3CPWO

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cpwO03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cpwO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cpwO02
1K73Q 1VQ6P 3CMAP 1S72P 3G6EP 3CCLP 3CCVP 1YHQP 3CC7P 2OTLP 1YITP 3I55P 3CCJP 1M90Q 3CCSP 3CCMP 1VQMP 3G71P 1Q86Q 3CPWO 1YIJP 3I56P 1VQPP 1W2BO 1KQSO 1VQ9P 3CC2P 1VQ8P 3CCEP 3CCQP 1Q81Q 3CC4P 2OTJP 1K8AQ 2QEXP 1M1KQ 1JJ2O 1VQ4P 1VQOP 2QA4P 1Q7YQ 1N8RQ 1VQ7P 3CMEP 1QVFO 3OW2O 1Q82Q 1YI2P 1YJ9P 3CXCO 1VQKP 3CCUP 1KD1Q 1YJWP 1VQLP 3CCRP 1NJIQ 1K9MQ 1QVGO 3CD6P 1VQNP 1VQ5P 1KC8Q 3G4SP 1YJNP
chains in the Genus database with same CATH superfamily
1P84E 3OAKA 2C9LY 3GZLA 2Y0CA 2P7JA 1ZNVA 2ROQA 2E75B 1NYHA 2FXOA 3LMOA 4XRQA 3QWOC 2IBZI 3WUUA 4F37A 1M74A 1AA0A 1SQQK 4C46A 2AEFA 1T2KD 4GR6A 5EFWB 3H32B 2G8YA 1SFCD 3L75D 4D6TE 1ZMEC 2WWWA 3H1HJ 1FOSE 5AVWB 1SQVG 2IBZG 3B5NC 2RN0A 5TISE 3AEEC 3HUSC 3CXHH 4U7JA 3RL0g 2OGUA 2KGEA 3Q5SA 3O8ZA 2WT7B 1AYIA 2LKMA 3CWBE 4RESB 3FGAD 3TDKA 3I56P 4N78D 2QRXA 2KK7A 3A7OA 5AW4B 2KOPA 5CBNA 4JPZB 2OTJP 1K8AQ 5HGLA 2LOLA 3OJAB 2Q1KA 1IO4A 1KYOE 3TGUD 1X8YA 1RQUA 1L0LE 4R0MA 1LP1B 2O3JA 2OTLP 2I1JA 3JSVC 2OQQA 5APVA 3CC4P 1OX3A 2GZGA 2JWDA 4I7ZB 2ITAA 3L70J 3S9OA 1VQKP 2RH0A 3C8VA 3I5CA 2QG4A 3RK2D 3AE8C 4L74A 4RO0A 4XE5B 2BCCD 2R32A 5I4TG 1PP9D 4PXHB 2QJPB 5HV8A 1PL5A 4N3YB 3L75J 1ZV8A 3G3ZA 4PD4D 3AECC 3MIWA 3CMAP 5KAIE 1DV5A 3HRNA 1VL2A 5K5GB 3TGUG 2KR5A 3A0BE 4XA4A 2XDJA 3H1JE 1OW8A 2CG5B 3KQGA 3H1LE 1X0TA 3Q5PA 5KKZB 1L0IA 1K9MQ 2HODA 3D6YA 1T8ZA 1KTMA 3PJSK 2FYZA 2PAJA 4PD4I 3F89A 1NTMD 5APXA 2W6BA 1GPJA 1W2BO 1VQPP 2KZIA 1W5CE 3UIAA 1VQ8P 2J59M 1FR2A 2LMLA 1IZNB 2MR8A 1SQPG 1NHLA 2XZ0D 2R3CA 2B87A 3CXCO 2N50A 3IR9A 3G4SP 3KHUA 2K1AA 3DS3A 1EXIA 3SWFA 1AVOA 4WWIA 4EDFA 3BCCJ 2QM7A 1CSBA 1PEMA 2WSSH 1LTBC 2QSIA 2YXQB 3MUDA 4BPGA 2M5AA 4PH0A 3O6QA 2ERHA 2BCCJ 1JMMA 5APYA 1JY2P 2E76B 2GZFA 5JPAA 1PP9J 1RHZB 4BXLA 2PEQA 4PWVB 1Q86Q 4WY4D 5CJ4A 2YO2A 1NO4A 2CNRA 2C0XA 1USDA 2YIUB 4YPCA 3KZIH 1NTMG 5AW1B 3E1RA 1QEXA 1HGVA 5APTA 2D2CD 5E79H 2AFDA 1S1CX 4JYCA 3VP8A 2MKVA 2PEJA 5EJDA 3CCJP 2XNDH 1NTKE 2I8DA 1L0NE 1U7JA 2LTEA 1RE3C 2R5DA 4GOEA 2VLPA 1PEOA 2WSEJ 5BU8B 3H1HE 1X9VA 1N73A 1L4AC 4H2XC 2KLVA 2XV6A 1S4XA 1JUNA 1LTJC 2LR2A 2Q3IA 1KN7A 1LTIC 3GHGC 1LTSC 2FACA 3I55P 1FS0E 1KB9D 1S5LX 4TLFA 2ZT9D 1NU1D 3M0DA 3V6IA 1S5LH 1LT1A 1SQVE 3M9HA 2IBZE 2FHSC 3EJBA 1S9KD 2A06D 1GZLA 2QJYC 1BGYD 3W67A 3AE5C 3CCSP 1J2JB 4H0LB 4H13C 1M57D 4L73A 2N1TA 1SQBG 2XV5A 4U3FJ 5DJUB 2E75D 1H8AA 4XFZA 2JBGA 2N9BA 2FYUD 1FJKA 1GL2A 1N7SC 5CCHA 2VLQA 3CCUP 1VQLP 5KLVD 1RNIA 1ZLLA 5HGOA 3V4WA 1K73Q 3L73D 5AVXB 2GZJA 1SQPK 2O01N 2H89C 1BSNA 4GDOA 1URQB 2B87B 2KS1A 2ZAEB 4BPFA 1VKUA 1SQXJ 1NU1G 3L75E 1NJIQ 2K0XA 1GDTA 2JQ4A 2L6EA 5CCGA 1VQ6P 1N2DC 3PLNA 3HE4B 1KFNA 2FXPA 3SWKA 2M5AB 3B5NA 1LNQA 1J1EB 1KYOI 3O6QB 3HUSA 1BGYG 1M1KQ 1SQQD 1GD2E 2Y9YA 3VMAA 3G28A 4U0EA 3NFQA 1T6AA 4D6TJ 1BDCA 2FYUG 3U59A 4N78E 3WUTA 2ZYDA 3SSUA 2W27A 3Q20A 2H88C 1VPCA 2FQ0A 4KT0J 3RBZA 2OARA 4HKGA 3TGUE 2VRSA 4OH8B 2SPZA 1M1JC 1Y9BA 1T2KC 1T8KA 2KGDA 3CWBJ 5F2KA 1P84H 1SFCC 1N73B 1JCDA 5KLVJ 1RY3A 2A45I 4UB6H 3G1IA 3NTNA 1EQ7A 3L73J 1AQ5A 2N5IA 1YJ9P 2KG6A 5CCHC 1L0LJ 1SQPE 2BCCE 2IYPA 3U43A 1PP9E 1NGMB 3H1KG 4YTPC 5B66E 1AVYA 4WYMA 1WRGA 4IPYA 4PD4E 2R5BA 2GDXA 2KW2A 2PEKA 1GK6A 1G1JA 5APQA 5TISH 1SQBK 1EIAA 2N1TB 2XU6A 5BU5A 1GL2B 2JEEA 3VMYA 2N6YA 1XTGB 1WMKA 2O01J 3HD7C 3MZWB 4U0DA 3H0DA 1NTME 2N98A 3JC22 4U0CA 1BE3D 4IL6X 1M6EX 3RK2C 2KS1B 1HUCA 2PGDA 3TYYA 1IK7A 2FYNC 3H1LJ 3IFMA 2GUVA 2JYLA 2BASA 2FBWC 2OYIC 1YI2P 3AE4C 1EZVD 3L74G 1GK4A 4AQRD 3MGNA 2E76D 3B5NB 2W8ZA 1UNKA 3H1ID 1HGZA 1N7LA 1HH0A 3TSIA 1FDIA 1OW7A 