3CPWO

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cpwO03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cpwO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cpwO02
3CCQP 1Q81Q 1M90Q 1VQOP 3CXCO 3I55P 3CC2P 2OTLP 1VQLP 1YJ9P 2QA4P 1K73Q 1K9MQ 1QVFO 2QEXP 1YITP 1YI2P 1W2BO 1YJWP 1Q82Q 1KC8Q 1VQKP 1S72P 3CCVP 3CCLP 1N8RQ 3CC4P 3CCJP 1M1KQ 1KD1Q 3CPWO 3CCEP 3CMEP 3CCRP 3CC7P 1VQ6P 1VQ8P 3I56P 1VQPP 1Q7YQ 1QVGO 1YHQP 1K8AQ 2OTJP 3G6EP 1Q86Q 1YIJP 1VQ9P 3CCMP 1KQSO 1JJ2O 3CD6P 3CMAP 3G4SP 1YJNP 3OW2O 3CCSP 1VQ4P 1VQ7P 1VQNP 3G71P 1VQMP 1NJIQ 1VQ5P 3CCUP
chains in the Genus database with same CATH superfamily
5HVCA 5KP7B 1EZVD 1ZRTE 4DG9A 2GYKA 1LWUA 2VLPA 3A0BH 2QJKB 3E7KA 1EQ7A 1S9KE 5AW4B 4EDFA 2OTJP 2N1TD 1A43A 1KILA 3LW5H 3HZQA 4LLHA 2C9LY 4XFYA 2ZT9D 1E5WA 2MD9A 4XROA 3P8CE 3VN0A 3S4RA 3U59A 1NTZD 2KNCB 2XDJA 1NTZJ 1N73C 1IFMA 5APQA 4GR2A 3WU2H 3M0DC 3P32A 1PPJE 1AV1A 1F80D 2K94A 2OQQA 1OXZA 2O3JA 2LL8A 1JY3O 3GG2A 2KGCA 5E79E 1EZVI 4I2LC 1DX7A 4NPFX 3DS3A 3G6EP 2N50A 1FOSF 2A45I 1QLED 2K5XA 2W6JH 1RF0A 2Y0DA 1VQ4P 3CX5H 2HODB 1Q81Q 4U3FG 2OYIB 1ZMEC 3MP7B 3GHGA 5BU5A 5KLVE 3L73G 3SWKA 1CZQA 2OYHC 1KD1Q 4L73A 3KZIE 1VQ6P 1PGQA 2IYPA 1HY8A 4I7ZB 3ABVC 2ZYGA 1LTJB 3HUSA 2Y9YA 2JU1A 4YTPC 1RQUA 2B87B 1L0NK 5HGLA 2X2BA 1N7SB 1T3UA 2CG5B 2B9BA 4TLFA 1GD2E 2BCCD 2FVAA 5APWA 3RK3C 2BCCJ 1RH5B 3IR9A 4WY4B 5AW6B 3CD6P 5JPAA 2BASA 1K30A 2KLVA 5APYA 1PEMA 2L91A 1M7LA 1L0IA 2KW2A 1WRGA 2LXBA 2JO1A 2Z5IA 2W8ZA 2IDBA 2D2CB 2WPSA 2W83C 2PY8A 2FFDB 3V4WA 2QM7A 1P84D 2EIAA 1N7LA 1FR2A 2L5GB 2N6ZA 2ITAA 2QEXP 1EDLA 3D6ZA 2XU6A 4PD4D 1CSBA 1BE3G 3H1KG 3ITKA 3H1LG 3G26A 2KORA 5APTA 4HH2A 1VDFA 1M90Q 5KAFE 2LPKA 4N78D 1VKUA 1NTZK 2JP3A 3VMAA 3U1AA 1EC5A 1AJYA 4C7RA 3CXHD 1KYOE 3RK2C 5KAIH 1L0NG 2KZJA 1VQMP 1E6JP 2PEJA 1S3JA 3JSVC 4IL6H 1YJWP 1S72P 3RK3D 2P10A 2PGDA 1P84I 1RF1C 1EOQA 4OGQB 1BCCD 3I56P 4XA4A 1BCCJ 1OW7A 3H1HD 4W80A 2RKLA 4PD4I 3PRJA 4XFXA 3H1HJ 1JY2N 3B5NC 1GL2B 4COPA 1JY3P 1NKZB 1T8KA 1LTGC 1K04A 1KFNA 2R3SA 3H1JD 4U0AA 3H1JJ 1PP9G 3BVHA 2RH0A 3HD7A 1M1KQ 1PFIA 1HGVA 2P9XA 1A8OA 4WB4A 2QRXA 3USSA 3GJNA 5CCHA 2KG6A 1S5LX 1BSNA 1IMPA 3M06A 2CGQA 3DS1A 1JB0J 3VYIA 1YQ4C 3AEEC 3TGUD 1KILE 1SQBE 3W67A 3EJBA 2H89C 3KXDA 2FVEA 3TGUJ 1S2EA 1NOHA 3Q5RA 1VQLP 1EZVG 1FBMA 2P2UA 1ZP0C 1EXJA 3F5HA 1R8EA 2H43A 3CXHI 2A45G 3CCJP 3A3YB 1IZNB 3EFFK 1PIXA 3HYBA 2QE7H 1NU1K 2EG5A 3WUUA 2Z46A 1VQOP 4F37A 1NYHA 3EFGA 2IYOA 2OYIC 3VMZA 3MGNA 2LXCB 4JPZB 3CCLP 4IL6X 2LOLA 3L70J 3HE5A 2N5HA 2KLUA 4GT1A 5TISE 1NTZG 2Q3EA 5BVZA 3RK2D 4I7ZC 4ASVA 2N6YA 1LTJC 4Z1MH 2N5IA 2KS1A 1RE4A 1N7SC 1LJ2A 4H13B 1GMJA 4UB6H 3DS0A 3B71A 3B5IA 3G0VA 1NTME 3DS2A 2G3AA 3GW6A 3B5ND 4WY4C 1IJDB 3CX5D 2FQ2A 2R3CA 3G4SP 2AXCA 4UB8H 1YJ9P 2NPSA 1YI2P 1HUCA 1J1DB 2K88A 3ZDMA 3G21A 1PEQA 1DNYA 2D2CC 3E1RA 1YIJP 5M1BA 2RMZA 3FXDA 1YJNP 3VP9A 2FFDC 2KOQA 3GZLA 1NJIQ 2Z45A 2WT7B 4U3FD 2WITA 3E1IA 4JYBA 3O6QB 5B5EE 3CC4P 2HPCB 2BCCG 3H32A 1KQFB 3TF5A 2R5DA 2O1JA 1JNMA 2M3BA 5CBOA 1FOSE 3C1LA 4LGDE 1M1JA 2PEMA 2CK3H 1DV5A 1D1DA 2DNWA 1HBWA 3UIAA 5CJ4A 3M91A 1L0LE 3I5CA 1BGYD 2YKOA 3G3ZA 1BGYJ 1LT9A 4H0LB 2KUBA 3Q5PA 5AVRB 1M74A 1N7SD 2K0XA 4GOFA 1JEKA 3F89A 1NTKE 4EOTA 3CCVP 1N8RQ 1QEXA 2IBZE 1FZCA 4WY4D 4W7ZA 4R0MA 1QL1A 2PNGA 4BPHA 4HJGH 3L4FA 3JC22 2YO2A 1GL2C 1GU5A 5KLVD 1SLQA 5KLVJ 4HB1A 2KOGA 1LP1B 1JY2O 2JO0A 2JJLA 4RJTA 2ZYDA 2ERHA 2XV6A 2D2CD 4L76A 4PD4H 2CWOA 3TNUA 5KP8B 2L0QA 3H1LD 2SPZA 4DOJA 1JCDA 3HRNA 1FDIA 2E5TA 5APVA 2FKWB 3G28A 1FDOA 5F2NA 5EFWB 5DCKA 5KJ7C 1BCCG 4ASWA 2KSJA 3P7KA 4KT0J 4PJ0H 1DD3A 1K8AQ 3VMYA 2GDXA 3H1HG 5TJHA 4ZMDA 2A06D 1EDJA 1SQXD 3BCCD 1FU1A 1SQXJ 3CXCO 5CHXA 2UWJE 3BCCJ 3H1JG 3MUDA 