5EJDA

The crystal structure of holo t3ct
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
KQLSTDAERELANIWATVLDIPIGTISASDNFFFRGGHSIDAMKASALGRAAGMSFGVADIFDHPVLSELASVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords TqaA
publication title Structural basis of nonribosomal peptide macrocyclization in fungi
pubmed doi rcsb
source organism Penicillium aethiopicum
total genus 23
structure length 75
sequence length 75
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5ejdA00
2LOLA 1AF8A 2L9FA 2X2BA 2CNRA 2L22A 2N98A 2KG8A 2ROQA 2MR8A 4BPGA 2MVUA 2MR7A 2FAEA 2KOSA 2K94A 2VSQA 2GDYA 2KGDA 1L0HA 2AVAA 1NQ4A 1OR5A 1DNYA 2JGPA 2KOQA 2KGCA 2K92A 1T8KA 2LL8A 2CQ8A 4HKGA 3RG2A 2N5IA 3GZLA 2LIUA 2PNGA 2L4BA 4PXHB 2AF8A 2GDXA 2LMLA 4BPFA 1VKUA 2EHSA 1X3OA 2FVEA 2LTEA 3EJBA 5KP7B 2KGEA 3NY7B 4CA3A 2XZ0D 2QNWA 1KLPA 5HVCA 2FVAA 5CZDB 2N50A 4IZ6A 2MD9A 4H2YC 2N6YA 2KOOA 5HV8A 2JU2A 2K0XA 2L0QA 1DV5A 4DG9A 5EJDA 2MVVA 2N6ZA 5KP6B 2LKIA 2FHSC 2FADA 4MRTC 2CG5B 2CGQA 4NEOA 1HY8A 2KW2A 2EHTA 3EJDA 2MY5A 2KR5A 2KG9A 2LPKA 2AFEA 3EJEA 2K2QA 2KG6A 2KWLA 2XZ1C 2KORA 2JU1A 2AFDA 2FQ1A 2N5HA 2KOPA 2KGAA 2K0YA 2M5RA 4BPHA 5KP8B 3GZMA 3CE7A 4H2WC 2DNWA 2FACA 2MF4A 2JQ4A 1F80D 2LIWA 2FQ2A 1HQBA 4PWVB 1L0IA 4H2XC 4R0MA 2FVFA 1ACPA 2K93A 3LMOA 2FQ0A 2GDWA
chains in the Genus database with same CATH superfamily
1RNIA 2CWOA 2L9FA 1EMVA 3DS2A 2JYLA 2FAEA 1GPJA 2KGDA 1KC8Q 1ZNVA 1OR5A 3CC4P 2PY8A 1DNYA 2JGPA 4XRQA 2QA4P 1UJZA 1M1KQ 1Z6MA 2M8PA 3GZLA 5F2OA 2L4BA 2EG5A 3G6EP 2GZJA 4XROA 2GZFA 1RO0A 3G4SP 3CCUP 5I4TG 1RO2A 1A8OA 2XV6A 3VRLC 5KP7B 2KGEA 3NY7B 1KLPA 5HVCA 3GKLC 2XXMA 3G29A 2K0XA 1DV5A 1QRJA 3E2DA 5EJDA 2KODA 2LF4A 3CCLP 5KP6B 4MRTC 1QVFO 2CG5B 1IMPA 3G1GA 5EW5E 3DS5A 1VQNP 2KG9A 1Q86Q 3DTJA 1BAJA 4QNBA 2KG6A 2KWLA 2KORA 2JU1A 2FQ1A 1VQ8P 2K0DX 2VLPA 3HZQA 2PEJA 2PEQA 2M5RA 4BPHA 5KP8B 3CE7A 3CXCO 2JQ4A 2FQ2A 1HQBA 1N8RQ 1L0IA 1BXIA 2VLOA 1ACPA 2FQ0A 2LOLA 1AF8A 1YI2P 1K73Q 1VQMP 1KD1Q 2X2BA 1AYIA 2ROQA 5DCKA 4BPGA 2KOSA 2K94A 1YJWP 2GDYA 4COCA 2AVAA 1MZ8A 1A43A 2ERHA 