3EJBA

Crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejbA00
4PXHB 2FVFA 1F80D 2FVAA 4H2WC 2JQ4A 2CNRA 2KGCA 2LOLA 2KG6A 2AF8A 2MR7A 4DG9A 2N98A 2N6YA 1NQ4A 2FHSC 3EJDA 5HV8A 2CG5B 2L4BA 2MVUA 2LIWA 4MRTC 2N5IA 2AFEA 2DNWA 2VSQA 2M5RA 1AF8A 2KOOA 5EJDA 2FQ1A 2LIUA 3GZLA 2KG8A 2L22A 1DV5A 2LMLA 3EJEA 2QNWA 2MR8A 2LKIA 5KP8B 1KLPA 1ACPA 2MF4A 2KGEA 2LPKA 2EHSA 4PWVB 2MVVA 2CQ8A 1L0IA 2GDXA 5CZDB 2FVEA 1HQBA 5KP6B 5HVCA 2JU1A 5KP7B 1DNYA 4IZ6A 1HY8A 2GDYA 2FADA 2K93A 2K92A 3EJBA 2EHTA 2FAEA 3NY7B 4H2YC 4H2XC 2JGPA 2KOSA 2K94A 2MD9A 4NEOA 2ROQA 1X3OA 1L0HA 4R0MA 4HKGA 1OR5A 2AVAA 2KORA 2GDWA 2L0QA 2MY5A 2KW2A 2KG9A 2K2QA 2N5HA 4BPGA 2XZ0D 2AFDA 2PNGA 2N6ZA 1VKUA 3LMOA 4CA3A 2K0XA 2KOPA 3RG2A 4BPFA 2X2BA 2KWLA 2XZ1C 2K0YA 2CGQA 2KGAA 3GZMA 4BPHA 2FQ0A 3CE7A 2KOQA 2KGDA 2LTEA 2LL8A 2FACA 1T8KA 2JU2A 2KR5A 2N50A 2FQ2A 2L9FA
chains in the Genus database with same CATH superfamily
1YI2P 3G6EP 1VQOP 2AF8A 3H0DA 3DPHA 4DG9A 1IMPA 2N6YA 3EJDA 3DS4A 5HV8A 2MVUA 1CEIA 2P9XA 2LIWA 1VQKP 2N5IA 5BS1A 3G26A 2CWOA 2FQ1A 3GZLA 5JPAA 1YJNP 1K30A 1GXHA 1JJ2O 2QNWA 1EMVA 5KP8B 1VQLP 4GR6A 2MF4A 1QVFO 5CZDB 3CCEP 2Z44A 3CD6P 2JU1A 1M90Q 4IZ6A 1HY8A 2GDYA 2K5XA 2M8LA 2K93A 3EJBA 3DS3A 1K9MQ 2FAEA 4H2YC 1VQMP 2JBGA 2K94A 1BXIA 2ONTA 2PEOA 2EIAA 3CMEP 1X3OA 4R0MA 1OR5A 1FR2A 1M74A 7CEIA 2N5HA 2OARA 3G0VA 4XFYA 2KOPA 4U0CA 2K0YA 1RO0A 3GZMA 1VQ5P 3DS2A 1VQ7P 4BPHA 2GYKA 3G21A 1W2BO 2KODA 2LL8A 2FACA 1YJ9P 1YITP 2JU2A 3P05A 4U0FA 1ZNVA 1IUQA 2FVAA 3G71P 4H2WC 1A43A 2KG6A 2MR7A 1NQ4A 3CCMP 2GZIA 2VSQA 1M6NA 2KOOA 1EOQA 5EJDA 1AYIA 1YHQP 2KG8A 3CCQP 4PH0A 2LMLA 4COCA 2MR8A 2LKIA 4QKOA 3H4EA 2KGEA 4M0IA 2LPKA 4PWVB 2QA4P 2E1MA 1L0IA 2GDXA 2FVEA 5KP6B 2M8NA 5HGMA 4XROA 2WPTA 3CPWO 5HGNA 2QEXP 2FADA 2EG5A 2K92A 1M6EX 2L6EA 2PEMA 4H2XC 2JGPA 2XT1A 2Z45A 3GKLC 1EIAA 1A8OA 1VQ6P 4WYMA 1MZ8A 2KORA 2GDWA 2L0QA 1K8AQ 3G1IA 4BPGA 1RNIA 2NO8A 4CA3A 2VLQA 3U43A 3CCLP 1D1DA 3CC2P 1Q82Q 2KWLA 1IMQA 2PY8A 2KGAA 