2DNWA

Solution structure of rsgi ruh-059, an acp domain of acyl carrier protein, mitochondrial [precursor] from human cdna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-059, an ACP domain of acyl carrier protein, mitochondrial [Precursor] from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Acyl carrier protein
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2dnwA00
2FAEA 2JU1A 5HV8A 2L9FA 2MD9A 5KP7B 2AVAA 2MR7A 2AFDA 2GDYA 1ACPA 2CQ8A 4H2WC 2QNWA 2FVEA 3EJDA 2JGPA 5CZDB 3GZMA 1KLPA 2FADA 2LKIA 1L0HA 2XZ0D 4PWVB 2K0XA 2KG9A 2KW2A 2LIWA 2LMLA 2L22A 3GZLA 3RG2A 2GDWA 1T8KA 2CNRA 2KOSA 2FQ1A 4H2XC 3LMOA 1AF8A 1F80D 2KGDA 2K2QA 4BPFA 2KOOA 2CGQA 4IZ6A 2KOPA 1L0IA 2VSQA 2N5IA 2FACA 2N6YA 2N6ZA 2LIUA 2FQ0A 2KORA 2PNGA 4H2YC 2K92A 2ROQA 3EJBA 2MF4A 2FHSC 2LL8A 2KGCA 4R0MA 2JQ4A 2N98A 2KR5A 4PXHB 2DNWA 4NEOA 1HQBA 2GDXA 2KG6A 2MVVA 4BPHA 1X3OA 2K0YA 2FQ2A 2K93A 4MRTC 2JU2A 2L0QA 2XZ1C 5KP8B 2KGAA 2L4BA 1OR5A 2KGEA 3NY7B 4BPGA 1NQ4A 2MVUA 2AF8A 2FVAA 4DG9A 2KOQA 2N5HA 2LPKA 2FVFA 2CG5B 2X2BA 1VKUA 1HY8A 5EJDA 2EHSA 1DNYA 3CE7A 4CA3A 2AFEA 4HKGA 2K94A 2LOLA 2LTEA 5HVCA 2N50A 2M5RA 1DV5A 2KWLA 5KP6B 3EJEA 2MY5A 2EHTA 2KG8A 2MR8A
chains in the Genus database with same CATH superfamily
2L9FA 5KP7B 3CMAP 1YI2P 1E0HA 2XXMA 1FR2A 2JGPA 3Q20A 1L0HA 3CCLP 1M90Q 1T8KA 3DS1A 4QKOA 2ERHA 1EMVA 1BXIA 1M6EX 3G4SP 3CCMP 3CC2P 3G26A 1L0IA 4GR2A 4U0EA 4U0FA 2N6YA 2PNGA 2LIUA 2KORA 3G1GA 2PEOA 2MF4A 2KGCA 2VLPA 2BHVA 4XRQA 1A43A 2KR5A 1KC8Q 1UJZA 7CEIA 2DNWA 2VLQA 1VQ6P 3M1MA 4MRTC 1VHNA 3G71P 2GZFA 2GYKA 3NY7B 2Z45A 4DG9A 3CC4P 2CG5B 2QA4P 1DNYA 3CE7A 1Q7YQ 4HKGA 3CCRP 2M5RA 2KWLA 1AYIA 5KP6B 3EJEA 4PH0A 4UHPB 1KQSO 2EHTA 2EFJA 4U0AA 2JU1A 2JBGA 4U0DA 2AFDA 1GXHA 1A8OA 3DTJA 4H2WC 2QNWA 2FVEA 1YHQP 3EJDA 3B5IA 5JPAA 2PEKA 1KLPA 1Q81Q 1E6JP 2JYGA 2PENA 4PWVB 4M0IA 2GZJA 3DS2A 3RG2A 2KOSA 1YITP 2CWOA 3U43A 4H2XC 1K9MQ 1VQ9P 3G21A 2KGDA 2NO8A 2K2QA 1D1DA 3DS0A 2N5IA 2FACA 1VQ7P 3EJBA 1UNKA 5I4TG 2OTJP 2OARA 4NEOA 2K0DX 1HQBA 3I55P 2XT1A 3GJNA 