2PEJA

Crystal structure of rbcx point mutant y17a/y20l
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
109
structure length
109
Chain Sequence
FKKVAKETAITLQSALTLQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 43
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pejA00
4GR6A 2PEOA 2PEJA 3HYBA 5BS2A 2PEKA 4GR2A 2PY8A 2PENA 2Z45A 2PEIA 2Z46A 5BS1A 2Z44A 2PEMA 3Q20A 2PEQA 3RG6C
chains in the Genus database with same CATH superfamily
3CCQP 3GZMA 3EJDA 2JQ4A 4H2WC 3G71P 2N6ZA 5CZDB 3I55P 3DS0A 1K8AQ 2GZFA 3NY7B 2L9FA 2PEJA 1S72P 2FHSC 2L4BA 2MY5A 1VQKP 2EIAA 2GYKA 2MR7A 1KD1Q 3CCLP 2Z44A 1VQ8P 2N98A 1IUQA 2JU2A 5DCKA 3CCRP 1BAJA 3OW2O 2CQ8A 5F2NA 3DS2A 1VQNP 4U0EA 2VSQA 2JGPA 2QEXP 1X3OA 1YITP 3B5IA 3CE7A 1BXIA 4IZ6A 2MD9A 4PH0A 1Q82Q 2M8NA 2QNWA 4HKGA 1F80D 7CEIA 4QNBA 1KC8Q 3DS1A 5HGLA 1VHNA 5EJDA 2KGAA 4M0IA 2LL8A 2M8LA 1OR5A 3CC4P 2L6EA 2LF4A 2BUOA 5HGOA 4PXHB 2DGYA 3MGEA 2E1MA 1YHQP 1IMPA 5BS2A 3VRLC 1KLPA 2KODA 4H2YC 3B4QA 2FACA 3G1IA 2LTEA 1M6NA 1A43A 4U0BA 4R0MA 1DV5A 2K0YA 2MR8A 1T8KA 3RG6C 1VQMP 2LMLA 1QVFO 2L22A 2ROQA 3CCJP 2Z46A 3G28A 2KOQA 3M1MA 2EHTA 3CCMP 2K94A 2N50A 2JAZA 4XROA 4PWVB 2N5IA 2AFDA 3G21A 2OTJP 3CXCO 1K9MQ 2MVVA 2KW2A 4NEOA 5KP6B 2LKIA 3HZQA 1ZMBA 2GZEA 2FVAA 1EMVA 5F2KA 3CC2P 1Q86Q 1QRJA 2FQ2A 3DS5A 1IMQA 1AYIA 2K2QA 3LRYA 3H0DA 3DS4A 1N8RQ 2EFJA 1GXHA 1Q7YQ 4XFZA 5EW5E 4XRQA 2JYGA 2PY8A 4UHPB 3G0VA 2PEMA 1W2BO 3G6EP 1M74A 1YI2P 1UNKA 2XZ1C 2CWOA 2ONTA 2JYLA 2XT1A 1UJZA 2EG5A 4IPYA 5KP8B 4H2XC 2JB0A 3E2DA 2ERHA 5I4TG 1YJ9P 3HYBA 4XFXA 5F2OA 2KWLA 1GPJA 1MZ8A 1ZNVA 1M1KQ 3G1GA 1ACPA 4BPHA 2AFEA 2XZ0D 1VQ5P 1VQ9P 5HVCA 2EHSA 2PNGA 2NO8A 1K30A 1GXGA 1VQ4P 1EIAA 1VQOP 4BPFA 1AF8A 2OTLP 2GDYA 3CC7P 3EJEA 1L0HA 2PEIA 2VLPA 1Q81Q 4COCA 5KP7B 2PEQA 5HV8A 3I56P 1E0HA 2AVAA 2K0XA 3P05A 5BS1A 1VQ6P 3NTEA 3CMAP 3WBHA 2KOSA 1HQBA 2GZIA 1RO0A 1K73Q 3DS3A 3GZLA 2GDWA 2K92A 2GZJA 2LPKA 3RG2A 1RO2A 2CNRA 1D1DA 2P9XA 3CD6P 3CMEP 3DTJA 1NJIQ 2FVFA 1VQLP 3CPWO 2K0DX 2CGQA 4CA3A 1E6JP 2KGDA 2Z45A 2VLQA 2JBGA 2FQ1A 3CCUP 2KOPA 1QVGO 2WPTA 1YIJP 1L0IA 3U43A 3G26A 4DG9A 2PEKA 3H47A 3CCSP 2L0QA 2GZGA 4COPA 2VLNA 1VQ7P 4GR6A 1Z6MA 4PH1A 4U0FA 2PEOA 4GR2A 1VQPP 2KGEA 2KG6A 4MRTC 2KGCA 2LIWA 2FVEA 2XXMA 3G4SP 1EOQA 3EJBA 2KOOA 2FADA 4U0AA 1NQ4A 2PENA 2FAEA 4U0DA 2LOLA 