1BAJA

Hiv-1 capsid protein c-terminal fragment plus gag p2 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the HIV-1 capsid protein dimerization domain at 2.6 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN
total genus 23
structure length 71
sequence length 71
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1bajA00
3H4EA 4M0IA 4U0CA 2XXMA 1A43A 3DS1A 2M8PA 3DPHA 3P05A 2JYLA 4WYMA 3G28A 2L6EA 2M8NA 2ONTA 3DS3A 3G1IA 4U0FA 3G29A 3LRYA 3VRLC 4XFXA 1A8OA 3DS4A 2LF4A 3G26A 4U0EA 4PH0A 1E6JP 3DTJA 4COCA 4U0DA 2JYGA 2EIAA 3DS2A 4XFZA 5HGNA 3G21A 4U0BA 1AUMA 1BAJA 3G0VA 4IPYA 4COPA 2XV6A 5I4TG 3DS5A 3NTEA 3MGEA 5HGOA 1QRJA 3H47A 2BUOA 2JO0A 4PH1A 4XFYA 2KODA 5JPAA 4XRQA 2M8LA 5DCKA 1EOQA 4QNBA 4U0AA 4XROA 1D1DA 3G1GA 3DS0A 5HGLA 1EIAA 5HGMA 2XT1A
chains in the Genus database with same CATH superfamily
2GZEA 1HQBA 3P05A 1VQMP 3G29A 4XFXA 2VLNA 3NY7B 2WPTA 2KOPA 3H47A 1IUQA 1VKUA 2EFJA 5BS1A 1YHQP 2CQ8A 1M6EX 2VSQA 2FVEA 2L6EA 2CNRA 3VRLC 4F37A 1KD1Q 1K8AQ 4H2XC 5EW5E 2DGYA 2MVVA 1VQPP 1Q82Q 3G71P 2ERHA 2KGAA 2XT1A 2EG5A 1RNIA 2Z45A 3DS4A 5KP6B 3DTJA 4U0DA 1M74A 4BPHA 1GPJA 1VQ9P 1AUMA 2L22A 2DNWA 3NTEA 2L4BA 3GZMA 1Q81Q 1UJZA 3GKLC 2KGDA 1Z6MA 2N5HA 2MR7A 4M0IA 2JAZA 2NO8A 2PEOA 2LIUA 4U0FA 2M5RA 4H2WC 1E6JP 3CCEP 2GZGA 1N8RQ 2OARA 2N6YA 3G0VA 2GZIA 2PEJA 2N98A 2KODA 1EOQA 2MVUA 2KG9A 4HKGA 3CE7A 2XXMA 2PEIA 2FQ1A 4U0EA 1YIJP 1KQSO 2KR5A 1VHNA 2ROQA 2P9XA 4BPFA 3CCVP 2K0DX 5F2OA 2EHSA 2FADA 2VLQA 1D1DA 4PWVB 3H4EA 1DV5A 5KP7B 1QVFO 2CWOA 2FAEA 2FVAA 1AF8A 2LIWA 3H0DA 1IMQA 1L0HA 4PH0A 1UNKA 2KGCA 2MD9A 2PEKA 2K0YA 2FHSC 2QEXP 3CCMP 4XROA 5CZDB 2XZ0D 5HGLA 2AFEA 4U0CA 3CMAP 4H2YC 3B5IA 2ONTA 3DS3A 1GXHA 1Q86Q 1RO2A 1VQKP 3U43A 1EMVA 2KW2A 2K93A 1IMPA 1YJNP 2E1MA 5HVCA 1M90Q 1ZMBA 2JO0A 4QKOA 4R0MA 1VQ6P 2X2BA 1EIAA 3CMEP 2FQ0A 3EJEA 1VQ4P 3DS2A 3G21A 4U0BA 4IPYA 2FQ2A 1AYIA 2BUOA 3HZQA 2PENA 1GXGA 5BS2A 2KG6A 1KLPA 1YJWP 2M8PA 1K73Q 3EJDA 3G4SP 3G1IA 4IZ6A 1A8OA 2N5IA 2Z44A 4GR6A 1K30A 2GDXA 2LPKA 3GJNA 3G1GA 