3EJBA

Crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
b'SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejbA00
4DG9A 3EJBA 2MY5A 4H2WC 2KOSA 1T8KA 2L4BA 2AFDA 2KR5A 4PWVB 2GDWA 2PNGA 2KW2A 2N98A 5KP6B 2N6ZA 1VKUA 2KGCA 2MF4A 1F80D 1DV5A 1HY8A 2CQ8A 2K92A 2JQ4A 4BPHA 2XZ0D 1L0HA 2FADA 3RG2A 2LL8A 2LOLA 4NEOA 1KLPA 2KGAA 5CZDB 3NY7B 1DNYA 2LPKA 2AFEA 2EHTA 2FAEA 2K0YA 2KGEA 2ROQA 2X2BA 2AF8A 2KOOA 2GDXA 1HQBA 2N50A 2VSQA 2LMLA 2MR8A 2MVUA 1L0IA 4BPGA 5KP7B 2FQ2A 5HVCA 2CG5B 5EJDA 2M5RA 4H2YC 2FACA 2KG6A 2FVFA 2CNRA 2L22A 2AVAA 4H2XC 1AF8A 2GDYA 1X3OA 2DNWA 4MRTC 2LKIA 4HKGA 2EHSA 3GZMA 4R0MA 2N6YA 2LTEA 4PXHB 2L0QA 2LIWA 2JGPA 2KORA 2FQ1A 2K0XA 2K2QA 3LMOA 2JU1A 2N5IA 4BPFA 5KP8B 2KG9A 2KWLA 3EJEA 2KOQA 3EJDA 5HV8A 2MD9A 2JU2A 2LIUA 1ACPA 2MR7A 2XZ1C 4IZ6A 2K94A 2MVVA 4CA3A 2K93A 2KGDA 1OR5A 2KG8A 3CE7A 2CGQA 2FQ0A 2FVEA 2FHSC 2QNWA 2L9FA 2FVAA 1NQ4A 2N5HA 2KOPA 3GZLA
chains in the Genus database with same CATH superfamily
1VQ6P 2GDWA 2KW2A 2N98A 3DS4A 3CCJP 1VQMP 1YHQP 2K92A 2JQ4A 4BPHA 2XZ0D 2FADA 3GKLC 3RG2A 1YITP 2LOLA 4NEOA 1FR2A 4WYMA 5CZDB 3E2DA 5F2KA 1DNYA 2LPKA 2AFEA 4U0FA 2EHTA 1GXHA 2P9XA 1ZNVA 2N50A 2GZJA 1M6EX 1IMPA 2JYGA 3CC4P 2M5RA 2EG5A 4H2YC 2KG6A 3G29A 2XV6A 1AF8A 1AYIA 3GZMA 4R0MA 1AUMA 2M8PA 5I4TG 2L0QA 2LIWA 2KORA 1VQLP 2KG9A 2KWLA 1IMQA 2JAZA 4QNBA 2EIAA 1VQ9P 1VQPP 2BUOA 2JYLA 3GJNA 3CMAP 1EMVA 2FHSC 5HGOA 1UJZA 2PEKA 2QNWA 2OARA 2GYKA 3CXCO 2L9FA 1BXIA 2JO0A 5F2OA 1VHNA 3RG6C 1KD1Q 1K9MQ 2PEJA 2E1MA 2KOSA 2L4BA 3CPWO 3DPHA 3HYBA 1YI2P 2KR5A 5EW5E 2PNGA 1RNIA 4U0CA 2KGCA 2BHVA 2MF4A 3H4EA 1DV5A 3M1MA 3CCUP 1VQNP 1L0HA 3VRLC 1IUQA 2GZEA 1MZ8A 2QEXP 1YIJP 3G6EP 3NY7B 3DS2A 3H47A 1Q82Q 2X2BA 1CEIA 1HQBA 2VSQA 2MR8A 1RO0A 1L0IA 5HVCA 1QVFO 2K0DX 5EJDA 3G71P 3CCQP 2XT1A 1VQKP 2VLQA 3MGEA 2NO8A 2L22A 5HGLA 2ONTA 2GDYA 1X3OA 1VQ5P 4MRTC 2LKIA 3CC7P 2EHSA 3DTJA 1VQ7P 2WPTA 4M0IA 2K0XA 1YJ9P 1JJ2O 5KP8B 3CD6P 4XFXA 4COPA 3P05A 3EJEA 2KOQA 5HV8A 2MD9A 2LIUA 