1KC8Q

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kc8Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kc8Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kc8Q03
3CD6P 1VQ5P 1YI2P 1Q81Q 3CMEP 3OW2O 1K9MQ 1Q86Q 3G6EP 1YIJP 1JJ2O 1YHQP 3CCRP 1Q7YQ 1VQLP 1QVGO 3I56P 3CCQP 1VQOP 1YJWP 1VQKP 1KQSO 1VQPP 1VQ6P 1VQMP 3CC7P 2QA4P 1YJNP 3CCJP 1VQ9P 3CXCO 1NJIQ 3CCVP 1VQ7P 3CC2P 1K8AQ 3I55P 3CCEP 1VQNP 2OTLP 2OTJP 3CMAP 1N8RQ 1M90Q 1YJ9P 1YITP 1M1KQ 2QEXP 1KC8Q 1VQ8P 3CCMP 3G71P 3CCUP 1KD1Q 3CC4P 3CCSP 1W2BO 3G4SP 3CCLP 3CPWO 1S72P 1K73Q 1Q82Q 1VQ4P 1QVFO
chains in the Genus database with same CATH superfamily
1K9MQ 3A2AA 1NTKJ 4Y99C 3MGEA 3L73J 1VKUA 3S1KA 3CXHD 2XT1A 1OWAA 3RBZA 5B5EH 3CWBJ 1M6EX 3RL0D 3NFQA 1DEEG 2E74D 3CL3D 3EWKA 1PP9J 2FAEA 5AW5B 2IZ0A 1JY3N 3KPEA 1LT9A 4M3LA 1L0LK 1NVOA 2QSIA 2Y9ZA 4WVZA 1J1EC 1R5LA 4U0CA 4ASWA 2JO0A 4OGQB 2KGCA 3H1LE 3AE9C 3R4YA 1MV8A 2BCCG 1PPJD 1BE3E 1LP1A 2ZT9C 3Q5PA 4YXDC 3FX0A 2K0YA 3AE7C 2L9FA 3P32A 3G21A 2L22A 3H1HJ 3RK2D 2PEMA 1DD4A 4GIFA 2ZFCA 2N6YA 1KORA 2H7HA 4JBZA 2HPCA 3VYIA 1ZOYC 3GZMA 2KI7B 1NTME 3L37A 1SQBG 2M0BA 2JO1A 3MUDC 5KJ7D 2AFEA 2ZXEB 3CLQA 1QL1A 3OJAB 2KG6A 1N73B 1LTTC 1SQQK 2KYVA 1X0TA 1NTKG 2B87B 1RE3C 1RF1C 3L75D 3P8CE 1SQPK 5F2KA 2M8LA 3A5TA 1CW5A 4U0FA 1J2JB 1SFCA 2M3BA 3H1LD 1OIPA 4HKZH 2E75D 3H32B 4PXHB 1DH3A 5E79E 2YXQB 3L70G 1NO4A 5KAFH 3EQ2A 2Q9IA 1KB9E 1J1DC 2B88A 1L0HA 5AVYB 1X22A 2A06E 3JSVC 5BVZA 3LIEA 2N5IA 1KTMA 2E76C 2Z5HA 1KYOH 2A45H 3E7KA 2YO3A 3DS2A 1CI6B 3E1IA 1S2EA 4BPHA 2ZYAA 4GR2A 2KSJA 1N7SC 3WUTA 3SWKA 2R3SA 5CJ4A 4KHXA 3CMAP 1CZQA 2C9LY 4B86A 1CI6A 3SWYA 4W80A 2H43A 2H88C 2V7QJ 1SQVD 1NTMD 3AE2C 2P9XA 1Q86Q 1RO2A 1HQBA 3DS0A 2R5DA 5KLVK 5CHXA 2N98A 5CCGD 3CCEP 2OTLP 2N9BA 2ZAEB 4Y28J 1IO4A 2JB0A 3U1AA 5HGNA 3L71D 2N50A 2MKVA 2NPSD 5H2FH 3SSUA 4LGDE 1NTKK 2WSFJ 1MFTA 2IX7C 3LW5J 4RJTA 