1AUMA 1KQSO 2JU1A 2OARA 1M90Q 5HGMA 1YJNP 2LIUA 2X2BA 3GJNA 4F37A 4XFYA 2GDXA 5HGNA 3CCEP 1HY8A 2MVUA 2M8PA 2K5XA 2DNWA 4BPGA 1YJWP 4WYMA 2KR5A 1VKUA 3G29A 2JO0A 1FR2A 2AF8A 1A8OA 4U0CA 2CG5B 1M6EX 2QA4P 2XV6A 3GKLC 2K93A 2KG9A 3DPHA 2BHVA 1CEIA 3CCVP 1JJ2O 2KORA 3LMOA 2VLOA 2M5RA 1DNYA 2MF4A 2FQ0A 3H4EA 2N5HA 4QKOA 2N6YA 2KG8A 5JPAA 3Q20A 1RNIA
chains in the Genus database with same CATH topology
1M6NA 1A43A 4U0BA 3CCQP 4PH1A 3RG6C 1M1KQ 1VQMP 3G1GA 1QVFO 3CCJP 3G71P 2Z46A 3G28A 4U0FA 1VQ9P 1VQ5P 3M1MA 3I55P 3DS0A 1K8AQ 2PEOA 3CCMP 4GR2A 1VQPP 1S72P 2PEJA 1K30A 4XROA 1VQ4P 1VQKP 3G21A 2EIAA 1EIAA 2OTJP 3CXCO 1VQOP 1K9MQ 2XXMA 1KD1Q 2OTLP 3G4SP 3CCLP 1EOQA 2Z44A 3HZQA 1ZMBA 1VQ8P 3CC7P 4U0AA 2PENA 1IUQA 2PEIA 4U0DA 1Q81Q 1AUMA 4COCA 5DCKA 5F2KA 1KQSO 3CC2P 3CCRP 1BAJA 2PEQA 3OW2O 5F2NA 1Q86Q 2OARA 1QRJA 3DS5A 3I56P 1M90Q 3DS2A 5HGMA 1YJNP 3P05A 5BS1A 1VQNP 3LRYA 4U0EA 1VQ6P 3NTEA 3WBHA 3H0DA 3DS4A 2QEXP 3CMAP 1N8RQ 2EFJA 1YITP 1RO0A 3B5IA 1Q7YQ 1K73Q 4XFYA 3DS3A 5HGNA 4PH0A 1Q82Q 4XFZA 3CCEP 2M8NA 1RO2A 2M8PA 4XRQA 2JYGA 1D1DA 1YJWP 4WYMA 2P9XA 2PY8A 3G0VA 3CD6P 2PEMA 3CMEP 3DTJA 3G29A 3G6EP 1W2BO 1M74A 1NJIQ 1YI2P 4QNBA 1VQLP 2JO0A 3CPWO 1A8OA 2CWOA 4U0CA 3DS1A 2ONTA 1KC8Q 2XT1A 2JYLA 1M6EX 5HGLA 2EG5A 2QA4P 4M0IA 1E6JP 2Z45A 2XV6A 4IPYA 2M8LA 3CC4P 2L6EA 2LF4A 3CCUP 2BUOA 3DPHA 5HGOA 1QVGO 2DGYA 2BHVA 3MGEA 2E1MA 3E2DA 1YHQP 3CCVP 1YIJP 3G26A 5BS2A 2PEKA 3H47A 3CCSP 1JJ2O 3VRLC 5I4TG 1YJ9P 2KODA 3HYBA 4COPA 4XFXA 5F2OA 3H4EA 1VQ7P 3G1IA 5JPAA 3Q20A 1RNIA 4GR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR6 A;  2PEO A;  2PEJ A;  3HYB A;  5BS2 A;  2PEK A;  4GR2 A;  2PY8 A;  2PEN A;  2Z45 A;  2PEI A;  2Z46 A;  5BS1 A;  2Z44 A;  2PEM A;  3Q20 A;  2PEQ A;  3RG6 C; 
#chains in the Genus database with same CATH topology
 3CCQ P;  3GZM A;  3EJD A;  2JQ4 A;  4H2W C;  3G71 P;  2N6Z A;  5CZD B;  3I55 P;  3DS0 A;  1K8A Q;  2GZF A;  3NY7 B;  2L9F A;  2PEJ A;  1S72 P;  2FHS C;  2L4B A;  2MY5 A;  1VQK P;  2EIA A;  2GYK A;  2MR7 A;  1KD1 Q;  3CCL P;  2Z44 A;  1VQ8 P;  2N98 A;  1IUQ A;  2JU2 A;  5DCK A;  3CCR P;  1BAJ A;  3OW2 O;  2CQ8 A;  5F2N A;  3DS2 A;  1VQN P;  4U0E A;  2VSQ A;  2JGP A;  2QEX P;  1X3O A;  1YIT P;  3B5I A;  3CE7 A;  1BXI A;  4IZ6 A;  2MD9 A;  4PH0 A;  1Q82 Q;  2M8N A;  