2GZGA 3E2DA 3H47A 5HGLA 2K0YA 2JO0A 2K93A 5DCKA 2KGAA 2L4BA 1YJ9P 2KGEA 1VQLP 4BPGA 2KOQA 4U0BA 2LPKA 2X2BA 2JAZA 1GXGA 2GZIA 1W2BO 3OW2O 2JYLA 2AFEA 2LOLA 2OTLP 4U0CA 1DV5A 2M8NA 2GZEA 2KG8A 2KODA 1VQNP 1RNIA 4QNBA 2PEMA 2MD9A 3DS5A 2AVAA 2MR7A 1Z6MA 5HGOA 2GDYA 2QEXP 2EIAA 2CQ8A 5HGMA 2BUOA 2LF4A 5CZDB 1AUMA 3GZMA 5HGNA 5F2KA 1VQ5P 2FADA 2LKIA 2PEIA 2XZ0D 2K0XA 2KG9A 2KW2A 2LMLA 1K30A 3GZLA 2GDWA 2CNRA 3NTEA 1YJWP 1CEIA 1ZMBA 1QVGO 4IPYA 1VQPP 2L6EA 1F80D 3RG6C 1IUQA 5BS1A 2CGQA 4IZ6A 1M6NA 2N6ZA 2K92A 1ZNVA 2EG5A 2Z46A 2FHSC 4R0MA 2M8LA 2JQ4A 2ONTA 2PEJA 3CD6P 4GR6A 3P05A 1EIAA 2GDXA 3LRYA 4BPHA 4COCA 3CCJP 1QRJA 1RO2A 2JU2A 2XZ1C 1M74A 1GPJA 4XROA 1OR5A 1NQ4A 3H4EA 3DS3A 2N5HA 3G28A 1VKUA 1HY8A 5EJDA 3G29A 2EHSA 3GKLC 3MGEA 4CA3A 4WYMA 3B4QA 2LTEA 2N50A 3G0VA 3CCSP 1VQMP 1JJ2O 2MY5A 3CCQP 4PH1A 3I56P 2MR8A 2FAEA 2JB0A 5HV8A 1N8RQ 2XV6A 5EW5E 1ACPA 3CPWO 1YJNP 3HYBA 2Z44A 3CMEP 1VQOP 2VLNA 4COPA 2VLOA 3CCEP 3WBHA 2LIWA 1K73Q 2L22A 1BAJA 3G1IA 2FQ1A 5F2NA 3LMOA 1AF8A 4F37A 1NJIQ 4XFYA 1Q86Q 3CXCO 4BPFA 2KOOA 3HZQA 2KOPA 3H0DA 1YIJP 2VSQA 3VRLC 2FQ0A 1QVFO 1EOQA 4H2YC 3CCVP 5F2OA 2ROQA 2LL8A 2PY8A 1VQ8P 2WPTA 3DS4A 2N98A 3CC7P 4PXHB 1RO0A 2KG6A 2MVVA 1X3OA 2FQ2A 1M1KQ 1MZ8A 2DGYA 2L0QA 2PEQA 5KP8B 2E1MA 1K8AQ 5BS2A 3DPHA 2AF8A 2MVUA 2FVAA 1VQ4P 3G6EP 2FVFA 2P9XA 1VQKP 2K5XA 2M8PA 4XFZA 1KD1Q 2K94A 1IMQA 5HVCA 3CCUP 1IMPA 4XFXA 1Q82Q 1S72P
chains in the Genus database with same CATH topology
2FAEA 2JU1A 5HV8A 2L9FA 2MD9A 5KP7B 2AVAA 2MR7A 2AFDA 2GDYA 1ACPA 2CQ8A 4H2WC 2QNWA 2FVEA 3EJDA 2JGPA 5CZDB 3GZMA 1KLPA 2FADA 2LKIA 1L0HA 2XZ0D 4PWVB 2K0XA 2KG9A 2KW2A 2LIWA 2LMLA 2L22A 3GZLA 3RG2A 2GDWA 1T8KA 2CNRA 2KOSA 2FQ1A 4H2XC 3LMOA 1AF8A 1F80D 2KGDA 2K2QA 4BPFA 2KOOA 2CGQA 4IZ6A 2KOPA 1L0IA 2VSQA 2N5IA 2FACA 2N6YA 2N6ZA 2LIUA 2FQ0A 2KORA 2PNGA 4H2YC 2K92A 2ROQA 3EJBA 2MF4A 2FHSC 2LL8A 2KGCA 4R0MA 2JQ4A 2N98A 2KR5A 4PXHB 2DNWA 4NEOA 1HQBA 2GDXA 2KG6A 2MVVA 4BPHA 1X3OA 2K0YA 2FQ2A 2K93A 4MRTC 2JU2A 2L0QA 2XZ1C 5KP8B 2KGAA 2L4BA 1OR5A 2KGEA 