3CCUP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccuP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccuP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccuP02
3CPWO 1N8RQ 1VQ7P 1VQ4P 3CD6P 1VQNP 1K8AQ 1YHQP 3CC2P 1M90Q 1QVFO 3G6EP 3G4SP 3CCJP 1VQPP 3CCQP 3CCVP 1S72P 3I56P 1NJIQ 1VQMP 1M1KQ 1KQSO 1KC8Q 3CMEP 1Q86Q 3I55P 2QA4P 1YJNP 1KD1Q 1YIJP 3CCRP 3OW2O 1QVGO 1VQLP 2OTJP 1VQ8P 3CXCO 1Q7YQ 3CCMP 1VQ5P 1Q81Q 1W2BO 3CCSP 3CCLP 2OTLP 1YITP 1JJ2O 1K9MQ 3G71P 1VQ6P 3CCEP 3CMAP 1Q82Q 1VQ9P 3CCUP 3CC4P 1YJWP 1VQOP 1VQKP 3CC7P 2QEXP 1K73Q 1YI2P 1YJ9P
chains in the Genus database with same CATH superfamily
2PY8A 1N73B 5TISE 1A8OA 2IBZD 3A0HH 3FXEA 3H6PA 2KK7A 1SQQE 1LWUB 1KILB 1KILE 1L0ND 2A45H 2CPBA 2P67A 2KOPA 2FKWB 2IPPA 4XFYA 5KLIC 2Y9ZA 1QX8A 1M1JA 2K0YA 3HZQA 1RNIA 2MKVA 2KI7B 1BDDA 1ZW0A 1GW4A 2L0QA 2LR2A 4H13B 2YNYA 4GDOA 1GU5A 1DD4A 2NPSD 3VN0A 3E7KA 5CCHA 1KN7A 3MUDA 1FR2A 2BCCJ 4H13C 2WTYA 1SFCB 2OTLP 1L0LK 1GL2C 2L9FA 1FS0E 5B66E 3ITKA 2PAJA 1OVRA 3Q20A 1RF0A 1S5LX 2QJPB 3G21A 1P84D 1LTGC 4BWNA 3RGUA 1S5LE 3HD7D 1GL2D 4JYCA 4N3YB 1FDOA 2QM7A 2QRXA 2FBWC 5I4TG 1S2EA 1RHZB 2R3CA 2POHA 2H7HA 3DS4A 1ZR4A 2KG6A 4WY4A 3II6A 2FVEA 3G4SP 1NTMG 3TGUG 4HJGH 2WQYC 2ZXEB 3L75G 1GW3A 1FZAA 5AW5B 1GXHA 1JJ2O 1T2KD 2XV6A 2E76D 5E79H 3A7OA 3AEGC 1L0IA 1EZVG 4YXDC 2Q1KA 2Y0CA 1HY8A 1SQXD 5AVUB 2WVRA 4U3FD 3BCCJ 1ZRTD 4CPGA 2QJPC 3RBZA 3I55P 3CCRP 1VL2A 3D6YA 2SPZA 4IFMA 1USEA 1DX7A 1PZQA 2Z46A 1IK9A 2FFDA 3H47A 1R8EA 2RMZA 2FVFA 5F2OA 1N8RQ 1K8AQ 1ZLLA 2JEEA 2WT7A 3H1JG 5KLVD 3AEFC 3ZDMA 4OGQC 1KYOI 4BRYB 5KJ7A 5KP6B 1RY3A 1SQQG 1L0NK 3CWBD 1MFZA 3GF7A 2BUOA 3P05A 4U0FA 4H2YC 5BU8B 3L74D 3V2PA 2ZFCA 1S9KE 2LMLA 1JY3N 2K92A 3VYIA 1VQ7P 4H0LB 3QH9A 4ZNCA 4ZKPA 1PEUA 4YXWH 2JJLA 2A06G 2LXBA 3KDPB 4COPA 2PNGA 1BCCD 2GZJA 5GTIH 1UIIA 4HYTB 4PD4I 1NKZB 1NU1K 2PEQA 2H88C 3P32A 2LOLA 2N50A 3AEEC 3KXDA 4XFXA 1IMQA 2O3JA 2LL8A 1BCCJ 1P84E 5APTA 1YIJP 3PP5A 2W8ZA 1KTMA 3G1GA 1K05A 5CJ4A 1RE3C 1JO5A 3USSA 1JB0J 2C9NY 2O1JA 1NTKG 1K04A 2KSJA 5KTBA 1P84H 4BPFA 1ZXGA 1R5LA 4IZ6A 2BEZF 4UB8H 2ZXXA 1PV3A 2KXPB 5APQA 1YJNP 5APYA 1HF9A 1M6NA 3CCMP 1IFDA 4PV1D 4D6TE 2BASA 1VQ6P 3CXHI 2ZYAA 1XTCC 2KW2A 2L6EA 3HUSB 4LC1A 1L4AB 4N6JA 2QJYC 2FAEA 3TYYA 1AVOA 1BGYD 2K0DX 2ITAA 5BU5A 1EDLA 3H1KE 4I2LC 3M9QA 1QVGO 2N9BA 2M5AB 1NTZK 3H1IJ 4Z1MH 3Q5SA 3S4RA 1EDJA 2LKIA 4N78D 3NTEA 1LP1A 5APUA 2FFDB 3RK3E 3MP7B 5B5EE 2Z44A 3DS1A 2KLUA 5DCKA 1OW6A 1L0LJ 3GG2A 1DIPA 1IZNB 3EQ2A 3N4XA 2LXCB 3M0DC 1JY2P 3GHGC 2OYIA 3TSIA 3L73E 3HE5A 4D6TG 2MVVA 3BATA 3B4SA 1NQ4A 2LIUA 5EW5E 3BCCD 1FZBA 1KQFB 2B89A 1PGJA 1SQPK 4WVZA 3M9HA 2UWJE 3B71A 2FXPA 1LTBC 1SQVD 2QE7H 1OIPA 4GOFA 2E75D 1SQVK 1YQ3C 2E5TA 2OQQA 2VLOA 1FC2C 2ZVNB 5DJUB 4N78E 3DPHA 2C9LY 2HPCB 1NWQA 2CK3H 3AECC 3IFMA 3A2AA 1URQD 4I1LA 1EZVE 2GZEA 4M0IA 3B8EB 3Q1MA 3VTPC 4U0CA 3H32A 1M57D 2Y0DA 3MGEA 4PD4E 2Y9YA 2M8RA 1J1EC 3CWBE 1S9KD 3C9IA 4DZOA 5AVXB 1VQ5P 2M3EA 3E1RA 3CCSP 1OX3A 4UB6E 2FYNC 1URQA 3RK2C 2ZT9D 3H1LD 3AE4C 1LTJA 2LTEA 1EOQA 1YJ9P 2CGQA 1RE3A 3CC2P 2OTKE 1SQPD 3CXHE 1X8YA 2O01J 1AV1A 2CWOA 2B87A 2E74C 3MIWA 1L0HA 2K94A 3L70J 3G0VA 3EJEA 2D2CB 1W2BO 2VSQA 1DEEG 1IFJA 2A06E 1FDMA 2WSCH 3P7KA 1QGKB 1BXIA 1KFNA 4W80A 2N1TB 5KLVK 1LWUA 2C0WA 1JMMA 2L5GB 2R5BA 3CE7A 2KLVA 1N7LA 2Z5IA 2DGYA 2WITA 3L73D 2H43A 1KB9D 1LTIC 3AEAC 2V7QJ 4KJMA 1KORA 2W6AA 2QM8A 3NFQA 1PIXA 2CG5B 2IBZI 2ZAEB 1FE6A 5AVSB 3S1KA 3B5NB 3Q3DA 1J2JB 1HTLC 3GZMA 4TT3H 1PP9E 1JOCA 1PL5A 4WYMA 2KB7P 2AVAA 3TF5A 2JKVA 3RK2D 1RO0A 2WSSH 1YQ4C 1BSNA 2XDJA 2WSFH 1Q7YQ 4H44C 3JC22 3H1KD 3O8ZA 1FZCB 1JMBA 4XFZA 1F80D 1VQOP 1FBMA 4GKGA 2AEMA 1KYOD 2FXMA 2KSEA 2M5AA 1QVFO 1KLPA 3G6EP 1BE3E 