1ACPA 1M1KQ 1KQSO 2KG8A 2CGQA 2FQ0A 2DGYA 1NQ4A 3G1IA 2GZGA 1UNKA 3GZLA 5DCKA 3CCVP 3DS0A 4H2WC 3CC2P 2AFDA 4U0AA 1E6JP 4PWVB 2CWOA 2Z44A 5KP6B 4GR2A 1Z6MA 1VQOP 1F80D 1S72P 4F37A 1YJNP 1A8OA 3DS3A 1K73Q 3G0VA 2L6EA 2K0YA 1M90Q 2KGEA 5HGNA 2ROQA 2Z45A 2LMLA 3CMEP 2JB0A 4BPGA 5KP7B 2FQ2A 1Q86Q 3CCRP 1YJWP 4QKOA 4XRQA 2VLPA 4U0EA 3DS1A 1N8RQ 4PH0A 2AVAA 4H2XC 2VLNA 2DNWA 1NJIQ 2N6YA 2GZIA 2LTEA 2QA4P 2JGPA 2PEMA 1QVGO 2ERHA 3Q20A 2K2QA 2EFJA 5HGMA 3LMOA 4BPFA 3HZQA 4XROA 3I56P 3G28A 2VLOA 3EJDA 3G21A 2JU2A 2MR7A 4IZ6A 1GPJA 3G26A 2K5XA 3DS5A 3G1GA 4CA3A 2KGDA 1OR5A 3CE7A 3NTEA 2FVEA 2M8NA 5BS2A 4COCA 3CCLP 1VQ4P 2KODA 2FVAA 2N5HA 1A43A 7CEIA 2OTJP 5F2NA 2KOPA 4DG9A 3EJBA 2MY5A 1T8KA 3B4QA 2N6ZA 3G4SP 1VKUA 1HY8A 2CQ8A 1Q81Q 2LL8A 1VQ8P 2PEOA 1KLPA 2KGAA 1GXGA 2PY8A 5JPAA 2Z46A 2FAEA 3B5IA 4U0DA 1M74A 2XXMA 2AF8A 2KOOA 2GDXA 2MVUA 2PEIA 4XFYA 2PEQA 1BAJA 2CG5B 1QRJA 3LRYA 2FACA 2OTLP 2FVFA 2M8LA 3CCSP 1M6NA 2CNRA 4IPYA 1RO2A 1ZMBA 4HKGA 1EOQA 3CCMP 4PXHB 2JBGA 2FQ1A 1Q7YQ 3I55P 3OW2O 4XFZA 3WBHA 5BS1A 2JU1A 2N5IA 1KC8Q 4U0BA 2GZFA 3U43A 1K8AQ 4PH1A 2PENA 2XZ1C 2K94A 1K30A 2MVVA 2K93A 1W2BO 1EIAA 1E0HA 2LF4A 1D1DA 3H0DA 4UHPB 3CCEP 4GR6A
chains in the Genus database with same CATH topology
4DG9A 3EJBA 2MY5A 4H2WC 2KOSA 1T8KA 2L4BA 2AFDA 2KR5A 4PWVB 2GDWA 2PNGA 2KW2A 2N98A 5KP6B 2N6ZA 1VKUA 2KGCA 2MF4A 1F80D 1DV5A 1HY8A 2CQ8A 2K92A 2JQ4A 4BPHA 2XZ0D 1L0HA 2FADA 3RG2A 2LL8A 2LOLA 4NEOA 1KLPA 2KGAA 5CZDB 3NY7B 1DNYA 2LPKA 2AFEA 2EHTA 2FAEA 2K0YA 2KGEA 2ROQA 2X2BA 2AF8A 2KOOA 2GDXA 1HQBA 2N50A 2VSQA 2LMLA 2MR8A 2MVUA 1L0IA 4BPGA 5KP7B 2FQ2A 5HVCA 2CG5B 5EJDA 2M5RA 4H2YC 2FACA 2KG6A 2FVFA 2CNRA 2L22A 2AVAA 4H2XC 1AF8A 2GDYA 1X3OA 2DNWA 4MRTC 2LKIA 4HKGA 2EHSA 3GZMA 4R0MA 2N6YA 2LTEA 4PXHB 2L0QA 2LIWA 2JGPA 2KORA 2FQ1A 2K0XA 2K2QA 3LMOA 2JU1A 2N5IA 4BPFA 5KP8B 2KG9A 2KWLA 3EJEA 2KOQA 3EJDA 5HV8A 2MD9A 2JU2A 2LIUA 1ACPA 2MR7A 2XZ1C 4IZ6A 2K94A 2MVVA 4CA3A 2K93A 2KGDA 1OR5A 2KG8A 3CE7A 2CGQA 