1T8KA 1VQPP 3RG2A 5HGMA 2Z46A 2PEOA 2VLNA 3H47A 3CCMP 1CEIA 2PEMA 2JBGA 2LMLA 1GXGA 1VKUA 2EHSA 3M1MA 1M6NA 2JB0A 1EOQA 2M8NA 4CA3A 2QNWA 5CZDB 3G0VA 4PH1A 1YJ9P 3G28A 4IZ6A 4H2YC 2L0QA 2QEXP 4GR2A 1VQ7P 2MVVA 1W2BO 5F2NA 2JYGA 2LKIA 2GZGA 2FHSC 4U0BA 1IUQA 3CMEP 1HY8A 2DGYA 2EHTA 3WBHA 2MY5A 1YJNP 3OW2O 4GR6A 2AFEA 2NO8A 2XZ1C 2M8LA 2GZIA 4WYMA 2AFDA 3CCQP 4F37A 3DS3A 3MGEA 4IPYA 3HYBA 1Q7YQ 4PWVB 2Z44A 4H2XC 1YHQP 2PEIA 1GXHA 2K93A 2EFJA 1NJIQ 5F2KA 2CNRA 2KG8A 5HGLA 3NTEA 2MVUA 1YITP 3Q20A 5HGOA 2GZEA 1NQ4A 2KOQA 2KGCA 2K92A 2LL8A 2ONTA 2CQ8A 5BS2A 3CD6P 3DS0A 2N5IA 2JO0A 3CMAP 3CPWO 2AF8A 5BS1A 4UHPB 1K9MQ 2Z45A 3GJNA 1VQ4P 2FVEA 3EJBA 2XZ0D 2L6EA 2FVAA 4U0FA 2OTLP 2N50A 4XFYA 1D1DA 2MD9A 2KOOA 5HV8A 2JU2A 4U0AA 2GYKA 2PENA 2K5XA 2E1MA 3H4EA 2CGQA 1IMQA 4XFXA 4NEOA 1Q82Q 3CC7P 1M6EX 2KW2A 1VQ5P 3DS4A 3EJEA 5HGNA 2K2QA 2P9XA 1VQ6P 3G26A 3I55P 2N5HA 2KGAA 3G1IA 4H2WC 2DNWA 2FACA 7CEIA 1KQSO 4M0IA 1VQKP 1F80D 2LIWA 3I56P 3DS1A 3CCVP 4PH0A 3CCJP 2WPTA 2L22A 2N98A 3CCRP 2MR8A 2MR7A 1S72P 2JAZA 2VSQA 1VQOP 1L0HA 3G71P 1EIAA 5JPAA 3CC2P 4QKOA 3G21A 4HKGA 2LIUA 2PNGA 2VLQA 1VQLP 4PXHB 2EIAA 1FR2A 1E6JP 3DPHA 2BUOA 2XT1A 3RG6C 1VQ9P 3U43A 1M74A 1UNKA 2GDXA 4BPFA 1X3OA 1K8AQ 2LTEA 2OTJP 3B5IA 1VHNA 1ZMBA 4XFZA 2N6YA 4COPA 3B4QA 2OARA 4DG9A 1JJ2O 2N6ZA 1AUMA 3P05A 2FADA 3CCEP 1YIJP 2PEKA 3CCSP 3EJDA 2KR5A 2LPKA 4U0DA 2KOPA 2K0YA 1M90Q 3H0DA 4U0EA 3GZMA 1E0HA 3LRYA 1K30A 2MF4A 2BHVA 1Q81Q 4R0MA 2FVFA 1QVGO 3LMOA 4U0CA 2GDWA
chains in the Genus database with same CATH topology
2LOLA 1AF8A 2L9FA 2X2BA 2CNRA 2L22A 2N98A 2KG8A 2ROQA 2MR8A 4BPGA 2MVUA 2MR7A 2FAEA 2KOSA 2K94A 2VSQA 2GDYA 2KGDA 1L0HA 2AVAA 1NQ4A 1OR5A 1DNYA 2JGPA 2KOQA 2KGCA 2K92A 1T8KA 2LL8A 2CQ8A 4HKGA 3RG2A 2N5IA 3GZLA 2LIUA 2PNGA 2L4BA 4PXHB 2AF8A 2GDXA 2LMLA 4BPFA 1VKUA 2EHSA 1X3OA 2FVEA 2LTEA 3EJBA 5KP7B 2KGEA 3NY7B 4CA3A 2XZ0D 2QNWA 1KLPA 5HVCA 2FVAA 5CZDB 2N50A 4IZ6A 2MD9A 4H2YC 2N6YA 2KOOA 5HV8A 2JU2A 2K0XA 2L0QA 1DV5A 4DG9A 5EJDA 2MVVA 2N6ZA 5KP6B 2LKIA 2FHSC 2FADA 4MRTC 2CG5B 2CGQA 4NEOA 