2QNW A;  4HKG A;  1F80 D;  7CEI A;  4QNB A;  1KC8 Q;  3DS1 A;  5HGL A;  1VHN A;  5EJD A;  2KGA A;  4M0I A;  2LL8 A;  2M8L A;  1OR5 A;  3CC4 P;  2L6E A;  2LF4 A;  2BUO A;  5HGO A;  4PXH B;  2DGY A;  3MGE A;  2E1M A;  1YHQ P;  1IMP A;  5BS2 A;  3VRL C;  1KLP A;  2KOD A;  4H2Y C;  3B4Q A;  2FAC A;  3G1I A;  2LTE A;  1M6N A;  1A43 A;  4U0B A;  4R0M A;  1DV5 A;  2K0Y A;  2MR8 A;  1T8K A;  3RG6 C;  1VQM P;  2LML A;  1QVF O;  2L22 A;  2ROQ A;  3CCJ P;  2Z46 A;  3G28 A;  2KOQ A;  3M1M A;  2EHT A;  3CCM P;  2K94 A;  2N50 A;  2JAZ A;  4XRO A;  4PWV B;  2N5I A;  2AFD A;  3G21 A;  2OTJ P;  3CXC O;  1K9M Q;  2MVV A;  2KW2 A;  4NEO A;  5KP6 B;  2LKI A;  3HZQ A;  1ZMB A;  2GZE A;  2FVA A;  1EMV A;  5F2K A;  3CC2 P;  1Q86 Q;  1QRJ A;  2FQ2 A;  3DS5 A;  1IMQ A;  1AYI A;  2K2Q A;  3LRY A;  3H0D A;  3DS4 A;  1N8R Q;  2EFJ A;  1GXH A;  1Q7Y Q;  4XFZ A;  5EW5 E;  4XRQ A;  2JYG A;  2PY8 A;  4UHP B;  3G0V A;  2PEM A;  1W2B O;  3G6E P;  1M74 A;  1YI2 P;  1UNK A;  2XZ1 C;  2CWO A;  2ONT A;  2JYL A;  2XT1 A;  1UJZ A;  2EG5 A;  4IPY A;  5KP8 B;  4H2X C;  2JB0 A;  3E2D A;  2ERH A;  5I4T G;  1YJ9 P;  3HYB A;  4XFX A;  5F2O A;  2KWL A;  1GPJ A;  1MZ8 A;  1ZNV A;  1M1K Q;  3G1G A;  1ACP A;  4BPH A;  2AFE A;  2XZ0 D;  1VQ5 P;  1VQ9 P;  5HVC A;  2EHS A;  2PNG A;  2NO8 A;  1K30 A;  1GXG A;  1VQ4 P;  1EIA A;  1VQO P;  4BPF A;  1AF8 A;  2OTL P;  2GDY A;  3CC7 P;  3EJE A;  1L0H A;  2PEI A;  2VLP A;  1Q81 Q;  4COC A;  5KP7 B;  2PEQ A;  5HV8 A;  3I56 P;  1E0H A;  2AVA A;  2K0X A;  3P05 A;  5BS1 A;  1VQ6 P;  3NTE A;  3CMA P;  3WBH A;  2KOS A;  1HQB A;  2GZI A;  1RO0 A;  1K73 Q;  3DS3 A;  3GZL A;  2GDW A;  2K92 A;  2GZJ A;  2LPK A;  3RG2 A;  1RO2 A;  2CNR A;  1D1D A;  2P9X A;  3CD6 P;  3CME P;  3DTJ A;  1NJI Q;  2FVF A;  1VQL P;  3CPW O;  2K0D X;  2CGQ A;  4CA3 A;  1E6J P;  2KGD A;  2Z45 A;  2VLQ A;  2JBG A;  2FQ1 A;  3CCU P;  2KOP A;  1QVG O;  2WPT A;  1YIJ P;  1L0I A;  3U43 A;  3G26 A;  4DG9 A;  2PEK A;  3H47 A;  3CCS P;  2L0Q A;  2GZG A;  4COP A;  2VLN A;  1VQ7 P;  4GR6 A;  1Z6M A;  4PH1 A;  4U0F A;  2PEO A;  4GR2 A;  1VQP P;  2KGE A;  2KG6 A;  4MRT C;  2KGC A;  2LIW A;  2FVE A;  2XXM A;  3G4S P;  1EOQ A;  3EJB A;  2KOO A;  2FAD A;  4U0A A;  1NQ4 A;  2PEN A;  2FAE A;  4U0D A;  2LOL A;  1AUM A;  1KQS O;  2JU1 A;  2OAR A;  