3CCUP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccuP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccuP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccuP02
1QVGO 3OW2O 1VQ6P 3CCLP 1VQ7P 1Q86Q 1VQ9P 1Q82Q 1N8RQ 1NJIQ 3G4SP 1K8AQ 3CC4P 1S72P 1VQKP 1M1KQ 1W2BO 1M90Q 1YJNP 1KC8Q 3CMAP 1KD1Q 3CMEP 3I56P 3CXCO 1YJ9P 3I55P 1QVFO 3CD6P 3CCMP 3CCSP 3CCVP 2QA4P 3G6EP 3CCJP 1VQ5P 3CCRP 1YI2P 1YITP 3CCUP 3CPWO 1VQMP 1VQOP 1Q7YQ 1VQ4P 1VQPP 1VQLP 3CCQP 1VQNP 3CC7P 1Q81Q 1JJ2O 1KQSO 1K9MQ 2QEXP 1YJWP 1YHQP 2OTJP 3G71P 1VQ8P 1YIJP 3CCEP 2OTLP 3CC2P 1K73Q
chains in the Genus database with same CATH superfamily
1JB0J 2QSIA 4JPZB 1OW8A 1BE3G 2Z46A 1IFIA 4Z1MH 4HYTB 1EZVD 3H1JD 3ITKA 2KGEA 5CBOA 2FVEA 1P84E 2M3BA 2ZJSE 3TGUE 3QWOC 2Z5IA 2E75D 1URQC 4KHXA 5AW2B 1RHZB 5B5EH 5CZDB 3FWLA 2V4HA 2AXCA 4DT0A 2FXMA 3CI9A 3G3ZA 2W27A 4RESB 1ZXGA 1EXIA 4JQ0D 2M5AA 4U0AA 1SQBG 2WZ7A 2OYIC 1GL2C 3SFDC 4ZMDA 4M0IA 3PRJA 2KSEA 1T3UA 2Q1KA 5B66E 1SQQJ 1RF1A 1FU1A 1S9KE 1Y9BA 5APWA 2KWLA 1NTKG 3HUSB 5I4TG 2QJPC 2FYUD 4BPFA 4PD4E 1N7SA 3HD7D 2YKPA 2VLOA 2J59M 2BCCJ 3LIDA 1IZNB 2KOQA 3L37A 2BHVA 3CCUP 3E1RA 1D7MA 4AYCA 2EG5A 5CCGA 1YHQP 3H1LE 4U0FA 1PV3A 2JO0A 3L70D 2FVFA 3L73J 1OR5A 1SQVJ 2JJLA 3II6A 3H1IE 1BGYG 2W6BA 3EJBA 1OMIA 4H2XC 1PPJG 1IJDB 1FBMA 5AW3B 1VQOP 3U1CA 1HVVA 1JO5A 1NAFA 3CXHH 3P7KA 2VLPA 4N78E 1LGHB 3M0AA 1NJIQ 4H13C 1K8AQ 5AVRB 2W8ZA 4PV1C 3TGUD 4PJ0H 3G21A 1L0NJ 3H1HG 2WWWA 5KLVE 5EJDA 2AEMA 1FE6A 2B88A 4ZKPA 3L35A 2MJZA 4GR6A 2PEMA 2Q9IA 5APYA 1NO4A 2BEZF 3O8ZA 4WY4A 1CI6A 4XFZA 1MFTA 1VQKP 3AEAC 1LTJA 1KQLA 2HG5D 4XFXA 3A2AA 5KAIE 1YITP 2M5RA 1LT9A 1S9KD 3M06A 3TF5A 2H89C 1PIXA 3BRVB 1SFCB 3WU2E 3VOPA 3C1LA 3FXDA 1KILE 1H0TB 2FYZA 5TISE 2FBWC 3M0DC 3RK3B 1NWQA 2MR8A 3CWBD 2QG4A 1FDIA 1RY3A 3H1LD 3NXSA 1EMVA 2LKIA 2W6AA 2VLNA 3O6QA 3HE4B 3H1ID 4C7NB 3V5BA 1G2CB 2B87B 1FZFA 3GZMA 2FQ2A 1SQBE 4LC1A 2E76B 2AVAA 1K73Q 2ZFCA 1M8OB 1S2EA 1FOSF 1NTMK 4PWVB 1DNYA 2IZ1A 4OVNF 1L4AA 3GJNA 4GIFA 4ASVA 4OWFA 2EFJA 2R44A 3KXDA 3U1AA 5KLVD 4XE5B 2KGDA 2YXQB 5HGLA 4B86A 3TDKA 1PGQA 5B5EE 5KP8B 2OTLP 4DZOA 4L74A 5F2OA 3L72E 1SFCD 2IPPA 3A3YB 1UIXA 4L76A 1T8KA 2LOLA 1YTZI 1VDFA 1BGYE 1PEUA 1PPJE 3GW6A 2WSEJ 2P9XA 2M8RA 3AE1C 1KILD 3H1JJ 2E75C 4TT3H 1BDDA 2KYVA 1NU1K 2Q3IA 2M5AB 2K1AA 1PP9G 3HE5A 1SQPE 4BWNA 3G1IA 3BASA 4GKGA 5KAFE 2Z4EA 3H1HE 3LW5J 1RF1B 1A8OA 3L71E 1EOQA 1S3JA 2NPSA 4WBAA 2M0BA 2FYNC 4GDOA 2OYHC 2E5YA 1EDLA 1IK9A 2X2BA 2M8NA 3MHVA 1SQBD 4YTPC 2QJYB 4WVZA 2R5BA 4C7RA 3VP9A 3NMDA 3S4RA 4U0EA 1N73A 5CCHA 3EFFK 3HD7C 2O1JA 2K92A 3W68A 2XV5A 3CXHE 2FYUJ 2IZ0A 2ZYGA 2JGPA 2XNDH 2KXPB 2KIKA 3C9IA 1A02F 4CA3A 2H88C 3CXHI 4PJ0E 2P1JA 2XV6A 1RE4C 2O01H 1HTLC 3AE6C 2E74B 1JJ2O 2GZEA 2MKVA 2K2QA 2KOPA 3L72D 1JY2O 3G26A 3V2RA 3NTEA 2N1TA 2GDWA 1P84H 3EJEA 1LTGC 3A0HH 5CHXA 1M6EX 1PEMA 1OW7A 3E2DA 4I7ZB 3AEBC 1NTZK 2LXCB 2R3SA 2GYKA 2WSCH 3MIWA 3TGUJ 5BVZA 4WY4B 1CI6B 1QL2A 2Q3EA 4I6MC 1S5LH 1GK4A 3MGNA 1SQPD 1LTJB 3DTJA 3P05A 3L74E 1X8YA 5GTIH 1ZLLA 1VQ4P 2KOOA 1N7SD 1NTMG 3FX0A 4EOTA 3H1HD 4KJMA 3R4YA 2FY8A 1CSBA 2L4BA 1LT9B 3L71D 3HUSC 2PENA 3B5NA 4BPGA 1GU5A 5CCGD 1WRGA 1JTHB 1OW6A 4QNBA 3PHLA 4PD4H 1OVUA 4XFYA 3GG2A 1KORA 3CCSP 4R0MA 2PEJA 2A06E 1JEKA 1EIAA 2P2UA 2JU1A 3PLNA 2SPZA 3D6YA 3CXHD 2XNXA 2E74D 2K37A 3H1KE 2MR7A 2GA1A 4IOIH 1GW3A 5AW1B 3CXCO 2FXPA 2P58A 2YMKA 2LR2A 3H1LJ 2FQ1A 3CCRP 3AE4C 3VTPC 1RE3A 1NU1G 1J2JB 2L22A 3H1IJ 1E79H 1KV4A 1L4AB 1NKZB 1LTAC 4WY4D 3OAKA 1SQXE 1VL2A 2O3JA 1K9MQ 2IBZG 2KNCA 4Y28J 3E7KA 2JO1A 3AEGC 2BEQD 2FHSC 1SQQK 5KLVJ 1KFNA 4DJGA 1GMJA 2LXBA 1H89A 2IYPA 2Z45A 2QJKB 3L74D 2K93A 3S9OA 1SFCC 1E0HA 5AVVB 3HYBA 5KJ7D 2FVAA 3RK3C 1VQ9P 5CBNA 1N8RQ 