2VLOA 1E0HA 3B5IA 2VLNA 4U0EA 2KR5A 2N50A 1VQ8P 2FQ2A 3CC4P 2LOLA 3CCSP 2N98A 2VLPA 1BAJA 2AFEA 3CXCO 4GR2A 1Q7YQ 2GZJA 1NJIQ 3OW2O 1M1KQ 3EJEA 4UHPB 2PEQA 1RO2A 5I4TG 4PH1A 3G1GA 4U0DA 2DGYA 1HQBA 1K73Q 1DNYA 3CCRP 2EHTA 1AUMA 3WBHA 2KOSA 4NEOA 4IPYA 3G29A 1L0HA 2XV6A 1ZMBA 2BUOA 4XFZA 3LRYA 3HZQA 3CC7P 3HYBA 2MY5A 1GXGA 2KW2A 3G4SP 1YJWP 1VQ4P 2AFDA 2PNGA 2N6ZA 3LMOA 1QRJA 5BS2A 1QVGO 1VQNP 4BPFA 1VQPP 3GJNA 3DS1A 2CGQA 2JO0A 2OTJP 2KGDA 2OTLP 1T8KA 1KQSO 4U0AA 1YIJP 4PXHB 4XFXA 2FVFA 3DTJA 1F80D 3CCJP 2PEKA 2JQ4A 3M1MA 2CNRA 2KGCA 3CCUP 1UNKA 2PENA 5HGOA 2ERHA 2FHSC 2CG5B 2L4BA 4MRTC 2DNWA 2M5RA 2JYLA 1AF8A 2EFJA 2LIUA 1VQ9P 3G28A 2L22A 1DV5A 5DCKA 2XXMA 3NTEA 1KLPA 1ACPA 1Q81Q 3DS0A 4COPA 2EHSA 2MVVA 2CQ8A 1VHNA 5HVCA 5KP7B 4QNBA 2GZFA 2LF4A 3H47A 3E2DA 3NY7B 3VRLC 5HGLA 3DS5A 2MD9A 2ROQA 1UJZA 2K0DX 2PEJA 4HKGA 3CMAP 4F37A 1Z6MA 1E6JP 2GZGA 5EW5E 2BHVA 2Z46A 4XRQA 3I55P 2AVAA 2JYGA 1KD1Q 5F2KA 1N8RQ 2KG9A 2K2QA 3B4QA 2XZ0D 3RG6C 2JAZA 1GPJA 1VKUA 4U0BA 2JB0A 2K0XA 2M8PA 2GZEA 3Q20A 3RG2A 5F2OA 2X2BA 3MGEA 2XZ1C 3CCVP 5F2NA 2FQ0A 3CE7A 2KOQA 2LTEA 1Q86Q 2PEIA 1S72P 3I56P 2L9FA 1KC8Q
chains in the Genus database with same CATH topology
4PXHB 2FVFA 1F80D 2FVAA 4H2WC 2JQ4A 2CNRA 2KGCA 2LOLA 2KG6A 2AF8A 2MR7A 4DG9A 2N98A 2N6YA 1NQ4A 2FHSC 3EJDA 5HV8A 2CG5B 2L4BA 2MVUA 2LIWA 4MRTC 2N5IA 2AFEA 2DNWA 2VSQA 2M5RA 1AF8A 2KOOA 5EJDA 2FQ1A 2LIUA 3GZLA 2KG8A 2L22A 1DV5A 2LMLA 3EJEA 2QNWA 2MR8A 2LKIA 5KP8B 1KLPA 1ACPA 2MF4A 2KGEA 2LPKA 2EHSA 4PWVB 2MVVA 2CQ8A 1L0IA 2GDXA 5CZDB 2FVEA 1HQBA 5KP6B 5HVCA 2JU1A 5KP7B 1DNYA 4IZ6A 1HY8A 2GDYA 2FADA 2K93A 2K92A 3EJBA 2EHTA 2FAEA 3NY7B 4H2YC 4H2XC 2JGPA 2KOSA 2K94A 2MD9A 4NEOA 2ROQA 1X3OA 1L0HA 4R0MA 4HKGA 1OR5A 2AVAA 2KORA 2GDWA 2L0QA 2MY5A 2KW2A 2KG9A 2K2QA 2N5HA 4BPGA 2XZ0D 2AFDA 2PNGA 2N6ZA 1VKUA 3LMOA 4CA3A 2K0XA 2KOPA 3RG2A 4BPFA 2X2BA 2KWLA 2XZ1C 2K0YA 2CGQA 2KGAA 3GZMA 4BPHA 2FQ0A 3CE7A 2KOQA 2KGDA 2LTEA 2LL8A 2FACA 1T8KA 2JU2A 