1KC8Q

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kc8Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kc8Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kc8Q03
3I55P 1KC8Q 3CXCO 2QEXP 3CCUP 3G6EP 1VQOP 1K73Q 3CPWO 3G71P 3CMAP 1Q7YQ 3CCEP 1VQ6P 1VQNP 1VQPP 1VQMP 1K8AQ 3CMEP 1QVFO 1VQ5P 1Q86Q 1VQLP 3CCJP 3CD6P 1M90Q 1VQKP 1KQSO 1KD1Q 1Q82Q 3CC4P 1YJNP 1S72P 3CC2P 1VQ8P 1YHQP 1YITP 1QVGO 3G4SP 3CCMP 1W2BO 1YJ9P 2OTLP 1N8RQ 3CCRP 3CCVP 3OW2O 1YIJP 1YJWP 1M1KQ 2OTJP 1NJIQ 1K9MQ 1Q81Q 1VQ9P 3CCLP 3CCQP 3I56P 1VQ7P 3CCSP 1JJ2O 3CC7P 2QA4P 1VQ4P 1YI2P
chains in the Genus database with same CATH superfamily
5TISH 1HBWA 2JDIH 3L74E 3L72D 3WBHA 1Y8AA 1T6AA 1M1JA 1CI6B 2WSCH 2QVAA 1SS1A 1NWQA 1CW5A 3L73G 4H44B 5B66E 2ONTA 2YIUB 3Q1MA 1Q81Q 2P10A 2FYUG 1DEEG 5APYA 3TNUA 4UB8E 4HJGH 2VLNA 1M74A 2ERHA 5KKZC 3V2RA 3L74G 4NPFX 2B87B 2ZT9D 4GR2A 3HD7B 1M6NA 2KSEA 3H1LJ 3O6QB 1KZUB 2BCCJ 2QRXA 3D71A 1N8RQ 2M8RA 3CWBD 4WVZA 2N6YA 2AXTE 3CXCO 3BCCE 3WUTA 3VN0A 5CCGC 4MRTC 3ZDMA 1KFMA 4ZKPA 3A0BE 1LTJB 3LIDA 3OA7A 3GHGC 1LWUC 1ZMEC 1Z6MA 2YKPA 1P84I 2D2CD 1VQ4P 4DJGA 5KLVE 2CG5B 3BCCG 1SQPE 3HE4A 1H0TA 1E79H 1L0LJ 2QJKB 4H2WC 3M0DA 1EXJA 2HODA 1Q82Q 2PRRA 4QKOA 1EQ7A 1T8ZA 3NFQA 1NTME 4PXHB 5KJ7A 1JO5A 4EDFA 2Q6QA 2MY5A 1G1IA 2K9YA 1BDCA 3H1LD 5KLVG 4IOIH 1N7SB 4GODA 1SQPG 2BCCD 1GL2D 3G71P 2IYPA 2XV6A 2O01J 2GZFA 2KG8A 4DOJA 4L73A 4PD4H 3NXSA 1KN7A 1NTMG 1GW3A 4PV1C 1J1EC 1BGYJ 4R0MA 4LLHA 3B71A 2WSFH 1CSBA 3VMAA 1FU1A 5AW6B 1NOHA 2C9NY 3HZQA 2IBZD 5AVWB 1KB9D 5HGLA 1JY2O 1G2CB 5H2FH 3MTUE 1J2JB 1PP9J 3AE1C 2FAEA 3G26A 3Q20A 5AVQB 2WT7B 2FVEA 1LT9A 3L70D 4U0CA 5AW9B 3EJBA 2EHSA 1X22A 2QJPB 3KPEA 3TSIA 1JUNA 3D70A 2FYZA 2P7JA 3TYYA 1A8OA 2BQ1E 1FOSF 4JYBA 1E5WA 1S9KE 1DIPA 2BHVA 2IDBA 4IL6X 5DJTB 1YQ4C 1FZCB 1PIXA 1IC2A 1USDA 1BGYD 1FDMA 4I7ZB 1K8AQ 1K04A 3C8VA 1M90Q 1YQ3C 1PL5A 1L0HA 1ACPA 2YMYA 1JB0J 1MUUA 1NTZD 1OW7A 5M1BA 1SQQE 2E75D 1QLED 1JNMA 1SQXJ 1AQTA 5AVUB 3AE6C 5B5EH 3AE2C 3DS3A 1KYOE 3H47A 1PEQA 2R32A 5AW3B 1FZBA 4GOEA 3RL0D 3RG6C 2KS1A 4ASWA 1SQQG 3TGUJ 2D2CB 1SQVG 1SQQK 1M1KQ 3P8CD 1K30A 1NU1G 4H13D 1SQVK 1FC2C 3HE5A 2KORA 3USSA 1NU1K 1RF0C 1L0NJ 1A43A 1QVFO 1VQKP 1FZGA 1PFIA 1S5LH 3H1IE 1YJNP 3RK3D 1HJBA 2FVFA 4OGQB 2M8NA 1FZFA 3GJNA 4PWVB 3WUVA 1USEA 2AVAA 4U7JA 3BRTB 2AEJA 2K1AA 1KC8Q 3RK2B 4WBAA 1NTKE 1IFIA 1SQXD 3H1IG 4U0EA 4D6TJ 2KGCA 2XXMA 3AEFC 1VKUA 3H32A 3M1MA 3CCMP 1NO4A 4O9BA 4I2LC 4HH2A 1GL2A 1PEUA 3H1HE 2KI7B 1X3OA 2Z45A 3TGUD 3BCCD 1BCCJ 3AE9C 4EYYQ 1NTKG 1SFCB 2IPPA 3E7KA 5L8RJ 2PEQA 2W6BA 4BRYA 2LOLA 1L0ND 4RJTA 2AXCA 2JYGA 3H4EA 2PGDA 1ZMBA 1NKNA 2R5DA 3H1HG 2ROQA 2OQQA 2V7QJ 1AQ5A 5CHXA 1OX3A 2MKVA 4EOTA 2H43A 1JY3O 5AVZB 2W83C 5HGMA 4AYCA 1GDTA 3DTJA 2CPBA 2W6JH 2ZT9C 3L4FA 1J1DC 1W2BO 4DCKA 1PEMA 3KHUA 2Q7CA 5B66H 4IL6H 2VLPA 1A02J 1YI2P 3O8ZA 3VMXA 2P2UA 3DPHA 2XV5A 4UB8H 5CBOA 3Q2YA 2PEIA 5KLIB 2E76B 1EMVA 2Q9IA 1FOSE 3L71J 1BCCD 1SQBJ 3M9BA 1GTWA 1RH5B 2YMKA 2G8YA 3BVHA 1S3JA 4COPA 1WRGA 2LKMA 4WY4A 2QJYB 4A7PA 2OYIB 2AXTH 2CWOA 2WSEJ 2L22A 1IFDA 3RL0g 3RL0B 2DNWA 3AEDC 1AFOA 5BVZA 3G1GA 5AVSB 1YITP 1AYIA 1ZP0C 3IR9A 1JMBA 2OTLP 2K0YA 1OFCX 3B5NB 1IMPA 4L74A 1LTSC 2W8ZA 1NAFA 1LTGC 1JM0A 1EDIA 2WMMA 2MD9A 2QM7A 1GL2C 1GK4A 2OGUA 3MUDA 2JWDA 2K9JA 1P84E 3Q5RA 3A7OA 2PEJA 1JY2P 2Y9YA 1S9KD 5KAIE 1QX8A 2M3EA 2HPCA 2FBWC 2KOSA 3MZWB 1HGVA 4H44D 3L71D 2KOPA 1SQBD 1NYHA 3CI9A 2FACA 2WSCJ 4DZOA 2EHTA 2FQ2A 1URQB 5APXA 3UIAA 1KILE 3HD7D 1ZRTD 3EJEA 2IZ0A 1OW8A 4PJ0E 2FADA 3GG2A 1ZLLA 3CC7P 3CX5D 4WYMA 3GW6A 2L91A 2R3CA 1BSNA 3G29A 2IFMA 3A2AA 3H6PA 4KT0J 3CC4P 5AVRB 1R5SA 2ZVNB 4Y99B 1K05A 1JJ2O 2KIKA 3H1KE 5TJHA 2QSIA 2GZJA 2H89C 3GF3A 4GOFA 2BEZF 2ZXEB 