1ZW0 A;  3H1I G;  1BDC A;  5KLV E;  3LMO A;  2QEX P;  1JY2 P;  1L0L D;  1ZRT E;  1IFN A;  1OIP A;  3L72 J;  4OGQ D;  1EDL A;  1N7L A;  5AW3 B;  1S9K D;  2GZG A;  4PD4 H;  4XFJ A;  1M74 A;  2D2C B;  4EYY Q;  1VQ4 P;  3BRT B;  3TYY A;  1EMV A;  3RK3 E;  4L73 A;  1KYO D;  1KV4 A;  1IMP A;  4XFX A;  4H44 B;  4HYT B;  2N9B A;  4I2L C;  3AE3 C;  2QJP B;  2BAS A;  2WPT A;  2BQ1 E;  1LTA C;  1PIX A;  2V7Q J;  3M0A A;  5KKZ B;  2A45 I;  3VMY A;  3HD7 B;  2O01 J;  5AW0 B;  2QSI A;  5C39 A;  1SQX J;  3V4W A;  1SQV K;  2FXM A;  3A3Y B;  2YIU B;  2L0Q A;  4IOI H;  5HV8 A;  1AYI A;  4HJG H;  1NTZ D;  1NGM B;  3Q2Y A;  3CPW O;  1E6J P;  2AEF A;  2FYN C;  3JC2 2;  5GTI H;  3P7K A;  1FZC A;  4UB6 H;  4C7N A;  1GU5 A;  4DG9 A;  3H32 B;  3C1L A;  3L73 J;  1N8R Q;  1FBM A;  2HG5 D;  1L0H A;  2P2U A;  4YXW H;  1RQU A;  2Y0E A;  3EWK A;  2CK3 H;  5KJ7 C;  2MVV A;  1BE3 E;  2RH0 A;  4YXD C;  2JBG A;  2Z5H A;  3P8C D;  2OYI B;  1KFM A;  4NPF X;  1YI2 P;  4NPD A;  1IK9 A;  2YNY A;  3CC7 P;  4JYC A;  4PJ0 H;  5HGL A;  2DNW A;  4U0A A;  2E75 C;  3A2A A;  1FOS E;  2E75 D;  1RE3 A;  2BCC G;  1A02 J;  1ZN5 A;  1NU1 E;  1VQN P;  1JMM A;  1RE4 C;  5KLI C;  3KZI E;  3L74 G;  1SFC C;  2BEZ F;  2FQ0 A;  1K05 A;  4IL6 X;  1ZXG A;  3WBH A;  1HGZ A;  1ZR4 A;  2RKL A;  1NTK K;  2AXC A;  1AJY A;  1BSH A;  1CZQ A;  3GF7 A;  5KAI H;  3C8V A;  2K1A A;  1BE3 J;  1L0L K;  2KOG A;  2LTE A;  4BRY B;  3KHU A;  1QGK B;  2JU2 A;  3AE2 C;  1GL2 B;  2A06 G;  3G1I A;  1JM0 A;  1T6A A;  2K93 A;  1S2E A;  3CC4 P;  1X79 B;  1KQS O;  3GG2 A;  2FXP A;  3HD7 A;  1OR5 A;  5BS1 A;  3B5N C;  1EOQ A;  4XRO A;  1NU1 J;  2AEJ A;  4K3A A;  4U0C A;  4Z1M H;  1GD2 E;  1KLP A;  4PD4 D;  3P05 A;  2R44 A;  1J1E B;  2C0X A;  3CXH E;  5JPA A;  2A06 E;  2KG6 A;  5AW2 B;  3PTZ A;  5B5E H;  2FFD C;  1IFD A;  1HBW A;  1PPJ G;  2XU6 A;  1CSB A;  2P9X A;  4WB4 A;  3V2Q A;  4WVZ A;  1UIX A;  2ZYD A;  2QJK B;  2WTY A;  1L0N D;  1P84 H;  1EDK A;  1X0T A;  1TU3 F;  1YTZ I;  1KZU B;  4Y28 J;  3CCU P;  2Y0C A;  1MV8 A;  1IFM A;  2P58 A;  3MZW B;  4MRT C;  5M1B A;  2KGD A;  1IUQ A;  4U7J A;  3AE1 C;  5HGM A;  2OYI A;  3HUS C;  2AXT E;  1VPC A;  3GHG C;  1FAV