3CCUP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccuP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccuP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccuP02
1Q86Q 1QVGO 3CMEP 2OTLP 3G71P 1YJNP 1K8AQ 1VQLP 2QEXP 3CC7P 1VQOP 1K73Q 1KD1Q 1YIJP 3CC2P 3CCVP 3G4SP 3CCLP 1YJ9P 1VQ7P 3I56P 3CXCO 1K9MQ 3CC4P 1VQMP 3CCEP 3CCMP 3CCSP 1KC8Q 2OTJP 1YITP 1VQPP 1QVFO 3CCRP 1VQ8P 1YJWP 1VQKP 1Q81Q 1YHQP 1N8RQ 3I55P 1VQ4P 1VQNP 1NJIQ 3CD6P 3CCUP 3G6EP 3OW2O 3CCQP 1M90Q 1JJ2O 3CPWO 1Q7YQ 1Q82Q 1M1KQ 3CMAP 3CCJP 1KQSO 1VQ6P 2QA4P 1YI2P 1S72P 1VQ5P 1W2BO 1VQ9P
chains in the Genus database with same CATH superfamily
2IBZD 4YPCA 3RL0g 4GDOA 3M1MA 4H44B 1T3JA 2PEQA 1K73Q 1HWTC 3CC2P 4JPZB 3AE1C 3MUDC 1WRGA 3NFQA 1EZVG 2SPZA 2LR2A 2KSEA 5APTA 3VYIA 2HODB 3HE5A 1DEEG 4H0LD 5F2OA 3KHUA 2O01H 1GL2A 4M3LA 3Q2YA 3A0BE 3AE8C 1VQ9P 4WY4B 5APVA 4COCA 1LWUA 5AVUB 1VPCA 2C0XA 1FU1A 3HD7C 1U7JA 2YMYA 2N9BA 1AA0A 1H88A 3L73E 2L6EA 1OZHA 3UIAA 2K2QA 2WTYA 3AE6C 1MUUA 1S72P 1FZBA 2CQ8A 1KB9I 2PY8A 5KP7B 2OYIC 2ZT9D 1SQPD 2XV5A 3L71J 2NPSC 1VQMP 2K0DX 4EYYQ 1BGYG 4LGDE 1L0NG 1QL2A 2XNDH 1TU3F 3JCUH 3Q5RA 2AXTH 3V4QA 2Z44A 2E74D 3QH9A 1L4AD 1KQLA 2KS1A 3L74E 3EFGA 2LPKA 2LIWA 1N7SA 3B5NB 3H1LE 2QE7H 3H1JG 1SQXE 2A06D 2GYKA 5AW8B 2WVRA 2BEQD 2R44A 4U0DA 1YHQP 4OGQD 3BCCG 3BATA 4YXDC 5EW5E 4WB4A 1JY3O 2FXPA 1Q90D 3VTPC 3G1GA 4C7NB 5KAFE 1JTHA 3FWLA 4DOJA 2IPPA 1J1DB 1BE3J 5CZDB 4H44D 1VQ8P 1UJZA 5AVZB 2W90A 5AVSB 1FC2C 1HJ0A 1GL2B 3IF4A 3D6YA 5KLVK 1S2EA 2Y9YA 4NEOA 1SQVJ 3CX5D 3BRTB 1N86A 4C7RA 2H8PD 4R4MA 1DD3A 2AVAA 1VKUA 2NRGA 4WY4D 3CXHI 2XNXA 1JO5A 4GOEA 5APWA 1G2CA 1F80D 2KNCB 1NQ4A 3PHLA 1RH5B 3P05A 3W68A 1EIAA 4YXWH 2ITAA 2P2UA 4KHXA 2GZEA 5AW7B 2JBGA 3IFMA 1NTME 2WSEH 4GR6A 1G1JA 1DV5A 3HTKB 3DTJA 5TISH 2BHVA 3I55P 1VQ4P 3EJEA 2ONTA 5KLVJ 1AQ5A 2JGPA 1GD2E 1VF5D 2KS1B 2RMZA 4RESB 1N7SB 1GK6A 2E5TA 1K30A 2A45H 4I7ZB 1P84H 3B5ND 3L35A 4UHPB 1JY2P 4IL6E 4N78E 1URQA 1KORA 2OYOA 2B87A 3HUSA 2LXCB 2WSFH 2QVAA 2W6JH 1KYOI 2VLNA 3L36A 1W5CE 1NVOA 3H1LG 2JR8A 1HY8A 1SQXG 5E79E 1FBMA 1T2KC 2CGQA 1NTKJ 1KC8Q 1KN7A 1M57D 1N73B 3P7KA 4JYBA 3CC7P 1KD1Q 4EDFA 3L73D 3PLNA 1FDOA 2QG4A 4R4LA 7CEIA 1J1EC 2PAJA 3DS3A 2WSCH 4XROA 1H89A 3N7NA 1YJNP 2N6ZA 1MFZA 1OW7A 3H1KE 3JSVC 1L0NK 1RE4A 2EG5A 3L74D 3O8ZA 1YJWP 4NPDA 5CCHA 3KXDA 3H1LD 3CCJP 1DEBA 1SQXD 1RNIA 3G71P 3RL0B 3KYQA 1NGMB 1GU5A 3S1KA 2RN0A 1ZNVA 3G26A 3VP8A 1X8YA 2PNGA 2YXRB 3T97B 1E6JP 1S5LH 1NTMG 1OIPA 1URQB 1QGKB 1GK4A 3Q20A 2B87B 1YI2P 1EOQA 2QM7A 2G3AA 1PFIA 1ZRTD 3LW5J 1BGYJ 3VMXA 1L0NJ 3P8MC 2K37A 1IFPA 3E1RA 2Z4EA 3CCSP 1EQ7A 4PV1D 4C46A 5KLIB 1QLED 1VQNP 3Q5SA 1L0LK 3H1IE 2FYUG 3ABVC 1KB9H 2LF4A 1A43A 2IBZI 4KT0J 3VMYA 2BCCE 1X3OA 3H1JJ 4U3FE 3CCLP 1ZN5A 2QRXA 2NO8A 1JCCA 2QJYC 1KILB 3BCCJ 3L72G 2GZGA 2E75B 3TGUG 2K1AA 4RKUJ 2FADA 3DS1A 3SWYA 1NTMD 2E76C 2KP8A 3JCUE 5BU5A 2AXTE 2Z46A 1DH3A 1DNYA 3I5CA 4PJ0H 1HH0A 2K9YA 2YO2A 2E42A 2MKVA 2YIUC 2E5YA 4GKGA 2XZRA 2CK3H 1OVVA 2VSQA 4H0LC 2ZVNB 3I56P 3NTNA 3GHGA 4N78D 1SQQE 2R3SA 3TSIA 3MGNA 2WPRA 1EZVI 2D2CB 1IFMA 1SQBE 1MZ9A 5CBOA 2OGUA 1LTSC 1GW4A 3H1KG 3V2PA 5TJHA 5KJ7A 3QWOC 2HR3A 5AVQB 2MF4A 1Q86Q 4BPFA 1RF0C 2IZ0A 4BXLA 2PRRA 4Y99C 1X79B 5HGOA 2BQ1E 2KG8A 3VRLC 2ZT9C 5KKZB 1NAYA 1NOHA 2POHA 4JYCA 1LP1B 5AVRB 1LTJA 1KMIZ 2M8PA 1VQOP 2E74C 1L4AC 3CCEP 1NTZG 2QNWA 2JP3A 2PEIA 3MIWA 2K93A 3H1HE 2JKVA 4CA3A 3CI9A 1KILD 2P7JA 2XT1A 3V6IA 2P67A 3Q5PA 1Q2NA 1SFCB 4OGQC 5TISE 1FZCC 5AVXB 2OYHA 2FYNB 2K9JA 1E5WA 2JO1A 1SLQA 3H1LJ 2ERHA 2Y0DA 1SQXJ 2DGYA 3CWBE 3CX5E 4D6TE 5F2KA 2K92A 2QJPC 2N5IA 2DW3A 1BXIA 4NPEA 4BRYA 1EDJA 1ZXGA 5AW1B 4H44C 4ZKUA 5BS1A 3CMEP 2FAEA 1JMBA 2KZIA 2MVVA 1M1JA 3D71A 3E1IA 