2AFDA 1ZXGA 2MKVA 1NH4A 2YXQB 3RL0C 1FZGA 2OGUA 3NMDA 2YNYA 2JYLA 1LT1A 4ZKUA 3N4XA 2AEMA 5GTIE 1KILC 3TGUG 3KHUA 7CEIA 2BQ1E 1FDMA 2E74B 1W2BO 3KYQA 2Q9IA 4OGQD 4L74A 2M0BA 1HF9A 2KGEA 4H13C 3D70A 2WSEJ 1ACPA 5KLIB 1Q7YQ 3JCUH 1D7MA 4IFMA 2FYZA 1VQ9P 3II6A 1GL2D 2N1TA 3WBHA 4U0CA 1YYCA 5CCGC 2L6EA 1X3OA 1A02J 2KK7A 2VLOA 2I1JA 2N9BA 3L70G 1RF1B 2V4HA 5AW0B 1ZNVA 3D6YA 4KHXA 1J1DC 5AVXB 4AQRD 4QNBA 1KYOD 4O9BA 4YPCA 3CCMP 2Q5UA 1T8ZA 3B5NB 1ZV8A 3OW2O 3LIEA 1VQNP 1SQPE 5AVWB 4IZ6A 1KB9E 3HE4B 4B86A 3OJAB 2QG4A 3CC2P 1Z6MA 1DD4A 3NY7B 3GHGC 5KJ7D 3HE5B 1KQLA 2W90A 3L73E 5APSA 3CWBE 2Z5HA 2HYNA 5K5GB 1EXIA 1W2EA 5EJDA 2KOPA 1KFMA 3L75D 3L75J 5HV8A 3EJEA 1AVYA 3RL0D 3DS4A 2YXRB 3V2QA 5KLVK 4DJGA 1JTHA 3HTKB 2ZJSE 2PFXA 2WPTA 2E43A 4OWFA 3N7NA 4PXHB 1KV4A 1H88A 3LIDA 4H2XC 4H0LC 1JY2P 3CMEP 5L8RJ 1IK7A 2M8RA 3V6IA 1KYOI 4H13D 3RBZA 3PTZA 2FXOA 5CZDB 1GPJA 3CCRP 3H6PA 5AVTB 1S5LE 5H2FH 5CCGD 2FBWC 1VPCA 5KP6B 3C9IA 1SQXK 2O01H 3I55P 1KN7A 2NRGA 3H1IE 1BE3E 2K0YA 3AE7C 2FVFA 1OZHA 1BGYG 2HFED 3H1KE 1IC2A 5AW1B 1SQQD 1NU1D 1FZEA 2M8LA 1SQQJ 1NU1J 1AYIA 3L36A 1ZN5A 3RL0g 1GXHA 4RESB 1PGOA 4WYMA 3RG6C 2J5UA 3B4SA 5AW5B 5AW2B 5AVSB 1Q2NA 1OR5A 1HJ0A 5C39A 4M3LA 4BPGA 3L72E 2JR8A 2OARA 2ZVNB 2JDIH 4IOIH 4K35A 5KLVG 3T97A 2OYHA 1SQVD 2E75B 2VSQA 4C7NB 1SQVJ 2AXTE 3OA7A 3L71D 1DEBA 1HH0A 5E79H 3L71J 4CA3A 4DZOA 4H0LD 1AQTA 2WQYC 2VRSA 2WSFH 2FQ1A 2XXMA 3EWKA 2GZEA 2Q3IA 1SS1A 2K9JB 3G1GA 5AVUB 2E74C 3AE1C 2KB7P 1GW4A 3KZIH 3QWOC 4KJMA 3AE4C 5KLIC 5F2OA 2EHSA 2A06G 1BDCA 1RE3C 1SQXG 3V5BA 2V7QH 3BCCG 2M8PA 2PP6A 1KC8Q 1EZVE 3B8EB 1L0LD 3CLQA 1VQ8P 1L0LJ 1PL5A 2Q1KA 1G2CA 1UJZA 1NGMB 2O01N 3L74D 3OAKA 1KLPA 1NTKD 3L74J 3SWYA 1MFZA 1NO4A 1NTKJ 3AEFC 2IBZD 3AECC 1JMBA 3WUTA 3AE5C 1R5SA 2FAEA 4HYTB 2JQ4A 1M8OB 2L4BA 2I1KA 5APXA 1JCCA 1G1JA 4XRQA 1Y8AA 4WVZA 2ZVOB 1QRJA 1U7JA 2WPQA 3P8MC 1Z56A 3CCSP 2E42A 2ROQA 4MRTC 1GW3A 4OVNF 1RE4C 1BXIA 2W6BA 2PRRA 2JWDA 2P58A 3TSIA 2WSEH 1VHNA 2EHTA 2I8DA 2ZXXA 1SQQK 2M3EA 1URQA 2P1JA 4DT0A 1WMKA 1W5CE 2E74D 2R32A 5KAFH 1LGHB 4GKGA 1LWUB 3RL0B 3L70D 5APUA 2JYGA 1NAYA 3V2RA 2KWLA 1LTTC 1NTMK 3AE6C 3GF7A 2IBZI 1IFNA 4GDOA 1IK9A 2O1KA 1KILB 2DGYA 4XFJA 1KYOH 3L75G 2N98A 1RO0A 4H2YC 1XTGB 2M5AA 3AE2C 3MTUE 1JUNA 2MJZA 1PGJA 1QVFO 1YITP 1SQVK 3AEAC 2C0XA 4WWIA 2B89A 4COCA 2BCCE 3A2AA 3L37A 1LTAC 3PLNA 3A0HE 3VRLC 4U0FA 1USEA 1ZMBA 1FC2C 2J59M 2L22A 1FS0E 1JTHB 1H0TA 1HQBA 2PEKA 1MV8A 1KTMA 2XNDH 2Z4EA 2FYNC 2K1AA 3D71A 1AFOA 3E2DA 1ZRTD 4RKUJ 1FJPA 1P84E 2O01J 3GHGB 3R4YA 3V4QA 1S1CX 1IFPA 1S9KD 2E75C 1YBKA 1L0LK 2LMLA 3GMAA 1S4XA 1SQPD 3HUSB 1KB9D 4JQ0D 1SQPJ 3QH9A 1SQQG 1NU1G 2IPPA 2B87A 3NTEA 2NO8A 2E5YA 2JEEA 1NTKK 3CCQP 3VTPC 1N7SA 2GUSA 4QKOA 3IAOA 3P8CD 3U43A 3CWBD 1R5LA 1CEIA 3CWBJ 2QJPC 2QM8A 2FADA 1H8AA 2QSIA 4N78E 4WY4A 5TISH 1YHQP 1MKMA 4D6TE 1Q86Q 1EIAA 1X79B 1AA0A 2Y9ZA 2KR5A 1UIXA 1PPJD 3G71P 5GTHE 3CXHE 2KODA 3CL3D 1SQVG 1T2KC 3RK3E 3L71G 2P7JA 2ONTA 2GZFA 1BCCE 4L75A 1KORA 4GODA 2FFDA 2WSFJ 1X9VA 1GXGA 2K9YA 1E0HA 5B66E 1NVOA 2MR7A 2IZ0A 3T97B 3RBXA 1EDIA 1KB9I 3H1JE 1M57D 2KI7B 1WT6A 1GK6A 2OYOA 3DS5A 1NAFA 1U7MA 1Q90D 1FAVA 2WWWA 2XKMA 3KQGA 3B4QA 1OVUA 1PGPA 1USDA 2FACA 2XT1A 2V7QJ 2MVVA 2IX7C 3TGUE 2WSCH 2E75D 3H1ID 3R2PA 2K93A 3NTNA 5B5EH 2AF8A 3H1IJ 2HR3A 3A0BE 3VP8A 1L0LG 2QVAA 3PH0A 4K3AA 3O8ZA 2BEQD 2FYUE 2YIUC 2WPVB 2CQ8A 1OMIA 3L74G 1NTKG 3GLMA 2PEOA 1L4AA 2OTKE 5HGNA 2IBZG 3S9OA 1DEEG 1LWUC 2JGPA 2QJYB 1G2CB 1IO4A 3C8VA 4H2WC 1QGKB 3L72J 2LIWA 3WU2E 1JMMA 4PH0A 1EDKA 2KYVA 1RNIA 2YMKA 1SFCA 5AVZB 1T2KD 3LRYA 2GA1A 2Q7CA 3KPEA 3HD7B 2WVRA 4IPYA 2J58A 1NQ4A 3GF3A 3SWFA 1LTIC 2ZYAA 2IFNA 1SQPK 1Y9BA 2XZRA 3CX5E 2AFEA 1ZOYC 1JM0A 2LTEA 3IN6A 