1BAJA

Hiv-1 capsid protein c-terminal fragment plus gag p2 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GAG POLYPROTEIN
publication title Structures of the HIV-1 capsid protein dimerization domain at 2.6 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 23
structure length 71
sequence length 71
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1bajA00
1A8OA 5HGLA 4IPYA 2XT1A 4U0FA 2KODA 4XFZA 2XV6A 2M8LA 2M8PA 3G28A 2ONTA 4PH1A 1E6JP 2JO0A 3DS2A 1AUMA 2BUOA 3DTJA 3G29A 2XXMA 1QRJA 4COPA 5DCKA 3H47A 3NTEA 5I4TG 2JYLA 5JPAA 4QNBA 2M8NA 3G21A 3H4EA 4WYMA 2EIAA 4XFXA 4M0IA 3LRYA 4XRQA 3DS0A 3G1GA 3G26A 4U0AA 3G0VA 3G1IA 5HGOA 4U0BA 4U0EA 4U0CA 2JYGA 3DS5A 3P05A 5HGNA 3DS3A 3DS4A 3VRLC 2LF4A 4COCA 5HGMA 1D1DA 1A43A 4XROA 1EOQA 1EIAA 3DPHA 3MGEA 1BAJA 2L6EA 4PH0A 3DS1A 4XFYA 4U0DA
chains in the Genus database with same CATH superfamily
4GR6A 4IZ6A 2QEXP 4H2WC 1YJNP 2BUOA 3I55P 3CCRP 2L4BA 2GDXA 2JAZA 2LOLA 1D1DA 1OR5A 4XROA 3MGEA 2MF4A 2LL8A 3CCSP 1VQ9P 3CPWO 1Q7YQ 1VQPP 2M8PA 4PH1A 3LMOA 5DCKA 2JU2A 2FAEA 2QA4P 2OTJP 3G6EP 2LIWA 1M6EX 2M5RA 2N5HA 1E0HA 2ERHA 3VRLC 2XZ0D 4PH0A 4QKOA 4H2YC 1L0HA 2DNWA 1N8RQ 1VQKP 4PWVB 1QVFO 4COPA 1AUMA 1T8KA 5BS1A 2CGQA 3H4EA 3HYBA 5HV8A 2AFEA 1AYIA 1VQ8P 4MRTC 5HGNA 2FADA 1Q81Q 1EIAA 2L6EA 3EJEA 2KGCA 5EW5E 2LIUA 1KC8Q 1S72P 1GPJA 1FR2A 2GDYA 2GZJA 3H47A 1JJ2O 1NJIQ 4UHPB 2KORA 1VQ7P 2PENA 1X3OA 2FVEA 3GZLA 4F37A 2KW2A 2PY8A 1RO2A 2FQ0A 2KODA 3NY7B 2ONTA 3GKLC 4CA3A 2EHTA 2CQ8A 3CCUP 1VQOP 3EJDA 3G0VA 2KG9A 2CWOA 5JPAA 3DS1A 2OTLP 2JB0A 2FACA 4XFZA 1YI2P 5F2NA 2LMLA 4BPGA 2N6ZA 4WYMA 2K5XA 2JU1A 4U0BA 1ACPA 4U0CA 2LF4A 1K8AQ 2E1MA 2KWLA 4U0DA 2KGEA 3CCMP 2XV6A 1M1KQ 2GZIA 2XXMA 2EHSA 5KP6B 2JYLA 3EJBA 3CCVP 2GZGA 3B4QA 3G26A 2BHVA 2Z46A 1YHQP 3U43A 3M1MA 3CE7A 1K73Q 4XFYA 5HGLA 3I56P 1YJ9P 2Z45A 1ZNVA 1IMQA 1E6JP 1IMPA 1VQ6P 1KLPA 2EIAA 2FHSC 3HZQA 2K94A 3DS3A 3DS4A 1IUQA 2KGDA 2L0QA 2MVVA 4GR2A 2MD9A 2FVAA 2MY5A 3CMAP 2K2QA 2KOPA 2N50A 2QNWA 2K0YA 1HQBA 2KG8A 3CXCO 1K30A 2XZ1C 