3EJBA

Crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/lipid transport
molecule keywords Acyl carrier protein
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejbA00
2AF8A 5KP6B 5KP8B 2FHSC 2XZ0D 2ROQA 2N98A 1L0HA 4BPGA 4R0MA 2AFEA 2KG8A 2GDWA 2KGEA 1VKUA 2L9FA 4H2WC 2MR8A 5HVCA 2X2BA 1HQBA 2LMLA 2N50A 4NEOA 2K0YA 4H2XC 1T8KA 2JQ4A 2CGQA 4HKGA 1NQ4A 1KLPA 2FVAA 4DG9A 4PWVB 3EJBA 2N5IA 2AFDA 2XZ1C 4H2YC 1ACPA 1AF8A 4PXHB 2MR7A 2K0XA 2FADA 2LIUA 2KR5A 2KWLA 2LIWA 2PNGA 3EJEA 4IZ6A 2LL8A 2FVEA 3RG2A 2LTEA 2CG5B 2KGDA 2FQ0A 2KGAA 2QNWA 2KORA 2MY5A 1F80D 4MRTC 2KW2A 2GDXA 2KG6A 1L0IA 2K94A 5CZDB 2EHTA 2L0QA 2MVUA 2JU2A 2LPKA 2LOLA 3GZLA 2KOSA 2K93A 3CE7A 2KOOA 2JGPA 2K2QA 3LMOA 2KOQA 2N6ZA 2AVAA 2N5HA 2JU1A 2L4BA 2LKIA 2CNRA 1HY8A 2VSQA 2KGCA 1DNYA 5HV8A 2EHSA 5EJDA 2MVVA 2FAEA 2MF4A 4CA3A 2FQ1A 2KOPA 5KP7B 2L22A 2KG9A 2N6YA 1DV5A 2MD9A 1X3OA 2GDYA 2CQ8A 3GZMA 1OR5A 2DNWA 2K92A 2FVFA 3EJDA 3NY7B 2FACA 4BPFA 2FQ2A 4BPHA 2M5RA
chains in the Genus database with same CATH superfamily
5KP8B 5KP6B 1L0HA 2Z45A 3G1GA 4H2WC 1VKUA 3DS1A 4UHPB 2N50A 2LMLA 2WPTA 1KD1Q 2P9XA 2CGQA 1KLPA 4XFXA 4DG9A 1UJZA 2XZ1C 4U0DA 2MR7A 2K0XA 3HZQA 2PEJA 3G29A 2Z46A 3CC7P 2KGAA 5BS1A 1VQLP 2KORA 1M6NA 4XROA 1VQ9P 1L0IA 5CZDB 2EHTA 4IPYA 2L0QA 2JU2A 2VLOA 3MGEA 5I4TG 3CCEP 1YJNP 3G26A 3G1IA 2KOOA 2XT1A 3LRYA 2N6ZA 3DS3A 2N5HA 3CC2P 3CCLP 1AUMA 2GZIA 2LKIA 4U0AA 4COCA 1VQ6P 3DPHA 1NJIQ 5JPAA 1E0HA 5HV8A 3DS4A 2FAEA 4CA3A 4COPA 2KOPA 2PEQA 2BHVA 2E1MA 1BAJA 2DNWA 2ERHA 1RO0A 4XRQA 1QVFO 1EIAA 5HGNA 2AF8A 3CXCO 3G0VA 4BPGA 4R0MA 2VLNA 2PEKA 3G6EP 2GZGA 5EW5E 2K0YA 1KQSO 2JQ4A 2EFJA 4U0FA 2QA4P 4M0IA 1YHQP 2N5IA 1A8OA 1ACPA 1VQOP 4XFYA 4PXHB 2KODA 1YI2P 2KR5A 3H4EA 2LL8A 2M8LA 1D1DA 4PH1A 5BS2A 2PENA 1N8RQ 2GDXA 3Q20A 1K8AQ 2K94A 2BUOA 2JBGA 2PEOA 3G28A 3GZLA 3CE7A 3LMOA 1ZMBA 1Q7YQ 1MZ8A 3U43A 2KOQA 5HGOA 2AVAA 2QEXP 4GR6A 1UNKA 2CNRA 3DS5A 2KGCA 1W2BO 3P05A 1DNYA 2PEMA 3B4QA 1M6EX 1VQPP 1QVGO 3DTJA 5KP7B 2N6YA 2K0DX 