2DNWA

Solution structure of rsgi ruh-059, an acp domain of acyl carrier protein, mitochondrial [precursor] from human cdna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
b'GSSGSSGMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Solution structure of RSGI RUH-059, an ACP domain of acyl carrier protein, mitochondrial [Precursor] from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2dnwA00
2FVEA 5KP7B 2L0QA 2JGPA 2KOPA 2N98A 4PXHB 4BPHA 5KP8B 3RG2A 2MVUA 2CNRA 2CQ8A 2K94A 4CA3A 2EHSA 2AFDA 2LL8A 2MR8A 3EJDA 2GDWA 2FADA 3LMOA 2L4BA 4MRTC 4IZ6A 1L0IA 2MD9A 5HVCA 2FAEA 2LMLA 2KOQA 2N5IA 4H2YC 2KOSA 2LIUA 1T8KA 4HKGA 4BPGA 2CG5B 2XZ1C 2KGCA 2XZ0D 2VSQA 2PNGA 4NEOA 2KGEA 2GDXA 1ACPA 4H2XC 2N6ZA 2FVAA 2FVFA 3EJBA 2N5HA 2AFEA 5KP6B 1HQBA 2N50A 5CZDB 1HY8A 2KGAA 2FQ2A 4H2WC 2JU1A 2JQ4A 2MY5A 5EJDA 3CE7A 2FQ0A 2CGQA 2L22A 2AVAA 2KWLA 2M5RA 3EJEA 2KG8A 1F80D 2LKIA 5HV8A 2EHTA 1KLPA 2LIWA 2KGDA 2KR5A 2QNWA 4DG9A 4R0MA 2X2BA 3GZLA 3GZMA 2K93A 2L9FA 2KOOA 1X3OA 4PWVB 2K2QA 1OR5A 2K92A 2MVVA 1DNYA 2K0YA 2MR7A 2GDYA 2KG9A 2KG6A 2K0XA 2KORA 1AF8A 2N6YA 1NQ4A 2LTEA 2FACA 3NY7B 1DV5A 2AF8A 2LPKA 2ROQA 4BPFA 2JU2A 2DNWA 2LOLA 2FHSC 2KW2A 2FQ1A 2MF4A 1VKUA 1L0HA
chains in the Genus database with same CATH superfamily
1RNIA 1KD1Q 2JGPA 4PXHB 3CPWO 1Z6MA 3P05A 1M74A 4WYMA 3CC4P 1JJ2O 2PEQA 2CNRA 4CA3A 4XRQA 2VLQA 2GYKA 2LL8A 2FADA 1KC8Q 1YI2P 4MRTC 3I56P 2MD9A 2LMLA 4H2YC 4HKGA 2JYGA 1EMVA 1S72P 2PEKA 3G0VA 2XZ1C 1K73Q 1Q82Q 4IPYA 2XZ0D 2VSQA 1RO2A 3CCRP 3CCVP 1K8AQ 1ACPA 4H2XC 2FVFA 5DCKA 3EJBA 4XFYA 2GZJA 4U0CA 2N5HA 4U0EA 3M1MA 1IUQA 1HY8A 4H2WC 3H4EA 2JQ4A 2MY5A 1YJ9P 3MGEA 2PEOA 4QKOA 3CXCO 1FR2A 2L22A 1E6JP 2M5RA 1F80D 2LKIA 3GJNA 1MZ8A 3DS0A 1KLPA 2EG5A 2KR5A 4DG9A 4R0MA 2K93A 2K2QA 2K92A 2MVVA 1KQSO 2MR7A 2VLNA 2KG6A 5HGMA 1NQ4A 2LTEA 2JB0A 1BAJA 1Q86Q 2LPKA 2Z46A 1AYIA 2JU2A 1UJZA 1VQOP 1W2BO 2FQ1A 1IMQA 3G71P 2MF4A 3G28A 2M8LA 2L0QA 2N98A 1GPJA 3CCSP 2WPTA 2MVUA 1ZNVA 2CWOA 7CEIA 3G4SP 3RG6C 1QVGO 4XROA 2MR8A 3EJDA 2GDWA 2DGYA 3LMOA 1RO0A 