4QKOA

The crystal structure of the pyocin s2 nuclease domain, immunity protein complex at 1.8 angstroms
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
MKSKISEYTEKEFLEFVKDIYTNNKKKFPTEESHIQAVLEFKKLTEHPSGSDLLYYPNENREDSPAGVVKEVKEWRASKGLPGFKAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Pyocin-S2 immunity protein
publication title Structural Insights into pyocin S2
rcsb
source organism Pseudomonas aeruginosa
total genus 30
structure length 87
sequence length 87
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4qkoA00
1GXGA 2VLNA 1UNKA 2JBGA 4QKOA 7CEIA 2ERHA 5EW5E 3GKLC 2JB0A 2GYKA 1UJZA 1EMVA 1FR2A 2JAZA 2VLPA 2VLQA 2K5XA 3GJNA 2GZIA 1CEIA 2GZGA 4UHPB 4F37A 3U43A 1AYIA 2NO8A 1IMPA 2K0DX 1E0HA 2GZEA 1BXIA 2VLOA 1ZNVA 1IMQA 1MZ8A 2WPTA 1GXHA 2GZFA 2GZJA
chains in the Genus database with same CATH superfamily
2KW2A 2N6ZA 4COCA 1Q86Q 2E1MA 1VHNA 2JAZA 2KODA 1A43A 1HQBA 2FHSC 2LOLA 5CZDB 3OW2O 1M1KQ 2FVAA 3DTJA 3NY7B 7CEIA 2K0YA 2CQ8A 3CCMP 2MR8A 1YI2P 5HV8A 3G6EP 3G28A 2GDYA 3DS5A 1YHQP 2QA4P 2N5IA 1IMQA 3HZQA 1GXHA 2X2BA 4GR6A 1VQ5P 3WBHA 2JU1A 3P05A 1Q81Q 1M6NA 2KOOA 3H47A 2GDWA 2GZGA 3DS3A 5HGLA 2M8NA 4U0FA 1OR5A 2JQ4A 1GXGA 1UNKA 1GPJA 2BHVA 2VSQA 3EJDA 3CC4P 2MVVA 1QRJA 2K94A 1FR2A 1VQKP 2GZIA 1CEIA 2K0XA 2LL8A 1QVFO 1AUMA 2CGQA 3EJEA 3G4SP 4IZ6A 3G29A 1NQ4A 1DV5A 2N50A 4XFZA 3G1GA 2FVFA 2VLNA 4MRTC 2KGDA 1EIAA 4PWVB 4XFXA 1UJZA 2PEKA 2K92A 3GJNA 2EIAA 2JO0A 3LRYA 1KQSO 1YITP 1VQ6P 1F80D 1RO0A 2JYLA 2GYKA 5EJDA 1QVGO 3B4QA 1VQ8P 2NO8A 2DGYA 1M90Q 2LF4A 2Z45A 3G0VA 1D1DA 2BUOA 4PH1A 2Z44A 2KR5A 1L0IA 1X3OA 2JYGA 2KG8A 3LMOA 5F2KA 2MVUA 2CG5B 2K0DX 3M1MA 1YJNP 1M6EX 2L22A 3CD6P 1BXIA 2FACA 1BAJA 1YJ9P 2KG6A 4U0BA 5HGNA 2LIUA 2PNGA 3CC7P 2LKIA 1Q7YQ 1N8RQ 2LTEA 1VQ4P 4U0CA 1Q82Q 2JGPA 2KOQA 3DS1A 1E6JP 3CCSP 2PEJA 1AF8A 4WYMA 2FAEA 2KORA 1VQOP 2L6EA 1A8OA 2OTJP 2LIWA 2LPKA 4M0IA 2PEMA 2KGEA 2L4BA 3CCQP 1VKUA 2KGCA 2FQ0A 2XXMA 3CCVP 1NJIQ 2VLPA 3CE7A 4XRQA 4CA3A 4XFYA 1M74A 1VQMP 1VQ9P 1T8KA 1E0HA 2JU2A 2QEXP 3CCEP 5KP8B 4PXHB 2WPTA 2N5HA 2XT1A 2GZFA 3GZMA 3GZLA 2EG5A 2GDXA 1RO2A 5JPAA 2ERHA 2FQ2A 1KD1Q 2FVEA 3RG6C 3CXCO 1EMVA 3E2DA 1YIJP 3EJBA 1K9MQ 3DS0A 4BPFA 2K2QA 1MZ8A 3DS2A 4DG9A 2AFDA 3CMEP 1L0HA 5HVCA 1Z6MA 2PEIA 5EW5E 1S72P 1HY8A 2PENA 1IMPA 1ZNVA 3CPWO 4QNBA 5HGMA 2N98A 4COPA 2JB0A 2K93A 4NEOA 3G26A 2VLQA 3B5IA 3CCJP 2OTLP 2EHTA 4U0EA 2GZEA 2KGAA 3G1IA 2MY5A 3HYBA 1RNIA 1ZMBA 2KOSA 1VQPP 3H0DA 2FQ1A 2GZJA 2PY8A 3MGEA 2JBGA 3G71P 4QKOA 2CNRA 4BPHA 2M8LA 4H2YC 4HKGA 2K5XA 4BPGA 1DNYA 