3DS0A 5HGMA 2K94A 2KOSA 3HYBA 3CC4P 1ZNVA 1A43A 2QA4P 2FVFA 2JYLA 2LF4A 1W2BO 3CPWO 3LMOA 3CCSP 3CD6P 3RG6C 4XFZA 4PXHB 1BAJA 2LL8A 1QRJA 2GDWA 2N6ZA 3Q20A 1HY8A 2JBGA 2KGEA 1NJIQ 3G28A 2MY5A 3I56P 2CG5B 5EJDA 1E0HA 4GR2A 2JYGA 2KWLA 2OTJP 4COPA 2PEMA 4XFYA 1JJ2O 2Z46A 1VQNP 1VQ8P 3CCLP 1CEIA 2KORA 2JQ4A 5F2NA 2M8NA 2N50A 2L9FA 3E2DA 2MR8A 1VQOP 3MGEA 2EHTA 4PH1A 2VLOA 2JGPA 2M8LA 1ACPA 3G6EP 2AVAA 1QVGO 4MRTC 4CA3A 2K5XA 3EJBA 2LOLA 1L0IA 1YITP 1M1KQ 4COCA 1Q7YQ 2LKIA 1KC8Q 1FR2A 5DCKA 1S72P 4NEOA 2PY8A 2GZJA 3CXCO 2LTEA 1VQ5P 5F2KA 3OW2O 3M1MA 4WYMA 5HV8A 1DNYA 2JU1A 2L0QA 2EIAA 1RO0A 2K92A 2OTLP 5I4TG 2GZFA 5HGOA 2XZ1C 4QNBA 2KOOA 2PNGA 4UHPB 3CCRP 3CC7P 2MF4A 2JU2A 2GYKA 3LRYA 2PEQA 2FACA 3CCUP 1OR5A 2K2QA 5HGNA 3B4QA 1T8KA 4DG9A 2QNWA 1YI2P 1MZ8A 1M6NA 2AFDA 7CEIA 4U0AA 2CGQA 3CC2P 1VQLP 2LMLA 1VQ7P 3I55P 1K9MQ 1NQ4A 3DS1A 3DPHA 1F80D 2VLPA 3WBHA 4BPGA 1X3OA 2KOQA 3G26A 2GDYA 2KG8A 3GZLA 3CCJP 3CCQP 2XV6A 1BXIA 3DS5A 5KP8B 2K0XA 5JPAA 2AF8A 4XRQA 2JB0A 1YJ9P 2BHVA 3RG2A
chains in the Genus database with same CATH topology
2XXMA 2M8PA 2PEIA 3P05A 1VQMP 1K73Q 3G4SP 1YITP 3G1IA 3G29A 4XFXA 1A8OA 4U0EA 1M1KQ 4COCA 1Q7YQ 1YIJP 1KC8Q 1KQSO 2Z44A 4GR6A 2P9XA 1K30A 3CCVP 3H47A 1IUQA 5F2OA 2EFJA 5DCKA 1S72P 5BS1A 1D1DA 2PY8A 3G1GA 1YHQP 3DS0A 5HGMA 1M6EX 3CXCO 3H4EA 3HYBA 3CC4P 1VQ5P 5F2KA 1A43A 3M1MA 2QA4P 3OW2O 2JYLA 4WYMA 2L6EA 1QVFO 2CWOA 3VRLC 3H0DA 2LF4A 1W2BO 4PH0A 3CPWO 3CCSP 3CD6P 1KD1Q 2EIAA 3RG6C 4XFZA 1K8AQ 1RO0A 2PEKA 1BAJA 2OTLP 5I4TG 2DGYA 5HGOA 1QRJA 1VQPP 2QEXP 1Q82Q 3G71P 3CCMP 4QNBA 4XROA 3Q20A 5HGLA 2XT1A 2EG5A 4U0CA 3CCRP 3CC7P 3CMAP 1RNIA 3B5IA 3G28A 2ONTA 3DS3A 1NJIQ 1Q86Q 3I56P 1RO2A 1VQKP 3LRYA 2PEQA 2Z45A 3DS4A 4GR2A 3CCUP 3DTJA 1YJNP 4U0DA 2JYGA 5HGNA 1M74A 1VQ9P 1AUMA 2OTJP 4COPA 2E1MA 3NTEA 1YI2P 1M90Q 1M6NA 1ZMBA 2PEMA 2JO0A 4XFYA 1JJ2O 4U0AA 2Z46A 1Q81Q 1VQNP 3CC2P 1VQLP 1VQ6P 1VQ7P 3I55P 1EIAA 1K9MQ 1VQ8P 3CMEP 3CCLP 4M0IA 3DS1A 3DPHA 5F2NA 2M8NA 2PEOA 3WBHA 4U0FA 3G26A 1VQ4P 1E6JP 3CCEP 