1HF9A 2KLVA 3CXHD 2WSSH 1FZEA 3M9HA 1S5LE 4BWNA 4WY4C 1U7JA 1ZW0A 1M57D 2LR2A 2JB0A 2L9FA 3FX0A 4EI2A 1QL2A 2E75C 3G1IA 3GZMA 3L72J 2KLUA 3GHGA 2WTYA 3I5CA 2Z44A 1N7SD 1VQPP 1LWUA 1SLQA 3U1AA 2DW3A 2I1JA 1RE4A 2I1KA 1L0LK 1RHZB 3AEBC 3RL0C 1S4XA 2IYOA 3CCVP 2FHSC 1NJIQ 1FE6A 2PEOA 2FYNC 4H13C 3GKLC 2KNCB 1QL1A 3KDPB 2M3BA 2QNWA 1SVFA 2AFEA 1KYOH 2WPRA 3H0DA 2WSFJ 3CWBJ 3RK3C 3LIEA 1EIAA 1PP9E 2O1JA 3KYQA 4C7NB 1E6JP 1NHLA 4XA4A 3I55P 3L36A 2WITA 3DS1A 1N73A 1A02F 2FFDA 2JO0A 2POHA 1M1JB 2AEMA 1G1JA 1YHQP 2JAZA 1EZVD 4XFZA 1PP9G 2HYNA 3OW2O 3G3ZA 1L2PA 1HJ0A 1GW4A 4IL6E 4JQ0D 5AVVB 2XNDH 2KOOA 1BE3J 3DS5A 3MGEA 1KQFB 3FXDA 1LNQA 1IFPA 4PD4D 3LRYA 1JY3P 2LF4A 3S4RA 5AW5B 1HTLC 2N5IA 1LP1B 2LL8A 2UWJE 3KXDA 3FWNA 2W27A 2KUBA 2ZXXA 2Q5UA 2B87A 5AVXB 5GTIE 2VLOA 4I6MC 2M5AA 2A06E 3M06A 1DX7A 1X9VA 3G4SP 1NH4A 3TDKA 2Q1KA 3CCLP 3EQ2A 4UHPB 3SWYA 1RE4C 2FKWB 4H0LB 2NPSB 3KZIE 1H0TB 1SQXK 4R4MA 1FAVA 1LTIC 2HODB 1BE3D 2A06G 3L70J 3OAKA 3CE7A 3PJSK 1DEBA 4H2XC 4ASVA 3NTEA 4NEOA 4OGQD 3IF4A 2QA4P 4DG9A 1U57A 5AVTB 2AEFA 4N78E 4XE5B 4BPGA 4U3FE 2J5UA 3RK2D 2EG5A 1L0NK 1RF0A 1N73C 1AUMA 2LMLA 2FFDC 5HV8A 4GKGA 3E1IA 1RF1C 4D6TE 2X2BA 1UIXA 2GZIA 1EC5A 2KR5A 3RG2A 3AE5C 1OVVA 1NTZJ 2KOQA 1IZNB 4U3FG 1JMMA 1SFCD 3BRVB 2IBZI 1KB9I 2M8PA 1LTTC 5E79E 4D6TG 1PGQA 1KMIZ 1D1DA 1LT9B 2V4HA 2YKOA 1L0IA 3FWLA 1T3UA 3H1KD 3PHLA 5KTBA 1JTHA 3HRNA 4H44C 3B4SA 3CL3D 2YIUC 2A45I 2BUOA 1KQLA 3L73J 1S2EA 2P9XA 1P84H 4LGDE 3VMZA 3IAOA 2CK3H 5CCHD 2MVUA 2FYUJ 1QVGO 2WT7A 3B5IA 1BXIA 3M9QA 5KAIH 1BSHA 3HD7C 3L74J 2QM8A 3EJDA 1Q7YQ 1H88A 2ITAA 2IX7C 3BASA 2DGYA 2E74B 2E76D 1RE3C 5AVYB 3HUSB 2GDYA 2HG5D 3E2DA 3V6IA 5EW5E 2FY8A 4PJ0H 3CCRP 3H1JD 1LTJC 1X8YA 3A0HE 1SQVE 3MP7B 2W90A 1NU1E 3A5TA 1Q2NA 1W2EA 1EDJA 3JCUH 5JPAA 3N7NA 3CMEP 4TLFA 2E5YA 2FVAA 4IZ6A 1PGOA 1AJYA 2W6AA 2KS1B 2QJKC 2K88A 3L73D 3BCCJ 1N2DC 3L75E 1SP4A 1SQBK 3HE5B 4N3YB 3AEEC 1OW6A 2FYUD 4OVNF 3B5ND 2KG6A 2M5RA 3G6EP 1VQOP 4RESB 1VQMP 3L74D 4NPEA 1TU3F 1N7SC 1IMQA 1GMJA 3VP8A 2M0BA 5KLVJ 3L35A 1SQPJ 3ITKA 5KAFE 2ZFCA 3L75G 2FQ1A 4RO0A 5AW2B 1QEXA 2VSQA 1VQLP 1NTMJ 3CCJP 2L0QA 2KZJA 2OYHB 3GF7A 1GD2E 1KILB 1HQBA 1T3JA 1URQD 3WUUA 2K0XA 5K5GB 4GDOA 1ZXGA 1HGZA 4BPHA 3K5BA 3PH0A 3AECC 2QEXP 2JEEA 2LTEA 2QJPC 4BRYB 3SSUA 2B89A 1OVUA 1X0TA 2K2QA 1AV1A 5DCKA 1FS0E 2Z5IA 3MD0A 1MKMA 2OYOA 1L4AB 5KLVD 1SQPD 4CPGA 2PEMA 3R2PA 2KXPB 2Z5HA 4IFFA 2QG4A 3VRLC 1FZCC 2KK7A 3LW5J 1GZLA 2MJZA 1IFMA 4I7ZC 1NTMD 1OMIA 3FGAD 1VQ7P 3HUSC 2GDWA 4OH8B 2GZEA 4HYTB 5CJ0A 3AE3C 3VTPC 3HYBA 3L72E 1NAYA 2ZVOB 3GMAA 5CCHA 2N6ZA 2O3JA 2GA1A 1AA0A 2KYVA 3W68A 2MR8A 3Q5SA 1K9MQ 4BXLA 3CCSP 3GLMA 3P7KA 4K35A 4WWIA 1Y9BA 2WPTA 2D2CC 3S1KA 4HB1A 2LKIA 3L72G 2J59M 3WMM0 5GTIH 3NMDA 2B88A 1WMKA 2N1TB 5CZDB 1CZQA 1KV4A 3V2QA 2JJLA 3CWBE 2GUVA 2YXQB 4OGQC 2GUSA 2CPSA 3KZIH 3CD6P 1NQ4A 1NGMB 4I1LA 2KGAA 2K9JB 3T97B 2H8PD 3RK2C 2KGEA 2YO3A 3GZLA 3II6A 3B5NA 3CWBG 2AFDA 1OZHA 2XNXA 3H1IJ 1RQVA 3V5BA 4XFJA 2JKVA 2G3AA 3PP5A 3KQGA 3JC22 1SFCC 1CEIA 4RKUJ 1UJZA 2L5GB 2OTJP 1SQQD 3H1LE 3SFEC 1SQVD 1NTKJ 3AEGC 1NU1D 2BCCE 3JCUE 1HWTC 1URQA 1RY3A 2BEQD 3CX5I 3DS2A 1KQSO 1KYOD 2JQ4A 4COCA 3H1HJ 5E79H 2WQYC 3TK1A 1R8EA 2XZ1C 3H1LG 5KKZB 3EWKA 5CCHC 4OWFA 2BCCG 1YBKA 4U0DA 1HUCA 4GIFA 1JY2N 2IBZE 2K3RA 2YO2A 1KB9E 2HLOA 2V7QH 1VHNA 4H0LD 2CNRA 2LPKA 2NPSD 5DJUB 5I4TG 3QWOC 3H1ID 5AW1B 4XROA 1L0LE 2N50A 4H2YC 5KLIC 2E76C 3CXHI 3L70E 3R4YA 2Q3IA 2E5TA 5F2KA 5KJ7D 3MIWA 2IBZG 2WVRA 3GHGB 1LJ2A 1LWUB 1NTKD 2QJYC 2OYIC 2WWWA 1L0LG 3B8EB 4M0IA 3RBZA 1KQGB 2R44A 3L70G 1X79B 2LIUA 2A45G 3A0HH 2JP3A 2RMZA 3H1HD 1FJKA 1BGYE 4ZKUA 1KTMA 3DS4A 4XFYA 3B5NC 4L76A 4PH0A 1R5LA 1M7LA 3U43A 2WSEH 4YXWH 4XFXA 1H8AA 