2DNWA

Solution structure of rsgi ruh-059, an acp domain of acyl carrier protein, mitochondrial [precursor] from human cdna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Solution structure of RSGI RUH-059, an ACP domain of acyl carrier protein, mitochondrial [Precursor] from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2dnwA00
2DNWA 3EJDA 2VSQA 1HQBA 2FQ0A 2LOLA 1KLPA 2LTEA 2KR5A 2AF8A 3EJEA 2KOSA 2N98A 2KG6A 1AF8A 2N5IA 2AFEA 2LIUA 2PNGA 2N50A 2MD9A 2KGCA 2CG5B 2L0QA 4HKGA 4R0MA 2L9FA 2ROQA 2LIWA 3GZMA 4H2XC 4BPGA 5KP7B 2X2BA 1HY8A 2FVAA 2MVUA 5KP8B 2JGPA 2AFDA 4H2WC 2GDWA 5KP6B 2JU2A 1T8KA 5CZDB 2FACA 3GZLA 2L4BA 2LPKA 2QNWA 3CE7A 2KGEA 2KOPA 1NQ4A 2GDXA 2XZ1C 2K2QA 2N6YA 2KOQA 2KORA 4BPFA 4CA3A 1F80D 2FAEA 2KG9A 2MVVA 4NEOA 1L0IA 2KG8A 2KWLA 2K94A 4DG9A 2KGAA 2K0XA 5HV8A 2MR7A 1X3OA 2KW2A 5EJDA 5HVCA 2M5RA 2MR8A 2MF4A 2LMLA 2CGQA 2EHSA 3EJBA 2N5HA 2FHSC 2GDYA 2XZ0D 2FVFA 2K93A 4H2YC 3RG2A 2LL8A 2MY5A 1OR5A 4PWVB 2FQ1A 2EHTA 2LKIA 2CNRA 4MRTC 1DNYA 1ACPA 2FVEA 2JU1A 3NY7B 2K92A 4IZ6A 4BPHA 1VKUA 2N6ZA 2JQ4A 2FADA 1DV5A 2FQ2A 3LMOA 1L0HA 2L22A 2KOOA 2AVAA 4PXHB 2KGDA 2K0YA 2CQ8A
chains in the Genus database with same CATH superfamily
2M8PA 3CXCO 2LOLA 4IPYA 2Z45A 2LTEA 3DS5A 3VRLC 1VQKP 2KG6A 2N5IA 1GXGA 2AFEA 2LIUA 1E0HA 3CD6P 1BAJA 4U0FA 3GZMA 4BPGA 2X2BA 3G1IA 2FVAA 1Q7YQ 1M6EX 2JU2A 1T8KA 2VLOA 2PY8A 2GDXA 5JPAA 3G71P 2GZFA 5BS2A 1Z6MA 3OW2O 2KORA 2ERHA 5DCKA 2FAEA 4U0AA 1RO0A 4DG9A 4XRQA 2VLQA 5HV8A 1QVGO 3HZQA 3CCJP 2OARA 2XXMA 2NO8A 2MF4A 3EJBA 1ZMBA 2N5HA 2FHSC 2GDYA 2XZ0D 2FVFA 2K93A 2JAZA 3DS3A 5EW5E 3E2DA 2LL8A 1S72P 3GKLC 1OR5A 3Q20A 5F2NA 1KD1Q 3CCRP 2CNRA 1ACPA 2FVEA 2K92A 4UHPB 2FQ2A 5I4TG 3LMOA 3DTJA 2L22A 2KGDA 4M0IA 2DNWA 3EJDA 2VSQA 2K0DX 1HQBA 2EFJA 3M1MA 2FQ0A 1YJWP 3HYBA 2KR5A 2AF8A 1YIJP 1IUQA 1UJZA 3G0VA 4U0CA 2Z44A 3CPWO 1AF8A 1GXHA 1M74A 2N50A 2L0QA 1YJ9P 3H0DA 1VQ5P 2ROQA 1YJNP 1HY8A 1K8AQ 2MVUA 3LRYA 3GJNA 4H2WC 1JJ2O 3NTEA 2FACA 3GZLA 2LPKA 2PEKA 4XFYA 3CE7A 2KOPA 1NQ4A 2ONTA 2K2QA 