1NQ4A 4M0IA 1BXIA 5F2KA 2N5IA 4U0EA 2JYGA 2DGYA 2N98A 2PEKA 2EG5A 1VKUA 2OARA 2CG5B 5F2OA 2XT1A 3CMEP 2JO0A 3DTJA 1YIJP 4HKGA 4PXHB 1VQ5P 5BS2A 1K9MQ 4XRQA 3H0DA 3DS0A 4H2XC 1VQ4P 1M74A 2JBGA 1A43A 1EOQA 1YJWP 2PEIA 1L0IA 1QVGO 1GXGA 5CZDB 1QRJA 3NTEA 3G21A 2GYKA 3CC4P 4XFXA 2CNRA 2LTEA 5HVCA 3G71P 3G4SP 2K92A 3Q20A 1CEIA 1DV5A 2KG6A 2M8LA 3B5IA 3DS2A 3G29A 1MZ8A 4BPHA 5EJDA 5KP7B 3CCLP 3G1GA 2K93A 2K0XA 1KQSO 2AVAA 7CEIA 4U0FA 1VQLP 5HGOA 2FQ2A 2LKIA 1KD1Q 2JQ4A 2FVFA 3CC2P 2VLQA 3OW2O 1Z6MA 2MVUA 2KOQA 3G1IA 3CCJP 2EFJA 2P9XA 2VLOA 2KR5A 2MR7A 2X2BA 1UJZA 3CCEP 4IPYA 1GXHA 1UNKA 3CCQP 2VLNA 3G28A 2LPKA 1HY8A 3RG2A 3GJNA 2AFDA 5I4TG 2K0DX 2FQ1A 2KGAA 2L22A 1VHNA 1YITP 4COCA 2PEQA 4NEOA 1EMVA 1A8OA 1M90Q 4BPFA 2N6YA 2GDWA 3RG6C 1Q82Q 3GZMA 2PEOA 2VLPA 3E2DA 4R0MA 2MR8A 2JGPA 2M8NA 5KP8B 4DG9A 2KOSA 2KOOA 3DS5A 1DNYA 5HGMA 1RNIA 3DPHA 1BAJA 3WBHA 2GZFA 1ZMBA 1Q86Q 2GZEA 2PEMA 2AF8A 1W2BO 1F80D 2PNGA 2WPTA 4QNBA 1RO0A 1AF8A 2L9FA 1VQNP 1VQMP 3LRYA 2Z44A 4U0AA 2PEJA 3CC7P 2NO8A 3P05A 1M6NA 3CD6P 2VSQA 2ROQA
chains in the Genus database with same CATH topology
3CMAP 2PY8A 1RO2A 4GR6A 4U0FA 2QEXP 2KODA 1VQLP 2ONTA 5HGOA 1YJNP 2BUOA 3I55P 3CXCO 3CCRP 1KD1Q 1K30A 3CCUP 1VQOP 3CC2P 4M0IA 3OW2O 5F2KA 3G0VA 3G1IA 4U0EA 3CCJP 2JYGA 2DGYA 2EFJA 2P9XA 1D1DA 4XROA 3CCEP 3MGEA 2PEKA 2CWOA 2EG5A 5JPAA 3DS1A 2OTLP 3CCSP 1VQ9P 2OARA 4IPYA 3CPWO 5F2OA 2XT1A 1Q7YQ 1VQPP 4XFZA 3CCQP 1YI2P 5F2NA 2M8PA 3G28A 4PH1A 3CMEP 2JO0A 3DTJA 1YIJP 5DCKA 5I4TG 1VQ5P 5BS2A 4WYMA 1K9MQ 2QA4P 4XRQA 3H0DA 2OTJP 3DS0A 3G6EP 1VQ4P 4U0BA 1YITP 1M6EX 4U0CA 1M74A 4COCA 3VRLC 2LF4A 1A43A 1K8AQ 1EOQA 2E1MA 2PEQA 1YJWP 4PH0A 2PEIA 4U0DA 1A8OA 1M90Q 3RG6C 1N8RQ 1Q82Q 3CCMP 1VQKP 2PEOA 2XV6A 1QVGO 1QVFO 1M1KQ 3E2DA 1AUMA 4COPA 2XXMA 1QRJA 3NTEA 5BS1A 2JYLA 2M8NA 3G21A 3H4EA 3CC4P 3HYBA 4XFXA 3CCVP 1VQ8P 3G26A 2BHVA 3DS5A 5HGNA 2Z46A 5HGMA 1YHQP 3G71P 1RNIA 3M1MA 1Q81Q 1EIAA 3G4SP 3DPHA 1BAJA 2L6EA 3Q20A 3WBHA 4XFYA 1K73Q 5HGLA 3I56P 1YJ9P 2Z45A 1ZMBA 1Q86Q 2PEMA 2M8LA 