5L8RJ 3N7NA 3TNUA 1KD1Q 3OJAB 3HE5B 2A06D 2JB0A 5CMZA 1BDCA 5DJTB 4U3FG 1SQVK 1N2DC 2G8YA 1MFZA 4N3YB 2ZVNB 3SWFA 1CW5A 2NPSB 3H1KD 1A43A 4F37A 2OGUA 2XZ0D 1KMIZ 3CLQA 1AFOA 1L0LK 3AE7C 1HJ0A 1NTZG 1IK7A 1L4AD 1LJ2A 2E76C 5H2FH 3M9HA 3DS3A 1L0NK 1NHLA 2OQQA 1LWUA 3AE8C 1BCCG 5AW0B 2H8PD 1SQBJ 1KB9H 1JNMA 2LF4A 3G28A 1SQXD 2IFNA 1QX8A 3A0HE 4D6TG 2FQ0A 3HTKA 3GZLA 1HBWA 2JU2A 1P84I 2DGYA 1KQGB 2N5IA 1M1JA 3U43A 4NEOA 3RGUA 2C0WA 1M1KQ 1S5LE 1NAYA 2N1TB 4ZKUA 5HGMA 2PEIA 2OYIA 1GL2A 4ASWA 5GTIE 2WITA 2LTEA 3L72J 3AEEC 3BVHA 1NU1E 1SS1A 1SP4A 4RKUJ 5AW7B 1BGYJ 2AF8A 2NPSD 3I55P 3PP5A 3CL3D 2KGAA 1RQVA 1RF1C 4PH1A 3RBZA 5KAFH 2C0XA 1AJYA 4PD4I 2IX7C 3CCEP 3B5NB 1WT6A 5CCHD 1KZUB 2IBZE 1SQPJ 1FS0E 1TU3F 1GXHA 2QJYC 4W7YA 2E43A 3H1HJ 2IBZI 1M7LA 4H44B 3L71J 5APSA 5GTHH 1LNQA 5CCGC 1PGJA 1SQQG 3Q20A 2ZAEB 1OX3A 4KT0J 4OGQC 2E5TA 1GXGA 3NY7B 1IO4A 2ZXXA 1P84D 2FADA 2K0XA 2CWOA 2BCCG 2E74C 1EC5A 3V4WA 2N1TD 1FAVA 2GM4A 2AFEA 4JYCA 4JYBA 3AEFC 1PGOA 4HH2A 4U3FE 1LT1A 3B71A 3L73G 5AVXB 4EIJA 3GMAA 1SQVG 1LP1A 2PEKA 2ZVOB 4UHPB 3CCMP 4XFJA 5AW8B 1AVOA 3G6EP 2QM7A 3GHGA 4R4LA 4I7ZC 3AECC 1YQ3C 1PL5A 2KNCB 1UNKA 2POHA 4DG9A 1L0LG 1NU1D 4WY4C 1PGPA 3BCCG 1LTJC 3B5ND 2FFDB 4PD4D 1YJNP 1BE3E 1DD4A 3GF3A 1L0NG 3R2PA 2EHTA 1LT9C 3W67A 3MTUE 4H44D 1KILB 1X22A 1DEEG 3M91A 1E5WA 3V4QA 1RF0C 1FZCA 3L74J 1L0IA 1NKNA 4GT1A 3TNUB 3WUVA 2FYUK 1GDTA 4JF7A 2YNYA 5KJ7C 1S5LX 2CGQA 1E6JP 4BPHA 5H2FE 5DCKA 2ONTA 3B5IA 3B8EB 1BSHA 3LMOA 2GDYA 4N78D 1OXZA 2RN0A 1ZMEC 2ZYAA 1KB9E 4IFFA 1NTKE 2KOSA 1T2KD 5C39A 2GZFA 2YIUC 1KB9I 2WSFH 1M6NA 1AA0A 2CPBA 3H1KJ 1DD3A 1L4AC 2R3CA 4XROA 1LWUB 3WMM0 4A7PA 3CCVP 1DV5A 1UJZA 1G1IA 2HFED 2XKMA 2HLOA 3HTKB 2L91A 3AEDC 1M1JB 2QJKC 2WPVB 3HZQA 5F2NA 4IFDK 1BE3D 1SQXJ 3QH9A 2P7JA 2EIAA 4ZNCA 4H0LB 2CQ8A 2ZXEB 4L73A 1AQ5A 1YIJP 3L75G 2AEJA 3V2PA 2OYHA 1BAJA 5AVUB 1N7SB 4HKGA 1VQLP 3IR9A 3MZWB 5GTHE 1WMKA 1KLPA 1HJBA 2NPSC 2N9YB 2VSQA 3SFEC 4IPYA 2MVUA 1EZVG 3H1JG 5E79H 2AFDA 2CG5B 1KB9D 2PRRA 1L0LE 2NRGA 1NTKD 3Q2YA 2I8DA 1RO0A 2C9NY 1HUCA 3BCCE 2P67A 3L4FA 2Y0EA 1JY3P 1K05A 2FKWB 2N9BA 5CCHC 5APUA 3AE2C 1IFPA 1RE4A 2KSJA 3M1MA 1JY3O 4XRQA 2O01N 2BUOA 2Y0CA 2FXOA 1M90Q 2O01J 3CMAP 1J1EB 3M9QA 2QE7H 1EQ7A 2J58A 3D71A 1BGYD 1VQNP 4AQRD 1EDJA 1PPJD 2PAJA 2IFMA 1GL2D 4DCKA 2OTJP 1KN7A 2CK3H 1JY2N 2FYUG 3CX5H 4H0LD 2G3AA 1FZEA 2N1TC 3EWKA 5AW4B 4H2YC 1Z6MA 1LP1B 2P10A 5AW5B 2BASA 4GOFA 1EDKA 1ZOYC 1RO2A 2UWJE 1Y8AA 3GHGB 2QIWA 4YPCA 1RQUA 1YYCA 3L70G 2XDJA 2WSCJ 3FWNA 1J1DB 2W83C 2HR3A 4IL6H 2L9FA 1JCDA 1K30A 3H0DA 3V2QA 5JPAA 3P8MC 3PH0A 1KQFB 1KC8Q 2KORA 1U7JA 5APXA 1IUQA 1Y47A 3MD0A 3B5NC 2GZGA 5APQA 1NU1J 2NZ2A 3VMYA 4K3AA 2ZT9B 1DX7A 3TGUG 1L0LD 1LTSC 1FZCB 1OVRA 3O6QB 4H44C 5BS1A 2ZYDA 2B9BA 1FZGA 2E1MA 1PP9E 7CEIA 3TYYA 1XTGB 1GTWA 2JWAA 2GDXA 2YO2A 4NPFX 1H8AA 4WB4A 2KB7P 2KZJA 1W2BO 2N6YA 3L75E 2WQYC 1X3OA 2D2CB 3MUDC 2YMYA 1USEA 3M9BA 2GZJA 1QGKB 1MUUA 1ZMBA 5EW5E 2N5HA 3DS0A 5KKZB 3CWBG 4MRTC 3IF4A 1T6AA 2JKVA 1EZVE 4HJGH 1AUMA 3VN0A 1Q90D 1L2PA 3H1LG 3CD6P 3CPWO 2Z5HA 1D1DA 4U3FJ 3RK2B 1EZVI 2PEOA 3DS1A 2FFDC 3RL0B 3H1IG 1H0TA 5KP6B 3C8VA 1BSNA 4COCA 3Q5SA 2ZT9D 1FJKA 3Q5RA 2MD9A 4LGDE 1SQPK 1KILC 1KYOH 2KG9A 1VQMP 3SWKA 1LTBC 2GUSA 3AE5C 2QVAA 2YKOA 2WSSH 2JWDA 1MZ8A 3FGAD 1MZ9A 2ERHA 3H25A 1BE3J 5DJUB 3HE4A 4C7NA 1RNIA 2YO3A 1Q82Q 4UB8H 5E79E 2Q7CA 1G2CA 1DEBA 1VPCA 2KP8A 2LIUA 4WWIA 3SWYA 1XTCC 1PP9D 3F5HA 3Q1MA 2VRSA 1JUNA 4U0BA 3H32A 1N73B 2D2CD 2CNRA 3G0VA 3CC2P 1NTME 2OARA 2QM8A 1NQ4A 3L70E 4NPDA 2B89A 3V6IA 2JAZA 3P8CE 2QNWA 3PJSK 3L75D 1JOCA 1R5LA 2JR8A 1Q81Q 5AVWB 1URQA 1OVVA 3OA7A 1LWUC 4HKZH 3RK2D 4DOJA 4W80A 1NTKJ 3CX5E 2KR5A 3DS2A 4NPEA 2ITAA 1GPJA 3RL0D 