3Q2YA 3WMM0 4ZMDA 2JDIH 1IMPA 1EXIA 3L4FA 1PP9G 1M1JC 1G1JA 2YKPA 3CMAP 2K5XA 2P2UA 4PH0A 3D6ZA 3IF4A 2P58A 4DT0A 2I8DA 1M1KQ 1YBKA 1NTMK 5HGNA 2JP3A 4I7ZC 2NPSB 1ZNVA 2ZT9B 3HD7A 4XE5B 1N7SD 1G2CB 3CCEP 4EYYQ 4IFDK 3DS3A 1UNKA 3V2NA 1PGOA 3K5BA 3CD6P 2WSCJ 3CCJP 1VQLP 1SLQA 2PFXA 5TISH 3HTKB 1PGQA 2QJKC 1BE3D 5CJ0A 1G2CA 1L4AD 3HD7B 1LTAC 2PGDA 3CWBJ 4JYBA 1HJ0A 2PP6A 1GU4A 2O1KA 1RF0C 1VHNA 1S72P 2QA4P 2MVUA 1NU1D 2QVAA 3U1CA 3VP9A 2J58A 3L71G 4L73A 3CCLP 4NPEA 4U0EA 1E6JP 1H89A 2WPRA 1NTZG 3TK1A 1IFPA 1FOSE 1UIXA 1VF5D 1H0TA 1NTKJ 2RH0A 3A3YB 2E75C 2Q3IA 4GOEA 3L71E 3VMYA 1SQVG 3RL0g 1EDIA 1FZCA 3CC4P 2P7JA 1Y8AA 1H8AA 1LT9B 2WWWA 1WMKA 1JY2O 3KZIH 2D2CC 3BVHA 3QWOC 2RKLA 2Q3EA 2ZT9C 1NTKE 4QKOA 5AW3B 3G71P 1T6AA 1A02F 1Q82Q 1KB9E 2BHVA 2I1JA 2N6YA 1HUCA 2CPSA 2M8PA 4HB1A 3H1HD 4C46A 5CBNA 3L75D 4Y99C 5AVVB 1HGVA 1CI6A 2D2CD 2XT1A 3AE5C 3CX5D 3RK3C 3HTKA 1L0LG 1JTHA 1DNYA 3RL0B 4KHXA 1SQBE 1ZN5A 1KB9H 3GKLC 2B9BA 1AUMA 1KQLA 5KP7B 4TLFA 2CQ8A 2W6JH 3TNUA 3VMXA 2BEQD 5JPAA 2V4HA 3CCVP 2FYUJ 1KILC 2FYUD 3RL0C 3S9OA 2P9XA 1M8OB 1WRGA 4IL6E 1SVFA 1MZ8A 3EFGA 3F89A 2E76B 1SQBG 3AE9C 4LLHA 1X9VA 3L70E 2WZ7A 5KP8B 2NO8A 1RQVA 2KGAA 1NOHA 1KZUB 2JYLA 1E5WA 5H2FH 1AF8A 3I56P 1T3JA 1EZVI 2G8YA 3L74G 3TNUB 3LIDA 1M7LA 3RK3B 3H1IE 4OWFA 1X22A 1AQ5A 1CEIA 3L70G 2FY8A 4GODA 1EQ7A 3CC7P 4XFJA 4PV1B 2B88A 1QEXA 4L74A 1OZHA 1QL2A 3O6QB 5HGLA 5KAIH 1NO4A 2GYKA 3A0BE 3CLQA 3KYQA 1SQVE 5APSA 3H0DA 2OGUA 1J1EB 4CA3A 4JQ0D 4AQRD 3MTUE 1AYIA 4UB8E 3GHGB 2FXOA 3CPWO 3CCQP 4H44B 2FYNB 3N7NA 3KZIE 1JUNA 3VMAA 1N73A 1NTKD 2JGPA 3GMAA 3SSUA 1FZFA 4LGDE 1L0NG 5CZDB 1RE4A 4RO0A 3OA7A 1LJ2A 3GHGA 1HBWA 2XV5A 4IFFA 1FOSF 3C1LA 2KG8A 3M9BA 1OW7A 1H0TB 1JM0A 1IUQA 3O6QA 2OYHC 2B87B 1BGYG 4WY4D 3IN6A 1OFCX 2YXQB 1SQPE 3CXHD 1PFIA 2BCCG 3A5TA 2YMKA 5E79E 1DV5A 3P8CE 3MGNA 4BXLA 3EJDA 2GUVA 1IFMA 2R44A 2XXMA 1NTKK 4H0LD 4ZKUA 3FXDA 2JQ4A 1DH3A 1GDTA 2FQ2A 1RH5B 3G28A 3H32B 4R4LA 1VQNP 1U7MA 3CMEP 3I5CA 5BS2A 1NU1G 1RQUA 2Z4EA 3OW2O 5AW2B 1EC5A 2ROQA 2N5IA 2K93A 1NTZD 3H1IG 4A7PA 4DCKA 1GD2E 5KJ7C 1J1DC 1SFCC 3BCCE 3TGUJ 1X0TA 1N86A 1JY2N 2N6ZA 5KJ7D 5AW8B 2JBGA 2HLOA 3CWBG 1T8KA 4WBAA 2ONTA 1K30A 3EWKA 3D71A 2NRGA 5L8RJ 3AE3C 2K3RA 2VLNA 1PPJE 5AW0B 3WUVA 2NPSC 2L4BA 1EZVD 1P84I 3LW5H 1KD1Q 1NYHA 1HJBA 1GK4A 2QJYB 1KMIZ 4W7ZA 5HV8A 3T97B 3HYBA 2HODB 3GF3A 3Q5PA 3GZLA 3H1HG 1CZQA 4IPYA 1NAYA 3CXHH 3OAKA 4L75A 1T8ZA 4ASVA 3WUUA 3VOPA 1LP1B 1IFIA 3H1LG 4AUWA 1VF5B 2YO3A 1BGYE 4MN4C 1KQGB 2ZJSE 4UHPB 1NVOA 5AVZB 3CI9A 3OJAB 1L0NJ 1SQQJ 3U1AA 1ZMEC 2AEJA 3KPEA 3M06A 1RF1A 2HODA 3H1KJ 2OARA 2RN0A 1X3OA 3P8MC 4B86A 3KQGA 2AXTE 3R4YA 2JU1A 2QIWA 1L2PA 2IYPA 2FFDC 4F37A 2IFNA 2GA1A 5AVTB 1S4XA 4QMAA 3GW6A 1IC2A 2PEJA 2M5RA 1NU1E 1MFTA 3PTZA 1YI2P 4PJ0H 2QG4A 5CCGD 4DG9A 3WBHA 2XKMA 1OVUA 2WPTA 4H0LC 5CMZA 3ABVC 2LIWA 2FQ1A 2PEMA 1FU1A 1EMVA 2ERHA 3VP8A 3CX5E 3H25A 1KB9I 4PJ0E 2AXCA 3B5NC 4HH2A 2H8PD 3BRVB 3L72G 3U43A 2IBZE 2E5YA 1RF1C 4R4MA 2JWDA 2GDWA 2BCCE 1CI6B 4PXHB 3H1HJ 3JCUH 2XU6A 1URQB 3JSVC 2KZIA 1VQ4P 1SFCD 2E74D 1KC8Q 2OTJP 1JCCA 3VMZA 3AE6C 2AEFA 3H1HE 5AW4B 1QLED 3M0AA 4OH8B 2WPQA 2XNDH 2G3AA 1JTHB 4H44D 4C7RA 2DNWA 5TJHA 1LT9C 5HGMA 4OGQB 2J5UA 2N1TC 3H1LE 2C0XA 1SQBJ 1OW8A 1BDCA 1FJKA 3DS2A 1E0HA 3L72E 2GDYA 3WU2H 2KR5A 3TGUD 2KS1B 1URQC 2BCCD 2Q5UA 4UB6H 1L0NE 2YMYA 1EXJA 3GJNA 3C8VA 3RG2A 1N7SB 1GL2B 1HVVA 1SS1A 3BCCG 3L72J 1PPJD 2K9YA 3SWYA 4U3FG 2JYGA 3PHLA 3W68A 2N1TA 2DW3A 3RK2B 3SWFA 1FZCC 2FQ0A 2IX7C 4U0AA 2CNRA 3EJBA 1ZR2A 1S1CX 3R2PA 1PEOA 1N2DC 2GUSA 2AFEA 5AVYB 3H1ID 1MKMA 4RJTA 2EHSA 1Y9BA 5BVZA 2YKOA 2KP8A 4K3AA 2K9JB 2W83C 4IL6X 1LTTC 3H1JD 4M3LA 1M74A 3L35A 2JU2A 1VQMP 4K35A 3LRYA 1ZV8A 2KODA 