1QGKB 2WSCH 1SLQA 4AUWA 4DZOA 1EDLA 2FYUK 1CI6A 1RF1A 3GG2A 2GM4A 2E5YA 3OA7A 1S72P 3B71A 3L36A 3RK3C 1LWUA 1KQGB 2OTKE 2QJKC 1KILB 3A0BH 1HQBA 3GLMA 5CMZA 4COPA 3KPEA 2JKVA 2GZEA 1RE3A 1OZHA 1EZVG 3GMAA 3HTKA 1L4AA 2ONTA 2OYHB 3H1IG 1BE3J 3MD0A 3B4SA 1CEIA 1IK9A 3GHGA 2C9NY 3FWNA 2ZXEB 2I1KA 3L4FA 1NTKJ 1KB9E 2K5XA 1L0NJ 1NU1E 1PPJG 5DJTB 3F5HA 2JU2A 4LGDE 4OGQB 3CI9A 4H0LD 4UB8H 4WY4C 1G1IA 3AE3C 2QVAA 1S9KE 2A06E 1BGYE 2JO1A 3CX5D 3D6ZA 1JB0J 2D2CC 1Z6MA 2PEMA 3DS5A 2FYUE 2HFED 1N7SA 2H7HA 1JM0A 1U7MA 5KLVE 1T3UA 3H6PA 1RE4C 1URQD 2WPTA 4H2YC 1SQVJ 2K9YA 4EIJA 1FAVA 2JO0A 3L73E 1IUQA 3VMXA 3E1IA 1SS1A 3MHVA 1PZQA 2KOQA 2NPSB 3CX5I 2BEQD 3C9IA 5KLIB 1IFMA 3BASA 3HD7D 1JTHA 1WT6A 4XROA 3CMEP 4PJ0H 2ZT9C 4DT0A 1MZ9A 1KORA 5CJ0A 1J1DC 5BVZA 2FAEA 3KDPB 1U57A 3IAOA 3A5TA 3ABVC 1SQPD 2JYGA 3B4QA 1SQQE 1LT9C 2K88A 3GW6A 3LW5J 1EDIA 1HY8A 3H1KE 1RF1B 1H88A 2JB0A 1LTTC 3M1MA 2E75C 4OWFA 5AVTB 2WTYA 1N8RQ 2K9JB 1IJDB 1VHNA 1LWUB 1YQ3C 4IOIH 1ZXGA 4PV1B 1A43A 2GYKA 2P67A 3S4RA 2GUSA 3RL0B 1USEA 5H2FE 1M1JA 2KIKA 2LXCB 5M1BA 3RBXA 1BSHA 5F2OA 2BQ1E 2LIWA 1YTZI 3RK3D 3HTKB 3M0AA 4A7PA 1OW6A 3USSA 4ASWA 5B5EH 2H8PD 1A02J 3AEFC 3TGUJ 1A8OA 2AF8A 4LLHA 4ASVA 1IFNA 3MP7B 3LW5H 3L72G 4UHPB 3NMDA 1E5WA 2HR3A 4GIFA 1LJ2A 2IZ1A 2FQ2A 5BS1A 3WU2H 2MY5A 3KYQA 1MFTA 2QJYB 2FVAA 5GTHH 1SQPJ 4H13B 1FU1A 2FXMA 2QE7H 2N5HA 1ZW0A 4I7ZC 1M8OB 3CCLP 4OVNF 3AE1C 2E74B 1YITP 3VRLC 2NZ2A 1BCCD 1FZCA 4IFDK 1SVFA 2CQ8A 4TT3H 1ZN5A 2MVVA 3R2PA 2KZJA 2AXTE 2ZVOB 4IZ6A 1BE3E 1YJWP 4GT1A 1IC2A 1NVOA 5CCGD 2RKLA 1SQBD 2IFMA 1ZMBA 3ZDMA 1JTHB 2B89A 2KI7B 4M0IA 1QL2A 2O1KA 2OYIA 1N86A 2K93A 2ZYAA 2H43A 1YQ4C 1EZVE 3A2AA 1NTMJ 1VF5D 1QVGO 3H1IE 3NXSA 2FVEA 4XFXA 5KJ7D 5KKZC 2Q3EA 2P9XA 2FQ1A 3G1GA 1H0TA 4K3AA 1HJ0A 3BVHA 5B66H 1FZEA 3M91A 2IPPA 3CE7A 1KILD 1ZR2A 2M8RA 1K04A 1BCCG 4I2LC 4PD4H 3A0HE 4MN4C 2E42A 1EMVA 2GDWA 2EG5A 1JO5A 2L5GB 2WVRA 3EFFK 4U0BA 1E79H 3Q5RA 1EXJA 1NTZG 1JOCA 3L71D 2EIAA 1KB9I 2HODB 5KTBA 2IZ0A 2AVAA 2K2QA 4K35A 4N6JA 2HPCA 2BHVA 2WSEH 3AE7C 1OXZA 1PGJA 5GTIE 3A3YB 4IFFA 3TNUA 2KSEA 2E76C 3GJNA 1MUUA 1E0HA 3WBHA 1GMJA 2JGPA 2AEJA 1E6JP 1JCCA 2FFDC 4CPGA 2KOOA 3C1LA 2JJLA 3CCRP 1DH3A 1VQNP 2YIUC 2JR8A 1PIXA 3BRVB 1XTCC 3P8CD 2W83C 2W6AA 2JU1A 2RMZA 4WY4A 2KWLA 4ZKUA 3G21A 3V2RA 1LTGC 2IFNA 4H44B 1TU3F 4MRTC 3CX5E 2Y0EA 1DEBA 5AVQB 3II6A 3H1KD 5AW2B 2PY8A 5EW5E 1AJYA 1NU1J 3L71G 3QH9A 2KUBA 3GF3A 1FZCB 1YHQP 3CC7P 2N6ZA 3V2NA 1QLED 3K5BA 2NPSD 1RE4A 1YBKA 2XNXA 3VOPA 2V4HA 4NPEA 3MTUE 3LRYA 1BGYJ 4JQ0D 2KSJA 1R5SA 1HBWA 3WUVA 3VMZA 3TF5A 1LTAC 1K05A 4XFYA 5L8RJ 2K3RA 3G29A 1QX8A 2XXMA 4GODA 1Y8AA 3KZIE 2FYUJ 2WPSA 2AEMA 2YKPA 5KAFE 3Q2YA 3DS4A 4H0LC 4CA3A 4QNBA 4HJGH 2MF4A 1BAJA 2N9YB 2FY8A 2KP8A 5AW6B 2ZXXA 2Z45A 1RO0A 2Q9IA 1LT9A 1FZBA 3MGEA 1PEUA 1AV1A 3CL3D 2CK3H 2KNCA 2PEOA 1ACPA 3L74D 2M8NA 1M56D 4EI2A 3RL0D 2WQYC 3E2DA 1URQC 3P05A 2AXCA 1ZOYC 1IFIA 3PHLA 5AW5B 1SQQJ 2PFXA 2EFJA 1NTZK 4C7NA 3L35A 1OWAA 1S2EA 3H1KJ 1S5LE 3T97A 1OVUA 2Z5IA 1FOSF 3V5BA 2HPCB 4I1LA 1M6NA 4HB1A 3CXHD 1NKNA 1X79B 1J1EC 3RK3E 3WMM0 3TNUB 3H47A 1KYOH 2GA1A 1SQXK 3H1JG 3V4QA 1VQMP 4XFJA 1FDMA 4O9BA 4KHXA 2WT7A 2LPKA 4WBAA 1NAYA 3IF4A 2BUOA 3U1AA 2IYOA 4QKOA 4HKZH 1KZUB 4BPHA 1PGOA 4ZKPA 3CXHI 2V7QJ 2DW3A 3DS1A 2YKOA 1DIPA 3HUSB 2E74D 2MJZA 2W6JH 3M9QA 3P8MC 1GW3A 2K94A 4U0AA 3PTZA 1JY3N 2J5UA 4DJGA 1N73C 1PPJD 1UIIA 3LIEA 2KGCA 2KB7P 3EQ2A 3FXDA 3IN6A 4JBZA 2WPQA 5AW9B 2O01H 1BCCE 2A45H 3L74J 2E43A 2ZFCA 2P1JA 4ZMDA 1IFDA 1EZVI 5KAIH 1YYCA 3FXEA 2QM8A 3M0DC 1SQBE 2FVFA 4Y99C 2Y0DA 1YTZT 2ZT9B 1IFPA 1KLPA 1JY3O 1L0LK 3G0VA 4BWNA 1YIJP 3GKLC 4DOJA 5AW8B 1J1DB 1DEEG 4HYTB 2N1TC 2Z4EA 2M3BA 2KYVA 1LTJA 2L4BA 2LIUA 1L0NG 