A;  3VYI A;  2LXB A;  2KNC B;  3CXH I;  4WY4 B;  2IZ1 A;  4R4L A;  5KP8 B;  2E74 B;  4N78 D;  2AF8 A;  4DJG A;  3DS3 A;  2QVA A;  1JUN A;  1L2P A;  3AEA C;  4OH8 B;  2N6Y A;  2QNW A;  3DPH A;  3USS A;  3BCC J;  2X2B A;  3H1K G;  5H2F E;  4F37 A;  3L35 A;  4H44 C;  3TGU G;  1A02 F;  4HB1 A;  4EOT A;  3GKL C;  4TT3 H;  1YQ3 C;  1DH3 A;  5KLV K;  2QJP C;  2ZT9 C;  5AVV B;  5AW6 B;  3G0V A;  3L75 D;  2PEI A;  4N6J A;  2Q5U A;  1SQQ J;  3DS2 A;  1LTJ C;  4BPG A;  2GZF A;  1LTG C;  4BRY A;  2KW2 A;  1BGY J;  1GL2 A;  2E42 A;  2C9L Y;  2M8R A;  1SP4 A;  1M7L A;  1VF5 C;  4JQ0 D;  3AE7 C;  2OYO A;  2IFM A;  4LC1 A;  4AUW A;  1DEB A;  1J2J B;  3DS4 A;  2FYZ A;  2WIT A;  3D6Z A;  3GMA A;  2KK7 A;  3L70 D;  4W80 A;  3BAS A;  2HR3 A;  2JYG A;  1VQ9 P;  1OW8 A;  1E0H A;  1NVO A;  3HTK A;  1S5L X;  3IFM A;  1NQ4 A;  2FKW B;  1X22 A;  5EJD A;  2EFJ A;  1UJZ A;  2QJY B;  4XRQ A;  1KIL C;  1N7S B;  1PP9 D;  1KIL D;  4ZMD A;  2YXQ B;  3Q5R A;  4IZ6 A;  1PPJ D;  2KOP A;  2AVA A;  2K3R A;  4IFF A;  2K37 A;  4U3F D;  2KLV A;  4JYB A;  2WSC J;  3W68 A;  1SQP G;  3H1J D;  2XV6 A;  5DCK A;  1GXH A;  1GMJ A;  1GU4 A;  2KNC A;  4WY4 A;  3AEB C;  3M91 A;  2AFE A;  2R5B A;  1SVF A;  2E76 B;  1FR2 A;  2Z5I A;  1VQO P;  3AED C;  1P84 D;  3H1K D;  3WUT A;  1SQP E;  4MN4 C;  5KAF H;  4RES B;  1S5L E;  2B88 A;  5AVS B;  1RQV A;  1HJB A;  3LRY A;  1CEI A;  1PGO A;  1ZME C;  1NTM J;  2FVA A;  1Q2N A;  2M5R A;  2W8Z A;  2MKV A;  2GYK A;  2DW3 A;  2PAJ A;  1IMQ A;  2V4H A;  3JCU H;  4A7P A;  2XZR A;  3CX5 H;  2I1J A;  2WPQ A;  1L4A D;  2WQY C;  2MVU A;  2IDB A;  1NWQ A;  5CCH D;  2GM4 A;  3EJE A;  4HH2 A;  1VQ7 P;  3HRN A;  2Y9Z A;  2WVR A;  1LNQ A;  3C9I A;  3G1G A;  3FXD A;  2QM8 A;  2QJK C;  1SQP J;  2KWL A;  2WWW A;  4AQR D;  1PFI A;  3L71 G;  3V6I A;  2B89 A;  2LL8 A;  3DS0 A;  2M5A B;  3QH9 A;  4M0I A;  2PNG A;  1JCC A;  1N7S A;  1GK6 A;  2FVF A;  3RL0 B;  5EW5 E;  2E74 C;  3TSI A;  3PRJ A;  1SQV D;  3CE7 A;  2LKM A;  5E79 E;  2MR7 A;  3SWK A;  4M3L A;  3CMA P;  4Y99 B;  2JQ4 A;  2L9F A;  4GOE A;  1S1C X;  1LWU B;  2ZYA A;  5GTH E;  4H13 C;  2V7Q H;  3D70 A;  1Q81 Q;  4H13 D;  1VDF A;  1AA0 A;  5APU A;  