2FQ0A 2FVEA 2FHSC 2QNWA 2L9FA 2FVAA 1NQ4A 2N5HA 2KOPA 3GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DG9 A;  3EJB A;  2MY5 A;  4H2W C;  2KOS A;  1T8K A;  2L4B A;  2AFD A;  2KR5 A;  4PWV B;  2GDW A;  2PNG A;  2KW2 A;  2N98 A;  5KP6 B;  2N6Z A;  1VKU A;  2KGC A;  2MF4 A;  1F80 D;  1DV5 A;  1HY8 A;  2CQ8 A;  2K92 A;  2JQ4 A;  4BPH A;  2XZ0 D;  1L0H A;  2FAD A;  3RG2 A;  2LL8 A;  2LOL A;  4NEO A;  1KLP A;  2KGA A;  5CZD B;  3NY7 B;  1DNY A;  2LPK A;  2AFE A;  2EHT A;  2FAE A;  2K0Y A;  2KGE A;  2ROQ A;  2X2B A;  2AF8 A;  2KOO A;  2GDX A;  1HQB A;  2N50 A;  2VSQ A;  2LML A;  2MR8 A;  2MVU A;  1L0I A;  4BPG A;  5KP7 B;  2FQ2 A;  5HVC A;  2CG5 B;  5EJD A;  2M5R A;  4H2Y C;  2FAC A;  2KG6 A;  2FVF A;  2CNR A;  2L22 A;  2AVA A;  4H2X C;  1AF8 A;  2GDY A;  1X3O A;  2DNW A;  4MRT C;  2LKI A;  4HKG A;  2EHS A;  3GZM A;  4R0M A;  2N6Y A;  2LTE A;  4PXH B;  2L0Q A;  2LIW A;  2JGP A;  2KOR A;  2FQ1 A;  2K0X A;  2K2Q A;  3LMO A;  2JU1 A;  2N5I A;  4BPF A;  5KP8 B;  2KG9 A;  2KWL A;  3EJE A;  2KOQ A;  3EJD A;  5HV8 A;  2MD9 A;  2JU2 A;  2LIU A;  1ACP A;  2MR7 A;  2XZ1 C;  4IZ6 A;  2K94 A;  2MVV A;  4CA3 A;  2K93 A;  2KGD A;  1OR5 A;  2KG8 A;  3CE7 A;  2CGQ A;  2FQ0 A;  2FVE A;  2FHS C;  2QNW A;  2L9F A;  2FVA A;  1NQ4 A;  2N5H A;  2KOP A;  3GZL A; 
#chains in the Genus database with same CATH topology
 1VQ6 P;  2GDW A;  2KW2 A;  2N98 A;  3DS4 A;  3CCJ P;  1VQM P;  1YHQ P;  2K92 A;  2JQ4 A;  4BPH A;  2XZ0 D;  2FAD A;  3GKL C;  3RG2 A;  1YIT P;  2LOL A;  4NEO A;  1FR2 A;  4WYM A;  5CZD B;  3E2D A;  5F2K A;  1DNY A;  2LPK A;  2AFE A;  4U0F A;  2EHT A;  1GXH A;  2P9X A;  1ZNV A;  2N50 A;  2GZJ A;  1M6E X;  1IMP A;  2JYG A;  3CC4 P;  2M5R A;  2EG5 A;  4H2Y C;  2KG6 A;  3G29 A;  2XV6 A;  1AF8 A;  1AYI A;  3GZM A;  4R0M A;  1AUM A;  2M8P A;  5I4T G;  2L0Q A;  2LIW A;  2KOR A;  1VQL P;  2KG9 A;  2KWL A;  1IMQ A;  2JAZ A;  4QNB A;  2EIA A;  1VQ9 P;  1VQP P;  2BUO A;  2JYL A;  3GJN A;  3CMA P;  1EMV A;  