1FZAA 3L70D 2KNCB 3H1HG 4UB6E 1LGHB 2KG8A 1RF0C 4Z1MH 3VN0A 3H4EA 1KILE 2WPVB 1Q82Q 4H2WC 3H1IJ 3EWKA 2KGAA 4C7NB 3JCUE 3D71A 1RH5B 5CCGC 4GKGA 2VLOA 3T97B 3L71E 3HZQA 2JDIH 3BATA 3P32A 2AXTH 1AFOA 1KC8Q 1VF5C 2HLOA 2PNGA 1MKMA 1ZRTD 2FFDA 2G3AA 1ZR4A 5KJ7C 3L70G 2W90A 1IMPA 2YMKA 3VYIA 1GU5A 3W68A 4RJTA 4H44D 1KD1Q 1MZ8A 1KILC 3P8CE 4C7RA 2KXPB 4YXWH 2XZ1C 2HYNA 4IL6E 2C0WA 2M8PA 1EC5A 3TK1A 2K37A 1Y47A 2DNWA 3L75G 3SFDC 4U0FA 2FKWB 2AFEA 3L72D 1FZFA 1CI6B 1QRJA 2QIWA 2MD9A 3BCCD 2ZJSE 4PH1A 2OYHC 3A0HH 2KG9A 2M3EA 3G71P 5CHXA 3N7NA 1NOHA 1HF9A 1CZQA 4YXDC 2KORA 3DTJA 3RG6C 4NPDA 1PFIA 1T3JA 4OGQC 3BRTB 5KP7B 1BDDA 1SFCA 1AF8A 1F80D 1L4AB 3N4XA 5GTIH 2P2UA 1VQ9P 4L75A 1JMBA 2JAZA 2LL8A 1NTKK 2KOSA 1LTJB 1OVVA 3GF7A 4WVZA 1GTWA 1L0NK 2P58A 4ZNCA 3GHGB 1VDFA 4DCKA 4GOFA 3AEAC 5AW0B 2YO3A 2WZ7A 3BCCG 2CPBA 2Y9ZA 1KQSO 2UWJE 1FJPA 3L74E 2N1TD 5KP8B 3DS0A 4EYYQ 2BCCG 2NPSC 1URQA 5KLIC 1IMQA 1GL2D 1PP9G 5CCHD 3EJDA 2HG5D 1GU4A 2XT1A 3CX5H 1DX7A 3L72J 4R4LA 1W2EA 1SQVK 4UB8E 1HTLC 1PV3A 2L91A 1MFZA 1N7SB 3HE4A 1X3OA 3PRJA 3HD7A 5CBOA 3CXHE 4BRYA 5AW7B 2Z46A 3SFEC 4U3FD 5AVYB 3RGUA 2EHTA 1RF1C 2QJPC 2FFDB 3CCVP 1NTZD 3VTPC 1IFJA 1UIXA 3CCEP 3B5ND 4RKUJ 5HGMA 3U1CA 1LWUC 2QEXP 2CWOA 5BS2A 4PV1C 1A02F 1S3JA 1MV8A 2GDYA 1NQ4A 4KJMA 5KAFH 5CZDB 3PP5A 3RL0C 1GXHA 2P10A 1YJNP 1AQTA 2WITA 2M5RA 3DS2A 3H25A 1R8EA 1SQXD 2R3SA 2M0BA 1P84D 1X22A 4R4MA 1JY3P 4PJ0E 1Q90D 3CC2P 1NAFA 1FZGA 4COCA 1CW5A 1JNMA 1PPJE 2MVUA 2B88A 3B5IA 3NTEA 2QNWA 1DNYA 1ZP0C 2YXRB 3CD6P 1BXIA 3M06A 4WB4A 4HH2A 3PH0A 4U3FG 4D6TD 1M1JB 3EJEA 3L37A 3GZMA 2WPRA 2R44A 2VSQA 1P84I 2KODA 2PENA 2VLNA 2KOGA 1SP4A 2K0DX 1QL1A 5F2NA 1SFCB 2K0YA 2B9BA 1BCCJ 2O1JA 4NPFX 3S1KA 2LKIA 3CWBD 2E74C 1SQXG 2QA4P 1HWTC 1RQVA 1SQBJ 4OGQD 2NRGA 1JEKA 2Z5HA 1NTZJ 3L70E 1KMIZ 3HYBA 5B5EE 1G2CA 1KYOD 3G6EP 1RF0A 3CLQA 4IFMA 1M90Q 2YNYA 1L0LD 1L2PA 4GR2A 3AEGC 4L76A 5AVSB 1OIPA 3AE6C 4B86A 1R5LA 2Z44A 5APSA 4D6TG 1NH4A 4I6MC 2EHSA 4AYCA 2CGQA 2JWAA 3WU2E 2BEZF 1OMIA 3HD7B 5GTHE 5TJHA 2A06G 4BRYB 5APUA 2NO8A 3NY7B 2Q7CA 1DD3A 5KP6B 1PGPA 3RK2B 1UJZA 3ITKA 3CWBG 2E5TA 2FADA 3HE5A 2FYNB 1ZRTE 4W7YA 1NKZB 3D70A 3RG2A 2IX7C 2PP6A 5KJ7A 1NTMK 2WMMA 3L71J 5KLVG 2OYIB 1M7LA 1HVVA 1FC2C 3L73G 1D1DA 2LXBA 1VQ4P 4EOTA 5E79E 2POHA 1L0LG 1KILA 3KXDA 3H1JD 3H1LD 3VP9A 2LF4A 1EOQA 2Q6QA 3B8EB 3Q3DA 3Q1MA 2YKQA 1H0TB 4LC1A 3E7KA 3L72E 2X2BA 1KB9H 4PV1D 5DCKA 1KQFB 5AVVB 1VQ7P 3BCCE 1OFCX 1FBMA 4W80A 2OYHA 5AW3B 1K30A 3RK3B 2L9FA 1OVRA 1EDJA 1SQQG 2QJKB 4M3LA 5HVCA 2YMYA 3LIDA 1Q2NA 2WSFJ 4Y28J 1HJBA 3H32A 3CCMP 3JCUH 4Y99B 2OYOA 1L4AD 2XKMA 2A45G 1DD4A 1JJ2O 1PGQA 1QVFO 1Q7YQ 2PEIA 3OW2O 2MR7A 5AVZB 2M8LA 3MUDC 3AE2C 1GXGA 4H44C 2GZIA 3AEDC 2WSCJ 4W7ZA 1JY2N 2L0QA 3H1LG 1PEQA 3G9RA 1FE6A 1KQLA 1VQOP 2Q5UA 1FZCC 1OR5A 3V2PA 1G2CB 2E1MA 4H13D 4WY4B 1D7MA 3SWYA 5HGNA 1KFMA 3H1JJ 2NPSA 1LP1A 1H89A 1NU1K 4IL6H 1NTKD 1N7SD 2JP3A 1L0ND 7CEIA 2WSFH 3V2QA 4NEOA 1NWQA 2D2CB 2CPSA 4JF7A 1JY2O 3H1HD 5C39A 1KV4A 1RO2A 3G26A 3R4YA 2KLUA 3DPHA 2ZYGA 3M9BA 2ZVNB 1EDKA 3FX0A 2J58A 1Q81Q 3EFGA 2DGYA 1VF5B 4U3FE 2IDBA 5AVUB 3HE5B 3P7KA 5H2FH 5KLVK 1VQ5P 1NTZE 1AUMA 5AVRB 1SQVD 4DG9A 2IBZD 3AEBC 2K9JA 2K92A 3AE9C 3CPWO 1FDOA 2XZRA 1BE3G 3CCQP 5APWA 2L22A 4QMAA 2PRRA 2V7QH 1Z56A 4JYBA 1NTKG 1L0HA 1SQXE 1LT9B 3FWLA 1GL2C 1GW4A
chains in the Genus database with same CATH topology