2WT7A 1QEXA 2KORA 1BDDA 1GXHA 2FFDA 2GA1A 5CCGC 4WBAA 1Q82Q 4WY4C 1HJBA 2P9XA 2D2CD 3C8VA 1M7LA 2N1TD 5C39A 3VMZA 3MUDA 1JOCA 1JY2N 1IK9A 3H1ID 5BU8B 2OTJP 1NAFA 2EFJA 1NU1D 1IO4A 3CD6P 2BCCD 3RK2B 5CJ0A 4DCKA 2FYUK 1KTMA 2PEKA 4W7ZA 4U3FD 1SQPG 2Q3EA 2PEOA 2WPQA 1VF5C 1IFJA 3HD7A 5K5GB 2FBWC 1NTMJ 1U57A 2R5DA 2DNWA 5L8RJ 2H43A 3M9BA 2FQ0A 3MP7B 4XFXA 2OYIA 1DD4A 2A06G 3B5NC 4EOTA 3EQ2A 4PXHB 3AEFC 2Y0CA 2OYHB 2NPSA 3MD0A 5DJUB 1UIIA 3SWFA 1PP9D 1SFCD 3CL3D 3NXSA 1JNMA 4I6MC 2FYUJ 2JU2A 1LT9B 4WYMA 4XFYA 1SQQD 3IR9A 3OA7A 1BAJA 1OVRA 2OTLP 1E79H 3NTEA 5GTIH 1OXZA 2IFNA 1GU4A 1SQBD 2MD9A 1CZQA 4RJTA 3L72J 1J1DC 1ZR2A 5HVCA 3TGUJ 2Q9IA 2KZJA 3HYBA 1AUMA 2FFDB 2FACA 2FHSC 2M3BA 2E1MA 2ROQA 2QA4P 1S3JA 5AVYB 3AEEC 1OR5A 3ZDMA 4D6TG 2M3EA 3EFFK 1JY3P 2I1JA 4TT3H 1GDTA 2PP6A 1KB9E 1SQVK 1HGVA 1RQUA 1A02F 4K35A 1VQ6P 4MRTC 1OWAA 3RK2D 3H1HD 1IFNA 2O1JA 1NTZK 1PEUA 3HD7B 2K0XA 1T8KA 3M06A 1ZRTE 3H1KJ 2KSJA 3HE5B 1JMMA 4R0MA 4AQRD 3L37A 1PPJE 1BCCE 3AEDC 3OAKA 2FXOA 3CWBD 4QNBA 2L4BA 5I4TG 4D6TD 3V4WA 4TLFA 3SSUA 1LWUB 5CCGD 4I7ZC 5B66H 1AFOA 3L70E 4IL6X 4PH1A 3EJBA 1P84D 2KODA 1QRJA 4OWFA 4PV1C 3DS0A 3U59A 3S4RA 3A2AA 2V4HA 3M0AA 2CNRA 1NTZJ 4PD4E 2GZJA 2KYVA 2B88A 2E43A 3WU2H 5H2FE 4N6JA 3VN0A 3L73G 4GIFA 1N73C 1RO0A 2KGEA 4U0FA 1S9KD 3WUVA 1NTKK 4ZKPA 2N9YB 2HYNA 3KZIE 1JUNA 1LTTC 3LW5H 5AW5B 3H6PA 3BVHA 2Y9ZA 3B4QA 3A0HH 3GF3A 2KOQA 1L0LD 1Q7YQ 2EHTA 1SP4A 3TYYA 1Y47A 1N2DC 1QVGO 1SQPK 1JTHB 2YO3A 1H0TA 4AYCA 2P10A 2XV6A 2JJLA 2Q1KA 3L74G 1DIPA 3RBXA 4UB6H 1IFIA 1YITP 3PJSK 3G6EP 4JF7A 3O6QA 2P1JA 1RE3C 1JB0J 2K5XA 1ZV8A 4PWVB 3G4SP 1HBWA 1R8EA 4H13B 1GL2D 1KLPA 2WWWA 4BPHA 4LLHA 1A8OA 3LRYA 2JAZA 1Q81Q 1G2CB 3GG2A 2LTEA 4U0AA 1SQPJ 3KPEA 3G28A 1M8OB 5AVVB 3R4YA 2KG9A 1KILE 4HH2A 1SVFA 5KLIC 2OTKE 2EIAA 5AVWB 2PGDA 5DCKA 1U7MA 3PTZA 2XXMA 1K04A 4L76A 1YQ4C 1FAVA 1FZGA 2Z45A 3AE7C 1KB9D 2XU6A 2IYOA 1K8AQ 2KXPB 4UB8E 1R5SA 1LT1A 3A0BH 1KILC 2W8ZA 2GM4A 1QX8A 3RK3B 2AEJA 1N7SD 1YYCA 2CPBA 1JJ2O 2MJZA 1IC2A 1IFDA 3TF5A 1VQ5P 3HUSB 2KB7P 2WSEJ 4BPGA 3C9IA 1H0TB 1D7MA 4IFDK 2Q5UA 1RE4C 1KV4A 1LTAC 2IDBA 2GDXA 1OFCX 1JEKA 1PPJD 3DPHA 1BCCD 1J1EB 2XKMA 4D6TJ 1NU1E 3G3ZA 1IMPA 3L70D 4WWIA 3RGUA 1LGHB 2D2CC 5KLVE 1GZLA 3L75D 2N1TC 4DT0A 2FVEA 4H13D 5GTIE 2QJKB 1RF1C 1PEMA 4PD4D 3GLMA 4W80A 2JU1A 3EWKA 5APQA 3U1CA 2L9FA 5F2NA 1KZUB 2FY8A 2LMLA 2JQ4A 2FVFA 1VHNA 3FXDA 3M9QA 2C9LY 1HGZA 1PP9E 2IFMA 3M0DC 1OX3A 2M8RA 4XFJA 1CI6A 2GZFA 2FQ2A 4K3AA 3B71A 2VLPA 1PEQA 1LJ2A 2Q7CA 2KOOA 4U7JA 3MHVA 1NKNA 3PP5A 3RL0D 3VMAA 1NHLA 1M90Q 3WMM0 1Z6MA 1GPJA 1QL1A 1JY3N 1SFCC 3RK3D 2JYLA 1NH4A 1URQD 1L4AA 3CXHH 2KWLA 5AVTB 5KP6B 5CJ4A 2KI7B 5AW0B 2J5UA 3L71D 4EI2A 1SQXK 3HE4A 3L73J 1FZEA 3VOPA 1RO2A 2I8DA 3G9RA 2H7HA 5B66E 2HPCA 2E76B 1FZCA 2C0WA 3GKLC 2ZYGA 1IZNB 3CLQA 2KK7A 1ACPA 1NO4A 1UIXA 2EHSA 4IPYA 3KDPB 3TDKA 2YIUB 1E0HA 2OQQA 2XDJA 2R5BA 4GR2A 2OARA 2E75D 3P8CD 4ZNCA 3CX5I 3L74J 5B5EH 2QSIA 4H0LB 1H8AA 3H1IG 2WPVB 3F89A 3FWNA 1K9MQ 2C9NY 1NU1G 3IN6A 1L0HA 2KW2A 2BCCG 2HODA 3RK2C 2G8YA 4U3FG 3A3YB 1HUCA 3R2PA 2Y0EA 4OVNF 5CCGA 2GZIA 1BE3D 3E7KA 4WY4A 2VLQA 1L0NE 1NKZB 1KYOH 4U0CA 5E79H 3H4EA 3BRVB 1P84E 1CI6B 4GOFA 3H47A 5CCHD 2JWDA 2M0BA 3GHGB 1J2JB 1GW3A 1SQVD 2H89C 1AYIA 2ZT9B 2GDWA 4WVZA 2WQYC 3CCQP 3H1JE 1NTMK 1R5LA 4IFFA 2WITA 4OH8B 1RQVA 3C1LA 4UB6E 3BCCE 2KR5A 1PP9G 2E74B 1D1DA 3CXCO 1S9KE 4EIJA 1VQKP 3WUTA 3B8EB 1LT9C 2FKWB 4IOIH 4DG9A 1KQGB 1FJPA 4PH0A 1SQQG 1M1KQ 1AF8A 1PGQA 1W2BO 2V7QJ 5BS2A 3H0DA 1OW8A 1SQBG 2HPCB 1LTJB 3B5NA 5KLVD 1L0LE 1AJYA 2JYGA 4XE5B 3L4FA 4YTPC 4H2WC 3CC4P 3AE4C 2L5GB 2LOLA 1X9VA 1OVUA 1PV3A 3N4XA 2QJPB 3USSA 3CMAP 3Q1MA 4C7NA 3Q3DA 4I1LA 2K94A 1RY3A 3HRNA 4NPFX 1FOSF 