3G29A 3CMAP 4IZ6A 3VRLC 5HVCA 1ZMBA 1UNKA 1A43A 2KOQA 3E2DA 2N5IA 1T8KA 1YIJP 2CG5B 2KGCA 1BXIA 1N8RQ 1D1DA 1K30A 4NEOA 1Q81Q 2FVAA 3Q20A 3B4QA 5KP6B 1YJNP 1K9MQ 1GXHA 3WBHA 2VLPA 2N50A 1VQLP 2KGAA 2FQ2A 3DS2A 1VHNA 5EJDA 2CGQA 2BUOA 2JBGA 2KWLA 3EJEA 2KG8A 2PEJA 1VQMP 5HV8A 1M1KQ 2LIWA 2KGDA 2OARA 3DS5A 3G1IA 2QNWA 3GZLA 3GZMA 2QA4P 1OR5A 1VQ5P 2Z44A 2K5XA 1NJIQ 1VQKP 3HYBA 2N6YA 3CCJP 5F2KA 1M6EX 1VKUA 1L0HA 2FVEA 1EOQA 2ERHA 5KP7B 2KOPA 5KP8B 2L6EA 4GR2A 3OW2O 2GZEA 2K94A 3NTEA 2GZIA 3CCQP 2M8NA 3DS3A 2LIUA 5HGOA 1QVFO 4BPGA 3CC7P 2OTJP 2GDXA 2K0DX 2N6ZA 2GZGA 5BS2A 2PEMA 2ONTA 2PENA 4PH0A 5BS1A 2AFEA 1HQBA 1VQPP 1YHQP 5CZDB 3H47A 3H0DA 1GXGA 5F2OA 3U43A 3CE7A 3HZQA 2QEXP 2FQ0A 3GKLC 2AVAA 4U0BA 4COPA 1QRJA 2KODA 1M6NA 4U0DA 2L9FA 2E1MA 4PWVB 5I4TG 3CMEP 2EFJA 2KG9A 4PH1A 3LRYA 1AF8A 1VQ4P 2Z45A 3DS4A 4U0FA 2FACA 5F2NA 3NY7B 2OTLP 2P9XA 3G1GA 4BPFA 2VLOA 2LF4A 1E0HA 1EIAA 4BPHA 1IMPA 3RG2A 3CCEP 2BHVA 2CQ8A 4F37A 2EHSA 2AFDA 3CD6P 2L4BA 3B5IA 1L0IA 1A8OA 2FAEA 3I55P 2KOSA 2M8PA 1AUMA 1YITP 2PNGA 1VQ7P 1YJWP 2KGEA 3G26A 5EW5E 3DTJA 3DS1A 3CCUP 4XFXA 1VQ8P 5JPAA 2PY8A 1VQ6P 2XV6A 3CC2P 4GR6A 2JU1A 4UHPB 4COCA 2XT1A 4U0AA 2EHTA 1VQ9P 2PEIA 3CCMP 2XXMA 2X2BA 1X3OA 2KOOA 3G21A 1VQNP 1DNYA 2K0YA 2JO0A 2GDYA 3DPHA 5HGLA 2K0XA 4M0IA 2KORA 3G6EP 1CEIA 1M90Q 1Q7YQ 1DV5A 2AF8A 2GZFA 2ROQA 2EIAA 5HGNA 4XFZA 2DNWA 2NO8A 2JAZA 2FHSC 2JYLA 2KW2A 2LOLA 4QNBA 3CCLP
chains in the Genus database with same CATH topology
2FVEA 5KP7B 2L0QA 2JGPA 2KOPA 2N98A 4PXHB 4BPHA 5KP8B 3RG2A 2MVUA 2CNRA 2CQ8A 2K94A 4CA3A 2EHSA 2AFDA 2LL8A 2MR8A 3EJDA 2GDWA 2FADA 3LMOA 2L4BA 4MRTC 4IZ6A 1L0IA 2MD9A 5HVCA 2FAEA 2LMLA 2KOQA 2N5IA 4H2YC 2KOSA 2LIUA 1T8KA 4HKGA 4BPGA 2CG5B 2XZ1C 2KGCA 2XZ0D 2VSQA 2PNGA 4NEOA 2KGEA 2GDXA 1ACPA 4H2XC 2N6ZA 2FVAA 2FVFA 3EJBA 2N5HA 2AFEA 5KP6B 1HQBA 2N50A 5CZDB 1HY8A 2KGAA 2FQ2A 4H2WC 2JU1A 2JQ4A 2MY5A 5EJDA 3CE7A 2FQ0A 2CGQA 2L22A 2AVAA 2KWLA 2M5RA 3EJEA 2KG8A 1F80D 2LKIA 5HV8A 2EHTA 1KLPA 2LIWA 2KGDA 2KR5A 2QNWA 4DG9A 4R0MA 2X2BA 3GZLA 