3E2DA 3DS2A 1N8RQ 3G21A 2OARA 3CCJP 3CCQP 4U0BA 3G0VA 1VQOP 4IPYA 2XV6A 3DS5A 2PEJA 3MGEA 2BUOA 5JPAA 3HZQA 4PH1A 2KODA 2PENA 4XRQA 2M8LA 1EOQA 5BS2A 1YJ9P 2BHVA 3G6EP 1YJWP 1QVGO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4E A;  4M0I A;  4U0C A;  2XXM A;  1A43 A;  3DS1 A;  2M8P A;  3DPH A;  3P05 A;  2JYL A;  4WYM A;  3G28 A;  2L6E A;  2M8N A;  2ONT A;  3DS3 A;  3G1I A;  4U0F A;  3G29 A;  3LRY A;  3VRL C;  4XFX A;  1A8O A;  3DS4 A;  2LF4 A;  3G26 A;  4U0E A;  4PH0 A;  1E6J P;  3DTJ A;  4COC A;  4U0D A;  2JYG A;  2EIA A;  3DS2 A;  4XFZ A;  5HGN A;  3G21 A;  4U0B A;  1AUM A;  1BAJ A;  3G0V A;  4IPY A;  4COP A;  2XV6 A;  5I4T G;  3DS5 A;  3NTE A;  3MGE A;  5HGO A;  1QRJ A;  3H47 A;  2BUO A;  2JO0 A;  4PH1 A;  4XFY A;  2KOD A;  5JPA A;  4XRQ A;  2M8L A;  5DCK A;  1EOQ A;  4QNB A;  4U0A A;  4XRO A;  1D1D A;  3G1G A;  3DS0 A;  5HGL A;  1EIA A;  5HGM A;  2XT1 A; 
#chains in the Genus database with same CATH topology
 2GZE A;  1HQB A;  3P05 A;  1VQM P;  3G29 A;  4XFX A;  2VLN A;  3NY7 B;  2WPT A;  2KOP A;  3H47 A;  1IUQ A;  1VKU A;  2EFJ A;  5BS1 A;  1YHQ P;  2CQ8 A;  1M6E X;  2VSQ A;  2FVE A;  2L6E A;  2CNR A;  3VRL C;  4F37 A;  1KD1 Q;  1K8A Q;  4H2X C;  5EW5 E;  2DGY A;  2MVV A;  1VQP P;  1Q82 Q;  3G71 P;  2ERH A;  2KGA A;  2XT1 A;  2EG5 A;  1RNI A;  2Z45 A;  3DS4 A;  5KP6 B;  3DTJ A;  4U0D A;  1M74 A;  4BPH A;  1GPJ A;  1VQ9 P;  1AUM A;  2L22 A;  2DNW A;  3NTE A;  2L4B A;  3GZM A;  1Q81 Q;  1UJZ A;  3GKL C;  2KGD A;  1Z6M A;  2N5H A;  2MR7 A;  4M0I A;  2JAZ A;  2NO8 A;  2PEO A;  2LIU A;  4U0F A;  2M5R A;  4H2W C;  1E6J P;  3CCE P;  2GZG A;  1N8R Q;  2OAR A;  2N6Y A;  3G0V A;  2GZI A;  2PEJ A;  2N98 A;  2KOD A;  1EOQ A;  2MVU A;  2KG9 A;  4HKG A;  3CE7 A;  2XXM A;  2PEI A;  2FQ1 A;  4U0E A;  1YIJ P;  1KQS O;  2KR5 A;  1VHN A;  2ROQ A;  2P9X A;  4BPF A;  3CCV P;  2K0D X;  5F2O A;  2EHS A;  2FAD A;  2VLQ A;  1D1D A;  4PWV B;  3H4E A;  1DV5 A;  5KP7 B;  1QVF O;  2CWO A;  2FAE A;  2FVA A;  1AF8 A;  2LIW A;  3H0D A;  