2PEJA

Crystal structure of rbcx point mutant y17a/y20l
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
109
structure length
109
Chain Sequence
FKKVAKETAITLQSALTLQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 43
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pejA00
2Z44A 3RG6C 2PEJA 2Z46A 3HYBA 3Q20A 4GR2A 4GR6A 2PEKA 2PENA 2PEIA 2PEOA 2PY8A 2Z45A 5BS1A 5BS2A 2PEMA 2PEQA
chains in the Genus database with same CATH superfamily
2GDYA 4HKGA 3E2DA 2KOQA 2ONTA 5DCKA 2K0YA 2QA4P 1VQPP 4U0DA 2PY8A 1M1KQ 2CNRA 2K94A 2DNWA 1KLPA 2FACA 2GZGA 1UJZA 1JJ2O 5BS1A 3G29A 2K92A 1RO0A 1VKUA 3RG2A 2PEJA 3GJNA 1QVFO 2QEXP 2AF8A 2FVEA 3G21A 1Q7YQ 3CE7A 3GKLC 2MR7A 2K2QA 2LF4A 1QVGO 2Z46A 2MVVA 3NTEA 4F37A 1YITP 2M8LA 5KP8B 5HGOA 1NJIQ 2Z44A 1A43A 4COCA 2KORA 3M1MA 3DS1A 2AVAA 3G4SP 1A8OA 1KQSO 4BPGA 2XZ1C 3G28A 2X2BA 1VQKP 3G0VA 2BUOA 2VLPA 4U0AA 4PH1A 1M74A 1VHNA 4DG9A 1S72P 1UNKA 2MF4A 3P05A 2EFJA 5HVCA 2VLNA 1KC8Q 3NY7B 2FQ1A 5EJDA 3RG6C 2QNWA 1VQ9P 2LMLA 2PEKA 2XT1A 2Z45A 2DGYA 2K0XA 1GPJA 2L0QA 1Z6MA 2N5IA 5KP7B 4COPA 1FR2A 1VQ5P 2LOLA 1M6EX 1T8KA 2K93A 2M8PA 2GZFA 1YJ9P 2MY5A 2P9XA 2N6YA 4XFXA 5HV8A 1ZMBA 1Q82Q 2FAEA 3G1IA 2PEQA 3G1GA 1VQOP 3LMOA 2MD9A 2EIAA 3CC7P 1L0HA 5KP6B 2KGEA 2JQ4A 3CCEP 4IZ6A 2M5RA 2KGCA 4IPYA 4NEOA 3H47A 5CZDB 3CMAP 1KD1Q 4XFZA 1GXGA 3CCRP 1YJWP 1HQBA 2KG8A 3DPHA 1Q86Q 1DNYA 3DTJA 2XZ0D 4XROA 2N50A 2LIUA 3CCQP 2KODA 3MGEA 1VQMP 1VQ8P 3G26A 4QNBA 2LKIA 2KR5A 4PXHB 4WYMA 4CA3A 1Q81Q 1IMPA 2JGPA 4PH0A 1VQ6P 3OW2O 1AF8A 2K5XA 3I56P 2JB0A 3CCSP 2KW2A 1OR5A 1YI2P 5HGNA 4H2WC 2JO0A 1IMQA 1NQ4A 3CCMP 2CGQA 4U0BA 1D1DA 1VQLP 2KGDA 1RNIA 4M0IA 5JPAA 2K0DX 1N8RQ 2GDXA 3GZMA 3CPWO 4QKOA 2GZJA 1AUMA 1IUQA 2KG9A 2GZIA 1YHQP 1VQ7P 7CEIA 1M6NA 1MZ8A 2JBGA 4H2YC 2WPTA 2KOOA 2PEMA 4MRTC 2VLQA 3H0DA 5HGMA 2ROQA 2AFDA 2N6ZA 2FADA 2PEOA 2EG5A 2FHSC 2EHTA 1BAJA 5EW5E 3CD6P 2OTJP 2JU2A 4GR2A 5F2KA 2MVUA 2ERHA 2L9FA 2BHVA 2JYGA 1YIJP 3CCLP 2KG6A 1E6JP 2LPKA 1K9MQ 3DS4A 2L4BA 1F80D 2GDWA 3GZLA 1QRJA 2OTLP 4U0CA 2EHSA 4PWVB 3EJEA 1X3OA 3DS2A 2OARA 5BS2A 3CC4P 4UHPB 3I55P 2M8NA 1ZNVA 3VRLC 3B4QA 2XV6A 1BXIA 2N98A 3WBHA 2LIWA 2JU1A 2LTEA 1CEIA 2GZEA 4BPHA 3CMEP 1EOQA 2E1MA 2NO8A 2PENA 2VSQA 3G71P 3LRYA 2FQ0A 3B5IA 2CWOA 3G6EP 1VQNP 3CXCO 5I4TG 2KOSA 2PNGA 1M90Q 2XXMA 2FQ2A 1GXHA 