1H89A 4XE5B 1JO5A 2FXPA 2LKMA 2KOOA 3AEBC 1IFJA 2AEJA 3M9QA 1URQB 1RF0C 1KZUB 3EQ2A 2KP8A 4HKGA 4U3FE 4U0EA 1ZR2A 3RG2A 1RO2A 1N2DC 5HGOA 3MZWB 1LNQA 4XFZA 1QX8A 5EW5E 5BS2A 1OVRA 5BS1A 3FGAD 3HUSC 1T6AA 4UHPB 2MVUA 3MD0A 3CCUP 2KS1B 2M5AB 3V2PA 5KKZB 5DJUB 4BXLA 4PV1B 2YO3A 5AVQB 1AF8A 1OW8A 2GUVA 2RN0A 2K92A 4W7YA 3A5TA 3FWNA 1KILD 1SQBD 5CCGA 1BGYE 2KGAA 1LTBC 1KQSO 1RY3A 1SQBJ 5GTIH 3V2NA 2YMYA 1MUUA 3M0AA 1L0HA 4NEOA 3Q20A 1H0TB 2NPSB 1Q82Q 1VL2A 1M6NA 3AEGC 1QL2A 1DIPA 2POHA 2FXMA 2G8YA 4C46A 1SQPG 2E76B 3BRVB 4TT3H 2KGDA 3MHVA 2WT7A 4GR6A 1K9MQ 3O6QA 2M8NA 4HKZH 4YXDC 2L9FA 3CWBG 2WMMA 2HPCA 1JOCA 4MN4C 3MIWA 3H32B 4WBAA 2GM4A 2B88A 1HJBA 4RO0A 2VLNA 5AW8B 2W6AA 1N73A 1M6EX 3M0DA 1YTZT 5KAIE 2MY5A 2XZ0D 1PPJG 1VQ5P 1KB9H 3H1LE 1M1JB 1FZFA 4IL6E 4NPDA 2EFJA 1NHLA 3TDKA 1IMQA 1AQ5A 1NTMD 1NTMJ 2FYNB 2CNRA 4BRYA 1LTSC 1LT9B 5DJTB 3CMAP 3GKLC 1UIIA 2A06E 1L0NE 1SQXE 4JYCA 3BCCE 1K73Q 2H8PD 5CJ0A 2H7HA 2YKQA 4N6JA 1FZCB 2GDYA 2FHSC 1GU4A 2P67A 2KG8A 2QJYC 2Q6QA 2NZ2A 1YTZI 4H44B 2WSCJ 4Y99B 1VF5B 5HGMA 2QIWA 1RHZB 3H1IG 1LP1A 2WTYA 1PEUA 2QJPB 1PP9E 3HD7C 3BASA 3BATA 4U7JA 1E79H 1S5LH 3G29A 4GOEA 2C0WA 2XV5A 3TNUB 2M5RA 1CI6A 3H4EA 5CCHC 5CBNA 2Y0CA 1SVFA 4R4LA 3K5BA 4EIJA 4D6TD 3Q3DA 4D6TJ 1IFIA 3L72G 1SQBK 1X0TA 1L4AB 1GK4A 1URQC 4UB6E 3WUVA 4I6MC 5AW9B 3CPWO 1NWQA 2QJKC 2YKPA 1L2PA 1IUQA 3SFDC 1NTZE 1ZW0A 4UB8E 3L75E 1SFCB 2N9YB 1KQGB 3AEDC 3AE9C 1J1EB 2XZ1C 5KKZC 1M56D 2GZJA 4PV1C 4N3YB 2AXTH 2QNWA 3CI9A 2KXPB 2Y0EA 1PZQA 2YIUB 3FXEA 2AVAA 1RE3A 1ZLLA 2N1TB 1Y47A 5AW3B 3KDPB 2ZT9B 3HD7D 3Q1MA 2LIUA 2NPSC 5AVYB 1RF1A 3AE3C 2AEFA 2FYUD 2K37A 5CCHD 2FYUJ 3LW5J 2KG9A 1OIPA 3B5NA 2E76C 2GZGA 5F2KA 3LMOA 3HE4A 3VMXA 3FWLA 1X8YA 3L35A 2K0DX 3M9BA 2PEQA 1AVOA 1HVVA 4CPGA 3PJSK 3DTJA 2A45H 1FZBA 2MF4A 1MZ8A 1MZ9A 2KNCA 5BU8B 4BPFA 1SQBG 1URQD 5AW7B 1SQQE 1NU1E 2W27A 3M9HA 1BDDA 1BSHA 1M1JC 3HTKA 3VOPA 4M0IA 1UNKA 3EJDA 3CCEP 1KMIZ 3NFQA 3WMM0 3P05A 2HLOA 2MR8A 2ZFCA 1J2JB 4NPEA 4IFFA 5AVVB 1CW5A 1LT9C 1HGZA 4ZKPA 4Y28J 2HODA 3H25A 4U0DA 4PV1D 2OYIA 3NXSA 3G9RA 1VQKP 1SP4A 1SQVE 2JAZA 1FZCC 4PD4E 1VQPP 3H0DA 2JBGA 1QVGO 1T3JA 3L71E 3SFEC 1LTJA 3S1KA 1YQ3C 3SSUA 4AUWA 3IFMA 4H44C 2NPSD 4U3FJ 4Y99C 1VF5C 2JWAA 3L73D 2GZIA 3L73J 1NTMG 1U57A 4PJ0E 3G1IA 1XTCC 2E76D 2LKIA 3RGUA 1N73B 2LR2A 4EI2A 1OX3A 1N86A 4DCKA 2BUOA 1JY3N 4IFDK 2IZ1A 2BEZF 3U1CA 3CX5I 3PHLA 1FJKA 3A7OA 2K3RA 2H88C 1EMVA 1GTWA 1NKNA 4U0BA 1FZAA 2WPRA 3A0HH 4BRYB 4JF7A 1GDTA 1VQ7P 3H1HE 4AYCA 3GZMA 3L74E 4R4MA 1AUMA 1L4AC 1A02F 3DPHA 2CPBA 2DW3A 4JBZA 1OVVA 3PP5A 2OYHB 3MUDC 2HG5D 2FQ0A 4C7NA 2JB0A 1HTLC 2WZ7A 4OGQC 2PENA 3CC7P 2FYUK 3JCUE 1GZLA 2Z44A 4QMAA 4PH1A 2K2QA 2LF4A 3MGEA 4EYYQ 1FE6A 1P84H 4A7PA 2KIKA 2R44A 1SFCC 3CE7A 2K9JA 1J1EC 1BE3D 1X22A 1DH3A 3RK3B 1BE3J 3H47A 4D6TG 2R5BA 3Q2YA 3H1KD 3IF4A 3H1KJ 1CI6B 1HWTC 3TYYA 2GDWA 4H44D 2N1TC 3H1LJ 1VF5D 4YXWH 2BHVA 2OTLP 1OWAA 2PAJA 4ZNCA 4LC1A 2XNXA 3AE8C 2C9NY 2ZT9C 2E1MA 3L70E 3L72D 3W68A 3M1MA 2KZIA 2IFMA 1L0ND 2JKVA 2PEIA 1GL2A 1L0NJ 5GTHH 3CXHH 2QA4P 2VLQA 1OFCX 3Q5SA 3TK1A 1PV3A 2WSSH 2ZXEB 2FY8A 4PWVB 3BRTB 2JU2A 2KSEA 1ZR4A 1L4AD 1BAJA 5B66H 1MFTA 5CMZA 2CPSA 1PEOA 5I4TG 1PP9D 4I1LA 1PP9J 5KJ7A 5KTBA 4OH8B 2FYUG 2ZAEB 1TU3F 2KOSA 5H2FE 3FX0A 3RK2B 1OW6A 1RQVA 1JJ2O 1IFDA 4GIFA 1G1IA 4BWNA 1SFCD 1K05A
chains in the Genus database with same CATH topology