3NY7B 3HTKA 2OARA 2NO8A 3C9IA 1ZR2A 2JBGA 4M3LA 4U0AA 2XKMA 2J58A 1BGYG 3N4XA 4PV1B 1VQ6P 1VQNP 2Z46A 4YTPC 1RF1A 2ZJSE 2PAJA 3CLQA 1J1EB 2EFJA 4JBZA 1NTZG 2PY8A 1NTZK 5EJDA 5AW4B 1URQC 4NPDA 3P8CE 2B9BA 4C7NA 1YTZT 5KAFH 1ZNVA 1EZVI 3F89A 2XU6A 3TNUB 1WT6A 3CXHH 2KWLA 2K93A 5CMZA 3RK3E 1CI6A 2I8DA 1S72P 2E74D 1IK7A 2JU2A 2YNYA 3EFGA 2JYLA 1AVYA 4PD4I 1FJPA 2FYUK 2P67A 5AW8B 2KB7P 2WPVB 1K73Q 4YPCA 4Y99C 1SQXE 2M8LA 2O1KA 5APUA 2RKLA 3HD7A 2PNGA 2M5AB 3CC2P 2Y0DA 3O6QA 2JR8A 5AW7B 3A3YB 3WU2H 4TT3H 2CGQA 4ZMDA 1LP1A 3CCQP 1FBMA 4AUWA 3TGUE 1MZ8A 4IFDK 1RE3A 1SQXG 1OVRA 3SWFA 1H89A 4F37A 2Z4EA 3VP9A 3HE4B 1N7LA 1Q90D 1DD4A 1E0HA 1U7MA 1LTJA 1L0NE 3Q3DA 3G28A 1P84D 2NZ2A 3H1KJ 4W7YA 4KHXA 1VPCA 1Y47A 5APTA 2ZYGA 3TGUG 4GR6A 1JY3N 2NPSA 1KLPA 2K92A 4L75A 2N5HA 2XT1A 3V2PA 1MV8A 3AEAC 2ZYAA 5BU5A 1KD1Q 1L0NG 1S5LX 4HKZH 1ZR4A 1FDIA 1VDFA 2QE7H 1VQ8P 1FZAA 1KILD 5APWA 1OR5A 1PPJE 3AE4C 3D6YA 2OTKE 4KJMA 2JWAA 3V4QA 1N7SA 5KLVK 1SQPK 3CCUP 3G21A 4K3AA 2N9BA 5F2NA 5HGOA 5HGNA 3MHVA 1BCCE 3H1JJ 2FXOA 3V4WA 1NTMK 3TF5A 1PPJG 1KFNA 3E1RA 1JOCA 2XDJA 1M1JC 4UB6H 2KZIA 3PTZA 3SWKA 1JTHB 3FXEA 1FDOA 3BATA 1G2CA 1L4AD 2P1JA 1LTBC 1BCCG 1EDKA 2Q3EA 2WPQA 5C39A 1JCCA 1L0LD 5APVA 2C9LY 1JCDA 2VRSA 1KORA 1GU5A 2ZAEB 3G9RA 2RN0A 2NRGA 4EIJA 5AW0B 1IO4A 1HVVA 1PGPA 5KP6B 1YIJP 3L71E 2KP8A 2E1MA 1MFTA 1YTZI 1PZQA 1SQBE 1MFZA 1FZCA 2ZT9B 5APQA 1S1CX 4WY4D 1PV3A 1ZV8A 1GXGA 1J1DB 1VF5D 2HFED 3ABVC 4H0LC 5CJ4A 2N98A 2NPSC 1W5CE 3HUSA 1ZRTE 1OIPA 3H25A 4JYCA 1ZOYC 5KP7B 2GZGA 2IZ1A 3M0DC 3L71G 2N1TD 2JGPA 1PP9D 1SQBG 3CX5E 2R3SA 5KJ7C 1OWAA 1KB9H 4WB4A 2R5BA 3IFMA 3G0VA 5BU8B 3JSVC 3EFFK 1NVOA 1QRJA 2PENA 2A45H 1T8KA 3P8MC 3B4QA 5TISE 2WPSA 1UNKA 1IJDB 3CPWO 1LTAC 3CXHE 1ZN5A 1T2KD 3PRJA 3S9OA 2KSJA 2O01H 3AE7C 3H32B 1AVOA 1NKZB 1YJWP 2IFNA 2MR7A 5KP8B 1GL2B 4U3FJ 2LXBA 3P05A 1LT9C 2OYHA 2GM4A 3NTNA 1KILA 3D6ZA 3C1LA 4Z1MH 2C0XA 2A06D 3WU2E 1IFNA 3M0AA 1M6EX 1BDDA 3QH9A 5CBNA 1SFCA 1NTKK 1VQ5P 1Q86Q 3PLNA 5EFWB 4PH1A 1LGHB 5GTHH 1YYCA 5F2OA 4R4LA 4U0BA 2E74C 2CQ8A 3F5HA 1FR2A 3RGUA 1L4AA 5CCGD 2MVVA 3W67A 2KODA 3V2NA 2K37A 1LT1A 4N78D 1EOQA 4U3FD 1IUQA 4C46A 1EZVE 2LXCB 4C7RA 1F80D 1PPJD 1M56D 2YXRB 4D6TD 3I56P 1GPJA 3IN6A 4WY4B 1VF5B 1RO0A 3CCEP 4MN4C 5APSA 2JO1A 1HY8A 4PD4E 1SQQJ 1EZVG 1RQUA 2H88C 4W80A 1SQVJ 2E75B 2LIWA 2FXPA 1NU1J 3Q5PA 4UB6E 2JU1A 2FXMA 2E42A 3SFDC 2OYIA 2XZ0D 1GU4A 4QMAA 2E43A 5H2FE 1IK9A 3AE8C 3A0BH 4PV1D 3MGNA 4CA3A 2N1TA 2FYNB 3L75J 2H7HA 4H13B 2OYHC 1KILC 2HPCB 2GDXA 2L4BA 4HKGA 3CMAP 2Y9ZA 4IPYA 1HH0A 2AF8A 2YKQA 3RK3B 2RH0A 3VOPA 5BS2A 3T97A 4AQRD 1BE3E 3DS0A 2N9YB 1RNIA 2QIWA 1D7MA 1OXZA 4GT1A 4JPZB 4XRQA 4JF7A 1DNYA 2BASA 1BE3G 1L4AC 4DT0A 1DV5A 3OJAB 2L6EA 1KYOI 3LMOA 1PGJA 4Y28J 1XTGB 3L75D 1AF8A 3M91A 5B5EE 1PEOA 2P58A 2C0WA 5HVCA 2KG9A 3L37A 3P32A 2EIAA 1GXHA 1M8OB 2HR3A 1IFJA 2SPZA 3LW5H 4QNBA 1DH3A 2Y0EA 1EXIA 1BAJA 2Y0CA 1Z56A 2GYKA 2PFXA 4YXDC 2ZYDA 1VF5C 1RO2A 4B86A 2O01N 2VLQA 4LC1A 5CCGA 3H1KG 3VMYA 4W7ZA 2K94A 2K5XA 1JEKA 2N1TC 4N6JA 2MF4A 1UIIA 1VL2A 1NTZE 3U59A 2XZRA 1XTCC 3HTKB 1N86A 3VYIA 1YJ9P 3H1JE 2PP6A 3MUDC 1GK6A 2WZ7A 2KGDA 3CX5H 4BPFA 7CEIA 2KNCA 1DD3A 1MZ9A 1EDLA 1N73B 2PEKA 2FFDB 1RF1B 4U0FA 4IFMA 2KOGA 5GTHE 1T2KC 3L73E 2KW2A 3H1JG 1QGKB 3U1CA 2FQ0A 2K0DX 1VQ9P 3RBXA 4ZNCA 5BS1A 2FYUE
chains in the Genus database with same CATH topology