4U0BA 1L0IA 1M6EX 2K9JB 3G21A 1OW6A 2JO0A 2HFED 2L0QA 5HV8A 2AFDA 1FJKA 2L22A 2N98A 1MKMA 2CG5B 3DS4A 3WUUA 4BRYB 3H32A 5BVZA 1A02J 3H1HG 4IFMA 2PENA 5APYA 2K88A 4ASVA 2BUOA 5JPAA 1NTKD 4M0IA 2QIWA 1S5LE 3RBZA 2MR7A 1M1JB 2K0YA 4MN4C 4Y28J 2WPTA 2WT7B 2O01N 2KLUA 2YKQA 2KNCA 3SFEC 3TNUA 2K3RA 1GL2C 3CWBG 2IX7C 3G1IA 2YMKA 2ZXEB 5AW2B 1LWUC 4U0EA 1HQBA 3HTKA 5KJ7D 1M74A 1VF5B 2A45G 1EZVD 1L2PA 2N5HA 3CCUP 1XTGB 1KFNA 5GTHH 1LTBC 1KQFB 1NYHA 1IJDB 5AW6B 2WPSA 2KGCA 2KG6A 3U1AA 2KGDA 2QM8A 4QMAA 2AF8A 2LXBA 1AQTA 2Z5HA 3DS5A 1EXJA 4XFZA 3RG2A 2FQ1A 2NZ2A 2FYZA 2J58A 1EMVA 1X22A 1G1IA 2OYIB 3S9OA 1N7SC 4PJ0E 4HB1A 1FOSE 5HGMA 4AUWA 3JC22 2ZYAA 1NU1K 2NPSB 4BWNA 5APUA 3V2NA 5APSA 1IUQA 1L0LG 1BGYD 1L0ND 4L74A 2IZ1A 5KAIH 4PD4I 1PGOA 2CWOA 5AW9B 4ASWA 1IK7A 3AEAC 3L75E 3H32B 1N73A 3NY7B 5AW3B 5M1BA 3TK1A 1EDLA 3H1JD 1MFTA 1FZAA 2M8LA 1FDMA 2O01J 1JM0A 3TNUB 1OMIA 3H25A 3BCCD 2MVUA 3CXHE 1YTZI 4CPGA 3GMAA 3H1IJ 1NU1J 4H13C 2BCCJ 5CMZA 2CPSA 2Z5IA 3AEBC 2Q6QA 4U3FJ 2N6YA 5CHXA 5HGNA 1W2EA 1Y9BA 3DS2A 1RE3A 1SQQK 2I1KA 3CX5H 1ZR4A 2W83C 2PEJA 1SQBK 2LKIA 2MR8A 1LTIC 2ZFCA 3GF7A 1EXIA 4IZ6A 1XTCC 2FYUE 2N50A 1Y8AA 3RK3E 1CSBA 3T97A 1N7LA 3CCRP 2LKMA 3LIEA 1HF9A 4XRQA 4A7PA 5B5EE 1X0TA 1WMKA 3AEGC 1AVYA 3PH0A 3HD7D 4PV1B 2JB0A 2JDIH 3L72E 1PP9J 5KTBA 3L71E 1YBKA 3MGEA 2KUBA 3RL0C 3TGUE 1JY2O 1VQ7P 1GMJA 3RK3C 2BASA 1ZMBA 1YQ3C 1KYOE 1SQQJ 1USDA 1WT6A 4HYTB 1KFMA 4W7YA 1URQC 1EDKA 3WBHA 2NPSD 2XZ0D 1SQBJ 2H88C 3FGAD 3HUSC 2B9BA 2M5AA 2XZ1C 3M91A 1YIJP 4JBZA 1KILA 1PPJG 1BCCG 3P8CE 2Q3IA 3OJAB 3G0VA 3ITKA 2AEFA 3AE2C 1S4XA 1KQSO 1FS0E 1FE6A 5EFWB 3L70G 2QEXP 2YKOA 4LC1A 1BE3E 2HLOA 2KGAA 3W67A 3A5TA 3CCMP 3L75G 5APXA 2FVAA 2X2BA 2E75C 1MV8A 1N8RQ 2QJKC 2R32A 3OW2O 3AE3C 3CE7A 3H1HJ 2BEZF 1LNQA 1SQVE 1NWQA 1BSHA 1EDIA 1VQLP 4COPA 1MZ8A 3CCVP 1YJ9P 2GUVA 3MZWB 4KJMA 3GJNA 1YTZT 2N1TA 3G29A 3FXEA 3HZQA 5EJDA 3CWBJ 5CCHC 1RF1A 3O6QB 2KOSA 1NTZE 5HGLA 1VL2A 4JQ0D 4L73A 2W6AA 3D6ZA 2LL8A 2J59M 1FDIA 3RG6C 1GXGA 2O3JA 2ZVOB 1LP1A 1T8ZA 3A7OA 3KQGA 3F5HA 3U43A 2WSFJ 3M0DA 3EJDA 4XA4A 1GTWA 2M5AB 2GDYA 3LMOA 2IBZE 5KAFH 1AV1A 1HVVA 3L71G 3CXHD 5KKZC 1PIXA 2PFXA 1NJIQ 2YXQB 3B5IA 4B86A 1BSNA 3CPWO 1ZW0A 1SFCA 1CW5A 2B89A 2UWJE 1RF0A 2RH0A 1PL5A 2JEEA 3GW6A 2W6BA 4L75A 5DJTB 3V2RA 1RHZB 1L0LJ 3AE5C 5GTHE 3D70A 4HJGH 1QVFO 4Z1MH 1NTKE 2ZYDA 1ZP0C 2WSCJ 3FX0A 4O9BA 2FYUD 2ZJSE 2V7QH 1PGJA 2FYNC 3E2DA 2RKLA 1Z56A 1T2KD 1AVOA 4F37A 2AEMA 2IYPA 1USEA 3B4SA 2M8NA 2QJYB 4PD4H 1SQPE 1K05A 1PGPA 2YNYA 1BE3G 2N1TB 3L72D 1LTGC 3LIDA 2KLVA 2M5RA 3TGUD 1RF1B 1EZVE 3PRJA 3VP9A 3K5BA 2VRSA 5H2FH 1KYOD 2FXMA 3II6A 5KAIE 1M6NA 3GHGC 1SQVG 2WZ7A 5AW4B 2VLOA 2GUSA 1VQPP 1PEOA 3SWKA 2A06E 4H2YC 3KZIH 3V5BA 1IMQA 3BASA 5KJ7C 5KP8B 1JCDA 3GZMA 1SS1A 3NMDA 4IL6H 2L91A 2JWAA 1FR2A 3GZLA 1FZFA 2W27A 1HTLC 3WU2E 3V2QA 2PEMA 5CBNA 3SFDC 2A45I 2ZAEB 1P84I 2KIKA 4GODA 5KLVG 3H1KD 1BGYE 1LTJC 4GT1A 1ZLLA 1T3UA 3A0HE 2AXCA 3AE9C 4HKZH 4Y99B 1ZMEC 3MTUE 1T6AA 2MY5A 4ZMDA 1PZQA 1LT9A 2IBZG 2KOPA 1M56D 2YKPA 1ZOYC 1EC5A 2R3CA 2P58A 2OYHC 1BCCJ 2HG5D 2WSSH 3AECC 1L4AB 2LIUA 1CEIA 1NTZD 1VDFA 3M9HA 1S1CX 3L70J 3HE4B 3P32A 4I2LC 4H2XC 4DZOA 4HKGA 1NTKG 4QKOA 1UNKA 3L75J 4OGQB 1FZCB 1S5LX 1M1JC 3IAOA 2AFEA 2E76D 2ZXXA 4RO0A 4UB8H 4N3YB 1DX7A 2FFDC 2KOGA 1BDCA 2WMMA 2O1KA 4DJGA
chains in the Genus database with same CATH topology
