5EJDA

The crystal structure of holo t3ct
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
KQLSTDAERELANIWATVLDIPIGTISASDNFFFRGGHSIDAMKASALGRAAGMSFGVADIFDHPVLSELASVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TqaA
publication title Structural basis of nonribosomal peptide macrocyclization in fungi
pubmed doi rcsb
source organism Penicillium aethiopicum
molecule tags Biosynthetic protein
total genus 23
structure length 75
sequence length 75
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5ejdA00
2CQ8A 2KOPA 5EJDA 1F80D 3NY7B 2MF4A 2X2BA 4IZ6A 2CG5B 2JU1A 4H2YC 2EHTA 2KOSA 2MR8A 2N5IA 1ACPA 1VKUA 2L9FA 2KORA 2DNWA 4PWVB 2GDXA 2FADA 1X3OA 2JGPA 3RG2A 2EHSA 1AF8A 2N6YA 2FQ1A 2MVUA 2LL8A 2K93A 2XZ1C 2L22A 4MRTC 2KOOA 1DNYA 2FQ0A 3GZMA 1KLPA 2CGQA 2FVEA 2LMLA 2AFEA 1T8KA 5CZDB 2LOLA 2L0QA 2KG8A 4NEOA 2FQ2A 2KW2A 3LMOA 5KP7B 5KP6B 5HV8A 1DV5A 2MVVA 2AF8A 2GDWA 4H2XC 2FHSC 2KG9A 5KP8B 2JU2A 1L0IA 2LIUA 1L0HA 2K92A 4BPFA 1HY8A 2K0XA 1HQBA 2AFDA 2MD9A 2LKIA 4HKGA 4BPGA 4H2WC 2FVFA 4BPHA 2JQ4A 2LPKA 2KR5A 2KGAA 3GZLA 2K94A 2FACA 2LTEA 2KGCA 4CA3A 1OR5A 2N6ZA 2MR7A 1NQ4A 2M5RA 2GDYA 3EJEA 4DG9A 3EJDA 2MY5A 2ROQA 2XZ0D 2LIWA 2N50A 5HVCA 3CE7A 2K2QA 2QNWA 2N5HA 2KWLA 2KOQA 2KGEA 2AVAA 2CNRA 2N98A 2K0YA 2VSQA 2FAEA 2FVAA 3EJBA 2KG6A 4R0MA 2KGDA 2L4BA 2PNGA 4PXHB
chains in the Genus database with same CATH superfamily
1M1KQ 2MF4A 1FR2A 2Z46A 2X2BA 1VQ8P 4IZ6A 4QKOA 2CG5B 2EHTA 2KOSA 2MR8A 3DS3A 5F2OA 2N5IA 3CCVP 1VKUA 2L6EA 2PEKA 2DNWA 2JB0A 2FADA 1E6JP 2GZFA 3RG2A 3DS0A 1AF8A 1W2BO 2K93A 1EOQA 2L22A 1DNYA 1UNKA 3GZMA 2LMLA 4M0IA 5CZDB 2XT1A 1KD1Q 2FQ2A 2KW2A 3LMOA 5DCKA 5KP6B 4PH0A 3G4SP 2MVVA 1K73Q 2LIUA 1L0HA 5HGNA 4BPFA 5F2NA 2AFDA 4BPGA 3CD6P 3CMEP 2DGYA 1YI2P 4QNBA 1K8AQ 1RO0A 3WBHA 1VQKP 1VQ7P 1A8OA 2EG5A 1EIAA 1NQ4A 2JYLA 3CC7P 1BXIA 3EJEA 4DG9A 3RG6C 2XZ0D 2N50A 2E1MA 5HVCA 3CCUP 4XFZA 1M6NA 3B4QA 3EJBA 1AYIA 2FVAA 1YJNP 2P9XA 5F2KA 4PXHB 2GZGA 2K0DX 3CCJP 1M90Q 1N8RQ 4COPA 3DS5A 2JU1A 2ONTA 2JBGA 2JO0A 2L9FA 5EW5E 4XRQA 4PWVB 7CEIA 4U0EA 3VRLC 2GDXA 