1KC8Q 1S72P 3B5IA 1W2BO 1E6JP 3DS2A 3G29A 3H47A 1JJ2O 1VQ6P 1NJIQ 4QNBA 1RO0A 1VQNP 2EIAA 3CCLP 1VQMP 3LRYA 3G1GA 1VQ7P 2PENA 2Z44A 4U0AA 2PEJA 3HZQA 3CC7P 3P05A 3DS4A 3DS3A 1IUQA 1M6NA 4GR2A 3CD6P 1KQSO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8O A;  5HGL A;  4IPY A;  2XT1 A;  4U0F A;  2KOD A;  4XFZ A;  2XV6 A;  2M8L A;  2M8P A;  3G28 A;  2ONT A;  4PH1 A;  1E6J P;  2JO0 A;  3DS2 A;  1AUM A;  2BUO A;  3DTJ A;  3G29 A;  2XXM A;  1QRJ A;  4COP A;  5DCK A;  3H47 A;  3NTE A;  5I4T G;  2JYL A;  5JPA A;  4QNB A;  2M8N A;  3G21 A;  3H4E A;  4WYM A;  2EIA A;  4XFX A;  4M0I A;  3LRY A;  4XRQ A;  3DS0 A;  3G1G A;  3G26 A;  4U0A A;  3G0V A;  3G1I A;  5HGO A;  4U0B A;  4U0E A;  4U0C A;  2JYG A;  3DS5 A;  3P05 A;  5HGN A;  3DS3 A;  3DS4 A;  3VRL C;  2LF4 A;  4COC A;  5HGM A;  1D1D A;  1A43 A;  4XRO A;  1EOQ A;  1EIA A;  3DPH A;  3MGE A;  1BAJ A;  2L6E A;  4PH0 A;  3DS1 A;  4XFY A;  4U0D A; 
#chains in the Genus database with same CATH topology
 4GR6 A;  4IZ6 A;  2QEX P;  4H2W C;  1YJN P;  2BUO A;  3I55 P;  3CCR P;  2L4B A;  2GDX A;  2JAZ A;  2LOL A;  1D1D A;  1OR5 A;  4XRO A;  3MGE A;  2MF4 A;  2LL8 A;  3CCS P;  1VQ9 P;  3CPW O;  1Q7Y Q;  1VQP P;  2M8P A;  4PH1 A;  3LMO A;  5DCK A;  2JU2 A;  2FAE A;  2QA4 P;  2OTJ P;  3G6E P;  2LIW A;  1M6E X;  2M5R A;  2N5H A;  1E0H A;  2ERH A;  3VRL C;  2XZ0 D;  4PH0 A;  4QKO A;  4H2Y C;  1L0H A;  2DNW A;  1N8R Q;  1VQK P;  4PWV B;  1QVF O;  4COP A;  1AUM A;  1T8K A;  5BS1 A;  2CGQ A;  3H4E A;  3HYB A;  5HV8 A;  2AFE A;  1AYI A;  1VQ8 P;  4MRT C;  5HGN A;  2FAD A;  1Q81 Q;  1EIA A;  2L6E A;  3EJE A;  2KGC A;  5EW5 E;  2LIU A;  1KC8 Q;  1S72 P;  1GPJ A;  1FR2 A;  2GDY A;  2GZJ A;  3H47 A;  1JJ2 O;  1NJI Q;  4UHP B;  2KOR A;  1VQ7 P;  2PEN A;  1X3O A;  2FVE A;  3GZL A;  4F37 A;  2KW2 A;  2PY8 A;  1RO2 A;  2FQ0 A;  2KOD A;  3NY7 B;  2ONT A;  3GKL C;  4CA3 A;  2EHT A;  2CQ8 A;  3CCU P;  1VQO P;  3EJD A;  3G0V A;  2KG9 A;  2CWO A;  5JPA A;  3DS1 A;  2OTL P;  2JB0 A;  2FAC A;  4XFZ A;  1YI2 P;  