1N73 B;  3OA7 A;  1FZB A;  4D6T E;  3Q3D A;  2ZAE B;  3H1H D;  1MZ8 A;  2VRS A;  2E5Y A;  1HF9 A;  4PWV B;  2YO2 A;  2KG8 A;  5EFW B;  3CME P;  2K9J B;  1WRG A;  1YYC A;  1JEK A;  2YMY A;  1HWT C;  1G2C B;  1M1K Q;  1VQL P;  1Q90 D;  2QM7 A;  5KP6 B;  2WPS A;  2KZJ A;  3RK2 D;  4GT1 A;  1PEQ A;  1SQX G;  5APV A;  5AW7 B;  4H2W C;  5HGN A;  1JB0 J;  2O1K A;  3EFG A;  1NTZ E;  1VHN A;  2OAR A;  3AE9 C;  2B9B A;  5CBN A;  3EJD A;  1KMI Z;  2QJY C;  1HH0 A;  5BU5 A;  2LKI A;  4D6T J;  2GUS A;  2N1T D;  5CMZ A;  2KGA A;  1OMI A;  3AE6 C;  1FZE A;  2NO8 A;  2ZYG A;  3L73 G;  1S72 P;  2FY8 A;  2JJL A;  1KB9 D;  3L37 A;  2M5A A;  3V2N A;  1M1J B;  1NAY A;  3ABV C;  2GA1 A;  3H0D A;  3CX5 D;  1HTL C;  3P8C E;  3AEF C;  4L76 A;  1QEX A;  4JF7 A;  1Y8A A;  1ACP A;  3A0B H;  1IJD B;  5CBO A;  1YTZ T;  3L73 E;  3CWB G;  4PV1 B;  4PH1 A;  1BCC D;  1NTZ J;  3FWN A;  1URQ B;  4H0L C;  2M8P A;  4QNB A;  3EFF K;  1SQB G;  3NTN A;  2M3B A;  1LWU A;  3F89 A;  1G1I A;  3TDK A;  1EZV E;  1FJK A;  2K0Y A;  2AEM A;  3CWB E;  1RY3 A;  1BSN A;  3L72 D;  1N73 A;  3PP5 A;  3O8Z A;  2PRR A;  1T8Z A;  3I5C A;  4I7Z C;  1FDI A;  3KZI H;  1AF8 A;  5CJ0 A;  1BE3 G;  2LIW A;  1XTC C;  3D71 A;  1SQB E;  3CCE P;  2K9J A;  2XNX A;  5DJT B;  3CCV P;  2OYH C;  2WPV B;  3M0D A;  4ASV A;  1EXI A;  1IK7 A;  1G2C A;  2FAC A;  3MIW A;  1M57 D;  1RF0 A;  2O01 N;  3AEE C;  1K04 A;  1L0I A;  1IFI A;  2YKO A;  2L22 A;  2L91 A;  1NU1 G;  5KJ7 D;  2IX7 C;  3MGN A;  1EZV I;  4U0F A;  4PD4 E;  5AVZ B;  5HGO A;  4O9B A;  2IPP A;  5KLV D;  1ZRT D;  1M56 D;  2FBW C;  2CGQ A;  4AYC A;  3CWB J;  3H6P A;  2JDI H;  3G26 A;  1HGV A;  3Q5S A;  2KOS A;  2Q9I A;  3MGE A;  2H88 C;  1L0N E;  3RK3 C;  3WUU A;  1SQB J;  2OTJ P;  3ITK A;  4U0E A;  3RK3 D;  1RHZ B;  4YPC A;  1M1J A;  3H1I D;  1OXZ A;  1SFC D;  3CCR P;  2FYU E;  5K5G B;  1AV1 A;  4XA4 A;  1BXI A;  4PD4 I;  2IFN A;  2MY5 A;  2NZ2 A;  2M8N A;  1GZL A;  2K5X A;  2P1J A;  3RGU A;  1Q82 Q;  3WUV A;  1YBK A;  5GTI E;  1NOH A;  2WT7 B;  3VMA A;  1T3U A;  3FXE A;  1URQ A;  2Y0D A;  4UB6 E;  1K8A Q;  4BWN A;  3BCC G;  3SWF A;  1WMK A;  1K30 A;  1FZF A;  2AXT H;  4KHX A;  1AQ5 A;  1FJP