5EJDA

The crystal structure of holo t3ct
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
b'KQLSTDAERELANIWATVLDIPIGTISASDNFFFRGGHSIDAMKASALGRAAGMSFGVADIFDHPVLSELASVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TqaA
publication title Structural basis of nonribosomal peptide macrocyclization in fungi
pubmed doi rcsb
source organism Penicillium aethiopicum
molecule tags Biosynthetic protein
total genus 23
structure length 75
sequence length 75
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5ejdA00
1HQBA 2MR7A 2L22A 1OR5A 2K93A 1DNYA 2KOPA 3NY7B 1T8KA 2MD9A 2FADA 2K2QA 4BPFA 2FHSC 2PNGA 2X2BA 2CGQA 2KGCA 5KP8B 4BPHA 2N98A 2XZ0D 2GDWA 2AVAA 5KP7B 1L0IA 2K92A 2KGAA 5CZDB 3RG2A 2L4BA 4DG9A 2K94A 2L0QA 1DV5A 2FVAA 2FVEA 5HV8A 2CG5B 2KR5A 2ROQA 3GZMA 2LIUA 2LMLA 2N50A 2FACA 1HY8A 2KOOA 2K0XA 2KOQA 2MVUA 2FQ0A 2CQ8A 2CNRA 2KOSA 2JU1A 2LIWA 2LKIA 2AFEA 3CE7A 1ACPA 2KWLA 2GDYA 2GDXA 2KGDA 2EHTA 2MR8A 2LTEA 2L9FA 4H2YC 2FQ2A 2MF4A 3GZLA 2AF8A 2M5RA 2K0YA 2KG6A 1VKUA 4PWVB 2N5IA 2FVFA 2EHSA 2FAEA 2KW2A 2KG8A 2LOLA 2JQ4A 4R0MA 2VSQA 4H2WC 4CA3A 3EJBA 2KG9A 1X3OA 2KORA 2JGPA 2MVVA 2N6YA 5HVCA 4HKGA 1NQ4A 2MY5A 2QNWA 2AFDA 3EJDA 2LL8A 4H2XC 2N6ZA 3LMOA 5KP6B 1AF8A 2FQ1A 2LPKA 2DNWA 4IZ6A 3EJEA 4PXHB 4NEOA 5EJDA 4MRTC 1L0HA 2N5HA 2KGEA 1KLPA 4BPGA 1F80D 2JU2A 2XZ1C
chains in the Genus database with same CATH superfamily
1K9MQ 5HGMA 4M0IA 2K93A 4U0CA 7CEIA 3NY7B 3G29A 1E0HA 2KGCA 5KP8B 4BPHA 2GDWA 3CMEP 3CCQP 2KGAA 4XFZA 5CZDB 1S72P 1W2BO 5JPAA 2FVAA 2FVEA 2WPTA 2PEQA 2CG5B 2ROQA 2CWOA 2K0DX 3CCRP 1ZMBA 2N50A 2PEKA 1HY8A 2KOOA 2GYKA 2K0XA 1VQ5P 2KOQA 3CCUP 1BXIA 2FQ0A 1RO2A 3M1MA 1BAJA 3OW2O 2JU1A 3LRYA 1VQNP 1UJZA 3CCVP 2GDXA 1UNKA 2EHTA 2JB0A 2MR8A 2LTEA 5F2KA 4H2YC 3GZLA 2M5RA 2K0YA 2EIAA 2KG6A 1VKUA 1VQMP 1Q7YQ 2KW2A 2KG8A 2LOLA 2JQ4A 3G0VA 4H2WC 4CA3A 3DS5A 4U0BA 1X3OA 3H47A 3GKLC 1VQLP 4XFYA 2Z46A 1EOQA 4XFXA 2QNWA 1EIAA 2K5XA 2JBGA 4IPYA 2LL8A 2E1MA 2PEOA 3VRLC 2GZFA 4XRQA 4H2XC 3LMOA 1JJ2O 5KP6B 4GR2A 4XROA 5EW5E 3CCJP 2EG5A 1FR2A 2JU2A 1VQ7P 1HQBA 