2JO0A 3CCVP 3G21A 1KQSO 3DPHA 4NEOA 1M6NA 2JB0A 1L0IA 3U43A 2K94A 1RO2A 2K0XA 1VQNP 1NJIQ 3CCSP 4U0DA 3MGEA 1QVFO 2GZJA 2LMLA 1EMVA 2CGQA 1VQ8P 2GYKA 1EIAA 3RG2A 4GR6A 7CEIA 1IMPA 1VQ6P 1A8OA 2EHTA 2K5XA 5HGNA 4F37A 2JU1A 3NY7B 4IZ6A 4WYMA 3I55P 2OTJP 1IMQA 1VKUA 1FR2A 2JQ4A 2FADA 2BHVA 5BS1A 2EIAA 4PXHB 3I56P 3G6EP 2JBGA 3G29A 2QEXP 1W2BO 1VQ4P 3EJEA 4COPA 1K9MQ 2KOSA 2N98A 2PNGA 2WPTA 3DS2A 2MD9A 2KGCA 1Q82Q 4HKGA 4U0EA 2LIWA 4H2XC 3DS4A 1CEIA 5KP7B 5F2KA 1YITP 1YHQP 3G26A 5KP8B 2EG5A 3WBHA 2Z46A 4U0BA 5KP6B 5CZDB 2PEMA 2QNWA 2KGEA 3G4SP 3DS0A 3CCLP 4PH0A 1VQLP 2M8LA 4BPFA 1F80D 1QRJA 2KG8A 2KGAA 2MR7A 1X3OA 1KC8Q 2M5RA 2QA4P 2EHSA 1VQPP 2L6EA 4H2YC 1Q86Q 3CMAP 4MRTC 3B5IA 3G28A 3CC2P 2P9XA 4BPHA 4QKOA 1BXIA 3H4EA 1D1DA 2N6ZA 2JYGA 1RNIA 3CCMP 1DV5A 1L0HA 5HGLA 2E1MA 2AVAA 1VQ7P 4PH1A 2K0YA 1GPJA 5HGMA 3CCEP 4XFZA 3DS1A 1KLPA 1A43A 3G1GA 3CMEP 4XFXA 2JYLA 4QNBA 4GR2A 1UNKA 1YI2P 2PEQA 2PEJA 1MZ8A 4XROA 2CG5B 4R0MA 2L9FA 1VQMP 1VQ9P 3B4QA 1VQOP 2JGPA 1N8RQ 2AFDA 5F2OA 2GDWA 2VLNA 3CCUP 2L4BA 3P05A 2XZ1C 2PEOA 2N6YA 2PENA 1ZNVA 3H47A 2LF4A 2KOQA 2VLPA 1EOQA 4CA3A 1AYIA 5HGOA 2KG9A 2MVVA 2KWLA 1M90Q 2XV6A 2OTLP 2BUOA 2KW2A 5EJDA 5HVCA 1E6JP 2DGYA 2MR8A 1K30A 2MY5A 2XT1A 4COCA 2CWOA 1M1KQ 2GZGA 4PWVB 2FQ1A 2LKIA 1DNYA 2GZEA 2KODA 3RG6C 3CC7P 1AUMA 1Q81Q 1VHNA 1K73Q 2KOOA 2M8NA 2PEIA 3CC4P 2GZIA 2CQ8A 3CCQP
chains in the Genus database with same CATH topology
2DNWA 3EJDA 2VSQA 1HQBA 2FQ0A 2LOLA 1KLPA 2LTEA 2KR5A 2AF8A 3EJEA 2KOSA 2N98A 2KG6A 1AF8A 2N5IA 2AFEA 2LIUA 2PNGA 2N50A 2MD9A 2KGCA 2CG5B 2L0QA 4HKGA 4R0MA 2L9FA 2ROQA 2LIWA 3GZMA 4H2XC 4BPGA 5KP7B 2X2BA 1HY8A 2FVAA 2MVUA 5KP8B 2JGPA 2AFDA 4H2WC 2GDWA 5KP6B 2JU2A 1T8KA 5CZDB 2FACA 3GZLA 2L4BA 2LPKA 2QNWA 3CE7A 2KGEA 2KOPA 1NQ4A 2GDXA 2XZ1C 2K2QA 2N6YA 2KOQA 2KORA 4BPFA 4CA3A 1F80D 2FAEA 2KG9A 2MVVA 4NEOA 1L0IA 2KG8A 2KWLA 2K94A 4DG9A 2KGAA 2K0XA 5HV8A 2MR7A 1X3OA 2KW2A 5EJDA 5HVCA 2M5RA 2MR8A 2MF4A 2LMLA 2CGQA 2EHSA 3EJBA 2N5HA 2FHSC 2GDYA 2XZ0D 2FVFA 2K93A 4H2YC 3RG2A 2LL8A 