2KR5A 2N50A 2FQ2A 2L9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXH B;  2FVF A;  1F80 D;  2FVA A;  4H2W C;  2JQ4 A;  2CNR A;  2KGC A;  2LOL A;  2KG6 A;  2AF8 A;  2MR7 A;  4DG9 A;  2N98 A;  2N6Y A;  1NQ4 A;  2FHS C;  3EJD A;  5HV8 A;  2CG5 B;  2L4B A;  2MVU A;  2LIW A;  4MRT C;  2N5I A;  2AFE A;  2DNW A;  2VSQ A;  2M5R A;  1AF8 A;  2KOO A;  5EJD A;  2FQ1 A;  2LIU A;  3GZL A;  2KG8 A;  2L22 A;  1DV5 A;  2LML A;  3EJE A;  2QNW A;  2MR8 A;  2LKI A;  5KP8 B;  1KLP A;  1ACP A;  2MF4 A;  2KGE A;  2LPK A;  2EHS A;  4PWV B;  2MVV A;  2CQ8 A;  1L0I A;  2GDX A;  5CZD B;  2FVE A;  1HQB A;  5KP6 B;  5HVC A;  2JU1 A;  5KP7 B;  1DNY A;  4IZ6 A;  1HY8 A;  2GDY A;  2FAD A;  2K93 A;  2K92 A;  3EJB A;  2EHT A;  2FAE A;  3NY7 B;  4H2Y C;  4H2X C;  2JGP A;  2KOS A;  2K94 A;  2MD9 A;  4NEO A;  2ROQ A;  1X3O A;  1L0H A;  4R0M A;  4HKG A;  1OR5 A;  2AVA A;  2KOR A;  2GDW A;  2L0Q A;  2MY5 A;  2KW2 A;  2KG9 A;  2K2Q A;  2N5H A;  4BPG A;  2XZ0 D;  2AFD A;  2PNG A;  2N6Z A;  1VKU A;  3LMO A;  4CA3 A;  2K0X A;  2KOP A;  3RG2 A;  4BPF A;  2X2B A;  2KWL A;  2XZ1 C;  2K0Y A;  2CGQ A;  2KGA A;  3GZM A;  4BPH A;  2FQ0 A;  3CE7 A;  2KOQ A;  2KGD A;  2LTE A;  2LL8 A;  2FAC A;  1T8K A;  2JU2 A;  2KR5 A;  2N50 A;  2FQ2 A;  2L9F A; 
#chains in the Genus database with same CATH topology
 1YI2 P;  3G6E P;  1VQO P;  2AF8 A;  3H0D A;  3DPH A;  4DG9 A;  1IMP A;  2N6Y A;  3EJD A;  3DS4 A;  5HV8 A;  2MVU A;  1CEI A;  2P9X A;  2LIW A;  1VQK P;  2N5I A;  5BS1 A;  3G26 A;  2CWO A;  2FQ1 A;  3GZL A;  5JPA A;  1YJN P;  1K30 A;  1GXH A;  1JJ2 O;  2QNW A;  1EMV A;  5KP8 B;  1VQL P;  4GR6 A;  2MF4 A;  1QVF O;  5CZD B;  3CCE P;  2Z44 A;  3CD6 P;  2JU1 A;  1M90 Q;  4IZ6 A;  1HY8 A;  2GDY A;  2K5X A;  2M8L A;  2K93 A;  3EJB A;  3DS3 A;  1K9M Q;  2FAE A;  4H2Y C;  1VQM P;  2JBG A;  2K94 A;  1BXI A;  2ONT A;  2PEO A;  2EIA A;  3CME P;  1X3O A;  4R0M A;  1OR5 A;  1FR2 A;  1M74 A;  7CEI A;  2N5H A;  2OAR A;  3G0V A;  4XFY