2PEJA

Crystal structure of rbcx point mutant y17a/y20l
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
109
structure length
109
Chain Sequence
FKKVAKETAITLQSALTLQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
molecule keywords ORF134
total genus 43
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pejA00
3Q20A 5BS2A 2PENA 2PEIA 2PEJA 2Z45A 2PEOA 3RG6C 3HYBA 4GR2A 2PEKA 5BS1A 4GR6A 2Z44A 2Z46A 2PY8A 2PEMA 2PEQA
chains in the Genus database with same CATH superfamily
3I55P 2LOLA 1F80D 1X3OA 3G6EP 1NJIQ 3CC2P 2AFEA 2PEKA 1K30A 2M8PA 5KP6B 3CPWO 4BPFA 3CCVP 5BS1A 1E0HA 1VQNP 4M0IA 3NY7B 2XT1A 1VKUA 2PEOA 1YJ9P 2AF8A 3I56P 2MF4A 1E6JP 2JYGA 2LIWA 2QEXP 2VLOA 1NQ4A 3G21A 1EMVA 2FADA 3Q20A 2JU1A 2P9XA 1W2BO 3CMAP 2XZ0D 1A8OA 1CEIA 1YHQP 1VHNA 3G26A 2FACA 3EJBA 4H2XC 4R0MA 1M6EX 1BAJA 2KGEA 4HKGA 2JGPA 2DGYA 5HGLA 2FVFA 1YI2P 2BHVA 1ZNVA 2PEIA 2LTEA 2L9FA 3RG6C 3LMOA 2FQ0A 2XZ1C 5JPAA 1KQSO 4QKOA 2OTLP 1VQ7P 1OR5A 4PH1A 3WBHA 5BS2A 4PWVB 2K2QA 1GXHA 3CXCO 2EHSA 2FVAA 5KP8B 3CMEP 4COCA 3G29A 2CGQA 2KWLA 1IUQA 1MZ8A 2BUOA 3CCQP 1VQMP 3H0DA 2K0XA 3H47A 2KODA 2K92A 3GZMA 4F37A 3CCMP 3DPHA 3B4QA 1M6NA 4GR6A 1GPJA 2CG5B 2JBGA 2XXMA 2DNWA 2GYKA 4IPYA 5EJDA 1UJZA 1K9MQ 2JO0A 1KC8Q 2VLNA 2EG5A 2KGCA 2Z44A 2PEMA 2L4BA 2GDYA 2MY5A 4PXHB 1K73Q 1VQ6P 1D1DA 2GZGA 1VQKP 3MGEA 2LIUA 4QNBA 4U0BA 3CCSP 2KGDA 4XROA 1GXGA 2GZEA 2PENA 1DV5A 1ACPA 2K0DX 3CE7A 1L0HA 2QA4P 2M5RA 1EIAA 2CWOA 1N8RQ 2M8NA 4U0CA 4U0AA 1VQ8P 2PEQA 5HGOA 1RNIA 3G4SP 1M74A 1FR2A 2E1MA 2KOOA 2QNWA 2L22A 3G28A 3CD6P 1S72P 2K5XA 1AF8A 3CCUP 2KGAA 1M1KQ 5HV8A 2LF4A 2GDXA 3VRLC 2JQ4A 2N6YA 3E2DA 2Z46A 7CEIA 2JB0A 1UNKA 1IMPA 4XRQA 2N5IA 4XFYA 1YITP 1VQ9P 3NTEA 2EFJA 2MR8A 5EW5E 1Z6MA 3GKLC 3DTJA 1YJNP 3OW2O 2FQ2A 4H2YC 2VSQA 3DS4A 2LMLA 4MRTC 5I4TG 2JU2A 2KOPA 2AVAA 2LKIA 3G1GA 3M1MA 1KD1Q 2KG9A 4COPA 5F2OA 2JYLA 2X2BA 2GZJA 2PEJA 2FVEA 2N50A 3CCJP 3EJDA 3H4EA 4U0DA 3DS5A 4WYMA 1K8AQ 1T8KA 2VLQA 4PH0A 2EHTA 4DG9A 2NO8A 2EIAA 3B5IA 4U0EA 2N5HA 1ZMBA 1VQPP 1KLPA 3EJEA 3G1IA 2GZFA 1AUMA 2VLPA 1VQOP 2KOSA 1Q86Q 3GZLA 2KR5A 1EOQA 2PY8A 1YIJP 2GDWA 2KORA 5F2KA 3CCLP 1RO0A 4CA3A 4H2WC 2MR7A 3G71P 4XFZA 1JJ2O 1M90Q 1HY8A 2ERHA 2M8LA 2K93A 4U0FA 3P05A 2PNGA 5KP7B 4NEOA 3GJNA 2ONTA 5F2NA 2AFDA 2Z45A 2KW2A 3HYBA 5CZDB 2FQ1A 3DS1A 3DS0A 1BXIA 4GR2A 