1KC8Q

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kc8Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kc8Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kc8Q03
3I55P 1YJWP 1VQ8P 1YI2P 3CCEP 3CPWO 3CCMP 1Q81Q 1M90Q 1YHQP 1QVGO 2OTLP 1YJNP 1Q7YQ 1K73Q 3CCRP 1VQ4P 3CMEP 1YIJP 1YJ9P 1N8RQ 1KC8Q 1VQ9P 3OW2O 3CC7P 3CMAP 1VQMP 1S72P 3CCSP 1KD1Q 3I56P 1VQ6P 1Q82Q 3G6EP 1VQLP 1VQNP 1YITP 1KQSO 3CCJP 3CCQP 2QEXP 1VQ7P 1QVFO 1NJIQ 1K8AQ 1M1KQ 2OTJP 3G4SP 3CC4P 3CCLP 3CD6P 3CXCO 1VQPP 1VQ5P 1VQOP 1VQKP 1Q86Q 3G71P 1W2BO 1K9MQ 3CCUP 3CCVP 1JJ2O 3CC2P 2QA4P
chains in the Genus database with same CATH superfamily
1KYOD 4XFXA 2JDIH 1LT9A 3SSUA 1A02F 3EQ2A 1D7MA 1BXIA 3O6QA 1JY3O 3H32A 3VMXA 4MRTC 3RBXA 1IFDA 1ZR4A 4COPA 2JU2A 2FYUD 2GDXA 2QEXP 5AVXB 2BQ1E 3CLQA 2LOLA 3WU2H 2AFEA 3B5NA 4YTPC 3M9BA 2P1JA 3VYIA 1CI6A 2PP6A 3DS4A 3H1KG 1YJ9P 3H1KE 2JB0A 2C9LY 2PFXA 1OMIA 1KQSO 2ZT9B 4C7NB 4WYMA 3V2RA 1FE6A 1AA0A 1L0HA 1PGOA 5M1BA 2KGEA 1JOCA 2FHSC 5APQA 2N5IA 3GF3A 2PEQA 2C9NY 2W27A 5CCHA 2E74D 1URQA 4IPYA 3HD7C 3BCCD 1PPJG 1PPJE 4UB8E 2K88A 2Q3EA 2FYUE 4A7PA 1SFCD 3OA7A 3AE8C 1EC5A 1QGKB 1EZVD 1IJDB 2M5AA 1H88A 1U57A 3CC2P 3I55P 2V7QH 1Z6MA 1YTZT 1SQBJ 3L73D 5KTBA 5BU8B 5JPAA 3V2QA 1L4AB 4YXWH 1LGHB 2WVRA 2YO3A 2KOOA 4PV1B 1IMQA 3TNUB 1P84D 2L91A 3AEGC 1GW4A 3B4QA 2DNWA 2O01J 1VF5C 1FZCB 1USEA 2RMZA 1JY2N 5CCGD 4OGQC 1DD3A 3RK2D 2L4BA 1SQPK 1ZMBA 1SQPJ 1JUNA 2IFMA 5KAIE 4PH1A 1SQXK 1SQXJ 3WMM0 4PXHB 1FDOA 4XROA 1N73A 4H44D 2Z44A 3JCUH 2JAZA 2M8RA 1J2JB 4DT0A 4OGQB 2JJLA 3CX5H 2KOGA 4JQ0D 4TT3H 1YQ3C 1BGYG 1BGYE 2W6AA 5F2OA 3VN0A 1D1DA 2WTYA 4IOIH 1MZ8A 3L72G 3L72E 4GKGA 5AVZB 5C39A 2J59M 1LT1A 2WPRA 4WWIA 2IZ1A 1N7LA 3KPEA 2L9FA 1ZXGA 1MV8A 4L73A 2FKWB 3H1JD 3CPWO 1HGVA 1G2CB 3KZIE 5KP8B 2M5RA 1UNKA 1GK4A 3C1LA 1SVFA 5E79H 5B5EE 2GZFA 2OYIC 1FJKA 4GOEA 4OH8B 1DD4A 2K92A 4L75A 3M0AA 4IZ6A 5H2FE 2M8PA 2JWDA 4RJTA 1NTZG 5KLVJ 1NTZE 1NAYA 2N9BA 3H1LD 3E1RA 3CMAP 2XNXA 2N50A 2LTEA 4HH2A 1M74A 4I7ZC 1M6NA 2OTJP 4H2WC 2WMMA 2WWWA 4IL6E 2FAEA 3M9QA 2KS1A 4MN4C 2FXPA 1MFZA 2LF4A 4NPDA 3H25A 3W68A 3P32A 3CCSP 1Y9BA 2FADA 1Y8AA 1SQQK 1A43A 1SQQJ 1E79H 1MFTA 2QM7A 1KYOI 1M7LA 1RHZB 3DS5A 1T6AA 1NTKJ 2KG8A 1NKZB 3VMAA 2PEOA 1L0LD 3CWBD 3KZIH 2E76C 3O8ZA 7CEIA 1EXIA 1LTJC 3L35A 5BU5A 4C7NA 1M56D 1OWAA 1GL2B 2FYZA 1CEIA 1JCCA 1HJ0A 5H2FH 2M3BA 5K5GB 2B88A 1KZUB 4BPFA 3NMDA 1KC8Q 4R4LA 2K0DX 1VL2A 1FOSE 3H47A 1JY2O 4N78D 4WB4A 1RY3A 1KTMA 1FZBA 2EHSA 4PH0A 1IFMA 1ZN5A 2V4HA 2R32A 1OVRA 1AV1A 2N9YB 3L74G 3L74E 1KILC 2C0WA 1L4AA 3L70D 2KWLA 2E42A 1S72P 3TNUA 1RE4A 1FBMA 1J1EC 1FZCA 2WITA 3IAOA 4K35A 2JYLA 2R3CA 2GZIA 2PEJA 5APTA 3RGUA 3Q20A 1P84I 3CL3D 4ASWA 4AYCA 2CNRA 1FR2A 3HE5B 2KGDA 3G3ZA 4U0FA 2EHTA 2HLOA 4RESB 2WPVB 3E7KA 1WT6A 4H0LB 2ZYDA 5CHXA 3ZDMA 1L2PA 3IFMA 2YKOA 1NHLA 1KB9E 5APYA 4CPGA 4D6TJ 5KP6B 3CC7P 5KJ7D 1K30A 2PRRA 2A06G 3QH9A 2A06E 2KI7B 2KB7P 4GOFA 4IFFA 2KORA 4F37A 2N1TB 3II6A 2M8NA 1SLQA 1YQ4C 5AW6B 2QJPC 1UIIA 2I1JA 1PV3A 2CQ8A 3VP9A 1NU1J 1A8OA 2OTLP 1CI6B 1EDJA 1GMJA 1G2CA 5TJHA 4XFZA 1RQUA 1BDCA 1MZ9A 2ZFCA 2ZVOB 1FDMA 1R5SA 3PHLA 2D2CB 1NTZK 2PY8A 1HJBA 2ONTA 4H13B 1LTAC 3MUDC 1ZNVA 1SQPD 1ZRTE 2IDBA 2QM8A 3OJAB 2KGAA 1KFNA 1DEBA 3H1HD 2YKQA 2OYIA 1EQ7A 1SQXD 2KOSA 5AVRB 5KKZC 2XNDH 2M5AB 1BE3J 1G1IA 2CPSA 2KR5A 4XA4A 2NPSB 1SQBG 1SQBE 4M3LA 3VMYA 2WPQA 1FC2C 1GU5A 2K9JB 4WY4D 3L75D 1S3JA 5KP7B 2E75B 4GODA 5AW0B 3PTZA 1UIXA 2E43A 2BEZF 2P9XA 3CXHI 1DH3A 4U3FJ 2K37A 1VQ6P 5AVUB 2CWOA 2HYNA 2O01N 2K94A 4R4MA 1OW6A 3Q5RA 1FJPA 3PLNA 4K3AA 2ZJSE 3V2NA 2IBZD 1E6JP 4EIJA 2MJZA 2JR8A 5KAFE 2E74C 4RO0A 1H8AA 2AEJA 1DV5A 3MZWB 4OWFA 1RF0C 2KLUA 5BVZA 4OVNF 4JF7A 1SFCC 3AE2C 3B5ND 