1K73Q 2PEQA 4XFYA 1S72P 3DS2A 3DS1A 3G29A 2XXMA 1Q86Q 5BS1A 1VQ9P 3CC2P 4WYMA 5I4TG 1PEQA 4U0BA 4XRQA 4COCA 3HZQA 4IPYA 1VQOP 4XROA 3CMEP 1M74A 4U0AA 3DS4A 2EIAA 3B5IA 3NTEA 2PEKA 2E1MA 4GR6A 4QNBA 4COPA 1BAJA 1NJIQ 2BHVA 3CD6P 1KC8Q 2L6EA 2Z45A 1VQ6P 3CMAP 1RO0A 3CCLP 2PEJA 1EIAA 1YITP 3MGEA 3VRLC 3CCJP 1PEUA 2JYGA 5HGNA 1KQSO 2PEOA 1PEOA 2ONTA 3WBHA 1D1DA 3DS0A 1E6JP 1M1KQ 1VQ4P 2KODA 2PENA 2M8NA 3M1MA 3E2DA 1RO2A 1KD1Q 5F2NA 1YJWP 3G28A 4U0EA 3CCRP 3G26A 1K9MQ 4U0DA 2XT1A 2XV6A 3H0DA 1VQNP 3P05A 1N8RQ 4U0CA 2LF4A 1EOQA 1ZMBA 3DPHA 1M6EX 3I55P 2EFJA 1A43A 2M8PA 3G0VA 1YIJP 3Q20A 3I56P 1VQPP 1W2BO 4M0IA 1VQ8P 3G21A 1Q81Q 4U0FA 5DCKA 2DGYA 2OTJP 1K8AQ 5HGLA 1VQ7P 2OARA 2QA4P 2JYLA 1QRJA 1M6NA 1YI2P 2Z46A 3CXCO 1K30A 1QVGO 4PH1A 1VQ5P 2PY8A 3G4SP 3HYBA 5F2OA 3H47A 2BQ1E 1AUMA 3G6EP 3CCVP 4XFXA 5F2KA 1YHQP 3CC7P 2OTLP 1M90Q 3CCSP 3CCMP 3DS3A 1VQMP 3G71P 3CPWO 2PEMA 3DS5A 2P9XA 3G1GA 4GR2A 3CCQP 3H4EA 1A8OA 3CCEP 1PEMA 5HGMA 3CC4P 3G1IA 2QEXP 1JJ2O 2BUOA 2CWOA 1QVFO 1Q7YQ 3DTJA 4XFZA 2PEIA 3RG6C 5BS2A 3OW2O 1Q82Q 4PH0A 2Z44A 3LRYA 2M8LA 1YJ9P 1VQKP 2JO0A 3CCUP 1VQLP 1RNIA 5JPAA 5HGOA 2EG5A 1IUQA 1YJNP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 Q;  1VQ6 P;  3CMA P;  1S72 P;  3G6E P;  3CCL P;  3CCV P;  1YHQ P;  3CC7 P;  2OTL P;  1YIT P;  3I55 P;  3CCJ P;  1M90 Q;  3CCS P;  3CCM P;  1VQM P;  3G71 P;  1Q86 Q;  3CPW O;  1YIJ P;  3I56 P;  1VQP P;  1W2B O;  1KQS O;  1VQ9 P;  3CC2 P;  1VQ8 P;  3CCE P;  3CCQ P;  1Q81 Q;  3CC4 P;  2OTJ P;  1K8A Q;  2QEX P;  1M1K Q;  1JJ2 O;  1VQ4 P;  1VQO P;  2QA4 P;  1Q7Y Q;  1N8R Q;  1VQ7 P;  3CME P;  1QVF O;  3OW2 O;  1Q82 Q;  1YI2 P;  1YJ9 P;  3CXC O;  1VQK P;  3CCU P;  1KD1 Q;  1YJW P;  1VQL P;  3CCR P;  1NJI Q;  1K9M Q;  1QVG O;  3CD6 P;  1VQN P;  1VQ5 P;  1KC8 Q;  3G4S P;  1YJN P; 
#chains in the Genus database with same CATH topology
 1P84 E;  3OAK A;  2C9L Y;  3GZL A;  2Y0C A;  2P7J A;  1ZNV A;  2ROQ A;  2E75 B;  1NYH A;  2FXO A;  3LMO A;  4XRQ A;  3QWO C;  2IBZ I;  3WUU A;  4F37 A;  1M74 A;  1AA0 A;  1SQQ K;  4C46 A;  2AEF A;  1T2K D;  4GR6 A;  5EFW B;  3H32 B;  2G8Y A;  1SFC D;  3L75 D;  4D6T E;  1ZME C;  2WWW A;  3H1H J;  1FOS E;  5AVW B;  1SQV G;  2IBZ G;  3B5N C;  2RN0 A;  5TIS E;  3AEE C;  3HUS C;  3CXH H;  4U7J A;  3RL0 g;  2OGU A;  2KGE A;  3Q5S A;  3O8Z A;  2WT7 B;  1AYI A;  2LKM A;  3CWB E;  4RES B;  3FGA D;  3TDK A;  3I56 P;  4N78 D;  2QRX A;  2KK7 A;  3A7O A;  5AW4 B;  2KOP A;  5CBN A;  4JPZ B;  2OTJ P;  1K8A Q;  5HGL A;  2LOL A;  3OJA B;  2Q1K A;  1IO4 A;  1KYO E;  3TGU D;  1X8Y A;  1RQU A;  1L0L E;  4R0M A;  1LP1 B;  2O3J A;  2OTL P;  2I1J A;  3JSV C;  2OQQ A;  5APV A;  3CC4 P;  1OX3 A;  2GZG A;  2JWD A;  4I7Z B;  2ITA A;  3L70 J;  3S9O A;  1VQK P;  2RH0 A;  3C8V A;  3I5C A;  2QG4 A;  3RK2 D;  3AE8 C;  4L74 A;  4RO0 A;  4XE5 B;  2BCC D;  2R32 A;  5I4T G;  1PP9 D;  4PXH B;  2QJP B;  5HV8 A;  1PL5 A;  4N3Y B;  3L75 J;  1ZV8 A;  3G3Z A;  4PD4 D;  3AEC C;  3MIW A;  3CMA P;  5KAI E;  1DV5 A;  3HRN A;  1VL2 A;  5K5G B;  3TGU G;  2KR5 A;  3A0B E;  4XA4 A;  2XDJ A;  3H1J E;  1OW8 A;  2CG5 B;  3KQG A;  3H1L E;  1X0T A;  3Q5P A;  5KKZ B;  1L0I A;  1K9M Q;  2HOD A;  3D6Y A;  1T8Z A;  1KTM A;  3PJS K;  2FYZ A;  2PAJ A;  4PD4 I;  3F89 A;  1NTM D;  5APX A;  2W6B A;  1GPJ A;  1W2B O;  1VQP P;  2KZI A;  1W5C E;  3UIA A;  1VQ8 P;  2J59 M;  1FR2 A;  2LML A;  1IZN B;  2MR8 A;  1SQP G;  1NHL A;  2XZ0 D;  2R3C A;  2B87 A;  3CXC O;  2N50 A;  3IR9 A;  3G4S P;  3KHU A;  2K1A A;  3DS3 A;  1EXI A;  3SWF A;  1AVO A;  4WWI A;  4EDF A;  3BCC J;  2QM7 A;  1CSB A;  1PEM A;  2WSS H;  1LTB C;  2QSI A;  2YXQ B;  3MUD A;  4BPG A;  2M5A A;  4PH0 A;  3O6Q A;  2ERH A;  2BCC J;  1JMM A;  5APY A;  1JY2 P;  2E76 B;  2GZF A;  5JPA A;  1PP9 J;  1RHZ B;  4BXL A;  2PEQ A;  4PWV B;  1Q86 Q;  4WY4 D;  5CJ4 A;  2YO2 A;  1NO4 A;  2CNR A;  2C0X A;  1USD A;  2YIU B;  4YPC A;  3KZI H;  1NTM G;  5AW1 B;  3E1R A;  1QEX A;  1HGV A;  5APT A;  2D2C D;  5E79 H;  2AFD A;  1S1C X;  4JYC A;  3VP8 