4HB1A 2KG6A 3A0BH 2KOGA 1AF8A 3I56P 4Y99B 3CX5I 4N6JA 3IAOA 3IN6A 1BXIA 3A7OA 1M1JC 1W2EA 1EDIA 1ZP0C 2WPTA 4IL6E 4IFMA 1MKMA 1H88A 2JYLA 3PTZA 2CPSA 1JMBA 1KFMA 2MF4A 2XZRA 4H0LC 3CE7A 2OYOA 2LMLA 2KK7A 2ROQA 2O1KA 3FXEA 1NOHA 2PEQA 1CEIA 3USSA 2WT7A 2KS1A 1M74A 1N7SC 1VQ7P 2RH0A 5KLIB 2WPRA 4YXDC 2KW2A 3BRTB 4IZ6A 1G1JA 3CWBE 2Y9ZA 3CCJP 2FAEA 4C46A 1FOSE 3L72G 2R32A 2HODA 1NTMD 4GODA 4R4MA 3VP8A 2WPQA 3P8CD 4H2WC 3E1IA 2RKLA 1FDOA 2LPKA 1OWAA 5BS2A 1S4XA 2N6ZA 4K35A 2K94A 4PXHB 3EFGA 1X9VA 4U7JA 2JQ4A 1GW4A 1L0LJ 3CX5D 2IDBA 3BCCJ 1SQPG 1J1EC 3LIEA 1JM0A 1IFNA 4PH0A 1PZQA 2EHSA 2C9LY 3VRLC 2LIWA 4COPA 1HGZA 3L71G 5BU5A 3KZIE 3EQ2A 4MN4C 2Q6QA 1SQXK 1IFJA 5AVYB 2QEXP 1CZQA 1NTZE 3D70A 3LRYA 1IMPA 3Q3DA 4OH8B 1VQ6P 5K5GB 1Z56A 2XU6A 1AQTA 1HF9A 4YXWH 1FDMA 5AVQB 3GHGC 1AYIA 3M0DA 1IC2A 5AW6B 1BCCE 1IFMA 1Q2NA 3RK3E 1J1DC 2K9JA 1U57A 1KYOE 2DW3A 1FZBA 2KZIA 1GD2E 1L0HA 2K0YA 2JYGA 4D6TE 1U7MA 2J5UA 2IBZD 1KYOI 1JTHA 2Q5UA 3RBXA 2KLVA 1RF0A 2PGDA 3HRNA 4UB8E 1R8EA 2H7HA 2HPCA 1GZLA 3DPHA 2H43A 1HQBA 5KJ7A 3GLMA 4CPGA 2ZT9C 3DS5A 2W6JH 1FZCC 1VF5B 5CJ0A 2K5XA 2XT1A 4IL6X 2A45H 2M8LA 1HH0A 2M8PA 3F89A 3RL0g 3VMAA 3H32B 2R5DA 2N98A 2K3RA 4U3FD 3H47A 1JCCA 3A5TA 3KQGA 4AUWA 3L74G 5CJ4A 1PP9J 2D2CC 3A0BE 3CMEP 5HV8A 2QRXA 4GOEA 1PEOA 2WSFJ 4XA4A 3B4QA 4L75A 3DS4A 1NTZD 2N50A 3JCUH 1URQB 5KKZC 1DIPA 1ZV8A 2LL8A 3EJDA 1SQQE 1AVYA 2WSEH 3L75J 4EDFA 2A45G 2JP3A 2A06G 3CC4P 2RMZA 2PFXA 5AVTB 1BCCD 3RK2C 3RK3D 3D6ZA 1KYOD 1YI2P 2OYIB 1GL2B 1GU4A 2WPSA 3AE3C 3RL0C 2BCCE 4D6TD 3H1KG 1PFIA 3ABVC 3LW5H 2Y9YA 1FC2C 4U0DA 3RG6C 3CCLP 1VF5D 2AXTH 5M1BA 3ZDMA 2QJPB 3L73E 2KGCA 5APVA 2QA4P 2PP6A 1QLED 2VLQA 1AV1A 1SQVE 1ACPA 2WMMA 1YBKA 3Q5PA 1LTTC 4QKOA 2E76D 3HD7A 1S1CX 3H6PA 2WT7B 2KS1B 1SQXG 1KTMA 4M3LA 3T97A 2YKQA 1N73C 1Q7YQ 2WTYA 4U0CA 2Y0DA 1VQPP 4BRYA 1L0NE 2HODB 2KUBA 4UB6H 1IFDA 3OW2O 3RG2A 1URQD 3MP7B 1IMQA 4OGQB 1JY2P 3MGEA 3G4SP 1ZW0A 3N4XA 1X79B 1PEQA 4H13B 4PV1B 3VMZA 3BATA 1NTMJ 1ZNVA 3L70J 5KLVK 1SVFA 3S1KA 3KYQA 2KG8A 1SQQD 3KDPB 1QVGO 1JY3N 5BU8B 4Y99C 2K9YA 1HGVA 3KHUA 1QRJA 2MVVA 3VYIA 2FACA 3AE9C 3NTNA 2I1JA 2BCCD 2DNWA 2V7QH 1QVFO 4EI2A 1GK6A 3HUSA 1NGMB 1ZR4A 1W5CE 5KP7B 2L0QA 2E42A 3L73D 4W7ZA 4RO0A 5APTA 2V7QJ 1UIIA 1SQVD 2GZIA 3JC22 2BQ1E 1OZHA 5B66H 2K9JB 1KQSO 1YJ9P 1ZN5A 3VMXA 5KLIC 3JSVC 2W90A 1FR2A 5HGNA 2MY5A 5F2KA 2KLUA 3V2NA 3BCCD 2JBGA 1T3JA 1DH3A 4OGQD 2HPCB 3WUUA 2JEEA 1VQ5P 5EFWB 1L0ND 1SQBK 3IFMA 4H13D 4I2LC 4BXLA 1YJWP 4PV1D 3G71P 2A45I 2I1KA 4JBZA 1ZRTE 2XZ1C 1SLQA 3CWBJ 3WUTA 1Q86Q 3I5CA 3WBHA 2KI7B 2L6EA 1QL1A 4TLFA 3KPEA 3TK1A 1T8ZA 2Z44A 1M56D 1NTKK 4WYMA 1N7LA 1QEXA 1RE3C 3CC7P 3MUDA 3L36A 2K88A 2YIUB 3H4EA 2L5GB 3JCUE 5KTBA 1T2KC 1USDA 1EXJA 2AEFA 1F80D 4O9BA 3K5BA 1N86A 2LKMA 3H1JE 3G1GA 3U59A 3KZIH 2PNGA 1M57D 2PY8A 1NH4A 5HVCA 3CCQP 1RH5B 2YXRB 1SFCA 3NFQA 3GF7A 2FFDA 1HWTC 2K0DX 5AW9B 1S72P 2AXTE 2XXMA 3G29A 2E75B 5KAIH 4I1LA 1NTZJ 3GKLC 1K04A 1VHNA 1MV8A 1KILA 4LLHA 3P32A 3WU2H 1OIPA 1VQ8P 1ZR2A 1X0TA 2IYOA 1OFCX 5TISH 3UIAA 1NVOA 1BCCJ 2KODA 5KLVG 3SSUA 2FYUE 2FYNB 2B87A 2OYHB 1LTIC 1YQ4C 1JMMA 4D6TJ 1NYHA 1VF5C 1HY8A 2OTKE 1YTZT 4QMAA 1ZRTD 4UB6E 2HYNA 2GUVA 3HD7B 2M3EA 2JDIH 4EYYQ 5TJHA 3B4SA 3G9RA 4GR2A 2WVRA 5HGOA 5AVZB 2NO8A 1R5SA 3T97B 1A02J 4RJTA 5AVSB 4BRYB 1FZAA 3TSIA 1VKUA 1FJPA
chains in the Genus database with same CATH topology