3RK3D 2H89C 1WMKA 2GM4A 2JYGA 4KHXA 1T3JA 4PD4E 1G1JA 1X8YA 5CBOA 1PIXA 1Q82Q 3JSVC 2FFDB 1LTSC 3KYQA 2O01H 5CCGC 1EDKA 3AE9C 1T8ZA 3EWKA 2L22A 2MR7A 3MGNA 3RK2C 2KNCB 3GKLC 5KLVG 1KFMA 2GZJA 5KLVE 1BSHA 1KILA 3WBHA 1URQD 3FX0A 3AECC 1VHNA 2W8ZA 1N7SB 3H1KD 1X0TA 3OAKA 4H44C 2JO0A 2P7JA 2YMKA 4U0BA 2K1AA 3RK2B 1HWTC 3LIEA 1L0NJ 3G1IA 1SQVG 1SQVE 2KS1B 4HYTB 2QJKB 3MD0A 2KZIA 1PZQA 2IPPA 1VQ4P 4GT1A 2MKVA 1M1JB 3DPHA 4H44B 2Y9YA 1FZAA 4GR6A 1PPJD 1TU3F 2KG9A 4KJMA 1SQQG 1SQQE 1S5LE 2N1TA 4ZNCA 1NTKG 1NTKE 3G21A 2WQYC 3RL0D 5HV8A 1AVYA 4PD4H 3CCRP 1XTCC 2KW2A 1VQ9P 1OVVA 5AW3B 1U7MA 1AUMA 1MUUA 2GUVA 3GW6A 3L36A 3G9RA 1JJ2O 4HKGA 1JNMA 2Z5IA 3AEEC 2FQ2A 3OW2O 2WSCJ 2N6ZA 3M1MA 3RG2A 1SS1A 1T3UA 2FVFA 4GR2A 4TLFA 3C9IA 4H2XC 1SQBK 1BGYD 3MUDA 4GDOA 3HD7B 1OVUA 2NPSA 2BCCG 2BCCE 5KLIC 3LW5J 1YITP 2YKPA 3L72D 4U0EA 2K9JA 3B8EB 1QL2A 1JMMA 1NTMJ 4U7JA 1T8KA 1S5LH 1SP4A 2KSEA 1QVGO 1PL5A 3DTJA 2AVAA 1ZOYC 2RH0A 5AW8B 3NFQA 1NVOA 2WSFJ 3SFEC 1VF5B 2Y0EA 3GHGC 2HR3A 4YPCA 2YMYA 1W2BO 4NPFX 3AE4C 1H0TB 4DJGA 1NTZD 2XDJA 1AQTA 2MF4A 1FDIA 4D6TG 4D6TE 1ACPA 2LMLA 3GMAA 2ROQA 4UB8H 3T97A 3AEAC 2Y0DA 1PP9J 5CBNA 1YJNP 2MVUA 3LMOA 1NU1G 4LC1A 1NU1E 2LIWA 2FVAA 3GZLA 1RF0A 2ZT9D 1NH4A 3PJSK 3CE7A 2FFDA 1SFCA 3U43A 2GZEA 1E5WA 3RBZA 5KLVK 3P8CD 2RN0A 4AQRD 2KNCA 1FOSF 1IZNB 2KOQA 2XZ1C 3H1IJ 5KAIH 1EDLA 1N7SA 2OYIB 3CCJP 1S9KE 3GLMA 4UB6E 1SQVK 1SQVJ 3HRNA 1HTLC 3FWLA 1BE3G 1BE3E 3U59A 1Q7YQ 1L4AD 2MVVA 5DCKA 4PV1D 5KJ7C 4BPHA 1M1JA 2PENA 1LNQA 5APVA 4I7ZB 3CX5I 2VSQA 5GTHE 1K05A 2J5UA 1NTKK 3P8CE 1X9VA 5AVWB 1KQLA 3E1IA 5HGMA 2K0XA 1RF1C 3VMZA 2WSSH 1J1DC 3L74D 3PH0A 4U3FG 4U3FE 4ZMDA 5B5EH 2QSIA 1QL1A 1BCCJ 4OGQD 3TF5A 2QIWA 3CC4P 2ZAEB 2FACA 2R44A 4ZKUA 4JPZB 3TDKA 2W83C 2E76B 1LTGC 3V4QA 1LTJB 3MGEA 1GK6A 2AFDA 4LGDE 3GF7A 3Q1MA 1AF8A 3V2PA 2JGPA 3S9OA 3DS0A 2C0XA 3CCVP 4IL6H 1KQGB 3HYBA 2GA1A 5GTIE 2KUBA 1RE3C 3AE3C 1VPCA 2YIUC 5BS2A 5AW4B 1KB9D 4Z1MH 4WBAA 2BCCJ 3HD7A 2OYOA 3A7OA 1X3OA 1AJYA 2GDYA 1KD1Q 3CXHE 1EZVI 4XFYA 2A06D 4I1LA 1Y47A 4WY4C 2HODA 2Q9IA 5GTHH 3FXDA 1FZEA 2O1JA 2VLPA 4BPGA 2QVAA 2OYHC 1KILB 1PGJA 2HG5D 2KP8A 2SPZA 1NWQA 2PEKA 1J1EB 2N5HA 2Z46A 1BDDA 3M0DC 4KT0J 4N6JA 3CXCO 1L0NG 1L0NE 3BCCJ 2LIUA 3CCMP 1LT9C 1H0TA 3GZMA 3KHUA 1FZGA 2HPCA 1ZRTD 2EFJA 2KXPB 3I5CA 1LP1B 3L73J 2ITAA 3HZQA 3GG2A 2BASA 1AYIA 5B66E 5AW7B 2GDWA 2R5BA 5GTIH 1NU1K 4N3YB 1K73Q 1OW7A 2QE7H 3LRYA 2EIAA 1SQBD 3Q2YA 3CXHH 3MHVA 1S2EA 1GL2D 1HQBA 2PEIA 1AQ5A 4CA3A 2IYOA 2QJPB 2OGUA 1L0IA 2QJYC 4I2LC 2JEEA 3WUUA 1USDA 2KIKA 2ZYGA 1JMBA 1KN7A 1URQC 3Q3DA 1LTIC 2FYNC 1DNYA 2K2QA 3HUSC 3B71A 1OR5A 1W5CE 1UJZA 5APXA 1KB9H 2LXBA 3HUSB 1GZLA 1EXJA 5KKZB 3P7KA 3VTPC 1K9MQ 1NTMG 1NTME 2PEMA 4H2YC 3FGAD 1Q90D 3A0HE 2FQ1A 3RL0C 2YXQB 1PEMA 4PD4D 2M3EA 5KJ7A 2W90A 2Q5UA 3U1AA 3MIWA 1IMPA 4H0LD 1OX3A 1OFCX 1N73C 1LTTC 2UWJE 3CD6P 1PFIA 2PNGA 2JBGA 2XKMA 1NYHA 1RF1A 2EG5A 2I8DA 2OTKE 1EMVA 5KLVD 1LTJA 1N8RQ 2KK7A 3RG6C 2LL8A 3QWOC 2WSCH 3KXDA 2KG6A 2I1KA 2XV5A 2WT7A 3T97B 2N1TD 2VRSA 3L71G 3L71E 1LJ2A 1KILE 2Q1KA 1YI2P 1SQVD 1PP9G 2A45I 1PP9E 5AW1B 2E74B 3BASA 3I56P 3SWFA 3E2DA 2BEQD 3P8MC 1IO4A 2XU6A 3LW5H 4QKOA 1SFCB 3WU2E 2D2CD 1L0LJ 2QG4A 1YYCA 3BVHA 1SQQD 4H13D 3EJBA 2VLOA 3A0HH 1NTKD 5CCHD 3V4WA 1GDTA 3H1IG 1VQNP 3H1IE 5EFWB 1LWUC 1JY3P 2FXOA 2WSFH 1W2EA 2Q6QA 3A0BE 2H88C 1L0NK 2OYHA 3N7NA 3D6ZA 3P05A 3R2PA 1CW5A 2NPSD 5AW5B 2IYPA 1ZW0A 5DJUB 4B86A 3EJEA 5KAFH 2W6JH 3KQGA 3M0DA 5TISE 3M91A 2K3RA 2E75D 4YXDC 1JCDA 3SWKA 1LP1A 2LKIA 4BXLA 3L70J 3TYYA 3CCEP 3AEFC 1T2KD 1PGPA 3H0DA 2JKVA 2NO8A 1N86A 3IF4A 2WSEJ 3VOPA 3Q5PA 2CG5B 2DW3A 4AUWA 2BCCD 3U1CA 3TGUG 3UIAA 3TGUE 4EOTA 1EOQA 2JQ4A 2ZT9C 3B5IA 2YNYA 3G4SP 1KMIZ 