1YJ9P 1YHQP 3G28A 1CEIA 1NJIQ 2PEIA 1T8KA 4BPFA 2FHSC 4COCA 2JYGA 2P9XA 5F2OA 1L0IA 2L4BA 2ONTA 5HGLA 1Q86Q 1QVFO 3G1IA 5BS1A 2OARA 2Z44A 4QNBA 3G1GA 1YI2P 2JO0A 3GJNA 2LMLA 3U43A 3CXCO 1A8OA 1IUQA 3I56P 2KOSA 1YJNP 1ACPA 2BHVA 2KWLA 1YJWP 1VQKP 2VLQA 1M1KQ 2FQ2A 2GZIA 2AF8A 3DS3A 4R0MA 1Q81Q 1QRJA 3I55P 3EJBA 2OTJP 2JGPA 1YITP 2MVVA 3NTEA 3G21A 1Z6MA 2MY5A 2AFDA 1MZ8A 2N6ZA 1K30A 1VQOP 2LPKA 2DNWA 4U0DA 1E6JP 2N5HA 1F80D 2XZ1C 5I4TG 5BS2A 2DGYA 3CC2P 2X2BA 1K73Q 2N98A 5F2NA 2AVAA 5KP7B 2K92A 4QKOA 3RG2A 3DS4A 4DG9A 4WYMA 3CC4P 3DS2A 5HV8A 1GPJA 2KR5A 2GZJA 3GZMA 4GR6A 2FACA 2PEJA 3CMAP 3CD6P 3CCMP 3CPWO 2LIWA 2AFEA 1QVGO 1VHNA 2VLOA 2MF4A 4PWVB 2N5IA 2FAEA 2VSQA 1KQSO 2KG9A 3G71P 2PY8A 1RO0A 2VLPA 2N6YA 5HVCA 4HKGA 2XT1A 2XXMA 3EJDA 3H0DA 4PH0A 3EJEA 3B5IA 5EJDA 2VLNA 1YIJP 2JAZA 3Q20A 2KGEA 1GXHA 4BPGA 1VQ6P 3CCSP 1VQ8P 2NO8A 5HGOA 4U0EA 1VQ4P 2MR7A 2L22A 1OR5A 3WBHA 1DNYA 2L6EA 2OTLP 2GZGA 2KOPA 1D1DA 5HGNA 2MD9A 2FADA 2K2QA 2PENA 1AYIA 2PNGA 2GZEA 1M6EX 2CGQA 1GXGA 3G6EP 2XZ0D 3HZQA 1EMVA 2ERHA 3DS1A 2PEMA 1VQPP 2M8PA 2K94A 2L0QA 1DV5A 2BUOA 4U0FA 3DTJA 4UHPB 1Q82Q 2LIUA 2JYLA 2Z45A 2MVUA 1AUMA 3P05A 5DCKA 2CQ8A 2CNRA 3B4QA 1M6NA 1M90Q 1KD1Q 2LKIA 3CE7A 1K8AQ 3HYBA 2GDYA 2KGDA 2QA4P 1VQ9P 2XV6A 2M8NA 2L9FA 3DS0A 4U0AA 2QEXP 2FVFA 2EHSA 3H4EA 1KC8Q 1ZNVA 2KORA 2LF4A 1IMPA 1IMQA 3RG6C 3DPHA 1N8RQ 1A43A 1NQ4A 1RNIA 3E2DA 4PH1A 2EFJA 3CCEP 2M8LA 3CCLP 1AF8A 3MGEA 2FQ1A 3G4SP 2KODA 1M74A 4IZ6A 4PXHB 4NEOA 4MRTC 4COPA 1L0HA 3CC7P 1KLPA 3G26A 4F37A
chains in the Genus database with same CATH topology
1HQBA 2MR7A 2L22A 1OR5A 2K93A 1DNYA 2KOPA 3NY7B 1T8KA 2MD9A 2FADA 2K2QA 4BPFA 2FHSC 2PNGA 2X2BA 2CGQA 2KGCA 5KP8B 4BPHA 2N98A 2XZ0D 2GDWA 2AVAA 5KP7B 1L0IA 2K92A 2KGAA 5CZDB 3RG2A 2L4BA 4DG9A 2K94A 2L0QA 1DV5A 2FVAA 2FVEA 5HV8A 2CG5B 2KR5A 2ROQA 3GZMA 2LIUA 2LMLA 2N50A 2FACA 1HY8A 2KOOA 2K0XA 2KOQA 2MVUA 2FQ0A 2CQ8A 2CNRA 2KOSA 2JU1A 2LIWA 2LKIA 2AFEA 3CE7A 1ACPA 2KWLA 2GDYA 2GDXA 2KGDA 2EHTA 2MR8A 2LTEA 2L9FA 4H2YC 2FQ2A 2MF4A 3GZLA 2AF8A 2M5RA 2K0YA 2KG6A 1VKUA 4PWVB 