1BAJA

Hiv-1 capsid protein c-terminal fragment plus gag p2 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords GAG POLYPROTEIN
publication title Structures of the HIV-1 capsid protein dimerization domain at 2.6 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 23
structure length 71
sequence length 71
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1bajA00
4IPYA 3G0VA 2JYLA 3P05A 4PH0A 3G26A 4QNBA 3DS5A 4XFZA 5DCKA 3G28A 3MGEA 2EIAA 4COPA 4U0CA 5JPAA 1EIAA 3DPHA 4XROA 1EOQA 2JYGA 1QRJA 3DS0A 2M8LA 2JO0A 3G1IA 1A43A 3G29A 2ONTA 2M8PA 4XFYA 1BAJA 4U0EA 4WYMA 2XT1A 4U0BA 5I4TG 5HGOA 5HGNA 2XXMA 2LF4A 3H47A 4U0FA 1AUMA 3DS1A 3DS2A 1A8OA 2M8NA 3G21A 2BUOA 4PH1A 4XRQA 5HGMA 1D1DA 2KODA 2L6EA 3LRYA 4M0IA 4U0DA 1E6JP 3DTJA 3VRLC 4U0AA 3NTEA 4XFXA 4COCA 3DS4A 5HGLA 3DS3A 3G1GA 2XV6A 3H4EA
chains in the Genus database with same CATH superfamily
2JYLA 5HV8A 3G26A 4BPFA 2K93A 1K9MQ 2FQ0A 2MY5A 2AVAA 2WPTA 1QVFO 3U43A 2CWOA 2M8LA 1F80D 3CMAP 3GZMA 2KGCA 5HVCA 2KORA 5KP8B 1AF8A 2EFJA 1VQKP 1VHNA 1YI2P 2L4BA 2P9XA 1IUQA 2JGPA 1MZ8A 1X3OA 4COPA 2KWLA 3CE7A 3DS0A 2X2BA 4XFYA 3CD6P 2K92A 2GDYA 4F37A 4CA3A 2L6EA 2PEJA 1L0IA 5BS2A 1E0HA 2JQ4A 2MF4A 2EHTA 1YJ9P 2VSQA 4BPGA 1NJIQ 4XFZA 5DCKA 3G28A 4H2XC 2EIAA 4U0CA 5F2OA 1A43A 1ZNVA 4U0BA 3CXCO 1DV5A 2QEXP 5EW5E 4H2YC 5KP7B 2N5IA 2PEMA 1UNKA 3NTEA 1Q86Q 3EJDA 3P05A 1Q82Q 2FAEA 3CCUP 1YHQP 1EMVA 1ZMBA 2XZ1C 2M8PA 1BAJA 2JU2A 2KG8A 2ROQA 1ACPA 2M8NA 2BUOA 1BXIA 5HGMA 3EJEA 2M5RA 2KG6A 2FQ2A 5F2KA 2XZ0D 4BPHA 2GZJA 4PH0A 2PEQA 3DS5A 2JBGA 5JPAA 2Z44A 3WBHA 1W2BO 3G1IA 1CEIA 2LIUA 3E2DA 4U0FA 3I56P 2JU1A 2KOSA 2GZFA 3G71P 1AYIA 2FADA 2LKIA 5EJDA 3H47A 2FVFA 2OARA 2K94A 3GKLC 2LMLA 1HQBA 1RO0A 2JO0A 3HYBA 2ONTA 1HY8A 4U0EA 1K30A 2PEOA 1VQ9P 1VQLP 3CCLP 1IMPA 2CNRA 3DS3A 2BHVA 1T8KA 3Q20A 2KGAA 3DPHA 2KGDA 3GJNA 2PENA 2L22A 2CGQA 2N6YA 3VRLC 3I55P 2N6ZA 4XFXA 2XV6A 3CMEP 2L0QA 2Z46A 2Z45A 1IMQA 1K8AQ 5CZDB 1EOQA 2JYGA 3CC4P 1YIJP 3G29A 3EJBA 4PWVB 1D1DA 3CCQP 3CCMP 7CEIA 3DTJA 4COCA 