1PEOA 2QEXP 1RO0A 1K73Q 3CPWO 3DS3A 3G71P 1Q7YQ 3CCEP 2XV6A 2M8LA 3H47A 3CD6P 2DGYA 3WBHA 5HGMA 1PEQA 2EIAA 3H0DA 3DTJA 3CC2P 3RG6C 4M0IA 1EIAA 1W2BO 3NTEA 3E2DA 2ONTA 1PEMA 5DCKA 3CCRP 1YJWP 1M1KQ 1K30A 1Q81Q 3CCQP 1E6JP 3CC7P 2QA4P 4QNBA 1YI2P 3I55P 3DPHA 3DS1A 1A43A 1M74A 3HZQA 4WYMA 2PEIA 5HGLA 1BAJA 3DS4A 3P05A 4XFYA 5JPAA 2PEMA 3CMEP 1QVFO 3G29A 1VQKP 2JO0A 4GR2A 2EG5A 4PH0A 1M6NA 1YJNP 3VRLC 3CC4P 1RO2A 4XFXA 3G28A 1YHQP 1AUMA 2M8NA 2OARA 3G26A 3Q20A 4XFZA 1N8RQ 3OW2O 1M6EX 1YIJP 2OTJP 2E1MA 4COPA 4U0CA 1VQ7P 1JJ2O 4GR6A 1KC8Q 3CXCO 3DS5A 2CWOA 2XT1A 3G6EP 1VQOP 3MGEA 3CMAP 3HYBA 1VQ6P 1VQNP 1VQMP 2Z46A 4IPYA 1VQ5P 1Q86Q 5BS2A 1A8OA 3DS2A 1KQSO 2EFJA 1KD1Q 2BQ1E 2PY8A 3DS0A 4PH1A 4U0EA 3LRYA 1VQ8P 3G1GA 2M8PA 4COCA 2LF4A 1YITP 5F2OA 2XXMA 1RNIA 3M1MA 2BHVA 3CCMP 1YJ9P 2OTLP 1D1DA 4U0BA 1K9MQ 3CCSP 1PEUA 1VQ4P 4XRQA 3G1IA 2Z45A 4U0DA 2KODA 3CCUP 3G21A 2Z44A 2PEKA 1VQPP 1K8AQ 5F2NA 5HGOA 1VQLP 5HGNA 3CCJP 2PEQA 1M90Q 1EOQA 2BUOA 5I4TG 4U0FA 1Q82Q 1IUQA 2P9XA 3G0VA 2PEJA 1S72P 4XROA 1QRJA 1QVGO 3G4SP 3B5IA 2L6EA 2JYGA 2PENA 3CCVP 3H4EA 2JYLA 1NJIQ 1ZMBA 2PEOA 5F2KA 1VQ9P 3CCLP 3I56P 5BS1A 4U0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 P;  1KC8 Q;  3CXC O;  2QEX P;  3CCU P;  3G6E P;  1VQO P;  1K73 Q;  3CPW O;  3G71 P;  3CMA P;  1Q7Y Q;  3CCE P;  1VQ6 P;  1VQN P;  1VQP P;  1VQM P;  1K8A Q;  3CME P;  1QVF O;  1VQ5 P;  1Q86 Q;  1VQL P;  3CCJ P;  3CD6 P;  1M90 Q;  1VQK P;  1KQS O;  1KD1 Q;  1Q82 Q;  3CC4 P;  1YJN P;  1S72 P;  3CC2 P;  1VQ8 P;  1YHQ P;  1YIT P;  1QVG O;  3G4S P;  3CCM P;  1W2B O;  1YJ9 P;  2OTL P;  1N8R Q;  3CCR P;  3CCV P;  3OW2 O;  1YIJ P;  1YJW P;  1M1K Q;  2OTJ P;  1NJI Q;  1K9M Q;  1Q81 Q;  1VQ9 P;  3CCL P;  3CCQ P;  3I56 P;  1VQ7 P;  3CCS P;  1JJ2 O;  3CC7 P;  2QA4 P;  1VQ4 P;  1YI2 P; 
#chains in the Genus database with same CATH topology
 5TIS H;  1HBW A;  2JDI H;  3L74 E;  3L72 D;  3WBH A;  1Y8A A;  1T6A A;  1M1J A;  1CI6 B;  2WSC H;  2QVA A;  1SS1 A;  1NWQ A;  1CW5 A;  3L73 G;  4H44 B;  5B66 E;  2ONT A;  2YIU B;  3Q1M A;  1Q81 Q;  2P10 A;  2FYU G;  1DEE G;  5APY A;  3TNU A;  4UB8 E;  4HJG H;  2VLN A;  1M74 A;  2ERH A;  5KKZ C;  3V2R A;  3L74 G;  4NPF X;  2B87 B;  2ZT9 D;  4GR2 A;  3HD7 B;  1M6N A;  2KSE A;  3H1L J;  3O6Q B;  1KZU B;  2BCC J;  2QRX A;  3D71 A;  1N8R Q;  2M8R A;  3CWB D;  4WVZ A;  2N6Y A;  2AXT E;  3CXC O;  3BCC E;  3WUT A;  3VN0 A;  5CCG C;  4MRT C;  3ZDM A;  1KFM A;  4ZKP A;  3A0B E;  1LTJ B;  3LID A;  3OA7 A;  3GHG C;  1LWU C;  1ZME C;  1Z6M A;  2YKP A;  1P84 I;  2D2C D;  1VQ4 P;  4DJG A;  5KLV E;  2CG5 B;  3BCC G;  1SQP E;  3HE4 A;  1H0T A;  1E79 H;  1L0L J;  2QJK B;  4H2W C;  3M0D A;  1EXJ A;  2HOD A;  1Q82 Q;  2PRR A;  4QKO A;  1EQ7 A;  1T8Z A;  3NFQ A;  1NTM E;  4PXH B;  5KJ7 A;  1JO5 A;  4EDF A;  2Q6Q A;  2MY5 A;  1G1I A;  2K9Y A;  1BDC A;  3H1L D;  5KLV G;  4IOI H;  1N7S B;  4GOD A;  1SQP G;  2BCC D;  1GL2 D;  3G71 P;  2IYP A;  2XV6 A;  2O01 J;  2GZF A;  2KG8 A;  4DOJ A;  4L73 A;  4PD4 H;  3NXS A;  1KN7 A;  1NTM G;  1GW3 A;  4PV1 C;  1J1E C;  1BGY J;  4R0M A;  4LLH A;  3B71 A;  2WSF H;  1CSB A;  3VMA A;  1FU1 A;  5AW6 B;  1NOH A;  2C9N Y;  3HZQ A;  2IBZ D;  5AVW B;  1KB9 D;  5HGL A;  1JY2 O;  1G2C B;  5H2F H;  3MTU E;  1J2J B;  1PP9 J;  3AE1 C;  2FAE A;  3G26 A;  3Q20 A;  5AVQ B;  2WT7 B;  2FVE A;  1LT9 A;  3L70 D;  4U0C A;  5AW9 B;  3EJB A;  2EHS A;  1X22 A;  2QJP B;  3KPE A;  3TSI A;  1JUN A;  3D70 A;  2FYZ A;  2P7J A;  3TYY A;  1A8O A;  2BQ1 E;  1FOS F;  4JYB A;  1E5W A;  1S9K E;  1DIP A;  2BHV A;  2IDB A;  4IL6 X;  5DJT B;  1YQ4 C;  1FZC B;  1PIX A;  1IC2 A;  1USD A;  1BGY D;  1FDM A;  4I7Z B;  1K8A Q;  1K04 A;  3C8V A;  1M90 Q;  1YQ3 C;  1PL5 A;  1L0H A;  1ACP A;  2YMY A;  1JB0 J;  1MUU A;  1NTZ D;  1OW7 A;  5M1B A;  1SQQ E;  2E75 D;  1QLE D;  1JNM A;  1SQX J;  1AQT A;  5AVU B;  3AE6 C;  5B5E H;  3AE2 C;  3DS3 A;  1KYO E;  3H47 A;  1PEQ A;  2R32 A;  5AW3 B;  1FZB A;  4GOE A;  3RL0 D;  3RG6 C;  2KS1 A;  4ASW A;  1SQQ G;  3TGU J;  