3LRYA 1QVGO 1K30A 2Z46A 1VQ6P 1A43A 4COCA 1NJIQ 3H0DA 2JYLA 5JPAA 1K8AQ 3CC4P 1BAJA 1KC8Q 2EFJA 3CXCO 3G21A 1QRJA 3G1GA 2XV6A 1IUQA 3CCRP 1YI2P 2PY8A 5HGLA 1E6JP 1VQMP 1VQLP 3CCQP 1JJ2O 3DS3A 3Q20A 5DCKA 4GR6A 1QVFO 2OTLP 2ONTA 2JYGA 2PEMA 3B5IA 5F2OA 4IPYA 2PEQA 3G26A 4U0DA 3RG6C 3CCLP 1M74A 1VQ7P 1RNIA 1Q82Q 3NTEA 4U0AA 2LF4A 1RO0A 4XFZA 5BS1A 1S72P 1VQKP 2XXMA 3G29A 3G28A 4M0IA 4XFXA 2CWOA 2QA4P 3CCJP 2E1MA 3DPHA 1YITP 2BQ1E 4U0BA 1PEUA 1M6NA 1KQSO 1K9MQ 1M6EX 1PEMA 3DS5A 3E2DA 3G0VA 1VQ8P 2DGYA 2P9XA 1YJ9P 3CC2P 2OARA 1K73Q 3M1MA 4XROA 5I4TG 2XT1A 4XRQA 5HGNA 2BUOA 2KODA 5F2KA 1M1KQ 1W2BO 1M90Q 2PEKA 2Z45A 3CMAP 3DTJA 5BS2A 3P05A 3CCMP 5HGMA 2PEIA 3CCVP 3G6EP 3G1IA 1VQ5P 1VQ4P 1Q7YQ 2BHVA 4U0CA 2M8LA 3CCUP 2M8PA 1VQPP 1VQNP 2EG5A 1Q81Q 3HYBA 2PENA 1YJWP 1YHQP 1A8OA 2OTJP 3G71P 4U0FA 1EOQA 1ZMBA 2JO0A 3H47A 3OW2O 3DS0A 3DS2A 3HZQA 1Q86Q 1VQ9P 1N8RQ 4QNBA 2M8NA 3MGEA 5F2NA 3G4SP 3WBHA 2L6EA 4PH0A 4XFYA 1AUMA 1KD1Q 1YJNP 2Z44A 4GR2A 3I56P 3CMEP 3I55P 1PEQA 5HGOA 3CCSP 1PEOA 4WYMA 2PEJA 3VRLC 4COPA 1RO2A 3CPWO 1VQOP 3CD6P 4U0EA 4PH1A 1D1DA 2EIAA 3CC7P 1EIAA 3DS4A 2QEXP 2PEOA 1YIJP 3CCEP 3DS1A 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG O;  3OW2 O;  1VQ6 P;  3CCL P;  1VQ7 P;  1Q86 Q;  1VQ9 P;  1Q82 Q;  1N8R Q;  1NJI Q;  3G4S P;  1K8A Q;  3CC4 P;  1S72 P;  1VQK P;  1M1K Q;  1W2B O;  1M90 Q;  1YJN P;  1KC8 Q;  3CMA P;  1KD1 Q;  3CME P;  3I56 P;  3CXC O;  1YJ9 P;  3I55 P;  1QVF O;  3CD6 P;  3CCM P;  3CCS P;  3CCV P;  2QA4 P;  3G6E P;  3CCJ P;  1VQ5 P;  3CCR P;  1YI2 P;  1YIT P;  3CCU P;  3CPW O;  1VQM P;  1VQO P;  1Q7Y Q;  1VQ4 P;  1VQP P;  1VQL P;  3CCQ P;  1VQN P;  3CC7 P;  1Q81 Q;  1JJ2 O;  1KQS O;  1K9M Q;  2QEX P;  1YJW P;  1YHQ P;  2OTJ P;  3G71 P;  1VQ8 P;  1YIJ P;  3CCE P;  2OTL P;  3CC2 P;  1K73 Q; 
#chains in the Genus database with same CATH topology
 1JB0 J;  2QSI A;  4JPZ B;  1OW8 A;  1BE3 G;  2Z46 A;  1IFI A;  4Z1M H;  4HYT B;  1EZV D;  3H1J D;  3ITK A;  2KGE A;  5CBO A;  2FVE A;  1P84 E;  2M3B A;  2ZJS E;  3TGU E;  3QWO C;  2Z5I A;  2E75 D;  1URQ C;  4KHX A;  5AW2 B;  1RHZ B;  5B5E H;  5CZD B;  3FWL A;  2V4H A;  2AXC A;  4DT0 A;  2FXM A;  3CI9 A;  3G3Z A;  2W27 A;  4RES B;  1ZXG A;  1EXI A;  4JQ0 D;  2M5A A;  4U0A A;  1SQB G;  2WZ7 A;  2OYI C;  1GL2 C;  3SFD C;  4ZMD A;  4M0I A;  3PRJ A;  2KSE A;  1T3U A;  2Q1K A;  5B66 E;  1SQQ J;  1RF1 A;  1FU1 A;  1S9K E;  1Y9B A;  5APW A;  2KWL A;  1NTK G;  3HUS B;  5I4T G;  2QJP C;  2FYU D;  4BPF A;  4PD4 E;  1N7S A;  3HD7 D;  2YKP A;  2VLO A;  2J59 M;  2BCC J;  3LID A;  1IZN B;  2KOQ A;  3L37 A;  2BHV A;  3CCU P;  3E1R A;  1D7M A;  4AYC A;  2EG5 A;  5CCG A;  1YHQ P;  3H1L E;  4U0F A;  1PV3 A;  2JO0 A;  3L70 D;  2FVF A;  3L73 J;  1OR5 A;  1SQV J;  2JJL A;  3II6 A;  3H1I E;  1BGY G;  2W6B A;  3EJB A;  1OMI A;  4H2X C;  1PPJ G;  1IJD B;  1FBM A;  5AW3 B;  1VQO P;  3U1C A;  1HVV A;  1JO5 A;  1NAF A;  3CXH H;  3P7K A;  2VLP A;  4N78 E;  1LGH B;  3M0A A;  1NJI Q;  4H13 C;  1K8A Q;  5AVR B;  2W8Z A;  4PV1 C;  3TGU D;  4PJ0 H;  3G21 A;  1L0N J;  3H1H G;  2WWW A;  5KLV E;  5EJD A;  2AEM A;  1FE6 A;  2B88 A;  4ZKP A;  3L35 A;  2MJZ A;  4GR6 A;  2PEM A;  2Q9I A;  5APY A;  1NO4 A;  2BEZ F;  3O8Z A;  4WY4 A;  1CI6 A;  4XFZ A;  1MFT A;  1VQK P;  3AEA C;  1LTJ A;  1KQL A;  2HG5 D;  4XFX A;  3A2A A;  5KAI E;  1YIT P;  2M5R A;  1LT9 A;  1S9K D;  3M06 A;  3TF5 A;  2H89 C;  1PIX A;  3BRV B;  1SFC B;  3WU2 E;  3VOP A;  3C1L A;  3FXD A;  1KIL E;  1H0T B;  2FYZ A;  5TIS E;  2FBW C;  3M0D C;  3RK3 B;  1NWQ A;  2MR8 A;  3CWB D;  2QG4 A;  1FDI A;  1RY3 A;  3H1L D;  3NXS A;  1EMV A;  2LKI A;  2W6A A;  2VLN A;  3O6Q A;  3HE4 B;  3H1I D;  4C7N B;  3V5B A;  1G2C B;  2B87 B;  1FZF A;  3GZM A;  2FQ2 A;  1SQB E;  4LC1 A;  2E76 B;  2AVA A;  1K73 Q;  2ZFC A;  1M8O B;  1S2E A;  1FOS F;  1NTM K;  4PWV B;  1DNY A;  2IZ1 A;  4OVN F;  1L4A A;  3GJN A;  4GIF A;  4ASV A;  4OWF A;  2EFJ A;  2R44 A;  3KXD A;  3U1A A;  5KLV D;  4XE5 B;  2KGD A;  2YXQ B;  5HGL A;  4B86 