3RG2A 3G0VA 1VQ4P 2K0YA 1YJWP 1Q81Q 1VQLP 1A43A 4IZ6A 2KG8A 3CCEP 1Q82Q 2LL8A 3CC4P 1QVFO 2GZIA 2CNRA 2L0QA 1QVGO 2FAEA 2LPKA 1Q7YQ 1DNYA 1VQ5P 4BPGA 2MD9A 2MVVA 5HGMA 2OTJP 1HQBA 2N6ZA 2CQ8A 4UHPB 1AYIA 2XV6A 3HZQA 3CCRP 2OARA 1IMQA 2FHSC 2ROQA 3LRYA 2KOQA 1RO2A 1QRJA 3DS2A 3DS3A 2JAZA 4BPHA 4XFXA 2L6EA 2N98A 3CC7P 5HGNA 2MVUA 2WPTA 5DCKA 2K94A 1L0IA 2KG6A 3U43A 5HVCA
chains in the Genus database with same CATH topology
3I55P 1M90Q 1IUQA 3VRLC 3E2DA 3G6EP 1NJIQ 2M8LA 3CC2P 2Z46A 2BUOA 3CCQP 2PEKA 4XRQA 1VQMP 1K30A 2M8PA 4XFYA 1YITP 3CPWO 4U0FA 3H0DA 1VQ9P 3P05A 3NTEA 2EFJA 3H47A 2KODA 3CCVP 5BS1A 2ONTA 1VQNP 3DTJA 5F2NA 1YJNP 4M0IA 3OW2O 2XT1A 3DS4A 3CCMP 3DPHA 2Z45A 2PEOA 1YJ9P 3HYBA 1M6NA 3I56P 4GR6A 3DS1A 3DS0A 1E6JP 2XXMA 4GR2A 4IPYA 3G0VA 5I4TG 1VQ4P 2JYGA 1YJWP 2QEXP 1K9MQ 1Q81Q 2JO0A 3G21A 3G1GA 3M1MA 1KC8Q 1VQLP 1KD1Q 4COPA 1A43A 3Q20A 5F2OA 2P9XA 1W2BO 3CMAP 2EG5A 1A8OA 2JYLA 1YHQP 3CCEP 2Z44A 1Q82Q 2PEMA 2PEJA 3G26A 3CC4P 1QVFO 3CCJP 1K73Q 3H4EA 1M6EX 4U0DA 3DS5A 1BAJA 4WYMA 1VQ6P 1D1DA 1VQKP 1QVGO 3MGEA 1K8AQ 4QNBA 4U0BA 2DGYA 5HGLA 3CCSP 1YI2P 2BHVA 4PH0A 2PEIA 1Q7YQ 1VQ5P 4XROA 2EIAA 3B5IA 4U0EA 3RG6C 5HGMA 1ZMBA 2OTJP 2PENA 1VQPP 3G1IA 2QA4P 1AUMA 1EIAA 5JPAA 2CWOA 2XV6A 3HZQA 3CCRP 1KQSO 1VQOP 2OARA 2M8NA 4U0CA 1Q86Q 1N8RQ 1VQ7P 2OTLP 3LRYA 4U0AA 1EOQA 1RO2A 2PY8A 1QRJA 2PEQA 4PH1A 3WBHA 5BS2A 1YIJP 3DS2A 1VQ8P 5HGOA 3DS3A 1RNIA 3G4SP 5F2KA 3CCLP 1M74A 2E1MA 1RO0A 4XFXA 3CXCO 2L6EA 3G28A 3CMEP 3CC7P 5HGNA 3CD6P 1S72P 5DCKA 3CCUP 3G71P 1M1KQ 4COCA 2LF4A 4XFZA 3G29A 1JJ2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q20 A;  5BS2 A;  2PEN A;  2PEI A;  2PEJ A;  2Z45 A;  2PEO A;  3RG6 C;  3HYB A;  4GR2 A;  2PEK A;  5BS1 A;  4GR6 A;  2Z44 A;  2Z46 A;  2PY8 A;  2PEM A;  2PEQ A; 
#chains in the Genus database with same CATH topology
 3I55 P;  2LOL A;  1F80 D;  1X3O A;  3G6E P;  1NJI Q;  3CC2 P;  2AFE A;  2PEK A;  1K30 A;  2M8P A;  5KP6 B;  3CPW O;  4BPF A;  3CCV P;  5BS1 A;  1E0H A;  1VQN P;  4M0I A;  3NY7 B;  2XT1 A;  1VKU A;  2PEO A;  1YJ9 P;  2AF8 A;  3I56 P;  2MF4 A;  1E6J P;  2JYG A;  2LIW A;  2QEX P;  2VLO A;  1NQ4 A;  3G21 A;  1EMV A;  2FAD A;  3Q20 A;  2JU1 A;  2P9X A;  1W2B O;  3CMA P;  2XZ0 D;  1A8O A;  1CEI A;  1YHQ P;  1VHN A;  3G26 A;  2FAC A;  3EJB A;  4H2X C;  