A;  2KOP A;  4U0C A;  2K0Y A;  1RO0 A;  3GZM A;  1VQ5 P;  3DS2 A;  1VQ7 P;  4BPH A;  2GYK A;  3G21 A;  1W2B O;  2KOD A;  2LL8 A;  2FAC A;  1YJ9 P;  1YIT P;  2JU2 A;  3P05 A;  4U0F A;  1ZNV A;  1IUQ A;  2FVA A;  3G71 P;  4H2W C;  1A43 A;  2KG6 A;  2MR7 A;  1NQ4 A;  3CCM P;  2GZI A;  2VSQ A;  1M6N A;  2KOO A;  1EOQ A;  5EJD A;  1AYI A;  1YHQ P;  2KG8 A;  3CCQ P;  4PH0 A;  2LML A;  4COC A;  2MR8 A;  2LKI A;  4QKO A;  3H4E A;  2KGE A;  4M0I A;  2LPK A;  4PWV B;  2QA4 P;  2E1M A;  1L0I A;  2GDX A;  2FVE A;  5KP6 B;  2M8N A;  5HGM A;  4XRO A;  2WPT A;  3CPW O;  5HGN A;  2QEX P;  2FAD A;  2EG5 A;  2K92 A;  1M6E X;  2L6E A;  2PEM A;  4H2X C;  2JGP A;  2XT1 A;  2Z45 A;  3GKL C;  1EIA A;  1A8O A;  1VQ6 P;  4WYM A;  1MZ8 A;  2KOR A;  2GDW A;  2L0Q A;  1K8A Q;  3G1I A;  4BPG A;  1RNI A;  2NO8 A;  4CA3 A;  2VLQ A;  3U43 A;  3CCL P;  1D1D A;  3CC2 P;  1Q82 Q;  2KWL A;  1IMQ A;  2PY8 A;  2KGA A;  2VLO A;  1E0H A;  3B5I A;  2VLN A;  4U0E A;  2KR5 A;  2N50 A;  1VQ8 P;  2FQ2 A;  3CC4 P;  2LOL A;  3CCS P;  2N98 A;  2VLP A;  1BAJ A;  2AFE A;  3CXC O;  4GR2 A;  1Q7Y Q;  2GZJ A;  1NJI Q;  3OW2 O;  1M1K Q;  3EJE A;  4UHP B;  2PEQ A;  1RO2 A;  5I4T G;  4PH1 A;  3G1G A;  4U0D A;  2DGY A;  1HQB A;  1K73 Q;  1DNY A;  3CCR P;  2EHT A;  1AUM A;  3WBH A;  2KOS A;  4NEO A;  4IPY A;  3G29 A;  1L0H A;  2XV6 A;  1ZMB A;  2BUO A;  4XFZ A;  3LRY A;  3HZQ A;  3CC7 P;  3HYB A;  2MY5 A;  1GXG A;  2KW2 A;  3G4S P;  1YJW P;  1VQ4 P;  2AFD A;  2PNG A;  2N6Z A;  3LMO A;  1QRJ A;  5BS2 A;  1QVG O;  1VQN P;  4BPF A;  1VQP P;  3GJN A;  3DS1 A;  2CGQ A;  2JO0 A;  2OTJ P;  2KGD A;  2OTL P;  1T8K A;  1KQS O;  4U0A A;  1YIJ P;  4PXH B;  4XFX A;  2FVF A;  3DTJ A;  1F80 D;  3CCJ P;  2PEK A;  2JQ4 A;  3M1M A;  2CNR A;  2KGC A;  3CCU P;  1UNK A;  2PEN A;  5HGO A;  2ERH A;  2FHS C;  2CG5 B;  2L4B A;  4MRT C;  2DNW A;  2M5R A;  2JYL A;  1AF8 A;  2EFJ A;  2LIU A;  1VQ9 P;  3G28 A;  2L22 A;  1DV5 A;  5DCK A;  2XXM A;  3NTE A;  