A;  3TDK A;  1PGQ A;  5B5E E;  5KP8 B;  2OTL P;  4DZO A;  4L74 A;  5F2O A;  3L72 E;  1SFC D;  2IPP A;  3A3Y B;  1UIX A;  4L76 A;  1T8K A;  2LOL A;  1YTZ I;  1VDF A;  1BGY E;  1PEU A;  1PPJ E;  3GW6 A;  2WSE J;  2P9X A;  2M8R A;  3AE1 C;  1KIL D;  3H1J J;  2E75 C;  4TT3 H;  1BDD A;  2KYV A;  1NU1 K;  2Q3I A;  2M5A B;  2K1A A;  1PP9 G;  3HE5 A;  1SQP E;  4BWN A;  3G1I A;  3BAS A;  4GKG A;  5KAF E;  2Z4E A;  3H1H E;  3LW5 J;  1RF1 B;  1A8O A;  3L71 E;  1EOQ A;  1S3J A;  2NPS A;  4WBA A;  2M0B A;  2FYN C;  4GDO A;  2OYH C;  2E5Y A;  1EDL A;  1IK9 A;  2X2B A;  2M8N A;  3MHV A;  1SQB D;  4YTP C;  2QJY B;  4WVZ A;  2R5B A;  4C7R A;  3VP9 A;  3NMD A;  3S4R A;  4U0E A;  1N73 A;  5CCH A;  3EFF K;  3HD7 C;  2O1J A;  2K92 A;  3W68 A;  2XV5 A;  3CXH E;  2FYU J;  2IZ0 A;  2ZYG A;  2JGP A;  2XND H;  2KXP B;  2KIK A;  3C9I A;  1A02 F;  4CA3 A;  2H88 C;  3CXH I;  4PJ0 E;  2P1J A;  2XV6 A;  1RE4 C;  2O01 H;  1HTL C;  3AE6 C;  2E74 B;  1JJ2 O;  2GZE A;  2MKV A;  2K2Q A;  2KOP A;  3L72 D;  1JY2 O;  3G26 A;  3V2R A;  3NTE A;  2N1T A;  2GDW A;  1P84 H;  3EJE A;  1LTG C;  3A0H H;  5CHX A;  1M6E X;  1PEM A;  1OW7 A;  3E2D A;  4I7Z B;  3AEB C;  1NTZ K;  2LXC B;  2R3S A;  2GYK A;  2WSC H;  3MIW A;  3TGU J;  5BVZ A;  4WY4 B;  1CI6 B;  1QL2 A;  2Q3E A;  4I6M C;  1S5L H;  1GK4 A;  3MGN A;  1SQP D;  1LTJ B;  3DTJ A;  3P05 A;  3L74 E;  1X8Y A;  5GTI H;  1ZLL A;  1VQ4 P;  2KOO A;  1N7S D;  1NTM G;  3FX0 A;  4EOT A;  3H1H D;  4KJM A;  3R4Y A;  2FY8 A;  1CSB A;  2L4B A;  1LT9 B;  3L71 D;  3HUS C;  2PEN A;  3B5N A;  4BPG A;  1GU5 A;  5CCG D;  1WRG A;  1JTH B;  1OW6 A;  4QNB A;  3PHL A;  4PD4 H;  1OVU A;  4XFY A;  3GG2 A;  1KOR A;  3CCS P;  4R0M A;  2PEJ A;  2A06 E;  1JEK A;  1EIA A;  2P2U A;  2JU1 A;  3PLN A;  2SPZ A;  3D6Y A;  3CXH D;  2XNX A;  2E74 D;  2K37 A;  3H1K E;  2MR7 A;  2GA1 A;  4IOI H;  1GW3 A;  5AW1 B;  3CXC O;  2FXP A;  2P58 A;  2YMK A;  2LR2 A;  3H1L J;  2FQ1 A;  3CCR P;  3AE4 C;  3VTP C;  1RE3 A;  1NU1 G;  1J2J B;  2L22 A;  3H1I J;  1E79 H;  1KV4 A;  1L4A B;  1NKZ B;  1LTA C;  4WY4 D;  3OAK A;  1SQX E;  1VL2 A;  2O3J A;  1K9M Q;  2IBZ G;  2KNC A;  4Y28 J;  3E7K A;  2JO1 A;  3AEG C;  2BEQ D;  2FHS C;  1SQQ K;  5KLV J;  1KFN A;  4DJG A;  1GMJ A;  2LXB A;  1H89 A;  2IYP A;  2Z45 A;  2QJK B;  3L74 D;  2K93 A;  3S9O A;  1SFC C;  1E0H A;  5AVV B;  3HYB A;  5KJ7 D;  2FVA A;  3RK3 C;  1VQ9 P;  5CBN A;  1N8R Q;  5L8R J;  3N7N A;  3TNU A;  1KD1 Q;  3OJA B;  3HE5 B;  2A06 D;  2JB0 A;  5CMZ A;  1BDC A;  5DJT B;  4U3F G;  1SQV K;  1N2D C;  2G8Y A;  1MFZ A;  4N3Y B;  2ZVN B;  3SWF A;  1CW5 A;  2NPS B;  3H1K D;  1A43 A;  4F37 A;  2OGU A;  2XZ0 D;  1KMI Z;  3CLQ A;  1AFO A;  1L0L K;  3AE7 C;  1HJ0 A;  1NTZ G;  1IK7 A;  1L4A D;  1LJ2 A;  2E76 C;  5H2F H;  3M9H A;  3DS3 A;  1L0N K;  1NHL A;  2OQQ A;  1LWU A;  3AE8 C;  1BCC G;  5AW0 B;  2H8P D;  1SQB J;  1KB9 H;  1JNM A;  2LF4 A;  3G28 A;  1SQX D;  2IFN A;  1QX8 A;  3A0H E;  4D6T G;  2FQ0 A;  3HTK A;  3GZL A;  1HBW A;  2JU2 A;  1P84 I;  2DGY A;  1KQG B;  2N5I A;  1M1J A;  3U43 A;  4NEO A;  3RGU A;  2C0W A;  1M1K Q;  1S5L E;  1NAY A;  2N1T B;  4ZKU A;  5HGM A;  2PEI A;  2OYI A;  1GL2 A;  4ASW A;  5GTI E;  2WIT A;  2LTE A;  3L72 J;  3AEE C;  3BVH A;  1NU1 E;  1SS1 A;  1SP4 A;  4RKU J;  5AW7 B;  1BGY J;  2AF8 A;  2NPS D;  3I55 P;  3PP5 A;  3CL3 D;  2KGA A;  1RQV A;  1RF1 C;  4PH1 A;  3RBZ A;  5KAF H;  2C0X A;  1AJY A;  4PD4 I;  2IX7 C;  3CCE P;  3B5N B;  1WT6 A;  5CCH D;  1KZU B;  2IBZ E;  1SQP J;  1FS0 E;  1TU3 F;  1GXH A;  2QJY C;  4W7Y A;  2E43 A;  3H1H J;  2IBZ I;  1M7L A;  4H44 B;  3L71 J;  5APS A;  5GTH H;  1LNQ A;  5CCG C;  1PGJ A;  1SQQ G;  3Q20 A;  2ZAE B;  1OX3 