2PY8A 3CCMP 1Q81Q 3G0VA 3G6EP 1ZMBA 2FQ0A 3E2DA 1M6EX 1T8KA 2L0QA 3P05A 5HV8A 2AF8A 4H2XC 2FHSC 5KP8B 2M8LA 2K92A 2K0XA 4XFXA 3LRYA 3M1MA 3CCEP 4BPHA 3CMAP 1K9MQ 2JQ4A 2LPKA 1CEIA 2KGAA 2FACA 2LTEA 3DS1A 1VQ6P 1ZNVA 3DS2A 4U0FA 4U0AA 1VQNP 2PEOA 2ROQA 3CCSP 3DS4A 1D1DA 2GYKA 3H4EA 2GZIA 1RNIA 1VQLP 2QNWA 2CNRA 2N98A 2K0YA 4R0MA 2KG6A 4PH1A 2OARA 3B5IA 3I55P 2Z45A 3OW2O 3Q20A 1F80D 2EIAA 3G26A 2WPTA 5I4TG 1IUQA 2CWOA 3MGEA 3GJNA 1VQ9P 2OTLP 1X3OA 3G28A 2EHSA 2FQ1A 2MVUA 1EMVA 2QEXP 2XZ1C 2KOOA 1UJZA 2NO8A 3G29A 2FVEA 2M8NA 2LOLA 4NEOA 1KQSO 2PEIA 1YITP 1VQMP 2QA4P 5HGOA 1L0IA 5HGLA 1VQ4P 1GXHA 1HY8A 2BUOA 5BS2A 1YHQP 2MD9A 4HKGA 1Q86Q 4GR6A 3DTJA 2EFJA 2M8PA 3GZLA 2K94A 3I56P 2XXMA 2PEMA 2JYGA 5JPAA 2N6ZA 1QVFO 2MR7A 1GXGA 1BAJA 2PEQA 2GDYA 3EJDA 3CCLP 1Q82Q 5HGMA 3CE7A 3CCQP 2K2QA 2GZEA 2N5HA 2Z44A 2KOQA 3H0DA 2KGEA 2AVAA 1YJ9P 3U43A 2FAEA 1MZ8A 4WYMA 3CC4P 1K30A 1IMQA 1E0HA 2KGDA 2L4BA 1VQOP 1IMPA 4U0BA 2XV6A 1GPJA 2CQ8A 3GKLC 2KOPA 5EJDA 3NY7B 1A43A 2K5XA 4H2YC 2ERHA 5BS1A 1Z6MA 4COCA 1ACPA 2KORA 2PENA 3H47A 2BHVA 2JGPA 3CC2P 4GR2A 2N6YA 3G1IA 1NJIQ 2PEJA 2LL8A 1QVGO 1VQPP 4MRTC 1KLPA 2CGQA 1M74A 2AFEA 4U0CA 3HYBA 2KG8A 1VQ5P 4IPYA 5KP7B 2VLPA 1S72P 1AUMA 3CPWO 1DV5A 2GDWA 2KG9A 2VLQA 2JU2A 1Q7YQ 3CXCO 3CCRP 3DPHA 3NTEA 1HQBA 2VLNA 2LKIA 4H2WC 4U0DA 1JJ2O 4UHPB 2FVFA 2OTJP 2VLOA 2KR5A 1QRJA 2GZJA 1YJWP 2KGCA 4CA3A 1KC8Q 1OR5A 1YIJP 2JAZA 2M5RA 1RO2A 4XROA 2MY5A 3G21A 2LIWA 4F37A 2KWLA 2VSQA 3G1GA 4XFYA 3HZQA 1VHNA 2PNGA 3G71P 2KODA 2LF4A
chains in the Genus database with same CATH topology
2CQ8A 2KOPA 5EJDA 1F80D 3NY7B 2MF4A 2X2BA 4IZ6A 2CG5B 2JU1A 4H2YC 2EHTA 2KOSA 2MR8A 2N5IA 1ACPA 1VKUA 2L9FA 2KORA 2DNWA 4PWVB 2GDXA 2FADA 1X3OA 2JGPA 3RG2A 2EHSA 1AF8A 2N6YA 2FQ1A 2MVUA 2LL8A 2K93A 2XZ1C 2L22A 4MRTC 2KOOA 1DNYA 2FQ0A 3GZMA 1KLPA 2CGQA 2FVEA 2LMLA 2AFEA 1T8KA 5CZDB 2LOLA 2L0QA 2KG8A 4NEOA 2FQ2A 2KW2A 3LMOA 5KP7B 5KP6B 5HV8A 1DV5A 2MVVA 2AF8A 2GDWA 4H2XC 2FHSC 2KG9A 5KP8B 2JU2A 1L0IA 2LIUA 1L0HA 2K92A 4BPFA 1HY8A 2K0XA 1HQBA 2AFDA 2MD9A 2LKIA 4HKGA 4BPGA 