2DNWA

Solution structure of rsgi ruh-059, an acp domain of acyl carrier protein, mitochondrial [precursor] from human cdna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Acyl carrier protein
publication title Solution structure of RSGI RUH-059, an ACP domain of acyl carrier protein, mitochondrial [Precursor] from human cDNA
rcsb
source organism Homo sapiens
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2dnwA00
2KGCA 2MD9A 2KW2A 1KLPA 5HV8A 2K92A 4R0MA 2AVAA 2AFEA 2X2BA 3GZLA 2K0YA 2KOQA 3CE7A 2FHSC 2XZ1C 2MR8A 2FAEA 2L9FA 2CGQA 2XZ0D 2EHSA 2MR7A 2CG5B 2LPKA 2JGPA 2MY5A 2GDXA 2L0QA 4DG9A 1ACPA 4MRTC 2FACA 2K2QA 4CA3A 2MF4A 2KGDA 3EJDA 2AFDA 1T8KA 2KOOA 2PNGA 2FADA 2N5HA 2N6ZA 2KG9A 2LKIA 4HKGA 2GDWA 4NEOA 2L4BA 4BPHA 1HY8A 2CNRA 4IZ6A 3NY7B 4PXHB 2JU1A 3EJEA 2FQ0A 1L0HA 2FQ2A 2FVEA 1X3OA 2KG6A 4PWVB 5KP6B 2CQ8A 2M5RA 2JU2A 2KORA 5HVCA 4H2WC 5KP7B 2KWLA 2KGEA 2MVUA 2ROQA 2N6YA 1DV5A 1OR5A 1L0IA 2FQ1A 2LIUA 1NQ4A 2KOPA 5KP8B 2LMLA 2FVFA 2LL8A 1HQBA 3GZMA 2FVAA 2DNWA 3LMOA 2LIWA 3RG2A 4H2YC 2KG8A 1DNYA 2N50A 4H2XC 2LTEA 2N5IA 2K0XA 4BPFA 5CZDB 2AF8A 1VKUA 2LOLA 2JQ4A 5EJDA 2K94A 1F80D 2EHTA 2KR5A 2N98A 2K93A 3EJBA 2KOSA 2MVVA 2VSQA 2KGAA 2L22A 2QNWA 4BPGA 1AF8A 2GDYA
chains in the Genus database with same CATH superfamily
1YJ9P 1VQ8P 2KW2A 1MZ8A 1YJWP 2K92A 1IUQA 2AFEA 3G28A 2BHVA 1CEIA 2K0YA 1VQ4P 2CG5B 1NJIQ 2GZEA 2GZFA 1IMPA 2GDXA 3H47A 1ACPA 1YITP 1VQLP 4MRTC 2FACA 2M8NA 3HYBA 3G1GA 1UNKA 3CC4P 3DPHA 1T8KA 2KOOA 4U0FA 1JJ2O 3DS5A 1VQ9P 4PH1A 2GDWA 2L4BA 1L0HA 2FQ2A 1X3OA 2GZJA 3G29A 2JU2A 1S72P 5KP7B 3CMEP 2ROQA 1DV5A 1OR5A 1K73Q 2FQ1A 2KOPA 3WBHA 3LRYA 3B5IA 3GZMA 3CCUP 2DNWA 2XXMA 1M1KQ 2K0DX 5F2KA 2PEKA 1DNYA 2Z46A 4H2XC 4BPFA 2K0XA 5F2NA 1Q86Q 1M74A 2JQ4A 5EJDA 3CXCO 5BS1A 2VLPA 3CCLP 2L22A 2K5XA 1RO0A 1VQKP 2KGCA 1FR2A 1K30A 3Q20A 1E6JP 2EIAA 1Q82Q 4R0MA 2PEIA 2AVAA 4IPYA 5HGLA 2KOQA 2XV6A 2XZ1C 1A43A 1D1DA 3VRLC 2CGQA 1A8OA 2XZ0D 2MR7A 2JGPA 2MY5A 2OARA 3H4EA 3M1MA 2L0QA 3OW2O 4DG9A 2K2QA 3DS4A 3NTEA 3I56P 2MF4A 5HGMA 3EJDA 3P05A 1VQPP 5DCKA 2PNGA 4XROA 5HGNA 3CCRP 4XFZA 4GR6A 4BPHA 4QKOA 1HY8A 2CNRA 4IZ6A 3NY7B 4PXHB 4XFYA 2FQ0A 2QEXP 2GZGA 1QRJA 1BAJA 1VQ6P 3G6EP 2KGEA 2MVUA 1M90Q 3G71P 4M0IA 2FVFA 2LL8A 2PY8A 2XT1A 1Q81Q 4COPA 4XRQA 2GZIA 1N8RQ 3G0VA 2LIWA 2VLNA 2KG8A 1VQOP 2N50A 2JO0A 1Z6MA 2LOLA 1VQNP 2K94A 1UJZA 2N98A 2K93A 2VSQA 2KGAA 1EMVA 3DS0A 3MGEA 2MD9A 2Z45A 5HV8A 4U0BA 3B4QA 1YHQP 5BS2A 3CC2P 2X2BA 3GZLA 4UHPB 3CE7A 2MR8A 2FAEA 1RNIA 3G21A 3DS1A 2JYGA 2WPTA 1GPJA 3H0DA 2Z44A 4WYMA 4CA3A 2KGDA 2AFDA 2GYKA 2P9XA 5I4TG 1E0HA 2EG5A 1VHNA 2FADA 3CCVP 2LF4A 3CCJP 2LKIA 4NEOA 1YI2P 4U0CA 2JB0A 2L6EA 4PWVB 2KG6A 1VQMP 5KP6B 2CQ8A 1IMQA 2M5RA 1GXGA 3CMAP 1K9MQ 3GKLC 3DTJA 1L0IA 2OTLP 2LIUA 2LMLA 1HQBA 1RO2A 3G1IA 3LMOA 3RG2A 2JAZA 1AUMA 4PH0A 1KQSO 3CCEP 1EOQA 1F80D 1YIJP 4QNBA 2BUOA 2KOSA 2MVVA 2PENA 4XFXA 2VLOA 2M8LA 5JPAA 1QVGO 2QNWA 2DGYA 1AF8A 1Q7YQ 2EFJA 3CD6P 2E1MA 1KLPA 1YJNP 1BXIA 1EIAA 5HGOA 5EW5E 2JYLA 3U43A 3GJNA 3G4SP 2FHSC 2PEOA 3G26A 2QA4P 2L9FA 2M8PA 2KODA 2EHSA 2LPKA 4COCA 1ZNVA 1GXHA 3E2DA 4U0EA 1KC8Q 1K8AQ 1M6EX 5F2OA 2N5HA 3I55P 2N6ZA 2OTJP 2KG9A 4HKGA 2VLQA 2NO8A 2PEMA 2PEJA 3CCSP 2ONTA 2JU1A 3EJEA 4GR2A 7CEIA 1KD1Q 2FVEA 1VQ5P 1ZMBA 2KORA 5HVCA 4H2WC 2KWLA 3CPWO 1M6NA 2N6YA 4U0AA 1NQ4A 2JBGA 2PEQA 3DS3A 1W2BO 5KP8B 4F37A 3HZQA 2FVAA 4U0DA 2CWOA 3DS2A 3CC7P 1AYIA 3RG6C 4H2YC 1VQ7P 2LTEA 2N5IA 1QVFO 5CZDB 2AF8A 3CCMP 1VKUA 2EHTA 2KR5A 3EJBA 2ERHA 3CCQP 4BPGA 2GDYA
chains in the Genus database with same CATH topology
2KGCA 2MD9A 2KW2A 1KLPA 5HV8A 2K92A 4R0MA 2AVAA 2AFEA 2X2BA 3GZLA 2K0YA 2KOQA 3CE7A 2FHSC 2XZ1C 2MR8A 2FAEA 2L9FA 2CGQA 2XZ0D 2EHSA 2MR7A 2CG5B 2LPKA 2JGPA 2MY5A 2GDXA 2L0QA 4DG9A 1ACPA 4MRTC 2FACA 2K2QA 4CA3A 2MF4A 2KGDA 3EJDA 2AFDA 1T8KA 2KOOA 2PNGA 2FADA 2N5HA 2N6ZA 2KG9A 2LKIA 4HKGA 2GDWA 4NEOA 2L4BA 4BPHA 1HY8A 2CNRA 4IZ6A 3NY7B 4PXHB 2JU1A 3EJEA 2FQ0A 1L0HA 2FQ2A 2FVEA 1X3OA 2KG6A 4PWVB 5KP6B 2CQ8A 2M5RA 2JU2A 2KORA 5HVCA 4H2WC 5KP7B 2KWLA 2KGEA 2MVUA 2ROQA 2N6YA 1DV5A 1OR5A 1L0IA 2FQ1A 2LIUA 1NQ4A 2KOPA 5KP8B 2LMLA 