2MY5A 1OR5A 4PWVB 2FQ1A 2EHTA 2LKIA 2CNRA 4MRTC 1DNYA 1ACPA 2FVEA 2JU1A 3NY7B 2K92A 4IZ6A 4BPHA 1VKUA 2N6ZA 2JQ4A 2FADA 1DV5A 2FQ2A 3LMOA 1L0HA 2L22A 2KOOA 2AVAA 4PXHB 2KGDA 2K0YA 2CQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNW A;  3EJD A;  2VSQ A;  1HQB A;  2FQ0 A;  2LOL A;  1KLP A;  2LTE A;  2KR5 A;  2AF8 A;  3EJE A;  2KOS A;  2N98 A;  2KG6 A;  1AF8 A;  2N5I A;  2AFE A;  2LIU A;  2PNG A;  2N50 A;  2MD9 A;  2KGC A;  2CG5 B;  2L0Q A;  4HKG A;  4R0M A;  2L9F A;  2ROQ A;  2LIW A;  3GZM A;  4H2X C;  4BPG A;  5KP7 B;  2X2B A;  1HY8 A;  2FVA A;  2MVU A;  5KP8 B;  2JGP A;  2AFD A;  4H2W C;  2GDW A;  5KP6 B;  2JU2 A;  1T8K A;  5CZD B;  2FAC A;  3GZL A;  2L4B A;  2LPK A;  2QNW A;  3CE7 A;  2KGE A;  2KOP A;  1NQ4 A;  2GDX A;  2XZ1 C;  2K2Q A;  2N6Y A;  2KOQ A;  2KOR A;  4BPF A;  4CA3 A;  1F80 D;  2FAE A;  2KG9 A;  2MVV A;  4NEO A;  1L0I A;  2KG8 A;  2KWL A;  2K94 A;  4DG9 A;  2KGA A;  2K0X A;  5HV8 A;  2MR7 A;  1X3O A;  2KW2 A;  5EJD A;  5HVC A;  2M5R A;  2MR8 A;  2MF4 A;  2LML A;  2CGQ A;  2EHS A;  3EJB A;  2N5H A;  2FHS C;  2GDY A;  2XZ0 D;  2FVF A;  2K93 A;  4H2Y C;  3RG2 A;  2LL8 A;  2MY5 A;  1OR5 A;  4PWV B;  2FQ1 A;  2EHT A;  2LKI A;  2CNR A;  4MRT C;  1DNY A;  1ACP A;  2FVE A;  2JU1 A;  3NY7 B;  2K92 A;  4IZ6 A;  4BPH A;  1VKU A;  2N6Z A;  2JQ4 A;  2FAD A;  1DV5 A;  2FQ2 A;  3LMO A;  1L0H A;  2L22 A;  2KOO A;  2AVA A;  4PXH B;  2KGD A;  2K0Y A;  2CQ8 A; 
#chains in the Genus database with same CATH topology
 2M8P A;  3CXC O;  2LOL A;  4IPY A;  2Z45 A;  2LTE A;  3DS5 A;  3VRL C;  1VQK P;  2KG6 A;  2N5I A;  1GXG A;  2AFE A;  2LIU A;  1E0H A;  3CD6 P;  1BAJ A;  4U0F A;  3GZM A;  4BPG A;  2X2B A;  3G1I A;  2FVA A;  1Q7Y Q;  1M6E X;  2JU2 A;  1T8K A;  2VLO A;  2PY8 A;  2GDX A;  5JPA A;  3G71 P;  2GZF A;  5BS2 A;  1Z6M A;  3OW2 O;  2KOR A;  2ERH A;  5DCK A;  2FAE A;  4U0A A;  1RO0 A;  4DG9 A;  4XRQ A;  2VLQ A;  5HV8 A;  1QVG O;  3HZQ A;  3CCJ P;  2OAR A;  2XXM A;  2NO8 A;  2MF4 A;  3EJB A;  1ZMB A;  2N5H A;  2FHS C;  2GDY