1IMQ A;  1L0H A;  4PH0 A;  1UNK A;  2KGC A;  2MD9 A;  2PEK A;  2K0Y A;  2FHS C;  2QEX P;  3CCM P;  4XRO A;  5CZD B;  2XZ0 D;  5HGL A;  2AFE A;  4U0C A;  3CMA P;  4H2Y C;  3B5I A;  2ONT A;  3DS3 A;  1GXH A;  1Q86 Q;  1RO2 A;  1VQK P;  3U43 A;  1EMV A;  2KW2 A;  2K93 A;  1IMP A;  1YJN P;  2E1M A;  5HVC A;  1M90 Q;  1ZMB A;  2JO0 A;  4QKO A;  4R0M A;  1VQ6 P;  2X2B A;  1EIA A;  3CME P;  2FQ0 A;  3EJE A;  1VQ4 P;  3DS2 A;  3G21 A;  4U0B A;  4IPY A;  2FQ2 A;  1AYI A;  2BUO A;  3HZQ A;  2PEN A;  1GXG A;  5BS2 A;  2KG6 A;  1KLP A;  1YJW P;  2M8P A;  1K73 Q;  3EJD A;  3G4S P;  3G1I A;  4IZ6 A;  1A8O A;  2N5I A;  2Z44 A;  4GR6 A;  1K30 A;  2GDX A;  2LPK A;  3GJN A;  3G1G A;  3DS0 A;  5HGM A;  2K94 A;  2KOS A;  3HYB A;  3CC4 P;  1ZNV A;  1A43 A;  2QA4 P;  2FVF A;  2JYL A;  2LF4 A;  1W2B O;  3CPW O;  3LMO A;  3CCS P;  3CD6 P;  3RG6 C;  4XFZ A;  4PXH B;  1BAJ A;  2LL8 A;  1QRJ A;  2GDW A;  2N6Z A;  3Q20 A;  1HY8 A;  2JBG A;  2KGE A;  1NJI Q;  3G28 A;  2MY5 A;  3I56 P;  2CG5 B;  5EJD A;  1E0H A;  4GR2 A;  2JYG A;  2KWL A;  2OTJ P;  4COP A;  2PEM A;  4XFY A;  1JJ2 O;  2Z46 A;  1VQN P;  1VQ8 P;  3CCL P;  1CEI A;  2KOR A;  2JQ4 A;  5F2N A;  2M8N A;  2N50 A;  2L9F A;  3E2D A;  2MR8 A;  1VQO P;  3MGE A;  2EHT A;  4PH1 A;  2VLO A;  2JGP A;  2M8L A;  1ACP A;  3G6E P;  2AVA A;  1QVG O;  4MRT C;  4CA3 A;  2K5X A;  3EJB A;  2LOL A;  1L0I A;  1YIT P;  1M1K Q;  4COC A;  1Q7Y Q;  2LKI A;  1KC8 Q;  1FR2 A;  5DCK A;  1S72 P;  4NEO A;  2PY8 A;  2GZJ A;  3CXC O;  2LTE A;  1VQ5 P;  5F2K A;  3OW2 O;  3M1M A;  4WYM A;  5HV8 A;  1DNY A;  2JU1 A;  2L0Q A;  2EIA A;  1RO0 A;  2K92 A;  2OTL P;  5I4T G;  2GZF A;  5HGO A;  2XZ1 C;  4QNB A;  2KOO A;  2PNG A;  4UHP B;  3CCR P;  3CC7 P;  2MF4 A;  2JU2 A;  2GYK A;  3LRY A;  2PEQ A;  2FAC A;  3CCU P;  1OR5 A;  2K2Q A;  5HGN A;  3B4Q A;  1T8K A;  4DG9 A;  2QNW A;  1YI2 P;  1MZ8 A;  1M6N A;  2AFD A;  7CEI A;  4U0A A;  2CGQ A;  3CC2 P;  1VQL P;  2LML A;  1VQ7 P;  3I55 P;  1K9M Q;  1NQ4 A;  3DS1 A;  3DPH A;  1F80 D;  2VLP A;  3WBH A;  4BPG A;  1X3O A;  2KOQ A;  3G26 A;  2GDY A;  2KG8 A;  3GZL A;  3CCJ P;  3CCQ P;  2XV6 A;  1BXI A;  3DS5 A;  5KP8 B;  2K0X A;  5JPA A;  2AF8 A;  4XRQ A;  2JB0 A;  1YJ9 P;  2BHV A;  3RG2 A; 