4R0M A;  1M6E X;  1BAJ A;  2KGE A;  4HKG A;  2JGP A;  2DGY A;  5HGL A;  2FVF A;  1YI2 P;  2BHV A;  1ZNV A;  2PEI A;  2LTE A;  2L9F A;  3RG6 C;  3LMO A;  2FQ0 A;  2XZ1 C;  5JPA A;  1KQS O;  4QKO A;  2OTL P;  1VQ7 P;  1OR5 A;  4PH1 A;  3WBH A;  5BS2 A;  4PWV B;  2K2Q A;  1GXH A;  3CXC O;  2EHS A;  2FVA A;  5KP8 B;  3CME P;  4COC A;  3G29 A;  2CGQ A;  2KWL A;  1IUQ A;  1MZ8 A;  2BUO A;  3CCQ P;  1VQM P;  3H0D A;  2K0X A;  3H47 A;  2KOD A;  2K92 A;  3GZM A;  4F37 A;  3CCM P;  3DPH A;  3B4Q A;  1M6N A;  4GR6 A;  1GPJ A;  2CG5 B;  2JBG A;  2XXM A;  2DNW A;  2GYK A;  4IPY A;  5EJD A;  1UJZ A;  1K9M Q;  2JO0 A;  1KC8 Q;  2VLN A;  2EG5 A;  2KGC A;  2Z44 A;  2PEM A;  2L4B A;  2GDY A;  2MY5 A;  4PXH B;  1K73 Q;  1VQ6 P;  1D1D A;  2GZG A;  1VQK P;  3MGE A;  2LIU A;  4QNB A;  4U0B A;  3CCS P;  2KGD A;  4XRO A;  1GXG A;  2GZE A;  2PEN A;  1DV5 A;  1ACP A;  2K0D X;  3CE7 A;  1L0H A;  2QA4 P;  2M5R A;  1EIA A;  2CWO A;  1N8R Q;  2M8N A;  4U0C A;  4U0A A;  1VQ8 P;  2PEQ A;  5HGO A;  1RNI A;  3G4S P;  1M74 A;  1FR2 A;  2E1M A;  2KOO A;  2QNW A;  2L22 A;  3G28 A;  3CD6 P;  1S72 P;  2K5X A;  1AF8 A;  3CCU P;  2KGA A;  1M1K Q;  5HV8 A;  2LF4 A;  2GDX A;  3VRL C;  2JQ4 A;  2N6Y A;  3E2D A;  2Z46 A;  7CEI A;  2JB0 A;  1UNK A;  1IMP A;  4XRQ A;  2N5I A;  4XFY A;  1YIT P;  1VQ9 P;  3NTE A;  2EFJ A;  2MR8 A;  5EW5 E;  1Z6M A;  3GKL C;  3DTJ A;  1YJN P;  3OW2 O;  2FQ2 A;  4H2Y C;  2VSQ A;  3DS4 A;  2LML A;  4MRT C;  5I4T G;  2JU2 A;  2KOP A;  2AVA A;  2LKI A;  3G1G A;  3M1M A;  1KD1 Q;  2KG9 A;  4COP A;  5F2O A;  2JYL A;  2X2B A;  2GZJ A;  2PEJ A;  2FVE A;  2N50 A;  3CCJ P;  3EJD A;  3H4E A;  4U0D A;  3DS5 A;  4WYM A;  1K8A Q;  1T8K A;  2VLQ A;  4PH0 A;  2EHT A;  4DG9 A;  2NO8 A;  2EIA A;  3B5I A;  4U0E A;  2N5H A;  1ZMB A;  1VQP P;  1KLP A;  3EJE A;  3G1I A;  2GZF A;  1AUM A;  2VLP A;  1VQO P;  2KOS A;  1Q86 Q;  3GZL A;  2KR5 A;  1EOQ A;  2PY8 A;  1YIJ P;  2GDW A;  2KOR A;  5F2K A;  3CCL P;  1RO0 A;  4CA3 A;  4H2W C;  2MR7 A;  3G71 P;  4XFZ A;  1JJ2 O;  1M90 Q;  1HY8 A;  2ERH A;  2M8L A;  2K93 A;  4U0F A;  3P05 A;  2PNG A;  5KP7 B;  4NEO A;  3GJN A;  2ONT A;  5F2N A;  2AFD A;  2Z45 A;  2KW2 A;  3HYB A;  5CZD B;  2FQ1 A;  3DS1 A;  3DS0 A;  1BXI A;  4GR2 A;  3RG2 A;  3G0V A;  1VQ4 P;  2K0Y A;  1YJW P;  1Q81 Q;  1VQL P;  