1HY8A 2KW2A 2EHTA 3EJDA 2MY5A 2KR5A 2KG9A 2LPKA 2AFEA 3EJEA 2K2QA 2KG6A 2KWLA 2XZ1C 2KORA 2JU1A 2AFDA 2FQ1A 2N5HA 2KOPA 2KGAA 2K0YA 2M5RA 4BPHA 5KP8B 3GZMA 3CE7A 4H2WC 2DNWA 2FACA 2MF4A 2JQ4A 1F80D 2LIWA 2FQ2A 1HQBA 4PWVB 1L0IA 4H2XC 4R0MA 2FVFA 1ACPA 2K93A 3LMOA 2FQ0A 2GDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOL A;  1AF8 A;  2L9F A;  2X2B A;  2CNR A;  2L22 A;  2N98 A;  2KG8 A;  2ROQ A;  2MR8 A;  4BPG A;  2MVU A;  2MR7 A;  2FAE A;  2KOS A;  2K94 A;  2VSQ A;  2GDY A;  2KGD A;  1L0H A;  2AVA A;  1NQ4 A;  1OR5 A;  1DNY A;  2JGP A;  2KOQ A;  2KGC A;  2K92 A;  1T8K A;  2LL8 A;  2CQ8 A;  4HKG A;  3RG2 A;  2N5I A;  3GZL A;  2LIU A;  2PNG A;  2L4B A;  4PXH B;  2AF8 A;  2GDX A;  2LML A;  4BPF A;  1VKU A;  2EHS A;  1X3O A;  2FVE A;  2LTE A;  3EJB A;  5KP7 B;  2KGE A;  3NY7 B;  4CA3 A;  2XZ0 D;  2QNW A;  1KLP A;  5HVC A;  2FVA A;  5CZD B;  2N50 A;  4IZ6 A;  2MD9 A;  4H2Y C;  2N6Y A;  2KOO A;  5HV8 A;  2JU2 A;  2K0X A;  2L0Q A;  1DV5 A;  4DG9 A;  5EJD A;  2MVV A;  2N6Z A;  5KP6 B;  2LKI A;  2FHS C;  2FAD A;  4MRT C;  2CG5 B;  2CGQ A;  4NEO A;  1HY8 A;  2KW2 A;  2EHT A;  3EJD A;  2MY5 A;  2KR5 A;  2KG9 A;  2LPK A;  2AFE A;  3EJE A;  2K2Q A;  2KG6 A;  2KWL A;  2XZ1 C;  2KOR A;  2JU1 A;  2AFD A;  2FQ1 A;  2N5H A;  2KOP A;  2KGA A;  2K0Y A;  2M5R A;  4BPH A;  5KP8 B;  3GZM A;  3CE7 A;  4H2W C;  2DNW A;  2FAC A;  2MF4 A;  2JQ4 A;  1F80 D;  2LIW A;  2FQ2 A;  1HQB A;  4PWV B;  1L0I A;  4H2X C;  4R0M A;  2FVF A;  1ACP A;  2K93 A;  3LMO A;  2FQ0 A;  2GDW A; 
#chains in the Genus database with same CATH topology
 1RNI A;  2CWO A;  2L9F A;  1EMV A;  3DS2 A;  2JYL A;  2FAE A;  1GPJ A;  2KGD A;  1KC8 Q;  1ZNV A;  1OR5 A;  3CC4 P;  2PY8 A;  1DNY A;  2JGP A;  4XRQ A;  2QA4 P;  1UJZ A;  1M1K Q;  1Z6M A;  2M8P A;  3GZL A;  5F2O A;  2L4B A;  2EG5 A;  3G6E P;  2GZJ A;  4XRO A;  2GZF A;  1RO0 A;  3G4S P;  3CCU P;  5I4T G;  1RO2 A;  1A8O A;  2XV6 A;  3VRL C;  5KP7 B;  2KGE A;  3NY7 B;  1KLP A;  5HVC A;  3GKL C;  2XXM A;  3G29 A;  2K0X A;  1DV5 A;  1QRJ A;  3E2D A;  5EJD A;  