3NY7B 4BPGA 1NQ4A 2MVUA 2AF8A 2FVAA 4DG9A 2KOQA 2N5HA 2LPKA 2FVFA 2CG5B 2X2BA 1VKUA 1HY8A 5EJDA 2EHSA 1DNYA 3CE7A 4CA3A 2AFEA 4HKGA 2K94A 2LOLA 2LTEA 5HVCA 2N50A 2M5RA 1DV5A 2KWLA 5KP6B 3EJEA 2MY5A 2EHTA 2KG8A 2MR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAE A;  2JU1 A;  5HV8 A;  2L9F A;  2MD9 A;  5KP7 B;  2AVA A;  2MR7 A;  2AFD A;  2GDY A;  1ACP A;  2CQ8 A;  4H2W C;  2QNW A;  2FVE A;  3EJD A;  2JGP A;  5CZD B;  3GZM A;  1KLP A;  2FAD A;  2LKI A;  1L0H A;  2XZ0 D;  4PWV B;  2K0X A;  2KG9 A;  2KW2 A;  2LIW A;  2LML A;  2L22 A;  3GZL A;  3RG2 A;  2GDW A;  1T8K A;  2CNR A;  2KOS A;  2FQ1 A;  4H2X C;  3LMO A;  1AF8 A;  1F80 D;  2KGD A;  2K2Q A;  4BPF A;  2KOO A;  2CGQ A;  4IZ6 A;  2KOP A;  1L0I A;  2VSQ A;  2N5I A;  2FAC A;  2N6Y A;  2N6Z A;  2LIU A;  2FQ0 A;  2KOR A;  2PNG A;  4H2Y C;  2K92 A;  2ROQ A;  3EJB A;  2MF4 A;  2FHS C;  2LL8 A;  2KGC A;  4R0M A;  2JQ4 A;  2N98 A;  2KR5 A;  4PXH B;  2DNW A;  4NEO A;  1HQB A;  2GDX A;  2KG6 A;  2MVV A;  4BPH A;  1X3O A;  2K0Y A;  2FQ2 A;  2K93 A;  4MRT C;  2JU2 A;  2L0Q A;  2XZ1 C;  5KP8 B;  2KGA A;  2L4B A;  1OR5 A;  2KGE A;  3NY7 B;  4BPG A;  1NQ4 A;  2MVU A;  2AF8 A;  2FVA A;  4DG9 A;  2KOQ A;  2N5H A;  2LPK A;  2FVF A;  2CG5 B;  2X2B A;  1VKU A;  1HY8 A;  5EJD A;  2EHS A;  1DNY A;  3CE7 A;  4CA3 A;  2AFE A;  4HKG A;  2K94 A;  2LOL A;  2LTE A;  5HVC A;  2N50 A;  2M5R A;  1DV5 A;  2KWL A;  5KP6 B;  3EJE A;  2MY5 A;  2EHT A;  2KG8 A;  2MR8 A; 
#chains in the Genus database with same CATH topology
 2L9F A;  5KP7 B;  3CMA P;  1YI2 P;  1E0H A;  2XXM A;  1FR2 A;  2JGP A;  3Q20 A;  1L0H A;  3CCL P;  1M90 Q;  1T8K A;  3DS1 A;  4QKO A;  2ERH A;  1EMV A;  1BXI A;  1M6E X;  3G4S P;  3CCM P;  3CC2 P;  3G26 A;  1L0I A;  4GR2 A;  4U0E A;  4U0F A;  2N6Y A;  2PNG A;  2LIU A;  2KOR A;  3G1G A;  2PEO A;  2MF4 A;  2KGC A;  2VLP A;  2BHV A;  4XRQ A;  1A43 A;  2KR5 A;  1KC8 Q;  1UJZ A;  7CEI A;  2DNW A;  2VLQ A;  1VQ6 P;  3M1M A;  4MRT C;  1VHN A;  3G71 P;  2GZF A;  2GYK A;  3NY7 B;  2Z45 A;  4DG9 A;  3CC4 