A;  2MKV A;  2PEJ A;  5EJD A;  3CCJ P;  2XND H;  1NTK E;  2I8D A;  1L0N E;  1U7J A;  2LTE A;  1RE3 C;  2R5D A;  4GOE A;  2VLP A;  1PEO A;  2WSE J;  5BU8 B;  3H1H E;  1X9V A;  1N73 A;  1L4A C;  4H2X C;  2KLV A;  2XV6 A;  1S4X A;  1JUN A;  1LTJ C;  2LR2 A;  2Q3I A;  1KN7 A;  1LTI C;  3GHG C;  1LTS C;  2FAC A;  3I55 P;  1FS0 E;  1KB9 D;  1S5L X;  4TLF A;  2ZT9 D;  1NU1 D;  3M0D A;  3V6I A;  1S5L H;  1LT1 A;  1SQV E;  3M9H A;  2IBZ E;  2FHS C;  3EJB A;  1S9K D;  2A06 D;  1GZL A;  2QJY C;  1BGY D;  3W67 A;  3AE5 C;  3CCS P;  1J2J B;  4H0L B;  4H13 C;  1M57 D;  4L73 A;  2N1T A;  1SQB G;  2XV5 A;  4U3F J;  5DJU B;  2E75 D;  1H8A A;  4XFZ A;  2JBG A;  2N9B A;  2FYU D;  1FJK A;  1GL2 A;  1N7S C;  5CCH A;  2VLQ A;  3CCU P;  1VQL P;  5KLV D;  1RNI A;  1ZLL A;  5HGO A;  3V4W A;  1K73 Q;  3L73 D;  5AVX B;  2GZJ A;  1SQP K;  2O01 N;  2H89 C;  1BSN A;  4GDO A;  1URQ B;  2B87 B;  2KS1 A;  2ZAE B;  4BPF A;  1VKU A;  1SQX J;  1NU1 G;  3L75 E;  1NJI Q;  2K0X A;  1GDT A;  2JQ4 A;  2L6E A;  5CCG A;  1VQ6 P;  1N2D C;  3PLN A;  3HE4 B;  1KFN A;  2FXP A;  3SWK A;  2M5A B;  3B5N A;  1LNQ A;  1J1E B;  1KYO I;  3O6Q B;  3HUS A;  1BGY G;  1M1K Q;  1SQQ D;  1GD2 E;  2Y9Y A;  3VMA A;  3G28 A;  4U0E A;  3NFQ A;  1T6A A;  4D6T J;  1BDC A;  2FYU G;  3U59 A;  4N78 E;  3WUT A;  2ZYD A;  3SSU A;  2W27 A;  3Q20 A;  2H88 C;  1VPC A;  2FQ0 A;  4KT0 J;  3RBZ A;  2OAR A;  4HKG A;  3TGU E;  2VRS A;  4OH8 B;  2SPZ A;  1M1J C;  1Y9B A;  1T2K C;  1T8K A;  2KGD A;  3CWB J;  5F2K A;  1P84 H;  1SFC C;  1N73 B;  1JCD A;  5KLV J;  1RY3 A;  2A45 I;  4UB6 H;  3G1I A;  3NTN A;  1EQ7 A;  3L73 J;  1AQ5 A;  2N5I A;  1YJ9 P;  2KG6 A;  5CCH C;  1L0L J;  1SQP E;  2BCC E;  2IYP A;  3U43 A;  1PP9 E;  1NGM B;  3H1K G;  4YTP C;  5B66 E;  1AVY A;  4WYM A;  1WRG A;  4IPY A;  4PD4 E;  2R5B A;  2GDX A;  2KW2 A;  2PEK A;  1GK6 A;  1G1J A;  5APQ A;  5TIS H;  1SQB K;  1EIA A;  2N1T B;  2XU6 A;  5BU5 A;  1GL2 B;  2JEE A;  3VMY A;  2N6Y A;  1XTG B;  1WMK A;  2O01 J;  3HD7 C;  3MZW B;  4U0D A;  3H0D A;  1NTM E;  2N98 A;  3JC2 2;  4U0C A;  1BE3 D;  4IL6 X;  1M6E X;  3RK2 C;  2KS1 B;  1HUC A;  2PGD A;  3TYY A;  1IK7 A;  2FYN C;  3H1L J;  3IFM A;  2GUV A;  2JYL A;  2BAS A;  2FBW C;  2OYI C;  1YI2 P;  3AE4 C;  1EZV D;  3L74 G;  1GK4 A;  4AQR D;  3MGN A;  2E76 D;  3B5N B;  2W8Z A;  1UNK A;  3H1I D;  1HGZ A;  1N7L A;  1HH0 A;  3TSI A;  1FDI A;  1OW7 A;  1QGK B;  2WSC H;  1SLQ A;  4AUW A;  4DZO A;  1EDL A;  2FYU K;  1CI6 A;  1RF1 A;  3GG2 A;  2GM4 A;  2E5Y A;  3OA7 A;  1S72 P;  3B71 A;  3L36 A;  3RK3 C;  1LWU A;  1KQG B;  2OTK E;  2QJK C;  1KIL B;  3A0B H;  1HQB A;  3GLM A;  5CMZ A;  4COP A;  3KPE A;  2JKV A;  2GZE A;  1RE3 A;  1OZH A;  1EZV G;  3GMA A;  3HTK A;  1L4A A;  2ONT A;  2OYH B;  3H1I G;  1BE3 J;  3MD0 A;  3B4S A;  1CEI A;  1IK9 A;  3GHG A;  2C9N Y;  3FWN A;  2ZXE B;  2I1K A;  3L4F A;  1NTK J;  1KB9 E;  2K5X A;  1L0N J;  1NU1 E;  1PPJ G;  5DJT B;  3F5H A;  2JU2 A;  4LGD E;  4OGQ B;  3CI9 A;  4H0L D;  4UB8 H;  4WY4 C;  1G1I A;  3AE3 C;  2QVA A;  1S9K E;  2A06 E;  1BGY E;  2JO1 A;  3CX5 D;  3D6Z A;  1JB0 J;  2D2C C;  1Z6M A;  2PEM A;  3DS5 A;  2FYU E;  2HFE D;  1N7S A;  2H7H A;  1JM0 A;  1U7M A;  5KLV E;  1T3U A;  3H6P A;  1RE4 C;  1URQ D;  2WPT A;  4H2Y C;  1SQV J;  2K9Y A;  4EIJ A;  1FAV A;  2JO0 A;  3L73 E;  1IUQ A;  3VMX A;  3E1I A;  1SS1 A;  3MHV A;  1PZQ A;  2KOQ A;  2NPS B;  3CX5 I;  2BEQ D;  3C9I A;  5KLI B;  1IFM A;  3BAS A;  3HD7 D;  1JTH A;  1WT6 A;  4XRO A;  3CME P;  4PJ0 H;  2ZT9 C;  4DT0 A;  1MZ9 A;  1KOR A;  5CJ0 A;  1J1D C;  5BVZ A;  2FAE A;  3KDP B;  1U57 A;  3IAO A;  3A5T A;  3ABV C;  1SQP D;  2JYG A;  3B4Q A;  1SQQ E;  1LT9 C;  2K88 A;  