4H2WC 2FVFA 4BPHA 2JQ4A 2LPKA 2KR5A 2KGAA 3GZLA 2K94A 2FACA 2LTEA 2KGCA 4CA3A 1OR5A 2N6ZA 2MR7A 1NQ4A 2M5RA 2GDYA 3EJEA 4DG9A 3EJDA 2MY5A 2ROQA 2XZ0D 2LIWA 2N50A 5HVCA 3CE7A 2K2QA 2QNWA 2N5HA 2KWLA 2KOQA 2KGEA 2AVAA 2CNRA 2N98A 2K0YA 2VSQA 2FAEA 2FVAA 3EJBA 2KG6A 4R0MA 2KGDA 2L4BA 2PNGA 4PXHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQ8 A;  2KOP A;  5EJD A;  1F80 D;  3NY7 B;  2MF4 A;  2X2B A;  4IZ6 A;  2CG5 B;  2JU1 A;  4H2Y C;  2EHT A;  2KOS A;  2MR8 A;  2N5I A;  1ACP A;  1VKU A;  2L9F A;  2KOR A;  2DNW A;  4PWV B;  2GDX A;  2FAD A;  1X3O A;  2JGP A;  3RG2 A;  2EHS A;  1AF8 A;  2N6Y A;  2FQ1 A;  2MVU A;  2LL8 A;  2K93 A;  2XZ1 C;  2L22 A;  4MRT C;  2KOO A;  1DNY A;  2FQ0 A;  3GZM A;  1KLP A;  2CGQ A;  2FVE A;  2LML A;  2AFE A;  1T8K A;  5CZD B;  2LOL A;  2L0Q A;  2KG8 A;  4NEO A;  2FQ2 A;  2KW2 A;  3LMO A;  5KP7 B;  5KP6 B;  5HV8 A;  1DV5 A;  2MVV A;  2AF8 A;  2GDW A;  4H2X C;  2FHS C;  2KG9 A;  5KP8 B;  2JU2 A;  1L0I A;  2LIU A;  1L0H A;  2K92 A;  4BPF A;  1HY8 A;  2K0X A;  1HQB A;  2AFD A;  2MD9 A;  2LKI A;  4HKG A;  4BPG A;  4H2W C;  2FVF A;  4BPH A;  2JQ4 A;  2LPK A;  2KR5 A;  2KGA A;  3GZL A;  2K94 A;  2FAC A;  2LTE A;  2KGC A;  4CA3 A;  1OR5 A;  2N6Z A;  2MR7 A;  1NQ4 A;  2M5R A;  2GDY A;  3EJE A;  4DG9 A;  3EJD A;  2MY5 A;  2ROQ A;  2XZ0 D;  2LIW A;  2N50 A;  5HVC A;  3CE7 A;  2K2Q A;  2QNW A;  2N5H A;  2KWL A;  2KOQ A;  2KGE A;  2AVA A;  2CNR A;  2N98 A;  2K0Y A;  2VSQ A;  2FAE A;  2FVA A;  3EJB A;  2KG6 A;  4R0M A;  2KGD A;  2L4B A;  2PNG A;  4PXH B; 
#chains in the Genus database with same CATH topology
 1M1K Q;  2MF4 A;  1FR2 A;  2Z46 A;  2X2B A;  1VQ8 P;  4IZ6 A;  4QKO A;  2CG5 B;  2EHT A;  2KOS A;  2MR8 A;  3DS3 A;  5F2O A;  2N5I A;  3CCV P;  1VKU A;  2L6E A;  2PEK A;  2DNW A;  2JB0 A;  2FAD A;  1E6J P;  2GZF A;  3RG2 A;  3DS0 A;  1AF8 A;  1W2B O;  2K93 A;  1EOQ A;  2L22 A;  1DNY A;  1UNK A;  3GZM A;  2LML A;  4M0I A;  5CZD B;  2XT1 A;  1KD1 Q;  2FQ2 A;  2KW2 A;  3LMO A;  5DCK A;  5KP6 B;  4PH0 A;  3G4S P;  2MVV A;  1K73 Q;  2LIU A;  1L0H