2Z45A 1Q86Q 4U0CA 3M1MA 1RO0A 3H4EA 1K8AQ 4U0FA 2PEQA 1K73Q 2PENA 1YIJP 3CC2P 3H47A 2BUOA 5JPAA 4M0IA 1PEQA 3CCSP 2OTJP 2M8LA 5HGOA 2BQ1E 2PEMA 2EFJA 1VQ8P 3VRLC 3G0VA 1VQNP 1NJIQ 3CD6P 3B5IA 3CCQP 5F2OA 1M90Q 1JJ2O 3CPWO 1Q7YQ 2PEKA 2LF4A 1KQSO 1VQ6P 1A43A 1VQ5P 1KC8Q 1VQ9P 1QVGO 2M8PA 2JYLA 2QEXP 3G1IA 3CC7P 1VQOP 1KD1Q 3CCLP 4COCA 2PEOA 4U0EA 2XV6A 1D1DA 3CXCO 3CCEP 3CCMP 1M74A 1PEUA 2PEIA 1YITP 1QVFO 2L6EA 1VQKP 1N8RQ 3DPHA 3CCUP 5HGNA 3G6EP 3OW2O 3DS1A 4PH0A 1RO2A 3DS2A 3DS3A 1M1KQ 2XT1A 1S72P 3P05A 1W2BO 4XFXA 5BS2A 4XROA 3H0DA 1EIAA 2PY8A 2PEJA 1YJNP 1VQLP 4QNBA 4COPA 3G4SP 3CCVP 5I4TG 1YJ9P 2Z46A 2JYGA 3E2DA 3CC4P 4GR6A 1VQMP 1A8OA 2EG5A 3DTJA 2DGYA 3LRYA 2M8NA 3CCRP 1YJWP 2BHVA 4PH1A 5F2KA 1Q81Q 3I55P 4IPYA 1VQ4P 3DS5A 2Z44A 4XFZA 3G29A 4XRQA 2ONTA 3HZQA 4WYMA 2KODA 1PEMA 4U0AA 3CMAP 3CCJP 5HGLA 3G28A 1QRJA 4XFYA 4GR2A 3DS0A 1RNIA 2OARA 1BAJA 5BS1A 3CMEP 2OTLP 3G71P 3MGEA 3NTEA 1VQ7P 5HGMA 4U0BA 5F2NA 3I56P 1M6NA 1K9MQ 1K30A 1M6EX 3G21A 3G26A 1IUQA 2EIAA 1VQPP 3RG6C 1PEOA 3HYBA 1ZMBA 2JO0A 1E6JP 4U0DA 1YHQP 5DCKA 1AUMA 2XXMA 3WBHA 2CWOA 1Q82Q 3DS4A 2E1MA 3Q20A 3G1GA 2QA4P 1YI2P 2P9XA 1EOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 Q;  1QVG O;  3CME P;  2OTL P;  3G71 P;  1YJN P;  1K8A Q;  1VQL P;  2QEX P;  3CC7 P;  1VQO P;  1K73 Q;  1KD1 Q;  1YIJ P;  3CC2 P;  3CCV P;  3G4S P;  3CCL P;  1YJ9 P;  1VQ7 P;  3I56 P;  3CXC O;  1K9M Q;  3CC4 P;  1VQM P;  3CCE P;  3CCM P;  3CCS P;  1KC8 Q;  2OTJ P;  1YIT P;  1VQP P;  1QVF O;  3CCR P;  1VQ8 P;  1YJW P;  1VQK P;  1Q81 Q;  1YHQ P;  1N8R Q;  3I55 P;  1VQ4 P;  1VQN P;  1NJI Q;  3CD6 P;  3CCU P;  3G6E P;  3OW2 O;  3CCQ P;  1M90 Q;  1JJ2 O;  3CPW O;  1Q7Y Q;  1Q82 Q;  1M1K Q;  3CMA P;  3CCJ P;  1KQS O;  1VQ6 P;  2QA4 P;  1YI2 P;  1S72 P;  1VQ5 P;  1W2B O;  1VQ9 P; 
#chains in the Genus database with same CATH topology
 2IBZ D;  4YPC A;  3RL0 g;  4GDO A;  3M1M A;  4H44 B;  1T3J A;  2PEQ A;  1K73 Q;  1HWT C;  3CC2 P;  4JPZ B;  3AE1 C;  3MUD C;  1WRG A;  3NFQ A;  1EZV G;  2SPZ A;  2LR2 A;  2KSE A;  5APT A;  3VYI A;  2HOD B;  3HE5 A;  1DEE G;  4H0L D;  5F2O A;  3KHU A;  2O01 H;  1GL2 A;  4M3L A;  3Q2Y A;  3A0B E;  3AE8 C;  1VQ9 P;  4WY4 B;  5APV A;  4COC A;  1LWU A;  5AVU B;  1VPC A;  2C0X A;  1FU1 A;  3HD7 C;  1U7J A;  2YMY A;  2N9B A;  1AA0 A;  1H88 A;  3L73 E;  2L6E A;  1OZH A;  3UIA A;  2K2Q A;  2WTY A;  3AE6 C;  1MUU A;  1S72 P;  1FZB A;  2CQ8 A;  1KB9 I;  2PY8 A;  5KP7 B;  2OYI C;  2ZT9 D;  1SQP D;  2XV5 A;  3L71 J;  2NPS C;  1VQM P;  2K0D X;  4EYY Q;  1BGY G;  4LGD E;  1L0N G;  1QL2 A;  2XND H;  1TU3 F;  3JCU H;  3Q5R A;  2AXT H;  3V4Q A;  2Z44 A;  2E74 D;  3QH9 A;  1L4A D;  1KQL A;  2KS1 A;  3L74 E;  3EFG A;  2LPK A;  2LIW A;  1N7S A;  3B5N B;  3H1L E;  2QE7 H;  3H1J G;  1SQX E;  2A06 D;  2GYK A;  5AW8 B;  2WVR A;  2BEQ D;  2R44 A;  4U0D A;  1YHQ P;  4OGQ D;  3BCC G;  3BAT A;  4YXD C;  5EW5 E;  4WB4 A;  1JY3 O;  2FXP A;  1Q90 D;  3VTP C;  3G1G A;  4C7N B;  5KAF E;  1JTH A;  3FWL A;  4DOJ A;  2IPP A;  1J1D B;  1BE3 J;  5CZD B;  4H44 D;  1VQ8 P;  1UJZ A;  5AVZ B;  2W90 A;  5AVS B;  1FC2 C;  1HJ0 A;  1GL2 B;  3IF4 A;  3D6Y A;  5KLV K;  1S2E A;  2Y9Y A;  4NEO A;  1SQV J;  3CX5 D;  3BRT B;  1N86 A;  4C7R A;  2H8P D;  4R4M A;  1DD3 A;  2AVA A;  1VKU A;  2NRG A;  4WY4 D;  3CXH I;  2XNX A;  1JO5 A;  4GOE A;  5APW A;  1G2C A;  1F80 D;  2KNC B;  1NQ4 A;  3PHL A;  1RH5 B;  3P05 A;  3W68 A;  1EIA A;  4YXW H;  2ITA A;  2P2U A;  4KHX A;  2GZE A;  5AW7 B;  2JBG A;  3IFM A;  1NTM E;  2WSE H;  4GR6 A;  1G1J A;  1DV5 A;  3HTK B;  3DTJ A;  5TIS H;  2BHV A;  3I55 P;  1VQ4 P;  3EJE A;  2ONT A;  5KLV J;  1AQ5 A;  2JGP A;  1GD2 E;  1VF5 D;  2KS1 B;  2RMZ A;  4RES B;  1N7S B;  1GK6 A;  2E5T A;  1K30 A;  2A45 H;  4I7Z B;  1P84 H;  3B5N D;  3L35 A;  4UHP B;  1JY2 P;  4IL6 E;  4N78 E;  1URQ A;  1KOR A;  2OYO A;  2B87 A;  3HUS A;  2LXC B;  2WSF H;  2QVA A;  2W6J H;  1KYO I;  2VLN A;  3L36 A;  1W5C E;  1NVO A;  3H1L G;  2JR8 A;  1HY8 A;  1SQX G;  5E79 E;  1FBM A;  