2E75B 1NHLA 3TGUE 4EIJA 5CBOA 1S5LH 2NPSA 2ZYGA 4YTPC 3AEDC 2LKMA 3DS0A 3JCUE 1UJZA 3PRJA 5HGOA 5KAFE 1YHQP 2KGDA 1U7JA 5CCGC 3KHUA 1YITP 2W27A 3CCUP 2L91A 5KAFH 1SQVJ 4PV1C 4XROA 2QJKB 3V4WA 1ACPA 5AW9B 2IZ1A 4COCA 5KLVG 2JWAA 4H2XC 1NU1J 2JO1A 1SQQD 2EFJA 5KLIB 2E43A 5CCGA 1MV8A 1GPJA 2HYNA 1MZ9A 1VDFA 1X79B 2MF4A 3P8CD 2LF4A 2KNCA 2FYUE 3F5HA 4U3FJ 1SQXJ 2FVAA 1PGPA 3L74J 1DD3A 3CL3D 2A06D 4XRQA 3B5ND 5KKZB 1YTZT 1JEKA 2O01N 4I7ZB 3BASA 2R32A 2GDXA 5H2FE 2WMMA 2QNWA 2MR8A 4R0MA 3H1LJ 1NTME 1FAVA 2E1MA 1M90Q 1KQSO 2YIUB 3Q5RA 1LGHB 3A0BH 2H89C 3SFDC 3CXCO 3RBXA 5CHXA 2IDBA 1JY3O 3W67A 3B5NA 1FZEA 3B5IA 4GR6A 3LIEA 3SFEC 3PLNA 4KT0J 1L4AA 4H2WC 3L72D 2EIAA 3FWLA 2GZFA 3UIAA 3AE2C 3BRTB 1N7SC 1D7MA 2KNCB 2KS1A 4U0DA 3DS5A 3NY7B 2R5DA 4PWVB 1K9MQ 1BGYJ 1VQKP 2EG5A 3G9RA 2J59M 2ZYDA 1VF5C 1ZP0C 5M1BA 2MD9A 2MR7A 3MUDC 2KIKA 3V2QA 5AW1B 2R3SA 2PENA 2KZJA 1Y47A 1CW5A 5AVQB 1Q2NA 1GXGA 3AE1C 5F2KA 4L76A 3HE4B 3HUSC 1PEMA 1NTZE 2JB0A 1L4AC 2Q9IA 3HRNA 2VRSA 3NTNA 2KUBA 3NXSA 1S3JA 3MZWB 4RESB 1Q81Q 1USDA 1OVVA 2P10A 3CX5I 3L75J 3L71D 2WSEJ 1XTGB 2AXTH 1YJWP 1AJYA 1OR5A 1YTZI 3D70A 1NTZJ 4GIFA 3HD7C 4OGQD 1NTMJ 2WSEH 4IL6H 2HPCA 3B4QA 2XZRA 2N98A 1HH0A 5KLVE 4HKZH 1JNMA 4BRYA 5F2NA 3G1IA 1VQ9P 2Q7CA 1FJPA 1FZGA 3FWNA 1RF1B 2KWLA 1NGMB 2K0XA 2FYUG 4PD4D 2KOOA 4EOTA 2HR3A 2PEOA 2KYVA 3H1JJ 3L36A 1BAJA 2N9YB 1VPCA 1BCCG 4DOJA 2KORA 1CSBA 1ZRTE 1G1IA 2E76C 5GTHH 1NH4A 1HGZA 1K73Q 3E1IA 2PEIA 1LTSC 1HWTC 1AQTA 2FYUK 5KAIE 1E79H 1D1DA 1WT6A 5B66H 1MUUA 1M6EX 3V2RA 5GTHE 1NAFA 1QL1A 1Z56A 2NZ2A 2A45G 2O01H 1L0LD 1T3UA 3M1MA 3MD0A 4EI2A 1ZMBA 4JBZA 1ZOYC 4PD4H 1AVYA 2P1JA 4C7NB 3LMOA 2EHTA 1SQQK 4I6MC 1KV4A 4O9BA 1A02J 4OVNF 3M91A 3RL0D 2GZIA 4U3FE 1SQBK 1PP9D 2XZ0D 2IBZG 3WU2E 4NPFX 1PP9J 3V4QA 2I1KA 1SFCA 3FGAD 3G29A 4RKUJ 4D6TJ 2K88A 1W5CE 1Z6MA 1EDKA 1BSHA 2FADA 3NMDA 2FYZA 2PRRA 1SQXK 2QSIA 5DJTB 4PH1A 1BE3J 3RK3D 3V6IA 1H88A 1VQPP 1J1DB 2JR8A 1TU3F 1GMJA 4Y28J 5BS1A 1SQPJ 1HQBA 1VKUA 7CEIA 2WSFJ 5AW6B 2K37A 1JY3P 5EJDA 2KOGA 3H1KG 5KLVJ 5APVA 3L74E 2OYHA 1IJDB 1LNQA 5B5EH 1KFMA 1LT1A 4D6TD 3AEBC 1Q86Q 2JO0A 1JCDA 3GLMA 1GL2A 2KG9A 4MRTC 2N1TD 1GK6A 2MY5A 2IFMA 3H1JE 4HKGA 3L71J 4AYCA 5CCHC 5GTIE 2Q6QA 1YYCA 4U0BA 2M0BA 1AA0A 1KILD 4GT1A 3HE5B 1KYOE 2W90A 3L73J 2OYIB 3TDKA 1M56D 2X2BA 4WB4A 4QNBA 1LT9A 1N7SA 4NPDA 2YKQA 2W6BA 3VRLC 2YXRB 3DTJA 1Q90D 2L22A 1OWAA 3EFFK 2Z45A 1L0LE 1IK7A 4BPHA 1EIAA 2KOQA 3PH0A 2XNXA 2AF8A 5C39A 2HG5D 3RG6C 1KYOH 3M0DA 5AVRB 2IYOA 2OYIC 2OYOA 1NTMD 2A45I 2JAZA 2GZGA 4H13D 4WY4C 3L75E 1IFNA 1BE3G 3SWKA 1BCCE 1SQXG 2KGEA 3HUSA 2KOSA 2IZ0A 3AE8C 1FDIA 1RE4C 4WY4B 1SQPG 4ASWA 2MJZA 2GM4A 3PJSK 3E2DA 2M8LA 2YIUC 1A43A 2KGCA 1DEBA 3HE4A 1R5SA 2V7QH 1QRJA 2Y0EA 1PPJG 4NEOA 1VQ8P 5HVCA 5K5GB 5CCHD 3FX0A 1LTJB 2OYHB 2ZVOB 3L73G 2VLPA 1PEQA 2FACA 4U7JA 1NKNA 2M3BA 3G26A 1OXZA 2Z5HA 5APXA 1SQBD 4IOIH 4EDFA 1AFOA 1SQXE 3H4EA 5AVWB 1GTWA 2HFED 1LTJC 1SP4A 5APWA 1W2EA 5KKZC 2PEKA 4DJGA 1N73C 3IR9A 4WWIA 4Y99B 2QEXP 3G3ZA 1RO2A 2N5HA 1LWUC 3WUTA 4W7YA 4C7NA 1NJIQ 4BPGA 1GZLA 2K1AA 3CX5H 2K2QA 2BQ1E 1M1JB 1T2KC 4JPZB 2XZ1C 3L70D 4GR2A 2E74B 4XA4A 1U57A 2K9JA 3IAOA 2LPKA 2E42A 2WT7B 2VLQA 2FHSC 2AFDA 2WPSA 3U59A 1KILA 3L37A 1OMIA 4YPCA 3AE7C 3T97A 3A0HE 2YO2A 5AW7B 2M8NA 3LW5J 2WPVB 3V5BA 1IO4A 5EFWB 3MHVA 4JF7A
chains in the Genus database with same CATH topology