3CCQP 2Z44A 2DGYA 1Q81Q 2ONTA 1X3OA 3E2DA 3GZMA 1M1KQ 2K92A 3NTEA 2FVFA 1CEIA 3NY7B 1RO2A 1VQNP 2OTJP 1YITP 1VQ7P 2GZEA 3G71P 2FHSC 1VQ5P 1K9MQ 2OARA 1QRJA 1A43A 2CWOA 2MR8A 5HVCA 1IMQA 2X2BA 1HQBA 4NEOA 5HGMA 4QNBA 4HKGA 3CCJP 3EJBA 2AFDA 4H2YC 7CEIA 3CCUP 2M8NA 2PY8A 2FADA 2KWLA 2LIWA 2PNGA 3H0DA 4IZ6A 1AYIA 1M90Q 2CG5B 2KGDA 1VQKP 2FQ0A 2JB0A 3I55P 4XFZA 1F80D 3CPWO 3CCVP 1FR2A 3I56P 1Z6MA 1E6JP 2MVUA 4PH0A 1VQ8P 2JYGA 2LOLA 3GJNA 1S72P 2K93A 1VHNA 2K2QA 1IUQA 1HY8A 2VSQA 1RNIA 3H47A 5DCKA 1YJ9P 4F37A 2JAZA 2LF4A 2MF4A 2NO8A 1K30A 2L22A 1DV5A 1YJWP 2PEIA 3CCSP 1GXHA 2GDYA 1Q82Q 5F2KA 1OR5A 2EG5A 4WYMA 2OTLP 2FQ2A 4BPHA 1JJ2O 2XZ0D 2ROQA 1EOQA 2N98A 2L6EA 2AFEA 1Q86Q 2KG8A 2GDWA 2KGEA 2L9FA 2M8PA 1YIJP 2JYLA 4H2XC 3G21A 3CCRP 1T8KA 2JO0A 1NQ4A 2FVAA 3RG6C 4PWVB 3WBHA 1AF8A 1GXGA 2LIUA 3EJEA 2FVEA 3RG2A 2LTEA 3CD6P 2K5XA 2QNWA 4U0EA 2MY5A 4MRTC 2KW2A 4U0CA 2VLPA 4GR2A 2KG6A 1IMPA 2XV6A 1K73Q 1BXIA 2XXMA 2VLQA 2LPKA 1GPJA 5F2OA 3OW2O 2GYKA 2KOSA 3CCMP 3VRLC 1KC8Q 2JGPA 3B5IA 1ZNVA 3HYBA 5F2NA 1VQMP 2JU1A 3GKLC 1VQ4P 2L4BA 3CMAP 3G4SP 3CC4P 3M1MA 3DS0A 2EHSA 4QKOA 5EJDA 2MVVA 1M74A 2FQ1A 2GZFA 2KG9A 5HGLA 2MD9A 2CQ8A 4U0BA 1EMVA 3EJDA 3CMEP 2FACA 4BPFA 2GZJA 2EIAA 3DS2A 2M5RA
chains in the Genus database with same CATH topology
2AF8A 5KP6B 5KP8B 2FHSC 2XZ0D 2ROQA 2N98A 1L0HA 4BPGA 4R0MA 2AFEA 2KG8A 2GDWA 2KGEA 1VKUA 2L9FA 4H2WC 2MR8A 5HVCA 2X2BA 1HQBA 2LMLA 2N50A 4NEOA 2K0YA 4H2XC 1T8KA 2JQ4A 2CGQA 4HKGA 1NQ4A 1KLPA 2FVAA 4DG9A 4PWVB 3EJBA 2N5IA 2AFDA 2XZ1C 4H2YC 1ACPA 1AF8A 4PXHB 2MR7A 2K0XA 2FADA 2LIUA 2KR5A 2KWLA 2LIWA 2PNGA 3EJEA 4IZ6A 2LL8A 2FVEA 3RG2A 2LTEA 2CG5B 2KGDA 2FQ0A 2KGAA 2QNWA 2KORA 2MY5A 1F80D 4MRTC 2KW2A 2GDXA 2KG6A 1L0IA 2K94A 5CZDB 2EHTA 2L0QA 2MVUA 2JU2A 2LPKA 2LOLA 3GZLA 2KOSA 2K93A 3CE7A 2KOOA 2JGPA 2K2QA 3LMOA 2KOQA 2N6ZA 2AVAA 2N5HA 2JU1A 2L4BA 2LKIA 2CNRA 1HY8A 2VSQA 2KGCA 1DNYA 5HV8A 2EHSA 5EJDA 2MVVA 2FAEA 2MF4A 4CA3A 2FQ1A 2KOPA 5KP7B 2L22A 2KG9A 2N6YA 1DV5A 2MD9A 