1A43 A;  4IZ6 A;  2KG8 A;  3CCE P;  1Q82 Q;  2LL8 A;  3CC4 P;  1QVF O;  2GZI A;  2CNR A;  2L0Q A;  1QVG O;  2FAE A;  2LPK A;  1Q7Y Q;  1DNY A;  1VQ5 P;  4BPG A;  2MD9 A;  2MVV A;  5HGM A;  2OTJ P;  1HQB A;  2N6Z A;  2CQ8 A;  4UHP B;  1AYI A;  2XV6 A;  3HZQ A;  3CCR P;  2OAR A;  1IMQ A;  2FHS C;  2ROQ A;  3LRY A;  2KOQ A;  1RO2 A;  1QRJ A;  3DS2 A;  3DS3 A;  2JAZ A;  4BPH A;  4XFX A;  2L6E A;  2N98 A;  3CC7 P;  5HGN A;  2MVU A;  2WPT A;  5DCK A;  2K94 A;  1L0I A;  2KG6 A;  3U43 A;  5HVC A; 
#chains in the Genus database with same CATH homology
 3I55 P;  1M90 Q;  1IUQ A;  3VRL C;  3E2D A;  3G6E P;  1NJI Q;  2M8L A;  3CC2 P;  2Z46 A;  2BUO A;  3CCQ P;  2PEK A;  4XRQ A;  1VQM P;  1K30 A;  2M8P A;  4XFY A;  1YIT P;  3CPW O;  4U0F A;  3H0D A;  1VQ9 P;  3P05 A;  3NTE A;  2EFJ A;  3H47 A;  2KOD A;  3CCV P;  5BS1 A;  2ONT A;  1VQN P;  3DTJ A;  5F2N A;  1YJN P;  4M0I A;  3OW2 O;  2XT1 A;  3DS4 A;  3CCM P;  3DPH A;  2Z45 A;  2PEO A;  1YJ9 P;  3HYB A;  1M6N A;  3I56 P;  4GR6 A;  3DS1 A;  3DS0 A;  1E6J P;  2XXM A;  4GR2 A;  4IPY A;  3G0V A;  5I4T G;  1VQ4 P;  2JYG A;  1YJW P;  2QEX P;  1K9M Q;  1Q81 Q;  2JO0 A;  3G21 A;  3G1G A;  3M1M A;  1KC8 Q;  1VQL P;  1KD1 Q;  4COP A;  1A43 A;  3Q20 A;  5F2O A;  2P9X A;  1W2B O;  3CMA P;  2EG5 A;  1A8O A;  2JYL A;  1YHQ P;  3CCE P;  2Z44 A;  1Q82 Q;  2PEM A;  2PEJ A;  3G26 A;  3CC4 P;  1QVF O;  3CCJ P;  1K73 Q;  3H4E A;  1M6E X;  4U0D A;  3DS5 A;  1BAJ A;  4WYM A;  1VQ6 P;  1D1D A;  1VQK P;  1QVG O;  3MGE A;  1K8A Q;  4QNB A;  4U0B A;  2DGY A;  5HGL A;  3CCS P;  1YI2 P;  2BHV A;  4PH0 A;  2PEI A;  1Q7Y Q;  1VQ5 P;  4XRO A;  2EIA A;  3B5I A;  4U0E A;  3RG6 C;  5HGM A;  1ZMB A;  2OTJ P;  2PEN A;  1VQP P;  3G1I A;  2QA4 P;  1AUM A;  1EIA A;  5JPA A;  2CWO A;  2XV6 A;  3HZQ A;  3CCR P;  1KQS O;  1VQO P;  2OAR A;  2M8N A;  4U0C A;  1Q86 Q;  1N8R Q;  1VQ7 P;  2OTL P;  3LRY A;  4U0A A;  1EOQ A;  1RO2 A;  2PY8 A;  1QRJ A;  2PEQ A;  4PH1 A;  3WBH A;  5BS2 A;  1YIJ P;  3DS2 A;  1VQ8 P;  5HGO A;  3DS3 A;  1RNI A;  3G4S P;  5F2K A;  3CCL P;  1M74 A;  2E1M A;  1RO0 A;  4XFX A;  3CXC O;  2L6E A;  3G28 A;  3CME P;  3CC7 P;  5HGN A;  3CD6 P;  1S72 P;  5DCK A;  3CCU P;  3G71 P;  1M1K Q;  4COC A;  2LF4 A;  4XFZ A;  3G29 A;  1JJ2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...