2FVFA 2LL8A 1HQBA 3GZMA 2FVAA 2DNWA 3LMOA 2LIWA 3RG2A 4H2YC 2KG8A 1DNYA 2N50A 4H2XC 2LTEA 2N5IA 2K0XA 4BPFA 5CZDB 2AF8A 1VKUA 2LOLA 2JQ4A 5EJDA 2K94A 1F80D 2EHTA 2KR5A 2N98A 2K93A 3EJBA 2KOSA 2MVVA 2VSQA 2KGAA 2L22A 2QNWA 4BPGA 1AF8A 2GDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGC A;  2MD9 A;  2KW2 A;  1KLP A;  5HV8 A;  2K92 A;  4R0M A;  2AVA A;  2AFE A;  2X2B A;  3GZL A;  2K0Y A;  2KOQ A;  3CE7 A;  2FHS C;  2XZ1 C;  2MR8 A;  2FAE A;  2L9F A;  2CGQ A;  2XZ0 D;  2EHS A;  2MR7 A;  2CG5 B;  2LPK A;  2JGP A;  2MY5 A;  2GDX A;  2L0Q A;  4DG9 A;  1ACP A;  4MRT C;  2FAC A;  2K2Q A;  4CA3 A;  2MF4 A;  2KGD A;  3EJD A;  2AFD A;  1T8K A;  2KOO A;  2PNG A;  2FAD A;  2N5H A;  2N6Z A;  2KG9 A;  2LKI A;  4HKG A;  2GDW A;  4NEO A;  2L4B A;  4BPH A;  1HY8 A;  2CNR A;  4IZ6 A;  3NY7 B;  4PXH B;  2JU1 A;  3EJE A;  2FQ0 A;  1L0H A;  2FQ2 A;  2FVE A;  1X3O A;  2KG6 A;  4PWV B;  5KP6 B;  2CQ8 A;  2M5R A;  2JU2 A;  2KOR A;  5HVC A;  4H2W C;  5KP7 B;  2KWL A;  2KGE A;  2MVU A;  2ROQ A;  2N6Y A;  1DV5 A;  1OR5 A;  1L0I A;  2FQ1 A;  2LIU A;  1NQ4 A;  2KOP A;  5KP8 B;  2LML A;  2FVF A;  2LL8 A;  1HQB A;  3GZM A;  2FVA A;  2DNW A;  3LMO A;  2LIW A;  3RG2 A;  4H2Y C;  2KG8 A;  1DNY A;  2N50 A;  4H2X C;  2LTE A;  2N5I A;  2K0X A;  4BPF A;  5CZD B;  2AF8 A;  1VKU A;  2LOL A;  2JQ4 A;  5EJD A;  2K94 A;  1F80 D;  2EHT A;  2KR5 A;  2N98 A;  2K93 A;  3EJB A;  2KOS A;  2MVV A;  2VSQ A;  2KGA A;  2L22 A;  2QNW A;  4BPG A;  1AF8 A;  2GDY A; 
#chains in the Genus database with same CATH topology
 1YJ9 P;  1VQ8 P;  2KW2 A;  1MZ8 A;  1YJW P;  2K92 A;  1IUQ A;  2AFE A;  3G28 A;  2BHV A;  1CEI A;  2K0Y A;  1VQ4 P;  2CG5 B;  1NJI Q;  2GZE A;  2GZF A;  1IMP A;  2GDX A;  3H47 A;  1ACP A;  1YIT P;  1VQL P;  4MRT C;  2FAC A;  2M8N A;  3HYB A;  3G1G A;  1UNK A;  3CC4 P;  3DPH A;  1T8K A;  2KOO A;  4U0F A;  1JJ2 O;  3DS5 A;  1VQ9 P;  4PH1 A;  2GDW A;  2L4B A;  1L0H A;  2FQ2 A;  1X3O A;  2GZJ A;  3G29 A;  2JU2 A;  1S72 P;  5KP7 B;  3CME P;  2ROQ A;  1DV5 A;  1OR5 A;  1K73 Q;  2FQ1 