1BCCG 1BCCE 2B87B 3BRVB 1QLED 2AF8A 1QX8A 2ERHA 3LIDA 2J58A 3JCUE 2FVEA 5APUA 2LXCB 2OARA 2N6YA 4RKUJ 3CX5E 1GXHA 2O3JA 1VQ5P 3A0BH 1KYOE 3NTEA 2QNWA 1CSBA 4L74A 3PRJA 3NTNA 4PJ0E 3CMEP 3H6PA 2RKLA 1L4AC 5AVYB 2LPKA 3HUSA 5AW2B 4PV1C 1RE4C 2FYUG 4D6TD 2ZXEB 3HTKB 3L4FA 3KDPB 5TISH 4W80A 2HODB 3S1KA 2IZ0A 1FZCC 1JTHB 1IFJA 1NTMK 3D70A 4R0MA 2FY8A 2E5TA 4DZOA 5KLIB 1IUQA 5E79E 1ZLLA 3EFFK 1N7SD 2AXTE 1NU1D 2BUOA 1WRGA 3PP5A 2MD9A 3V5BA 2K93A 2Z45A 3A2AA 2N98A 1NKNA 4PD4I 4LLHA 3BCCG 3H1HJ 3BCCE 2HPCB 2Z5HA 3GHGB 2XZRA 2P2UA 2VLNA 5L8RJ 1EZVG 1EZVE 3L71J 1S9KD 2IBZI 3L73G 1KYOH 3L73E 1NOHA 1HVVA 2DGYA 2L0QA 3M06A 1Q81Q 2KLVA 1DX7A 2WZ7A 3AEBC 1EIAA 1P84E 2YO2A 4PJ0H 1BE3D 3L75J 1S4XA 1FS0E 2MY5A 1EDIA 2G3AA 2H8PD 2XZ0D 3G28A 3ABVC 2W6BA 5I4TG 1RO2A 3WUVA 3R4YA 4XFJA 1OXZA 2K5XA 3CCUP 1NGMB 1GTWA 1X79B 3S4RA 3SFDC 4BWNA 1GD2E 3ITKA 4W7YA 2AXTH 4JYBA 4GIFA 3HE4A 4U3FD 2B9BA 5CCGA 1IC2A 2KGCA 3DS1A 1ZV8A 3AE1C 2KYVA 1RH5B 1M90Q 1AVOA 3HD7D 2IFNA 1NO4A 1F80D 3NY7B 1LWUA 2IX7C 5HVCA 3W67A 3H1JG 2V7QJ 3H1JE 3VRLC 2XXMA 1OW8A 2PGDA 1VQ8P 2WPTA 4ZKPA 1QEXA 1DEEG 3Q5SA 1P84H 2AXCA 4JYCA 3IR9A 4BRYB 5BS1A 3G6EP 3TGUJ 1VF5D 3BRTB 3USSA 2ZXXA 3CXHD 3GJNA 2JO1A 1K8AQ 1JY2P 1GL2C 3CCLP 2AEMA 2B87A 1IFIA 3H1LG 3H1LE 1YBKA 1RF1B 1KLPA 4EI2A 1YJWP 3EFGA 3G0VA 1N2DC 3H1KJ 1J1DB 2L5GB 2FXMA 2ZVNB 3C8VA 4U0DA 2P58A 2O1KA 1KORA 2WT7B 1PEOA 1IFPA 1VQKP 4UB6H 2GUSA 2CPBA 3H4EA 1IK7A 3M9HA 1PEUA 1L0ND 5F2KA 1M8OB 2FYUK 2FYUJ 5CJ0A 1VQLP 1GXGA 1IFNA 4EDFA 3DS3A 1JO5A 2VLQA 1H89A 4U0AA 2L6EA 3HTKA 1S5LX 2B89A 1YTZI 5HGNA 1JTHA 2GZGA 1L0LG 1L0LE 2YIUB 1ZP0C 3CWBE 3CWBG 3G29A 1CZQA 3JC22 1HY8A 1VDFA 3N4XA 4I6MC 2JU1A 5CMZA 1RNIA 4XE5B 1A02J 4H0LC 2H7HA 4XRQA 4EYYQ 4WY4B 3CCQP 3RL0g 2K9YA 1VQOP 3G71P 2OYHB 4M0IA 1R8EA 4QNBA 1GW3A 2MR8A 3NXSA 3CI9A 2A45G 5AW9B 1R5LA 3D6YA 4U0CA 2Y9ZA 3DS2A 4N78E 4QMAA 1XTGB 1PEQA 3GHGA 5AVQB 2G8YA 1GPJA 1VQPP 1BGYJ 2N1TC 1U7JA 1Z56A 3D71A 3B5NC 1PGQA 1LT9B 3IN6A 3RK3C 1Q2NA 2CGQA 3SWYA 3L70G 1ZMEC 3L70E 3L72J 3O6QB 3H32B 1BAJA 3TSIA 1VQ7P 2Q3IA 2XV6A 1FZFA 2KODA 3B5NB 3MTUE 3RK3B 4COCA 2D2CC 3K5BA 3FWNA 2JP3A 3L37A 2QA4P 3G1GA 4H13C 1NTMD 2E76D 3VP8A 4Y99C 1LTBC 5CCHC 1AFOA 2QRXA 3F89A 2K0YA 1M57D 4HB1A 1JY3N 2R5DA 2P67A 4C7RA 2POHA 1JM0A 1NTZJ 2QJYB 2NRGA 1Q86Q 1HBWA 1RO0A 4Y99B 1HH0A 2E1MA 1URQB 4O9BA 2FYNB 2NPSC 2A45H 4W7ZA 1OZHA 3BATA 2M8LA 2M0BA 3H1JJ 2Q7CA 1NQ4A 2X2BA 2E75C 4PWVB 1VKUA 3L71D 5B66H 1M6EX 1KILD 1T2KC 2E5YA 1PP9D 1BSNA 2KSJA 3AE6C 4WVZA 3WUTA 4BRYA 2ZYAA 5CZDB 1JEKA 1OIPA 2WSEH 1MKMA 2PAJA 3AE7C 3H1LJ 2JWAA 1E0HA 5AVVB 5F2NA 2R3SA 3TK1A 3RL0B 1SQPG 1SQPE 3B4SA 5DJTB 5EW5E 3H1HG 3H1HE 1SQXG 1SQXE 1N73B 2NZ2A 3F5HA 3H1ID 2YXRB 1GL2A 2GYKA 4DG9A 4IL6X 2WPSA 2HFED 1ZR2A 1GU4A 1HF9A 2LKMA 5AVTB 3A3YB 1QRJA 2Z4EA 1K04A 1DIPA 2FBWC 3AEDC 4DOJA 4HJGH 3EJDA 5EJDA 3L75G 3L75E 4C46A 4HKZH 4IFMA 2FFDC 4JBZA 3V6IA 1KB9I 1L0LK 2OQQA 4NPEA 3CWBJ 1S1CX 1JB0J 1RE3A 5CJ4A 3L74J 1HGZA 2KZJA 1YHQP 3G26A 2XT1A 4ASVA 1KQFB 5APSA 5HGOA 3MP7B 4DCKA 1N7SC 1X22A 3HE4B 4L76A 3AE5C 2P10A 1RQVA 3TGUD 4WY4A 4IFDK 5APWA 1FU1A 5AVSB 4NEOA 1BCCD 2IBZG 1KV4A 2IBZE 2H43A 2QJKC 4Y28J 3HE5A 3FXEA 2CK3H 2KOPA 1YIJP 2FQ0A 2LR2A 1LWUB 1VQMP 5HGLA 1M1JC 1NAFA 4UHPB 3A5TA 1QVFO 1NJIQ 1M1KQ 3RK3E 2BHVA 1IK9A 1HUCA 2AEFA 2Y0CA 3CX5D 1FAVA
chains in the Genus database with same CATH topology