A;  5HGN A;  4BPF A;  5F2N A;  2AFD A;  4BPG A;  3CD6 P;  3CME P;  2DGY A;  1YI2 P;  4QNB A;  1K8A Q;  1RO0 A;  3WBH A;  1VQK P;  1VQ7 P;  1A8O A;  2EG5 A;  1EIA A;  1NQ4 A;  2JYL A;  3CC7 P;  1BXI A;  3EJE A;  4DG9 A;  3RG6 C;  2XZ0 D;  2N50 A;  2E1M A;  5HVC A;  3CCU P;  4XFZ A;  1M6N A;  3B4Q A;  3EJB A;  1AYI A;  2FVA A;  1YJN P;  2P9X A;  5F2K A;  4PXH B;  2GZG A;  2K0D X;  3CCJ P;  1M90 Q;  1N8R Q;  4COP A;  3DS5 A;  2JU1 A;  2ONT A;  2JBG A;  2JO0 A;  2L9F A;  5EW5 E;  4XRQ A;  4PWV B;  7CEI A;  4U0E A;  3VRL C;  2GDX A;  2PY8 A;  3CCM P;  1Q81 Q;  3G0V A;  3G6E P;  1ZMB A;  2FQ0 A;  3E2D A;  1M6E X;  1T8K A;  2L0Q A;  3P05 A;  5HV8 A;  2AF8 A;  4H2X C;  2FHS C;  5KP8 B;  2M8L A;  2K92 A;  2K0X A;  4XFX A;  3LRY A;  3M1M A;  3CCE P;  4BPH A;  3CMA P;  1K9M Q;  2JQ4 A;  2LPK A;  1CEI A;  2KGA A;  2FAC A;  2LTE A;  3DS1 A;  1VQ6 P;  1ZNV A;  3DS2 A;  4U0F A;  4U0A A;  1VQN P;  2PEO A;  2ROQ A;  3CCS P;  3DS4 A;  1D1D A;  2GYK A;  3H4E A;  2GZI A;  1RNI A;  1VQL P;  2QNW A;  2CNR A;  2N98 A;  2K0Y A;  4R0M A;  2KG6 A;  4PH1 A;  2OAR A;  3B5I A;  3I55 P;  2Z45 A;  3OW2 O;  3Q20 A;  1F80 D;  2EIA A;  3G26 A;  2WPT A;  5I4T G;  1IUQ A;  2CWO A;  3MGE A;  3GJN A;  1VQ9 P;  2OTL P;  1X3O A;  3G28 A;  2EHS A;  2FQ1 A;  2MVU A;  1EMV A;  2QEX P;  2XZ1 C;  2KOO A;  1UJZ A;  2NO8 A;  3G29 A;  2FVE A;  2M8N A;  2LOL A;  4NEO A;  1KQS O;  2PEI A;  1YIT P;  1VQM P;  2QA4 P;  5HGO A;  1L0I A;  5HGL A;  1VQ4 P;  1GXH A;  1HY8 A;  2BUO A;  5BS2 A;  1YHQ P;  2MD9 A;  4HKG A;  1Q86 Q;  4GR6 A;  3DTJ A;  2EFJ A;  2M8P A;  3GZL A;  2K94 A;  3I56 P;  2XXM A;  2PEM A;  2JYG A;  5JPA A;  2N6Z A;  1QVF O;  2MR7 A;  1GXG A;  1BAJ A;  2PEQ A;  2GDY A;  3EJD A;  3CCL P;  1Q82 Q;  5HGM A;  3CE7 A;  3CCQ P;  2K2Q A;  2GZE A;  2N5H A;  2Z44 A;  2KOQ A;  3H0D A;  2KGE A;  2AVA A;  1YJ9 P;  3U43 A;  2FAE A;  1MZ8 A;  4WYM A;  3CC4 P;  1K30 A;  1IMQ A;  1E0H A;  2KGD A;  2L4B A;  1VQO P;  1IMP A;  4U0B A;  2XV6 A;  1GPJ A;  2CQ8 A;  3GKL C;  2KOP A;  5EJD A;  3NY7 B;  1A43 A;  2K5X A;  