1X3OA 2GDYA 2CQ8A 3GZMA 1OR5A 2DNWA 2K92A 2FVFA 3EJDA 3NY7B 2FACA 4BPFA 2FQ2A 4BPHA 2M5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AF8 A;  5KP6 B;  5KP8 B;  2FHS C;  2XZ0 D;  2ROQ A;  2N98 A;  1L0H A;  4BPG A;  4R0M A;  2AFE A;  2KG8 A;  2GDW A;  2KGE A;  1VKU A;  2L9F A;  4H2W C;  2MR8 A;  5HVC A;  2X2B A;  1HQB A;  2LML A;  2N50 A;  4NEO A;  2K0Y A;  4H2X C;  1T8K A;  2JQ4 A;  2CGQ A;  4HKG A;  1NQ4 A;  1KLP A;  2FVA A;  4DG9 A;  4PWV B;  3EJB A;  2N5I A;  2AFD A;  2XZ1 C;  4H2Y C;  1ACP A;  1AF8 A;  4PXH B;  2MR7 A;  2K0X A;  2FAD A;  2LIU A;  2KR5 A;  2KWL A;  2LIW A;  2PNG A;  3EJE A;  4IZ6 A;  2LL8 A;  2FVE A;  3RG2 A;  2LTE A;  2CG5 B;  2KGD A;  2FQ0 A;  2KGA A;  2QNW A;  2KOR A;  2MY5 A;  1F80 D;  4MRT C;  2KW2 A;  2GDX A;  2KG6 A;  1L0I A;  2K94 A;  5CZD B;  2EHT A;  2L0Q A;  2MVU A;  2JU2 A;  2LPK A;  2LOL A;  3GZL A;  2KOS A;  2K93 A;  3CE7 A;  2KOO A;  2JGP A;  2K2Q A;  3LMO A;  2KOQ A;  2N6Z A;  2AVA A;  2N5H A;  2JU1 A;  2L4B A;  2LKI A;  2CNR A;  1HY8 A;  2VSQ A;  2KGC A;  1DNY A;  5HV8 A;  2EHS A;  5EJD A;  2MVV A;  2FAE A;  2MF4 A;  4CA3 A;  2FQ1 A;  2KOP A;  5KP7 B;  2L22 A;  2KG9 A;  2N6Y A;  1DV5 A;  2MD9 A;  1X3O A;  2GDY A;  2CQ8 A;  3GZM A;  1OR5 A;  2DNW A;  2K92 A;  2FVF A;  3EJD A;  3NY7 B;  2FAC A;  4BPF A;  2FQ2 A;  4BPH A;  2M5R A; 
#chains in the Genus database with same CATH topology
 5KP8 B;  5KP6 B;  1L0H A;  2Z45 A;  3G1G A;  4H2W C;  1VKU A;  3DS1 A;  4UHP B;  2N50 A;  2LML A;  2WPT A;  1KD1 Q;  2P9X A;  2CGQ A;  1KLP A;  4XFX A;  4DG9 A;  1UJZ A;  2XZ1 C;  4U0D A;  2MR7 A;  2K0X A;  3HZQ A;  2PEJ A;  3G29 A;  2Z46 A;  3CC7 P;  2KGA A;  5BS1 A;  1VQL P;  2KOR A;  1M6N A;  4XRO A;  1VQ9 P;  1L0I A;  5CZD B;  2EHT A;  4IPY A;  2L0Q A;  2JU2 A;  2VLO A;  3MGE A;  5I4T G;  3CCE P;  1YJN P;  3G26 A;  3G1I A;  2KOO A;  2XT1 A;  3LRY A;  2N6Z A;  3DS3 A;  2N5H A;  3CC2 P;  3CCL P;  1AUM A;  2GZI A;  2LKI A;  4U0A A;  4COC A;  1VQ6 P;  3DPH A;  1NJI Q;  5JPA