1T2K C;  2CGQ A;  1NTK J;  1KC8 Q;  1KN7 A;  1M57 D;  1N73 B;  3P7K A;  4JYB A;  3CC7 P;  1KD1 Q;  4EDF A;  3L73 D;  3PLN A;  1FDO A;  2QG4 A;  4R4L A;  7CEI A;  1J1E C;  2PAJ A;  3DS3 A;  2WSC H;  4XRO A;  1H89 A;  3N7N A;  1YJN P;  2N6Z A;  1MFZ A;  1OW7 A;  3H1K E;  3JSV C;  1L0N K;  1RE4 A;  2EG5 A;  3L74 D;  3O8Z A;  1YJW P;  4NPD A;  5CCH A;  3KXD A;  3H1L D;  3CCJ P;  1DEB A;  1SQX D;  1RNI A;  3G71 P;  3RL0 B;  3KYQ A;  1NGM B;  1GU5 A;  3S1K A;  2RN0 A;  1ZNV A;  3G26 A;  3VP8 A;  1X8Y A;  2PNG A;  2YXR B;  3T97 B;  1E6J P;  1S5L H;  1NTM G;  1OIP A;  1URQ B;  1QGK B;  1GK4 A;  3Q20 A;  2B87 B;  1YI2 P;  1EOQ A;  2QM7 A;  2G3A A;  1PFI A;  1ZRT D;  3LW5 J;  1BGY J;  3VMX A;  1L0N J;  3P8M C;  2K37 A;  1IFP A;  3E1R A;  2Z4E A;  3CCS P;  1EQ7 A;  4PV1 D;  4C46 A;  5KLI B;  1QLE D;  1VQN P;  3Q5S A;  1L0L K;  3H1I E;  2FYU G;  3ABV C;  1KB9 H;  2LF4 A;  1A43 A;  2IBZ I;  4KT0 J;  3VMY A;  2BCC E;  1X3O A;  3H1J J;  4U3F E;  3CCL P;  1ZN5 A;  2QRX A;  2NO8 A;  1JCC A;  2QJY C;  1KIL B;  3BCC J;  3L72 G;  2GZG A;  2E75 B;  3TGU G;  2K1A A;  4RKU J;  2FAD A;  3DS1 A;  3SWY A;  1NTM D;  2E76 C;  2KP8 A;  3JCU E;  5BU5 A;  2AXT E;  2Z46 A;  1DH3 A;  1DNY A;  3I5C A;  4PJ0 H;  1HH0 A;  2K9Y A;  2YO2 A;  2E42 A;  2MKV A;  2YIU C;  2E5Y A;  4GKG A;  2XZR A;  2CK3 H;  1OVV A;  2VSQ A;  4H0L C;  2ZVN B;  3I56 P;  3NTN A;  3GHG A;  4N78 D;  1SQQ E;  2R3S A;  3TSI A;  3MGN A;  2WPR A;  1EZV I;  2D2C B;  1IFM A;  1SQB E;  1MZ9 A;  5CBO A;  2OGU A;  1LTS C;  1GW4 A;  3H1K G;  3V2P A;  5TJH A;  5KJ7 A;  3QWO C;  2HR3 A;  5AVQ B;  2MF4 A;  1Q86 Q;  4BPF A;  1RF0 C;  2IZ0 A;  4BXL A;  2PRR A;  4Y99 C;  1X79 B;  5HGO A;  2BQ1 E;  2KG8 A;  3VRL C;  2ZT9 C;  5KKZ B;  1NAY A;  1NOH A;  2POH A;  4JYC A;  1LP1 B;  5AVR B;  1LTJ A;  1KMI Z;  2M8P A;  1VQO P;  2E74 C;  1L4A C;  3CCE P;  1NTZ G;  2QNW A;  2JP3 A;  2PEI A;  3MIW A;  2K93 A;  3H1H E;  2JKV A;  4CA3 A;  3CI9 A;  1KIL D;  2P7J A;  2XT1 A;  3V6I A;  2P67 A;  3Q5P A;  1Q2N A;  1SFC B;  4OGQ C;  5TIS E;  1FZC C;  5AVX B;  2OYH A;  2FYN B;  2K9J A;  1E5W A;  2JO1 A;  1SLQ A;  3H1L J;  2ERH A;  2Y0D A;  1SQX J;  2DGY A;  3CWB E;  3CX5 E;  4D6T E;  5F2K A;  2K92 A;  2QJP C;  2N5I A;  2DW3 A;  1BXI A;  4NPE A;  4BRY A;  1EDJ A;  1ZXG A;  5AW1 B;  4H44 C;  4ZKU A;  5BS1 A;  3CME P;  2FAE A;  1JMB A;  2KZI A;  2MVV A;  1M1J A;  3D71 A;  3E1I A;  2WT7 A;  1QEX A;  2KOR A;  1BDD A;  1GXH A;  2FFD A;  2GA1 A;  5CCG C;  4WBA A;  1Q82 Q;  4WY4 C;  1HJB A;  2P9X A;  2D2C D;  3C8V A;  1M7L A;  2N1T D;  5C39 A;  3VMZ A;  3MUD A;  1JOC A;  1JY2 N;  1IK9 A;  3H1I D;  5BU8 B;  2OTJ P;  1NAF A;  2EFJ A;  1NU1 D;  1IO4 A;  3CD6 P;  2BCC D;  3RK2 B;  5CJ0 A;  4DCK A;  2FYU K;  1KTM A;  2PEK A;  4W7Z A;  4U3F D;  1SQP G;  2Q3E A;  2PEO A;  2WPQ A;  1VF5 C;  1IFJ A;  3HD7 A;  5K5G B;  2FBW C;  1NTM J;  1U57 A;  2R5D A;  2DNW A;  5L8R J;  2H43 A;  3M9B A;  2FQ0 A;  3MP7 B;  4XFX A;  2OYI A;  1DD4 A;  2A06 G;  3B5N C;  4EOT A;  3EQ2 A;  4PXH B;  3AEF C;  2Y0C A;  2OYH B;  2NPS A;  3MD0 A;  5DJU B;  1UII A;  3SWF A;  1PP9 D;  1SFC D;  3CL3 D;  3NXS A;  1JNM A;  4I6M C;  2FYU J;  2JU2 A;  1LT9 B;  4WYM A;  4XFY A;  1SQQ D;  3IR9 A;  3OA7 A;  1BAJ A;  1OVR A;  2OTL P;  1E79 H;  3NTE A;  5GTI H;  1OXZ A;  2IFN A;  1GU4 A;  1SQB D;  2MD9 A;  1CZQ A;  4RJT A;  3L72 J;  1J1D C;  1ZR2 A;  5HVC A;  3TGU J;  2Q9I A;  2KZJ A;  3HYB A;  1AUM A;  2FFD B;  2FAC A;  2FHS C;  2M3B A;  2E1M A;  2ROQ A;  2QA4 P;  1S3J A;  5AVY B;  3AEE C;  1OR5 A;  3ZDM A;  4D6T G;  2M3E A;  3EFF K;  1JY3 P;  2I1J A;  4TT3 H;  1GDT A;  2PP6 A;  1KB9 E;  1SQV K;  1HGV A;  1RQU A;  1A02 F;  4K35 A;  