2M8PA 3CPWO 3CD6P 2PY8A 1A8OA 3G4SP 3CCJP 1QRJA 3WBHA 3CCQP 4COCA 1Q86Q 1YIJP 1VQLP 2XT1A 2JO0A 3G1GA 1VQ8P 2DGYA 2PENA 2PEMA 1D1DA 1M6EX 1AUMA 1JJ2O 2ONTA 2XV6A 1K30A 2EFJA 2JYGA 1PEQA 4XFYA 5F2KA 2LF4A 3M1MA 4U0AA 5JPAA 4U0BA 1ZMBA 3DPHA 3G26A 1PEMA 3HZQA 3CCVP 1S72P 1RNIA 4WYMA 3I55P 2QA4P 1YJNP 1KD1Q 4XRQA 3H4EA 1RO0A 3CCRP 1M6NA 1PEOA 2P9XA 1Q7YQ 3CCMP 1IUQA 4QNBA 1Q81Q 4M0IA 3CCLP 3VRLC 2Z46A 4U0EA 1E6JP 1VQ6P 4XFZA 3DTJA 3H47A 1YJWP 2PEKA 1VQOP 2L6EA 3HYBA 2Z45A 4U0CA 2QEXP 4IPYA 2E1MA 1M74A 1EIAA 1RO2A 5F2OA 1N8RQ 1VQ4P 2JYLA 3MGEA 3RG6C 1K8AQ 1M90Q 1QVFO 3G6EP 1NJIQ 3I56P 1KQSO 1VQMP 1KC8Q 1QVGO 2BQ1E 3LRYA 2OTJP 2KODA 3G29A 3CXCO 1VQ5P 4GR2A 3CCSP 2XXMA 2OTLP 3NTEA 3B5IA 2BUOA 3P05A 4U0FA 5F2NA 3G1IA 3CMAP 1VQ9P 3DS0A 3CC4P 4PH0A 2Z44A 4GR6A 3DS1A 3CC7P 3Q20A 1EOQA 5HGOA 3G28A 1YJ9P 4PH1A 3G21A 1VQ7P 1VQNP 2EIAA 1YHQP 3CC2P 1PEUA 5DCKA 1VQPP 3CMEP 2OARA 1M1KQ 5BS2A 4COPA 2CWOA 5BS1A 5HGNA 2PEOA 3OW2O 5HGMA 5HGLA 3G0VA 1W2BO 1BAJA 2M8NA 4U0DA 2PEQA 3DS5A 1YITP 1K9MQ 3H0DA 3G71P 3DS2A 3E2DA 5I4TG 2M8LA 3CCEP 1Q82Q 3DS3A 3CCUP 2BHVA 1A43A 1VQKP 2PEJA 3DS4A 4XROA 2EG5A 1K73Q 1YI2P 4XFXA 2PEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW O;  1N8R Q;  1VQ7 P;  1VQ4 P;  3CD6 P;  1VQN P;  1K8A Q;  1YHQ P;  3CC2 P;  1M90 Q;  1QVF O;  3G6E P;  3G4S P;  3CCJ P;  1VQP P;  3CCQ P;  3CCV P;  1S72 P;  3I56 P;  1NJI Q;  1VQM P;  1M1K Q;  1KQS O;  1KC8 Q;  3CME P;  1Q86 Q;  3I55 P;  2QA4 P;  1YJN P;  1KD1 Q;  1YIJ P;  3CCR P;  3OW2 O;  1QVG O;  1VQL P;  2OTJ P;  1VQ8 P;  3CXC O;  1Q7Y Q;  3CCM P;  1VQ5 P;  1Q81 Q;  1W2B O;  3CCS P;  3CCL P;  2OTL P;  1YIT P;  1JJ2 O;  1K9M Q;  3G71 P;  1VQ6 P;  3CCE P;  3CMA P;  1Q82 Q;  1VQ9 P;  3CCU P;  3CC4 P;  1YJW P;  1VQO P;  1VQK P;  3CC7 P;  2QEX P;  1K73 Q;  1YI2 P;  1YJ9 P; 
#chains in the Genus database with same CATH topology
 2PY8 A;  1N73 B;  5TIS E;  1A8O A;  2IBZ D;  3A0H H;  3FXE A;  3H6P A;  2KK7 A;  1SQQ E;  1LWU B;  1KIL B;  1KIL E;  1L0N D;  2A45 H;  2CPB A;  2P67 A;  2KOP A;  2FKW B;  2IPP A;  4XFY A;  5KLI C;  2Y9Z A;  1QX8 A;  1M1J A;  2K0Y A;  3HZQ A;  1RNI A;  2MKV A;  2KI7 B;  1BDD A;  1ZW0 A;  1GW4 A;  2L0Q A;  2LR2 A;  4H13 B;  2YNY A;  4GDO A;  1GU5 A;  1DD4 A;  2NPS D;  3VN0 A;  3E7K A;  5CCH A;  1KN7 A;  3MUD A;  1FR2 A;  2BCC J;  4H13 C;  2WTY A;  1SFC B;  2OTL P;  1L0L K;  1GL2 C;  2L9F A;  1FS0 E;  5B66 E;  3ITK A;  2PAJ A;  1OVR A;  3Q20 A;  1RF0 A;  1S5L X;  2QJP B;  3G21 A;  1P84 D;  1LTG C;  4BWN A;  3RGU A;  1S5L E;  3HD7 D;  1GL2 D;  4JYC A;  4N3Y B;  1FDO A;  2QM7 A;  2QRX A;  2FBW C;  5I4T G;  1S2E A;  1RHZ B;  2R3C A;  2POH A;  2H7H A;  3DS4 A;  1ZR4 A;  2KG6 A;  4WY4 A;  3II6 A;  2FVE A;  3G4S P;  1NTM G;  3TGU G;  4HJG H;  2WQY C;  2ZXE B;  3L75 G;  1GW3 A;  1FZA A;  5AW5 B;  1GXH A;  1JJ2 O;  1T2K D;  2XV6 A;  2E76 D;  5E79 H;  3A7O A;  3AEG C;  1L0I A;  1EZV G;  4YXD C;  2Q1K A;  2Y0C A;  1HY8 A;  1SQX D;  5AVU B;  2WVR A;  4U3F D;  3BCC J;  1ZRT D;  4CPG A;  2QJP C;  3RBZ A;  3I55 P;  3CCR P;  1VL2 A;  3D6Y A;  2SPZ A;  4IFM A;  1USE A;  1DX7 A;  1PZQ A;  2Z46 A;  1IK9 A;  2FFD A;  3H47 A;  1R8E A;  2RMZ A;  2FVF A;  5F2O A;  1N8R Q;  1K8A Q;  1ZLL A;  2JEE A;  2WT7 A;  3H1J G;  5KLV D;  3AEF C;  3ZDM A;  4OGQ C;  1KYO I;  4BRY B;  5KJ7 A;  5KP6 B;  1RY3 A;  1SQQ G;  1L0N K;  3CWB D;  1MFZ A;  3GF7 A;  2BUO A;  3P05 A;  4U0F A;  4H2Y C;  5BU8 B;  3L74 D;  3V2P A;  2ZFC A;  1S9K E;  2LML A;  1JY3 N;  2K92 A;  3VYI A;  1VQ7 P;  4H0L B;  3QH9 A;  4ZNC A;  4ZKP A;  1PEU A;  4YXW H;  2JJL A;  2A06 G;  2LXB A;  3KDP B;  4COP A;  2PNG A;  1BCC D;  2GZJ A;  5GTI H;  1UII A;  4HYT B;  4PD4 I;  1NKZ B;  1NU1 K;  2PEQ A;  2H88 C;  3P32 A;  2LOL A;  2N50 A;  3AEE C;  3KXD A;  4XFX A;  1IMQ A;  2O3J A;  2LL8 A;  1BCC J;  1P84 E;  5APT A;  1YIJ P;  3PP5 A;  2W8Z A;  1KTM A;  3G1G A;  1K05 A;  5CJ4 A;  1RE3 C;  1JO5 A;  3USS A;  1JB0 J;  2C9N Y;  2O1J A;  1NTK G;  1K04 A;  2KSJ A;  5KTB A;  1P84 H;  4BPF A;  1ZXG A;  1R5L A;  