2PEOA 3CCQP 4U0DA 5HGNA 1K73Q 2BQ1E 1W2BO 1YJWP 1VQKP 3G1GA 1S72P 3CCVP 3DS0A 1N8RQ 1EOQA 2JYGA 3H47A 3CMEP 3CCRP 3I56P 1VQPP 3H0DA 1Q7YQ 3B5IA 1QVGO 3G0VA 1YHQP 2OTJP 3DS2A 1Q86Q 1EIAA 5F2OA 1A43A 1VQ9P 1KQSO 4XFXA 2DGYA 3G4SP 3WBHA 4U0CA 2L6EA 1RO0A 4PH0A 5JPAA 3G71P 1K30A 1RNIA 4COPA 3CD6P 3HZQA 2KODA 2BHVA 2M8PA 3I55P 4XFYA 2OTLP 3Q20A 5HGMA 1YJ9P 1PEMA 1QVFO 1YITP 3LRYA 1YI2P 1Q82Q 1KC8Q 4U0AA 4XROA 2E1MA 1PEUA 2JO0A 4IPYA 1M1KQ 3G21A 4COCA 1PEQA 1M6NA 2XV6A 1VQ8P 2ONTA 2P9XA 2CWOA 1A8OA 3G1IA 3G29A 4QNBA 3VRLC 2PY8A 1YIJP 3M1MA 4U0FA 3H4EA 3CCMP 3DS1A 4GR2A 1YJNP 2M8LA 3OW2O 1VQNP 5F2KA 1ZMBA 2PEIA 1NJIQ 2Z45A 2EIAA 2BUOA 4GR6A 3CC2P 1VQLP 2QA4P 1K9MQ 2QEXP 2M8NA 2PEQA 3G28A 2PEKA 4WYMA 3RG6C 5F2NA 3CC4P 3CCJP 5DCKA 3DS5A 4XRQA 3DTJA 1QRJA 4U0BA 3DS3A 1K8AQ 3HYBA 3G6EP 1M6EX 2EG5A 3E2DA 3G26A 1BAJA 3CCSP 1VQ4P 1VQ7P 2XT1A 1VQ5P 1Q81Q 1M90Q 2Z46A 1VQOP 3CXCO 2PEMA 1AUMA 2OARA 5I4TG 1PEOA 3DPHA 3DS4A 4U0EA 2EFJA 1D1DA 3CCLP 1RO2A 5HGOA 4M0IA 1KD1Q 3CPWO 3CCEP 2PENA 1VQ6P 3CC7P 2JYLA 4XFZA 3P05A 1IUQA 2Z44A 5BS2A 1JJ2O 4PH1A 5BS1A 3CMAP 1M74A 2LF4A 3MGEA 5HGLA 2XXMA 3NTEA 1VQMP 1E6JP 3CCUP 2PEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ P;  1Q81 Q;  1M90 Q;  1VQO P;  3CXC O;  3I55 P;  3CC2 P;  2OTL P;  1VQL P;  1YJ9 P;  2QA4 P;  1K73 Q;  1K9M Q;  1QVF O;  2QEX P;  1YIT P;  1YI2 P;  1W2B O;  1YJW P;  1Q82 Q;  1KC8 Q;  1VQK P;  1S72 P;  3CCV P;  3CCL P;  1N8R Q;  3CC4 P;  3CCJ P;  1M1K Q;  1KD1 Q;  3CPW O;  3CCE P;  3CME P;  3CCR P;  3CC7 P;  1VQ6 P;  1VQ8 P;  3I56 P;  1VQP P;  1Q7Y Q;  1QVG O;  1YHQ P;  1K8A Q;  2OTJ P;  3G6E P;  1Q86 Q;  1YIJ P;  1VQ9 P;  3CCM P;  1KQS O;  1JJ2 O;  3CD6 P;  3CMA P;  3G4S P;  1YJN P;  3OW2 O;  3CCS P;  1VQ4 P;  1VQ7 P;  1VQN P;  3G71 P;  1VQM P;  1NJI Q;  1VQ5 P;  3CCU P; 
#chains in the Genus database with same CATH topology
 5HVC A;  5KP7 B;  1EZV D;  1ZRT E;  4DG9 A;  2GYK A;  1LWU A;  2VLP A;  3A0B H;  2QJK B;  3E7K A;  1EQ7 A;  1S9K E;  5AW4 B;  4EDF A;  2OTJ P;  2N1T D;  1A43 A;  1KIL A;  3LW5 H;  3HZQ A;  4LLH A;  2C9L Y;  4XFY A;  2ZT9 D;  1E5W A;  2MD9 A;  4XRO A;  3P8C E;  3VN0 A;  3S4R A;  3U59 A;  1NTZ D;  2KNC B;  2XDJ A;  1NTZ J;  1N73 C;  1IFM A;  5APQ A;  4GR2 A;  3WU2 H;  3M0D C;  3P32 A;  1PPJ E;  1AV1 A;  1F80 D;  2K94 A;  2OQQ A;  1OXZ A;  2O3J A;  2LL8 A;  1JY3 O;  3GG2 A;  2KGC A;  5E79 E;  1EZV I;  4I2L C;  1DX7 A;  4NPF X;  3DS3 A;  3G6E P;  2N50 A;  1FOS F;  2A45 I;  1QLE D;  2K5X A;  2W6J H;  1RF0 A;  2Y0D A;  1VQ4 P;  3CX5 H;  2HOD B;  1Q81 Q;  4U3F G;  2OYI B;  1ZME C;  3MP7 B;  3GHG A;  5BU5 A;  5KLV E;  3L73 G;  3SWK A;  1CZQ A;  2OYH C;  1KD1 Q;  4L73 A;  3KZI E;  1VQ6 P;  1PGQ A;  2IYP A;  1HY8 A;  4I7Z B;  3ABV C;  2ZYG A;  1LTJ B;  3HUS A;  2Y9Y A;  2JU1 A;  4YTP C;  1RQU A;  2B87 B;  1L0N K;  5HGL A;  2X2B A;  1N7S B;  1T3U A;  2CG5 B;  2B9B A;  4TLF A;  1GD2 E;  2BCC D;  2FVA A;  5APW A;  3RK3 C;  2BCC J;  1RH5 B;  3IR9 A;  4WY4 B;  5AW6 B;  3CD6 P;  5JPA A;  2BAS A;  1K30 A;  2KLV A;  5APY A;  1PEM A;  2L91 A;  1M7L A;  1L0I A;  2KW2 A;  1WRG A;  2LXB A;  2JO1 A;  2Z5I A;  2W8Z A;  2IDB A;  2D2C B;  2WPS A;  2W83 C;  2PY8 A;  2FFD B;  3V4W A;  2QM7 A;  1P84 D;  2EIA A;  1N7L A;  1FR2 A;  2L5G B;  2N6Z A;  2ITA A;  2QEX P;  1EDL A;  3D6Z A;  2XU6 A;  4PD4 D;  1CSB A;  1BE3 G;  3H1K G;  3ITK A;  3H1L G;  3G26 A;  2KOR A;  5APT A;  4HH2 A;  1VDF A;  1M90 Q;  5KAF E;  2LPK A;  4N78 D;  1VKU A;  1NTZ K;  2JP3 A;  3VMA A;  3U1A A;  1EC5 A;  1AJY A;  4C7R A;  3CXH D;  1KYO E;  3RK2 C;  5KAI H;  1L0N G;  2KZJ A;  1VQM P;  1E6J P;  2PEJ A;  1S3J A;  3JSV C;  4IL6 H;  1YJW P;  1S72 P;  3RK3 D;  2P10 A;  2PGD A;  1P84 I;  1RF1 C;  1EOQ A;  4OGQ B;  1BCC D;  3I56 P;  4XA4 A;  1BCC J;  1OW7 A;  3H1H D;  4W80 A;  2RKL A;  4PD4 I;  3PRJ A;  4XFX A;  3H1H J;  1JY2 N;  3B5N C;  1GL2 B;  4COP A;  1JY3 P;  1NKZ B;  1T8K A;  1LTG C;  1K04 A;  1KFN A;  2R3S A;  3H1J D;  4U0A A;  3H1J J;  1PP9 G;  3BVH A;  2RH0 A;  3HD7 A;  1M1K