A;  2XZ0 D;  2FVF A;  2K93 A;  2JAZ A;  3DS3 A;  5EW5 E;  3E2D A;  2LL8 A;  1S72 P;  3GKL C;  1OR5 A;  3Q20 A;  5F2N A;  1KD1 Q;  3CCR P;  2CNR A;  1ACP A;  2FVE A;  2K92 A;  4UHP B;  2FQ2 A;  5I4T G;  3LMO A;  3DTJ A;  2L22 A;  2KGD A;  4M0I A;  2DNW A;  3EJD A;  2VSQ A;  2K0D X;  1HQB A;  2EFJ A;  3M1M A;  2FQ0 A;  1YJW P;  3HYB A;  2KR5 A;  2AF8 A;  1YIJ P;  1IUQ A;  1UJZ A;  3G0V A;  4U0C A;  2Z44 A;  3CPW O;  1AF8 A;  1GXH A;  1M74 A;  2N50 A;  2L0Q A;  1YJ9 P;  3H0D A;  1VQ5 P;  2ROQ A;  1YJN P;  1HY8 A;  1K8A Q;  2MVU A;  3LRY A;  3GJN A;  4H2W C;  1JJ2 O;  3NTE A;  2FAC A;  3GZL A;  2LPK A;  2PEK A;  4XFY A;  3CE7 A;  2KOP A;  1NQ4 A;  2ONT A;  2K2Q A;  2JO0 A;  3CCV P;  3G21 A;  1KQS O;  3DPH A;  4NEO A;  1M6N A;  2JB0 A;  1L0I A;  3U43 A;  2K94 A;  1RO2 A;  2K0X A;  1VQN P;  1NJI Q;  3CCS P;  4U0D A;  3MGE A;  1QVF O;  2GZJ A;  2LML A;  1EMV A;  2CGQ A;  1VQ8 P;  2GYK A;  1EIA A;  3RG2 A;  4GR6 A;  7CEI A;  1IMP A;  1VQ6 P;  1A8O A;  2EHT A;  2K5X A;  5HGN A;  4F37 A;  2JU1 A;  3NY7 B;  4IZ6 A;  4WYM A;  3I55 P;  2OTJ P;  1IMQ A;  1VKU A;  1FR2 A;  2JQ4 A;  2FAD A;  2BHV A;  5BS1 A;  2EIA A;  4PXH B;  3I56 P;  3G6E P;  2JBG A;  3G29 A;  2QEX P;  1W2B O;  1VQ4 P;  3EJE A;  4COP A;  1K9M Q;  2KOS A;  2N98 A;  2PNG A;  2WPT A;  3DS2 A;  2MD9 A;  2KGC A;  1Q82 Q;  4HKG A;  4U0E A;  2LIW A;  4H2X C;  3DS4 A;  1CEI A;  5KP7 B;  5F2K A;  1YIT P;  1YHQ P;  3G26 A;  5KP8 B;  2EG5 A;  3WBH A;  2Z46 A;  4U0B A;  5KP6 B;  5CZD B;  2PEM A;  2QNW A;  2KGE A;  3G4S P;  3DS0 A;  3CCL P;  4PH0 A;  1VQL P;  2M8L A;  4BPF A;  1F80 D;  1QRJ A;  2KG8 A;  2KGA A;  2MR7 A;  1X3O A;  1KC8 Q;  2M5R A;  2QA4 P;  2EHS A;  1VQP P;  2L6E A;  4H2Y C;  1Q86 Q;  3CMA P;  4MRT C;  3B5I A;  3G28 A;  3CC2 P;  2P9X A;  4BPH A;  4QKO A;  1BXI A;  3H4E A;  1D1D A;  2N6Z A;  2JYG A;  1RNI A;  3CCM P;  1DV5 A;  1L0H A;  5HGL A;  2E1M A;  2AVA A;  1VQ7 P;  4PH1 A;  2K0Y A;  1GPJ A;  5HGM A;  3CCE P;  4XFZ A;  3DS1 A;  1KLP A;  1A43 A;  3G1G A;  3CME P;  