3CPWO

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cpwO03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cpwO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cpwO02
3CXCO 1VQ8P 3CD6P 1YJWP 3G6EP 3CMAP 1YHQP 1YJNP 1K8AQ 3CC7P 1YI2P 3G71P 1Q7YQ 1KC8Q 1VQMP 1VQPP 1VQ4P 1Q82Q 3CMEP 1KQSO 1VQ9P 1QVFO 2OTJP 3I56P 1S72P 1VQOP 1Q81Q 1Q86Q 1M1KQ 3I55P 3CCLP 2OTLP 1VQ5P 3CCUP 1VQLP 1YIJP 1N8RQ 3CCRP 3G4SP 1VQ7P 3CPWO 3CC2P 3OW2O 1QVGO 1NJIQ 3CCMP 1VQ6P 1W2BO 1VQNP 3CCQP 2QEXP 3CCJP 1K9MQ 1YJ9P 1K73Q 1YITP 3CCVP 2QA4P 1M90Q 1KD1Q 1VQKP 3CC4P 3CCEP 1JJ2O 3CCSP
chains in the Genus database with same CATH superfamily
3WMM0 1BCCG 2AEJA 4BPHA 3OAKA 2FFDC 5AVTB 4H13B 1HBWA 1K05A 2XKMA 1DIPA 3M0DA 4PJ0E 2OYHA 2PNGA 2KB7P 4U7JA 2POHA 1QL1A 2O01H 3VMZA 4ASWA 1NU1K 1ZLLA 1RF1A 1ACPA 1KC8Q 1ZRTE 2KNCB 3L71J 4JYBA 2ERHA 3HE5B 3CX5H 3O6QA 1URQA 4CPGA 2H89C 1FR2A 2K0YA 2KXPB 2P67A 5DCKA 3WUUA 3GF7A 1KD1Q 3C9IA 1KYOD 3SWKA 2FYUD 1DX7A 5B66E 1M1JA 3NMDA 2GZJA 1MFTA 1N7SB 1Q7YQ 2E5YA 2BCCG 1EZVD 3RK2B 1VQNP 2PAJA 3H1LJ 4H44B 1S4XA 2LMLA 1JJ2O 3FX0A 1IFMA 2AEMA 3NTEA 1L0NK 1YQ4C 1ZMBA 4NEOA 2ZT9C 1OXZA 4YXDC 5AVUB 2KGAA 2YKOA 3SFEC 4DG9A 2QJKC 3AEDC 1S72P 2PGDA 2M3BA 1X79B 2XV6A 1PPJG 3PJSK 3CXHE 3AEAC 1YJ9P 2WPSA 3L72J 2K9YA 2W6BA 4U0CA 1X3OA 1AUMA 1L0IA 1J2JB 2RN0A 2MY5A 4RKUJ 1L0NJ 1RF0C 2KNCA 3HE5A 4PXHB 2N1TD 2Z4EA 3WBHA 3RBXA 1NYHA 2EFJA 4I1LA 2PEJA 1NU1D 1GPJA 1YJWP 1PEUA 2AF8A 5CZDB 1BCCE 4N3YB 3BATA 1N7SA 4KHXA 3RBZA 3G21A 2FYUG 1LTJA 1PP9J 5EJDA 3N4XA 4IFDK 4PH0A 1QEXA 2AXTH 2KLUA 2QNWA 3BCCG 2O1KA 1KTMA 1LTTC 5APWA 1L0LG 3H1HG 2CWOA 2O01N 2WPTA 2KZIA 3CC2P 3AE7C 2KW2A 4RJTA 2OYIC 4BWNA 1P84I 4O9BA 1SVFA 2P2UA 3KDPB 1PL5A 2D2CB 1KMIZ 3TK1A 2PEMA 1L0ND 3C1LA 5KLVK 1FAVA 2K2QA 5APUA 2Y9ZA 4IFFA 3L71G 2BCCE 1M8OB 3QWOC 3WU2H 1VF5D 3HUSC 4Y99B 3CCJP 4LC1A 3L70G 1DV5A 3ITKA 2QG4A 3EJEA 5E79E 5TISH 1PP9D 4N6JA 1NTKJ 3LIDA 5KLVJ 4OGQB 3TSIA 3CI9A 2AVAA 2Q6QA 3A5TA 1PPJE 5CCGC 2GUSA 1USDA 1NHLA 5KP7B 1GW4A 2KODA 3H1LG 1L0HA 1E0HA 2A06D 2B88A 1SFCD 1NWQA 1PGPA 1P84H 3H25A 4W80A 3G1GA 1CI6B 4XFJA 1PEMA 1GK6A 2E75C 4W7YA 4BPFA 4GODA 2B87B 1PGJA 4KT0J 4I7ZB 3CXCO 2HFED 2KG8A 3L72G 3P8CE 2Y9YA 3RG2A 4IL6E 5EW5E 3QH9A 2QJPB 1X22A 2NPSD 1MZ8A 1GL2B 1J1DB 2IFMA 1GXHA 4DJGA 2FYUE 3DS1A 1KZUB 2YKPA 1OX3A 4UHPB 4WY4B 1Q2NA 1MUUA 1KQFB 1H89A 4WYMA 1LNQA 5KLVD 4COPA 3H0DA 2P10A 2WQYC 2OGUA 3BCCE 2V7QJ 4D6TD 1NAFA 3HZQA 2WMMA 2LKMA 1L0LE 3H1HE 2N1TA 1MV8A 1KV4A 2OTLP 2KK7A 3TGUD 3OW2O 2B89A 2N50A 4R0MA 2WWWA 2QA4P 1KB9D 2HODA 1FZEA 4QKOA 3E1IA 2V4HA 2LIUA 1OMIA 3DTJA 1YI2P 3VOPA 2M5RA 2MR7A 2KOGA 1R8EA 2FAEA 2Q3IA 1M1KQ 1CI6A 5APTA 3L71E 3HD7B 2IBZG 3LW5H 2B87A 5K5GB 2YXQB 4BRYB 1EOQA 2CG5B 4IFMA 3L70E 4XA4A 3Q5RA 2N6ZA 3WUVA 1KORA 3AEEC 2FQ2A 5CMZA 3NXSA 2Q7CA 3V2QA 4UB6E 3G28A 1HTLC 1J1EB 1ZRTD 1K30A 3MUDC 1L4AB 2I1JA 2ZT9D 5KAFE 3A2AA 4OWFA 2YMKA 3AE9C 3WUTA 4WY4A 4H2WC 1N73A 2JB0A 2C0WA 3H1LE 2KR5A 1JY2N 2ONTA 3AE5C 2C0XA 2M8RA 3IN6A 2WSCJ 2Y0DA 1OVUA 5AW8B 2G8YA 1NTKG 1A43A 3L36A 3A0HH 1Q90D 2KGDA 4JYCA 1IFPA 1G1JA 5B5EE 2L4BA 1KYOI 1DNYA 2IDBA 1YQ3C 1JTHB 4JBZA 3H1IJ 3L72E 3A0BH 3FGAD 1Q82Q 2FBWC 1JY2O 2DGYA 3G3ZA 1EZVI 3M9QA 2L91A 3KPEA 2E5TA 4PD4E 3EJBA 3HTKB 4HKGA 1S9KD 3HD7A 3G0VA 3CCSP 1QL2A 4YPCA 3CXHD 2JJLA 1IFIA 3H32B 5APVA 1W5CE 1LT9B 1VQLP 1IK9A 3LIEA 2FYZA 5APYA 1OW8A 1NOHA 4HH2A 1L4AA 5EFWB 1USEA 5AVVB 1EC5A 1DEEG 2FFDA 1RQVA 4W7ZA 2MKVA 3VMXA 1U7JA 1KYOH 1LTSC 1BCCD 2A45I 2E76B 3MZWB 2YO3A 1AVYA 3RK3E 3P05A 5JPAA 1FC2C 2IBZE 3L73J 4H0LC 2JYGA 1NTMJ 1JTHA 1H0TB 2NRGA 1RO2A 2KI7B 4OVNF 1HGZA 4H13D 3VP9A 4CA3A 3B5NC 3C8VA 1E5WA 3BVHA 1S5LX 3HTKA 2J58A 4HJGH 1RF1B 3P32A 2FYUK 5GTHE 2IX7C 