A;  4KT0 J;  4OGQ C;  2E5T A;  1GXG A;  3NY7 B;  1IO4 A;  2ZXX A;  1P84 D;  2FAD A;  2K0X A;  2CWO A;  2BCC G;  2E74 C;  1EC5 A;  3V4W A;  2N1T D;  1FAV A;  2GM4 A;  2AFE A;  4JYC A;  4JYB A;  3AEF C;  1PGO A;  4HH2 A;  4U3F E;  1LT1 A;  3B71 A;  3L73 G;  5AVX B;  4EIJ A;  3GMA A;  1SQV G;  1LP1 A;  2PEK A;  2ZVO B;  4UHP B;  3CCM P;  4XFJ A;  5AW8 B;  1AVO A;  3G6E P;  2QM7 A;  3GHG A;  4R4L A;  4I7Z C;  3AEC C;  1YQ3 C;  1PL5 A;  2KNC B;  1UNK A;  2POH A;  4DG9 A;  1L0L G;  1NU1 D;  4WY4 C;  1PGP A;  3BCC G;  1LTJ C;  3B5N D;  2FFD B;  4PD4 D;  1YJN P;  1BE3 E;  1DD4 A;  3GF3 A;  1L0N G;  3R2P A;  2EHT A;  1LT9 C;  3W67 A;  3MTU E;  4H44 D;  1KIL B;  1X22 A;  1DEE G;  3M91 A;  1E5W A;  3V4Q A;  1RF0 C;  1FZC A;  3L74 J;  1L0I A;  1NKN A;  4GT1 A;  3TNU B;  3WUV A;  2FYU K;  1GDT A;  4JF7 A;  2YNY A;  5KJ7 C;  1S5L X;  2CGQ A;  1E6J P;  4BPH A;  5H2F E;  5DCK A;  2ONT A;  3B5I A;  3B8E B;  1BSH A;  3LMO A;  2GDY A;  4N78 D;  1OXZ A;  2RN0 A;  1ZME C;  2ZYA A;  1KB9 E;  4IFF A;  1NTK E;  2KOS A;  1T2K D;  5C39 A;  2GZF A;  2YIU C;  1KB9 I;  2WSF H;  1M6N A;  1AA0 A;  2CPB A;  3H1K J;  1DD3 A;  1L4A C;  2R3C A;  4XRO A;  1LWU B;  3WMM 0;  4A7P A;  3CCV P;  1DV5 A;  1UJZ A;  1G1I A;  2HFE D;  2XKM A;  2HLO A;  3HTK B;  2L91 A;  3AED C;  1M1J B;  2QJK C;  2WPV B;  3HZQ A;  5F2N A;  4IFD K;  1BE3 D;  1SQX J;  3QH9 A;  2P7J A;  2EIA A;  4ZNC A;  4H0L B;  2CQ8 A;  2ZXE B;  4L73 A;  1AQ5 A;  1YIJ P;  3L75 G;  2AEJ A;  3V2P A;  2OYH A;  1BAJ A;  5AVU B;  1N7S B;  4HKG A;  1VQL P;  3IR9 A;  3MZW B;  5GTH E;  1WMK A;  1KLP A;  1HJB A;  2NPS C;  2N9Y B;  2VSQ A;  3SFE C;  4IPY A;  2MVU A;  1EZV G;  3H1J G;  5E79 H;  2AFD A;  2CG5 B;  1KB9 D;  2PRR A;  1L0L E;  2NRG A;  1NTK D;  3Q2Y A;  2I8D A;  1RO0 A;  2C9N Y;  1HUC A;  3BCC E;  2P67 A;  3L4F A;  2Y0E A;  1JY3 P;  1K05 A;  2FKW B;  2N9B A;  5CCH C;  5APU A;  3AE2 C;  1IFP A;  1RE4 A;  2KSJ A;  3M1M A;  1JY3 O;  4XRQ A;  2O01 N;  2BUO A;  2Y0C A;  2FXO A;  1M90 Q;  2O01 J;  3CMA P;  1J1E B;  3M9Q A;  2QE7 H;  1EQ7 A;  2J58 A;  3D71 A;  1BGY D;  1VQN P;  4AQR D;  1EDJ A;  1PPJ D;  2PAJ A;  2IFM A;  1GL2 D;  4DCK A;  2OTJ P;  1KN7 A;  2CK3 H;  1JY2 N;  2FYU G;  3CX5 H;  4H0L D;  2G3A A;  1FZE A;  2N1T C;  3EWK A;  5AW4 B;  4H2Y C;  1Z6M A;  1LP1 B;  2P10 A;  5AW5 B;  2BAS A;  4GOF A;  1EDK A;  1ZOY C;  1RO2 A;  2UWJ E;  1Y8A A;  3GHG B;  2QIW A;  4YPC A;  1RQU A;  1YYC A;  3L70 G;  2XDJ A;  2WSC J;  3FWN A;  1J1D B;  2W83 C;  2HR3 A;  4IL6 H;  2L9F A;  1JCD A;  1K30 A;  3H0D A;  3V2Q A;  5JPA A;  3P8M C;  3PH0 A;  1KQF B;  1KC8 Q;  2KOR A;  1U7J A;  5APX A;  1IUQ A;  1Y47 A;  3MD0 A;  3B5N C;  2GZG A;  5APQ A;  1NU1 J;  2NZ2 A;  3VMY A;  4K3A A;  2ZT9 B;  1DX7 A;  3TGU G;  1L0L D;  1LTS C;  1FZC B;  1OVR A;  3O6Q B;  4H44 C;  5BS1 A;  2ZYD A;  2B9B A;  1FZG A;  2E1M A;  1PP9 E;  7CEI A;  3TYY A;  1XTG B;  1GTW A;  2JWA A;  2GDX A;  2YO2 A;  4NPF X;  1H8A A;  4WB4 A;  2KB7 P;  2KZJ A;  1W2B O;  2N6Y A;  3L75 E;  2WQY C;  1X3O A;  2D2C B;  3MUD C;  2YMY A;  1USE A;  3M9B A;  2GZJ A;  1QGK B;  1MUU A;  1ZMB A;  5EW5 E;  2N5H A;  3DS0 A;  5KKZ B;  3CWB G;  4MRT C;  3IF4 A;  1T6A A;  2JKV A;  1EZV E;  4HJG H;  1AUM A;  3VN0 A;  1Q90 D;  1L2P A;  3H1L G;  3CD6 P;  3CPW O;  2Z5H A;  1D1D A;  4U3F J;  3RK2 B;  1EZV I;  2PEO A;  3DS1 A;  2FFD C;  3RL0 B;  3H1I G;  1H0T A;  5KP6 B;  3C8V A;  1BSN A;  4COC A;  3Q5S A;  2ZT9 D;  1FJK A;  3Q5R A;  2MD9 A;  4LGD E;  1SQP K;  1KIL C;  1KYO H;  2KG9 A;  1VQM P;  3SWK A;  1LTB C;  2GUS A;  3AE5 C;  2QVA A;  2YKO A;  2WSS H;  2JWD A;  1MZ8 A;  3FGA D;  1MZ9 A;  2ERH A;  3H25 A;  1BE3 J;  5DJU B;  3HE4 A;  4C7N