2KOD A;  2LF4 A;  3CCL P;  5KP6 B;  4MRT C;  1QVF O;  2CG5 B;  1IMP A;  3G1G A;  5EW5 E;  3DS5 A;  1VQN P;  2KG9 A;  1Q86 Q;  3DTJ A;  1BAJ A;  4QNB A;  2KG6 A;  2KWL A;  2KOR A;  2JU1 A;  2FQ1 A;  1VQ8 P;  2K0D X;  2VLP A;  3HZQ A;  2PEJ A;  2PEQ A;  2M5R A;  4BPH A;  5KP8 B;  3CE7 A;  3CXC O;  2JQ4 A;  2FQ2 A;  1HQB A;  1N8R Q;  1L0I A;  1BXI A;  2VLO A;  1ACP A;  2FQ0 A;  2LOL A;  1AF8 A;  1YI2 P;  1K73 Q;  1VQM P;  1KD1 Q;  2X2B A;  1AYI A;  2ROQ A;  5DCK A;  4BPG A;  2KOS A;  2K94 A;  1YJW P;  2GDY A;  4COC A;  2AVA A;  1MZ8 A;  1A43 A;  2ERH A;  1T8K A;  1VQP P;  3RG2 A;  5HGM A;  2Z46 A;  2PEO A;  2VLN A;  3H47 A;  3CCM P;  1CEI A;  2PEM A;  2JBG A;  2LML A;  1GXG A;  1VKU A;  2EHS A;  3M1M A;  1M6N A;  2JB0 A;  1EOQ A;  2M8N A;  4CA3 A;  2QNW A;  5CZD B;  3G0V A;  4PH1 A;  1YJ9 P;  3G28 A;  4IZ6 A;  4H2Y C;  2L0Q A;  2QEX P;  4GR2 A;  1VQ7 P;  2MVV A;  1W2B O;  5F2N A;  2JYG A;  2LKI A;  2GZG A;  2FHS C;  4U0B A;  1IUQ A;  3CME P;  1HY8 A;  2DGY A;  2EHT A;  3WBH A;  2MY5 A;  1YJN P;  3OW2 O;  4GR6 A;  2AFE A;  2NO8 A;  2XZ1 C;  2M8L A;  2GZI A;  4WYM A;  2AFD A;  3CCQ P;  4F37 A;  3DS3 A;  3MGE A;  4IPY A;  3HYB A;  1Q7Y Q;  4PWV B;  2Z44 A;  4H2X C;  1YHQ P;  2PEI A;  1GXH A;  2K93 A;  2EFJ A;  1NJI Q;  5F2K A;  2CNR A;  2KG8 A;  5HGL A;  3NTE A;  2MVU A;  1YIT P;  3Q20 A;  5HGO A;  2GZE A;  1NQ4 A;  2KOQ A;  2KGC A;  2K92 A;  2LL8 A;  2ONT A;  2CQ8 A;  5BS2 A;  3CD6 P;  3DS0 A;  2N5I A;  2JO0 A;  3CMA P;  3CPW O;  2AF8 A;  5BS1 A;  4UHP B;  1K9M Q;  2Z45 A;  3GJN A;  1VQ4 P;  2FVE A;  3EJB A;  2XZ0 D;  2L6E A;  2FVA A;  4U0F A;  2OTL P;  2N50 A;  4XFY A;  1D1D A;  2MD9 A;  2KOO A;  5HV8 A;  2JU2 A;  4U0A A;  2GYK A;  2PEN A;  2K5X A;  2E1M A;  3H4E A;  2CGQ A;  1IMQ A;  4XFX A;  4NEO A;  1Q82 Q;  3CC7 P;  1M6E X;  2KW2 A;  1VQ5 P;  3DS4 A;  3EJE A;  5HGN A;  2K2Q A;  2P9X A;  1VQ6 P;  3G26 A;  3I55 P;  2N5H A;  2KGA A;  3G1I A;  4H2W C;  2DNW A;  2FAC A;  7CEI A;  1KQS O;  4M0I A;  1VQK P;  1F80 D;  2LIW A;  3I56 P;  3DS1 A;  3CCV P;  4PH0 