5F2NA 1YJWP 4XFXA 1YI2P 2DGYA 1Q81Q 5BS2A 3G0VA 2LF4A 1EIAA 3WBHA 4U0FA 4PH1A 1BAJA 3CCSP 3I56P 1KD1Q 4XROA 1YITP 3E2DA 2Z44A 4U0DA 3CCJP 4COPA 4XFYA 1A43A 2OARA 3G28A 4U0EA 2JO0A 2QEXP 4U0BA 1VQ7P 2XV6A 5I4TG 1PEOA 1RO2A 2BQ1E 3DS5A 2KODA 1VQ5P 1VQKP 4COCA 3NTEA 3G1IA 3CCUP 2QA4P 2P9XA 3G1GA 5F2OA 3H4EA 1QRJA 2PEOA 1QVGO 1Q7YQ 1PEUA 3DTJA 3CMEP 1D1DA 1VQ4P 3DS4A 5F2KA 1YJ9P 5DCKA 3CC7P 3DPHA 1K30A 1VQ6P 1VQLP 1VQNP 1KQSO 2PENA 4WYMA 3DS3A 2CWOA 2PEKA 4GR6A 4U0AA 2Z46A 2L6EA 3CXCO 5HGNA 2M8NA 3DS1A 1Q86Q 1W2BO 1K9MQ 1RO0A 2PEMA 3G21A 5HGMA 3P05A 2PEQA 3G29A 3CPWO 3CCMP 1M90Q 2E1MA 1A8OA 1YHQP 2OTLP 1E6JP 3CCRP 1IUQA 3G26A 2XT1A 4XFZA 1KC8Q 1VQ9P 1PEMA 4IPYA 5HGOA 1RNIA 2EFJA 2M8LA 2BUOA 3H47A 4XRQA 1AUMA 3CCQP 3CC4P 3CD6P 2Z45A 1VQOP 2PY8A 3HZQA 2M8PA 3VRLC 3G71P 2XXMA 1JJ2O 2ONTA 4M0IA 4QNBA 3CC2P 2JYGA 4PH0A 3I55P 1VQ8P 2EG5A 3CCEP 1M6EX 1YJNP 5JPAA 1K73Q 1YIJP 3H0DA 3LRYA 3MGEA 1N8RQ 4U0CA 3OW2O 2EIAA 3M1MA 3CMAP 1VQMP 5HGLA 1S72P 3DS2A 3RG6C 5BS1A 3G6EP 1Q82Q 1EOQA 1M74A 1PEQA 3B5IA 1QVFO 1M6NA 2PEIA 1NJIQ 1K8AQ 1M1KQ 2BHVA 3G4SP 2OTJP 3CCLP 1VQPP 2JYLA 3DS0A 4GR2A 3CCVP 2PEJA 3HYBA 3Q20A 1ZMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 P;  1YJW P;  1VQ8 P;  1YI2 P;  3CCE P;  3CPW O;  3CCM P;  1Q81 Q;  1M90 Q;  1YHQ P;  1QVG O;  2OTL P;  1YJN P;  1Q7Y Q;  1K73 Q;  3CCR P;  1VQ4 P;  3CME P;  1YIJ P;  1YJ9 P;  1N8R Q;  1KC8 Q;  1VQ9 P;  3OW2 O;  3CC7 P;  3CMA P;  1VQM P;  1S72 P;  3CCS P;  1KD1 Q;  3I56 P;  1VQ6 P;  1Q82 Q;  3G6E P;  1VQL P;  1VQN P;  1YIT P;  1KQS O;  3CCJ P;  3CCQ P;  2QEX P;  1VQ7 P;  1QVF O;  1NJI Q;  1K8A Q;  1M1K Q;  2OTJ P;  3G4S P;  3CC4 P;  3CCL P;  3CD6 P;  3CXC O;  1VQP P;  1VQ5 P;  1VQO P;  1VQK P;  1Q86 Q;  3G71 P;  1W2B O;  1K9M Q;  3CCU P;  3CCV P;  1JJ2 O;  3CC2 P;  2QA4 P; 
#chains in the Genus database with same CATH topology
 1KYO D;  4XFX A;  2JDI H;  1LT9 A;  3SSU A;  1A02 F;  3EQ2 A;  1D7M A;  1BXI A;  3O6Q A;  1JY3 O;  3H32 A;  3VMX A;  4MRT C;  3RBX A;  1IFD A;  1ZR4 A;  4COP A;  2JU2 A;  2FYU D;  2GDX A;  2QEX P;  5AVX B;  2BQ1 E;  3CLQ A;  2LOL A;  3WU2 H;  2AFE A;  3B5N A;  4YTP C;  3M9B A;  2P1J A;  3VYI A;  1CI6 A;  2PP6 A;  3DS4 A;  3H1K G;  1YJ9 P;  3H1K E;  2JB0 A;  2C9L Y;  2PFX A;  1OMI A;  1KQS O;  2ZT9 B;  4C7N B;  4WYM A;  3V2R A;  1FE6 A;  1AA0 A;  1L0H A;  1PGO A;  5M1B A;  2KGE A;  1JOC A;  2FHS C;  5APQ A;  2N5I A;  3GF3 A;  2PEQ A;  2C9N Y;  2W27 A;  5CCH A;  2E74 D;  1URQ A;  4IPY A;  3HD7 C;  3BCC D;  1PPJ G;  1PPJ E;  4UB8 E;  2K88 A;  2Q3E A;  2FYU E;  4A7P A;  1SFC D;  3OA7 A;  3AE8 C;  1EC5 A;  1QGK B;  1EZV D;  1IJD B;  2M5A A;  1H88 A;  1U57 A;  3CC2 P;  3I55 P;  2V7Q H;  1Z6M A;  1YTZ T;  1SQB J;  3L73 D;  5KTB A;  5BU8 B;  5JPA A;  3V2Q A;  1L4A B;  4YXW H;  1LGH B;  2WVR A;  2YO3 A;  2KOO A;  4PV1 B;  1IMQ A;  3TNU B;  1P84 D;  2L91 A;  3AEG C;  1GW4 A;  3B4Q A;  2DNW A;  2O01 J;  1VF5 C;  1FZC B;  1USE A;  2RMZ A;  1JY2 N;  5CCG D;  4OGQ C;  1DD3 A;  3RK2 D;  2L4B A;  1SQP K;  1ZMB A;  1SQP J;  1JUN A;  2IFM A;  5KAI E;  4PH1 A;  1SQX K;  1SQX J;  3WMM 0;  4PXH B;  1FDO A;  4XRO A;  1N73 A;  4H44 D;  2Z44 A;  3JCU H;  2JAZ A;  2M8R A;  1J2J B;  4DT0 A;  4OGQ B;  2JJL A;  3CX5 H;  2KOG A;  4JQ0 D;  4TT3 H;  1YQ3 C;  1BGY G;  1BGY E;  2W6A A;  5F2O A;  3VN0 A;  1D1D A;  2WTY A;  4IOI H;  1MZ8 A;  3L72 G;  3L72 E;  4GKG A;  5AVZ B;  5C39 A;  2J59 M;  1LT1 A;  2WPR A;  4WWI A;  2IZ1 A;  1N7L A;  3KPE A;  2L9F A;  1ZXG A;  1MV8 A;  4L73 A;  2FKW B;  3H1J D;  3CPW O;  1HGV A;  1G2C B;  3KZI E;  5KP8 B;  2M5R A;  1UNK A;  1GK4 A;  3C1L A;  1SVF A;  5E79 H;  5B5E E;  2GZF A;  2OYI C;  1FJK A;  4GOE A;  4OH8 B;  1DD4 A;  2K92 A;  4L75 A;  3M0A A;  4IZ6 A;  5H2F E;  2M8P A;  2JWD A;  4RJT A;  1NTZ G;  5KLV J;  1NTZ E;  1NAY A;  2N9B A;  3H1L D;  3E1R A;  3CMA P;  2XNX A;  2N50 A;  2LTE A;  4HH2 A;  1M74 A;  4I7Z C;  1M6N A;  2OTJ P;  4H2W C;  2WMM A;  2WWW A;  4IL6 E;  2FAE A;  3M9Q A;  2KS1 A;  4MN4 C;  2FXP A;  1MFZ A;  