3GW6 A;  3LW5 J;  1EDI A;  1HY8 A;  3H1K E;  1RF1 B;  1H88 A;  2JB0 A;  1LTT C;  3M1M A;  2E75 C;  4OWF A;  5AVT B;  2WTY A;  1N8R Q;  2K9J B;  1IJD B;  1VHN A;  1LWU B;  1YQ3 C;  4IOI H;  1ZXG A;  4PV1 B;  1A43 A;  2GYK A;  2P67 A;  3S4R A;  2GUS A;  3RL0 B;  1USE A;  5H2F E;  1M1J A;  2KIK A;  2LXC B;  5M1B A;  3RBX A;  1BSH A;  5F2O A;  2BQ1 E;  2LIW A;  1YTZ I;  3RK3 D;  3HTK B;  3M0A A;  4A7P A;  1OW6 A;  3USS A;  4ASW A;  5B5E H;  2H8P D;  1A02 J;  3AEF C;  3TGU J;  1A8O A;  2AF8 A;  4LLH A;  4ASV A;  1IFN A;  3MP7 B;  3LW5 H;  3L72 G;  4UHP B;  3NMD A;  1E5W A;  2HR3 A;  4GIF A;  1LJ2 A;  2IZ1 A;  2FQ2 A;  5BS1 A;  3WU2 H;  2MY5 A;  3KYQ A;  1MFT A;  2QJY B;  2FVA A;  5GTH H;  1SQP J;  4H13 B;  1FU1 A;  2FXM A;  2QE7 H;  2N5H A;  1ZW0 A;  4I7Z C;  1M8O B;  3CCL P;  4OVN F;  3AE1 C;  2E74 B;  1YIT P;  3VRL C;  2NZ2 A;  1BCC D;  1FZC A;  4IFD K;  1SVF A;  2CQ8 A;  4TT3 H;  1ZN5 A;  2MVV A;  3R2P A;  2KZJ A;  2AXT E;  2ZVO B;  4IZ6 A;  1BE3 E;  1YJW P;  4GT1 A;  1IC2 A;  1NVO A;  5CCG D;  2RKL A;  1SQB D;  2IFM A;  1ZMB A;  3ZDM A;  1JTH B;  2B89 A;  2KI7 B;  4M0I A;  1QL2 A;  2O1K A;  2OYI A;  1N86 A;  2K93 A;  2ZYA A;  2H43 A;  1YQ4 C;  1EZV E;  3A2A A;  1NTM J;  1VF5 D;  1QVG O;  3H1I E;  3NXS A;  2FVE A;  4XFX A;  5KJ7 D;  5KKZ C;  2Q3E A;  2P9X A;  2FQ1 A;  3G1G A;  1H0T A;  4K3A A;  1HJ0 A;  3BVH A;  5B66 H;  1FZE A;  3M91 A;  2IPP A;  3CE7 A;  1KIL D;  1ZR2 A;  2M8R A;  1K04 A;  1BCC G;  4I2L C;  4PD4 H;  3A0H E;  4MN4 C;  2E42 A;  1EMV A;  2GDW A;  2EG5 A;  1JO5 A;  2L5G B;  2WVR A;  3EFF K;  4U0B A;  1E79 H;  3Q5R A;  1EXJ A;  1NTZ G;  1JOC A;  3L71 D;  2EIA A;  1KB9 I;  2HOD B;  5KTB A;  2IZ0 A;  2AVA A;  2K2Q A;  4K35 A;  4N6J A;  2HPC A;  2BHV A;  2WSE H;  3AE7 C;  1OXZ A;  1PGJ A;  5GTI E;  3A3Y B;  4IFF A;  3TNU A;  2KSE A;  2E76 C;  3GJN A;  1MUU A;  1E0H A;  3WBH A;  1GMJ A;  2JGP A;  2AEJ A;  1E6J P;  1JCC A;  2FFD C;  4CPG A;  2KOO A;  3C1L A;  2JJL A;  3CCR P;  1DH3 A;  1VQN P;  2YIU C;  2JR8 A;  1PIX A;  3BRV B;  1XTC C;  3P8C D;  2W83 C;  2W6A A;  2JU1 A;  2RMZ A;  4WY4 A;  2KWL A;  4ZKU A;  3G21 A;  3V2R A;  1LTG C;  2IFN A;  4H44 B;  1TU3 F;  4MRT C;  3CX5 E;  2Y0E A;  1DEB A;  5AVQ B;  3II6 A;  3H1K D;  5AW2 B;  2PY8 A;  5EW5 E;  1AJY A;  1NU1 J;  3L71 G;  3QH9 A;  2KUB A;  3GF3 A;  1FZC B;  1YHQ P;  3CC7 P;  2N6Z A;  3V2N A;  1QLE D;  3K5B A;  2NPS D;  1RE4 A;  1YBK A;  2XNX A;  3VOP A;  2V4H A;  4NPE A;  3MTU E;  3LRY A;  1BGY J;  4JQ0 D;  2KSJ A;  1R5S A;  1HBW A;  3WUV A;  3VMZ A;  3TF5 A;  1LTA C;  1K05 A;  4XFY A;  5L8R J;  2K3R A;  3G29 A;  1QX8 A;  2XXM A;  4GOD A;  1Y8A A;  3KZI E;  2FYU J;  2WPS A;  2AEM A;  2YKP A;  5KAF E;  3Q2Y A;  3DS4 A;  4H0L C;  4CA3 A;  4QNB A;  4HJG H;  2MF4 A;  1BAJ A;  2N9Y B;  2FY8 A;  2KP8 A;  5AW6 B;  2ZXX A;  2Z45 A;  1RO0 A;  2Q9I A;  1LT9 A;  1FZB A;  3MGE A;  1PEU A;  1AV1 A;  3CL3 D;  2CK3 H;  2KNC A;  2PEO A;  1ACP A;  3L74 D;  2M8N A;  1M56 D;  4EI2 A;  3RL0 D;  2WQY C;  3E2D A;  1URQ C;  3P05 A;  2AXC A;  1ZOY C;  1IFI A;  3PHL A;  5AW5 B;  1SQQ J;  2PFX A;  2EFJ A;  1NTZ K;  4C7N A;  3L35 A;  1OWA A;  1S2E A;  3H1K J;  1S5L E;  3T97 A;  1OVU A;  2Z5I A;  1FOS F;  3V5B A;  2HPC B;  4I1L A;  1M6N A;  4HB1 A;  3CXH D;  1NKN A;  1X79 B;  1J1E C;  3RK3 E;  3WMM 0;  3TNU B;  3H47 A;  1KYO H;  2GA1 A;  1SQX K;  3H1J G;  3V4Q A;  1VQM P;  4XFJ A;  1FDM A;  4O9B A;  4KHX A;  2WT7 A;  2LPK A;  4WBA A;  1NAY A;  3IF4 A;  2BUO A;  3U1A A;  2IYO A;  4QKO A;  4HKZ H;  1KZU B;  4BPH A;  1PGO A;  4ZKP A;  3CXH I;  2V7Q J;  2DW3 A;  3DS1 A;  2YKO A;  1DIP A;  3HUS B;  2E74 D;  2MJZ A;  2W6J H;  3M9Q A;  3P8M C;  1GW3 A;  