2D2C B;  1SQV G;  1SQQ K;  1M1K Q;  3P8C D;  1K30 A;  1NU1 G;  4H13 D;  1SQV K;  1FC2 C;  3HE5 A;  2KOR A;  3USS A;  1NU1 K;  1RF0 C;  1L0N J;  1A43 A;  1QVF O;  1VQK P;  1FZG A;  1PFI A;  1S5L H;  3H1I E;  1YJN P;  3RK3 D;  1HJB A;  2FVF A;  4OGQ B;  2M8N A;  1FZF A;  3GJN A;  4PWV B;  3WUV A;  1USE A;  2AVA A;  4U7J A;  3BRT B;  2AEJ A;  2K1A A;  1KC8 Q;  3RK2 B;  4WBA A;  1NTK E;  1IFI A;  1SQX D;  3H1I G;  4U0E A;  4D6T J;  2KGC A;  2XXM A;  3AEF C;  1VKU A;  3H32 A;  3M1M A;  3CCM P;  1NO4 A;  4O9B A;  4I2L C;  4HH2 A;  1GL2 A;  1PEU A;  3H1H E;  2KI7 B;  1X3O A;  2Z45 A;  3TGU D;  3BCC D;  1BCC J;  3AE9 C;  4EYY Q;  1NTK G;  1SFC B;  2IPP A;  3E7K A;  5L8R J;  2PEQ A;  2W6B A;  4BRY A;  2LOL A;  1L0N D;  4RJT A;  2AXC A;  2JYG A;  3H4E A;  2PGD A;  1ZMB A;  1NKN A;  2R5D A;  3H1H G;  2ROQ A;  2OQQ A;  2V7Q J;  1AQ5 A;  5CHX A;  1OX3 A;  2MKV A;  4EOT A;  2H43 A;  1JY3 O;  5AVZ B;  2W83 C;  5HGM A;  4AYC A;  1GDT A;  3DTJ A;  2CPB A;  2W6J H;  2ZT9 C;  3L4F A;  1J1D C;  1W2B O;  4DCK A;  1PEM A;  3KHU A;  2Q7C A;  5B66 H;  4IL6 H;  2VLP A;  1A02 J;  1YI2 P;  3O8Z A;  3VMX A;  2P2U A;  3DPH A;  2XV5 A;  4UB8 H;  5CBO A;  3Q2Y A;  2PEI A;  5KLI B;  2E76 B;  1EMV A;  2Q9I A;  1FOS E;  3L71 J;  1BCC D;  1SQB J;  3M9B A;  1GTW A;  1RH5 B;  2YMK A;  2G8Y A;  3BVH A;  1S3J A;  4COP A;  1WRG A;  2LKM A;  4WY4 A;  2QJY B;  4A7P A;  2OYI B;  2AXT H;  2CWO A;  2WSE J;  2L22 A;  1IFD A;  3RL0 g;  3RL0 B;  2DNW A;  3AED C;  1AFO A;  5BVZ A;  3G1G A;  5AVS B;  1YIT P;  1AYI A;  1ZP0 C;  3IR9 A;  1JMB A;  2OTL P;  2K0Y A;  1OFC X;  3B5N B;  1IMP A;  4L74 A;  1LTS C;  2W8Z A;  1NAF A;  1LTG C;  1JM0 A;  1EDI A;  2WMM A;  2MD9 A;  2QM7 A;  1GL2 C;  1GK4 A;  2OGU A;  3MUD A;  2JWD A;  2K9J A;  1P84 E;  3Q5R A;  3A7O A;  2PEJ A;  1JY2 P;  2Y9Y A;  1S9K D;  5KAI E;  1QX8 A;  2M3E A;  2HPC A;  2FBW C;  2KOS A;  3MZW B;  1HGV A;  4H44 D;  3L71 D;  2KOP A;  1SQB D;  1NYH A;  3CI9 A;  2FAC A;  2WSC J;  4DZO A;  2EHT A;  2FQ2 A;  1URQ B;  5APX A;  3UIA A;  1KIL E;  3HD7 D;  1ZRT D;  3EJE A;  2IZ0 A;  1OW8 A;  4PJ0 E;  2FAD A;  3GG2 A;  1ZLL A;  3CC7 P;  3CX5 D;  4WYM A;  3GW6 A;  2L91 A;  2R3C A;  1BSN A;  3G29 A;  2IFM A;  3A2A A;  3H6P A;  4KT0 J;  3CC4 P;  5AVR B;  1R5S A;  2ZVN B;  4Y99 B;  1K05 A;  1JJ2 O;  2KIK A;  3H1K E;  5TJH A;  2QSI A;  2GZJ A;  2H89 C;  3GF3 A;  4GOF A;  2BEZ F;  2ZXE B;  1HF9 A;  2KLV A;  3CXH D;  2WSS H;  1FZE A;  3M9H A;  1S5L E;  4BWN A;  4WY4 C;  1U7J A;  1ZW0 A;  1M57 D;  2LR2 A;  2JB0 A;  2L9F A;  3FX0 A;  4EI2 A;  1QL2 A;  2E75 C;  3G1I A;  3GZM A;  3L72 J;  2KLU A;  3GHG A;  2WTY A;  3I5C A;  2Z44 A;  1N7S D;  1VQP P;  1LWU A;  1SLQ A;  3U1A A;  2DW3 A;  2I1J A;  1RE4 A;  2I1K A;  1L0L K;  1RHZ B;  3AEB C;  3RL0 C;  1S4X A;  2IYO A;  3CCV P;  2FHS C;  1NJI Q;  1FE6 A;  2PEO A;  2FYN C;  4H13 C;  3GKL C;  2KNC B;  1QL1 A;  3KDP B;  2M3B A;  2QNW A;  1SVF A;  2AFE A;  1KYO H;  2WPR A;  3H0D A;  2WSF J;  3CWB J;  3RK3 C;  3LIE A;  1EIA A;  1PP9 E;  2O1J A;  3KYQ A;  4C7N B;  1E6J P;  1NHL A;  4XA4 A;  3I55 P;  3L36 A;  2WIT A;  3DS1 A;  1N73 A;  1A02 F;  2FFD A;  2JO0 A;  2POH A;  1M1J B;  2AEM A;  1G1J A;  1YHQ P;  2JAZ A;  1EZV D;  4XFZ A;  1PP9 G;  2HYN A;  3OW2 O;  3G3Z A;  1L2P A;  1HJ0 A;  1GW4 A;  4IL6 E;  4JQ0 D;  5AVV B;  2XND H;  2KOO A;  1BE3 J;  3DS5 A;  3MGE A;  1KQF B;  3FXD A;  1LNQ A;  1IFP A;  4PD4 D;  3LRY A;  1JY3 P;  2LF4 A;  3S4R A;  5AW5 B;  1HTL C;  2N5I A;  1LP1 B;  2LL8 A;  2UWJ E;  3KXD A;  3FWN A;  2W27 A;  2KUB A;  2ZXX A;  2Q5U A;  2B87 A;  5AVX B;  5GTI E;  2VLO A;  4I6M C;  2M5A A;  2A06 E;  3M06 A;  1DX7 A;  1X9V A;  3G4S P;  1NH4 A;  