4IZ6 A;  2BEZ F;  4UB8 H;  2ZXX A;  1PV3 A;  2KXP B;  5APQ A;  1YJN P;  5APY A;  1HF9 A;  1M6N A;  3CCM P;  1IFD A;  4PV1 D;  4D6T E;  2BAS A;  1VQ6 P;  3CXH I;  2ZYA A;  1XTC C;  2KW2 A;  2L6E A;  3HUS B;  4LC1 A;  1L4A B;  4N6J A;  2QJY C;  2FAE A;  3TYY A;  1AVO A;  1BGY D;  2K0D X;  2ITA A;  5BU5 A;  1EDL A;  3H1K E;  4I2L C;  3M9Q A;  1QVG O;  2N9B A;  2M5A B;  1NTZ K;  3H1I J;  4Z1M H;  3Q5S A;  3S4R A;  1EDJ A;  2LKI A;  4N78 D;  3NTE A;  1LP1 A;  5APU A;  2FFD B;  3RK3 E;  3MP7 B;  5B5E E;  2Z44 A;  3DS1 A;  2KLU A;  5DCK A;  1OW6 A;  1L0L J;  3GG2 A;  1DIP A;  1IZN B;  3EQ2 A;  3N4X A;  2LXC B;  3M0D C;  1JY2 P;  3GHG C;  2OYI A;  3TSI A;  3L73 E;  3HE5 A;  4D6T G;  2MVV A;  3BAT A;  3B4S A;  1NQ4 A;  2LIU A;  5EW5 E;  3BCC D;  1FZB A;  1KQF B;  2B89 A;  1PGJ A;  1SQP K;  4WVZ A;  3M9H A;  2UWJ E;  3B71 A;  2FXP A;  1LTB C;  1SQV D;  2QE7 H;  1OIP A;  4GOF A;  2E75 D;  1SQV K;  1YQ3 C;  2E5T A;  2OQQ A;  2VLO A;  1FC2 C;  2ZVN B;  5DJU B;  4N78 E;  3DPH A;  2C9L Y;  2HPC B;  1NWQ A;  2CK3 H;  3AEC C;  3IFM A;  3A2A A;  1URQ D;  4I1L A;  1EZV E;  2GZE A;  4M0I A;  3B8E B;  3Q1M A;  3VTP C;  4U0C A;  3H32 A;  1M57 D;  2Y0D A;  3MGE A;  4PD4 E;  2Y9Y A;  2M8R A;  1J1E C;  3CWB E;  1S9K D;  3C9I A;  4DZO A;  5AVX B;  1VQ5 P;  2M3E A;  3E1R A;  3CCS P;  1OX3 A;  4UB6 E;  2FYN C;  1URQ A;  3RK2 C;  2ZT9 D;  3H1L D;  3AE4 C;  1LTJ A;  2LTE A;  1EOQ A;  1YJ9 P;  2CGQ A;  1RE3 A;  3CC2 P;  2OTK E;  1SQP D;  3CXH E;  1X8Y A;  2O01 J;  1AV1 A;  2CWO A;  2B87 A;  2E74 C;  3MIW A;  1L0H A;  2K94 A;  3L70 J;  3G0V A;  3EJE A;  2D2C B;  1W2B O;  2VSQ A;  1DEE G;  1IFJ A;  2A06 E;  1FDM A;  2WSC H;  3P7K A;  1QGK B;  1BXI A;  1KFN A;  4W80 A;  2N1T B;  5KLV K;  1LWU A;  2C0W A;  1JMM A;  2L5G B;  2R5B A;  3CE7 A;  2KLV A;  1N7L A;  2Z5I A;  2DGY A;  2WIT A;  3L73 D;  2H43 A;  1KB9 D;  1LTI C;  3AEA C;  2V7Q J;  4KJM A;  1KOR A;  2W6A A;  2QM8 A;  3NFQ A;  1PIX A;  2CG5 B;  2IBZ I;  2ZAE B;  1FE6 A;  5AVS B;  3S1K A;  3B5N B;  3Q3D A;  1J2J B;  1HTL C;  3GZM A;  4TT3 H;  1PP9 E;  1JOC A;  1PL5 A;  4WYM A;  2KB7 P;  2AVA A;  3TF5 A;  2JKV A;  3RK2 D;  1RO0 A;  2WSS H;  1YQ4 C;  1BSN A;  2XDJ A;  2WSF H;  1Q7Y Q;  4H44 C;  3JC2 2;  3H1K D;  3O8Z A;  1FZC B;  1JMB A;  4XFZ A;  1F80 D;  1VQO P;  1FBM A;  4GKG A;  2AEM A;  1KYO D;  2FXM A;  2KSE A;  2M5A A;  1QVF O;  1KLP A;  3G6E P;  1BE3 E;  3Q2Y A;  3WMM 0;  4ZMD A;  2JDI H;  1IMP A;  1EXI A;  3L4F A;  1PP9 G;  1M1J C;  1G1J A;  2YKP A;  3CMA P;  2K5X A;  2P2U A;  4PH0 A;  3D6Z A;  3IF4 A;  2P58 A;  4DT0 A;  2I8D A;  1M1K Q;  1YBK A;  1NTM K;  5HGN A;  2JP3 A;  4I7Z C;  2NPS B;  1ZNV A;  2ZT9 B;  3HD7 A;  4XE5 B;  1N7S D;  1G2C B;  3CCE P;  4EYY Q;  4IFD K;  3DS3 A;  1UNK A;  3V2N A;  1PGO A;  3K5B A;  3CD6 P;  2WSC J;  3CCJ P;  1VQL P;  1SLQ A;  2PFX A;  5TIS H;  3HTK B;  1PGQ A;  2QJK C;  1BE3 D;  5CJ0 A;  1G2C A;  1L4A D;  3HD7 B;  1LTA C;  2PGD A;  3CWB J;  4JYB A;  1HJ0 A;  2PP6 A;  1GU4 A;  2O1K A;  1RF0 C;  1VHN A;  1S72 P;  2QA4 P;  2MVU A;  1NU1 D;  2QVA A;  3U1C A;  3VP9 A;  2J58 A;  3L71 G;  4L73 A;  3CCL P;  4NPE A;  4U0E A;  1E6J P;  1H89 A;  2WPR A;  1NTZ G;  3TK1 A;  1IFP A;  1FOS E;  1UIX A;  1VF5 D;  1H0T A;  1NTK J;  2RH0 A;  3A3Y B;  2E75 C;  2Q3I A;  4GOE A;  3L71 E;  3VMY A;  1SQV G;  3RL0 g;  1EDI A;  1FZC A;  3CC4 P;  2P7J A;  1Y8A A;  1H8A A;  1LT9 B;  2WWW A;  1WMK A;  1JY2 O;  3KZI H;  2D2C C;  3BVH A;  3QWO C;  2RKL A;  2Q3E A;  2ZT9 C;  1NTK E;  4QKO A;  5AW3 B;  3G71 P;  1T6A A;  1A02 F;  1Q82 Q;  1KB9 E;  2BHV A;  2I1J A;  2N6Y A;  1HUC A;  2CPS A;  2M8P A;  4HB1 A;  3H1H D;  4C46 A;  5CBN A;  3L75 D;  4Y99 C;  