A;  1VQ8 P;  3HE5 A;  3RBX A;  1USD A;  1YJ9 P;  1FZC C;  1PV3 A;  1QLE D;  3B5N D;  1QVF O;  3KDP B;  5HVC A;  1L0N J;  1AFO A;  2ZXE B;  5F2O A;  1JOC A;  5H2F H;  1J1D C;  3F5H A;  2IYP A;  3HTK B;  1T3J A;  3E1I A;  1K9M Q;  1SQQ G;  1NHL A;  3NMD A;  2KGE A;  3BCC E;  2FYU J;  2NPS C;  4PJ0 E;  2NPS D;  4CPG A;  1BGY G;  4QMA A;  3IR9 A;  3LW5 H;  1BE3 D;  2KP8 A;  1OW6 A;  1VQK P;  2KYV A;  2WSE J;  4IL6 E;  1PGP A;  3M9B A;  5APX A;  1JMB A;  1DD4 A;  3L70 E;  1RE3 C;  4GR6 A;  1SQQ E;  2OTL P;  4GR2 A;  3EJB A;  1IO4 A;  2W83 C;  1LT1 A;  1BGY E;  2MD9 A;  1NU1 D;  3B4Q A;  2IBZ G;  2WSF H;  1KTM A;  1GK4 A;  5KAI E;  1YJN P;  3L75 J;  2D2C C;  2VLP A;  2D2C D;  2J5U A;  1DD3 A;  5CZD B;  2VLN A;  4GOF A;  4H44 D;  2BCC D;  1IZN B;  1MUU A;  2PP6 A;  1SQX K;  2GDX A;  4PV1 C;  4U3F E;  4DZO A;  1PGJ A;  2RMZ A;  2G3A A;  2IBZ E;  5CCG A;  2ZT9 D;  2Q3E A;  2HYN A;  3KPE A;  2JB0 A;  3L74 D;  5F2K A;  2H43 A;  2MR8 A;  5KKZ C;  3L70 J;  2KOO A;  3HD7 C;  1RF1 A;  3A0H H;  2DGY A;  4UB8 H;  2N6Z A;  4EI2 A;  4DCK A;  2YIU C;  1AUM A;  5TJH A;  5B5E E;  1OWA A;  2WT7 A;  2K88 A;  1DNY A;  1N86 A;  2JWA A;  4RJT A;  2KGC A;  2KXP B;  3VP9 A;  1VF5 D;  4IFM A;  3VMZ A;  3CC2 P;  2LR2 A;  1QX8 A;  2XV5 A;  2A06 D;  2ONT A;  3QWO C;  4NEO A;  2FVE A;  3MUD A;  2IBZ I;  3E1R A;  1NTM G;  4U3F J;  4I6M C;  2Z44 A;  3N4X A;  5AVU B;  1ZV8 A;  1FU1 A;  2GZI A;  4COP A;  2Q6Q A;  5TIS E;  3VOP A;  1ZR2 A;  3R4Y A;  1S5L H;  2LML A;  1R8E A;  1NKZ B;  3H1J J;  3RK2 B;  2JO1 A;  1JY3 O;  2XZ0 D;  1U57 A;  2OYI C;  1L4A A;  2IYO A;  1LT9 B;  2H7H A;  1NTM E;  2JR8 A;  5CCH A;  1P84 I;  3AE4 C;  3HE4 B;  3D6Y A;  1JTH A;  1W2E A;  2QA4 P;  2N1T B;  4ASW A;  2EHS A;  5APS A;  4COC A;  1PEM A;  1M6E X;  2O1J A;  3CCL P;  5BVZ A;  3G29 A;  3HYB A;  3CD6 P;  4UHP B;  4OGQ B;  3LID A;  1CI6 B;  4KJM A;  2XDJ A;  3L36 A;  2UWJ E;  5APQ A;  3VRL C;  2B87 B;  1NU1 K;  1GL2 C;  1SQV E;  1PEU A;  3TGU D;  3B8E B;  2HOD A;  3H1L G;  1LTI C;  4ZKP A;  1EQ7 A;  2KS1 A;  2R3C A;  1KOR A;  4PH0 A;  1KB9 H;  4LGD E;  2JWD A;  2L6E A;  4RKU J;  4ZNC A;  2ZJS E;  2EG5 A;  5BS2 A;  1S3J A;  4EDF A;  