3TDK A;  2Q1K A;  3CCL P;  3EQ2 A;  4UHP B;  3SWY A;  1RE4 C;  2FKW B;  4H0L B;  2NPS B;  3KZI E;  1H0T B;  1SQX K;  4R4M A;  1FAV A;  1LTI C;  2HOD B;  1BE3 D;  2A06 G;  3L70 J;  3OAK A;  3CE7 A;  3PJS K;  1DEB A;  4H2X C;  4ASV A;  3NTE A;  4NEO A;  4OGQ D;  3IF4 A;  2QA4 P;  4DG9 A;  1U57 A;  5AVT B;  2AEF A;  4N78 E;  4XE5 B;  4BPG A;  4U3F E;  2J5U A;  3RK2 D;  2EG5 A;  1L0N K;  1RF0 A;  1N73 C;  1AUM A;  2LML A;  2FFD C;  5HV8 A;  4GKG A;  3E1I A;  1RF1 C;  4D6T E;  2X2B A;  1UIX A;  2GZI A;  1EC5 A;  2KR5 A;  3RG2 A;  3AE5 C;  1OVV A;  1NTZ J;  2KOQ A;  1IZN B;  4U3F G;  1JMM A;  1SFC D;  3BRV B;  2IBZ I;  1KB9 I;  2M8P A;  1LTT C;  5E79 E;  4D6T G;  1PGQ A;  1KMI Z;  1D1D A;  1LT9 B;  2V4H A;  2YKO A;  1L0I A;  3FWL A;  1T3U A;  3H1K D;  3PHL A;  5KTB A;  1JTH A;  3HRN A;  4H44 C;  3B4S A;  3CL3 D;  2YIU C;  2A45 I;  2BUO A;  1KQL A;  3L73 J;  1S2E A;  2P9X A;  1P84 H;  4LGD E;  3VMZ A;  3IAO A;  2CK3 H;  5CCH D;  2MVU A;  2FYU J;  1QVG O;  2WT7 A;  3B5I A;  1BXI A;  3M9Q A;  5KAI H;  1BSH A;  3HD7 C;  3L74 J;  2QM8 A;  3EJD A;  1Q7Y Q;  1H88 A;  2ITA A;  2IX7 C;  3BAS A;  2DGY A;  2E74 B;  2E76 D;  1RE3 C;  5AVY B;  3HUS B;  2GDY A;  2HG5 D;  3E2D A;  3V6I A;  5EW5 E;  2FY8 A;  4PJ0 H;  3CCR P;  3H1J D;  1LTJ C;  1X8Y A;  3A0H E;  1SQV E;  3MP7 B;  2W90 A;  1NU1 E;  3A5T A;  1Q2N A;  1W2E A;  1EDJ A;  3JCU H;  5JPA A;  3N7N A;  3CME P;  4TLF A;  2E5Y A;  2FVA A;  4IZ6 A;  1PGO A;  1AJY A;  2W6A A;  2KS1 B;  2QJK C;  2K88 A;  3L73 D;  3BCC J;  1N2D C;  3L75 E;  1SP4 A;  1SQB K;  3HE5 B;  4N3Y B;  3AEE C;  1OW6 A;  2FYU D;  4OVN F;  3B5N D;  2KG6 A;  2M5R A;  3G6E P;  1VQO P;  4RES B;  1VQM P;  3L74 D;  4NPE A;  1TU3 F;  1N7S C;  1IMQ A;  1GMJ A;  3VP8 A;  2M0B A;  5KLV J;  3L35 A;  1SQP J;  3ITK A;  5KAF E;  2ZFC A;  3L75 G;  2FQ1 A;  4RO0 A;  5AW2 B;  1QEX A;  2VSQ A;  1VQL P;  1NTM J;  3CCJ P;  2L0Q A;  2KZJ A;  2OYH B;  3GF7 A;  1GD2 E;  1KIL B;  1HQB A;  1T3J A;  1URQ D;  3WUU A;  2K0X A;  5K5G B;  4GDO A;  1ZXG A;  1HGZ A;  4BPH A;  3K5B A;  3PH0 A;  3AEC C;  2QEX P;  2JEE A;  2LTE A;  2QJP C;  4BRY B;  3SSU A;  2B89 A;  1OVU A;  1X0T A;  2K2Q A;  1AV1 A;  5DCK A;  1FS0 E;  2Z5I A;  3MD0 A;  1MKM A;  2OYO A;  1L4A B;  5KLV D;  1SQP D;  4CPG A;  2PEM A;  3R2P A;  2KXP B;  2Z5H A;  4IFF A;  2QG4 A;  3VRL C;  1FZC C;  2KK7 A;  3LW5 J;  1GZL A;  2MJZ A;  1IFM A;  4I7Z C;  1NTM D;  1OMI A;  3FGA D;  1VQ7 P;  3HUS C;  2GDW A;  4OH8 B;  2GZE A;  4HYT B;  5CJ0 A;  3AE3 C;  3VTP C;  3HYB A;  3L72 E;  1NAY A;  2ZVO B;  3GMA A;  5CCH A;  2N6Z A;  2O3J A;  2GA1 A;  1AA0 A;  2KYV A;  3W68 A;  2MR8 A;  3Q5S A;  1K9M Q;  4BXL A;  3CCS P;  3GLM A;  3P7K A;  4K35 A;  4WWI A;  1Y9B A;  2WPT A;  2D2C C;  3S1K A;  4HB1 A;  2LKI A;  3L72 G;  2J59 M;  3WMM 0;  5GTI H;  3NMD A;  2B88 A;  1WMK A;  2N1T B;  5CZD B;  1CZQ A;  1KV4 A;  3V2Q A;  2JJL A;  3CWB E;  2GUV A;  2YXQ B;  4OGQ C;  2GUS A;  2CPS A;  3KZI H;  3CD6 P;  1NQ4 A;  1NGM B;  4I1L A;  2KGA A;  2K9J B;  3T97 B;  2H8P D;  3RK2 C;  2KGE A;  2YO3 A;  3GZL A;  3II6 A;  3B5N A;  3CWB G;  2AFD A;  1OZH A;  2XNX A;  3H1I J;  1RQV A;  3V5B A;  4XFJ A;  2JKV A;  2G3A A;  3PP5 A;  3KQG A;  3JC2 2;  1SFC C;  1CEI A;  4RKU J;  1UJZ A;  2L5G B;  2OTJ P;  1SQQ D;  3H1L E;  3SFE C;  1SQV D;  1NTK J;  3AEG C;  1NU1 D;  2BCC E;  3JCU E;  1HWT C;  1URQ A;  1RY3 A;  2BEQ D;  3CX5 I;  3DS2 A;  1KQS O;  1KYO D;  2JQ4 A;  4COC A;  3H1H J;  5E79 H;  2WQY C;  3TK1 A;  1R8E A;  2XZ1 C;  3H1L G;  5KKZ B;  3EWK A;  5CCH C;  4OWF A;  2BCC G;  1YBK A;  4U0D A;  1HUC A;  4GIF A;  1JY2 N;  2IBZ E;  2K3R A;  2YO2 A;  1KB9 E;  2HLO A;  2V7Q H;  1VHN A;  4H0L