2K94 A;  4U0A A;  3PTZ A;  1JY3 N;  2J5U A;  4DJG A;  1N73 C;  1PPJ D;  1UII A;  3LIE A;  2KGC A;  2KB7 P;  3EQ2 A;  3FXD A;  3IN6 A;  4JBZ A;  2WPQ A;  5AW9 B;  2O01 H;  1BCC E;  2A45 H;  3L74 J;  2E43 A;  2ZFC A;  2P1J A;  4ZMD A;  1IFD A;  1EZV I;  5KAI H;  1YYC A;  3FXE A;  2QM8 A;  3M0D C;  1SQB E;  2FVF A;  4Y99 C;  2Y0D A;  1YTZ T;  2ZT9 B;  1IFP A;  1KLP A;  1JY3 O;  1L0L K;  3G0V A;  4BWN A;  1YIJ P;  3GKL C;  4DOJ A;  5AW8 B;  1J1D B;  1DEE G;  4HYT B;  2N1T C;  2Z4E A;  2M3B A;  2KYV A;  1LTJ A;  2L4B A;  2LIU A;  1L0N G;  1FZA A;  3L70 D;  2KNC B;  3H1H G;  4UB6 E;  1LGH B;  2KG8 A;  1RF0 C;  4Z1M H;  3VN0 A;  3H4E A;  1KIL E;  2WPV B;  1Q82 Q;  4H2W C;  3H1I J;  3EWK A;  2KGA A;  4C7N B;  3JCU E;  3D71 A;  1RH5 B;  5CCG C;  4GKG A;  2VLO A;  3T97 B;  3L71 E;  3HZQ A;  2JDI H;  3BAT A;  3P32 A;  2AXT H;  1AFO A;  1KC8 Q;  1VF5 C;  2HLO A;  2PNG A;  1MKM A;  1ZRT D;  2FFD A;  2G3A A;  1ZR4 A;  5KJ7 C;  3L70 G;  2W90 A;  1IMP A;  2YMK A;  3VYI A;  1GU5 A;  3W68 A;  4RJT A;  4H44 D;  1KD1 Q;  1MZ8 A;  1KIL C;  3P8C E;  4C7R A;  2KXP B;  4YXW H;  2XZ1 C;  2HYN A;  4IL6 E;  2C0W A;  2M8P A;  1EC5 A;  3TK1 A;  2K37 A;  1Y47 A;  2DNW A;  3L75 G;  3SFD C;  4U0F A;  2FKW B;  2AFE A;  3L72 D;  1FZF A;  1CI6 B;  1QRJ A;  2QIW A;  2MD9 A;  3BCC D;  2ZJS E;  4PH1 A;  2OYH C;  3A0H H;  2KG9 A;  2M3E A;  3G71 P;  5CHX A;  3N7N A;  1NOH A;  1HF9 A;  1CZQ A;  4YXD C;  2KOR A;  3DTJ A;  3RG6 C;  4NPD A;  1PFI A;  1T3J A;  4OGQ C;  3BRT B;  5KP7 B;  1BDD A;  1SFC A;  1AF8 A;  1F80 D;  1L4A B;  3N4X A;  5GTI H;  2P2U A;  1VQ9 P;  4L75 A;  1JMB A;  2JAZ A;  2LL8 A;  1NTK K;  2KOS A;  1LTJ B;  1OVV A;  3GF7 A;  4WVZ A;  1GTW A;  1L0N K;  2P58 A;  4ZNC A;  3GHG B;  1VDF A;  4DCK A;  4GOF A;  3AEA C;  5AW0 B;  2YO3 A;  2WZ7 A;  3BCC G;  2CPB A;  2Y9Z A;  1KQS O;  2UWJ E;  1FJP A;  3L74 E;  2N1T D;  5KP8 B;  3DS0 A;  4EYY Q;  2BCC G;  2NPS C;  1URQ A;  5KLI C;  1IMQ A;  1GL2 D;  1PP9 G;  5CCH D;  3EJD A;  2HG5 D;  1GU4 A;  2XT1 A;  3CX5 H;  1DX7 A;  3L72 J;  4R4L A;  1W2E A;  1SQV K;  4UB8 E;  1HTL C;  1PV3 A;  2L91 A;  1MFZ A;  1N7S B;  3HE4 A;  1X3O A;  3PRJ A;  3HD7 A;  5CBO A;  3CXH E;  4BRY A;  5AW7 B;  2Z46 A;  3SFE C;  4U3F D;  5AVY B;  3RGU A;  2EHT A;  1RF1 C;  2QJP C;  2FFD B;  3CCV P;  1NTZ D;  3VTP C;  1IFJ A;  1UIX A;  3CCE P;  3B5N D;  4RKU J;  5HGM A;  3U1C A;  1LWU C;  2QEX P;  2CWO A;  5BS2 A;  4PV1 C;  1A02 F;  1S3J A;  1MV8 A;  2GDY A;  1NQ4 A;  4KJM A;  5KAF H;  5CZD B;  3PP5 A;  3RL0 C;  1GXH A;  2P10 A;  1YJN P;  1AQT A;  2WIT A;  2M5R A;  3DS2 A;  3H25 A;  1R8E A;  1SQX D;  2R3S A;  2M0B A;  1P84 D;  1X22 A;  4R4M A;  1JY3 P;  4PJ0 E;  1Q90 D;  3CC2 P;  1NAF A;  1FZG A;  4COC A;  1CW5 A;  1JNM A;  1PPJ E;  2MVU A;  2B88 A;  3B5I A;  3NTE A;  2QNW A;  1DNY A;  1ZP0 C;  2YXR B;  3CD6 P;  1BXI A;  3M06 A;  4WB4 A;  4HH2 A;  3PH0 A;  4U3F G;  4D6T D;  1M1J B;  3EJE A;  3L37 A;  3GZM A;  2WPR A;  2R44 A;  2VSQ A;  1P84 I;  2KOD A;  2PEN A;  2VLN A;  2KOG A;  1SP4 A;  2K0D X;  1QL1 A;  5F2N A;  1SFC B;  2K0Y A;  2B9B A;  1BCC J;  2O1J A;  4NPF X;  3S1K A;  2LKI A;  3CWB D;  2E74 C;  1SQX G;  2QA4 P;  1HWT C;  1RQV A;  1SQB J;  4OGQ D;  2NRG A;  1JEK A;  2Z5H A;  1NTZ J;  3L70 E;  1KMI Z;  3HYB A;  5B5E E;  1G2C A;  1KYO D;  3G6E P;  1RF0 A;  3CLQ A;  4IFM A;  1M90 Q;  2YNY A;  1L0L D;  1L2P A;  4GR2 A;  3AEG C;  4L76 A;  5AVS B;  1OIP A;  3AE6 C;  4B86 A;  1R5L A;  2Z44 A;  5APS A;  4D6T G;  1NH4 A;  4I6M C;  2EHS A;  4AYC A;  2CGQ A;  2JWA A;  3WU2 E;  2BEZ F;  1OMI A;  3HD7 B;  5GTH E;  5TJH A;  2A06 G;  4BRY B;  5APU A;  2NO8 A;  3NY7 B;  2Q7C A;  1DD3 A;  5KP6 B;  1PGP A;  