1VQ6 P;  4MRT C;  1OWA A;  3RK2 D;  3H1H D;  1IFN A;  2O1J A;  1NTZ K;  1PEU A;  3HD7 B;  2K0X A;  1T8K A;  3M06 A;  1ZRT E;  3H1K J;  2KSJ A;  3HE5 B;  1JMM A;  4R0M A;  4AQR D;  3L37 A;  1PPJ E;  1BCC E;  3AED C;  3OAK A;  2FXO A;  3CWB D;  4QNB A;  2L4B A;  5I4T G;  4D6T D;  3V4W A;  4TLF A;  3SSU A;  1LWU B;  5CCG D;  4I7Z C;  5B66 H;  1AFO A;  3L70 E;  4IL6 X;  4PH1 A;  3EJB A;  1P84 D;  2KOD A;  1QRJ A;  4OWF A;  4PV1 C;  3DS0 A;  3U59 A;  3S4R A;  3A2A A;  2V4H A;  3M0A A;  2CNR A;  1NTZ J;  4PD4 E;  2GZJ A;  2KYV A;  2B88 A;  2E43 A;  3WU2 H;  5H2F E;  4N6J A;  3VN0 A;  3L73 G;  4GIF A;  1N73 C;  1RO0 A;  2KGE A;  4U0F A;  1S9K D;  3WUV A;  1NTK K;  4ZKP A;  2N9Y B;  2HYN A;  3KZI E;  1JUN A;  1LTT C;  3LW5 H;  5AW5 B;  3H6P A;  3BVH A;  2Y9Z A;  3B4Q A;  3A0H H;  3GF3 A;  2KOQ A;  1L0L D;  1Q7Y Q;  2EHT A;  1SP4 A;  3TYY A;  1Y47 A;  1N2D C;  1QVG O;  1SQP K;  1JTH B;  2YO3 A;  1H0T A;  4AYC A;  2P10 A;  2XV6 A;  2JJL A;  2Q1K A;  3L74 G;  1DIP A;  3RBX A;  4UB6 H;  1IFI A;  1YIT P;  3PJS K;  3G6E P;  4JF7 A;  3O6Q A;  2P1J A;  1RE3 C;  1JB0 J;  2K5X A;  1ZV8 A;  4PWV B;  3G4S P;  1HBW A;  1R8E A;  4H13 B;  1GL2 D;  1KLP A;  2WWW A;  4BPH A;  4LLH A;  1A8O A;  3LRY A;  2JAZ A;  1Q81 Q;  1G2C B;  3GG2 A;  2LTE A;  4U0A A;  1SQP J;  3KPE A;  3G28 A;  1M8O B;  5AVV B;  3R4Y A;  2KG9 A;  1KIL E;  4HH2 A;  1SVF A;  5KLI C;  2OTK E;  2EIA A;  5AVW B;  2PGD A;  5DCK A;  1U7M A;  3PTZ A;  2XXM A;  1K04 A;  4L76 A;  1YQ4 C;  1FAV A;  1FZG A;  2Z45 A;  3AE7 C;  1KB9 D;  2XU6 A;  2IYO A;  1K8A Q;  2KXP B;  4UB8 E;  1R5S A;  1LT1 A;  3A0B H;  1KIL C;  2W8Z A;  2GM4 A;  1QX8 A;  3RK3 B;  2AEJ A;  1N7S D;  1YYC A;  2CPB A;  1JJ2 O;  2MJZ A;  1IC2 A;  1IFD A;  3TF5 A;  1VQ5 P;  3HUS B;  2KB7 P;  2WSE J;  4BPG A;  3C9I A;  1H0T B;  1D7M A;  4IFD K;  2Q5U A;  1RE4 C;  1KV4 A;  1LTA C;  2IDB A;  2GDX A;  1OFC X;  1JEK A;  1PPJ D;  3DPH A;  1BCC D;  1J1E B;  2XKM A;  4D6T J;  1NU1 E;  3G3Z A;  1IMP A;  3L70 D;  4WWI A;  3RGU A;  1LGH B;  2D2C C;  5KLV E;  1GZL A;  3L75 D;  2N1T C;  4DT0 A;  2FVE A;  4H13 D;  5GTI E;  2QJK B;  1RF1 C;  1PEM A;  4PD4 D;  3GLM A;  4W80 A;  2JU1 A;  3EWK A;  5APQ A;  3U1C A;  2L9F A;  5F2N A;  1KZU B;  2FY8 A;  2LML A;  2JQ4 A;  2FVF A;  1VHN A;  3FXD A;  3M9Q A;  2C9L Y;  1HGZ A;  1PP9 E;  2IFM A;  3M0D C;  1OX3 A;  2M8R A;  4XFJ A;  1CI6 A;  2GZF A;  2FQ2 A;  4K3A A;  3B71 A;  2VLP A;  1PEQ A;  1LJ2 A;  2Q7C A;  2KOO A;  4U7J A;  3MHV A;  1NKN A;  3PP5 A;  3RL0 D;  3VMA A;  1NHL A;  1M90 Q;  3WMM 0;  1Z6M A;  1GPJ A;  1QL1 A;  1JY3 N;  1SFC C;  3RK3 D;  2JYL A;  1NH4 A;  1URQ D;  1L4A A;  3CXH H;  2KWL A;  5AVT B;  5KP6 B;  5CJ4 A;  2KI7 B;  5AW0 B;  2J5U A;  3L71 D;  4EI2 A;  1SQX K;  3HE4 A;  3L73 J;  1FZE A;  3VOP A;  1RO2 A;  2I8D A;  3G9R A;  2H7H A;  5B66 E;  2HPC A;  2E76 B;  1FZC A;  2C0W A;  3GKL C;  2ZYG A;  1IZN B;  3CLQ A;  2KK7 A;  1ACP A;  1NO4 A;  1UIX A;  2EHS A;  4IPY A;  3KDP B;  3TDK A;  2YIU B;  1E0H A;  2OQQ A;  2XDJ A;  2R5B A;  4GR2 A;  2OAR A;  2E75 D;  3P8C D;  4ZNC A;  3CX5 I;  3L74 J;  5B5E H;  2QSI A;  4H0L B;  1H8A A;  3H1I G;  2WPV B;  3F89 A;  3FWN A;  1K9M Q;  2C9N Y;  1NU1 G;  3IN6 A;  1L0H A;  2KW2 A;  2BCC G;  2HOD A;  3RK2 C;  2G8Y A;  4U3F G;  3A3Y B;  1HUC A;  3R2P A;  2Y0E A;  4OVN F;  5CCG A;  2GZI A;  1BE3 D;  3E7K A;  4WY4 A;  2VLQ A;  1L0N E;  1NKZ B;  1KYO H;  4U0C A;  5E79 H;  3H4E A;  3BRV B;  1P84 E;  1CI6 B;  4GOF A;  3H47 A;  5CCH D;  2JWD A;  2M0B A;  3GHG B;  1J2J B;  1GW3 A;  1SQV D;  2H89 C;  1AYI A;  2ZT9 B;  2GDW A;  4WVZ A;  2WQY C;  3CCQ P;  3H1J E;  1NTM K;  1R5L A;  4IFF A;  2WIT A;  4OH8 B;  1RQV