D;  2CNR A;  2LPK A;  2NPS D;  5DJU B;  5I4T G;  3QWO C;  3H1I D;  5AW1 B;  4XRO A;  1L0L E;  2N50 A;  4H2Y C;  5KLI C;  2E76 C;  3CXH I;  3L70 E;  3R4Y A;  2Q3I A;  2E5T A;  5F2K A;  5KJ7 D;  3MIW A;  2IBZ G;  2WVR A;  3GHG B;  1LJ2 A;  1LWU B;  1NTK D;  2QJY C;  2OYI C;  2WWW A;  1L0L G;  3B8E B;  4M0I A;  3RBZ A;  1KQG B;  2R44 A;  3L70 G;  1X79 B;  2LIU A;  2A45 G;  3A0H H;  2JP3 A;  2RMZ A;  3H1H D;  1FJK A;  1BGY E;  4ZKU A;  1KTM A;  3DS4 A;  4XFY A;  3B5N C;  4L76 A;  4PH0 A;  1R5L A;  1M7L A;  3U43 A;  2WSE H;  4YXW H;  4XFX A;  1H8A A;  3NY7 B;  3HTK A;  2OAR A;  2NO8 A;  3C9I A;  1ZR2 A;  2JBG A;  4M3L A;  4U0A A;  2XKM A;  2J58 A;  1BGY G;  3N4X A;  4PV1 B;  1VQ6 P;  1VQN P;  2Z46 A;  4YTP C;  1RF1 A;  2ZJS E;  2PAJ A;  3CLQ A;  1J1E B;  2EFJ A;  4JBZ A;  1NTZ G;  2PY8 A;  1NTZ K;  5EJD A;  5AW4 B;  1URQ C;  4NPD A;  3P8C E;  2B9B A;  4C7N A;  1YTZ T;  5KAF H;  1ZNV A;  1EZV I;  3F89 A;  2XU6 A;  3TNU B;  1WT6 A;  3CXH H;  2KWL A;  2K93 A;  5CMZ A;  3RK3 E;  1CI6 A;  2I8D A;  1S72 P;  2E74 D;  1IK7 A;  2JU2 A;  2YNY A;  3EFG A;  2JYL A;  1AVY A;  4PD4 I;  1FJP A;  2FYU K;  2P67 A;  5AW8 B;  2KB7 P;  2WPV B;  1K73 Q;  4YPC A;  4Y99 C;  1SQX E;  2M8L A;  2O1K A;  5APU A;  2RKL A;  3HD7 A;  2PNG A;  2M5A B;  3CC2 P;  2Y0D A;  3O6Q A;  2JR8 A;  5AW7 B;  3A3Y B;  3WU2 H;  4TT3 H;  2CGQ A;  4ZMD A;  1LP1 A;  3CCQ P;  1FBM A;  4AUW A;  3TGU E;  1MZ8 A;  4IFD K;  1RE3 A;  1SQX G;  1OVR A;  3SWF A;  1H89 A;  4F37 A;  2Z4E A;  3VP9 A;  3HE4 B;  1N7L A;  1Q90 D;  1DD4 A;  1E0H A;  1U7M A;  1LTJ A;  1L0N E;  3Q3D A;  3G28 A;  1P84 D;  2NZ2 A;  3H1K J;  4W7Y A;  4KHX A;  1VPC A;  1Y47 A;  5APT A;  2ZYG A;  3TGU G;  4GR6 A;  1JY3 N;  2NPS A;  1KLP A;  2K92 A;  4L75 A;  2N5H A;  2XT1 A;  3V2P A;  1MV8 A;  3AEA C;  2ZYA A;  5BU5 A;  1KD1 Q;  1L0N G;  1S5L X;  4HKZ H;  1ZR4 A;  1FDI A;  1VDF A;  2QE7 H;  1VQ8 P;  1FZA A;  1KIL D;  5APW A;  1OR5 A;  1PPJ E;  3AE4 C;  3D6Y A;  2OTK E;  4KJM A;  2JWA A;  3V4Q A;  1N7S A;  5KLV K;  1SQP K;  3CCU P;  3G21 A;  4K3A A;  2N9B A;  5F2N A;  5HGO A;  5HGN A;  3MHV A;  1BCC E;  3H1J J;  2FXO A;  3V4W A;  1NTM K;  3TF5 A;  1PPJ G;  1KFN A;  3E1R A;  1JOC A;  2XDJ A;  1M1J C;  4UB6 H;  2KZI A;  3PTZ A;  3SWK A;  1JTH B;  3FXE A;  1FDO A;  3BAT A;  1G2C A;  1L4A D;  2P1J A;  1LTB C;  1BCC G;  1EDK A;  2Q3E A;  2WPQ A;  5C39 A;  1JCC A;  1L0L D;  5APV A;  2C9L Y;  1JCD A;  2VRS A;  1KOR A;  1GU5 A;  2ZAE B;  3G9R A;  2RN0 A;  2NRG A;  4EIJ A;  5AW0 B;  1IO4 A;  1HVV A;  1PGP A;  5KP6 B;  1YIJ P;  3L71 E;  2KP8 A;  2E1M A;  1MFT A;  1YTZ I;  1PZQ A;  1SQB E;  1MFZ A;  1FZC A;  2ZT9 B;  5APQ A;  1S1C X;  4WY4 D;  1PV3 A;  1ZV8 A;  1GXG A;  1J1D B;  1VF5 D;  2HFE D;  3ABV C;  4H0L C;  5CJ4 A;  2N98 A;  2NPS C;  1W5C E;  3HUS A;  1ZRT E;  1OIP A;  3H25 A;  4JYC A;  1ZOY C;  5KP7 B;  2GZG A;  2IZ1 A;  3M0D C;  3L71 G;  2N1T D;  2JGP A;  1PP9 D;  1SQB G;  3CX5 E;  2R3S A;  5KJ7 C;  1OWA A;  1KB9 H;  4WB4 A;  2R5B A;  3IFM A;  3G0V A;  5BU8 B;  3JSV C;  3EFF K;  1NVO A;  1QRJ A;  2PEN A;  2A45 H;  1T8K A;  3P8M C;  3B4Q A;  5TIS E;  2WPS A;  1UNK A;  1IJD B;  3CPW O;  1LTA C;  3CXH E;  1ZN5 A;  1T2K D;  3PRJ A;  3S9O A;  2KSJ A;  2O01 H;  3AE7 C;  3H32 B;  1AVO A;  1NKZ B;  1YJW P;  2IFN A;  2MR7 A;  5KP8 B;  1GL2 B;  4U3F J;  2LXB A;  3P05 A;  1LT9 C;  2OYH A;  2GM4 A;  3NTN A;  1KIL A;  3D6Z A;  3C1L A;  4Z1M H;  2C0X A;  2A06 D;  3WU2 E;  1IFN A;  3M0A A;  1M6E X;  1BDD A;  3QH9 A;  5CBN A;  1SFC A;  1NTK K;  1VQ5 P;  1Q86 Q;  3PLN A;  5EFW B;  4PH1 A;  1LGH B;  5GTH H;  1YYC A;  5F2O A;  4R4L A;  4U0B A;  2E74 C;  2CQ8 A;  3F5H A;  1FR2 A;  3RGU A;  1L4A