3G1GA 4QNBA 1DNYA 4H2WC 3CC7P 3CCRP 1EIAA 2FACA 2DGYA 5HGNA 2LF4A 2PEKA 1A8OA 2FQ1A 1KC8Q 3CCJP 4U0DA 2JB0A 1M6EX 1K73Q 4IPYA 1RO2A 1M90Q 2KG9A 2KOQA 4HKGA 3LMOA 2KOOA 2OTLP 1YJNP 3RG6C 4NEOA 2QA4P 4IZ6A 4UHPB 1RNIA 2VLQA 1M1KQ 3CCSP 1KQSO 3RG2A 1E6JP 2E1MA 1Q7YQ 4U0AA 2FVAA 1M6NA 2FHSC 2LOLA 3NY7B 1Z6MA 4GR6A 2EG5A 3H0DA 2AFDA 1YJWP 2GZEA 2L9FA 4MRTC 3DS2A 4PH1A 4XRQA 2KODA 2K5XA 3DS4A 1Q81Q 1VQ4P 3G0VA 2MR7A 3MGEA 1VQNP 5KP6B 2AFEA 1VQPP 2LL8A 2MVVA 2PY8A 4WYMA 2CQ8A 2XXMA 1AUMA 3DS1A 4GR2A 1VQ6P 2QNWA 2KR5A 2PNGA 3CCVP 3B5IA 1FR2A 2N5HA 1GXGA 2VLNA 2JAZA 2K0YA 2VLOA 2KOPA 2KGEA 2MVUA 2DNWA 4QKOA 2ERHA 3GZLA 2XT1A 2GYKA 1L0HA 2GDWA 3OW2O 3G21A 4DG9A 5HGLA 2PEIA 3G4SP 1VQ8P 1VQ7P 5F2NA 1KLPA 3CPWO 1M74A 2LPKA 1KD1Q 5BS1A 2LIWA 1S72P 2AF8A 2LTEA 4R0MA 5I4TG 2GZGA 1VKUA 3HZQA 3CCEP 1GXHA 3H4EA 3M1MA 2OTJP 2N98A 2NO8A 2K0DX 2MR8A 1VQOP 2EHSA 4XROA 1QRJA 3G6EP 1UJZA 2FVEA 1JJ2O 2CG5B 4PXHB 2MD9A 1VQMP 4M0IA 3B4QA 3LRYA 2KW2A 1GPJA 2VLPA 1N8RQ 1NQ4A 1VQ5P 5HGOA 1QVGO 3CC2P 2K2QA 2GZIA 1YITP 2N50A 1OR5A 2GDXA 2K0XA
chains in the Genus database with same CATH topology
2PEQA 2JYLA 3G26A 4QNBA 3DS5A 1K9MQ 3CC7P 5JPAA 1QVFO 2Z44A 3CCRP 1EIAA 2CWOA 2M8LA 3WBHA 1W2BO 3G1IA 3CMAP 2DGYA 2XT1A 5HGNA 3E2DA 2LF4A 4U0FA 3I56P 3OW2O 2PEKA 1A8OA 3G21A 2EFJA 1VQKP 1KC8Q 3CCJP 3G71P 4U0DA 1M6EX 1K73Q 5HGLA 1YI2P 3H47A 2P9XA 4IPYA 1RO2A 2PEIA 1IUQA 2OARA 1M90Q 3G4SP 2OTLP 1VQ8P 1VQ7P 4COPA 5F2NA 1YJNP 3CPWO 1M74A 3RG6C 3DS0A 1RO0A 2JO0A 1KD1Q 2QA4P 3HYBA 2ONTA 5BS1A 4XFYA 1S72P 4U0EA 3CD6P 5I4TG 1K30A 2PEOA 1VQ9P 1VQLP 3CCLP 1RNIA 1M1KQ 3CCSP 1KQSO 2L6EA 1E6JP 2PEJA 5BS2A 2E1MA 1Q7YQ 4U0AA 3CCEP 3HZQA 3DS3A 1M6NA 2BHVA 3H4EA 1YJ9P 1NJIQ 3M1MA 2OTJP 3Q20A 4XFZA 5DCKA 3G28A 2EIAA 4U0CA 1VQOP 4GR6A 2EG5A 3DPHA 4XROA 1QRJA 3H0DA 3G6EP 5F2OA 1A43A 1YJWP 4U0BA 3CXCO 1JJ2O 2QEXP 3DS2A 2PENA 4PH1A 4XRQA 1VQMP 2KODA 4M0IA 3VRLC 3I55P 2PEMA 3NTEA 4XFXA 3DS4A 1Q81Q 1VQ4P 3LRYA 2XV6A 1Q86Q 3G0VA 3CMEP 3P05A 1Q82Q 2Z46A 2Z45A 3MGEA 1VQNP 1K8AQ 3CCUP 1YHQP 