A;  1RNI A;  2YO3 A;  1Q82 Q;  4UB8 H;  5E79 E;  2Q7C A;  1G2C A;  1DEB A;  1VPC A;  2KP8 A;  2LIU A;  4WWI A;  3SWY A;  1XTC C;  1PP9 D;  3F5H A;  3Q1M A;  2VRS A;  1JUN A;  4U0B A;  3H32 A;  1N73 B;  2D2C D;  2CNR A;  3G0V A;  3CC2 P;  1NTM E;  2OAR A;  2QM8 A;  1NQ4 A;  3L70 E;  4NPD A;  2B89 A;  3V6I A;  2JAZ A;  3P8C E;  2QNW A;  3PJS K;  3L75 D;  1JOC A;  1R5L A;  2JR8 A;  1Q81 Q;  5AVW B;  1URQ A;  1OVV A;  3OA7 A;  1LWU C;  4HKZ H;  3RK2 D;  4DOJ A;  4W80 A;  1NTK J;  3CX5 E;  2KR5 A;  3DS2 A;  4NPE A;  2ITA A;  1GPJ A;  3RL0 D;  4HB1 A;  2KG6 A;  3A0B H;  2KOG A;  1AF8 A;  3I56 P;  4Y99 B;  3CX5 I;  4N6J A;  3IAO A;  3IN6 A;  1BXI A;  3A7O A;  1M1J C;  1W2E A;  1EDI A;  1ZP0 C;  2WPT A;  4IL6 E;  4IFM A;  1MKM A;  1H88 A;  2JYL A;  3PTZ A;  2CPS A;  1JMB A;  1KFM A;  2MF4 A;  2XZR A;  4H0L C;  3CE7 A;  2OYO A;  2LML A;  2KK7 A;  2ROQ A;  2O1K A;  3FXE A;  1NOH A;  2PEQ A;  1CEI A;  3USS A;  2WT7 A;  2KS1 A;  1M74 A;  1N7S C;  1VQ7 P;  2RH0 A;  5KLI B;  2WPR A;  4YXD C;  2KW2 A;  3BRT B;  4IZ6 A;  1G1J A;  3CWB E;  2Y9Z A;  3CCJ P;  2FAE A;  4C46 A;  1FOS E;  3L72 G;  2R32 A;  2HOD A;  1NTM D;  4GOD A;  4R4M A;  3VP8 A;  2WPQ A;  3P8C D;  4H2W C;  3E1I A;  2RKL A;  1FDO A;  2LPK A;  1OWA A;  5BS2 A;  1S4X A;  2N6Z A;  4K35 A;  2K94 A;  4PXH B;  3EFG A;  1X9V A;  4U7J A;  2JQ4 A;  1GW4 A;  1L0L J;  3CX5 D;  2IDB A;  3BCC J;  1SQP G;  1J1E C;  3LIE A;  1JM0 A;  1IFN A;  4PH0 A;  1PZQ A;  2EHS A;  2C9L Y;  3VRL C;  2LIW A;  4COP A;  1HGZ A;  3L71 G;  5BU5 A;  3KZI E;  3EQ2 A;  4MN4 C;  2Q6Q A;  1SQX K;  1IFJ A;  5AVY B;  2QEX P;  1CZQ A;  1NTZ E;  3D70 A;  3LRY A;  1IMP A;  3Q3D A;  4OH8 B;  1VQ6 P;  5K5G B;  1Z56 A;  2XU6 A;  1AQT A;  1HF9 A;  4YXW H;  1FDM A;  5AVQ B;  3GHG C;  1AYI A;  3M0D A;  1IC2 A;  5AW6 B;  1BCC E;  1IFM A;  1Q2N A;  3RK3 E;  1J1D C;  2K9J A;  1U57 A;  1KYO E;  2DW3 A;  1FZB A;  2KZI A;  1GD2 E;  1L0H A;  2K0Y A;  2JYG A;  4D6T E;  1U7M A;  2J5U A;  2IBZ D;  1KYO I;  1JTH A;  2Q5U A;  3RBX A;  2KLV A;  1RF0 A;  2PGD A;  3HRN A;  4UB8 E;  1R8E A;  2H7H A;  2HPC A;  1GZL A;  3DPH A;  2H43 A;  1HQB A;  5KJ7 A;  3GLM A;  4CPG A;  2ZT9 C;  3DS5 A;  2W6J H;  1FZC C;  1VF5 B;  5CJ0 A;  2K5X A;  2XT1 A;  4IL6 X;  2A45 H;  2M8L A;  1HH0 A;  2M8P A;  3F89 A;  3RL0 g;  3VMA A;  3H32 B;  2R5D A;  2N98 A;  2K3R A;  4U3F D;  3H47 A;  1JCC A;  3A5T A;  3KQG A;  4AUW A;  3L74 G;  5CJ4 A;  1PP9 J;  2D2C C;  3A0B E;  3CME P;  5HV8 A;  2QRX A;  4GOE A;  1PEO A;  2WSF J;  4XA4 A;  3B4Q A;  4L75 A;  3DS4 A;  1NTZ D;  2N50 A;  3JCU H;  1URQ B;  5KKZ C;  1DIP A;  1ZV8 A;  2LL8 A;  3EJD A;  1SQQ E;  1AVY A;  2WSE H;  3L75 J;  4EDF A;  2A45 G;  2JP3 A;  2A06 G;  3CC4 P;  2RMZ A;  2PFX A;  5AVT B;  1BCC D;  3RK2 C;  3RK3 D;  3D6Z A;  1KYO D;  1YI2 P;  2OYI B;  1GL2 B;  1GU4 A;  2WPS A;  3AE3 C;  3RL0 C;  2BCC E;  4D6T D;  3H1K G;  1PFI A;  3ABV C;  3LW5 H;  2Y9Y A;  1FC2 C;  4U0D A;  3RG6 C;  3CCL P;  1VF5 D;  2AXT H;  5M1B A;  3ZDM A;  2QJP B;  3L73 E;  2KGC A;  5APV A;  2QA4 P;  2PP6 A;  1QLE D;  2VLQ A;  1AV1 A;  1SQV E;  1ACP A;  2WMM A;  1YBK A;  3Q5P A;  1LTT C;  4QKO A;  2E76 D;  3HD7 A;  1S1C X;  3H6P A;  2WT7 B;  2KS1 B;  1SQX G;  1KTM A;  4M3L A;  3T97 A;  2YKQ A;  1N73 C;  1Q7Y Q;  2WTY A;  4U0C A;  2Y0D A;  1VQP P;  4BRY A;  1L0N E;  2HOD B;  2KUB A;  4UB6 H;  1IFD A;  3OW2 O;  3RG2 A;  1URQ D;  3MP7 B;  1IMQ A;  4OGQ B;  1JY2 P;  3MGE A;  3G4S P;  1ZW0 A;  3N4X A;  1X79 B;  1PEQ A;  4H13 B;  4PV1 B;  3VMZ A;  3BAT A;  1NTM J;  1ZNV A;  3L70 J;  5KLV K;  1SVF A;  3S1K A;  3KYQ A;  2KG8 A;  1SQQ D;  3KDP B;  1QVG O;  1JY3 N;  5BU8 B;  4Y99 C;  2K9Y A;  1HGV A;  