5AVV B;  1HGV A;  1CI6 A;  2D2C D;  2XT1 A;  3AE5 C;  3CX5 D;  3RK3 C;  3HTK A;  1L0L G;  1JTH A;  1DNY A;  3RL0 B;  4KHX A;  1SQB E;  1ZN5 A;  1KB9 H;  3GKL C;  2B9B A;  1AUM A;  1KQL A;  5KP7 B;  4TLF A;  2CQ8 A;  2W6J H;  3TNU A;  3VMX A;  2BEQ D;  5JPA A;  2V4H A;  3CCV P;  2FYU J;  1KIL C;  2FYU D;  3RL0 C;  3S9O A;  2P9X A;  1M8O B;  1WRG A;  4IL6 E;  1SVF A;  1MZ8 A;  3EFG A;  3F89 A;  2E76 B;  1SQB G;  3AE9 C;  4LLH A;  1X9V A;  3L70 E;  2WZ7 A;  5KP8 B;  2NO8 A;  1RQV A;  2KGA A;  1NOH A;  1KZU B;  2JYL A;  1E5W A;  5H2F H;  1AF8 A;  3I56 P;  1T3J A;  1EZV I;  2G8Y A;  3L74 G;  3TNU B;  3LID A;  1M7L A;  3RK3 B;  3H1I E;  4OWF A;  1X22 A;  1AQ5 A;  1CEI A;  3L70 G;  2FY8 A;  4GOD A;  1EQ7 A;  3CC7 P;  4XFJ A;  4PV1 B;  2B88 A;  1QEX A;  4L74 A;  1OZH A;  1QL2 A;  3O6Q B;  5HGL A;  5KAI H;  1NO4 A;  2GYK A;  3A0B E;  3CLQ A;  3KYQ A;  1SQV E;  5APS A;  3H0D A;  2OGU A;  1J1E B;  4CA3 A;  4JQ0 D;  4AQR D;  3MTU E;  1AYI A;  4UB8 E;  3GHG B;  2FXO A;  3CPW O;  3CCQ P;  4H44 B;  2FYN B;  3N7N A;  3KZI E;  1JUN A;  3VMA A;  1N73 A;  1NTK D;  2JGP A;  3GMA A;  3SSU A;  1FZF A;  4LGD E;  1L0N G;  5CZD B;  1RE4 A;  4RO0 A;  3OA7 A;  1LJ2 A;  3GHG A;  1HBW A;  2XV5 A;  4IFF A;  1FOS F;  3C1L A;  2KG8 A;  3M9B A;  1OW7 A;  1H0T B;  1JM0 A;  1IUQ A;  3O6Q A;  2OYH C;  2B87 B;  1BGY G;  4WY4 D;  3IN6 A;  1OFC X;  2YXQ B;  1SQP E;  3CXH D;  1PFI A;  2BCC G;  3A5T A;  2YMK A;  5E79 E;  1DV5 A;  3P8C E;  3MGN A;  4BXL A;  3EJD A;  2GUV A;  1IFM A;  2R44 A;  2XXM A;  1NTK K;  4H0L D;  4ZKU A;  3FXD A;  2JQ4 A;  1DH3 A;  1GDT A;  2FQ2 A;  1RH5 B;  3G28 A;  3H32 B;  4R4L A;  1VQN P;  1U7M A;  3CME P;  3I5C A;  5BS2 A;  1NU1 G;  1RQU A;  2Z4E A;  3OW2 O;  5AW2 B;  1EC5 A;  2ROQ A;  2N5I A;  2K93 A;  1NTZ D;  3H1I G;  4A7P A;  4DCK A;  1GD2 E;  5KJ7 C;  1J1D C;  1SFC C;  3BCC E;  3TGU J;  1X0T A;  1N86 A;  1JY2 N;  2N6Z A;  5KJ7 D;  5AW8 B;  2JBG A;  2HLO A;  3CWB G;  1T8K A;  4WBA A;  2ONT A;  1K30 A;  3EWK A;  3D71 A;  2NRG A;  5L8R J;  3AE3 C;  2K3R A;  2VLN A;  1PPJ E;  5AW0 B;  3WUV A;  2NPS C;  2L4B A;  1EZV D;  1P84 I;  3LW5 H;  1KD1 Q;  1NYH A;  1HJB A;  1GK4 A;  2QJY B;  1KMI Z;  4W7Z A;  5HV8 A;  3T97 B;  3HYB A;  2HOD B;  3GF3 A;  3Q5P A;  3GZL A;  3H1H G;  1CZQ A;  4IPY A;  1NAY A;  3CXH H;  3OAK A;  4L75 A;  1T8Z A;  4ASV A;  3WUU A;  3VOP A;  1LP1 B;  1IFI A;  3H1L G;  4AUW A;  1VF5 B;  2YO3 A;  1BGY E;  4MN4 C;  1KQG B;  2ZJS E;  4UHP B;  1NVO A;  5AVZ B;  3CI9 A;  3OJA B;  1L0N J;  1SQQ J;  3U1A A;  1ZME C;  2AEJ A;  3KPE A;  3M06 A;  1RF1 A;  2HOD A;  3H1K J;  2OAR A;  2RN0 A;  1X3O A;  3P8M C;  4B86 A;  3KQG A;  2AXT E;  3R4Y A;  2JU1 A;  2QIW A;  1L2P A;  2IYP A;  2FFD C;  4F37 A;  2IFN A;  2GA1 A;  5AVT B;  1S4X A;  4QMA A;  3GW6 A;  1IC2 A;  2PEJ A;  2M5R A;  1NU1 E;  1MFT A;  3PTZ A;  1YI2 P;  4PJ0 H;  2QG4 A;  5CCG D;  4DG9 A;  3WBH A;  2XKM A;  1OVU A;  2WPT A;  4H0L C;  5CMZ A;  3ABV C;  2LIW A;  2FQ1 A;  2PEM A;  1FU1 A;  1EMV A;  2ERH A;  3VP8 A;  3CX5 E;  3H25 A;  1KB9 I;  4PJ0 E;  2AXC A;  3B5N C;  4HH2 A;  2H8P D;  3BRV B;  3L72 G;  3U43 A;  2IBZ E;  2E5Y A;  1RF1 C;  4R4M A;  2JWD A;  2GDW A;  2BCC E;  1CI6 B;  4PXH B;  3H1H J;  3JCU H;  2XU6 A;  1URQ B;  3JSV C;  2KZI A;  1VQ4 P;  1SFC D;  2E74 D;  1KC8 Q;  2OTJ P;  1JCC A;  3VMZ A;  3AE6 C;  2AEF A;  3H1H E;  5AW4 B;  1QLE D;  3M0A A;  4OH8 B;  2WPQ A;  2XND H;  2G3A A;  1JTH B;  4H44 D;  4C7R A;  2DNW A;  5TJH A;  1LT9 C;  5HGM A;  4OGQ B;  2J5U A;  2N1T C;  3H1L E;  2C0X A;  1SQB J;  1OW8 A;  1BDC A;  1FJK A;  3DS2 A;  1E0H A;  3L72 E;  2GDY A;  3WU2 H;  2KR5 A;  3TGU D;  2KS1 B;  1URQ C;  2BCC D;  2Q5U