Q;  1PFI A;  1HGV A;  2P9X A;  1A8O A;  4WB4 A;  2QRX A;  3USS A;  3GJN A;  5CCH A;  2KG6 A;  1S5L X;  1BSN A;  1IMP A;  3M06 A;  2CGQ A;  3DS1 A;  1JB0 J;  3VYI A;  1YQ4 C;  3AEE C;  3TGU D;  1KIL E;  1SQB E;  3W67 A;  3EJB A;  2H89 C;  3KXD A;  2FVE A;  3TGU J;  1S2E A;  1NOH A;  3Q5R A;  1VQL P;  1EZV G;  1FBM A;  2P2U A;  1ZP0 C;  1EXJ A;  3F5H A;  1R8E A;  2H43 A;  3CXH I;  2A45 G;  3CCJ P;  3A3Y B;  1IZN B;  3EFF K;  1PIX A;  3HYB A;  2QE7 H;  1NU1 K;  2EG5 A;  3WUU A;  2Z46 A;  1VQO P;  4F37 A;  1NYH A;  3EFG A;  2IYO A;  2OYI C;  3VMZ A;  3MGN A;  2LXC B;  4JPZ B;  3CCL P;  4IL6 X;  2LOL A;  3L70 J;  3HE5 A;  2N5H A;  2KLU A;  4GT1 A;  5TIS E;  1NTZ G;  2Q3E A;  5BVZ A;  3RK2 D;  4I7Z C;  4ASV A;  2N6Y A;  1LTJ C;  4Z1M H;  2N5I A;  2KS1 A;  1RE4 A;  1N7S C;  1LJ2 A;  4H13 B;  1GMJ A;  4UB6 H;  3DS0 A;  3B71 A;  3B5I A;  3G0V A;  1NTM E;  3DS2 A;  2G3A A;  3GW6 A;  3B5N D;  4WY4 C;  1IJD B;  3CX5 D;  2FQ2 A;  2R3C A;  3G4S P;  2AXC A;  4UB8 H;  1YJ9 P;  2NPS A;  1YI2 P;  1HUC A;  1J1D B;  2K88 A;  3ZDM A;  3G21 A;  1PEQ A;  1DNY A;  2D2C C;  3E1R A;  1YIJ P;  5M1B A;  2RMZ A;  3FXD A;  1YJN P;  3VP9 A;  2FFD C;  2KOQ A;  3GZL A;  1NJI Q;  2Z45 A;  2WT7 B;  4U3F D;  2WIT A;  3E1I A;  4JYB A;  3O6Q B;  5B5E E;  3CC4 P;  2HPC B;  2BCC G;  3H32 A;  1KQF B;  3TF5 A;  2R5D A;  2O1J A;  1JNM A;  2M3B A;  5CBO A;  1FOS E;  3C1L A;  4LGD E;  1M1J A;  2PEM A;  2CK3 H;  1DV5 A;  1D1D A;  2DNW A;  1HBW A;  3UIA A;  5CJ4 A;  3M91 A;  1L0L E;  3I5C A;  1BGY D;  2YKO A;  3G3Z A;  1BGY J;  1LT9 A;  4H0L B;  2KUB A;  3Q5P A;  5AVR B;  1M74 A;  1N7S D;  2K0X A;  4GOF A;  1JEK A;  3F89 A;  1NTK E;  4EOT A;  3CCV P;  1N8R Q;  1QEX A;  2IBZ E;  1FZC A;  4WY4 D;  4W7Z A;  4R0M A;  1QL1 A;  2PNG A;  4BPH A;  4HJG H;  3L4F A;  3JC2 2;  2YO2 A;  1GL2 C;  1GU5 A;  5KLV D;  1SLQ A;  5KLV J;  4HB1 A;  2KOG A;  1LP1 B;  1JY2 O;  2JO0 A;  2JJL A;  4RJT A;  2ZYD A;  2ERH A;  2XV6 A;  2D2C D;  4L76 A;  4PD4 H;  2CWO A;  3TNU A;  5KP8 B;  2L0Q A;  3H1L D;  2SPZ A;  4DOJ A;  1JCD A;  3HRN A;  1FDI A;  2E5T A;  5APV A;  2FKW B;  3G28 A;  1FDO A;  5F2N A;  5EFW B;  5DCK A;  5KJ7 C;  1BCC G;  4ASW A;  2KSJ A;  3P7K A;  4KT0 J;  4PJ0 H;  1DD3 A;  1K8A Q;  3VMY A;  2GDX A;  3H1H G;  5TJH A;  4ZMD A;  2A06 D;  1EDJ A;  1SQX D;  3BCC D;  1FU1 A;  1SQX J;  3CXC O;  5CHX A;  2UWJ E;  3BCC J;  3H1J G;  3MUD A;  2AFD A;  1ZXG A;  2MKV A;  1NH4 A;  2YXQ B;  3RL0 C;  1FZG A;  2OGU A;  3NMD A;  2YNY A;  2JYL A;  1LT1 A;  4ZKU A;  3N4X A;  2AEM A;  5GTI E;  1KIL C;  3TGU G;  3KHU A;  7CEI A;  2BQ1 E;  1FDM A;  2E74 B;  1W2B O;  3KYQ A;  2Q9I A;  4OGQ D;  4L74 A;  2M0B A;  1HF9 A;  2KGE A;  4H13 C;  3D70 A;  2WSE J;  1ACP A;  5KLI B;  1Q7Y Q;  3JCU H;  1D7M A;  4IFM A;  2FYZ A;  1VQ9 P;  3II6 A;  1GL2 D;  2N1T A;  3WBH A;  4U0C A;  1YYC A;  5CCG C;  2L6E A;  1X3O A;  1A02 J;  2KK7 A;  2VLO A;  2I1J A;  2N9B A;  3L70 G;  1RF1 B;  2V4H A;  5AW0 B;  1ZNV A;  3D6Y A;  4KHX A;  1J1D C;  5AVX B;  4AQR D;  4QNB A;  1KYO D;  4O9B A;  4YPC A;  3CCM P;  2Q5U A;  1T8Z A;  3B5N B;  1ZV8 A;  3OW2 O;  3LIE A;  1VQN P;  1SQP E;  5AVW B;  4IZ6 A;  1KB9 E;  3HE4 B;  4B86 A;  3OJA B;  2QG4 A;  3CC2 P;  1Z6M A;  1DD4 A;  3NY7 B;  3GHG C;  5KJ7 D;  3HE5 B;  1KQL A;  2W90 A;  3L73 E;  5APS A;  3CWB E;  2Z5H A;  2HYN A;  5K5G B;  1EXI A;  1W2E A;  5EJD A;  2KOP A;  1KFM A;  3L75 D;  3L75 J;  5HV8 A;  3EJE A;  1AVY A;  3RL0 D;  3DS4 A;  2YXR B;  3V2Q A;  5KLV K;  4DJG A;  1JTH A;  3HTK B;  2ZJS E;  2PFX A;  2WPT A;  2E43 A;  4OWF A;  3N7N A;  4PXH B;  1KV4 A;  1H88 A;  3LID A;  4H2X C;  4H0L C;  1JY2 P;  3CME P;  5L8R J;  1IK7 A;  2M8R A;  3V6I