1M90 Q;  5HGM A;  1YJN P;  2LIU A;  2X2B A;  3GJN A;  4F37 A;  4XFY A;  2GDX A;  5HGN A;  3CCE P;  1HY8 A;  2MVU A;  2M8P A;  2K5X A;  2DNW A;  4BPG A;  1YJW P;  4WYM A;  2KR5 A;  1VKU A;  3G29 A;  2JO0 A;  1FR2 A;  2AF8 A;  1A8O A;  4U0C A;  2CG5 B;  1M6E X;  2QA4 P;  2XV6 A;  3GKL C;  2K93 A;  2KG9 A;  3DPH A;  2BHV A;  1CEI A;  3CCV P;  1JJ2 O;  2KOR A;  3LMO A;  2VLO A;  2M5R A;  1DNY A;  2MF4 A;  2FQ0 A;  3H4E A;  2N5H A;  4QKO A;  2N6Y A;  2KG8 A;  5JPA A;  3Q20 A;  1RNI A; 
#chains in the Genus database with same CATH homology
 1M6N A;  1A43 A;  4U0B A;  3CCQ P;  4PH1 A;  3RG6 C;  1M1K Q;  1VQM P;  3G1G A;  1QVF O;  3CCJ P;  3G71 P;  2Z46 A;  3G28 A;  4U0F A;  1VQ9 P;  1VQ5 P;  3M1M A;  3I55 P;  3DS0 A;  1K8A Q;  2PEO A;  3CCM P;  4GR2 A;  1VQP P;  1S72 P;  2PEJ A;  1K30 A;  4XRO A;  1VQ4 P;  1VQK P;  3G21 A;  2EIA A;  1EIA A;  2OTJ P;  3CXC O;  1VQO P;  1K9M Q;  2XXM A;  1KD1 Q;  2OTL P;  3G4S P;  3CCL P;  1EOQ A;  2Z44 A;  3HZQ A;  1ZMB A;  1VQ8 P;  3CC7 P;  4U0A A;  2PEN A;  1IUQ A;  2PEI A;  4U0D A;  1Q81 Q;  1AUM A;  4COC A;  5DCK A;  5F2K A;  1KQS O;  3CC2 P;  3CCR P;  1BAJ A;  2PEQ A;  3OW2 O;  5F2N A;  1Q86 Q;  2OAR A;  1QRJ A;  3DS5 A;  3I56 P;  1M90 Q;  3DS2 A;  5HGM A;  1YJN P;  3P05 A;  5BS1 A;  1VQN P;  3LRY A;  4U0E A;  1VQ6 P;  3NTE A;  3WBH A;  3H0D A;  3DS4 A;  2QEX P;  3CMA P;  1N8R Q;  2EFJ A;  1YIT P;  1RO0 A;  3B5I A;  1Q7Y Q;  1K73 Q;  4XFY A;  3DS3 A;  5HGN A;  4PH0 A;  1Q82 Q;  4XFZ A;  3CCE P;  2M8N A;  1RO2 A;  2M8P A;  4XRQ A;  2JYG A;  1D1D A;  1YJW P;  4WYM A;  2P9X A;  2PY8 A;  3G0V A;  3CD6 P;  2PEM A;  3CME P;  3DTJ A;  3G29 A;  3G6E P;  1W2B O;  1M74 A;  1NJI Q;  1YI2 P;  4QNB A;  1VQL P;  2JO0 A;  3CPW O;  1A8O A;  2CWO A;  4U0C A;  3DS1 A;  2ONT A;  1KC8 Q;  2XT1 A;  2JYL A;  1M6E X;  5HGL A;  2EG5 A;  2QA4 P;  4M0I A;  1E6J P;  2Z45 A;  2XV6 A;  4IPY A;  2M8L A;  3CC4 P;  2L6E A;  2LF4 A;  3CCU P;  2BUO A;  3DPH A;  5HGO A;  1QVG O;  2DGY A;  2BHV A;  3MGE A;  2E1M A;  3E2D A;  1YHQ P;  3CCV P;  1YIJ P;  3G26 A;  5BS2 A;  2PEK A;  3H47 A;  3CCS P;  1JJ2 O;  3VRL C;  5I4T G;  1YJ9 P;  2KOD A;  3HYB A;  4COP A;  4XFX A;  5F2O A;  3H4E A;  1VQ7 P;  3G1I A;  5JPA A;  3Q20 A;  1RNI A;  4GR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...