1URQB 3AE8C 5KP8B 4JPZB 4TLFA 1LT9A 1NTKE 2N98A 2AFEA 3RK3C 2YIUB 1L0LK 2K88A 1SFCC 3B5IA 1M1JB 2BCCD 5H2FH 3L74J 5AW5B 3P8MC 1H88A 2W8ZA 1KILB 2ZXEB 2EHTA 2W83C 1UIIA 5APQA 2L0QA 1FDMA 3BCCJ 2NPSC 2G3AA 3H1HJ 1EMVA 1PPJD 2LPKA 3ZDMA 1YBKA 1X9VA 3G71P 1H0TA 3EJDA 1DEBA 3TNUA 5AVQB 1OZHA 1AVOA 3H1IG 1Q81Q 1ZV8A 2YO2A 2HR3A 1RF0A 3SFDC 3A3YB 1LWUB 2RH0A 1YTZT 4L76A 2GDYA 3A7OA 2W90A 3NY7B 1G2CB 1S5LH 3VMAA 2GZEA 3K5BA 3L4FA 4XFYA 3LRYA 1Z6MA 1PIXA 3PHLA 3P8CD 1WT6A 5GTIE 1FE6A 3WU2E 3L70J 4AYCA 3L74D 3GKLC 2VSQA 2CK3H 4U0BA 2KYVA 3M06A 2CNRA 3MGEA 3E2DA 2KWLA 1KILA 1LTJB 1SQVJ 3M91A 1YTZI 1X8YA 2BUOA 3BCCD 4DZOA 1FZAA 2HPCA 2H7HA 1L0LD 3H1HD 3VN0A 4EIJA 1AA0A 2P9XA 1CEIA 3CC4P 3V4WA 3MP7B 1BE3G 2OYIA 5CCHD 3CL3D 2R5DA 3L73G 1NTMG 5AW6B 5I4TG 3GMAA 1S9KE 4H2XC 2EHSA 2FKWB 3B4QA 1U7MA 4L73A 1LWUA 3V6IA 1MKMA 3HUSA 1KB9I 2OTKE 1GTWA 2JO0A 1HGVA 3L71D 1HUCA 1G2CA 2Q5UA 5KLIB 1FZCC 5AW7B 5AW9B 3L70D 3R2PA 1AV1A 2BHVA 3MD0A 4HB1A 5AW2B 3DS0A 1M56D 5CCGA 1LP1B 2PP6A 1HJ0A 1VQ8P 4IZ6A 3G6EP 3EWKA 2M0BA 3TF5A 1EXJA 1LTBC 4PV1C 3M0DC 5BVZA 2OYHC 2FVAA 3L74G 1HH0A 3H1IE 3H1LD 3JCUE 1BSHA 1LTIC 1OVVA 4ASVA 1H8AA 5KAIH 1T8ZA 2I1KA 2KG9A 1VL2A 1SS1A 2GZGA 2KOSA 2WSEH 2N9YB 5AW0B 1M6NA 5TJHA 1EXIA 3ABVC 1KB9H 2MD9A 4ZMDA 3L72D 3CWBG 5AW4B 1QRJA 1G1IA 3RG6C 3IAOA 2RKLA 3AE3C 1HQBA 1VHNA 2M5AB 1BDCA 4PD4D 1NTKK 1HJBA 2QJYB 3KHUA 1VQPP 4C46A 3CLQA 3I56P 2K92A 4PJ0H 4H0LD 1OW6A 2KOQA 3MGNA 2ZXXA 3CX5D 1OW7A 3DS5A 4GT1A 4B86A 2GA1A 4H2YC 2XNXA 2CPSA 1BE3E 1LP1A 4EYYQ 3CXHI 4H13C 3B5ND 1S1CX 2JAZA 2E42A 3L73E 2N1TB 1NTME 1VQOP 1HF9A 1YIJP 2FY8A 3KXDA 5C39A 1SQVG 2AFDA 1T6AA 4EI2A 2JU2A 3KZIE 2HODB 2FADA 5B66H 1EDJA 3CC7P 2K93A 3V2NA 1JY2P 1RE3A 3RK3D 2ZFCA 1VPCA 2MVVA 1GU4A 2IBZD 2YNYA 3I55P 2JO1A 2WPQA 2Z46A 2WSFH 3RGUA 4M0IA 2JYLA 3MUDA 2FQ1A 2W6AA 2IYOA 5KP6B 1N7SC 2VLPA 2M5AA 1ZW0A 2IFNA 1SQQJ 3L74E 1KQLA 3TYYA 3RK2C 2GDWA 1JY3P 1NJIQ 4H44C 3CXHH 2QM7A 3GJNA 1JCDA 3M1MA 2WTYA 4Z1MH 3GZLA 2K5XA 1N73B 1NTKD 1K8AQ 1VF5B 2N6YA 1RNIA 1ZR4A 3RL0B 2N5IA 3CPWO 3CWBE 3GZMA 4RESB 1T2KC 4ZKUA 2W6JH 3AEFC 2R32A 2E74B 4IPYA 1SQXG 2QM8A 1VQ4P 1JB0J 2R3SA 2FXMA 1PGQA 2ZJSE 1U57A 1PGOA 4COCA 2JP3A 1CW5A 1NGMB 1ZP0C 3H4EA 2KOOA 2PEKA 2L5GB 1RH5B 2FYNB 2XZRA 5BS2A 2LF4A 1JOCA 5HGLA 4R4LA 2K9JB 1YYCA 1SQBJ 4C7NA 2BQ1E 2E1MA 2GZFA 3VP8A 5CCHC 1ZMEC 5AVWB 1ZR2A 2B9BA 1SQVE 2WITA 3U1AA 2XZ1C 2YMYA 5CBNA 2Q1KA 2FFDB 2VLOA 2OQQA 3BRTB 3TDKA 2KGCA 5KTBA 1EIAA 5AVSB 1FZGA 3H1KJ 2D2CC 3G26A 1SP4A 1E6JP 1FZBA 3DS4A 1QGKB 1IMPA 1YHQP 1JCCA 2LKIA 1HVVA 2K0XA 4U3FJ 4Y99C 3KQGA 5CBOA 1JY3N 4PV1D 2FVFA 2KSJA 1GU5A 4L74A 3Q5SA 1OVRA 1R5LA 1L2PA 1SFCA 2KIKA 1T3JA 1SQBD 4OGQC 4BPGA 2LTEA 2LR2A 3CX5E 2K9JA 4XROA 3LW5J 1CZQA 1SQQG 3CCMP 4U0FA 1JY3O 1NTMK 2H43A 2LL8A 1BDDA 5HVCA 2NPSA 3G9RA 3BRVB 1UIXA 2CGQA 2ZT9B 1SQXE 4UB8H 1BAJA 2QJKB 2HLOA 2L9FA 2QVAA 2ZVNB 2MJZA 1BE3J 2WZ7A 1SQPJ 1K73Q 4BXLA 1Y9BA 3H1ID 2PEQA 4I7ZC 5HGMA 3GF3A 3TNUB 2QJPC 2XDJA 1GL2C 1J1DC 3L75J 2Y0EA 5AVXB 3D6YA 1OWAA 1SLQA 2MR8A 1UNKA 2LXBA 5APSA 4WY4C 3M0AA 3JSVC 1EQ7A 3CD6P 5DJTB 2P58A 3F5HA 3CE7A 1FBMA 2GZIA 4EDFA 2JU1A 5CHXA 4OH8B 2ZYDA 1XTCC 2K1AA 1SQBG 3BASA 2WPVB 1S3JA 4MRTC 3GHGC 3Q2YA 3CCEP 2DW3A 2KSEA 3S9OA 1QX8A 4PD4I 4F37A 3SWYA 4K3AA 2A45H 2P1JA 1HY8A 3MTUE 1JO5A 2JEEA 1BE3D 4XE5B 2JBGA 1N7SD 1OFCX 3B71A 2O1JA 2HPCB 3L73D 1AQTA 3Q5PA 5KAFH 2OYIB 1NTMD 2AXTE 2M8NA 3H1KG 3B4SA 2NZ2A 3RK2D 1RO0A 4H44D 1NTZK 3VMYA 3II6A 4GOFA 2BASA 3CWBJ 1Q86Q 2ROQA 1IK7A 2H88C 3CCUP 1J1EC 1L4AC 1QVGO 2PENA 1N2DC 2R44A 4WBAA 1SQQE 3HUSB 4U3FG 5B5EH 2K3RA 2ZYAA 1RE4C 1X0TA 2XZ0D 2JDIH 4PWVB 1NKNA 3L35A 2C9NY 3U1CA 1KQSO 1SQVK 2H8PD 2IBZI 1T2KD 1FOSE 1NTZJ 2FACA 1JNMA 4PD4H 