A;  3CCJ P;  2WPT A;  2L22 A;  2N98 A;  3CCR P;  2MR8 A;  2MR7 A;  1S72 P;  2JAZ A;  2VSQ A;  1VQO P;  1L0H A;  3G71 P;  1EIA A;  5JPA A;  3CC2 P;  4QKO A;  3G21 A;  4HKG A;  2LIU A;  2PNG A;  2VLQ A;  1VQL P;  4PXH B;  2EIA A;  1FR2 A;  1E6J P;  3DPH A;  2BUO A;  2XT1 A;  3RG6 C;  1VQ9 P;  3U43 A;  1M74 A;  1UNK A;  2GDX A;  4BPF A;  1X3O A;  1K8A Q;  2LTE A;  2OTJ P;  3B5I A;  1VHN A;  1ZMB A;  4XFZ A;  2N6Y A;  4COP A;  3B4Q A;  2OAR A;  4DG9 A;  1JJ2 O;  2N6Z A;  1AUM A;  3P05 A;  2FAD A;  3CCE P;  1YIJ P;  2PEK A;  3CCS P;  3EJD A;  2KR5 A;  2LPK A;  4U0D A;  2KOP A;  2K0Y A;  1M90 Q;  3H0D A;  4U0E A;  3GZM A;  1E0H A;  3LRY A;  1K30 A;  2MF4 A;  2BHV A;  1Q81 Q;  4R0M A;  2FVF A;  1QVG O;  3LMO A;  4U0C A;  2GDW A; 
#chains in the Genus database with same CATH homology
 2LOL A;  1AF8 A;  2L9F A;  2X2B A;  2CNR A;  2L22 A;  2N98 A;  2KG8 A;  2ROQ A;  2MR8 A;  4BPG A;  2MVU A;  2MR7 A;  2FAE A;  2KOS A;  2K94 A;  2VSQ A;  2GDY A;  2KGD A;  1L0H A;  2AVA A;  1NQ4 A;  1OR5 A;  1DNY A;  2JGP A;  2KOQ A;  2KGC A;  2K92 A;  1T8K A;  2LL8 A;  2CQ8 A;  4HKG A;  3RG2 A;  2N5I A;  3GZL A;  2LIU A;  2PNG A;  2L4B A;  4PXH B;  2AF8 A;  2GDX A;  2LML A;  4BPF A;  1VKU A;  2EHS A;  1X3O A;  2FVE A;  2LTE A;  3EJB A;  5KP7 B;  2KGE A;  3NY7 B;  4CA3 A;  2XZ0 D;  2QNW A;  1KLP A;  5HVC A;  2FVA A;  5CZD B;  2N50 A;  4IZ6 A;  2MD9 A;  4H2Y C;  2N6Y A;  2KOO A;  5HV8 A;  2JU2 A;  2K0X A;  2L0Q A;  1DV5 A;  4DG9 A;  5EJD A;  2MVV A;  2N6Z A;  5KP6 B;  2LKI A;  2FHS C;  2FAD A;  4MRT C;  2CG5 B;  2CGQ A;  4NEO A;  1HY8 A;  2KW2 A;  2EHT A;  3EJD A;  2MY5 A;  2KR5 A;  2KG9 A;  2LPK A;  2AFE A;  3EJE A;  2K2Q A;  2KG6 A;  2KWL A;  2XZ1 C;  2KOR A;  2JU1 A;  2AFD A;  2FQ1 A;  2N5H A;  2KOP A;  2KGA A;  2K0Y A;  2M5R A;  4BPH A;  5KP8 B;  3GZM A;  3CE7 A;  4H2W C;  2DNW A;  2FAC A;  2MF4 A;  2JQ4 A;  1F80 D;  2LIW A;  2FQ2 A;  1HQB A;  4PWV B;  1L0I A;  4H2X C;  4R0M A;  2FVF A;  1ACP A;  2K93 A;  3LMO A;  2FQ0 A;  2GDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...