3DS3A 2JAZA 5F2NA 2L6EA 1K30A 5F2OA 1K73Q 3H4EA 2KWLA 3EJBA 1DV5A 2JYLA 4R0MA 2GYKA 3CCJP 1E0HA 2KOPA 1L0IA 1YJNP 4H2XC 3HZQA 3CC2P 3DS5A 4XFYA 1VQ4P 1HY8A 2FVAA 3CCVP 1RO2A 2PEIA 1ACPA 2AFEA 2L22A 1W2BO 4XRQA 3Q20A 2LL8A 3EJDA 2VLOA 3DS0A 2CG5B 1EIAA 1EMVA 2KGAA 4U0EA 2MR8A 4U0FA 3U43A 5HGLA 1K8AQ 3HYBA 4GR6A 3CCUP 1AYIA 4BPFA 2N5HA 2FVFA 2CQ8A
chains in the Genus database with same CATH topology
3I56P 2M8NA 3VRLC 3E2DA 3CCSP 2ONTA 2XV6A 1S72P 5DCKA 1YI2P 5HGNA 3WBHA 3P05A 2EFJA 2QA4P 1VQPP 2JO0A 4U0DA 2PY8A 1M1KQ 3CCMP 1KC8Q 4U0BA 3RG6C 3CMEP 1D1DA 1EOQA 2E1MA 1VQ9P 1VQLP 2PEKA 2PENA 2XT1A 1RNIA 2DGYA 2Z45A 3G71P 4M0IA 5BS1A 3LRYA 1JJ2O 3G29A 3B5IA 2CWOA 5JPAA 4COPA 3G6EP 1VQNP 3CXCO 1N8RQ 1RO0A 5I4TG 1VQ5P 1M90Q 2XXMA 1M6EX 2PEJA 3CPWO 1QVFO 2QEXP 1AUMA 3DS3A 3G21A 1Q7YQ 2M8PA 5F2NA 1IUQA 1YJ9P 2P9XA 4XFXA 2L6EA 1K30A 5F2OA 1K73Q 3H4EA 1ZMBA 1Q82Q 2LF4A 1QVGO 3G1IA 2PEQA 3G1GA 2JYLA 1YHQP 1VQ7P 1VQOP 3CCJP 1M6NA 2Z46A 2EIAA 3CC7P 2PEMA 3NTEA 3H0DA 5HGMA 1YJNP 1YITP 2M8LA 3CCEP 2PEOA 3HZQA 2EG5A 4IPYA 3CC2P 3DS5A 1BAJA 3H47A 4XFYA 5HGOA 3CMAP 1VQ4P 3CD6P 1KD1Q 4XFZA 2OTJP 4GR2A 5F2KA 1NJIQ 3CCRP 1YJWP 3CCVP 1RO2A 2PEIA 1W2BO 2BHVA 3DPHA 2JYGA 4XRQA 1Q86Q 1YIJP 2Z44A 1A43A 3CCLP 3DTJA 1E6JP 3Q20A 4COCA 3M1MA 3DS1A 1K9MQ 3DS0A 4XROA 3DS4A 3G4SP 1A8OA 1EIAA 1QRJA 2KODA 3MGEA 3CCQP 1VQMP 1KQSO 1VQ8P 3G26A 4QNBA 2OTLP 3G28A 4U0EA 4U0CA 1VQKP 3G0VA 2BUOA 4WYMA 4U0FA 3DS2A 4U0AA 4PH1A 2OARA 5HGLA 5BS2A 1Q81Q 1K8AQ 3HYBA 4GR6A 4PH0A 3CCUP 3CC4P 1M74A 3OW2O 1VQ6P 3I55P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z44 A;  3RG6 C;  2PEJ A;  2Z46 A;  3HYB A;  3Q20 A;  4GR2 A;  4GR6 A;  2PEK A;  2PEN A;  2PEI A;  2PEO A;  2PY8 A;  2Z45 A;  5BS1 A;  5BS2 A;  2PEM A;  2PEQ A; 
#chains in the Genus database with same CATH topology
 2GDY A;  4HKG A;  3E2D A;  2KOQ A;  2ONT A;  5DCK A;  2K0Y A;  2QA4 P;  1VQP P;  4U0D A;  2PY8 A;  1M1K Q;  2CNR A;  2K94 A;  2DNW A;  1KLP A;  2FAC A;  2GZG A;  1UJZ A;  1JJ2 O;  5BS1 A;  3G29 A;  2K92 A;  1RO0 A;  1VKU A;  3RG2 A;  2PEJ A;  3GJN A;  1QVF O;  2QEX P;  2AF8 A;  2FVE A;  3G21 A;  1Q7Y Q;  3CE7 A;  3GKL C;  2MR7 A;  2K2Q A;  2LF4 A;  1QVG O;  2Z46 A;  2MVV A;  3NTE A;  4F37 A;  1YIT P;  2M8L A;  5KP8 B;  5HGO A;  1NJI Q;  2Z44 A;  1A43 A;  4COC A;  