2LF4 A;  4NPD A;  3H25 A;  3W68 A;  3P32 A;  3CCS P;  1Y9B A;  2FAD A;  1Y8A A;  1SQQ K;  1A43 A;  1SQQ J;  1E79 H;  1MFT A;  2QM7 A;  1KYO I;  1M7L A;  1RHZ B;  3DS5 A;  1T6A A;  1NTK J;  2KG8 A;  1NKZ B;  3VMA A;  2PEO A;  1L0L D;  3CWB D;  3KZI H;  2E76 C;  3O8Z A;  7CEI A;  1EXI A;  1LTJ C;  3L35 A;  5BU5 A;  4C7N A;  1M56 D;  1OWA A;  1GL2 B;  2FYZ A;  1CEI A;  1JCC A;  1HJ0 A;  5H2F H;  2M3B A;  5K5G B;  2B88 A;  1KZU B;  4BPF A;  3NMD A;  1KC8 Q;  4R4L A;  2K0D X;  1VL2 A;  1FOS E;  3H47 A;  1JY2 O;  4N78 D;  4WB4 A;  1RY3 A;  1KTM A;  1FZB A;  2EHS A;  4PH0 A;  1IFM A;  1ZN5 A;  2V4H A;  2R32 A;  1OVR A;  1AV1 A;  2N9Y B;  3L74 G;  3L74 E;  1KIL C;  2C0W A;  1L4A A;  3L70 D;  2KWL A;  2E42 A;  1S72 P;  3TNU A;  1RE4 A;  1FBM A;  1J1E C;  1FZC A;  2WIT A;  3IAO A;  4K35 A;  2JYL A;  2R3C A;  2GZI A;  2PEJ A;  5APT A;  3RGU A;  3Q20 A;  1P84 I;  3CL3 D;  4ASW A;  4AYC A;  2CNR A;  1FR2 A;  3HE5 B;  2KGD A;  3G3Z A;  4U0F A;  2EHT A;  2HLO A;  4RES B;  2WPV B;  3E7K A;  1WT6 A;  4H0L B;  2ZYD A;  5CHX A;  3ZDM A;  1L2P A;  3IFM A;  2YKO A;  1NHL A;  1KB9 E;  5APY A;  4CPG A;  4D6T J;  5KP6 B;  3CC7 P;  5KJ7 D;  1K30 A;  2PRR A;  2A06 G;  3QH9 A;  2A06 E;  2KI7 B;  2KB7 P;  4GOF A;  4IFF A;  2KOR A;  4F37 A;  2N1T B;  3II6 A;  2M8N A;  1SLQ A;  1YQ4 C;  5AW6 B;  2QJP C;  1UII A;  2I1J A;  1PV3 A;  2CQ8 A;  3VP9 A;  1NU1 J;  1A8O A;  2OTL P;  1CI6 B;  1EDJ A;  1GMJ A;  1G2C A;  5TJH A;  4XFZ A;  1RQU A;  1BDC A;  1MZ9 A;  2ZFC A;  2ZVO B;  1FDM A;  1R5S A;  3PHL A;  2D2C B;  1NTZ K;  2PY8 A;  1HJB A;  2ONT A;  4H13 B;  1LTA C;  3MUD C;  1ZNV A;  1SQP D;  1ZRT E;  2IDB A;  2QM8 A;  3OJA B;  2KGA A;  1KFN A;  1DEB A;  3H1H D;  2YKQ A;  2OYI A;  1EQ7 A;  1SQX D;  2KOS A;  5AVR B;  5KKZ C;  2XND H;  2M5A B;  1BE3 J;  1G1I A;  2CPS A;  2KR5 A;  4XA4 A;  2NPS B;  1SQB G;  1SQB E;  4M3L A;  3VMY A;  2WPQ A;  1FC2 C;  1GU5 A;  2K9J B;  4WY4 D;  3L75 D;  1S3J A;  5KP7 B;  2E75 B;  4GOD A;  5AW0 B;  3PTZ A;  1UIX A;  2E43 A;  2BEZ F;  2P9X A;  3CXH I;  1DH3 A;  4U3F J;  2K37 A;  1VQ6 P;  5AVU B;  2CWO A;  2HYN A;  2O01 N;  2K94 A;  4R4M A;  1OW6 A;  3Q5R A;  1FJP A;  3PLN A;  4K3A A;  2ZJS E;  3V2N A;  2IBZ D;  1E6J P;  4EIJ A;  2MJZ A;  2JR8 A;  5KAF E;  2E74 C;  4RO0 A;  1H8A A;  2AEJ A;  1DV5 A;  3MZW B;  4OWF A;  1RF0 C;  2KLU A;  5BVZ A;  4OVN F;  4JF7 A;  1SFC C;  3AE2 C;  3B5N D;  3RK3 D;  2H89 C;  1WMK A;  2GM4 A;  2JYG A;  4KHX A;  1T3J A;  4PD4 E;  1G1J A;  1X8Y A;  5CBO A;  1PIX A;  1Q82 Q;  3JSV C;  2FFD B;  1LTS C;  3KYQ A;  2O01 H;  5CCG C;  1EDK A;  3AE9 C;  1T8Z A;  3EWK A;  2L22 A;  2MR7 A;  3MGN A;  3RK2 C;  2KNC B;  3GKL C;  5KLV G;  1KFM A;  2GZJ A;  5KLV E;  1BSH A;  1KIL A;  3WBH A;  1URQ D;  3FX0 A;  3AEC C;  1VHN A;  2W8Z A;  1N7S B;  3H1K D;  1X0T A;  3OAK A;  4H44 C;  2JO0 A;  2P7J A;  2YMK A;  4U0B A;  2K1A A;  3RK2 B;  1HWT C;  3LIE A;  1L0N J;  3G1I A;  1SQV G;  1SQV E;  2KS1 B;  4HYT B;  2QJK B;  3MD0 A;  2KZI A;  1PZQ A;  2IPP A;  1VQ4 P;  4GT1 A;  2MKV A;  1M1J B;  3DPH A;  4H44 B;  2Y9Y A;  1FZA A;  4GR6 A;  1PPJ D;  1TU3 F;  2KG9 A;  4KJM A;  1SQQ G;  1SQQ E;  1S5L E;  2N1T A;  4ZNC A;  1NTK G;  1NTK E;  3G21 A;  2WQY C;  3RL0 D;  5HV8 A;  1AVY A;  4PD4 H;  3CCR P;  1XTC C;  2KW2 A;  1VQ9 P;  1OVV A;  5AW3 B;  1U7M A;  1AUM A;  1MUU A;  2GUV A;  3GW6 A;  3L36 A;  3G9R A;  1JJ2 O;  4HKG A;  1JNM A;  2Z5I A;  3AEE C;  2FQ2 A;  3OW2 O;  2WSC J;  2N6Z A;  3M1M A;  3RG2 A;  1SS1 A;  1T3U A;  2FVF A;  4GR2 A;  4TLF A;  3C9I A;  4H2X C;  1SQB K;  1BGY D;  3MUD A;  4GDO A;  3HD7 B;  1OVU A;  2NPS A;  2BCC G;  2BCC E;  5KLI C;  3LW5 J;  1YIT P;  2YKP A;  3L72 D;  