3KHU A;  1QRJ A;  2MVV A;  3VYI A;  2FAC A;  3AE9 C;  3NTN A;  2I1J A;  2BCC D;  2DNW A;  2V7Q H;  1QVF O;  4EI2 A;  1GK6 A;  3HUS A;  1NGM B;  1ZR4 A;  1W5C E;  5KP7 B;  2L0Q A;  2E42 A;  3L73 D;  4W7Z A;  4RO0 A;  5APT A;  2V7Q J;  1UII A;  1SQV D;  2GZI A;  3JC2 2;  2BQ1 E;  1OZH A;  5B66 H;  2K9J B;  1KQS O;  1YJ9 P;  1ZN5 A;  3VMX A;  5KLI C;  3JSV C;  2W90 A;  1FR2 A;  5HGN A;  2MY5 A;  5F2K A;  2KLU A;  3V2N A;  3BCC D;  2JBG A;  1T3J A;  1DH3 A;  4OGQ D;  2HPC B;  3WUU A;  2JEE A;  1VQ5 P;  5EFW B;  1L0N D;  1SQB K;  3IFM A;  4H13 D;  4I2L C;  4BXL A;  1YJW P;  4PV1 D;  3G71 P;  2A45 I;  2I1K A;  4JBZ A;  1ZRT E;  2XZ1 C;  1SLQ A;  3CWB J;  3WUT A;  1Q86 Q;  3I5C A;  3WBH A;  2KI7 B;  2L6E A;  1QL1 A;  4TLF A;  3KPE A;  3TK1 A;  1T8Z A;  2Z44 A;  1M56 D;  1NTK K;  4WYM A;  1N7L A;  1QEX A;  1RE3 C;  3CC7 P;  3MUD A;  3L36 A;  2K88 A;  2YIU B;  3H4E A;  2L5G B;  3JCU E;  5KTB A;  1T2K C;  1USD A;  1EXJ A;  2AEF A;  1F80 D;  4O9B A;  3K5B A;  1N86 A;  2LKM A;  3H1J E;  3G1G A;  3U59 A;  3KZI H;  2PNG A;  1M57 D;  2PY8 A;  1NH4 A;  5HVC A;  3CCQ P;  1RH5 B;  2YXR B;  1SFC A;  3NFQ A;  3GF7 A;  2FFD A;  1HWT C;  2K0D X;  5AW9 B;  1S72 P;  2AXT E;  2XXM A;  3G29 A;  2E75 B;  5KAI H;  4I1L A;  1NTZ J;  3GKL C;  1K04 A;  1VHN A;  1MV8 A;  1KIL A;  4LLH A;  3P32 A;  3WU2 H;  1OIP A;  1VQ8 P;  1ZR2 A;  1X0T A;  2IYO A;  1OFC X;  5TIS H;  3UIA A;  1NVO A;  1BCC J;  2KOD A;  5KLV G;  3SSU A;  2FYU E;  2FYN B;  2B87 A;  2OYH B;  1LTI C;  1YQ4 C;  1JMM A;  4D6T J;  1NYH A;  1VF5 C;  1HY8 A;  2OTK E;  1YTZ T;  4QMA A;  1ZRT D;  4UB6 E;  2HYN A;  2GUV A;  3HD7 B;  2M3E A;  2JDI H;  4EYY Q;  5TJH A;  3B4S A;  3G9R A;  4GR2 A;  2WVR A;  5HGO A;  5AVZ B;  2NO8 A;  1R5S A;  3T97 B;  1A02 J;  4RJT A;  5AVS B;  4BRY B;  1FZA A;  3TSI A;  1VKU A;  1FJP A; 
#chains in the Genus database with same CATH homology
 3LRY A;  1QVG O;  1K30 A;  2Z46 A;  1VQ6 P;  1A43 A;  4COC A;  1NJI Q;  3H0D A;  2JYL A;  5JPA A;  1K8A Q;  3CC4 P;  1BAJ A;  1KC8 Q;  2EFJ A;  3CXC O;  3G21 A;  1QRJ A;  3G1G A;  2XV6 A;  1IUQ A;  3CCR P;  1YI2 P;  2PY8 A;  5HGL A;  1E6J P;  1VQM P;  1VQL P;  3CCQ P;  1JJ2 O;  3DS3 A;  3Q20 A;  5DCK A;  4GR6 A;  1QVF O;  2OTL P;  2ONT A;  2JYG A;  2PEM A;  3B5I A;  5F2O A;  4IPY A;  2PEQ A;  3G26 A;  4U0D A;  3RG6 C;  3CCL P;  1M74 A;  1VQ7 P;  1RNI A;  1Q82 Q;  3NTE A;  4U0A A;  2LF4 A;  1RO0 A;  4XFZ A;  5BS1 A;  1S72 P;  1VQK P;  2XXM A;  3G29 A;  3G28 A;  4M0I A;  4XFX A;  2CWO A;  2QA4 P;  3CCJ P;  2E1M A;  3DPH A;  1YIT P;  2BQ1 E;  4U0B A;  1PEU A;  1M6N A;  1KQS O;  1K9M Q;  1M6E X;  1PEM A;  3DS5 A;  3E2D A;  3G0V A;  1VQ8 P;  2DGY A;  2P9X A;  1YJ9 P;  3CC2 P;  2OAR A;  1K73 Q;  3M1M A;  4XRO A;  5I4T G;  2XT1 A;  4XRQ A;  5HGN A;  2BUO A;  2KOD A;  5F2K A;  1M1K Q;  1W2B O;  1M90 Q;  2PEK A;  2Z45 A;  3CMA P;  3DTJ A;  5BS2 A;  3P05 A;  3CCM P;  5HGM A;  2PEI A;  3CCV P;  3G6E P;  3G1I A;  1VQ5 P;  1VQ4 P;  1Q7Y Q;  2BHV A;  4U0C A;  2M8L A;  3CCU P;  2M8P A;  1VQP P;  1VQN P;  2EG5 A;  1Q81 Q;  3HYB A;  2PEN A;  1YJW P;  1YHQ P;  1A8O A;  2OTJ P;  3G71 P;  4U0F A;  1EOQ A;  1ZMB A;  2JO0 A;  3H47 A;  3OW2 O;  3DS0 A;  3DS2 A;  3HZQ A;  1Q86 Q;  1VQ9 P;  1N8R Q;  4QNB A;  2M8N A;  3MGE A;  5F2N A;  3G4S P;  3WBH A;  2L6E A;  4PH0 A;  4XFY A;  1AUM A;  1KD1 Q;  1YJN P;  2Z44 A;  4GR2 A;  3I56 P;  3CME P;  3I55 P;  1PEQ A;  5HGO A;  3CCS P;  1PEO A;  4WYM A;  2PEJ A;  3VRL C;  4COP A;  1RO2 A;  3CPW O;  1VQO P;  3CD6 P;  4U0E A;  4PH1 A;  1D1D A;  2EIA A;  3CC7 P;  1EIA A;  3DS4 A;  2QEX P;  2PEO A;  1YIJ P;  3CCE P;  3DS1 A;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...