A;  1KYO I;  4H13 D;  3RBZ A;  3PTZ A;  2FXO A;  5CZD B;  1GPJ A;  3CCR P;  3H6P A;  5AVT B;  1S5L E;  5H2F H;  5CCG D;  2FBW C;  1VPC A;  5KP6 B;  3C9I A;  1SQX K;  2O01 H;  3I55 P;  1KN7 A;  2NRG A;  3H1I E;  1BE3 E;  2K0Y A;  3AE7 C;  2FVF A;  1OZH A;  1BGY G;  2HFE D;  3H1K E;  1IC2 A;  5AW1 B;  1SQQ D;  1NU1 D;  1FZE A;  2M8L A;  1SQQ J;  1NU1 J;  1AYI A;  3L36 A;  1ZN5 A;  3RL0 g;  1GXH A;  4RES B;  1PGO A;  4WYM A;  3RG6 C;  2J5U A;  3B4S A;  5AW5 B;  5AW2 B;  5AVS B;  1Q2N A;  1OR5 A;  1HJ0 A;  5C39 A;  4M3L A;  4BPG A;  3L72 E;  2JR8 A;  2OAR A;  2ZVN B;  2JDI H;  4IOI H;  4K35 A;  5KLV G;  3T97 A;  2OYH A;  1SQV D;  2E75 B;  2VSQ A;  4C7N B;  1SQV J;  2AXT E;  3OA7 A;  3L71 D;  1DEB A;  1HH0 A;  5E79 H;  3L71 J;  4CA3 A;  4DZO A;  4H0L D;  1AQT A;  2WQY C;  2VRS A;  2WSF H;  2FQ1 A;  2XXM A;  3EWK A;  2GZE A;  2Q3I A;  1SS1 A;  2K9J B;  3G1G A;  5AVU B;  2E74 C;  3AE1 C;  2KB7 P;  1GW4 A;  3KZI H;  3QWO C;  4KJM A;  3AE4 C;  5KLI C;  5F2O A;  2EHS A;  2A06 G;  1BDC A;  1RE3 C;  1SQX G;  3V5B A;  2V7Q H;  3BCC G;  2M8P A;  2PP6 A;  1KC8 Q;  1EZV E;  3B8E B;  1L0L D;  3CLQ A;  1VQ8 P;  1L0L J;  1PL5 A;  2Q1K A;  1G2C A;  1UJZ A;  1NGM B;  2O01 N;  3L74 D;  3OAK A;  1KLP A;  1NTK D;  3L74 J;  3SWY A;  1MFZ A;  1NO4 A;  1NTK J;  3AEF C;  2IBZ D;  3AEC C;  1JMB A;  3WUT A;  3AE5 C;  1R5S A;  2FAE A;  4HYT B;  2JQ4 A;  1M8O B;  2L4B A;  2I1K A;  5APX A;  1JCC A;  1G1J A;  4XRQ A;  1Y8A A;  4WVZ A;  2ZVO B;  1QRJ A;  1U7J A;  2WPQ A;  3P8M C;  1Z56 A;  3CCS P;  2E42 A;  2ROQ A;  4MRT C;  1GW3 A;  4OVN F;  1RE4 C;  1BXI A;  2W6B A;  2PRR A;  2JWD A;  2P58 A;  3TSI A;  2WSE H;  1VHN A;  2EHT A;  2I8D A;  2ZXX A;  1SQQ K;  2M3E A;  1URQ A;  2P1J A;  4DT0 A;  1WMK A;  1W5C E;  2E74 D;  2R32 A;  5KAF H;  1LGH B;  4GKG A;  1LWU B;  3RL0 B;  3L70 D;  5APU A;  2JYG A;  1NAY A;  3V2R A;  2KWL A;  1LTT C;  1NTM K;  3AE6 C;  3GF7 A;  2IBZ I;  1IFN A;  4GDO A;  1IK9 A;  2O1K A;  1KIL B;  2DGY A;  4XFJ A;  1KYO H;  3L75 G;  2N98 A;  1RO0 A;  4H2Y C;  1XTG B;  2M5A A;  3AE2 C;  3MTU E;  1JUN A;  2MJZ A;  1PGJ A;  1QVF O;  1YIT P;  1SQV K;  3AEA C;  2C0X A;  4WWI A;  2B89 A;  4COC A;  2BCC E;  3A2A A;  3L37 A;  1LTA C;  3PLN A;  3A0H E;  3VRL C;  4U0F A;  1USE A;  1ZMB A;  1FC2 C;  2J59 M;  2L22 A;  1FS0 E;  1JTH B;  1H0T A;  1HQB A;  2PEK A;  1MV8 A;  1KTM A;  2XND H;  2Z4E A;  2FYN C;  2K1A A;  3D71 A;  1AFO A;  3E2D A;  1ZRT D;  4RKU J;  1FJP A;  1P84 E;  2O01 J;  3GHG B;  3R4Y A;  3V4Q A;  1S1C X;  1IFP A;  1S9K D;  2E75 C;  1YBK A;  1L0L K;  2LML A;  3GMA A;  1S4X A;  1SQP D;  3HUS B;  1KB9 D;  4JQ0 D;  1SQP J;  3QH9 A;  1SQQ G;  1NU1 G;  2IPP A;  2B87 A;  3NTE A;  2NO8 A;  2E5Y A;  2JEE A;  1NTK K;  3CCQ P;  3VTP C;  1N7S A;  2GUS A;  4QKO A;  3IAO A;  3P8C D;  3U43 A;  3CWB D;  1R5L A;  1CEI A;  3CWB J;  2QJP C;  2QM8 A;  2FAD A;  1H8A A;  2QSI A;  4N78 E;  4WY4 A;  5TIS H;  1YHQ P;  1MKM A;  4D6T E;  1Q86 Q;  1EIA A;  1X79 B;  1AA0 A;  2Y9Z A;  2KR5 A;  1UIX A;  1PPJ D;  3G71 P;  5GTH E;  3CXH E;  2KOD A;  3CL3 D;  1SQV G;  1T2K C;  3RK3 E;  3L71 G;  2P7J A;  2ONT A;  2GZF A;  1BCC E;  4L75 A;  1KOR A;  4GOD A;  2FFD A;  2WSF J;  1X9V A;  1GXG A;  2K9Y A;  1E0H A;  5B66 E;  1NVO A;  2MR7 A;  2IZ0 A;  3T97 B;  3RBX A;  1EDI A;  1KB9 I;  3H1J E;  1M57 D;  2KI7 B;  1WT6 A;  1GK6 A;  2OYO A;  3DS5 A;  1NAF A;  1U7M A;  1Q90 D;  1FAV A;  2WWW A;  2XKM A;  3KQG A;  3B4Q A;  1OVU A;  1PGP A;  1USD A;  2FAC A;  2XT1 A;  2V7Q J;  2MVV A;  2IX7 C;  3TGU E;  2WSC H;  2E75 D;  3H1I D;  3R2P A;  2K93 A;  3NTN A;  5B5E H;  2AF8 A;  3H1I J;  2HR3 A;  3A0B E;  3VP8 A;  1L0L G;  2QVA A;  3PH0 A;  4K3A