3UIAA 3D71A 4XRQA 1JMMA 2VLQA 3JC22 1OR5A 4GIFA 3SSUA 1AJYA 2KGEA 3AEGC 3KYQA 5TISE 2JWAA 4R4MA 4GOEA 1AQ5A 1Z56A 5KJ7C 1GMJA 3M9HA 1VQ7P 2E75B 2PEIA 3D70A 3E1RA 2LXCB 1YITP 2PEOA 1NO4A 3S1KA 2LIWA 4M3LA 1SQPG 2J5UA 4I6MC 3CWBD 1NU1J 2I8DA 4I2LC 3AE1C 3H1JG 1P84E 5KKZC 1LT9C 1D7MA 3NTNA 2IPPA 3V4QA 1GK4A 3L75G 4U0DA 1WRGA 2KP8A 1BGYJ 3V2PA 1SQBE 1QLED 1JMBA 2XV5A 3AE6C 4LGDE 1M74A 1NVOA 3Q1MA 4U0EA 3AECC 5AW1B 1NTZD 4HYTB 2D2CD 2K0DX 4U0AA 1ZN5A 2E76C 1NKZB 1EDIA 2Z44A 3I5CA 1RY3A 2O01J 2ZYGA 2RMZA 4QMAA 1NQ4A 2FVEA 1SQXK 3HYBA 1IO4A 2MVUA 1CSBA 1A02J 3H1KE 1KFMA 5GTHH 2IYPA 2P7JA 1DD4A 5HGOA 1SQVD 5DJUB 1KILE 1LGHB 2JGPA 2JKVA 1LTAC 1ZOYC 1PFIA 1FOSF 4OGQD 1RF1C 2Z5HA 4U3FE 4JQ0D 1SQXJ 3AE2C 1ZXGA 3MIWA 1URQC 1VQMP 1VKUA 1HWTC 1BGYD 5M1BA 3U59A 2FQ0A 1N8RQ 1RHZB 2BEZF 2YIUC 5F2KA 2O3JA 1MFZA 1FU1A 1M1JC 1EZVG 2L22A 5CJ4A 1KILC 2XU6A 2OTJP 2NO8A 1NH4A 3GW6A 2JWDA 2QSIA 2C9LY 3GLMA 1NTZG 1GL2D 4RO0A 2WVRA 1JM0A 1M90Q 3FWLA 4ZNCA 2X2BA 2UWJE 1N7LA 1Y8AA 2N9BA 2JR8A 3EQ2A 1SQPE 2KUBA 3RL0g 2PFXA 2KLVA 4WY4D 1KN7A 2PRRA 5CJ0A 3H1JE 5AW3B 2R5BA 2V7QH 1AFOA 1LWUC 2WSSH 5GTIH 3G4SP 3A0HE 1E79H 3L75E 4EOTA 3LMOA 2KS1B 1SQXD 5BU5A 3RL0D 3NFQA 2A45G 1FJKA 4N78E 3PTZA 2W27A 2XT1A 3A0BE 3MHVA 1SQQK 4GR2A 1NU1G 1ZNVA 4D6TJ 4NPFX 2E74D 4L75A 2AEFA 1FDOA 2XXMA 2Q3EA 5CCHA 2KZJA 3TGUJ 1BGYG 2WSEJ 5AVYB 2WT7B 3H47A 3CMAP 3FXEA 3HD7D 3G29A 1IFNA 4C7NB 2E43A 1LTJC 2KG6A 5HV8A 1EDLA 1IJDB 4QNBA 1GW3A 2QEXP 3Q20A 3P7KA 4Y28J 2VRSA 1VQKP 1KQGB 4H0LB 4NPEA 4ZKPA 1L4AD 1D1DA 3F89A 4HKZH 4UB8E 3IFMA 3B8EB 1KYOE 1L0NG 1M6EX 2OYOA 4DCKA 2YXRB 1LJ2A 3B5NB 1PZQA 1IC2A 2WSCH 3CCVP 2KS1A 4K35A 1EZVE 7CEIA 1MZ9A 2EG5A 5KLIC 1SQBK 1GXGA 4XFXA 3L37A 1QVFO 1IUQA 2KOPA 1EDKA 2PY8A 3JCUH 1PP9G 3GHGB 4GR6A 1IMQA 1Y47A 3RK3B 1NTZE 4PH1A 1SFCB 2BEQD 5KJ7D 1K04A 4A7PA 2VLNA 3Q3DA 1WMKA 2WT7A 1SQQD 4C7RA 2WSFJ 2OARA 1VQ5P 4KJMA 2A06G 2N5HA 2FXOA 1M7LA 3DPHA 4IL6X 1RE3C 2HYNA 2NPSB 5H2FE 2SPZA 1YJNP 5BS1A 2K37A 2M8LA 1GD2E 2L6EA 4WWIA 1GL2A 1PV3A 3H6PA 4AQRD 1NU1E 1R5SA 3FXDA 3B5NA 1F80D 5F2NA 2E76D 1BGYE 2QJYC 3S4RA 1NAYA 1A8OA 1XTGB 2CPBA 2J59M 5E79H 1FZFA 1VQ9P 1FJPA 3PP5A 5L8RJ 5KLVG 3EFGA 3VYIA 1KLPA 3CCRP 4D6TG 1DH3A 3CCQP 1FDIA 1P84D 1BCCJ 3GHGA 3OJAB 3KZIH 4LLHA 3W67A 3TGUG 3AE4C 1S2EA 1S5LE 3EFFK 2N1TC 2M8PA 3DS2A 3CMEP 2QIWA 2XNDH 2WPRA 1SQPK 2FHSC 1L0NE 5HGNA 2QRXA 1URQD 1AYIA 1JUNA 5AVZB 4WVZA 4BRYA 1TU3F 1KFNA 5APXA 1UJZA 4IOIH 4IL6H 5F2OA 5KKZB 3PRJA 3H1KD 4YTPC 3HE4B 3T97B 1W2BO 1KILD 1AF8A 1PP9E 2EIAA 1JEKA 3W68A 1W2EA 1M57D 3H1JJ 1RE4A 4AUWA 4DOJA 2YKQA 1BSNA 2Z45A 2BCCJ 3IR9A 4XFZA 1FZCB 3PH0A 2DNWA 2FXPA 4U3FD 3CCLP 3FWNA 3V5BA 2JQ4A 3VTPC 1VQ6P 1RQUA 2GDXA 2A06E 1DD3A 3GG2A 1N86A 2M3EA 2HG5D 1N73C 2KORA 3V2RA 2GUVA 1IFDA 1OIPA 3USSA 1VDFA 1VF5C 1T8KA 5BU8B 2LOLA 2ITAA 4PV1B 2ZAEB 2OYHB 1PEOA 3DS3A 3RL0C 1GDTA 2IZ1A 1IZNB 5KJ7A 2GM4A 3AEBC 3N7NA 4JF7A 2R3CA 2AXCA 3SWFA 3D6ZA 3M9BA 1LTGC 3VRLC 3R4YA 2Y0CA 2E74C 1FS0E 2Z5IA 5CCGD 4NPDA 4DT0A 3O6QB 3H32A 4YXWH 2GYKA 2QE7H 1IFJA 1LT1A 5AVRB 1SQPD 4UB6H 2MF4A 5KLVE 1A02F 3HE4A 3HD7C 3PLNA 3T97A 1K9MQ 4D6TE 3CX5I 2IZ0A 3IF4A 3H1JD 1PEQA 2FYNC 5KAIE 2E75D 1BXIA 4WB4A 4MN4C 3L75D 2Q9IA 2K94A 3O8ZA 3TGUE 4GKGA 1GZLA 2FYUJ 3E7KA 4TT3H 3G1IA 2CQ8A 1FZCA 2ZVOB 3OA7A 1KB9E 4N78D 3HRNA 1T3UA 3U43A 4GDOA 1L0LJ
chains in the Genus database with same CATH topology