P;  2CG5 B;  2QA4 P;  1DNY A;  3CE7 A;  1Q7Y Q;  4HKG A;  3CCR P;  2M5R A;  2KWL A;  1AYI A;  5KP6 B;  3EJE A;  4PH0 A;  4UHP B;  1KQS O;  2EHT A;  2EFJ A;  4U0A A;  2JU1 A;  2JBG A;  4U0D A;  2AFD A;  1GXH A;  1A8O A;  3DTJ A;  4H2W C;  2QNW A;  2FVE A;  1YHQ P;  3EJD A;  3B5I A;  5JPA A;  2PEK A;  1KLP A;  1Q81 Q;  1E6J P;  2JYG A;  2PEN A;  4PWV B;  4M0I A;  2GZJ A;  3DS2 A;  3RG2 A;  2KOS A;  1YIT P;  2CWO A;  3U43 A;  4H2X C;  1K9M Q;  1VQ9 P;  3G21 A;  2KGD A;  2NO8 A;  2K2Q A;  1D1D A;  3DS0 A;  2N5I A;  2FAC A;  1VQ7 P;  3EJB A;  1UNK A;  5I4T G;  2OTJ P;  2OAR A;  4NEO A;  2K0D X;  1HQB A;  3I55 P;  2XT1 A;  3GJN A;  2GZG A;  3E2D A;  3H47 A;  5HGL A;  2K0Y A;  2JO0 A;  2K93 A;  5DCK A;  2KGA A;  2L4B A;  1YJ9 P;  2KGE A;  1VQL P;  4BPG A;  2KOQ A;  4U0B A;  2LPK A;  2X2B A;  2JAZ A;  1GXG A;  2GZI A;  1W2B O;  3OW2 O;  2JYL A;  2AFE A;  2LOL A;  2OTL P;  4U0C A;  1DV5 A;  2M8N A;  2GZE A;  2KG8 A;  2KOD A;  1VQN P;  1RNI A;  4QNB A;  2PEM A;  2MD9 A;  3DS5 A;  2AVA A;  2MR7 A;  1Z6M A;  5HGO A;  2GDY A;  2QEX P;  2EIA A;  2CQ8 A;  5HGM A;  2BUO A;  2LF4 A;  5CZD B;  1AUM A;  3GZM A;  5HGN A;  5F2K A;  1VQ5 P;  2FAD A;  2LKI A;  2PEI A;  2XZ0 D;  2K0X A;  2KG9 A;  2KW2 A;  2LML A;  1K30 A;  3GZL A;  2GDW A;  2CNR A;  3NTE A;  1YJW P;  1CEI A;  1ZMB A;  1QVG O;  4IPY A;  1VQP P;  2L6E A;  1F80 D;  3RG6 C;  1IUQ A;  5BS1 A;  2CGQ A;  4IZ6 A;  1M6N A;  2N6Z A;  2K92 A;  1ZNV A;  2EG5 A;  2Z46 A;  2FHS C;  4R0M A;  2M8L A;  2JQ4 A;  2ONT A;  2PEJ A;  3CD6 P;  4GR6 A;  3P05 A;  1EIA A;  2GDX A;  3LRY A;  4BPH A;  4COC A;  3CCJ P;  1QRJ A;  1RO2 A;  2JU2 A;  2XZ1 C;  1M74 A;  1GPJ A;  4XRO A;  1OR5 A;  1NQ4 A;  3H4E A;  3DS3 A;  2N5H A;  3G28 A;  1VKU A;  1HY8 A;  5EJD A;  3G29 A;  2EHS A;  3GKL C;  3MGE A;  4CA3 A;  4WYM A;  3B4Q A;  2LTE A;  2N50 A;  3G0V A;  3CCS P;  1VQM P;  1JJ2 O;  2MY5 A;  3CCQ P;  4PH1 A;  3I56 P;  2MR8 A;  2FAE A;  2JB0 A;  5HV8 A;  1N8R Q;  2XV6 A;  5EW5 E;  1ACP A;  3CPW O;  1YJN P;  3HYB A;  2Z44 A;  