A;  5CCG D;  2MVV A;  3W67 A;  2KOD A;  3V2N A;  2K37 A;  1LT1 A;  4N78 D;  1EOQ A;  4U3F D;  1IUQ A;  4C46 A;  1EZV E;  2LXC B;  4C7R A;  1F80 D;  1PPJ D;  1M56 D;  2YXR B;  4D6T D;  3I56 P;  1GPJ A;  3IN6 A;  4WY4 B;  1VF5 B;  1RO0 A;  3CCE P;  4MN4 C;  5APS A;  2JO1 A;  1HY8 A;  4PD4 E;  1SQQ J;  1EZV G;  1RQU A;  2H88 C;  4W80 A;  1SQV J;  2E75 B;  2LIW A;  2FXP A;  1NU1 J;  3Q5P A;  4UB6 E;  2JU1 A;  2FXM A;  2E42 A;  3SFD C;  2OYI A;  2XZ0 D;  1GU4 A;  4QMA A;  2E43 A;  5H2F E;  1IK9 A;  3AE8 C;  3A0B H;  4PV1 D;  3MGN A;  4CA3 A;  2N1T A;  2FYN B;  3L75 J;  2H7H A;  4H13 B;  2OYH C;  1KIL C;  2HPC B;  2GDX A;  2L4B A;  4HKG A;  3CMA P;  2Y9Z A;  4IPY A;  1HH0 A;  2AF8 A;  2YKQ A;  3RK3 B;  2RH0 A;  3VOP A;  5BS2 A;  3T97 A;  4AQR D;  1BE3 E;  3DS0 A;  2N9Y B;  1RNI A;  2QIW A;  1D7M A;  1OXZ A;  4GT1 A;  4JPZ B;  4XRQ A;  4JF7 A;  1DNY A;  2BAS A;  1BE3 G;  1L4A C;  4DT0 A;  1DV5 A;  3OJA B;  2L6E A;  1KYO I;  3LMO A;  1PGJ A;  4Y28 J;  1XTG B;  3L75 D;  1AF8 A;  3M91 A;  5B5E E;  1PEO A;  2P58 A;  2C0W A;  5HVC A;  2KG9 A;  3L37 A;  3P32 A;  2EIA A;  1GXH A;  1M8O B;  2HR3 A;  1IFJ A;  2SPZ A;  3LW5 H;  4QNB A;  1DH3 A;  2Y0E A;  1EXI A;  1BAJ A;  2Y0C A;  1Z56 A;  2GYK A;  2PFX A;  4YXD C;  2ZYD A;  1VF5 C;  1RO2 A;  4B86 A;  2O01 N;  2VLQ A;  4LC1 A;  5CCG A;  3H1K G;  3VMY A;  4W7Z A;  2K94 A;  2K5X A;  1JEK A;  2N1T C;  4N6J A;  2MF4 A;  1UII A;  1VL2 A;  1NTZ E;  3U59 A;  2XZR A;  1XTC C;  3HTK B;  1N86 A;  3VYI A;  1YJ9 P;  3H1J E;  2PP6 A;  3MUD C;  1GK6 A;  2WZ7 A;  2KGD A;  3CX5 H;  4BPF A;  7CEI A;  2KNC A;  1DD3 A;  1MZ9 A;  1EDL A;  1N73 B;  2PEK A;  2FFD B;  1RF1 B;  4U0F A;  4IFM A;  2KOG A;  5GTH E;  1T2K C;  3L73 E;  2KW2 A;  3H1J G;  1QGK B;  3U1C A;  2FQ0 A;  2K0D X;  1VQ9 P;  3RBX A;  4ZNC A;  5BS1 A;  2FYU E; 
#chains in the Genus database with same CATH homology
 1PEO A;  2QEX P;  1RO0 A;  1K73 Q;  3CPW O;  3DS3 A;  3G71 P;  1Q7Y Q;  3CCE P;  2XV6 A;  2M8L A;  3H47 A;  3CD6 P;  2DGY A;  3WBH A;  5HGM A;  1PEQ A;  2EIA A;  3H0D A;  3DTJ A;  3CC2 P;  3RG6 C;  4M0I A;  1EIA A;  1W2B O;  3NTE A;  3E2D A;  2ONT A;  1PEM A;  5DCK A;  3CCR P;  1YJW P;  1M1K Q;  1K30 A;  1Q81 Q;  3CCQ P;  1E6J P;  3CC7 P;  2QA4 P;  4QNB A;  1YI2 P;  3I55 P;  3DPH A;  3DS1 A;  1A43 A;  1M74 A;  3HZQ A;  4WYM A;  2PEI A;  5HGL A;  1BAJ A;  3DS4 A;  3P05 A;  4XFY A;  5JPA A;  2PEM A;  3CME P;  1QVF O;  3G29 A;  1VQK P;  2JO0 A;  4GR2 A;  2EG5 A;  4PH0 A;  1M6N A;  1YJN P;  3VRL C;  3CC4 P;  1RO2 A;  4XFX A;  3G28 A;  1YHQ P;  1AUM A;  2M8N A;  2OAR A;  3G26 A;  3Q20 A;  4XFZ A;  1N8R Q;  3OW2 O;  1M6E X;  1YIJ P;  2OTJ P;  2E1M A;  4COP A;  4U0C A;  1VQ7 P;  1JJ2 O;  4GR6 A;  1KC8 Q;  3CXC O;  3DS5 A;  2CWO A;  2XT1 A;  3G6E P;  1VQO P;  3MGE A;  3CMA P;  3HYB A;  1VQ6 P;  1VQN P;  1VQM P;  2Z46 A;  4IPY A;  1VQ5 P;  1Q86 Q;  5BS2 A;  1A8O A;  3DS2 A;  1KQS O;  2EFJ A;  1KD1 Q;  2BQ1 E;  2PY8 A;  3DS0 A;  4PH1 A;  4U0E A;  3LRY A;  1VQ8 P;  3G1G A;  2M8P A;  4COC A;  2LF4 A;  1YIT P;  5F2O A;  2XXM A;  1RNI A;  3M1M A;  2BHV A;  3CCM P;  1YJ9 P;  2OTL P;  1D1D A;  4U0B A;  1K9M Q;  3CCS P;  1PEU A;  1VQ4 P;  4XRQ A;  3G1I A;  2Z45 A;  4U0D A;  2KOD A;  3CCU P;  3G21 A;  2Z44 A;  2PEK A;  1VQP P;  1K8A Q;  5F2N A;  5HGO A;  1VQL P;  5HGN A;  3CCJ P;  2PEQ A;  1M90 Q;  1EOQ A;  2BUO A;  5I4T G;  4U0F A;  1Q82 Q;  1IUQ A;  2P9X A;  3G0V A;  2PEJ A;  1S72 P;  4XRO A;  1QRJ A;  1QVG O;  3G4S P;  3B5I A;  2L6E A;  2JYG A;  2PEN A;  3CCV P;  3H4E A;  2JYL A;  1NJI Q;  1ZMB A;  2PEO A;  5F2K A;  1VQ9 P;  3CCL P;  3I56 P;  5BS1 A;  4U0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...