1VQPP 1N8RQ 1EOQA 2JYGA 3CC4P 1ZMBA 1YIJP 3G29A 2PY8A 2M8PA 1BAJA 4WYMA 1VQ5P 5HGOA 1QVGO 2XXMA 1AUMA 3DS1A 4GR2A 2M8NA 2BUOA 5HGMA 3CC2P 3CCMP 3CCQP 1VQ6P 1D1DA 1YITP 3CCVP 3DTJA 3B5IA 5F2KA 4COCA 3G1GA 4PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPY A;  3G0V A;  2JYL A;  3P05 A;  4PH0 A;  3G26 A;  4QNB A;  3DS5 A;  4XFZ A;  5DCK A;  3G28 A;  3MGE A;  2EIA A;  4COP A;  4U0C A;  5JPA A;  1EIA A;  3DPH A;  4XRO A;  1EOQ A;  2JYG A;  1QRJ A;  3DS0 A;  2M8L A;  2JO0 A;  3G1I A;  1A43 A;  3G29 A;  2ONT A;  2M8P A;  4XFY A;  1BAJ A;  4U0E A;  4WYM A;  2XT1 A;  4U0B A;  5I4T G;  5HGO A;  5HGN A;  2XXM A;  2LF4 A;  3H47 A;  4U0F A;  1AUM A;  3DS1 A;  3DS2 A;  1A8O A;  2M8N A;  3G21 A;  2BUO A;  4PH1 A;  4XRQ A;  5HGM A;  1D1D A;  2KOD A;  2L6E A;  3LRY A;  4M0I A;  4U0D A;  1E6J P;  3DTJ A;  3VRL C;  4U0A A;  3NTE A;  4XFX A;  4COC A;  3DS4 A;  5HGL A;  3DS3 A;  3G1G A;  2XV6 A;  3H4E A; 
#chains in the Genus database with same CATH topology
 2JYL A;  5HV8 A;  3G26 A;  4BPF A;  2K93 A;  1K9M Q;  2FQ0 A;  2MY5 A;  2AVA A;  2WPT A;  1QVF O;  3U43 A;  2CWO A;  2M8L A;  1F80 D;  3CMA P;  3GZM A;  2KGC A;  5HVC A;  2KOR A;  5KP8 B;  1AF8 A;  2EFJ A;  1VQK P;  1VHN A;  1YI2 P;  2L4B A;  2P9X A;  1IUQ A;  2JGP A;  1MZ8 A;  1X3O A;  4COP A;  2KWL A;  3CE7 A;  3DS0 A;  2X2B A;  4XFY A;  3CD6 P;  2K92 A;  2GDY A;  4F37 A;  4CA3 A;  2L6E A;  2PEJ A;  1L0I A;  5BS2 A;  1E0H A;  2JQ4 A;  2MF4 A;  2EHT A;  1YJ9 P;  2VSQ A;  4BPG A;  1NJI Q;  4XFZ A;  5DCK A;  3G28 A;  4H2X C;  2EIA A;  4U0C A;  5F2O A;  1A43 A;  1ZNV A;  4U0B A;  3CXC O;  1DV5 A;  2QEX P;  5EW5 E;  4H2Y C;  5KP7 B;  2N5I A;  2PEM A;  1UNK A;  3NTE A;  1Q86 Q;  3EJD A;  3P05 A;  1Q82 Q;  2FAE A;  3CCU P;  1YHQ P;  1EMV A;  1ZMB A;  2XZ1 C;  2M8P A;  1BAJ A;  2JU2 A;  2KG8 A;  2ROQ A;  1ACP A;  2M8N A;  2BUO A;  1BXI A;  5HGM A;  3EJE A;  2M5R A;  2KG6 A;  2FQ2 A;  5F2K A;  2XZ0 D;  4BPH A;  2GZJ A;  4PH0 A;  2PEQ A;  3DS5 A;  2JBG A;  5JPA A;  2Z44 A;  3WBH A;  1W2B O;  