3B71 A;  1LTS C;  4GOD A;  2LIU A;  1FZA A;  2FXO A;  1J1E C;  5AVX B;  3FGA D;  2E43 A;  3G71 P;  3IAO A;  2BUO A;  2JEE A;  3G4S P;  3H1L E;  1T8K A;  3H1H E;  2PFX A;  5GTH H;  2MF4 A;  1X9V A;  3M1M A;  2OTK E;  2VSQ A;  3I55 P;  3PLN A;  1FDO A;  2N50 A;  3TNU B;  3II6 A;  1SQV J;  5B66 H;  1BDD A;  1XTG B;  4IPY A;  2W27 A; 
#chains in the Genus database with same CATH homology
 3MGE A;  3H47 A;  3G6E P;  2E1M A;  3CMA P;  1VQM P;  3H0D A;  5F2N A;  2OTJ P;  2BHV A;  4U0E A;  3H4E A;  1YIJ P;  2PEM A;  1YJW P;  2EIA A;  3Q20 A;  3RG6 C;  3DS5 A;  1ZMB A;  1YJN P;  3G0V A;  2Z46 A;  1VQP P;  2CWO A;  2PEI A;  2XT1 A;  3DS1 A;  1VQO P;  1M6N A;  1VQ6 P;  3G1I A;  2PEJ A;  2QA4 P;  3DS2 A;  4PH1 A;  3CC4 P;  3CCR P;  1JJ2 O;  4COC A;  1KQS O;  1PEM A;  1M6E X;  1Q81 Q;  3CCJ P;  3CCL P;  3CPW O;  1E6J P;  1BAJ A;  4U0D A;  5BS1 A;  3CCQ P;  2M8P A;  1EOQ A;  2JYL A;  3LRY A;  4QNB A;  4XRO A;  3G29 A;  3CXC O;  3HYB A;  2M8N A;  4U0C A;  1NJI Q;  1Q82 Q;  3CD6 P;  1RO0 A;  1Q86 Q;  1VQ5 P;  3P05 A;  4XFY A;  1D1D A;  3DS4 A;  5F2K A;  2PEO A;  3CME P;  1PEO A;  3VRL C;  1N8R Q;  1K8A Q;  5JPA A;  1YHQ P;  2Z45 A;  1K30 A;  2DGY A;  2JYG A;  5I4T G;  4U0B A;  1M1K Q;  1VQ8 P;  1VQ9 P;  1VQL P;  1QRJ A;  1RNI A;  2P9X A;  1PEU A;  1YJ9 P;  1AUM A;  2JO0 A;  1QVF O;  5F2O A;  2XXM A;  3CCE P;  3CCV P;  1PEQ A;  4XFZ A;  2PEQ A;  4PH0 A;  1YI2 P;  1VQ7 P;  3CC2 P;  2QEX P;  3CC7 P;  1W2B O;  1YIT P;  3G1G A;  2EFJ A;  5HGN A;  3NTE A;  3CCU P;  1K73 Q;  1K9M Q;  5HGL A;  2L6E A;  4XRQ A;  2EG5 A;  4U0A A;  5BS2 A;  2OAR A;  2ONT A;  3G21 A;  2KOD A;  1KC8 Q;  3B5I A;  4WYM A;  1KD1 Q;  1IUQ A;  3I56 P;  1M74 A;  3G71 P;  5HGM A;  2BUO A;  1VQ4 P;  1VQN P;  3DS0 A;  2Z44 A;  3G4S P;  4M0I A;  3OW2 O;  2PY8 A;  4U0F A;  2PEN A;  5HGO A;  3CCS P;  1VQK P;  3G28 A;  4XFX A;  1RO2 A;  2LF4 A;  4COP A;  3DS3 A;  3HZQ A;  3CCM P;  3M1M A;  1S72 P;  1A8O A;  1Q7Y Q;  3DPH A;  3E2D A;  4GR6 A;  3I55 P;  3WBH A;  2PEK A;  1EIA A;  1M90 Q;  3G26 A;  2BQ1 E;  2OTL P;  2XV6 A;  5DCK A;  1QVG O;  3DTJ A;  2M8L A;  4GR2 A;  4IPY A;  1A43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...