2FHS C;  5HGO A;  1UJZ A;  2PEK A;  2QNW A;  2OAR A;  2GYK A;  3CXC O;  2L9F A;  1BXI A;  2JO0 A;  5F2O A;  1VHN A;  3RG6 C;  1KD1 Q;  1K9M Q;  2PEJ A;  2E1M A;  2KOS A;  2L4B A;  3CPW O;  3DPH A;  3HYB A;  1YI2 P;  2KR5 A;  5EW5 E;  2PNG A;  1RNI A;  4U0C A;  2KGC A;  2BHV A;  2MF4 A;  3H4E A;  1DV5 A;  3M1M A;  3CCU P;  1VQN P;  1L0H A;  3VRL C;  1IUQ A;  2GZE A;  1MZ8 A;  2QEX P;  1YIJ P;  3G6E P;  3NY7 B;  3DS2 A;  3H47 A;  1Q82 Q;  2X2B A;  1CEI A;  1HQB A;  2VSQ A;  2MR8 A;  1RO0 A;  1L0I A;  5HVC A;  1QVF O;  2K0D X;  5EJD A;  3G71 P;  3CCQ P;  2XT1 A;  1VQK P;  2VLQ A;  3MGE A;  2NO8 A;  2L22 A;  5HGL A;  2ONT A;  2GDY A;  1X3O A;  1VQ5 P;  4MRT C;  2LKI A;  3CC7 P;  2EHS A;  3DTJ A;  1VQ7 P;  2WPT A;  4M0I A;  2K0X A;  1YJ9 P;  1JJ2 O;  5KP8 B;  3CD6 P;  4XFX A;  4COP A;  3P05 A;  3EJE A;  2KOQ A;  5HV8 A;  2MD9 A;  2LIU A;  1ACP A;  1M1K Q;  1KQS O;  2KG8 A;  2CGQ A;  2FQ0 A;  2DGY A;  1NQ4 A;  3G1I A;  2GZG A;  1UNK A;  3GZL A;  5DCK A;  3CCV P;  3DS0 A;  4H2W C;  3CC2 P;  2AFD A;  4U0A A;  1E6J P;  4PWV B;  2CWO A;  2Z44 A;  5KP6 B;  4GR2 A;  1Z6M A;  1VQO P;  1F80 D;  1S72 P;  4F37 A;  1YJN P;  1A8O A;  3DS3 A;  1K73 Q;  3G0V A;  2L6E A;  2K0Y A;  1M90 Q;  2KGE A;  5HGN A;  2ROQ A;  2Z45 A;  2LML A;  3CME P;  2JB0 A;  4BPG A;  5KP7 B;  2FQ2 A;  1Q86 Q;  3CCR P;  1YJW P;  4QKO A;  4XRQ A;  2VLP A;  4U0E A;  3DS1 A;  1N8R Q;  4PH0 A;  2AVA A;  4H2X C;  2VLN A;  2DNW A;  1NJI Q;  2N6Y A;  2GZI A;  2LTE A;  2QA4 P;  2JGP A;  2PEM A;  1QVG O;  2ERH A;  3Q20 A;  2K2Q A;  2EFJ A;  5HGM A;  3LMO A;  4BPF A;  3HZQ A;  4XRO A;  3I56 P;  3G28 A;  2VLO A;  3EJD A;  3G21 A;  2JU2 A;  2MR7 A;  4IZ6 A;  1GPJ A;  3G26 A;  2K5X A;  3DS5 A;  3G1G A;  4CA3 A;  2KGD A;  1OR5 A;  3CE7 A;  3NTE A;  2FVE A;  2M8N A;  5BS2 A;  4COC A;  3CCL P;  1VQ4 P;  2KOD A;  2FVA A;  2N5H A;  1A43 A;  7CEI A;  2OTJ P;  5F2N A;  2KOP A;  4DG9 A;  3EJB A;  2MY5 A;  1T8K A;  3B4Q A;  2N6Z A;  3G4S P;  1VKU