3B5IA 3G26A 3CD6P 1E6JP 3DS4A 3H47A 3CMAP 1YHQP 1YJNP 4U0CA 1K8AQ 3G29A 5BS1A 1AUMA 3DTJA 2M8LA 1YI2P 2L6EA 1VQMP 1VQPP 2Z45A 4XFZA 1RNIA 3I56P 5I4TG 3CCLP 1M1KQ 1VQLP 1N8RQ 1VQ7P 2PEIA 3CPWO 1VQ6P 4QNBA 5F2KA 2QEXP 3Q20A 3WBHA 3DS5A 1YITP 1VQKP 2PEOA 3CCEP 2EFJA 2PEJA 1EOQA 5F2NA 2JO0A 2KODA 1YJWP 1PEUA 1A8OA 1D1DA 3G71P 4IPYA 1KC8Q 1VQ4P 1VQ9P 2OTJP 1PEOA 3DS3A 1VQOP 1Q81Q 2BHVA 3G1GA 3G21A 4XROA 4COCA 1PEMA 1M6EX 3G28A 1YIJP 4U0DA 3CCRP 5DCKA 1K30A 3CCMP 3CCQP 3H4EA 4U0FA 2PEKA 1KD1Q 4PH0A 3P05A 5JPAA 3CCVP 1M90Q 3DS0A 1M74A 2M8NA 2JYGA 3VRLC 3CXCO 5BS2A 1VQ8P 2LF4A 3G6EP 4U0EA 3CC7P 2EG5A 1RO0A 5HGLA 1RO2A 2ONTA 1Q7YQ 4XFXA 2CWOA 2M8PA 3DS2A 3CMEP 4XFYA 1QVFO 3LRYA 1IUQA 2BQ1E 2E1MA 4U0AA 1BAJA 1Q86Q 3I55P 3CCUP 1A43A 2Z44A 3CC2P 2Z46A 3G4SP 3DS1A 2PY8A 2PENA 1QVGO 5HGNA 1VQNP 1K9MQ 4GR6A 4M0IA 1K73Q 2JYLA 1PEQA 2PEQA 3HYBA 4PH1A 1JJ2O 4U0BA 5HGMA 2PEMA 4WYMA 4COPA 3H0DA 3NTEA 1ZMBA 2XT1A 3MGEA 5HGOA 3HZQA 1Q82Q 3E2DA 1KQSO 4GR2A 5F2OA 1M6NA 1S72P 3G1IA 2DGYA 2OARA 2OTLP 1VQ5P 2XV6A 2BUOA 2XXMA 3OW2O 1EIAA 1NJIQ 1W2BO 1QRJA 3CCJP 3RG6C 1YJ9P 2QA4P 3M1MA 2P9XA 2EIAA 3CC4P 3DPHA 3G0VA 4XRQA 3CCSP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC O;  1VQ8 P;  3CD6 P;  1YJW P;  3G6E P;  3CMA P;  1YHQ P;  1YJN P;  1K8A Q;  3CC7 P;  1YI2 P;  3G71 P;  1Q7Y Q;  1KC8 Q;  1VQM P;  1VQP P;  1VQ4 P;  1Q82 Q;  3CME P;  1KQS O;  1VQ9 P;  1QVF O;  2OTJ P;  3I56 P;  1S72 P;  1VQO P;  1Q81 Q;  1Q86 Q;  1M1K Q;  3I55 P;  3CCL P;  2OTL P;  1VQ5 P;  3CCU P;  1VQL P;  1YIJ P;  1N8R Q;  3CCR P;  3G4S P;  1VQ7 P;  3CPW O;  3CC2 P;  3OW2 O;  1QVG O;  1NJI Q;  3CCM P;  1VQ6 P;  1W2B O;  1VQN P;  3CCQ P;  2QEX P;  3CCJ P;  1K9M Q;  1YJ9 P;  1K73 Q;  1YIT P;  3CCV P;  2QA4 P;  1M90 Q;  1KD1 Q;  1VQK P;  3CC4 P;  3CCE P;  1JJ2 O;  3CCS P; 
#chains in the Genus database with same CATH topology
 3WMM 0;  1BCC G;  2AEJ A;  4BPH A;  3OAK A;  2FFD C;  5AVT B;  4H13 B;  1HBW A;  1K05 A;  2XKM A;  1DIP A;  3M0D A;  4PJ0 E;  2OYH A;  2PNG A;  2KB7 P;  4U7J A;  2POH A;  1QL1 A;  2O01 H;  3VMZ A;  4ASW A;  1NU1 K;  1ZLL A;  1RF1 A;  1ACP A;  1KC8 Q;  1ZRT E;  2KNC B;  3L71 J;  4JYB A;  2ERH A;  3HE5 B;  3CX5 H;  3O6Q A;  1URQ A;  4CPG A;  2H89 C;  1FR2 A;  2K0Y A;  2KXP B;  2P67 A;  5DCK A;  3WUU A;  3GF7 A;  1KD1 Q;  3C9I A;  1KYO D;  3SWK A;  2FYU D;  1DX7 A;  5B66 E;  1M1J A;  3NMD A;  2GZJ A;  1MFT A;  1N7S B;  1Q7Y Q;  2E5Y A;  2BCC G;  1EZV D;  3RK2 B;  1VQN P;  2PAJ A;  3H1L J;  4H44 B;  1S4X A;  2LML A;  1JJ2 O;  3FX0 A;  1IFM A;  2AEM A;  3NTE A;  1L0N K;  1YQ4 C;  1ZMB A;  4NEO A;  2ZT9 C;  1OXZ A;  4YXD C;  5AVU B;  2KGA A;  2YKO A;  3SFE C;  4DG9 A;  2QJK C;  3AED C;  1S72 P;  2PGD A;  2M3B A;  1X79 B;  2XV6 A;  1PPJ G;  3PJS K;  3CXH E;  3AEA C;  1YJ9 P;  2WPS A;  3L72 J;  2K9Y A;  2W6B A;  4U0C A;  1X3O A;  1AUM A;  1L0I A;  1J2J B;  2RN0 A;  2MY5 A;  4RKU J;  1L0N J;  1RF0 C;  2KNC A;  3HE5 A;  4PXH B;  2N1T D;  2Z4E A;  3WBH A;  3RBX A;  1NYH A;  2EFJ A;  4I1L A;  2PEJ A;  1NU1 D;  1GPJ A;  1YJW P;  1PEU A;  2AF8 A;  5CZD B;  1BCC E;  4N3Y B;  3BAT A;  1N7S A;  4KHX A;  3RBZ A;  3G21 A;  2FYU G;  1LTJ A;  1PP9 J;  5EJD A;  3N4X A;  4IFD K;  4PH0 A;  1QEX A;  2AXT H;  2KLU A;  2QNW A;  3BCC G;  2O1K A;  1KTM A;  1LTT C;  5APW A;  1L0L G;  3H1H G;  2CWO A;  2O01 N;  2WPT A;  2KZI A;  3CC2 P;  3AE7 C;  2KW2 A;  4RJT A;  2OYI C;  4BWN A;  1P84 I;  4O9B A;  1SVF A;  2P2U A;  3KDP B;  1PL5 A;  2D2C B;  1KMI Z;  3TK1 A;  2PEM A;  1L0N D;  3C1L A;  5KLV K;  1FAV A;  2K2Q A;  5APU A;  2Y9Z A;  4IFF A;  3L71 G;  2BCC E;  1M8O B;  3QWO C;  3WU2 H;  1VF5 D;  3HUS C;  4Y99 B;  3CCJ P;  4LC1 A;  3L70 G;  1DV5 A;  3ITK A;  2QG4 A;  3EJE A;  5E79 E;  5TIS H;  1PP9 D;  4N6J A;  1NTK J;  3LID A;  5KLV J;  4OGQ B;  3TSI A;  3CI9 A;  2AVA A;  2Q6Q A;  3A5T A;  1PPJ E;  5CCG C;  2GUS A;  1USD A;  1NHL A;  5KP7 B;  1GW4 A;  2KOD A;  3H1L G;  1L0H A;  1E0H A;  2A06 D;  2B88 A;  1SFC D;  1NWQ A;  1PGP A;  1P84 H;  3H25 A;  4W80 