A;  3C1L A;  4UB6 E;  3BCC E;  2KR5 A;  1PP9 G;  2E74 B;  1D1D A;  3CXC O;  1S9K E;  4EIJ A;  1VQK P;  3WUT A;  3B8E B;  1LT9 C;  2FKW B;  4IOI H;  4DG9 A;  1KQG B;  1FJP A;  4PH0 A;  1SQQ G;  1M1K Q;  1AF8 A;  1PGQ A;  1W2B O;  2V7Q J;  5BS2 A;  3H0D A;  1OW8 A;  1SQB G;  2HPC B;  1LTJ B;  3B5N A;  5KLV D;  1L0L E;  1AJY A;  2JYG A;  4XE5 B;  3L4F A;  4YTP C;  4H2W C;  3CC4 P;  3AE4 C;  2L5G B;  2LOL A;  1X9V A;  1OVU A;  1PV3 A;  3N4X A;  2QJP B;  3USS A;  3CMA P;  3Q1M A;  4C7N A;  3Q3D A;  4I1L A;  2K94 A;  1RY3 A;  3HRN A;  4NPF X;  1FOS F;  4U0B A;  1L0I A;  1M6E X;  2K9J B;  3G21 A;  1OW6 A;  2JO0 A;  2HFE D;  2L0Q A;  5HV8 A;  2AFD A;  1FJK A;  2L22 A;  2N98 A;  1MKM A;  2CG5 B;  3DS4 A;  3WUU A;  4BRY B;  3H32 A;  5BVZ A;  1A02 J;  3H1H G;  4IFM A;  2PEN A;  5APY A;  2K88 A;  4ASV A;  2BUO A;  5JPA A;  1NTK D;  4M0I A;  2QIW A;  1S5L E;  3RBZ A;  2MR7 A;  1M1J B;  2K0Y A;  4MN4 C;  4Y28 J;  2WPT A;  2WT7 B;  2O01 N;  2KLU A;  2YKQ A;  2KNC A;  3SFE C;  3TNU A;  2K3R A;  1GL2 C;  3CWB G;  2IX7 C;  3G1I A;  2YMK A;  2ZXE B;  5AW2 B;  1LWU C;  4U0E A;  1HQB A;  3HTK A;  5KJ7 D;  1M74 A;  1VF5 B;  2A45 G;  1EZV D;  1L2P A;  2N5H A;  3CCU P;  1XTG B;  1KFN A;  5GTH H;  1LTB C;  1KQF B;  1NYH A;  1IJD B;  5AW6 B;  2WPS A;  2KGC A;  2KG6 A;  3U1A A;  2KGD A;  2QM8 A;  4QMA A;  2AF8 A;  2LXB A;  1AQT A;  2Z5H A;  3DS5 A;  1EXJ A;  4XFZ A;  3RG2 A;  2FQ1 A;  2NZ2 A;  2FYZ A;  2J58 A;  1EMV A;  1X22 A;  1G1I A;  2OYI B;  3S9O A;  1N7S C;  4PJ0 E;  4HB1 A;  1FOS E;  5HGM A;  4AUW A;  3JC2 2;  2ZYA A;  1NU1 K;  2NPS B;  4BWN A;  5APU A;  3V2N A;  5APS A;  1IUQ A;  1L0L G;  1BGY D;  1L0N D;  4L74 A;  2IZ1 A;  5KAI H;  4PD4 I;  1PGO A;  2CWO A;  5AW9 B;  4ASW A;  1IK7 A;  3AEA C;  3L75 E;  3H32 B;  1N73 A;  3NY7 B;  5AW3 B;  5M1B A;  3TK1 A;  1EDL A;  3H1J D;  1MFT A;  1FZA A;  2M8L A;  1FDM A;  2O01 J;  1JM0 A;  3TNU B;  1OMI A;  3H25 A;  3BCC D;  2MVU A;  3CXH E;  1YTZ I;  4CPG A;  3GMA A;  3H1I J;  1NU1 J;  4H13 C;  2BCC J;  5CMZ A;  2CPS A;  2Z5I A;  3AEB C;  2Q6Q A;  4U3F J;  2N6Y A;  5CHX A;  5HGN A;  1W2E A;  1Y9B A;  3DS2 A;  1RE3 A;  1SQQ K;  2I1K A;  3CX5 H;  1ZR4 A;  2W83 C;  2PEJ A;  1SQB K;  2LKI A;  2MR8 A;  1LTI C;  2ZFC A;  3GF7 A;  1EXI A;  4IZ6 A;  1XTC C;  2FYU E;  2N50 A;  1Y8A A;  3RK3 E;  1CSB A;  3T97 A;  1N7L A;  3CCR P;  2LKM A;  3LIE A;  1HF9 A;  4XRQ A;  4A7P A;  5B5E E;  1X0T A;  1WMK A;  3AEG C;  1AVY A;  3PH0 A;  3HD7 D;  4PV1 B;  2JB0 A;  2JDI H;  3L72 E;  1PP9 J;  5KTB A;  3L71 E;  1YBK A;  3MGE A;  2KUB A;  3RL0 C;  3TGU E;  1JY2 O;  1VQ7 P;  1GMJ A;  3RK3 C;  2BAS A;  1ZMB A;  1YQ3 C;  1KYO E;  1SQQ J;  1USD A;  1WT6 A;  4HYT B;  1KFM A;  4W7Y A;  1URQ C;  1EDK A;  3WBH A;  2NPS D;  2XZ0 D;  1SQB J;  2H88 C;  3FGA D;  3HUS C;  2B9B A;  2M5A A;  2XZ1 C;  3M91 A;  1YIJ P;  4JBZ A;  1KIL A;  1PPJ G;  1BCC G;  3P8C E;  2Q3I A;  3OJA B;  3G0V A;  3ITK A;  2AEF A;  3AE2 C;  1S4X A;  1KQS O;  1FS0 E;  1FE6 A;  5EFW B;  3L70 G;  2QEX P;  2YKO A;  4LC1 A;  1BE3 E;  2HLO A;  2KGA A;  3W67 A;  3A5T A;  3CCM P;  3L75 G;  5APX A;  2FVA A;  2X2B A;  2E75 C;  1MV8 A;  1N8R Q;  2QJK C;  2R32 A;  3OW2 O;  3AE3 C;  3CE7 A;  3H1H J;  2BEZ F;  1LNQ A;  1SQV E;  1NWQ A;  1BSH A;  1EDI A;  1VQL P;  4COP A;  1MZ8 A;  3CCV P;  1YJ9 P;  2GUV A;  3MZW B;  4KJM A;  3GJN A;  1YTZ T;  2N1T A;  3G29 A;  3FXE A;  3HZQ A;  5EJD A;  3CWB J;  5CCH C;  1RF1 A;  3O6Q B;  2KOS A;  1NTZ E;  5HGL A;  1VL2 A;  4JQ0 D;  4L73 A;  2W6A A;  3D6Z A;  2LL8 A;  2J59 M;  1FDI A;  3RG6 C;  1GXG A;  2O3J A;  2ZVO B;  1LP1 A;  1T8Z A;  3A7O A;  3KQG A;  3F5H A;  3U43 A;  2WSF J;  3M0D A;  3EJD A;  4XA4 