3G1I A;  1CEI A;  2LIU A;  3E2D A;  4U0F A;  3I56 P;  2JU1 A;  2KOS A;  2GZF A;  3G71 P;  1AYI A;  2FAD A;  2LKI A;  5EJD A;  3H47 A;  2FVF A;  2OAR A;  2K94 A;  3GKL C;  2LML A;  1HQB A;  1RO0 A;  2JO0 A;  3HYB A;  2ONT A;  1HY8 A;  4U0E A;  1K30 A;  2PEO A;  1VQ9 P;  1VQL P;  3CCL P;  1IMP A;  2CNR A;  3DS3 A;  2BHV A;  1T8K A;  3Q20 A;  2KGA A;  3DPH A;  2KGD A;  3GJN A;  2PEN A;  2L22 A;  2CGQ A;  2N6Y A;  3VRL C;  3I55 P;  2N6Z A;  4XFX A;  2XV6 A;  3CME P;  2L0Q A;  2Z46 A;  2Z45 A;  1IMQ A;  1K8A Q;  5CZD B;  1EOQ A;  2JYG A;  3CC4 P;  1YIJ P;  3G29 A;  3EJB A;  4PWV B;  1D1D A;  3CCQ P;  3CCM P;  7CEI A;  3DTJ A;  4COC A;  3G1G A;  4QNB A;  1DNY A;  4H2W C;  3CC7 P;  3CCR P;  1EIA A;  2FAC A;  2DGY A;  5HGN A;  2LF4 A;  2PEK A;  1A8O A;  2FQ1 A;  1KC8 Q;  3CCJ P;  4U0D A;  2JB0 A;  1M6E X;  1K73 Q;  4IPY A;  1RO2 A;  1M90 Q;  2KG9 A;  2KOQ A;  4HKG A;  3LMO A;  2KOO A;  2OTL P;  1YJN P;  3RG6 C;  4NEO A;  2QA4 P;  4IZ6 A;  4UHP B;  1RNI A;  2VLQ A;  1M1K Q;  3CCS P;  1KQS O;  3RG2 A;  1E6J P;  2E1M A;  1Q7Y Q;  4U0A A;  2FVA A;  1M6N A;  2FHS C;  2LOL A;  3NY7 B;  1Z6M A;  4GR6 A;  2EG5 A;  3H0D A;  2AFD A;  1YJW P;  2GZE A;  2L9F A;  4MRT C;  3DS2 A;  4PH1 A;  4XRQ A;  2KOD A;  2K5X A;  3DS4 A;  1Q81 Q;  1VQ4 P;  3G0V A;  2MR7 A;  3MGE A;  1VQN P;  5KP6 B;  2AFE A;  1VQP P;  2LL8 A;  2MVV A;  2PY8 A;  4WYM A;  2CQ8 A;  2XXM A;  1AUM A;  3DS1 A;  4GR2 A;  1VQ6 P;  2QNW A;  2KR5 A;  2PNG A;  3CCV P;  3B5I A;  1FR2 A;  2N5H A;  1GXG A;  2VLN A;  2JAZ A;  2K0Y A;  2VLO A;  2KOP A;  2KGE A;  2MVU A;  2DNW A;  4QKO A;  2ERH A;  3GZL A;  2XT1 A;  2GYK A;  1L0H A;  2GDW A;  3OW2 O;  3G21 A;  4DG9 A;  5HGL A;  2PEI A;  3G4S P;  1VQ8 P;  1VQ7 P;  5F2N A;  1KLP A;  3CPW O;  1M74 A;  2LPK A;  1KD1 Q;  5BS1 A;  2LIW A;  1S72 P;  2AF8 A;  2LTE A;  4R0M A;  5I4T G;  2GZG A;  1VKU A;  3HZQ A;  3CCE P;  1GXH A;  3H4E A;  3M1M A;  2OTJ P;  2N98 A;  2NO8 A;  2K0D X;  2MR8 A;  1VQO P;  2EHS A;  4XRO A;  1QRJ A;  3G6E P;  1UJZ A;  2FVE A;  1JJ2 O;  2CG5 B;  4PXH B;  2MD9 A;  1VQM P;  4M0I A;  3B4Q A;  3LRY A;  2KW2 A;  1GPJ A;  2VLP A;  1N8R Q;  1NQ4 A;  1VQ5 P;  5HGO A;  1QVG O;  3CC2 P;  2K2Q A;  2GZI A;  1YIT P;  2N50 A;  1OR5 A;  2GDX A;  2K0X A; 