3DPHA 2AFEA 2XZ0D 2PEOA 1VQLP 4R0MA 2CWOA 4IPYA 2ONTA 1KLPA 1YJWP 4PH0A 1EOQA 1VQNP 3GKLC 3CCLP 3CCRP 2LMLA 3DS4A 2KG9A 3G21A 2EHSA 5I4TG 1AYIA 5BS2A 5DCKA 2EFJA 3VRLC 2ROQA 2XV6A 3Q20A 5KP7B 2M5RA 1K73Q 2L0QA 5BS1A 4U0DA 5F2NA 2AF8A 5F2OA 1ACPA 1K30A 2MR7A 1VQ7P 2QNWA 3CC2P 2L9FA 2MF4A 3H4EA 4F37A 1K8AQ 3U43A 5HGOA 3I55P 2KWLA 4U0AA 1IUQA 2KOPA 2P9XA 2PEQA 2N6YA 2AVAA 3CMAP 3I56P 2MD9A 4H2XC 2FADA 4XROA 2Z46A 4H2WC 2M8PA 4GR2A 2XZ1C 4UHPB 2OARA 3NTEA 3RG2A 1W2BO 1KC8Q 5KP6B 2DNWA 2VLOA 1JJ2O 3CCUP
chains in the Genus database with same CATH topology
1GXGA 2VLNA 1UNKA 2JBGA 4QKOA 7CEIA 2ERHA 5EW5E 3GKLC 2JB0A 2GYKA 1UJZA 1EMVA 1FR2A 2JAZA 2VLPA 2VLQA 2K5XA 3GJNA 2GZIA 1CEIA 2GZGA 4UHPB 4F37A 3U43A 1AYIA 2NO8A 1IMPA 2K0DX 1E0HA 2GZEA 1BXIA 2VLOA 1ZNVA 1IMQA 1MZ8A 2WPTA 1GXHA 2GZFA 2GZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXG A;  2VLN A;  1UNK A;  2JBG A;  4QKO A;  7CEI A;  2ERH A;  5EW5 E;  3GKL C;  2JB0 A;  2GYK A;  1UJZ A;  1EMV A;  1FR2 A;  2JAZ A;  2VLP A;  2VLQ A;  2K5X A;  3GJN A;  2GZI A;  1CEI A;  2GZG A;  4UHP B;  4F37 A;  3U43 A;  1AYI A;  2NO8 A;  1IMP A;  2K0D X;  1E0H A;  2GZE A;  1BXI A;  2VLO A;  1ZNV A;  1IMQ A;  1MZ8 A;  2WPT A;  1GXH A;  2GZF A;  2GZJ A; 
#chains in the Genus database with same CATH topology
 2KW2 A;  2N6Z A;  4COC A;  1Q86 Q;  2E1M A;  1VHN A;  2JAZ A;  2KOD A;  1A43 A;  1HQB A;  2FHS C;  2LOL A;  5CZD B;  3OW2 O;  1M1K Q;  2FVA A;  3DTJ A;  3NY7 B;  7CEI A;  2K0Y A;  2CQ8 A;  3CCM P;  2MR8 A;  1YI2 P;  5HV8 A;  3G6E P;  3G28 A;  2GDY A;  3DS5 A;  1YHQ P;  2QA4 P;  2N5I A;  1IMQ A;  3HZQ A;  1GXH A;  2X2B A;  4GR6 A;  1VQ5 P;  3WBH A;  2JU1 A;  3P05 A;  1Q81 Q;  1M6N A;  2KOO A;  3H47 A;  2GDW A;  2GZG A;  3DS3 A;  5HGL A;  2M8N A;  4U0F A;  1OR5 A;  2JQ4 A;  1GXG A;  1UNK A;  1GPJ A;  2BHV A;  2VSQ A;  3EJD A;  3CC4 P;  2MVV A;  1QRJ A;  2K94 A;  1FR2 A;  1VQK P;  2GZI A;  1CEI A;  2K0X A;  2LL8 A;  1QVF O;  1AUM A;  2CGQ A;  3EJE A;  3G4S P;  4IZ6 A;  3G29 A;  1NQ4 A;  1DV5 A;  2N50 A;  4XFZ A;  3G1G A;  2FVF A;  2VLN A;  4MRT C;  2KGD A;  1EIA A;  4PWV B;  4XFX A;  1UJZ A;  2PEK A;  2K92 A;  3GJN A;  2EIA A;  2JO0 A;  3LRY A;  1KQS O;  1YIT P;  1VQ6 P;  1F80 D;  1RO0 A;  2JYL A;  2GYK A;  5EJD A;  1QVG O;  3B4Q A;  1VQ8 P;  2NO8 A;  2DGY A;  1M90 Q;  2LF4 A;  2Z45 A;  3G0V A;  1D1D A;  2BUO A;  4PH1 A;  2Z44 A;  2KR5 A;  1L0I A;  1X3O A;  2JYG A;  2KG8 A;  3LMO A;  5F2K A;  2MVU A;  2CG5 B;  2K0D X;  3M1M A;  1YJN P;  1M6E X;  2L22 A;  3CD6 P;  1BXI A;  2FAC