A;  3G1G A;  1CI6 B;  4XFJ A;  1PEM A;  1GK6 A;  2E75 C;  4W7Y A;  4BPF A;  4GOD A;  2B87 B;  1PGJ A;  4KT0 J;  4I7Z B;  3CXC O;  2HFE D;  2KG8 A;  3L72 G;  3P8C E;  2Y9Y A;  3RG2 A;  4IL6 E;  5EW5 E;  3QH9 A;  2QJP B;  1X22 A;  2NPS D;  1MZ8 A;  1GL2 B;  1J1D B;  2IFM A;  1GXH A;  4DJG A;  2FYU E;  3DS1 A;  1KZU B;  2YKP A;  1OX3 A;  4UHP B;  4WY4 B;  1Q2N A;  1MUU A;  1KQF B;  1H89 A;  4WYM A;  1LNQ A;  5KLV D;  4COP A;  3H0D A;  2P10 A;  2WQY C;  2OGU A;  3BCC E;  2V7Q J;  4D6T D;  1NAF A;  3HZQ A;  2WMM A;  2LKM A;  1L0L E;  3H1H E;  2N1T A;  1MV8 A;  1KV4 A;  2OTL P;  2KK7 A;  3TGU D;  3OW2 O;  2B89 A;  2N50 A;  4R0M A;  2WWW A;  2QA4 P;  1KB9 D;  2HOD A;  1FZE A;  4QKO A;  3E1I A;  2V4H A;  2LIU A;  1OMI A;  3DTJ A;  1YI2 P;  3VOP A;  2M5R A;  2MR7 A;  2KOG A;  1R8E A;  2FAE A;  2Q3I A;  1M1K Q;  1CI6 A;  5APT A;  3L71 E;  3HD7 B;  2IBZ G;  3LW5 H;  2B87 A;  5K5G B;  2YXQ B;  4BRY B;  1EOQ A;  2CG5 B;  4IFM A;  3L70 E;  4XA4 A;  3Q5R A;  2N6Z A;  3WUV A;  1KOR A;  3AEE C;  2FQ2 A;  5CMZ A;  3NXS A;  2Q7C A;  3V2Q A;  4UB6 E;  3G28 A;  1HTL C;  1J1E B;  1ZRT D;  1K30 A;  3MUD C;  1L4A B;  2I1J A;  2ZT9 D;  5KAF E;  3A2A A;  4OWF A;  2YMK A;  3AE9 C;  3WUT A;  4WY4 A;  4H2W C;  1N73 A;  2JB0 A;  2C0W A;  3H1L E;  2KR5 A;  1JY2 N;  2ONT A;  3AE5 C;  2C0X A;  2M8R A;  3IN6 A;  2WSC J;  2Y0D A;  1OVU A;  5AW8 B;  2G8Y A;  1NTK G;  1A43 A;  3L36 A;  3A0H H;  1Q90 D;  2KGD A;  4JYC A;  1IFP A;  1G1J A;  5B5E E;  2L4B A;  1KYO I;  1DNY A;  2IDB A;  1YQ3 C;  1JTH B;  4JBZ A;  3H1I J;  3L72 E;  3A0B H;  3FGA D;  1Q82 Q;  2FBW C;  1JY2 O;  2DGY A;  3G3Z A;  1EZV I;  3M9Q A;  2L91 A;  3KPE A;  2E5T A;  4PD4 E;  3EJB A;  3HTK B;  4HKG A;  1S9K D;  3HD7 A;  3G0V A;  3CCS P;  1QL2 A;  4YPC A;  3CXH D;  2JJL A;  1IFI A;  3H32 B;  5APV A;  1W5C E;  1LT9 B;  1VQL P;  1IK9 A;  3LIE A;  2FYZ A;  5APY A;  1OW8 A;  1NOH A;  4HH2 A;  1L4A A;  5EFW B;  1USE A;  5AVV B;  1EC5 A;  1DEE G;  2FFD A;  1RQV A;  4W7Z A;  2MKV A;  3VMX A;  1U7J A;  1KYO H;  1LTS C;  1BCC D;  2A45 I;  2E76 B;  3MZW B;  2YO3 A;  1AVY A;  3RK3 E;  3P05 A;  5JPA A;  1FC2 C;  2IBZ E;  3L73 J;  4H0L C;  2JYG A;  1NTM J;  1JTH A;  1H0T B;  2NRG A;  1RO2 A;  2KI7 B;  4OVN F;  1HGZ A;  4H13 D;  3VP9 A;  4CA3 A;  3B5N C;  3C8V A;  1E5W A;  3BVH A;  1S5L X;  3HTK A;  2J58 A;  4HJG H;  1RF1 B;  3P32 A;  2FYU K;  5GTH E;  2IX7 C;  1URQ B;  3AE8 C;  5KP8 B;  4JPZ B;  4TLF A;  1LT9 A;  1NTK E;  2N98 A;  2AFE A;  3RK3 C;  2YIU B;  1L0L K;  2K88 A;  1SFC C;  3B5I A;  1M1J B;  2BCC D;  5H2F H;  3L74 J;  5AW5 B;  3P8M C;  1H88 A;  2W8Z A;  1KIL B;  2ZXE B;  2EHT A;  2W83 C;  1UII A;  5APQ A;  2L0Q A;  1FDM A;  3BCC J;  2NPS C;  2G3A A;  3H1H J;  1EMV A;  1PPJ D;  2LPK A;  3ZDM A;  1YBK A;  1X9V A;  3G71 P;  1H0T A;  3EJD A;  1DEB A;  3TNU A;  5AVQ B;  1OZH A;  1AVO A;  3H1I G;  1Q81 Q;  1ZV8 A;  2YO2 A;  2HR3 A;  1RF0 A;  3SFD C;  3A3Y B;  1LWU B;  2RH0 A;  1YTZ T;  4L76 A;  2GDY A;  3A7O A;  2W90 A;  3NY7 B;  1G2C B;  1S5L H;  3VMA A;  2GZE A;  3K5B A;  3L4F A;  4XFY A;  3LRY A;  1Z6M A;  1PIX A;  3PHL A;  3P8C D;  1WT6 A;  5GTI E;  1FE6 A;  3WU2 E;  3L70 J;  4AYC A;  3L74 D;  3GKL C;  2VSQ A;  2CK3 H;  4U0B A;  2KYV A;  3M06 A;  2CNR A;  3MGE A;  3E2D A;  2KWL A;  1KIL A;  1LTJ B;  1SQV J;  3M91 A;  1YTZ I;  1X8Y A;  2BUO A;  3BCC D;  4DZO A;  1FZA A;  2HPC A;  2H7H A;  1L0L D;  3H1H D;  3VN0 A;  4EIJ A;  1AA0 A;  2P9X A;  1CEI A;  3CC4 P;  3V4W A;  3MP7 B;  1BE3 G;  2OYI A;  5CCH D;  3CL3 D;  2R5D A;  3L73 G;  1NTM G;  5AW6 B;  5I4T G;  3GMA A;  1S9K E;  4H2X C;  2EHS A;  2FKW B;  3B4Q A;  1U7M A;  4L73 A;  1LWU A;  3V6I A;  1MKM A;  3HUS