3GZMA 2K93A 2L9FA 2KOOA 1X3OA 4PWVB 2K2QA 1OR5A 2K92A 2MVVA 1DNYA 2K0YA 2MR7A 2GDYA 2KG9A 2KG6A 2K0XA 2KORA 1AF8A 2N6YA 1NQ4A 2LTEA 2FACA 3NY7B 1DV5A 2AF8A 2LPKA 2ROQA 4BPFA 2JU2A 2DNWA 2LOLA 2FHSC 2KW2A 2FQ1A 2MF4A 1VKUA 1L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVE A;  5KP7 B;  2L0Q A;  2JGP A;  2KOP A;  2N98 A;  4PXH B;  4BPH A;  5KP8 B;  3RG2 A;  2MVU A;  2CNR A;  2CQ8 A;  2K94 A;  4CA3 A;  2EHS A;  2AFD A;  2LL8 A;  2MR8 A;  3EJD A;  2GDW A;  2FAD A;  3LMO A;  2L4B A;  4MRT C;  4IZ6 A;  1L0I A;  2MD9 A;  5HVC A;  2FAE A;  2LML A;  2KOQ A;  2N5I A;  4H2Y C;  2KOS A;  2LIU A;  1T8K A;  4HKG A;  4BPG A;  2CG5 B;  2XZ1 C;  2KGC A;  2XZ0 D;  2VSQ A;  2PNG A;  4NEO A;  2KGE A;  2GDX A;  1ACP A;  4H2X C;  2N6Z A;  2FVA A;  2FVF A;  3EJB A;  2N5H A;  2AFE A;  5KP6 B;  1HQB A;  2N50 A;  5CZD B;  1HY8 A;  2KGA A;  2FQ2 A;  4H2W C;  2JU1 A;  2JQ4 A;  2MY5 A;  5EJD A;  3CE7 A;  2FQ0 A;  2CGQ A;  2L22 A;  2AVA A;  2KWL A;  2M5R A;  3EJE A;  2KG8 A;  1F80 D;  2LKI A;  5HV8 A;  2EHT A;  1KLP A;  2LIW A;  2KGD A;  2KR5 A;  2QNW A;  4DG9 A;  4R0M A;  2X2B A;  3GZL A;  3GZM A;  2K93 A;  2L9F A;  2KOO A;  1X3O A;  4PWV B;  2K2Q A;  1OR5 A;  2K92 A;  2MVV A;  1DNY A;  2K0Y A;  2MR7 A;  2GDY A;  2KG9 A;  2KG6 A;  2K0X A;  2KOR A;  1AF8 A;  2N6Y A;  1NQ4 A;  2LTE A;  2FAC A;  3NY7 B;  1DV5 A;  2AF8 A;  2LPK A;  2ROQ A;  4BPF A;  2JU2 A;  2DNW A;  2LOL A;  2FHS C;  2KW2 A;  2FQ1 A;  2MF4 A;  1VKU A;  1L0H A; 
#chains in the Genus database with same CATH topology
 1RNI A;  1KD1 Q;  2JGP A;  4PXH B;  3CPW O;  1Z6M A;  3P05 A;  1M74 A;  4WYM A;  3CC4 P;  1JJ2 O;  2PEQ A;  2CNR A;  4CA3 A;  4XRQ A;  2VLQ A;  2GYK A;  2LL8 A;  2FAD A;  1KC8 Q;  1YI2 P;  4MRT C;  3I56 P;  2MD9 A;  2LML A;  4H2Y C;  4HKG A;  2JYG A;  1EMV A;  1S72 P;  2PEK A;  3G0V A;  2XZ1 C;  1K73 Q;  1Q82 Q;  4IPY A;  2XZ0 D;  2VSQ A;  1RO2 A;  3CCR P;  3CCV P;  1K8A Q;  1ACP A;  4H2X C;  2FVF A;  5DCK A;  3EJB A;  4XFY A;  2GZJ A;  4U0C A;  2N5H A;  4U0E A;  3M1M A;  1IUQ A;  1HY8 