4H2Y C;  2ERH A;  5BS1 A;  1Z6M A;  4COC A;  1ACP A;  2KOR A;  2PEN A;  3H47 A;  2BHV A;  2JGP A;  3CC2 P;  4GR2 A;  2N6Y A;  3G1I A;  1NJI Q;  2PEJ A;  2LL8 A;  1QVG O;  1VQP P;  4MRT C;  1KLP A;  2CGQ A;  1M74 A;  2AFE A;  4U0C A;  3HYB A;  2KG8 A;  1VQ5 P;  4IPY A;  5KP7 B;  2VLP A;  1S72 P;  1AUM A;  3CPW O;  1DV5 A;  2GDW A;  2KG9 A;  2VLQ A;  2JU2 A;  1Q7Y Q;  3CXC O;  3CCR P;  3DPH A;  3NTE A;  1HQB A;  2VLN A;  2LKI A;  4H2W C;  4U0D A;  1JJ2 O;  4UHP B;  2FVF A;  2OTJ P;  2VLO A;  2KR5 A;  1QRJ A;  2GZJ A;  1YJW P;  2KGC A;  4CA3 A;  1KC8 Q;  1OR5 A;  1YIJ P;  2JAZ A;  2M5R A;  1RO2 A;  4XRO A;  2MY5 A;  3G21 A;  2LIW A;  4F37 A;  2KWL A;  2VSQ A;  3G1G A;  4XFY A;  3HZQ A;  1VHN A;  2PNG A;  3G71 P;  2KOD A;  2LF4 A; 
#chains in the Genus database with same CATH homology
 2CQ8 A;  2KOP A;  5EJD A;  1F80 D;  3NY7 B;  2MF4 A;  2X2B A;  4IZ6 A;  2CG5 B;  2JU1 A;  4H2Y C;  2EHT A;  2KOS A;  2MR8 A;  2N5I A;  1ACP A;  1VKU A;  2L9F A;  2KOR A;  2DNW A;  4PWV B;  2GDX A;  2FAD A;  1X3O A;  2JGP A;  3RG2 A;  2EHS A;  1AF8 A;  2N6Y A;  2FQ1 A;  2MVU A;  2LL8 A;  2K93 A;  2XZ1 C;  2L22 A;  4MRT C;  2KOO A;  1DNY A;  2FQ0 A;  3GZM A;  1KLP A;  2CGQ A;  2FVE A;  2LML A;  2AFE A;  1T8K A;  5CZD B;  2LOL A;  2L0Q A;  2KG8 A;  4NEO A;  2FQ2 A;  2KW2 A;  3LMO A;  5KP7 B;  5KP6 B;  5HV8 A;  1DV5 A;  2MVV A;  2AF8 A;  2GDW A;  4H2X C;  2FHS C;  2KG9 A;  5KP8 B;  2JU2 A;  1L0I A;  2LIU A;  1L0H A;  2K92 A;  4BPF A;  1HY8 A;  2K0X A;  1HQB A;  2AFD A;  2MD9 A;  2LKI A;  4HKG A;  4BPG A;  4H2W C;  2FVF A;  4BPH A;  2JQ4 A;  2LPK A;  2KR5 A;  2KGA A;  3GZL A;  2K94 A;  2FAC A;  2LTE A;  2KGC A;  4CA3 A;  1OR5 A;  2N6Z A;  2MR7 A;  1NQ4 A;  2M5R A;  2GDY A;  3EJE A;  4DG9 A;  3EJD A;  2MY5 A;  2ROQ A;  2XZ0 D;  2LIW A;  2N50 A;  5HVC A;  3CE7 A;  2K2Q A;  2QNW A;  2N5H A;  2KWL A;  2KOQ A;  2KGE A;  2AVA A;  2CNR A;  2N98 A;  2K0Y A;  2VSQ A;  2FAE A;  2FVA A;  3EJB A;  2KG6 A;  4R0M A;  2KGD A;  2L4B A;  2PNG A;  4PXH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...