A;  1GTW A;  2M5A B;  2GDY A;  3LMO A;  2IBZ E;  5KAF H;  1AV1 A;  1HVV A;  3L71 G;  3CXH D;  5KKZ C;  1PIX A;  2PFX A;  1NJI Q;  2YXQ B;  3B5I A;  4B86 A;  1BSN A;  3CPW O;  1ZW0 A;  1SFC A;  1CW5 A;  2B89 A;  2UWJ E;  1RF0 A;  2RH0 A;  1PL5 A;  2JEE A;  3GW6 A;  2W6B A;  4L75 A;  5DJT B;  3V2R A;  1RHZ B;  1L0L J;  3AE5 C;  5GTH E;  3D70 A;  4HJG H;  1QVF O;  4Z1M H;  1NTK E;  2ZYD A;  1ZP0 C;  2WSC J;  3FX0 A;  4O9B A;  2FYU D;  2ZJS E;  2V7Q H;  1PGJ A;  2FYN C;  3E2D A;  2RKL A;  1Z56 A;  1T2K D;  1AVO A;  4F37 A;  2AEM A;  2IYP A;  1USE A;  3B4S A;  2M8N A;  2QJY B;  4PD4 H;  1SQP E;  1K05 A;  1PGP A;  2YNY A;  1BE3 G;  2N1T B;  3L72 D;  1LTG C;  3LID A;  2KLV A;  2M5R A;  3TGU D;  1RF1 B;  1EZV E;  3PRJ A;  3VP9 A;  3K5B A;  2VRS A;  5H2F H;  1KYO D;  2FXM A;  3II6 A;  5KAI E;  1M6N A;  3GHG C;  1SQV G;  2WZ7 A;  5AW4 B;  2VLO A;  2GUS A;  1VQP P;  1PEO A;  3SWK A;  2A06 E;  4H2Y C;  3KZI H;  3V5B A;  1IMQ A;  3BAS A;  5KJ7 C;  5KP8 B;  1JCD A;  3GZM A;  1SS1 A;  3NMD A;  4IL6 H;  2L91 A;  2JWA A;  1FR2 A;  3GZL A;  1FZF A;  2W27 A;  1HTL C;  3WU2 E;  3V2Q A;  2PEM A;  5CBN A;  3SFD C;  2A45 I;  2ZAE B;  1P84 I;  2KIK A;  4GOD A;  5KLV G;  3H1K D;  1BGY E;  1LTJ C;  4GT1 A;  1ZLL A;  1T3U A;  3A0H E;  2AXC A;  3AE9 C;  4HKZ H;  4Y99 B;  1ZME C;  3MTU E;  1T6A A;  2MY5 A;  4ZMD A;  1PZQ A;  1LT9 A;  2IBZ G;  2KOP A;  1M56 D;  2YKP A;  1ZOY C;  1EC5 A;  2R3C A;  2P58 A;  2OYH C;  1BCC J;  2HG5 D;  2WSS H;  3AEC C;  1L4A B;  2LIU A;  1CEI A;  1NTZ D;  1VDF A;  3M9H A;  1S1C X;  3L70 J;  3HE4 B;  3P32 A;  4I2L C;  4H2X C;  4DZO A;  4HKG A;  1NTK G;  4QKO A;  1UNK A;  3L75 J;  4OGQ B;  1FZC B;  1S5L X;  1M1J C;  3IAO A;  2AFE A;  2E76 D;  2ZXX A;  4RO0 A;  4UB8 H;  4N3Y B;  1DX7 A;  2FFD C;  2KOG A;  1BDC A;  2WMM A;  2O1K A;  4DJG A; 
#chains in the Genus database with same CATH homology
 2Z45 A;  1Q86 Q;  4U0C A;  3M1M A;  1RO0 A;  3H4E A;  1K8A Q;  4U0F A;  2PEQ A;  1K73 Q;  2PEN A;  1YIJ P;  3CC2 P;  3H47 A;  2BUO A;  5JPA A;  4M0I A;  1PEQ A;  3CCS P;  2OTJ P;  2M8L A;  5HGO A;  2BQ1 E;  2PEM A;  2EFJ A;  1VQ8 P;  3VRL C;  3G0V A;  1VQN P;  1NJI Q;  3CD6 P;  3B5I A;  3CCQ P;  5F2O A;  1M90 Q;  1JJ2 O;  3CPW O;  1Q7Y Q;  2PEK A;  2LF4 A;  1KQS O;  1VQ6 P;  1A43 A;  1VQ5 P;  1KC8 Q;  1VQ9 P;  1QVG O;  2M8P A;  2JYL A;  2QEX P;  3G1I A;  3CC7 P;  1VQO P;  1KD1 Q;  3CCL P;  4COC A;  2PEO A;  4U0E A;  2XV6 A;  1D1D A;  3CXC O;  3CCE P;  3CCM P;  1M74 A;  1PEU A;  2PEI A;  1YIT P;  1QVF O;  2L6E A;  1VQK P;  1N8R Q;  3DPH A;  3CCU P;  5HGN A;  3G6E P;  3OW2 O;  3DS1 A;  4PH0 A;  1RO2 A;  3DS2 A;  3DS3 A;  1M1K Q;  2XT1 A;  1S72 P;  3P05 A;  1W2B O;  4XFX A;  5BS2 A;  4XRO A;  3H0D A;  1EIA A;  2PY8 A;  2PEJ A;  1YJN P;  1VQL P;  4QNB A;  4COP A;  3G4S P;  3CCV P;  5I4T G;  1YJ9 P;  2Z46 A;  2JYG A;  3E2D A;  3CC4 P;  4GR6 A;  1VQM P;  1A8O A;  2EG5 A;  3DTJ A;  2DGY A;  3LRY A;  2M8N A;  3CCR P;  1YJW P;  2BHV A;  4PH1 A;  5F2K A;  1Q81 Q;  3I55 P;  4IPY A;  1VQ4 P;  3DS5 A;  2Z44 A;  4XFZ A;  3G29 A;  4XRQ A;  2ONT A;  3HZQ A;  4WYM A;  2KOD A;  1PEM A;  4U0A A;  3CMA P;  3CCJ P;  5HGL A;  3G28 A;  1QRJ A;  4XFY A;  4GR2 A;  3DS0 A;  1RNI A;  2OAR A;  1BAJ A;  5BS1 A;  3CME P;  2OTL P;  3G71 P;  3MGE A;  3NTE A;  1VQ7 P;  5HGM A;  4U0B A;  5F2N A;  3I56 P;  1M6N A;  1K9M Q;  1K30 A;  1M6E X;  3G21 A;  3G26 A;  1IUQ A;  2EIA A;  1VQP P;  3RG6 C;  1PEO A;  3HYB A;  1ZMB A;  2JO0 A;  1E6J P;  4U0D A;  1YHQ P;  5DCK A;  1AUM A;  2XXM A;  3WBH A;  2CWO A;  1Q82 Q;  3DS4 A;  2E1M A;  3Q20 A;  3G1G A;  2QA4 P;  1YI2 P;  2P9X A;  1EOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...