A;  2KOP A;  3WBH A;  3LRY A;  3B5I A;  3GZM A;  3CCU P;  2DNW A;  2XXM A;  1M1K Q;  2K0D X;  5F2K A;  2PEK A;  1DNY A;  2Z46 A;  4H2X C;  4BPF A;  2K0X A;  5F2N A;  1Q86 Q;  1M74 A;  2JQ4 A;  5EJD A;  3CXC O;  5BS1 A;  2VLP A;  3CCL P;  2L22 A;  2K5X A;  1RO0 A;  1VQK P;  2KGC A;  1FR2 A;  1K30 A;  3Q20 A;  1E6J P;  2EIA A;  1Q82 Q;  4R0M A;  2PEI A;  2AVA A;  4IPY A;  5HGL A;  2KOQ A;  2XV6 A;  2XZ1 C;  1A43 A;  1D1D A;  3VRL C;  2CGQ A;  1A8O A;  2XZ0 D;  2MR7 A;  2JGP A;  2MY5 A;  2OAR A;  3H4E A;  3M1M A;  2L0Q A;  3OW2 O;  4DG9 A;  2K2Q A;  3DS4 A;  3NTE A;  3I56 P;  2MF4 A;  5HGM A;  3EJD A;  3P05 A;  1VQP P;  5DCK A;  2PNG A;  4XRO A;  5HGN A;  3CCR P;  4XFZ A;  4GR6 A;  4BPH A;  4QKO A;  1HY8 A;  2CNR A;  4IZ6 A;  3NY7 B;  4PXH B;  4XFY A;  2FQ0 A;  2QEX P;  2GZG A;  1QRJ A;  1BAJ A;  1VQ6 P;  3G6E P;  2KGE A;  2MVU A;  1M90 Q;  3G71 P;  4M0I A;  2FVF A;  2LL8 A;  2PY8 A;  2XT1 A;  1Q81 Q;  4COP A;  4XRQ A;  2GZI A;  1N8R Q;  3G0V A;  2LIW A;  2VLN A;  2KG8 A;  1VQO P;  2N50 A;  2JO0 A;  1Z6M A;  2LOL A;  1VQN P;  2K94 A;  1UJZ A;  2N98 A;  2K93 A;  2VSQ A;  2KGA A;  1EMV A;  3DS0 A;  3MGE A;  2MD9 A;  2Z45 A;  5HV8 A;  4U0B A;  3B4Q A;  1YHQ P;  5BS2 A;  3CC2 P;  2X2B A;  3GZL A;  4UHP B;  3CE7 A;  2MR8 A;  2FAE A;  1RNI A;  3G21 A;  3DS1 A;  2JYG A;  2WPT A;  1GPJ A;  3H0D A;  2Z44 A;  4WYM A;  4CA3 A;  2KGD A;  2AFD A;  2GYK A;  2P9X A;  5I4T G;  1E0H A;  2EG5 A;  1VHN A;  2FAD A;  3CCV P;  2LF4 A;  3CCJ P;  2LKI A;  4NEO A;  1YI2 P;  4U0C A;  2JB0 A;  2L6E A;  4PWV B;  2KG6 A;  1VQM P;  5KP6 B;  2CQ8 A;  1IMQ A;  2M5R A;  1GXG A;  3CMA P;  1K9M Q;  3GKL C;  3DTJ A;  1L0I A;  2OTL P;  2LIU A;  2LML A;  1HQB A;  1RO2 A;  3G1I A;  3LMO A;  3RG2 A;  2JAZ A;  1AUM A;  4PH0 A;  1KQS O;  3CCE P;  1EOQ A;  1F80 D;  1YIJ P;  4QNB A;  2BUO A;  2KOS A;  2MVV A;  2PEN A;  4XFX A;  2VLO A;  2M8L A;  5JPA A;  1QVG O;  2QNW A;  2DGY A;  1AF8 A;  1Q7Y Q;  2EFJ A;  3CD6 P;  2E1M A;  1KLP A;  1YJN P;  1BXI A;  1EIA A;  5HGO A;  5EW5 E;  2JYL A;  