2N5IA 2FVFA 2EHSA 2FAEA 2KW2A 2KG8A 2LOLA 2JQ4A 4R0MA 2VSQA 4H2WC 4CA3A 3EJBA 2KG9A 1X3OA 2KORA 2JGPA 2MVVA 2N6YA 5HVCA 4HKGA 1NQ4A 2MY5A 2QNWA 2AFDA 3EJDA 2LL8A 4H2XC 2N6ZA 3LMOA 5KP6B 1AF8A 2FQ1A 2LPKA 2DNWA 4IZ6A 3EJEA 4PXHB 4NEOA 5EJDA 4MRTC 1L0HA 2N5HA 2KGEA 1KLPA 4BPGA 1F80D 2JU2A 2XZ1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQB A;  2MR7 A;  2L22 A;  1OR5 A;  2K93 A;  1DNY A;  2KOP A;  3NY7 B;  1T8K A;  2MD9 A;  2FAD A;  2K2Q A;  4BPF A;  2FHS C;  2PNG A;  2X2B A;  2CGQ A;  2KGC A;  5KP8 B;  4BPH A;  2N98 A;  2XZ0 D;  2GDW A;  2AVA A;  5KP7 B;  1L0I A;  2K92 A;  2KGA A;  5CZD B;  3RG2 A;  2L4B A;  4DG9 A;  2K94 A;  2L0Q A;  1DV5 A;  2FVA A;  2FVE A;  5HV8 A;  2CG5 B;  2KR5 A;  2ROQ A;  3GZM A;  2LIU A;  2LML A;  2N50 A;  2FAC A;  1HY8 A;  2KOO A;  2K0X A;  2KOQ A;  2MVU A;  2FQ0 A;  2CQ8 A;  2CNR A;  2KOS A;  2JU1 A;  2LIW A;  2LKI A;  2AFE A;  3CE7 A;  1ACP A;  2KWL A;  2GDY A;  2GDX A;  2KGD A;  2EHT A;  2MR8 A;  2LTE A;  2L9F A;  4H2Y C;  2FQ2 A;  2MF4 A;  3GZL A;  2AF8 A;  2M5R A;  2K0Y A;  2KG6 A;  1VKU A;  4PWV B;  2N5I A;  2FVF A;  2EHS A;  2FAE A;  2KW2 A;  2KG8 A;  2LOL A;  2JQ4 A;  4R0M A;  2VSQ A;  4H2W C;  4CA3 A;  3EJB A;  2KG9 A;  1X3O A;  2KOR A;  2JGP A;  2MVV A;  2N6Y A;  5HVC A;  4HKG A;  1NQ4 A;  2MY5 A;  2QNW A;  2AFD A;  3EJD A;  2LL8 A;  4H2X C;  2N6Z A;  3LMO A;  5KP6 B;  1AF8 A;  2FQ1 A;  2LPK A;  2DNW A;  4IZ6 A;  3EJE A;  4PXH B;  4NEO A;  5EJD A;  4MRT C;  1L0H A;  2N5H A;  2KGE A;  1KLP A;  4BPG A;  1F80 D;  2JU2 A;  2XZ1 C; 
#chains in the Genus database with same CATH topology
 1K9M Q;  5HGM A;  4M0I A;  2K93 A;  4U0C A;  7CEI A;  3NY7 B;  3G29 A;  1E0H A;  2KGC A;  5KP8 B;  4BPH A;  2GDW A;  3CME P;  3CCQ P;  2KGA A;  4XFZ A;  5CZD B;  1S72 P;  1W2B O;  5JPA A;  2FVA A;  2FVE A;  2WPT A;  2PEQ A;  2CG5 B;  2ROQ A;  2CWO A;  2K0D X;  3CCR P;  1ZMB A;  2N50 A;  2PEK A;  1HY8 A;  2KOO A;  2GYK A;  2K0X A;  1VQ5 P;  2KOQ A;  3CCU P;  1BXI A;  2FQ0 A;  1RO2 A;  3M1M A;  1BAJ A;  3OW2 O;  2JU1 A;  3LRY A;  1VQN P;  1UJZ A;  3CCV P;  2GDX A;  1UNK A;  2EHT A;  2JB0 A;  2MR8 A;  2LTE A;  5F2K A;  4H2Y C;  3GZL A;  2M5R A;  2K0Y A;  2EIA A;  2KG6 A;  1VKU A;  1VQM P;  1Q7Y Q;  2KW2 A;  2KG8 A;  2LOL A;  2JQ4 A;  3G0V A;  4H2W C;  4CA3 A;  3DS5 A;  4U0B A;  1X3O A;  3H47 A;  3GKL C;  1VQL P;  4XFY A;  2Z46 A;  1EOQ A;  4XFX A;  2QNW A;  1EIA A;  2K5X A;  2JBG A;  4IPY A;  2LL8 A;  2E1M A;  2PEO A;  3VRL C;  2GZF A;  4XRQ A;  4H2X C;  3LMO A;  1JJ2 O;  5KP6 B;  4GR2 A;  4XRO A;  5EW5 E;  3CCJ P;  2EG5 A;  1FR2 A;  2JU2 A;  1VQ7 P;  1HQB A;  1YJ9 P;  1YHQ P;  3G28 A;  1CEI A;  1NJI Q;  2PEI A;  1T8K A;  4BPF A;  2FHS C;  4COC A;  2JYG A;  2P9X A;  5F2O A;  1L0I A;  2L4B A;  2ONT A;  5HGL A;  1Q86 Q;  1QVF O;  3G1I A;  5BS1 A;  2OAR A;  2Z44 A;  4QNB A;  3G1G A;  1YI2 P;  2JO0 A;  3GJN A;  2LML A;  3U43 A;  3CXC O;  1A8O A;  1IUQ A;  3I56 P;  2KOS A;  1YJN P;  1ACP A;  2BHV A;  2KWL A;  1YJW P;  1VQK P;  2VLQ A;  1M1K Q;  2FQ2 A;  2GZI A;  2AF8 A;  3DS3 A;  4R0M A;  1Q81 Q;  1QRJ A;  3I55 P;  3EJB A;  2OTJ P;  2JGP A;  1YIT P;  2MVV A;  3NTE A;  3G21 A;  1Z6M A;  2MY5 A;  2AFD A;  1MZ8 A;  2N6Z A;  1K30 A;  1VQO P;  2LPK A;  2DNW A;  4U0D A;  1E6J P;  2N5H A;  1F80 D;  2XZ1 C;  5I4T G;  5BS2 A;  2DGY A;  3CC2 P;  2X2B A;  1K73 Q;  2N98 A;  5F2N A;  2AVA A;  5KP7 B;  2K92 A;  4QKO A;  3RG2 A;  3DS4 A;  4DG9 A;  4WYM A;  3CC4 P;  3DS2 A;  5HV8 A;  1GPJ A;  2KR5 A;  2GZJ A;  3GZM A;  4GR6 A;  2FAC A;  2PEJ A;  3CMA P;  3CD6 P;  3CCM P;  3CPW O;  2LIW A;  2AFE A;  1QVG O;  1VHN A;  2VLO A;  2MF4 A;  4PWV B;  2N5I A;  2FAE A;  2VSQ A;  1KQS O;  2KG9 A;  3G71 P;  2PY8 A;  1RO0 A;  2VLP A;  2N6Y A;  5HVC A;  4HKG A;  2XT1 A;  2XXM A;  3EJD A;  3H0D A;  4PH0 A;  3EJE A;  3B5I A;  5EJD A;  2VLN A;  1YIJ P;  2JAZ A;  3Q20 A;  2KGE A;  1GXH A;  4BPG A;  1VQ6 P;  3CCS P;  1VQ8 P;  2NO8 A;  5HGO A;  4U0E A;  1VQ4 P;  2MR7 A;  2L22 A;  1OR5 A;  3WBH A;  1DNY A;  2L6E A;  2OTL P;  2GZG A;  2KOP A;  1D1D A;  5HGN A;  2MD9 A;  2FAD A;  2K2Q A;  2PEN A;  1AYI A;  2PNG A;  2GZE A;  1M6E X;  2CGQ A;  