A;  4UB6 H;  1L0N E;  2YMY A;  1EXJ A;  3GJN A;  3C8V A;  3RG2 A;  1N7S B;  1GL2 B;  1HVV A;  1SS1 A;  3BCC G;  3L72 J;  1PPJ D;  2K9Y A;  3SWY A;  4U3F G;  2JYG A;  3PHL A;  3W68 A;  2N1T A;  2DW3 A;  3RK2 B;  3SWF A;  1FZC C;  2FQ0 A;  2IX7 C;  4U0A A;  2CNR A;  3EJB A;  1ZR2 A;  1S1C X;  3R2P A;  1PEO A;  1N2D C;  2GUS A;  2AFE A;  5AVY B;  3H1I D;  1MKM A;  4RJT A;  2EHS A;  1Y9B A;  5BVZ A;  2YKO A;  2KP8 A;  4K3A A;  2K9J B;  2W83 C;  4IL6 X;  1LTT C;  3H1J D;  4M3L A;  1M74 A;  3L35 A;  2JU2 A;  1VQM P;  4K35 A;  3LRY A;  1ZV8 A;  2KOD A;  2E75 B;  1NHL A;  3TGU E;  4EIJ A;  5CBO A;  1S5L H;  2NPS A;  2ZYG A;  4YTP C;  3AED C;  2LKM A;  3DS0 A;  3JCU E;  1UJZ A;  3PRJ A;  5HGO A;  5KAF E;  1YHQ P;  2KGD A;  1U7J A;  5CCG C;  3KHU A;  1YIT P;  2W27 A;  3CCU P;  2L91 A;  5KAF H;  1SQV J;  4PV1 C;  4XRO A;  2QJK B;  3V4W A;  1ACP A;  5AW9 B;  2IZ1 A;  4COC A;  5KLV G;  2JWA A;  4H2X C;  1NU1 J;  2JO1 A;  1SQQ D;  2EFJ A;  5KLI B;  2E43 A;  5CCG A;  1MV8 A;  1GPJ A;  2HYN A;  1MZ9 A;  1VDF A;  1X79 B;  2MF4 A;  3P8C D;  2LF4 A;  2KNC A;  2FYU E;  3F5H A;  4U3F J;  1SQX J;  2FVA A;  1PGP A;  3L74 J;  1DD3 A;  3CL3 D;  2A06 D;  4XRQ A;  3B5N D;  5KKZ B;  1YTZ T;  1JEK A;  2O01 N;  4I7Z B;  3BAS A;  2R32 A;  2GDX A;  5H2F E;  2WMM A;  2QNW A;  2MR8 A;  4R0M A;  3H1L J;  1NTM E;  1FAV A;  2E1M A;  1M90 Q;  1KQS O;  2YIU B;  3Q5R A;  1LGH B;  3A0B H;  2H89 C;  3SFD C;  3CXC O;  3RBX A;  5CHX A;  2IDB A;  1JY3 O;  3W67 A;  3B5N A;  1FZE A;  3B5I A;  4GR6 A;  3LIE A;  3SFE C;  3PLN A;  4KT0 J;  1L4A A;  4H2W C;  3L72 D;  2EIA A;  3FWL A;  2GZF A;  3UIA A;  3AE2 C;  3BRT B;  1N7S C;  1D7M A;  2KNC B;  2KS1 A;  4U0D A;  3DS5 A;  3NY7 B;  2R5D A;  4PWV B;  1K9M Q;  1BGY J;  1VQK P;  2EG5 A;  3G9R A;  2J59 M;  2ZYD A;  1VF5 C;  1ZP0 C;  5M1B A;  2MD9 A;  2MR7 A;  3MUD C;  2KIK A;  3V2Q A;  5AW1 B;  2R3S A;  2PEN A;  2KZJ A;  1Y47 A;  1CW5 A;  5AVQ B;  1Q2N A;  1GXG A;  3AE1 C;  5F2K A;  4L76 A;  3HE4 B;  3HUS C;  1PEM A;  1NTZ E;  2JB0 A;  1L4A C;  2Q9I A;  3HRN A;  2VRS A;  3NTN A;  2KUB A;  3NXS A;  1S3J A;  3MZW B;  4RES B;  1Q81 Q;  1USD A;  1OVV A;  2P10 A;  3CX5 I;  3L75 J;  3L71 D;  2WSE J;  1XTG B;  2AXT H;  1YJW P;  1AJY A;  1OR5 A;  1YTZ I;  3D70 A;  1NTZ J;  4GIF A;  3HD7 C;  4OGQ D;  1NTM J;  2WSE H;  4IL6 H;  2HPC A;  3B4Q A;  2XZR A;  2N98 A;  1HH0 A;  5KLV E;  4HKZ H;  1JNM A;  4BRY A;  5F2N A;  3G1I A;  1VQ9 P;  2Q7C A;  1FJP A;  1FZG A;  3FWN A;  1RF1 B;  2KWL A;  1NGM B;  2K0X A;  2FYU G;  4PD4 D;  2KOO A;  4EOT A;  2HR3 A;  2PEO A;  2KYV A;  3H1J J;  3L36 A;  1BAJ A;  2N9Y B;  1VPC A;  1BCC G;  4DOJ A;  2KOR A;  1CSB A;  1ZRT E;  1G1I A;  2E76 C;  5GTH H;  1NH4 A;  1HGZ A;  1K73 Q;  3E1I A;  2PEI A;  1LTS C;  1HWT C;  1AQT A;  2FYU K;  5KAI E;  1E79 H;  1D1D A;  1WT6 A;  5B66 H;  1MUU A;  1M6E X;  3V2R A;  5GTH E;  1NAF A;  1QL1 A;  1Z56 A;  2NZ2 A;  2A45 G;  2O01 H;  1L0L D;  1T3U A;  3M1M A;  3MD0 A;  4EI2 A;  1ZMB A;  4JBZ A;  1ZOY C;  4PD4 H;  1AVY A;  2P1J A;  4C7N B;  3LMO A;  2EHT A;  1SQQ K;  4I6M C;  1KV4 A;  4O9B A;  1A02 J;  4OVN F;  3M91 A;  3RL0 D;  2GZI A;  4U3F E;  1SQB K;  1PP9 D;  2XZ0 D;  2IBZ G;  3WU2 E;  4NPF X;  1PP9 J;  3V4Q A;  2I1K A;  1SFC A;  3FGA D;  3G29 A;  4RKU J;  4D6T J;  2K88 A;  1W5C E;  1Z6M A;  1EDK A;  1BSH A;  2FAD A;  3NMD A;  2FYZ A;  2PRR A;  1SQX K;  2QSI A;  5DJT B;  4PH1 A;  1BE3 J;  3RK3 D;  3V6I A;  1H88 A;  1VQP P;  1J1D B;  2JR8 A;  1TU3 F;  1GMJ A;  4Y28 J;  5BS1 A;  1SQP J;  1HQB A;  1VKU A;  7CEI A;  2WSF J;  5AW6 B;  2K37 A;  1JY3 P;  5EJD A;  2KOG A;  3H1K G;  5KLV J;  5APV A;  3L74 E;  2OYH A;  1IJD B;  1LNQ A;  5B5E