A;  4H2W C;  3H4E A;  2JQ4 A;  2MY5 A;  1YJ9 P;  3MGE A;  2PEO A;  4QKO A;  3CXC O;  1FR2 A;  2L22 A;  1E6J P;  2M5R A;  1F80 D;  2LKI A;  3GJN A;  1MZ8 A;  3DS0 A;  1KLP A;  2EG5 A;  2KR5 A;  4DG9 A;  4R0M A;  2K93 A;  2K2Q A;  2K92 A;  2MVV A;  1KQS O;  2MR7 A;  2VLN A;  2KG6 A;  5HGM A;  1NQ4 A;  2LTE A;  2JB0 A;  1BAJ A;  1Q86 Q;  2LPK A;  2Z46 A;  1AYI A;  2JU2 A;  1UJZ A;  1VQO P;  1W2B O;  2FQ1 A;  1IMQ A;  3G71 P;  2MF4 A;  3G28 A;  2M8L A;  2L0Q A;  2N98 A;  1GPJ A;  3CCS P;  2WPT A;  2MVU A;  1ZNV A;  2CWO A;  7CEI A;  3G4S P;  3RG6 C;  1QVG O;  4XRO A;  2MR8 A;  3EJD A;  2GDW A;  2DGY A;  3LMO A;  1RO0 A;  3G29 A;  3CMA P;  4IZ6 A;  3VRL C;  5HVC A;  1ZMB A;  1UNK A;  1A43 A;  2KOQ A;  3E2D A;  2N5I A;  1T8K A;  1YIJ P;  2CG5 B;  2KGC A;  1BXI A;  1N8R Q;  1D1D A;  1K30 A;  4NEO A;  1Q81 Q;  2FVA A;  3Q20 A;  3B4Q A;  5KP6 B;  1YJN P;  1K9M Q;  1GXH A;  3WBH A;  2VLP A;  2N50 A;  1VQL P;  2KGA A;  2FQ2 A;  3DS2 A;  1VHN A;  5EJD A;  2CGQ A;  2BUO A;  2JBG A;  2KWL A;  3EJE A;  2KG8 A;  2PEJ A;  1VQM P;  5HV8 A;  1M1K Q;  2LIW A;  2KGD A;  2OAR A;  3DS5 A;  3G1I A;  2QNW A;  3GZL A;  3GZM A;  2QA4 P;  1OR5 A;  1VQ5 P;  2Z44 A;  2K5X A;  1NJI Q;  1VQK P;  3HYB A;  2N6Y A;  3CCJ P;  5F2K A;  1M6E X;  1VKU A;  1L0H A;  2FVE A;  1EOQ A;  2ERH A;  5KP7 B;  2KOP A;  5KP8 B;  2L6E A;  4GR2 A;  3OW2 O;  2GZE A;  2K94 A;  3NTE A;  2GZI A;  3CCQ P;  2M8N A;  3DS3 A;  2LIU A;  5HGO A;  1QVF O;  4BPG A;  3CC7 P;  2OTJ P;  2GDX A;  2K0D X;  2N6Z A;  2GZG A;  5BS2 A;  2PEM A;  2ONT A;  2PEN A;  4PH0 A;  5BS1 A;  2AFE A;  1HQB A;  1VQP P;  1YHQ P;  5CZD B;  3H47 A;  3H0D A;  1GXG A;  5F2O A;  3U43 A;  3CE7 A;  3HZQ A;  2QEX P;  2FQ0 A;  3GKL C;  2AVA A;  4U0B A;  4COP A;  1QRJ A;  2KOD A;  1M6N A;  4U0D A;  2L9F A;  2E1M A;  4PWV B;  5I4T G;  3CME P;  2EFJ A;  2KG9 A;  4PH1 A;  3LRY A;  1AF8 A;  1VQ4 P;  2Z45 A;  3DS4 A;  4U0F A;  2FAC A;  5F2N A;  3NY7 B;  2OTL P;  2P9X A;  3G1G A;  4BPF A;  2VLO A;  2LF4 A;  1E0H A;  1EIA A;  4BPH A;  1IMP