3CME P;  1VQO P;  2VLN A;  4COP A;  2VLO A;  3CCE P;  3WBH A;  2LIW A;  1K73 Q;  2L22 A;  1BAJ A;  3G1I A;  2FQ1 A;  5F2N A;  3LMO A;  1AF8 A;  4F37 A;  1NJI Q;  4XFY A;  1Q86 Q;  3CXC O;  4BPF A;  2KOO A;  3HZQ A;  2KOP A;  3H0D A;  1YIJ P;  2VSQ A;  3VRL C;  2FQ0 A;  1QVF O;  1EOQ A;  4H2Y C;  3CCV P;  5F2O A;  2ROQ A;  2LL8 A;  2PY8 A;  1VQ8 P;  2WPT A;  3DS4 A;  2N98 A;  3CC7 P;  4PXH B;  1RO0 A;  2KG6 A;  2MVV A;  1X3O A;  2FQ2 A;  1M1K Q;  1MZ8 A;  2DGY A;  2L0Q A;  2PEQ A;  5KP8 B;  2E1M A;  1K8A Q;  5BS2 A;  3DPH A;  2AF8 A;  2MVU A;  2FVA A;  1VQ4 P;  3G6E P;  2FVF A;  2P9X A;  1VQK P;  2K5X A;  2M8P A;  4XFZ A;  1KD1 Q;  2K94 A;  1IMQ A;  5HVC A;  3CCU P;  1IMP A;  4XFX A;  1Q82 Q;  1S72 P; 
#chains in the Genus database with same CATH homology
 2FAE A;  2JU1 A;  5HV8 A;  2L9F A;  2MD9 A;  5KP7 B;  2AVA A;  2MR7 A;  2AFD A;  2GDY A;  1ACP A;  2CQ8 A;  4H2W C;  2QNW A;  2FVE A;  3EJD A;  2JGP A;  5CZD B;  3GZM A;  1KLP A;  2FAD A;  2LKI A;  1L0H A;  2XZ0 D;  4PWV B;  2K0X A;  2KG9 A;  2KW2 A;  2LIW A;  2LML A;  2L22 A;  3GZL A;  3RG2 A;  2GDW A;  1T8K A;  2CNR A;  2KOS A;  2FQ1 A;  4H2X C;  3LMO A;  1AF8 A;  1F80 D;  2KGD A;  2K2Q A;  4BPF A;  2KOO A;  2CGQ A;  4IZ6 A;  2KOP A;  1L0I A;  2VSQ A;  2N5I A;  2FAC A;  2N6Y A;  2N6Z A;  2LIU A;  2FQ0 A;  2KOR A;  2PNG A;  4H2Y C;  2K92 A;  2ROQ A;  3EJB A;  2MF4 A;  2FHS C;  2LL8 A;  2KGC A;  4R0M A;  2JQ4 A;  2N98 A;  2KR5 A;  4PXH B;  2DNW A;  4NEO A;  1HQB A;  2GDX A;  2KG6 A;  2MVV A;  4BPH A;  1X3O A;  2K0Y A;  2FQ2 A;  2K93 A;  4MRT C;  2JU2 A;  2L0Q A;  2XZ1 C;  5KP8 B;  2KGA A;  2L4B A;  1OR5 A;  2KGE A;  3NY7 B;  4BPG A;  1NQ4 A;  2MVU A;  2AF8 A;  2FVA A;  4DG9 A;  2KOQ A;  2N5H A;  2LPK A;  2FVF A;  2CG5 B;  2X2B A;  1VKU A;  1HY8 A;  5EJD A;  2EHS A;  1DNY A;  3CE7 A;  4CA3 A;  2AFE A;  4HKG A;  2K94 A;  2LOL A;  2LTE A;  5HVC A;  2N50 A;  2M5R A;  1DV5 A;  2KWL A;  5KP6 B;  3EJE A;  2MY5 A;  2EHT A;  2KG8 A;  2MR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...