3U43 A;  3GJN A;  3G4S P;  2FHS C;  2PEO A;  3G26 A;  2QA4 P;  2L9F A;  2M8P A;  2KOD A;  2EHS A;  2LPK A;  4COC A;  1ZNV A;  1GXH A;  3E2D A;  4U0E A;  1KC8 Q;  1K8A Q;  1M6E X;  5F2O A;  2N5H A;  3I55 P;  2N6Z A;  2OTJ P;  2KG9 A;  4HKG A;  2VLQ A;  2NO8 A;  2PEM A;  2PEJ A;  3CCS P;  2ONT A;  2JU1 A;  3EJE A;  4GR2 A;  7CEI A;  1KD1 Q;  2FVE A;  1VQ5 P;  1ZMB A;  2KOR A;  5HVC A;  4H2W C;  2KWL A;  3CPW O;  1M6N A;  2N6Y A;  4U0A A;  1NQ4 A;  2JBG A;  2PEQ A;  3DS3 A;  1W2B O;  5KP8 B;  4F37 A;  3HZQ A;  2FVA A;  4U0D A;  2CWO A;  3DS2 A;  3CC7 P;  1AYI A;  3RG6 C;  4H2Y C;  1VQ7 P;  2LTE A;  2N5I A;  1QVF O;  5CZD B;  2AF8 A;  3CCM P;  1VKU A;  2EHT A;  2KR5 A;  3EJB A;  2ERH A;  3CCQ P;  4BPG A;  2GDY A; 
#chains in the Genus database with same CATH homology
 2KGC A;  2MD9 A;  2KW2 A;  1KLP A;  5HV8 A;  2K92 A;  4R0M A;  2AVA A;  2AFE A;  2X2B A;  3GZL A;  2K0Y A;  2KOQ A;  3CE7 A;  2FHS C;  2XZ1 C;  2MR8 A;  2FAE A;  2L9F A;  2CGQ A;  2XZ0 D;  2EHS A;  2MR7 A;  2CG5 B;  2LPK A;  2JGP A;  2MY5 A;  2GDX A;  2L0Q A;  4DG9 A;  1ACP A;  4MRT C;  2FAC A;  2K2Q A;  4CA3 A;  2MF4 A;  2KGD A;  3EJD A;  2AFD A;  1T8K A;  2KOO A;  2PNG A;  2FAD A;  2N5H A;  2N6Z A;  2KG9 A;  2LKI A;  4HKG A;  2GDW A;  4NEO A;  2L4B A;  4BPH A;  1HY8 A;  2CNR A;  4IZ6 A;  3NY7 B;  4PXH B;  2JU1 A;  3EJE A;  2FQ0 A;  1L0H A;  2FQ2 A;  2FVE A;  1X3O A;  2KG6 A;  4PWV B;  5KP6 B;  2CQ8 A;  2M5R A;  2JU2 A;  2KOR A;  5HVC A;  4H2W C;  5KP7 B;  2KWL A;  2KGE A;  2MVU A;  2ROQ A;  2N6Y A;  1DV5 A;  1OR5 A;  1L0I A;  2FQ1 A;  2LIU A;  1NQ4 A;  2KOP A;  5KP8 B;  2LML A;  2FVF A;  2LL8 A;  1HQB A;  3GZM A;  2FVA A;  2DNW A;  3LMO A;  2LIW A;  3RG2 A;  4H2Y C;  2KG8 A;  1DNY A;  2N50 A;  4H2X C;  2LTE A;  2N5I A;  2K0X A;  4BPF A;  5CZD B;  2AF8 A;  1VKU A;  2LOL A;  2JQ4 A;  5EJD A;  2K94 A;  1F80 D;  2EHT A;  2KR5 A;  2N98 A;  2K93 A;  3EJB A;  2KOS A;  2MVV A;  2VSQ A;  2KGA A;  2L22 A;  2QNW A;  4BPG A;  1AF8 A;  2GDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...