3RK2 B;  1UJZ A;  3ITK A;  3CWB G;  2E5T A;  2FAD A;  3HE5 A;  2FYN B;  1ZRT E;  4W7Y A;  1NKZ B;  3D70 A;  3RG2 A;  2IX7 C;  2PP6 A;  5KJ7 A;  1NTM K;  2WMM A;  3L71 J;  5KLV G;  2OYI B;  1M7L A;  1HVV A;  1FC2 C;  3L73 G;  1D1D A;  2LXB A;  1VQ4 P;  4EOT A;  5E79 E;  2POH A;  1L0L G;  1KIL A;  3KXD A;  3H1J D;  3H1L D;  3VP9 A;  2LF4 A;  1EOQ A;  2Q6Q A;  3B8E B;  3Q3D A;  3Q1M A;  2YKQ A;  1H0T B;  4LC1 A;  3E7K A;  3L72 E;  2X2B A;  1KB9 H;  4PV1 D;  5DCK A;  1KQF B;  5AVV B;  1VQ7 P;  3BCC E;  1OFC X;  1FBM A;  4W80 A;  2OYH A;  5AW3 B;  1K30 A;  3RK3 B;  2L9F A;  1OVR A;  1EDJ A;  1SQQ G;  2QJK B;  4M3L A;  5HVC A;  2YMY A;  3LID A;  1Q2N A;  2WSF J;  4Y28 J;  1HJB A;  3H32 A;  3CCM P;  3JCU H;  4Y99 B;  2OYO A;  1L4A D;  2XKM A;  2A45 G;  1DD4 A;  1JJ2 O;  1PGQ A;  1QVF O;  1Q7Y Q;  2PEI A;  3OW2 O;  2MR7 A;  5AVZ B;  2M8L A;  3MUD C;  3AE2 C;  1GXG A;  4H44 C;  2GZI A;  3AED C;  2WSC J;  4W7Z A;  1JY2 N;  2L0Q A;  3H1L G;  1PEQ A;  3G9R A;  1FE6 A;  1KQL A;  1VQO P;  2Q5U A;  1FZC C;  1OR5 A;  3V2P A;  1G2C B;  2E1M A;  4H13 D;  4WY4 B;  1D7M A;  3SWY A;  5HGN A;  1KFM A;  3H1J J;  2NPS A;  1LP1 A;  1H89 A;  1NU1 K;  4IL6 H;  1NTK D;  1N7S D;  2JP3 A;  1L0N D;  7CEI A;  2WSF H;  3V2Q A;  4NEO A;  1NWQ A;  2D2C B;  2CPS A;  4JF7 A;  1JY2 O;  3H1H D;  5C39 A;  1KV4 A;  1RO2 A;  3G26 A;  3R4Y A;  2KLU A;  3DPH A;  2ZYG A;  3M9B A;  2ZVN B;  1EDK A;  3FX0 A;  2J58 A;  1Q81 Q;  3EFG A;  2DGY A;  1VF5 B;  4U3F E;  2IDB A;  5AVU B;  3HE5 B;  3P7K A;  5H2F H;  5KLV K;  1VQ5 P;  1NTZ E;  1AUM A;  5AVR B;  1SQV D;  4DG9 A;  2IBZ D;  3AEB C;  2K9J A;  2K92 A;  3AE9 C;  3CPW O;  1FDO A;  2XZR A;  1BE3 G;  3CCQ P;  5APW A;  2L22 A;  4QMA A;  2PRR A;  2V7Q H;  1Z56 A;  4JYB A;  1NTK G;  1L0H A;  1SQX E;  1LT9 B;  3FWL A;  1GL2 C;  1GW4 A; 
#chains in the Genus database with same CATH homology
 1K73 Q;  2PEQ A;  4XFY A;  1S72 P;  3DS2 A;  3DS1 A;  3G29 A;  2XXM A;  1Q86 Q;  5BS1 A;  1VQ9 P;  3CC2 P;  4WYM A;  5I4T G;  1PEQ A;  4U0B A;  4XRQ A;  4COC A;  3HZQ A;  4IPY A;  1VQO P;  4XRO A;  3CME P;  1M74 A;  4U0A A;  3DS4 A;  2EIA A;  3B5I A;  3NTE A;  2PEK A;  2E1M A;  4GR6 A;  4QNB A;  4COP A;  1BAJ A;  1NJI Q;  2BHV A;  3CD6 P;  1KC8 Q;  2L6E A;  2Z45 A;  1VQ6 P;  3CMA P;  1RO0 A;  3CCL P;  2PEJ A;  1EIA A;  1YIT P;  3MGE A;  3VRL C;  3CCJ P;  1PEU A;  2JYG A;  5HGN A;  1KQS O;  2PEO A;  1PEO A;  2ONT A;  3WBH A;  1D1D A;  3DS0 A;  1E6J P;  1M1K Q;  1VQ4 P;  2KOD A;  2PEN A;  2M8N A;  3M1M A;  3E2D A;  1RO2 A;  1KD1 Q;  5F2N A;  1YJW P;  3G28 A;  4U0E A;  3CCR P;  3G26 A;  1K9M Q;  4U0D A;  2XT1 A;  2XV6 A;  3H0D A;  1VQN P;  3P05 A;  1N8R Q;  4U0C A;  2LF4 A;  1EOQ A;  1ZMB A;  3DPH A;  1M6E X;  3I55 P;  2EFJ A;  1A43 A;  2M8P A;  3G0V A;  1YIJ P;  3Q20 A;  3I56 P;  1VQP P;  1W2B O;  4M0I A;  1VQ8 P;  3G21 A;  1Q81 Q;  4U0F A;  5DCK A;  2DGY A;  2OTJ P;  1K8A Q;  5HGL A;  1VQ7 P;  2OAR A;  2QA4 P;  2JYL A;  1QRJ A;  1M6N A;  1YI2 P;  2Z46 A;  3CXC O;  1K30 A;  1QVG O;  4PH1 A;  1VQ5 P;  2PY8 A;  3G4S P;  3HYB A;  5F2O A;  3H47 A;  2BQ1 E;  1AUM A;  3G6E P;  3CCV P;  4XFX A;  5F2K A;  1YHQ P;  3CC7 P;  2OTL P;  1M90 Q;  3CCS P;  3CCM P;  3DS3 A;  1VQM P;  3G71 P;  3CPW O;  2PEM A;  3DS5 A;  2P9X A;  3G1G A;  4GR2 A;  3CCQ P;  3H4E A;  1A8O A;  3CCE P;  1PEM A;  5HGM A;  3CC4 P;  3G1I A;  2QEX P;  1JJ2 O;  2BUO A;  2CWO A;  1QVF O;  1Q7Y Q;  3DTJ A;  4XFZ A;  2PEI A;  3RG6 C;  5BS2 A;  3OW2 O;  1Q82 Q;  4PH0 A;  2Z44 A;  3LRY A;  2M8L A;  1YJ9 P;  1VQK P;  2JO0 A;  3CCU P;  1VQL P;  1RNI A;  5JPA A;  5HGO A;  2EG5 A;  1IUQ A;  1YJN P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...