A;  1E0H A;  5HV8 A;  3DS4 A;  2FAE A;  4CA3 A;  4COP A;  2KOP A;  2PEQ A;  2BHV A;  2E1M A;  1BAJ A;  2DNW A;  2ERH A;  1RO0 A;  4XRQ A;  1QVF O;  1EIA A;  5HGN A;  2AF8 A;  3CXC O;  3G0V A;  4BPG A;  4R0M A;  2VLN A;  2PEK A;  3G6E P;  2GZG A;  5EW5 E;  2K0Y A;  1KQS O;  2JQ4 A;  2EFJ A;  4U0F A;  2QA4 P;  4M0I A;  1YHQ P;  2N5I A;  1A8O A;  1ACP A;  1VQO P;  4XFY A;  4PXH B;  2KOD A;  1YI2 P;  2KR5 A;  3H4E A;  2LL8 A;  2M8L A;  1D1D A;  4PH1 A;  5BS2 A;  2PEN A;  1N8R Q;  2GDX A;  3Q20 A;  1K8A Q;  2K94 A;  2BUO A;  2JBG A;  2PEO A;  3G28 A;  3GZL A;  3CE7 A;  3LMO A;  1ZMB A;  1Q7Y Q;  1MZ8 A;  3U43 A;  2KOQ A;  5HGO A;  2AVA A;  2QEX P;  4GR6 A;  1UNK A;  2CNR A;  3DS5 A;  2KGC A;  1W2B O;  3P05 A;  1DNY A;  2PEM A;  3B4Q A;  1M6E X;  1VQP P;  1QVG O;  3DTJ A;  5KP7 B;  2N6Y A;  2K0D X;  3CCQ P;  2Z44 A;  2DGY A;  1Q81 Q;  2ONT A;  1X3O A;  3E2D A;  3GZM A;  1M1K Q;  2K92 A;  3NTE A;  2FVF A;  1CEI A;  3NY7 B;  1RO2 A;  1VQN P;  2OTJ P;  1YIT P;  1VQ7 P;  2GZE A;  3G71 P;  2FHS C;  1VQ5 P;  1K9M Q;  2OAR A;  1QRJ A;  1A43 A;  2CWO A;  2MR8 A;  5HVC A;  1IMQ A;  2X2B A;  1HQB A;  4NEO A;  5HGM A;  4QNB A;  4HKG A;  3CCJ P;  3EJB A;  2AFD A;  4H2Y C;  7CEI A;  3CCU P;  2M8N A;  2PY8 A;  2FAD A;  2KWL A;  2LIW A;  2PNG A;  3H0D A;  4IZ6 A;  1AYI A;  1M90 Q;  2CG5 B;  2KGD A;  1VQK P;  2FQ0 A;  2JB0 A;  3I55 P;  4XFZ A;  1F80 D;  3CPW O;  3CCV P;  1FR2 A;  3I56 P;  1Z6M A;  1E6J P;  2MVU A;  4PH0 A;  1VQ8 P;  2JYG A;  2LOL A;  3GJN A;  1S72 P;  2K93 A;  1VHN A;  2K2Q A;  1IUQ A;  1HY8 A;  2VSQ A;  1RNI A;  3H47 A;  5DCK A;  1YJ9 P;  4F37 A;  2JAZ A;  2LF4 A;  2MF4 A;  2NO8 A;  1K30 A;  2L22 A;  1DV5 A;  1YJW P;  2PEI A;  3CCS P;  1GXH A;  2GDY A;  1Q82 Q;  5F2K A;  1OR5 A;  2EG5 A;  4WYM A;  2OTL P;  2FQ2 A;  4BPH A;  1JJ2 O;  2XZ0 D;  2ROQ A;  1EOQ A;  2N98 A;  2L6E A;  2AFE A;  1Q86 Q;  2KG8 A;  2GDW A;  2KGE A;  2L9F A;  2M8P A;  1YIJ P;  2JYL A;  4H2X C;  3G21 A;  3CCR P;  1T8K A;  2JO0 