A;  3RG2 A;  3CCE P;  2BHV A;  2CQ8 A;  4F37 A;  2EHS A;  2AFD A;  3CD6 P;  2L4B A;  3B5I A;  1L0I A;  1A8O A;  2FAE A;  3I55 P;  2KOS A;  2M8P A;  1AUM A;  1YIT P;  2PNG A;  1VQ7 P;  1YJW P;  2KGE A;  3G26 A;  5EW5 E;  3DTJ A;  3DS1 A;  3CCU P;  4XFX A;  1VQ8 P;  5JPA A;  2PY8 A;  1VQ6 P;  2XV6 A;  3CC2 P;  4GR6 A;  2JU1 A;  4UHP B;  4COC A;  2XT1 A;  4U0A A;  2EHT A;  1VQ9 P;  2PEI A;  3CCM P;  2XXM A;  2X2B A;  1X3O A;  2KOO A;  3G21 A;  1VQN P;  1DNY A;  2K0Y A;  2JO0 A;  2GDY A;  3DPH A;  5HGL A;  2K0X A;  4M0I A;  2KOR A;  3G6E P;  1CEI A;  1M90 Q;  1Q7Y Q;  1DV5 A;  2AF8 A;  2GZF A;  2ROQ A;  2EIA A;  5HGN A;  4XFZ A;  2DNW A;  2NO8 A;  2JAZ A;  2FHS C;  2JYL A;  2KW2 A;  2LOL A;  4QNB A;  3CCL P; 
#chains in the Genus database with same CATH homology
 2FVE A;  5KP7 B;  2L0Q A;  2JGP A;  2KOP A;  2N98 A;  4PXH B;  4BPH A;  5KP8 B;  3RG2 A;  2MVU A;  2CNR A;  2CQ8 A;  2K94 A;  4CA3 A;  2EHS A;  2AFD A;  2LL8 A;  2MR8 A;  3EJD A;  2GDW A;  2FAD A;  3LMO A;  2L4B A;  4MRT C;  4IZ6 A;  1L0I A;  2MD9 A;  5HVC A;  2FAE A;  2LML A;  2KOQ A;  2N5I A;  4H2Y C;  2KOS A;  2LIU A;  1T8K A;  4HKG A;  4BPG A;  2CG5 B;  2XZ1 C;  2KGC A;  2XZ0 D;  2VSQ A;  2PNG A;  4NEO A;  2KGE A;  2GDX A;  1ACP A;  4H2X C;  2N6Z A;  2FVA A;  2FVF A;  3EJB A;  2N5H A;  2AFE A;  5KP6 B;  1HQB A;  2N50 A;  5CZD B;  1HY8 A;  2KGA A;  2FQ2 A;  4H2W C;  2JU1 A;  2JQ4 A;  2MY5 A;  5EJD A;  3CE7 A;  2FQ0 A;  2CGQ A;  2L22 A;  2AVA A;  2KWL A;  2M5R A;  3EJE A;  2KG8 A;  1F80 D;  2LKI A;  5HV8 A;  2EHT A;  1KLP A;  2LIW A;  2KGD A;  2KR5 A;  2QNW A;  4DG9 A;  4R0M A;  2X2B A;  3GZL A;  3GZM A;  2K93 A;  2L9F A;  2KOO A;  1X3O A;  4PWV B;  2K2Q A;  1OR5 A;  2K92 A;  2MVV A;  1DNY A;  2K0Y A;  2MR7 A;  2GDY A;  2KG9 A;  2KG6 A;  2K0X A;  2KOR A;  1AF8 A;  2N6Y A;  1NQ4 A;  2LTE A;  2FAC A;  3NY7 B;  1DV5 A;  2AF8 A;  2LPK A;  2ROQ A;  4BPF A;  2JU2 A;  2DNW A;  2LOL A;  2FHS C;  2KW2 A;  2FQ1 A;  2MF4 A;  1VKU A;  1L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...