A;  3O8Z A;  2BEQ D;  2FYU E;  2YIU C;  2WPV B;  2CQ8 A;  1OMI A;  3L74 G;  1NTK G;  3GLM A;  2PEO A;  1L4A A;  2OTK E;  5HGN A;  2IBZ G;  3S9O A;  1DEE G;  1LWU C;  2JGP A;  2QJY B;  1G2C B;  1IO4 A;  3C8V A;  4H2W C;  1QGK B;  3L72 J;  2LIW A;  3WU2 E;  1JMM A;  4PH0 A;  1EDK A;  2KYV A;  1RNI A;  2YMK A;  1SFC A;  5AVZ B;  1T2K D;  3LRY A;  2GA1 A;  2Q7C A;  3KPE A;  3HD7 B;  2WVR A;  4IPY A;  2J58 A;  1NQ4 A;  3GF3 A;  3SWF A;  1LTI C;  2ZYA A;  2IFN A;  1SQP K;  1Y9B A;  2XZR A;  3CX5 E;  2AFE A;  1ZOY C;  1JM0 A;  2LTE A;  3IN6 A;  1H89 A;  4XE5 B;  1JO5 A;  2FXP A;  2LKM A;  2KOO A;  3AEB C;  1IFJ A;  2AEJ A;  3M9Q A;  1URQ B;  1RF0 C;  1KZU B;  3EQ2 A;  2KP8 A;  4HKG A;  4U3F E;  4U0E A;  1ZR2 A;  3RG2 A;  1RO2 A;  1N2D C;  5HGO A;  3MZW B;  1LNQ A;  4XFZ A;  1QX8 A;  5EW5 E;  5BS2 A;  1OVR A;  5BS1 A;  3FGA D;  3HUS C;  1T6A A;  4UHP B;  2MVU A;  3MD0 A;  3CCU P;  2KS1 B;  2M5A B;  3V2P A;  5KKZ B;  5DJU B;  4BXL A;  4PV1 B;  2YO3 A;  5AVQ B;  1AF8 A;  1OW8 A;  2GUV A;  2RN0 A;  2K92 A;  4W7Y A;  3A5T A;  3FWN A;  1KIL D;  1SQB D;  5CCG A;  1BGY E;  2KGA A;  1LTB C;  1KQS O;  1RY3 A;  1SQB J;  5GTI H;  3V2N A;  2YMY A;  1MUU A;  3M0A A;  1L0H A;  4NEO A;  3Q20 A;  1H0T B;  2NPS B;  1Q82 Q;  1VL2 A;  1M6N A;  3AEG C;  1QL2 A;  1DIP A;  2POH A;  2FXM A;  2G8Y A;  4C46 A;  1SQP G;  2E76 B;  3BRV B;  4TT3 H;  2KGD A;  3MHV A;  2WT7 A;  4GR6 A;  1K9M Q;  3O6Q A;  2M8N A;  4HKZ H;  4YXD C;  2L9F A;  3CWB G;  2WMM A;  2HPC A;  1JOC A;  4MN4 C;  3MIW A;  3H32 B;  4WBA A;  2GM4 A;  2B88 A;  1HJB A;  4RO0 A;  2VLN A;  5AW8 B;  2W6A A;  1N73 A;  1M6E X;  3M0D A;  1YTZ T;  5KAI E;  2MY5 A;  2XZ0 D;  1PPJ G;  1VQ5 P;  1KB9 H;  3H1L E;  1M1J B;  1FZF A;  4IL6 E;  4NPD A;  2EFJ A;  1NHL A;  3TDK A;  1IMQ A;  1AQ5 A;  1NTM D;  1NTM J;  2FYN B;  2CNR A;  4BRY A;  1LTS C;  1LT9 B;  5DJT B;  3CMA P;  3GKL C;  1UII A;  2A06 E;  1L0N E;  1SQX E;  4JYC A;  3BCC E;  1K73 Q;  2H8P D;  5CJ0 A;  2H7H A;  2YKQ A;  4N6J A;  1FZC B;  2GDY A;  2FHS C;  1GU4 A;  2P67 A;  2KG8 A;  2QJY C;  2Q6Q A;  2NZ2 A;  1YTZ I;  4H44 B;  2WSC J;  4Y99 B;  1VF5 B;  5HGM A;  2QIW A;  1RHZ B;  3H1I G;  1LP1 A;  2WTY A;  1PEU A;  2QJP B;  1PP9 E;  3HD7 C;  3BAS A;  3BAT A;  4U7J A;  1E79 H;  1S5L H;  3G29 A;  4GOE A;  2C0W A;  2XV5 A;  3TNU B;  2M5R A;  1CI6 A;  3H4E A;  5CCH C;  5CBN A;  2Y0C A;  1SVF A;  4R4L A;  3K5B A;  4EIJ A;  4D6T D;  3Q3D A;  4D6T J;  1IFI A;  3L72 G;  1SQB K;  1X0T A;  1L4A B;  1GK4 A;  1URQ C;  4UB6 E;  3WUV A;  4I6M C;  5AW9 B;  3CPW O;  1NWQ A;  2QJK C;  2YKP A;  1L2P A;  1IUQ A;  3SFD C;  1NTZ E;  1ZW0 A;  4UB8 E;  3L75 E;  1SFC B;  2N9Y B;  1KQG B;  3AED C;  3AE9 C;  1J1E B;  2XZ1 C;  5KKZ C;  1M56 D;  2GZJ A;  4PV1 C;  4N3Y B;  2AXT H;  2QNW A;  3CI9 A;  2KXP B;  2Y0E A;  1PZQ A;  2YIU B;  3FXE A;  2AVA A;  1RE3 A;  1ZLL A;  2N1T B;  1Y47 A;  5AW3 B;  3KDP B;  2ZT9 B;  3HD7 D;  3Q1M A;  2LIU A;  2NPS C;  5AVY B;  1RF1 A;  3AE3 C;  2AEF A;  2FYU D;  2K37 A;  5CCH D;  2FYU J;  3LW5 J;  2KG9 A;  1OIP A;  3B5N A;  2E76 C;  2GZG A;  5F2K A;  3LMO A;  3HE4 A;  3VMX A;  3FWL A;  1X8Y A;  3L35 A;  2K0D X;  3M9B A;  2PEQ A;  1AVO A;  1HVV A;  4CPG A;  3PJS K;  3DTJ A;  2A45 H;  1FZB A;  2MF4 A;  1MZ8 A;  1MZ9 A;  2KNC A;  5BU8 B;  4BPF A;  1SQB G;  1URQ D;  5AW7 B;  1SQQ E;  1NU1 E;  2W27 A;  3M9H A;  1BDD A;  1BSH A;  1M1J C;  3HTK A;  3VOP A;  4M0I A;  1UNK A;  3EJD A;  3CCE P;  1KMI Z;  3NFQ A;  3WMM 0;  3P05 A;  2HLO A;  2MR8 A;  2ZFC A;  1J2J B;  4NPE A;  4IFF A;  5AVV B;  1CW5 A;  1LT9 C;  1HGZ A;  4ZKP A;  4Y28 J;  2HOD A;  3H25 A;  4U0D A;  4PV1 D;  2OYI A;  3NXS A;  3G9R A;  1VQK P;  1SP4 