A;  1NQ4 A;  2FVA A;  3RG6 C;  4PWV B;  3WBH A;  1AF8 A;  1GXG A;  2LIU A;  3EJE A;  2FVE A;  3RG2 A;  2LTE A;  3CD6 P;  2K5X A;  2QNW A;  4U0E A;  2MY5 A;  4MRT C;  2KW2 A;  4U0C A;  2VLP A;  4GR2 A;  2KG6 A;  1IMP A;  2XV6 A;  1K73 Q;  1BXI A;  2XXM A;  2VLQ A;  2LPK A;  1GPJ A;  5F2O A;  3OW2 O;  2GYK A;  2KOS A;  3CCM P;  3VRL C;  1KC8 Q;  2JGP A;  3B5I A;  1ZNV A;  3HYB A;  5F2N A;  1VQM P;  2JU1 A;  3GKL C;  1VQ4 P;  2L4B A;  3CMA P;  3G4S P;  3CC4 P;  3M1M A;  3DS0 A;  2EHS A;  4QKO A;  5EJD A;  2MVV A;  1M74 A;  2FQ1 A;  2GZF A;  2KG9 A;  5HGL A;  2MD9 A;  2CQ8 A;  4U0B A;  1EMV A;  3EJD A;  3CME P;  2FAC A;  4BPF A;  2GZJ A;  2EIA A;  3DS2 A;  2M5R A; 
#chains in the Genus database with same CATH homology
 2AF8 A;  5KP6 B;  5KP8 B;  2FHS C;  2XZ0 D;  2ROQ A;  2N98 A;  1L0H A;  4BPG A;  4R0M A;  2AFE A;  2KG8 A;  2GDW A;  2KGE A;  1VKU A;  2L9F A;  4H2W C;  2MR8 A;  5HVC A;  2X2B A;  1HQB A;  2LML A;  2N50 A;  4NEO A;  2K0Y A;  4H2X C;  1T8K A;  2JQ4 A;  2CGQ A;  4HKG A;  1NQ4 A;  1KLP A;  2FVA A;  4DG9 A;  4PWV B;  3EJB A;  2N5I A;  2AFD A;  2XZ1 C;  4H2Y C;  1ACP A;  1AF8 A;  4PXH B;  2MR7 A;  2K0X A;  2FAD A;  2LIU A;  2KR5 A;  2KWL A;  2LIW A;  2PNG A;  3EJE A;  4IZ6 A;  2LL8 A;  2FVE A;  3RG2 A;  2LTE A;  2CG5 B;  2KGD A;  2FQ0 A;  2KGA A;  2QNW A;  2KOR A;  2MY5 A;  1F80 D;  4MRT C;  2KW2 A;  2GDX A;  2KG6 A;  1L0I A;  2K94 A;  5CZD B;  2EHT A;  2L0Q A;  2MVU A;  2JU2 A;  2LPK A;  2LOL A;  3GZL A;  2KOS A;  2K93 A;  3CE7 A;  2KOO A;  2JGP A;  2K2Q A;  3LMO A;  2KOQ A;  2N6Z A;  2AVA A;  2N5H A;  2JU1 A;  2L4B A;  2LKI A;  2CNR A;  1HY8 A;  2VSQ A;  2KGC A;  1DNY A;  5HV8 A;  2EHS A;  5EJD A;  2MVV A;  2FAE A;  2MF4 A;  4CA3 A;  2FQ1 A;  2KOP A;  5KP7 B;  2L22 A;  2KG9 A;  2N6Y A;  1DV5 A;  2MD9 A;  1X3O A;  2GDY A;  2CQ8 A;  3GZM A;  1OR5 A;  2DNW A;  2K92 A;  2FVF A;  3EJD A;  3NY7 B;  2FAC A;  4BPF A;  2FQ2 A;  4BPH A;  2M5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...