2KOR A;  3M1M A;  3DS1 A;  2AVA A;  3G4S P;  1A8O A;  1KQS O;  4BPG A;  2XZ1 C;  3G28 A;  2X2B A;  1VQK P;  3G0V A;  2BUO A;  2VLP A;  4U0A A;  4PH1 A;  1M74 A;  1VHN A;  4DG9 A;  1S72 P;  1UNK A;  2MF4 A;  3P05 A;  2EFJ A;  5HVC A;  2VLN A;  1KC8 Q;  3NY7 B;  2FQ1 A;  5EJD A;  3RG6 C;  2QNW A;  1VQ9 P;  2LML A;  2PEK A;  2XT1 A;  2Z45 A;  2DGY A;  2K0X A;  1GPJ A;  2L0Q A;  1Z6M A;  2N5I A;  5KP7 B;  4COP A;  1FR2 A;  1VQ5 P;  2LOL A;  1M6E X;  1T8K A;  2K93 A;  2M8P A;  2GZF A;  1YJ9 P;  2MY5 A;  2P9X A;  2N6Y A;  4XFX A;  5HV8 A;  1ZMB A;  1Q82 Q;  2FAE A;  3G1I A;  2PEQ A;  3G1G A;  1VQO P;  3LMO A;  2MD9 A;  2EIA A;  3CC7 P;  1L0H A;  5KP6 B;  2KGE A;  2JQ4 A;  3CCE P;  4IZ6 A;  2M5R A;  2KGC A;  4IPY A;  4NEO A;  3H47 A;  5CZD B;  3CMA P;  1KD1 Q;  4XFZ A;  1GXG A;  3CCR P;  1YJW P;  1HQB A;  2KG8 A;  3DPH A;  1Q86 Q;  1DNY A;  3DTJ A;  2XZ0 D;  4XRO A;  2N50 A;  2LIU A;  3CCQ P;  2KOD A;  3MGE A;  1VQM P;  1VQ8 P;  3G26 A;  4QNB A;  2LKI A;  2KR5 A;  4PXH B;  4WYM A;  4CA3 A;  1Q81 Q;  1IMP A;  2JGP A;  4PH0 A;  1VQ6 P;  3OW2 O;  1AF8 A;  2K5X A;  3I56 P;  2JB0 A;  3CCS P;  2KW2 A;  1OR5 A;  1YI2 P;  5HGN A;  4H2W C;  2JO0 A;  1IMQ A;  1NQ4 A;  3CCM P;  2CGQ A;  4U0B A;  1D1D A;  1VQL P;  2KGD A;  1RNI A;  4M0I A;  5JPA A;  2K0D X;  1N8R Q;  2GDX A;  3GZM A;  3CPW O;  4QKO A;  2GZJ A;  1AUM A;  1IUQ A;  2KG9 A;  2GZI A;  1YHQ P;  1VQ7 P;  7CEI A;  1M6N A;  1MZ8 A;  2JBG A;  4H2Y C;  2WPT A;  2KOO A;  2PEM A;  4MRT C;  2VLQ A;  3H0D A;  5HGM A;  2ROQ A;  2AFD A;  2N6Z A;  2FAD A;  2PEO A;  2EG5 A;  2FHS C;  2EHT A;  1BAJ A;  5EW5 E;  3CD6 P;  2OTJ P;  2JU2 A;  4GR2 A;  5F2K A;  2MVU A;  2ERH A;  2L9F A;  2BHV A;  2JYG A;  1YIJ P;  3CCL P;  2KG6 A;  1E6J P;  2LPK A;  1K9M Q;  3DS4 A;  2L4B A;  1F80 D;  2GDW A;  3GZL A;  1QRJ A;  2OTL P;  4U0C A;  2EHS A;  4PWV B;  3EJE A;  1X3O A;  3DS2 A;  2OAR A;  5BS2 A;  3CC4 P;  4UHP B;  3I55 P;  2M8N A;  1ZNV A;  3VRL C;  3B4Q A;  2XV6 A;  1BXI A;  2N98 A;  3WBH A;  2LIW A;  2JU1 A;  2LTE A;  1CEI A;  2GZE A;  4BPH A;  3CME P;  1EOQ A;  2E1M A;  2NO8 A;  2PEN A;  2VSQ A;  3G71 P;  3LRY A;  2FQ0 A;  3B5I A;  2CWO A;  3G6E P;  1VQN P;  3CXC O;  5I4T G;  2KOS A;  2PNG A;  1M90 Q;  2XXM A;  2FQ2 A;  1GXH A;  3DS3 A;  2JAZ A;  5F2N A;  2L6E A;  