#chains in the Genus database with same CATH homology
 2PEQ A;  2JYL A;  3G26 A;  4QNB A;  3DS5 A;  1K9M Q;  3CC7 P;  5JPA A;  1QVF O;  2Z44 A;  3CCR P;  1EIA A;  2CWO A;  2M8L A;  3WBH A;  1W2B O;  3G1I A;  3CMA P;  2DGY A;  2XT1 A;  5HGN A;  3E2D A;  2LF4 A;  4U0F A;  3I56 P;  3OW2 O;  2PEK A;  1A8O A;  3G21 A;  2EFJ A;  1VQK P;  1KC8 Q;  3CCJ P;  3G71 P;  4U0D A;  1M6E X;  1K73 Q;  5HGL A;  1YI2 P;  3H47 A;  2P9X A;  4IPY A;  1RO2 A;  2PEI A;  1IUQ A;  2OAR A;  1M90 Q;  3G4S P;  2OTL P;  1VQ8 P;  1VQ7 P;  4COP A;  5F2N A;  1YJN P;  3CPW O;  1M74 A;  3RG6 C;  3DS0 A;  1RO0 A;  2JO0 A;  1KD1 Q;  2QA4 P;  3HYB A;  2ONT A;  5BS1 A;  4XFY A;  1S72 P;  4U0E A;  3CD6 P;  5I4T G;  1K30 A;  2PEO A;  1VQ9 P;  1VQL P;  3CCL P;  1RNI A;  1M1K Q;  3CCS P;  1KQS O;  2L6E A;  1E6J P;  2PEJ A;  5BS2 A;  2E1M A;  1Q7Y Q;  4U0A A;  3CCE P;  3HZQ A;  3DS3 A;  1M6N A;  2BHV A;  3H4E A;  1YJ9 P;  1NJI Q;  3M1M A;  2OTJ P;  3Q20 A;  4XFZ A;  5DCK A;  3G28 A;  2EIA A;  4U0C A;  1VQO P;  4GR6 A;  2EG5 A;  3DPH A;  4XRO A;  1QRJ A;  3H0D A;  3G6E P;  5F2O A;  1A43 A;  1YJW P;  4U0B A;  3CXC O;  1JJ2 O;  2QEX P;  3DS2 A;  2PEN A;  4PH1 A;  4XRQ A;  1VQM P;  2KOD A;  4M0I A;  3VRL C;  3I55 P;  2PEM A;  3NTE A;  4XFX A;  3DS4 A;  1Q81 Q;  1VQ4 P;  3LRY A;  2XV6 A;  1Q86 Q;  3G0V A;  3CME P;  3P05 A;  1Q82 Q;  2Z46 A;  2Z45 A;  3MGE A;  1VQN P;  1K8A Q;  3CCU P;  1YHQ P;  1VQP P;  1N8R Q;  1EOQ A;  2JYG A;  3CC4 P;  1ZMB A;  1YIJ P;  3G29 A;  2PY8 A;  2M8P A;  1BAJ A;  4WYM A;  1VQ5 P;  5HGO A;  1QVG O;  2XXM A;  1AUM A;  3DS1 A;  4GR2 A;  2M8N A;  2BUO A;  5HGM A;  3CC2 P;  3CCM P;  3CCQ P;  1VQ6 P;  1D1D A;  1YIT P;  3CCV P;  3DTJ A;  3B5I A;  5F2K A;  4COC A;  3G1G A;  4PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...