4U0E A;  2K9J A;  3B8E B;  1QL2 A;  1JMM A;  1NTM J;  4U7J A;  1T8K A;  1S5L H;  1SP4 A;  2KSE A;  1QVG O;  1PL5 A;  3DTJ A;  2AVA A;  1ZOY C;  2RH0 A;  5AW8 B;  3NFQ A;  1NVO A;  2WSF J;  3SFE C;  1VF5 B;  2Y0E A;  3GHG C;  2HR3 A;  4YPC A;  2YMY A;  1W2B O;  4NPF X;  3AE4 C;  1H0T B;  4DJG A;  1NTZ D;  2XDJ A;  1AQT A;  2MF4 A;  1FDI A;  4D6T G;  4D6T E;  1ACP A;  2LML A;  3GMA A;  2ROQ A;  4UB8 H;  3T97 A;  3AEA C;  2Y0D A;  1PP9 J;  5CBN A;  1YJN P;  2MVU A;  3LMO A;  1NU1 G;  4LC1 A;  1NU1 E;  2LIW A;  2FVA A;  3GZL A;  1RF0 A;  2ZT9 D;  1NH4 A;  3PJS K;  3CE7 A;  2FFD A;  1SFC A;  3U43 A;  2GZE A;  1E5W A;  3RBZ A;  5KLV K;  3P8C D;  2RN0 A;  4AQR D;  2KNC A;  1FOS F;  1IZN B;  2KOQ A;  2XZ1 C;  3H1I J;  5KAI H;  1EDL A;  1N7S A;  2OYI B;  3CCJ P;  1S9K E;  3GLM A;  4UB6 E;  1SQV K;  1SQV J;  3HRN A;  1HTL C;  3FWL A;  1BE3 G;  1BE3 E;  3U59 A;  1Q7Y Q;  1L4A D;  2MVV A;  5DCK A;  4PV1 D;  5KJ7 C;  4BPH A;  1M1J A;  2PEN A;  1LNQ A;  5APV A;  4I7Z B;  3CX5 I;  2VSQ A;  5GTH E;  1K05 A;  2J5U A;  1NTK K;  3P8C E;  1X9V A;  5AVW B;  1KQL A;  3E1I A;  5HGM A;  2K0X A;  1RF1 C;  3VMZ A;  2WSS H;  1J1D C;  3L74 D;  3PH0 A;  4U3F G;  4U3F E;  4ZMD A;  5B5E H;  2QSI A;  1QL1 A;  1BCC J;  4OGQ D;  3TF5 A;  2QIW A;  3CC4 P;  2ZAE B;  2FAC A;  2R44 A;  4ZKU A;  4JPZ B;  3TDK A;  2W83 C;  2E76 B;  1LTG C;  3V4Q A;  1LTJ B;  3MGE A;  1GK6 A;  2AFD A;  4LGD E;  3GF7 A;  3Q1M A;  1AF8 A;  3V2P A;  2JGP A;  3S9O A;  3DS0 A;  2C0X A;  3CCV P;  4IL6 H;  1KQG B;  3HYB A;  2GA1 A;  5GTI E;  2KUB A;  1RE3 C;  3AE3 C;  1VPC A;  2YIU C;  5BS2 A;  5AW4 B;  1KB9 D;  4Z1M H;  4WBA A;  2BCC J;  3HD7 A;  2OYO A;  3A7O A;  1X3O A;  1AJY A;  2GDY A;  1KD1 Q;  3CXH E;  1EZV I;  4XFY A;  2A06 D;  4I1L A;  1Y47 A;  4WY4 C;  2HOD A;  2Q9I A;  5GTH H;  3FXD A;  1FZE A;  2O1J A;  2VLP A;  4BPG A;  2QVA A;  2OYH C;  1KIL B;  1PGJ A;  2HG5 D;  2KP8 A;  2SPZ A;  1NWQ A;  2PEK A;  1J1E B;  2N5H A;  2Z46 A;  1BDD A;  3M0D C;  4KT0 J;  4N6J A;  3CXC O;  1L0N G;  1L0N E;  3BCC J;  2LIU A;  3CCM P;  1LT9 C;  1H0T A;  3GZM A;  3KHU A;  1FZG A;  2HPC A;  1ZRT D;  2EFJ A;  2KXP B;  3I5C A;  1LP1 B;  3L73 J;  2ITA A;  3HZQ A;  3GG2 A;  2BAS A;  1AYI A;  5B66 E;  5AW7 B;  2GDW A;  2R5B A;  5GTI H;  1NU1 K;  4N3Y B;  1K73 Q;  1OW7 A;  2QE7 H;  3LRY A;  2EIA A;  1SQB D;  3Q2Y A;  3CXH H;  3MHV A;  1S2E A;  1GL2 D;  1HQB A;  2PEI A;  1AQ5 A;  4CA3 A;  2IYO A;  2QJP B;  2OGU A;  1L0I A;  2QJY C;  4I2L C;  2JEE A;  3WUU A;  1USD A;  2KIK A;  2ZYG A;  1JMB A;  1KN7 A;  1URQ C;  3Q3D A;  1LTI C;  2FYN C;  1DNY A;  2K2Q A;  3HUS C;  3B71 A;  1OR5 A;  1W5C E;  1UJZ A;  5APX A;  1KB9 H;  2LXB A;  3HUS B;  1GZL A;  1EXJ A;  5KKZ B;  3P7K A;  3VTP C;  1K9M Q;  1NTM G;  1NTM E;  2PEM A;  4H2Y C;  3FGA D;  1Q90 D;  3A0H E;  2FQ1 A;  3RL0 C;  2YXQ B;  1PEM A;  4PD4 D;  2M3E A;  5KJ7 A;  2W90 A;  2Q5U A;  3U1A A;  3MIW A;  1IMP A;  4H0L D;  1OX3 A;  1OFC X;  1N73 C;  1LTT C;  2UWJ E;  3CD6 P;  1PFI A;  2PNG A;  2JBG A;  2XKM A;  1NYH A;  1RF1 A;  2EG5 A;  2I8D A;  2OTK E;  1EMV A;  5KLV D;  1LTJ A;  1N8R Q;  2KK7 A;  3RG6 C;  2LL8 A;  3QWO C;  2WSC H;  3KXD A;  2KG6 A;  2I1K A;  2XV5 A;  2WT7 A;  3T97 B;  2N1T D;  2VRS A;  3L71 G;  3L71 E;  1LJ2 A;  1KIL E;  2Q1K A;  1YI2 P;  1SQV D;  1PP9 G;  2A45 I;  1PP9 E;  5AW1 B;  2E74 B;  3BAS A;  3I56 P;  3SWF A;  3E2D A;  2BEQ D;  3P8M C;  1IO4 A;  2XU6 A;  3LW5 H;  4QKO A;  1SFC B;  3WU2 E;  2D2C D;  1L0L J;  2QG4 A;  1YYC A;  3BVH A;  1SQQ D;  4H13 D;  3EJB A;  2VLO A;  3A0H H;  1NTK D;  5CCH D;  3V4W A;  1GDT A;  3H1I G;  1VQN P;  3H1I E;  5EFW B;  1LWU C;  1JY3 P;  2FXO A;  2WSF H;  1W2E