5F2N A;  2LML A;  4BPG A;  2N6Z A;  4WYM A;  2K5X A;  2JU1 A;  4U0B A;  1ACP A;  4U0C A;  2LF4 A;  1K8A Q;  2E1M A;  2KWL A;  4U0D A;  2KGE A;  3CCM P;  2XV6 A;  1M1K Q;  2GZI A;  2XXM A;  2EHS A;  5KP6 B;  2JYL A;  3EJB A;  3CCV P;  2GZG A;  3B4Q A;  3G26 A;  2BHV A;  2Z46 A;  1YHQ P;  3U43 A;  3M1M A;  3CE7 A;  1K73 Q;  4XFY A;  5HGL A;  3I56 P;  1YJ9 P;  2Z45 A;  1ZNV A;  1IMQ A;  1E6J P;  1IMP A;  1VQ6 P;  1KLP A;  2EIA A;  2FHS C;  3HZQ A;  2K94 A;  3DS3 A;  3DS4 A;  1IUQ A;  2KGD A;  2L0Q A;  2MVV A;  4GR2 A;  2MD9 A;  2FVA A;  2MY5 A;  3CMA P;  2K2Q A;  2KOP A;  2N50 A;  2QNW A;  2K0Y A;  1HQB A;  2KG8 A;  3CXC O;  1K30 A;  2XZ1 C;  1NQ4 A;  4M0I A;  1BXI A;  5F2K A;  2N5I A;  4U0E A;  2JYG A;  2DGY A;  2N98 A;  2PEK A;  2EG5 A;  1VKU A;  2OAR A;  2CG5 B;  5F2O A;  2XT1 A;  3CME P;  2JO0 A;  3DTJ A;  1YIJ P;  4HKG A;  4PXH B;  1VQ5 P;  5BS2 A;  1K9M Q;  4XRQ A;  3H0D A;  3DS0 A;  4H2X C;  1VQ4 P;  1M74 A;  2JBG A;  1A43 A;  1EOQ A;  1YJW P;  2PEI A;  1L0I A;  1QVG O;  1GXG A;  5CZD B;  1QRJ A;  3NTE A;  3G21 A;  2GYK A;  3CC4 P;  4XFX A;  2CNR A;  2LTE A;  5HVC A;  3G71 P;  3G4S P;  2K92 A;  3Q20 A;  1CEI A;  1DV5 A;  2KG6 A;  2M8L A;  3B5I A;  3DS2 A;  3G29 A;  1MZ8 A;  4BPH A;  5EJD A;  5KP7 B;  3CCL P;  3G1G A;  2K93 A;  2K0X A;  1KQS O;  2AVA A;  7CEI A;  4U0F A;  1VQL P;  5HGO A;  2FQ2 A;  2LKI A;  1KD1 Q;  2JQ4 A;  2FVF A;  3CC2 P;  2VLQ A;  3OW2 O;  1Z6M A;  2MVU A;  2KOQ A;  3G1I A;  3CCJ P;  2EFJ A;  2P9X A;  2VLO A;  2KR5 A;  2MR7 A;  2X2B A;  1UJZ A;  3CCE P;  4IPY A;  1GXH A;  1UNK A;  3CCQ P;  2VLN A;  3G28 A;  2LPK A;  1HY8 A;  3RG2 A;  3GJN A;  2AFD A;  5I4T G;  2K0D X;  2FQ1 A;  2KGA A;  2L22 A;  1VHN A;  1YIT P;  4COC A;  2PEQ A;  4NEO A;  1EMV A;  1A8O A;  1M90 Q;  4BPF A;  2N6Y A;  2GDW A;  3RG6 C;  1Q82 Q;  3GZM A;  2PEO A;  2VLP A;  3E2D A;  4R0M A;  2MR8 A;  2JGP A;  2M8N A;  5KP8 B;  4DG9 A;  2KOS A;  2KOO A;  3DS5 A;  1DNY A;  5HGM A;  1RNI A;  3DPH A;  1BAJ A;  3WBH A;  2GZF A;  1ZMB A;  1Q86 Q;  2GZE A;  2PEM A;  2AF8 A;  1W2B O;  1F80 D;  2PNG A;  2WPT A;  4QNB A;  1RO0 A;  1AF8 A;  2L9F A;  1VQN P;  1VQM P;  3LRY A;  2Z44 A;  4U0A A;  2PEJ A;  3CC7 P;  2NO8 A;  3P05 A;  1M6N A;  3CD6 P;  2VSQ A;  2ROQ A; 