1KLP A;  1ACP A;  1Q81 Q;  3DS0 A;  4COP A;  2EHS A;  2MVV A;  2CQ8 A;  1VHN A;  5HVC A;  5KP7 B;  4QNB A;  2GZF A;  2LF4 A;  3H47 A;  3E2D A;  3NY7 B;  3VRL C;  5HGL A;  3DS5 A;  2MD9 A;  2ROQ A;  1UJZ A;  2K0D X;  2PEJ A;  4HKG A;  3CMA P;  4F37 A;  1Z6M A;  1E6J P;  2GZG A;  5EW5 E;  2BHV A;  2Z46 A;  4XRQ A;  3I55 P;  2AVA A;  2JYG A;  1KD1 Q;  5F2K A;  1N8R Q;  2KG9 A;  2K2Q A;  3B4Q A;  2XZ0 D;  3RG6 C;  2JAZ A;  1GPJ A;  1VKU A;  4U0B A;  2JB0 A;  2K0X A;  2M8P A;  2GZE A;  3Q20 A;  3RG2 A;  5F2O A;  2X2B A;  3MGE A;  2XZ1 C;  3CCV P;  5F2N A;  2FQ0 A;  3CE7 A;  2KOQ A;  2LTE A;  1Q86 Q;  2PEI A;  1S72 P;  3I56 P;  2L9F A;  1KC8 Q; 
#chains in the Genus database with same CATH homology
 4PXH B;  2FVF A;  1F80 D;  2FVA A;  4H2W C;  2JQ4 A;  2CNR A;  2KGC A;  2LOL A;  2KG6 A;  2AF8 A;  2MR7 A;  4DG9 A;  2N98 A;  2N6Y A;  1NQ4 A;  2FHS C;  3EJD A;  5HV8 A;  2CG5 B;  2L4B A;  2MVU A;  2LIW A;  4MRT C;  2N5I A;  2AFE A;  2DNW A;  2VSQ A;  2M5R A;  1AF8 A;  2KOO A;  5EJD A;  2FQ1 A;  2LIU A;  3GZL A;  2KG8 A;  2L22 A;  1DV5 A;  2LML A;  3EJE A;  2QNW A;  2MR8 A;  2LKI A;  5KP8 B;  1KLP A;  1ACP A;  2MF4 A;  2KGE A;  2LPK A;  2EHS A;  4PWV B;  2MVV A;  2CQ8 A;  1L0I A;  2GDX A;  5CZD B;  2FVE A;  1HQB A;  5KP6 B;  5HVC A;  2JU1 A;  5KP7 B;  1DNY A;  4IZ6 A;  1HY8 A;  2GDY A;  2FAD A;  2K93 A;  2K92 A;  3EJB A;  2EHT A;  2FAE A;  3NY7 B;  4H2Y C;  4H2X C;  2JGP A;  2KOS A;  2K94 A;  2MD9 A;  4NEO A;  2ROQ A;  1X3O A;  1L0H A;  4R0M A;  4HKG A;  1OR5 A;  2AVA A;  2KOR A;  2GDW A;  2L0Q A;  2MY5 A;  2KW2 A;  2KG9 A;  2K2Q A;  2N5H A;  4BPG A;  2XZ0 D;  2AFD A;  2PNG A;  2N6Z A;  1VKU A;  3LMO A;  4CA3 A;  2K0X A;  2KOP A;  3RG2 A;  4BPF A;  2X2B A;  2KWL A;  2XZ1 C;  2K0Y A;  2CGQ A;  2KGA A;  3GZM A;  4BPH A;  2FQ0 A;  3CE7 A;  2KOQ A;  2KGD A;  2LTE A;  2LL8 A;  2FAC A;  1T8K A;  2JU2 A;  2KR5 A;  2N50 A;  2FQ2 A;  2L9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...