A;  2Q6Q A;  3A0B E;  2H88 C;  1L0N K;  2OYH A;  3N7N A;  3D6Z A;  3P05 A;  3R2P A;  1CW5 A;  2NPS D;  5AW5 B;  2IYP A;  1ZW0 A;  5DJU B;  4B86 A;  3EJE A;  5KAF H;  2W6J H;  3KQG A;  3M0D A;  5TIS E;  3M91 A;  2K3R A;  2E75 D;  4YXD C;  1JCD A;  3SWK A;  1LP1 A;  2LKI A;  4BXL A;  3L70 J;  3TYY A;  3CCE P;  3AEF C;  1T2K D;  1PGP A;  3H0D A;  2JKV A;  2NO8 A;  1N86 A;  3IF4 A;  2WSE J;  3VOP A;  3Q5P A;  2CG5 B;  2DW3 A;  4AUW A;  2BCC D;  3U1C A;  3TGU G;  3UIA A;  3TGU E;  4EOT A;  1EOQ A;  2JQ4 A;  2ZT9 C;  3B5I A;  2YNY A;  3G4S P;  1KMI Z;  1BCC G;  1BCC E;  2B87 B;  3BRV B;  1QLE D;  2AF8 A;  1QX8 A;  2ERH A;  3LID A;  2J58 A;  3JCU E;  2FVE A;  5APU A;  2LXC B;  2OAR A;  2N6Y A;  4RKU J;  3CX5 E;  1GXH A;  2O3J A;  1VQ5 P;  3A0B H;  1KYO E;  3NTE A;  2QNW A;  1CSB A;  4L74 A;  3PRJ A;  3NTN A;  4PJ0 E;  3CME P;  3H6P A;  2RKL A;  1L4A C;  5AVY B;  2LPK A;  3HUS A;  5AW2 B;  4PV1 C;  1RE4 C;  2FYU G;  4D6T D;  2ZXE B;  3HTK B;  3L4F A;  3KDP B;  5TIS H;  4W80 A;  2HOD B;  3S1K A;  2IZ0 A;  1FZC C;  1JTH B;  1IFJ A;  1NTM K;  3D70 A;  4R0M A;  2FY8 A;  2E5T A;  4DZO A;  5KLI B;  1IUQ A;  5E79 E;  1ZLL A;  3EFF K;  1N7S D;  2AXT E;  1NU1 D;  2BUO A;  1WRG A;  3PP5 A;  2MD9 A;  3V5B A;  2K93 A;  2Z45 A;  3A2A A;  2N98 A;  1NKN A;  4PD4 I;  4LLH A;  3BCC G;  3H1H J;  3BCC E;  2HPC B;  2Z5H A;  3GHG B;  2XZR A;  2P2U A;  2VLN A;  5L8R J;  1EZV G;  1EZV E;  3L71 J;  1S9K D;  2IBZ I;  3L73 G;  1KYO H;  3L73 E;  1NOH A;  1HVV A;  2DGY A;  2L0Q A;  3M06 A;  1Q81 Q;  2KLV A;  1DX7 A;  2WZ7 A;  3AEB C;  1EIA A;  1P84 E;  2YO2 A;  4PJ0 H;  1BE3 D;  3L75 J;  1S4X A;  1FS0 E;  2MY5 A;  1EDI A;  2G3A A;  2H8P D;  2XZ0 D;  3G28 A;  3ABV C;  2W6B A;  5I4T G;  1RO2 A;  3WUV A;  3R4Y A;  4XFJ A;  1OXZ A;  2K5X A;  3CCU P;  1NGM B;  1GTW A;  1X79 B;  3S4R A;  3SFD C;  4BWN A;  1GD2 E;  3ITK A;  4W7Y A;  2AXT H;  4JYB A;  4GIF A;  3HE4 A;  4U3F D;  2B9B A;  5CCG A;  1IC2 A;  2KGC A;  3DS1 A;  1ZV8 A;  3AE1 C;  2KYV A;  1RH5 B;  1M90 Q;  1AVO A;  3HD7 D;  2IFN A;  1NO4 A;  1F80 D;  3NY7 B;  1LWU A;  2IX7 C;  5HVC A;  3W67 A;  3H1J G;  2V7Q J;  3H1J E;  3VRL C;  2XXM A;  1OW8 A;  2PGD A;  1VQ8 P;  2WPT A;  4ZKP A;  1QEX A;  1DEE G;  3Q5S A;  1P84 H;  2AXC A;  4JYC A;  3IR9 A;  4BRY B;  5BS1 A;  3G6E P;  3TGU J;  1VF5 D;  3BRT B;  3USS A;  2ZXX A;  3CXH D;  3GJN A;  2JO1 A;  1K8A Q;  1JY2 P;  1GL2 C;  3CCL P;  2AEM A;  2B87 A;  1IFI A;  3H1L G;  3H1L E;  1YBK A;  1RF1 B;  1KLP A;  4EI2 A;  1YJW P;  3EFG A;  3G0V A;  1N2D C;  3H1K J;  1J1D B;  2L5G B;  2FXM A;  2ZVN B;  3C8V A;  4U0D A;  2P58 A;  2O1K A;  1KOR A;  2WT7 B;  1PEO A;  1IFP A;  1VQK P;  4UB6 H;  2GUS A;  2CPB A;  3H4E A;  1IK7 A;  3M9H A;  1PEU A;  1L0N D;  5F2K A;  1M8O B;  2FYU K;  2FYU J;  5CJ0 A;  1VQL P;  1GXG A;  1IFN A;  4EDF A;  3DS3 A;  1JO5 A;  2VLQ A;  1H89 A;  4U0A A;  2L6E A;  3HTK A;  1S5L X;  2B89 A;  1YTZ I;  5HGN A;  1JTH A;  2GZG A;  1L0L G;  1L0L E;  2YIU B;  1ZP0 C;  3CWB E;  3CWB G;  3G29 A;  1CZQ A;  3JC2 2;  1HY8 A;  1VDF A;  3N4X A;  4I6M C;  2JU1 A;  5CMZ A;  1RNI A;  4XE5 B;  1A02 J;  4H0L C;  2H7H A;  4XRQ A;  4EYY Q;  4WY4 B;  3CCQ P;  3RL0 g;  2K9Y A;  1VQO P;  3G71 P;  2OYH B;  4M0I A;  1R8E A;  4QNB A;  1GW3 A;  2MR8 A;  3NXS A;  3CI9 A;  2A45 G;  5AW9 B;  1R5L A;  3D6Y A;  4U0C A;  2Y9Z A;  3DS2 A;  4N78 E;  4QMA A;  1XTG B;  1PEQ A;  3GHG A;  5AVQ B;  2G8Y A;  1GPJ A;  1VQP P;  1BGY J;  2N1T C;  1U7J A;  1Z56 A;  3D71 A;  3B5N C;  1PGQ A;  1LT9 B;  3IN6 A;  3RK3 C;  1Q2N A;  2CGQ A;  3SWY A;  3L70 G;  1ZME C;  3L70 E;  3L72 J;  3O6Q B;  3H32 B;  1BAJ A;  3TSI A;  1VQ7 P;  2Q3I A;  2XV6 A;  1FZF A;  2KOD