#chains in the Genus database with same CATH homology
 3CMA P;  2PY8 A;  1RO2 A;  4GR6 A;  4U0F A;  2QEX P;  2KOD A;  1VQL P;  2ONT A;  5HGO A;  1YJN P;  2BUO A;  3I55 P;  3CXC O;  3CCR P;  1KD1 Q;  1K30 A;  3CCU P;  1VQO P;  3CC2 P;  4M0I A;  3OW2 O;  5F2K A;  3G0V A;  3G1I A;  4U0E A;  3CCJ P;  2JYG A;  2DGY A;  2EFJ A;  2P9X A;  1D1D A;  4XRO A;  3CCE P;  3MGE A;  2PEK A;  2CWO A;  2EG5 A;  5JPA A;  3DS1 A;  2OTL P;  3CCS P;  1VQ9 P;  2OAR A;  4IPY A;  3CPW O;  5F2O A;  2XT1 A;  1Q7Y Q;  1VQP P;  4XFZ A;  3CCQ P;  1YI2 P;  5F2N A;  2M8P A;  3G28 A;  4PH1 A;  3CME P;  2JO0 A;  3DTJ A;  1YIJ P;  5DCK A;  5I4T G;  1VQ5 P;  5BS2 A;  4WYM A;  1K9M Q;  2QA4 P;  4XRQ A;  3H0D A;  2OTJ P;  3DS0 A;  3G6E P;  1VQ4 P;  4U0B A;  1YIT P;  1M6E X;  4U0C A;  1M74 A;  4COC A;  3VRL C;  2LF4 A;  1A43 A;  1K8A Q;  1EOQ A;  2E1M A;  2PEQ A;  1YJW P;  4PH0 A;  2PEI A;  4U0D A;  1A8O A;  1M90 Q;  3RG6 C;  1N8R Q;  1Q82 Q;  3CCM P;  1VQK P;  2PEO A;  2XV6 A;  1QVG O;  1QVF O;  1M1K Q;  3E2D A;  1AUM A;  4COP A;  2XXM A;  1QRJ A;  3NTE A;  5BS1 A;  2JYL A;  2M8N A;  3G21 A;  3H4E A;  3CC4 P;  3HYB A;  4XFX A;  3CCV P;  1VQ8 P;  3G26 A;  2BHV A;  3DS5 A;  5HGN A;  2Z46 A;  5HGM A;  1YHQ P;  3G71 P;  1RNI A;  3M1M A;  1Q81 Q;  1EIA A;  3G4S P;  3DPH A;  1BAJ A;  2L6E A;  3Q20 A;  3WBH A;  4XFY A;  1K73 Q;  5HGL A;  3I56 P;  1YJ9 P;  2Z45 A;  1ZMB A;  1Q86 Q;  2PEM A;  2M8L A;  1KC8 Q;  1S72 P;  3B5I A;  1W2B O;  1E6J P;  3DS2 A;  3G29 A;  3H47 A;  1JJ2 O;  1VQ6 P;  1NJI Q;  4QNB A;  1RO0 A;  1VQN P;  2EIA A;  3CCL P;  1VQM P;  3LRY A;  3G1G A;  1VQ7 P;  2PEN A;  2Z44 A;  4U0A A;  2PEJ A;  3HZQ A;  3CC7 P;  3P05 A;  3DS4 A;  3DS3 A;  1IUQ A;  1M6N A;  4GR2 A;  3CD6 P;  1KQS O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...