A;  1HY8 A;  2CQ8 A;  1Q81 Q;  2LL8 A;  1VQ8 P;  2PEO A;  1KLP A;  2KGA A;  1GXG A;  2PY8 A;  5JPA A;  2Z46 A;  2FAE A;  3B5I A;  4U0D A;  1M74 A;  2XXM A;  2AF8 A;  2KOO A;  2GDX A;  2MVU A;  2PEI A;  4XFY A;  2PEQ A;  1BAJ A;  2CG5 B;  1QRJ A;  3LRY A;  2FAC A;  2OTL P;  2FVF A;  2M8L A;  3CCS P;  1M6N A;  2CNR A;  4IPY A;  1RO2 A;  1ZMB A;  4HKG A;  1EOQ A;  3CCM P;  4PXH B;  2JBG A;  2FQ1 A;  1Q7Y Q;  3I55 P;  3OW2 O;  4XFZ A;  3WBH A;  5BS1 A;  2JU1 A;  2N5I A;  1KC8 Q;  4U0B A;  2GZF A;  3U43 A;  1K8A Q;  4PH1 A;  2PEN A;  2XZ1 C;  2K94 A;  1K30 A;  2MVV A;  2K93 A;  1W2B O;  1EIA A;  1E0H A;  2LF4 A;  1D1D A;  3H0D A;  4UHP B;  3CCE P;  4GR6 A; 
#chains in the Genus database with same CATH homology
 4DG9 A;  3EJB A;  2MY5 A;  4H2W C;  2KOS A;  1T8K A;  2L4B A;  2AFD A;  2KR5 A;  4PWV B;  2GDW A;  2PNG A;  2KW2 A;  2N98 A;  5KP6 B;  2N6Z A;  1VKU A;  2KGC A;  2MF4 A;  1F80 D;  1DV5 A;  1HY8 A;  2CQ8 A;  2K92 A;  2JQ4 A;  4BPH A;  2XZ0 D;  1L0H A;  2FAD A;  3RG2 A;  2LL8 A;  2LOL A;  4NEO A;  1KLP A;  2KGA A;  5CZD B;  3NY7 B;  1DNY A;  2LPK A;  2AFE A;  2EHT A;  2FAE A;  2K0Y A;  2KGE A;  2ROQ A;  2X2B A;  2AF8 A;  2KOO A;  2GDX A;  1HQB A;  2N50 A;  2VSQ A;  2LML A;  2MR8 A;  2MVU A;  1L0I A;  4BPG A;  5KP7 B;  2FQ2 A;  5HVC A;  2CG5 B;  5EJD A;  2M5R A;  4H2Y C;  2FAC A;  2KG6 A;  2FVF A;  2CNR A;  2L22 A;  2AVA A;  4H2X C;  1AF8 A;  2GDY A;  1X3O A;  2DNW A;  4MRT C;  2LKI A;  4HKG A;  2EHS A;  3GZM A;  4R0M A;  2N6Y A;  2LTE A;  4PXH B;  2L0Q A;  2LIW A;  2JGP A;  2KOR A;  2FQ1 A;  2K0X A;  2K2Q A;  3LMO A;  2JU1 A;  2N5I A;  4BPF A;  5KP8 B;  2KG9 A;  2KWL A;  3EJE A;  2KOQ A;  3EJD A;  5HV8 A;  2MD9 A;  2JU2 A;  2LIU A;  1ACP A;  2MR7 A;  2XZ1 C;  4IZ6 A;  2K94 A;  2MVV A;  4CA3 A;  2K93 A;  2KGD A;  1OR5 A;  2KG8 A;  3CE7 A;  2CGQ A;  2FQ0 A;  2FVE A;  2FHS C;  2QNW A;  2L9F A;  2FVA A;  1NQ4 A;  2N5H A;  2KOP A;  3GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...