H;  1KFM A;  1LT1 A;  4D6T D;  3AEB C;  1Q86 Q;  2JO0 A;  1JCD A;  3GLM A;  1GL2 A;  2KG9 A;  4MRT C;  2N1T D;  1GK6 A;  2MY5 A;  2IFM A;  3H1J E;  4HKG A;  3L71 J;  4AYC A;  5CCH C;  5GTI E;  2Q6Q A;  1YYC A;  4U0B A;  2M0B A;  1AA0 A;  1KIL D;  4GT1 A;  3HE5 B;  1KYO E;  2W90 A;  3L73 J;  2OYI B;  3TDK A;  1M56 D;  2X2B A;  4WB4 A;  4QNB A;  1LT9 A;  1N7S A;  4NPD A;  2YKQ A;  2W6B A;  3VRL C;  2YXR B;  3DTJ A;  1Q90 D;  2L22 A;  1OWA A;  3EFF K;  2Z45 A;  1L0L E;  1IK7 A;  4BPH A;  1EIA A;  2KOQ A;  3PH0 A;  2XNX A;  2AF8 A;  5C39 A;  2HG5 D;  3RG6 C;  1KYO H;  3M0D A;  5AVR B;  2IYO A;  2OYI C;  2OYO A;  1NTM D;  2A45 I;  2JAZ A;  2GZG A;  4H13 D;  4WY4 C;  3L75 E;  1IFN A;  1BE3 G;  3SWK A;  1BCC E;  1SQX G;  2KGE A;  3HUS A;  2KOS A;  2IZ0 A;  3AE8 C;  1FDI A;  1RE4 C;  4WY4 B;  1SQP G;  4ASW A;  2MJZ A;  2GM4 A;  3PJS K;  3E2D A;  2M8L A;  2YIU C;  1A43 A;  2KGC A;  1DEB A;  3HE4 A;  1R5S A;  2V7Q H;  1QRJ A;  2Y0E A;  1PPJ G;  4NEO A;  1VQ8 P;  5HVC A;  5K5G B;  5CCH D;  3FX0 A;  1LTJ B;  2OYH B;  2ZVO B;  3L73 G;  2VLP A;  1PEQ A;  2FAC A;  4U7J A;  1NKN A;  2M3B A;  3G26 A;  1OXZ A;  2Z5H A;  5APX A;  1SQB D;  4IOI H;  4EDF A;  1AFO A;  1SQX E;  3H4E A;  5AVW B;  1GTW A;  2HFE D;  1LTJ C;  1SP4 A;  5APW A;  1W2E A;  5KKZ C;  2PEK A;  4DJG A;  1N73 C;  3IR9 A;  4WWI A;  4Y99 B;  2QEX P;  3G3Z A;  1RO2 A;  2N5H A;  1LWU C;  3WUT A;  4W7Y A;  4C7N A;  1NJI Q;  4BPG A;  1GZL A;  2K1A A;  3CX5 H;  2K2Q A;  2BQ1 E;  1M1J B;  1T2K C;  4JPZ B;  2XZ1 C;  3L70 D;  4GR2 A;  2E74 B;  4XA4 A;  1U57 A;  2K9J A;  3IAO A;  2LPK A;  2E42 A;  2WT7 B;  2VLQ A;  2FHS C;  2AFD A;  2WPS A;  3U59 A;  1KIL A;  3L37 A;  1OMI A;  4YPC A;  3AE7 C;  3T97 A;  3A0H E;  2YO2 A;  5AW7 B;  2M8N A;  3LW5 J;  2WPV B;  3V5B A;  1IO4 A;  5EFW B;  3MHV A;  4JF7 A; 
#chains in the Genus database with same CATH homology
 2M8P A;  3CPW O;  3CD6 P;  2PY8 A;  1A8O A;  3G4S P;  3CCJ P;  1QRJ A;  3WBH A;  3CCQ P;  4COC A;  1Q86 Q;  1YIJ P;  1VQL P;  2XT1 A;  2JO0 A;  3G1G A;  1VQ8 P;  2DGY A;  2PEN A;  2PEM A;  1D1D A;  1M6E X;  1AUM A;  1JJ2 O;  2ONT A;  2XV6 A;  1K30 A;  2EFJ A;  2JYG A;  1PEQ A;  4XFY A;  5F2K A;  2LF4 A;  3M1M A;  4U0A A;  5JPA A;  4U0B A;  1ZMB A;  3DPH A;  3G26 A;  1PEM A;  3HZQ A;  3CCV P;  1S72 P;  1RNI A;  4WYM A;  3I55 P;  2QA4 P;  1YJN P;  1KD1 Q;  4XRQ A;  3H4E A;  1RO0 A;  3CCR P;  1M6N A;  1PEO A;  2P9X A;  1Q7Y Q;  3CCM P;  1IUQ A;  4QNB A;  1Q81 Q;  4M0I A;  3CCL P;  3VRL C;  2Z46 A;  4U0E A;  1E6J P;  1VQ6 P;  4XFZ A;  3DTJ A;  3H47 A;  1YJW P;  2PEK A;  1VQO P;  2L6E A;  3HYB A;  2Z45 A;  4U0C A;  2QEX P;  4IPY A;  2E1M A;  1M74 A;  1EIA A;  1RO2 A;  5F2O A;  1N8R Q;  1VQ4 P;  2JYL A;  3MGE A;  3RG6 C;  1K8A Q;  1M90 Q;  1QVF O;  3G6E P;  1NJI Q;  3I56 P;  1KQS O;  1VQM P;  1KC8 Q;  1QVG O;  2BQ1 E;  3LRY A;  2OTJ P;  2KOD A;  3G29 A;  3CXC O;  1VQ5 P;  4GR2 A;  3CCS P;  2XXM A;  2OTL P;  3NTE A;  3B5I A;  2BUO A;  3P05 A;  4U0F A;  5F2N A;  3G1I A;  3CMA P;  1VQ9 P;  3DS0 A;  3CC4 P;  4PH0 A;  2Z44 A;  4GR6 A;  3DS1 A;  3CC7 P;  3Q20 A;  1EOQ A;  5HGO A;  3G28 A;  1YJ9 P;  4PH1 A;  3G21 A;  1VQ7 P;  1VQN P;  2EIA A;  1YHQ P;  3CC2 P;  1PEU A;  5DCK A;  1VQP P;  3CME P;  2OAR A;  1M1K Q;  5BS2 A;  4COP A;  2CWO A;  5BS1 A;  5HGN A;  2PEO A;  3OW2 O;  5HGM A;  5HGL A;  3G0V A;  1W2B O;  1BAJ A;  2M8N A;  4U0D A;  2PEQ A;  3DS5 A;  1YIT P;  1K9M Q;  3H0D A;  3G71 P;  3DS2 A;  3E2D A;  5I4T G;  2M8L A;  3CCE P;  1Q82 Q;  3DS3 A;  3CCU P;  2BHV A;  1A43 A;  1VQK P;  2PEJ A;  3DS4 A;  4XRO A;  2EG5 A;  1K73 Q;  1YI2 P;  4XFX A;  2PEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...