A;  1KB9 I;  2OTK E;  1GTW A;  2JO0 A;  1HGV A;  3L71 D;  1HUC A;  1G2C A;  2Q5U A;  5KLI B;  1FZC C;  5AW7 B;  5AW9 B;  3L70 D;  3R2P A;  1AV1 A;  2BHV A;  3MD0 A;  4HB1 A;  5AW2 B;  3DS0 A;  1M56 D;  5CCG A;  1LP1 B;  2PP6 A;  1HJ0 A;  1VQ8 P;  4IZ6 A;  3G6E P;  3EWK A;  2M0B A;  3TF5 A;  1EXJ A;  1LTB C;  4PV1 C;  3M0D C;  5BVZ A;  2OYH C;  2FVA A;  3L74 G;  1HH0 A;  3H1I E;  3H1L D;  3JCU E;  1BSH A;  1LTI C;  1OVV A;  4ASV A;  1H8A A;  5KAI H;  1T8Z A;  2I1K A;  2KG9 A;  1VL2 A;  1SS1 A;  2GZG A;  2KOS A;  2WSE H;  2N9Y B;  5AW0 B;  1M6N A;  5TJH A;  1EXI A;  3ABV C;  1KB9 H;  2MD9 A;  4ZMD A;  3L72 D;  3CWB G;  5AW4 B;  1QRJ A;  1G1I A;  3RG6 C;  3IAO A;  2RKL A;  3AE3 C;  1HQB A;  1VHN A;  2M5A B;  1BDC A;  4PD4 D;  1NTK K;  1HJB A;  2QJY B;  3KHU A;  1VQP P;  4C46 A;  3CLQ A;  3I56 P;  2K92 A;  4PJ0 H;  4H0L D;  1OW6 A;  2KOQ A;  3MGN A;  2ZXX A;  3CX5 D;  1OW7 A;  3DS5 A;  4GT1 A;  4B86 A;  2GA1 A;  4H2Y C;  2XNX A;  2CPS A;  1BE3 E;  1LP1 A;  4EYY Q;  3CXH I;  4H13 C;  3B5N D;  1S1C X;  2JAZ A;  2E42 A;  3L73 E;  2N1T B;  1NTM E;  1VQO P;  1HF9 A;  1YIJ P;  2FY8 A;  3KXD A;  5C39 A;  1SQV G;  2AFD A;  1T6A A;  4EI2 A;  2JU2 A;  3KZI E;  2HOD B;  2FAD A;  5B66 H;  1EDJ A;  3CC7 P;  2K93 A;  3V2N A;  1JY2 P;  1RE3 A;  3RK3 D;  2ZFC A;  1VPC A;  2MVV A;  1GU4 A;  2IBZ D;  2YNY A;  3I55 P;  2JO1 A;  2WPQ A;  2Z46 A;  2WSF H;  3RGU A;  4M0I A;  2JYL A;  3MUD A;  2FQ1 A;  2W6A A;  2IYO A;  5KP6 B;  1N7S C;  2VLP A;  2M5A A;  1ZW0 A;  2IFN A;  1SQQ J;  3L74 E;  1KQL A;  3TYY A;  3RK2 C;  2GDW A;  1JY3 P;  1NJI Q;  4H44 C;  3CXH H;  2QM7 A;  3GJN A;  1JCD A;  3M1M A;  2WTY A;  4Z1M H;  3GZL A;  2K5X A;  1N73 B;  1NTK D;  1K8A Q;  1VF5 B;  2N6Y A;  1RNI A;  1ZR4 A;  3RL0 B;  2N5I A;  3CPW O;  3CWB E;  3GZM A;  4RES B;  1T2K C;  4ZKU A;  2W6J H;  3AEF C;  2R32 A;  2E74 B;  4IPY A;  1SQX G;  2QM8 A;  1VQ4 P;  1JB0 J;  2R3S A;  2FXM A;  1PGQ A;  2ZJS E;  1U57 A;  1PGO A;  4COC A;  2JP3 A;  1CW5 A;  1NGM B;  1ZP0 C;  3H4E A;  2KOO A;  2PEK A;  2L5G B;  1RH5 B;  2FYN B;  2XZR A;  5BS2 A;  2LF4 A;  1JOC A;  5HGL A;  4R4L A;  2K9J B;  1YYC A;  1SQB J;  4C7N A;  2BQ1 E;  2E1M A;  2GZF A;  3VP8 A;  5CCH C;  1ZME C;  5AVW B;  1ZR2 A;  2B9B A;  1SQV E;  2WIT A;  3U1A A;  2XZ1 C;  2YMY A;  5CBN A;  2Q1K A;  2FFD B;  2VLO A;  2OQQ A;  3BRT B;  3TDK A;  2KGC A;  5KTB A;  1EIA A;  5AVS B;  1FZG A;  3H1K J;  2D2C C;  3G26 A;  1SP4 A;  1E6J P;  1FZB A;  3DS4 A;  1QGK B;  1IMP A;  1YHQ P;  1JCC A;  2LKI A;  1HVV A;  2K0X A;  4U3F J;  4Y99 C;  3KQG A;  5CBO A;  1JY3 N;  4PV1 D;  2FVF A;  2KSJ A;  1GU5 A;  4L74 A;  3Q5S A;  1OVR A;  1R5L A;  1L2P A;  1SFC A;  2KIK A;  1T3J A;  1SQB D;  4OGQ C;  4BPG A;  2LTE A;  2LR2 A;  3CX5 E;  2K9J A;  4XRO A;  3LW5 J;  1CZQ A;  1SQQ G;  3CCM P;  4U0F A;  1JY3 O;  1NTM K;  2H43 A;  2LL8 A;  1BDD A;  5HVC A;  2NPS A;  3G9R A;  3BRV B;  1UIX A;  2CGQ A;  2ZT9 B;  1SQX E;  4UB8 H;  1BAJ A;  2QJK B;  2HLO A;  2L9F A;  2QVA A;  2ZVN B;  2MJZ A;  1BE3 J;  2WZ7 A;  1SQP J;  1K73 Q;  4BXL A;  1Y9B A;  3H1I D;  2PEQ A;  4I7Z C;  5HGM A;  3GF3 A;  3TNU B;  2QJP C;  2XDJ A;  1GL2 C;  1J1D C;  3L75 J;  2Y0E A;  5AVX B;  3D6Y A;  1OWA A;  1SLQ A;  2MR8 A;  1UNK A;  2LXB A;  5APS A;  4WY4 C;  3M0A A;  3JSV C;  1EQ7 A;  3CD6 P;  5DJT B;  2P58 A;  3F5H A;  3CE7 A;  1FBM A;  2GZI A;  4EDF A;  2JU1 A;  5CHX A;  4OH8 B;  2ZYD A;  1XTC C;  2K1A A;  1SQB G;  3BAS A;  2WPV B;  1S3J A;  4MRT C;  3GHG C;  3Q2Y A;  3CCE P;  2DW3 A;  2KSE A;  3S9O A;  1QX8 A;  4PD4 I;  4F37 A;  3SWY A;  4K3A A;  2A45 H;  2P1J A;  1HY8 A;  3MTU E;  1JO5 A;  2JEE A;  1BE3 D;  4XE5 B;  2JBG A;  1N7S D;  1OFC X;  