A;  1SQV E;  2JAZ A;  1FZC C;  4PD4 E;  1VQP P;  3H0D A;  2JBG A;  1QVG O;  1T3J A;  3L71 E;  3SFE C;  1LTJ A;  3S1K A;  1YQ3 C;  3SSU A;  4AUW A;  3IFM A;  4H44 C;  2NPS D;  4U3F J;  4Y99 C;  1VF5 C;  2JWA A;  3L73 D;  2GZI A;  3L73 J;  1NTM G;  1U57 A;  4PJ0 E;  3G1I A;  1XTC C;  2E76 D;  2LKI A;  3RGU A;  1N73 B;  2LR2 A;  4EI2 A;  1OX3 A;  1N86 A;  4DCK A;  2BUO A;  1JY3 N;  4IFD K;  2IZ1 A;  2BEZ F;  3U1C A;  3CX5 I;  3PHL A;  1FJK A;  3A7O A;  2K3R A;  2H88 C;  1EMV A;  1GTW A;  1NKN A;  4U0B A;  1FZA A;  2WPR A;  3A0H H;  4BRY B;  4JF7 A;  1GDT A;  1VQ7 P;  3H1H E;  4AYC A;  3GZM A;  3L74 E;  4R4M A;  1AUM A;  1L4A C;  1A02 F;  3DPH A;  2CPB A;  2DW3 A;  4JBZ A;  1OVV A;  3PP5 A;  2OYH B;  3MUD C;  2HG5 D;  2FQ0 A;  4C7N A;  2JB0 A;  1HTL C;  2WZ7 A;  4OGQ C;  2PEN A;  3CC7 P;  2FYU K;  3JCU E;  1GZL A;  2Z44 A;  4QMA A;  4PH1 A;  2K2Q A;  2LF4 A;  3MGE A;  4EYY Q;  1FE6 A;  1P84 H;  4A7P A;  2KIK A;  2R44 A;  1SFC C;  3CE7 A;  2K9J A;  1J1E C;  1BE3 D;  1X22 A;  1DH3 A;  3RK3 B;  1BE3 J;  3H47 A;  4D6T G;  2R5B A;  3Q2Y A;  3H1K D;  3IF4 A;  3H1K J;  1CI6 B;  1HWT C;  3TYY A;  2GDW A;  4H44 D;  2N1T C;  3H1L J;  1VF5 D;  4YXW H;  2BHV A;  2OTL P;  1OWA A;  2PAJ A;  4ZNC A;  4LC1 A;  2XNX A;  3AE8 C;  2C9N Y;  2ZT9 C;  2E1M A;  3L70 E;  3L72 D;  3W68 A;  3M1M A;  2KZI A;  2IFM A;  1L0N D;  2JKV A;  2PEI A;  1GL2 A;  1L0N J;  5GTH H;  3CXH H;  2QA4 P;  2VLQ A;  1OFC X;  3Q5S A;  3TK1 A;  1PV3 A;  2WSS H;  2ZXE B;  2FY8 A;  4PWV B;  3BRT B;  2JU2 A;  2KSE A;  1ZR4 A;  1L4A D;  1BAJ A;  5B66 H;  1MFT A;  5CMZ A;  2CPS A;  1PEO A;  5I4T G;  1PP9 D;  4I1L A;  1PP9 J;  5KJ7 A;  5KTB A;  4OH8 B;  2FYU G;  2ZAE B;  1TU3 F;  2KOS A;  5H2F E;  3FX0 A;  3RK2 B;  1OW6 A;  1RQV A;  1JJ2 O;  1IFD A;  4GIF A;  1G1I A;  4BWN A;  1SFC D;  1K05 A; 
#chains in the Genus database with same CATH homology
 2PEO A;  3CCQ P;  4U0D A;  5HGN A;  1K73 Q;  2BQ1 E;  1W2B O;  1YJW P;  1VQK P;  3G1G A;  1S72 P;  3CCV P;  3DS0 A;  1N8R Q;  1EOQ A;  2JYG A;  3H47 A;  3CME P;  3CCR P;  3I56 P;  1VQP P;  3H0D A;  1Q7Y Q;  3B5I A;  1QVG O;  3G0V A;  1YHQ P;  2OTJ P;  3DS2 A;  1Q86 Q;  1EIA A;  5F2O A;  1A43 A;  1VQ9 P;  1KQS O;  4XFX A;  2DGY A;  3G4S P;  3WBH A;  4U0C A;  2L6E A;  1RO0 A;  4PH0 A;  5JPA A;  3G71 P;  1K30 A;  1RNI A;  4COP A;  3CD6 P;  3HZQ A;  2KOD A;  2BHV A;  2M8P A;  3I55 P;  4XFY A;  2OTL P;  3Q20 A;  5HGM A;  1YJ9 P;  1PEM A;  1QVF O;  1YIT P;  3LRY A;  1YI2 P;  1Q82 Q;  1KC8 Q;  4U0A A;  4XRO A;  2E1M A;  1PEU A;  2JO0 A;  4IPY A;  1M1K Q;  3G21 A;  4COC A;  1PEQ A;  1M6N A;  2XV6 A;  1VQ8 P;  2ONT A;  2P9X A;  2CWO A;  1A8O A;  3G1I A;  3G29 A;  4QNB A;  3VRL C;  2PY8 A;  1YIJ P;  3M1M A;  4U0F A;  3H4E A;  3CCM P;  3DS1 A;  4GR2 A;  1YJN P;  2M8L A;  3OW2 O;  1VQN P;  5F2K A;  1ZMB A;  2PEI A;  1NJI Q;  2Z45 A;  2EIA A;  2BUO A;  4GR6 A;  3CC2 P;  1VQL P;  2QA4 P;  1K9M Q;  2QEX P;  2M8N A;  2PEQ A;  3G28 A;  2PEK A;  4WYM A;  3RG6 C;  5F2N A;  3CC4 P;  3CCJ P;  5DCK A;  3DS5 A;  4XRQ A;  3DTJ A;  1QRJ A;  4U0B A;  3DS3 A;  1K8A Q;  3HYB A;  3G6E P;  1M6E X;  2EG5 A;  3E2D A;  3G26 A;  1BAJ A;  3CCS P;  1VQ4 P;  1VQ7 P;  2XT1 A;  1VQ5 P;  1Q81 Q;  1M90 Q;  2Z46 A;  1VQO P;  3CXC O;  2PEM A;  1AUM A;  2OAR A;  5I4T G;  1PEO A;  3DPH A;  3DS4 A;  4U0E A;  2EFJ A;  1D1D A;  3CCL P;  1RO2 A;  5HGO A;  4M0I A;  1KD1 Q;  3CPW O;  3CCE P;  2PEN A;  1VQ6 P;  3CC7 P;  2JYL A;  4XFZ A;  3P05 A;  1IUQ A;  2Z44 A;  5BS2 A;  1JJ2 O;  4PH1 A;  5BS1 A;  3CMA P;  1M74 A;  2LF4 A;  3MGE A;  5HGL A;  2XXM A;  3NTE A;  1VQM P;  1E6J P;  3CCU P;  2PEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...