A;  3B5N B;  3MTU E;  3RK3 B;  4COC A;  2D2C C;  3K5B A;  3FWN A;  2JP3 A;  3L37 A;  2QA4 P;  3G1G A;  4H13 C;  1NTM D;  2E76 D;  3VP8 A;  4Y99 C;  1LTB C;  5CCH C;  1AFO A;  2QRX A;  3F89 A;  2K0Y A;  1M57 D;  4HB1 A;  1JY3 N;  2R5D A;  2P67 A;  4C7R A;  2POH A;  1JM0 A;  1NTZ J;  2QJY B;  2NRG A;  1Q86 Q;  1HBW A;  1RO0 A;  4Y99 B;  1HH0 A;  2E1M A;  1URQ B;  4O9B A;  2FYN B;  2NPS C;  2A45 H;  4W7Z A;  1OZH A;  3BAT A;  2M8L A;  2M0B A;  3H1J J;  2Q7C A;  1NQ4 A;  2X2B A;  2E75 C;  4PWV B;  1VKU A;  3L71 D;  5B66 H;  1M6E X;  1KIL D;  1T2K C;  2E5Y A;  1PP9 D;  1BSN A;  2KSJ A;  3AE6 C;  4WVZ A;  3WUT A;  4BRY A;  2ZYA A;  5CZD B;  1JEK A;  1OIP A;  2WSE H;  1MKM A;  2PAJ A;  3AE7 C;  3H1L J;  2JWA A;  1E0H A;  5AVV B;  5F2N A;  2R3S A;  3TK1 A;  3RL0 B;  1SQP G;  1SQP E;  3B4S A;  5DJT B;  5EW5 E;  3H1H G;  3H1H E;  1SQX G;  1SQX E;  1N73 B;  2NZ2 A;  3F5H A;  3H1I D;  2YXR B;  1GL2 A;  2GYK A;  4DG9 A;  4IL6 X;  2WPS A;  2HFE D;  1ZR2 A;  1GU4 A;  1HF9 A;  2LKM A;  5AVT B;  3A3Y B;  1QRJ A;  2Z4E A;  1K04 A;  1DIP A;  2FBW C;  3AED C;  4DOJ A;  4HJG H;  3EJD A;  5EJD A;  3L75 G;  3L75 E;  4C46 A;  4HKZ H;  4IFM A;  2FFD C;  4JBZ A;  3V6I A;  1KB9 I;  1L0L K;  2OQQ A;  4NPE A;  3CWB J;  1S1C X;  1JB0 J;  1RE3 A;  5CJ4 A;  3L74 J;  1HGZ A;  2KZJ A;  1YHQ P;  3G26 A;  2XT1 A;  4ASV A;  1KQF B;  5APS A;  5HGO A;  3MP7 B;  4DCK A;  1N7S C;  1X22 A;  3HE4 B;  4L76 A;  3AE5 C;  2P10 A;  1RQV A;  3TGU D;  4WY4 A;  4IFD K;  5APW A;  1FU1 A;  5AVS B;  4NEO A;  1BCC D;  2IBZ G;  1KV4 A;  2IBZ E;  2H43 A;  2QJK C;  4Y28 J;  3HE5 A;  3FXE A;  2CK3 H;  2KOP A;  1YIJ P;  2FQ0 A;  2LR2 A;  1LWU B;  1VQM P;  5HGL A;  1M1J C;  1NAF A;  4UHP B;  3A5T A;  1QVF O;  1NJI Q;  1M1K Q;  3RK3 E;  2BHV A;  1IK9 A;  1HUC A;  2AEF A;  2Y0C A;  3CX5 D;  1FAV A; 
#chains in the Genus database with same CATH homology
 5F2N A;  1YJW P;  4XFX A;  1YI2 P;  2DGY A;  1Q81 Q;  5BS2 A;  3G0V A;  2LF4 A;  1EIA A;  3WBH A;  4U0F A;  4PH1 A;  1BAJ A;  3CCS P;  3I56 P;  1KD1 Q;  4XRO A;  1YIT P;  3E2D A;  2Z44 A;  4U0D A;  3CCJ P;  4COP A;  4XFY A;  1A43 A;  2OAR A;  3G28 A;  4U0E A;  2JO0 A;  2QEX P;  4U0B A;  1VQ7 P;  2XV6 A;  5I4T G;  1PEO A;  1RO2 A;  2BQ1 E;  3DS5 A;  2KOD A;  1VQ5 P;  1VQK P;  4COC A;  3NTE A;  3G1I A;  3CCU P;  2QA4 P;  2P9X A;  3G1G A;  5F2O A;  3H4E A;  1QRJ A;  2PEO A;  1QVG O;  1Q7Y Q;  1PEU A;  3DTJ A;  3CME P;  1D1D A;  1VQ4 P;  3DS4 A;  5F2K A;  1YJ9 P;  5DCK A;  3CC7 P;  3DPH A;  1K30 A;  1VQ6 P;  1VQL P;  1VQN P;  1KQS O;  2PEN A;  4WYM A;  3DS3 A;  2CWO A;  2PEK A;  4GR6 A;  4U0A A;  2Z46 A;  2L6E A;  3CXC O;  5HGN A;  2M8N A;  3DS1 A;  1Q86 Q;  1W2B O;  1K9M Q;  1RO0 A;  2PEM A;  3G21 A;  5HGM A;  3P05 A;  2PEQ A;  3G29 A;  3CPW O;  3CCM P;  1M90 Q;  2E1M A;  1A8O A;  1YHQ P;  2OTL P;  1E6J P;  3CCR P;  1IUQ A;  3G26 A;  2XT1 A;  4XFZ A;  1KC8 Q;  1VQ9 P;  1PEM A;  4IPY A;  5HGO A;  1RNI A;  2EFJ A;  2M8L A;  2BUO A;  3H47 A;  4XRQ A;  1AUM A;  3CCQ P;  3CC4 P;  3CD6 P;  2Z45 A;  1VQO P;  2PY8 A;  3HZQ A;  2M8P A;  3VRL C;  3G71 P;  2XXM A;  1JJ2 O;  2ONT A;  4M0I A;  4QNB A;  3CC2 P;  2JYG A;  4PH0 A;  3I55 P;  1VQ8 P;  2EG5 A;  3CCE P;  1M6E X;  1YJN P;  5JPA A;  1K73 Q;  1YIJ P;  3H0D A;  3LRY A;  3MGE A;  1N8R Q;  4U0C A;  3OW2 O;  2EIA A;  3M1M A;  3CMA P;  1VQM P;  5HGL A;  1S72 P;  3DS2 A;  3RG6 C;  5BS1 A;  3G6E P;  1Q82 Q;  1EOQ A;  1M74 A;  1PEQ A;  3B5I A;  1QVF O;  1M6N A;  2PEI A;  1NJI Q;  1K8A Q;  1M1K Q;  2BHV A;  3G4S P;  2OTJ P;  3CCL P;  1VQP P;  2JYL A;  3DS0 A;  4GR2 A;  3CCV P;  2PEJ A;  3HYB A;  3Q20 A;  1ZMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...