1GXG A;  3G6E P;  2XZ0 D;  3HZQ A;  1EMV A;  2ERH A;  3DS1 A;  2PEM A;  1VQP P;  2M8P A;  2K94 A;  2L0Q A;  1DV5 A;  2BUO A;  4U0F A;  3DTJ A;  4UHP B;  1Q82 Q;  2LIU A;  2JYL A;  2Z45 A;  2MVU A;  1AUM A;  3P05 A;  5DCK A;  2CQ8 A;  2CNR A;  3B4Q A;  1M6N A;  1M90 Q;  1KD1 Q;  2LKI A;  3CE7 A;  1K8A Q;  3HYB A;  2GDY A;  2KGD A;  2QA4 P;  1VQ9 P;  2XV6 A;  2M8N A;  2L9F A;  3DS0 A;  4U0A A;  2QEX P;  2FVF A;  2EHS A;  3H4E A;  1KC8 Q;  1ZNV A;  2KOR A;  2LF4 A;  1IMP A;  1IMQ A;  3RG6 C;  3DPH A;  1N8R Q;  1A43 A;  1NQ4 A;  1RNI A;  3E2D A;  4PH1 A;  2EFJ A;  3CCE P;  2M8L A;  3CCL P;  1AF8 A;  3MGE A;  2FQ1 A;  3G4S P;  2KOD A;  1M74 A;  4IZ6 A;  4PXH B;  4NEO A;  4MRT C;  4COP A;  1L0H A;  3CC7 P;  1KLP A;  3G26 A;  4F37 A; 
#chains in the Genus database with same CATH homology
 1HQB A;  2MR7 A;  2L22 A;  1OR5 A;  2K93 A;  1DNY A;  2KOP A;  3NY7 B;  1T8K A;  2MD9 A;  2FAD A;  2K2Q A;  4BPF A;  2FHS C;  2PNG A;  2X2B A;  2CGQ A;  2KGC A;  5KP8 B;  4BPH A;  2N98 A;  2XZ0 D;  2GDW A;  2AVA A;  5KP7 B;  1L0I A;  2K92 A;  2KGA A;  5CZD B;  3RG2 A;  2L4B A;  4DG9 A;  2K94 A;  2L0Q A;  1DV5 A;  2FVA A;  2FVE A;  5HV8 A;  2CG5 B;  2KR5 A;  2ROQ A;  3GZM A;  2LIU A;  2LML A;  2N50 A;  2FAC A;  1HY8 A;  2KOO A;  2K0X A;  2KOQ A;  2MVU A;  2FQ0 A;  2CQ8 A;  2CNR A;  2KOS A;  2JU1 A;  2LIW A;  2LKI A;  2AFE A;  3CE7 A;  1ACP A;  2KWL A;  2GDY A;  2GDX A;  2KGD A;  2EHT A;  2MR8 A;  2LTE A;  2L9F A;  4H2Y C;  2FQ2 A;  2MF4 A;  3GZL A;  2AF8 A;  2M5R A;  2K0Y A;  2KG6 A;  1VKU A;  4PWV B;  2N5I A;  2FVF A;  2EHS A;  2FAE A;  2KW2 A;  2KG8 A;  2LOL A;  2JQ4 A;  4R0M A;  2VSQ A;  4H2W C;  4CA3 A;  3EJB A;  2KG9 A;  1X3O A;  2KOR A;  2JGP A;  2MVV A;  2N6Y A;  5HVC A;  4HKG A;  1NQ4 A;  2MY5 A;  2QNW A;  2AFD A;  3EJD A;  2LL8 A;  4H2X C;  2N6Z A;  3LMO A;  5KP6 B;  1AF8 A;  2FQ1 A;  2LPK A;  2DNW A;  4IZ6 A;  3EJE A;  4PXH B;  4NEO A;  5EJD A;  4MRT C;  1L0H A;  2N5H A;  2KGE A;  1KLP A;  4BPG A;  1F80 D;  2JU2 A;  2XZ1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...