A;  1BAJ A;  1YJ9 P;  2KG6 A;  4U0B A;  5HGN A;  2LIU A;  2PNG A;  3CC7 P;  2LKI A;  1Q7Y Q;  1N8R Q;  2LTE A;  1VQ4 P;  4U0C A;  1Q82 Q;  2JGP A;  2KOQ A;  3DS1 A;  1E6J P;  3CCS P;  2PEJ A;  1AF8 A;  4WYM A;  2FAE A;  2KOR A;  1VQO P;  2L6E A;  1A8O A;  2OTJ P;  2LIW A;  2LPK A;  4M0I A;  2PEM A;  2KGE A;  2L4B A;  3CCQ P;  1VKU A;  2KGC A;  2FQ0 A;  2XXM A;  3CCV P;  1NJI Q;  2VLP A;  3CE7 A;  4XRQ A;  4CA3 A;  4XFY A;  1M74 A;  1VQM P;  1VQ9 P;  1T8K A;  1E0H A;  2JU2 A;  2QEX P;  3CCE P;  5KP8 B;  4PXH B;  2WPT A;  2N5H A;  2XT1 A;  2GZF A;  3GZM A;  3GZL A;  2EG5 A;  2GDX A;  1RO2 A;  5JPA A;  2ERH A;  2FQ2 A;  1KD1 Q;  2FVE A;  3RG6 C;  3CXC O;  1EMV A;  3E2D A;  1YIJ P;  3EJB A;  1K9M Q;  3DS0 A;  4BPF A;  2K2Q A;  1MZ8 A;  3DS2 A;  4DG9 A;  2AFD A;  3CME P;  1L0H A;  5HVC A;  1Z6M A;  2PEI A;  5EW5 E;  1S72 P;  1HY8 A;  2PEN A;  1IMP A;  1ZNV A;  3CPW O;  4QNB A;  5HGM A;  2N98 A;  4COP A;  2JB0 A;  2K93 A;  4NEO A;  3G26 A;  2VLQ A;  3B5I A;  3CCJ P;  2OTL P;  2EHT A;  4U0E A;  2GZE A;  2KGA A;  3G1I A;  2MY5 A;  3HYB A;  1RNI A;  1ZMB A;  2KOS A;  1VQP P;  3H0D A;  2FQ1 A;  2GZJ A;  2PY8 A;  3MGE A;  2JBG A;  3G71 P;  4QKO A;  2CNR A;  4BPH A;  2M8L A;  4H2Y C;  4HKG A;  2K5X A;  4BPG A;  1DNY A;  3DPH A;  2AFE A;  2XZ0 D;  2PEO A;  1VQL P;  4R0M A;  2CWO A;  4IPY A;  2ONT A;  1KLP A;  1YJW P;  4PH0 A;  1EOQ A;  1VQN P;  3GKL C;  3CCL P;  3CCR P;  2LML A;  3DS4 A;  2KG9 A;  3G21 A;  2EHS A;  5I4T G;  1AYI A;  5BS2 A;  5DCK A;  2EFJ A;  3VRL C;  2ROQ A;  2XV6 A;  3Q20 A;  5KP7 B;  2M5R A;  1K73 Q;  2L0Q A;  5BS1 A;  4U0D A;  5F2N A;  2AF8 A;  5F2O A;  1ACP A;  1K30 A;  2MR7 A;  1VQ7 P;  2QNW A;  3CC2 P;  2L9F A;  2MF4 A;  3H4E A;  4F37 A;  1K8A Q;  3U43 A;  5HGO A;  3I55 P;  2KWL A;  4U0A A;  1IUQ A;  2KOP A;  2P9X A;  2PEQ A;  2N6Y A;  2AVA A;  3CMA P;  3I56 P;  2MD9 A;  4H2X C;  2FAD A;  4XRO A;  2Z46 A;  4H2W C;  2M8P A;  4GR2 A;  2XZ1 C;  4UHP B;  2OAR A;  3NTE A;  3RG2 A;  1W2B O;  1KC8 Q;  5KP6 B;  2DNW A;  2VLO A;  1JJ2 O;  3CCU P; 
#chains in the Genus database with same CATH homology
 1GXG A;  2VLN A;  1UNK A;  2JBG A;  4QKO A;  7CEI A;  2ERH A;  5EW5 E;  3GKL C;  2JB0 A;  2GYK A;  1UJZ A;  1EMV A;  1FR2 A;  2JAZ A;  2VLP A;  2VLQ A;  2K5X A;  3GJN A;  2GZI A;  1CEI A;  2GZG A;  4UHP B;  4F37 A;  3U43 A;  1AYI A;  2NO8 A;  1IMP A;  2K0D X;  1E0H A;  2GZE A;  1BXI A;  2VLO A;  1ZNV A;  1IMQ A;  1MZ8 A;  2WPT A;  1GXH A;  2GZF A;  2GZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...