#chains in the Genus database with same CATH homology
 2XXM A;  2M8P A;  2PEI A;  3P05 A;  1VQM P;  1K73 Q;  3G4S P;  1YIT P;  3G1I A;  3G29 A;  4XFX A;  1A8O A;  4U0E A;  1M1K Q;  4COC A;  1Q7Y Q;  1YIJ P;  1KC8 Q;  1KQS O;  2Z44 A;  4GR6 A;  2P9X A;  1K30 A;  3CCV P;  3H47 A;  1IUQ A;  5F2O A;  2EFJ A;  5DCK A;  1S72 P;  5BS1 A;  1D1D A;  2PY8 A;  3G1G A;  1YHQ P;  3DS0 A;  5HGM A;  1M6E X;  3CXC O;  3H4E A;  3HYB A;  3CC4 P;  1VQ5 P;  5F2K A;  1A43 A;  3M1M A;  2QA4 P;  3OW2 O;  2JYL A;  4WYM A;  2L6E A;  1QVF O;  2CWO A;  3VRL C;  3H0D A;  2LF4 A;  1W2B O;  4PH0 A;  3CPW O;  3CCS P;  3CD6 P;  1KD1 Q;  2EIA A;  3RG6 C;  4XFZ A;  1K8A Q;  1RO0 A;  2PEK A;  1BAJ A;  2OTL P;  5I4T G;  2DGY A;  5HGO A;  1QRJ A;  1VQP P;  2QEX P;  1Q82 Q;  3G71 P;  3CCM P;  4QNB A;  4XRO A;  3Q20 A;  5HGL A;  2XT1 A;  2EG5 A;  4U0C A;  3CCR P;  3CC7 P;  3CMA P;  1RNI A;  3B5I A;  3G28 A;  2ONT A;  3DS3 A;  1NJI Q;  1Q86 Q;  3I56 P;  1RO2 A;  1VQK P;  3LRY A;  2PEQ A;  2Z45 A;  3DS4 A;  4GR2 A;  3CCU P;  3DTJ A;  1YJN P;  4U0D A;  2JYG A;  5HGN A;  1M74 A;  1VQ9 P;  1AUM A;  2OTJ P;  4COP A;  2E1M A;  3NTE A;  1YI2 P;  1M90 Q;  1M6N A;  1ZMB A;  2PEM A;  2JO0 A;  4XFY A;  1JJ2 O;  4U0A A;  2Z46 A;  1Q81 Q;  1VQN P;  3CC2 P;  1VQL P;  1VQ6 P;  1VQ7 P;  3I55 P;  1EIA A;  1K9M Q;  1VQ8 P;  3CME P;  3CCL P;  4M0I A;  3DS1 A;  3DPH A;  5F2N A;  2M8N A;  2PEO A;  3WBH A;  4U0F A;  3G26 A;  1VQ4 P;  1E6J P;  3CCE P;  3E2D A;  3DS2 A;  1N8R Q;  3G21 A;  2OAR A;  3CCJ P;  3CCQ P;  4U0B A;  3G0V A;  1VQO P;  4IPY A;  2XV6 A;  3DS5 A;  2PEJ A;  3MGE A;  2BUO A;  5JPA A;  3HZQ A;  4PH1 A;  2KOD A;  2PEN A;  4XRQ A;  2M8L A;  1EOQ A;  5BS2 A;  1YJ9 P;  2BHV A;  3G6E P;  1YJW P;  1QVG O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...