1K30 A;  5F2O A;  1K73 Q;  3H4E A;  2KWL A;  3EJB A;  1DV5 A;  2JYL A;  4R0M A;  2GYK A;  3CCJ P;  1E0H A;  2KOP A;  1L0I A;  1YJN P;  4H2X C;  3HZQ A;  3CC2 P;  3DS5 A;  4XFY A;  1VQ4 P;  1HY8 A;  2FVA A;  3CCV P;  1RO2 A;  2PEI A;  1ACP A;  2AFE A;  2L22 A;  1W2B O;  4XRQ A;  3Q20 A;  2LL8 A;  3EJD A;  2VLO A;  3DS0 A;  2CG5 B;  1EIA A;  1EMV A;  2KGA A;  4U0E A;  2MR8 A;  4U0F A;  3U43 A;  5HGL A;  1K8A Q;  3HYB A;  4GR6 A;  3CCU P;  1AYI A;  4BPF A;  2N5H A;  2FVF A;  2CQ8 A; 
#chains in the Genus database with same CATH homology
 3I56 P;  2M8N A;  3VRL C;  3E2D A;  3CCS P;  2ONT A;  2XV6 A;  1S72 P;  5DCK A;  1YI2 P;  5HGN A;  3WBH A;  3P05 A;  2EFJ A;  2QA4 P;  1VQP P;  2JO0 A;  4U0D A;  2PY8 A;  1M1K Q;  3CCM P;  1KC8 Q;  4U0B A;  3RG6 C;  3CME P;  1D1D A;  1EOQ A;  2E1M A;  1VQ9 P;  1VQL P;  2PEK A;  2PEN A;  2XT1 A;  1RNI A;  2DGY A;  2Z45 A;  3G71 P;  4M0I A;  5BS1 A;  3LRY A;  1JJ2 O;  3G29 A;  3B5I A;  2CWO A;  5JPA A;  4COP A;  3G6E P;  1VQN P;  3CXC O;  1N8R Q;  1RO0 A;  5I4T G;  1VQ5 P;  1M90 Q;  2XXM A;  1M6E X;  2PEJ A;  3CPW O;  1QVF O;  2QEX P;  1AUM A;  3DS3 A;  3G21 A;  1Q7Y Q;  2M8P A;  5F2N A;  1IUQ A;  1YJ9 P;  2P9X A;  4XFX A;  2L6E A;  1K30 A;  5F2O A;  1K73 Q;  3H4E A;  1ZMB A;  1Q82 Q;  2LF4 A;  1QVG O;  3G1I A;  2PEQ A;  3G1G A;  2JYL A;  1YHQ P;  1VQ7 P;  1VQO P;  3CCJ P;  1M6N A;  2Z46 A;  2EIA A;  3CC7 P;  2PEM A;  3NTE A;  3H0D A;  5HGM A;  1YJN P;  1YIT P;  2M8L A;  3CCE P;  2PEO A;  3HZQ A;  2EG5 A;  4IPY A;  3CC2 P;  3DS5 A;  1BAJ A;  3H47 A;  4XFY A;  5HGO A;  3CMA P;  1VQ4 P;  3CD6 P;  1KD1 Q;  4XFZ A;  2OTJ P;  4GR2 A;  5F2K A;  1NJI Q;  3CCR P;  1YJW P;  3CCV P;  1RO2 A;  2PEI A;  1W2B O;  2BHV A;  3DPH A;  2JYG A;  4XRQ A;  1Q86 Q;  1YIJ P;  2Z44 A;  1A43 A;  3CCL P;  3DTJ A;  1E6J P;  3Q20 A;  4COC A;  3M1M A;  3DS1 A;  1K9M Q;  3DS0 A;  4XRO A;  3DS4 A;  3G4S P;  1A8O A;  1EIA A;  1QRJ A;  2KOD A;  3MGE A;  3CCQ P;  1VQM P;  1KQS O;  1VQ8 P;  3G26 A;  4QNB A;  2OTL P;  3G28 A;  4U0E A;  4U0C A;  1VQK P;  3G0V A;  2BUO A;  4WYM A;  4U0F A;  3DS2 A;  4U0A A;  4PH1 A;  2OAR A;  5HGL A;  5BS2 A;  1Q81 Q;  1K8A Q;  3HYB A;  4GR6 A;  4PH0 A;  3CCU P;  3CC4 P;  1M74 A;  3OW2 O;  1VQ6 P;  3I55 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...