3B71 A;  2O1J A;  2HPC B;  3L73 D;  1AQT A;  3Q5P A;  5KAF H;  2OYI B;  1NTM D;  2AXT E;  2M8N A;  3H1K G;  3B4S A;  2NZ2 A;  3RK2 D;  1RO0 A;  4H44 D;  1NTZ K;  3VMY A;  3II6 A;  4GOF A;  2BAS A;  3CWB J;  1Q86 Q;  2ROQ A;  1IK7 A;  2H88 C;  3CCU P;  1J1E C;  1L4A C;  1QVG O;  2PEN A;  1N2D C;  2R44 A;  4WBA A;  1SQQ E;  3HUS B;  4U3F G;  5B5E H;  2K3R A;  2ZYA A;  1RE4 C;  1X0T A;  2XZ0 D;  2JDI H;  4PWV B;  1NKN A;  3L35 A;  2C9N Y;  3U1C A;  1KQS O;  1SQV K;  2H8P D;  2IBZ I;  1T2K D;  1FOS E;  1NTZ J;  2FAC A;  1JNM A;  4PD4 H;  3UIA A;  3D71 A;  4XRQ A;  1JMM A;  2VLQ A;  3JC2 2;  1OR5 A;  4GIF A;  3SSU A;  1AJY A;  2KGE A;  3AEG C;  3KYQ A;  5TIS E;  2JWA A;  4R4M A;  4GOE A;  1AQ5 A;  1Z56 A;  5KJ7 C;  1GMJ A;  3M9H A;  1VQ7 P;  2E75 B;  2PEI A;  3D70 A;  3E1R A;  2LXC B;  1YIT P;  2PEO A;  1NO4 A;  3S1K A;  2LIW A;  4M3L A;  1SQP G;  2J5U A;  4I6M C;  3CWB D;  1NU1 J;  2I8D A;  4I2L C;  3AE1 C;  3H1J G;  1P84 E;  5KKZ C;  1LT9 C;  1D7M A;  3NTN A;  2IPP A;  3V4Q A;  1GK4 A;  3L75 G;  4U0D A;  1WRG A;  2KP8 A;  1BGY J;  3V2P A;  1SQB E;  1QLE D;  1JMB A;  2XV5 A;  3AE6 C;  4LGD E;  1M74 A;  1NVO A;  3Q1M A;  4U0E A;  3AEC C;  5AW1 B;  1NTZ D;  4HYT B;  2D2C D;  2K0D X;  4U0A A;  1ZN5 A;  2E76 C;  1NKZ B;  1EDI A;  2Z44 A;  3I5C A;  1RY3 A;  2O01 J;  2ZYG A;  2RMZ A;  4QMA A;  1NQ4 A;  2FVE A;  1SQX K;  3HYB A;  1IO4 A;  2MVU A;  1CSB A;  1A02 J;  3H1K E;  1KFM A;  5GTH H;  2IYP A;  2P7J A;  1DD4 A;  5HGO A;  1SQV D;  5DJU B;  1KIL E;  1LGH B;  2JGP A;  2JKV A;  1LTA C;  1ZOY C;  1PFI A;  1FOS F;  4OGQ D;  1RF1 C;  2Z5H A;  4U3F E;  4JQ0 D;  1SQX J;  3AE2 C;  1ZXG A;  3MIW A;  1URQ C;  1VQM P;  1VKU A;  1HWT C;  1BGY D;  5M1B A;  3U59 A;  2FQ0 A;  1N8R Q;  1RHZ B;  2BEZ F;  2YIU C;  5F2K A;  2O3J A;  1MFZ A;  1FU1 A;  1M1J C;  1EZV G;  2L22 A;  5CJ4 A;  1KIL C;  2XU6 A;  2OTJ P;  2NO8 A;  1NH4 A;  3GW6 A;  2JWD A;  2QSI A;  2C9L Y;  3GLM A;  1NTZ G;  1GL2 D;  4RO0 A;  2WVR A;  1JM0 A;  1M90 Q;  3FWL A;  4ZNC A;  2X2B A;  2UWJ E;  1N7L A;  1Y8A A;  2N9B A;  2JR8 A;  3EQ2 A;  1SQP E;  2KUB A;  3RL0 g;  2PFX A;  2KLV A;  4WY4 D;  1KN7 A;  2PRR A;  5CJ0 A;  3H1J E;  5AW3 B;  2R5B A;  2V7Q H;  1AFO A;  1LWU C;  2WSS H;  5GTI H;  3G4S P;  3A0H E;  1E79 H;  3L75 E;  4EOT A;  3LMO A;  2KS1 B;  1SQX D;  5BU5 A;  3RL0 D;  3NFQ A;  2A45 G;  1FJK A;  4N78 E;  3PTZ A;  2W27 A;  2XT1 A;  3A0B E;  3MHV A;  1SQQ K;  4GR2 A;  1NU1 G;  1ZNV A;  4D6T J;  4NPF X;  2E74 D;  4L75 A;  2AEF A;  1FDO A;  2XXM A;  2Q3E A;  5CCH A;  2KZJ A;  3TGU J;  1BGY G;  2WSE J;  5AVY B;  2WT7 B;  3H47 A;  3CMA P;  3FXE A;  3HD7 D;  3G29 A;  1IFN A;  4C7N B;  2E43 A;  1LTJ C;  2KG6 A;  5HV8 A;  1EDL A;  1IJD B;  4QNB A;  1GW3 A;  2QEX P;  3Q20 A;  3P7K A;  4Y28 J;  2VRS A;  1VQK P;  1KQG B;  4H0L B;  4NPE A;  4ZKP A;  1L4A D;  1D1D A;  3F89 A;  4HKZ H;  4UB8 E;  3IFM A;  3B8E B;  1KYO E;  1L0N G;  1M6E X;  2OYO A;  4DCK A;  2YXR B;  1LJ2 A;  3B5N B;  1PZQ A;  1IC2 A;  2WSC H;  3CCV P;  2KS1 A;  4K35 A;  1EZV E;  7CEI A;  1MZ9 A;  2EG5 A;  5KLI C;  1SQB K;  1GXG A;  4XFX A;  3L37 A;  1QVF O;  1IUQ A;  2KOP A;  1EDK A;  2PY8 A;  3JCU H;  1PP9 G;  3GHG B;  4GR6 A;  1IMQ A;  1Y47 A;  3RK3 B;  1NTZ E;  4PH1 A;  1SFC B;  2BEQ D;  5KJ7 D;  1K04 A;  4A7P A;  2VLN A;  3Q3D A;  1WMK A;  2WT7 A;  1SQQ D;  4C7R A;  2WSF J;  2OAR A;  1VQ5 P;  4KJM A;  2A06 G;  2N5H A;  2FXO A;  1M7L A;  3DPH A;  4IL6 X;  1RE3 C;  2HYN A;  2NPS B;  5H2F E;  2SPZ A;  1YJN P;  5BS1 A;  2K37 A;  2M8L A;  1GD2 E;  2L6E A;  4WWI A;  1GL2 A;  1PV3 A;  3H6P A;  4AQR D;  1NU1 E;  1R5S A;  3FXD A;  3B5N A;  1F80 D;  5F2N A;  2E76 D;  1BGY E;  2QJY C;  