4XFX A;  2JYL A;  4QNB A;  4GR2 A;  1UNK A;  1YI2 P;  2PEQ A;  2PEJ A;  1MZ8 A;  4XRO A;  2CG5 B;  4R0M A;  2L9F A;  1VQM P;  1VQ9 P;  3B4Q A;  1VQO P;  2JGP A;  1N8R Q;  2AFD A;  5F2O A;  2GDW A;  2VLN A;  3CCU P;  2L4B A;  3P05 A;  2XZ1 C;  2PEO A;  2N6Y A;  2PEN A;  1ZNV A;  3H47 A;  2LF4 A;  2KOQ A;  2VLP A;  1EOQ A;  4CA3 A;  1AYI A;  5HGO A;  2KG9 A;  2MVV A;  2KWL A;  1M90 Q;  2XV6 A;  2OTL P;  2BUO A;  2KW2 A;  5EJD A;  5HVC A;  1E6J P;  2DGY A;  2MR8 A;  1K30 A;  2MY5 A;  2XT1 A;  4COC A;  2CWO A;  1M1K Q;  2GZG A;  4PWV B;  2FQ1 A;  2LKI A;  1DNY A;  2GZE A;  2KOD A;  3RG6 C;  3CC7 P;  1AUM A;  1Q81 Q;  1VHN A;  1K73 Q;  2KOO A;  2M8N A;  2PEI A;  3CC4 P;  2GZI A;  2CQ8 A;  3CCQ P; 
#chains in the Genus database with same CATH homology
 2DNW A;  3EJD A;  2VSQ A;  1HQB A;  2FQ0 A;  2LOL A;  1KLP A;  2LTE A;  2KR5 A;  2AF8 A;  3EJE A;  2KOS A;  2N98 A;  2KG6 A;  1AF8 A;  2N5I A;  2AFE A;  2LIU A;  2PNG A;  2N50 A;  2MD9 A;  2KGC A;  2CG5 B;  2L0Q A;  4HKG A;  4R0M A;  2L9F A;  2ROQ A;  2LIW A;  3GZM A;  4H2X C;  4BPG A;  5KP7 B;  2X2B A;  1HY8 A;  2FVA A;  2MVU A;  5KP8 B;  2JGP A;  2AFD A;  4H2W C;  2GDW A;  5KP6 B;  2JU2 A;  1T8K A;  5CZD B;  2FAC A;  3GZL A;  2L4B A;  2LPK A;  2QNW A;  3CE7 A;  2KGE A;  2KOP A;  1NQ4 A;  2GDX A;  2XZ1 C;  2K2Q A;  2N6Y A;  2KOQ A;  2KOR A;  4BPF A;  4CA3 A;  1F80 D;  2FAE A;  2KG9 A;  2MVV A;  4NEO A;  1L0I A;  2KG8 A;  2KWL A;  2K94 A;  4DG9 A;  2KGA A;  2K0X A;  5HV8 A;  2MR7 A;  1X3O A;  2KW2 A;  5EJD A;  5HVC A;  2M5R A;  2MR8 A;  2MF4 A;  2LML A;  2CGQ A;  2EHS A;  3EJB A;  2N5H A;  2FHS C;  2GDY A;  2XZ0 D;  2FVF A;  2K93 A;  4H2Y C;  3RG2 A;  2LL8 A;  2MY5 A;  1OR5 A;  4PWV B;  2FQ1 A;  2EHT A;  2LKI A;  2CNR A;  4MRT C;  1DNY A;  1ACP A;  2FVE A;  2JU1 A;  3NY7 B;  2K92 A;  4IZ6 A;  4BPH A;  1VKU A;  2N6Z A;  2JQ4 A;  2FAD A;  1DV5 A;  2FQ2 A;  3LMO A;  1L0H A;  2L22 A;  2KOO A;  2AVA A;  4PXH B;  2KGD A;  2K0Y A;  2CQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...