3S4R A;  1NAY A;  1A8O A;  1XTG B;  2CPB A;  2J59 M;  5E79 H;  1FZF A;  1VQ9 P;  1FJP A;  3PP5 A;  5L8R J;  5KLV G;  3EFG A;  3VYI A;  1KLP A;  3CCR P;  4D6T G;  1DH3 A;  3CCQ P;  1FDI A;  1P84 D;  1BCC J;  3GHG A;  3OJA B;  3KZI H;  4LLH A;  3W67 A;  3TGU G;  3AE4 C;  1S2E A;  1S5L E;  3EFF K;  2N1T C;  2M8P A;  3DS2 A;  3CME P;  2QIW A;  2XND H;  2WPR A;  1SQP K;  2FHS C;  1L0N E;  5HGN A;  2QRX A;  1URQ D;  1AYI A;  1JUN A;  5AVZ B;  4WVZ A;  4BRY A;  1TU3 F;  1KFN A;  5APX A;  1UJZ A;  4IOI H;  4IL6 H;  5F2O A;  5KKZ B;  3PRJ A;  3H1K D;  4YTP C;  3HE4 B;  3T97 B;  1W2B O;  1KIL D;  1AF8 A;  1PP9 E;  2EIA A;  1JEK A;  3W68 A;  1W2E A;  1M57 D;  3H1J J;  1RE4 A;  4AUW A;  4DOJ A;  2YKQ A;  1BSN A;  2Z45 A;  2BCC J;  3IR9 A;  4XFZ A;  1FZC B;  3PH0 A;  2DNW A;  2FXP A;  4U3F D;  3CCL P;  3FWN A;  3V5B A;  2JQ4 A;  3VTP C;  1VQ6 P;  1RQU A;  2GDX A;  2A06 E;  1DD3 A;  3GG2 A;  1N86 A;  2M3E A;  2HG5 D;  1N73 C;  2KOR A;  3V2R A;  2GUV A;  1IFD A;  1OIP A;  3USS A;  1VDF A;  1VF5 C;  1T8K A;  5BU8 B;  2LOL A;  2ITA A;  4PV1 B;  2ZAE B;  2OYH B;  1PEO A;  3DS3 A;  3RL0 C;  1GDT A;  2IZ1 A;  1IZN B;  5KJ7 A;  2GM4 A;  3AEB C;  3N7N A;  4JF7 A;  2R3C A;  2AXC A;  3SWF A;  3D6Z A;  3M9B A;  1LTG C;  3VRL C;  3R4Y A;  2Y0C A;  2E74 C;  1FS0 E;  2Z5I A;  5CCG D;  4NPD A;  4DT0 A;  3O6Q B;  3H32 A;  4YXW H;  2GYK A;  2QE7 H;  1IFJ A;  1LT1 A;  5AVR B;  1SQP D;  4UB6 H;  2MF4 A;  5KLV E;  1A02 F;  3HE4 A;  3HD7 C;  3PLN A;  3T97 A;  1K9M Q;  4D6T E;  3CX5 I;  2IZ0 A;  3IF4 A;  3H1J D;  1PEQ A;  2FYN C;  5KAI E;  2E75 D;  1BXI A;  4WB4 A;  4MN4 C;  3L75 D;  2Q9I A;  2K94 A;  3O8Z A;  3TGU E;  4GKG A;  1GZL A;  2FYU J;  3E7K A;  4TT3 H;  3G1I A;  2CQ8 A;  1FZC A;  2ZVO B;  3OA7 A;  1KB9 E;  4N78 D;  3HRN A;  1T3U A;  3U43 A;  4GDO A;  1L0L J; 
#chains in the Genus database with same CATH homology
 3B5I A;  3G26 A;  3CD6 P;  1E6J P;  3DS4 A;  3H47 A;  3CMA P;  1YHQ P;  1YJN P;  4U0C A;  1K8A Q;  3G29 A;  5BS1 A;  1AUM A;  3DTJ A;  2M8L A;  1YI2 P;  2L6E A;  1VQM P;  1VQP P;  2Z45 A;  4XFZ A;  1RNI A;  3I56 P;  5I4T G;  3CCL P;  1M1K Q;  1VQL P;  1N8R Q;  1VQ7 P;  2PEI A;  3CPW O;  1VQ6 P;  4QNB A;  5F2K A;  2QEX P;  3Q20 A;  3WBH A;  3DS5 A;  1YIT P;  1VQK P;  2PEO A;  3CCE P;  2EFJ A;  2PEJ A;  1EOQ A;  5F2N A;  2JO0 A;  2KOD A;  1YJW P;  1PEU A;  1A8O A;  1D1D A;  3G71 P;  4IPY A;  1KC8 Q;  1VQ4 P;  1VQ9 P;  2OTJ P;  1PEO A;  3DS3 A;  1VQO P;  1Q81 Q;  2BHV A;  3G1G A;  3G21 A;  4XRO A;  4COC A;  1PEM A;  1M6E X;  3G28 A;  1YIJ P;  4U0D A;  3CCR P;  5DCK A;  1K30 A;  3CCM P;  3CCQ P;  3H4E A;  4U0F A;  2PEK A;  1KD1 Q;  4PH0 A;  3P05 A;  5JPA A;  3CCV P;  1M90 Q;  3DS0 A;  1M74 A;  2M8N A;  2JYG A;  3VRL C;  3CXC O;  5BS2 A;  1VQ8 P;  2LF4 A;  3G6E P;  4U0E A;  3CC7 P;  2EG5 A;  1RO0 A;  5HGL A;  1RO2 A;  2ONT A;  1Q7Y Q;  4XFX A;  2CWO A;  2M8P A;  3DS2 A;  3CME P;  4XFY A;  1QVF O;  3LRY A;  1IUQ A;  2BQ1 E;  2E1M A;  4U0A A;  1BAJ A;  1Q86 Q;  3I55 P;  3CCU P;  1A43 A;  2Z44 A;  3CC2 P;  2Z46 A;  3G4S P;  3DS1 A;  2PY8 A;  2PEN A;  1QVG O;  5HGN A;  1VQN P;  1K9M Q;  4GR6 A;  4M0I A;  1K73 Q;  2JYL A;  1PEQ A;  2PEQ A;  3HYB A;  4PH1 A;  1JJ2 O;  4U0B A;  5HGM A;  2PEM A;  4WYM A;  4COP A;  3H0D A;  3NTE A;  1ZMB A;  2XT1 A;  3MGE A;  5HGO A;  3HZQ A;  1Q82 Q;  3E2D A;  1KQS O;  4GR2 A;  5F2O A;  1M6N A;  1S72 P;  3G1I A;  2DGY A;  2OAR A;  2OTL P;  1VQ5 P;  2XV6 A;  2BUO A;  2XXM A;  3OW2 O;  1EIA A;  1NJI Q;  1W2B O;  1QRJ A;  3CCJ P;  3RG6 C;  1YJ9 P;  2QA4 P;  3M1M A;  2P9X A;  2EIA A;  3CC4 P;  3DPH A;  3G0V A;  4XRQ A;  3CCS P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...