1SFCB 1HWTC 2J5UA 1EIAA 1NTZE 3QWOC 3H47A 1SQPJ 2AFDA 2JAZA 3TK1A 1LTBC 2PENA 1L0LJ 4XROA 2LTEA 3P8MC 1JJ2O 1EXJA 3IF4A 4GDOA 2MD9A 5AW1B 4EYYQ 5KJ7C 1AQTA 4XA4A 2E42A 1H0TB 3H1IJ 3GLMA 1XTCC 1YJ9P 2WQYC 4L74A 1FJKA 2A06D 1KD1Q 1URQA 4UB8H 2Q5UA 1L0NG 1LWUA 1Q82Q 1HGVA 1ZXGA 1JMMA 4W7ZA 2HPCB 5KKZC 3N4XA 3FGAD 1QVGO 3II6A 2Y0CA 2I1KA 1S5LH 2OGUA 2K37A 1VQNP 5BU8B 4H0LD 1PGQA 3NY7B 2K2QA 4H44D 4H13C 2IBZG 3M0AA 1GXGA 2QRXA 1E6JP 2P2UA 3CCLP 2LKIA 1NU1G 3HD7C 1URQD 3RK2C 2CQ8A 2MVVA 1U7MA 4H44B 3H25A 1USDA 3G3ZA 2HODA 3CXHH 2OTJP 1LT9B 4UB6H 2FVEA 2YIUB 3AEBC 3CCUP 5APVA 2QM8A 1ZR4A 3MD0A 1HF9A 1IFPA 1KV4A 3VMYA 2O01N 2PEKA 5KP8B 3RK3C 2HR3A 2N9YB 2JGPA 4DT0A 3A0BH 3CX5E 1NQ4A 1OW8A 5AVWB 2CPSA 1BXIA 1L0ND 5BS2A 2OYIC 1KLPA 2LF4A 1P84E 3CXHI 5KP7B 3SFDC 2HLOA 2W27A 3A7OA 2G8YA 3HRNA 2KG8A 1ZRTE 5AVVB 1T8KA 2M8NA 2Y0EA 5DJTB 4K3AA 2XKMA 2EIAA 1N7LA 3HE5A 1FR2A 3P05A 2QVAA 5APYA 1VQOP 2P67A 1HTLC 3RK3E 4U3FD 1FE6A 4R0MA 2XZ0D 3WMM0 2KS1B 2KG9A 2P1JA 4U7JA 3EJDA 5AW0B 3L71G 4I7ZB 2LXCB 4QMAA 4DG9A 3CCRP 1SQQJ 5F2OA 4H2YC 1KB9I 1L4AC 1ZLLA 2FYUD 3PH0A 4PWVB 2GDYA 1SLQA 1VQ9P 1FZCC 3DTJA 1N8RQ 3AEFC 1M90Q 4U3FJ 2BEQD 1KFNA 1S4XA 4RO0A 1X3OA 1S5LE 5AW3B 2K0DX 2ZVOB 1FZAA 1GZLA 1UIIA 3A0BE 4HYTB 2JR8A 2E76B 2D2CD 1JY3O 2BEZF 1G1IA 2QE7H 2FYUJ 3G9RA 2P7JA 4N6JA 2NPSC 1FDOA 1A02F 2BUOA 1FC2C 2E5TA 4IL6E 1M1JC 3CXHE 2ZVNB 3L75G 2FQ0A 4N78D 1FAVA 1K30A 1JEKA 1L0LE 2XV6A 2XNDH 1FZCB 4WWIA 4DCKA 1DD3A 5I4TG 2FFDC 1T3JA 3M0DA 4OVNF 1PGOA 2EHTA 2OYIA 2GA1A 1JTHA 5AW9B 1EZVE 1OMIA 2A06G 2NO8A 2W90A 3CX5I 3RK3B 3GHGB 2WT7B 3G28A 5APQA 1FJPA 1ZNVA 5HV8A 3E2DA 4JYCA 1VQPP 4ASVA 2FVFA 2L91A 4YTPC 1BGYG 1G2CB 1LTGC 4BPFA 5CMZA 3CCMP 1EDKA 2C0WA 3Q5SA 3VRLC 1FDIA 2YKOA 1YYCA 4GKGA 1PP9G 1EDLA 2GUSA 1JY3P 7CEIA 2LIUA 1YQ3C 2M8RA 3HTKB 3AEAC 3U43A 1P84I 1RH5B 1SQXK 3I55P 1MKMA 2RKLA 2YKQA 3GHGA 2HG5D 3LW5H 3NTEA 1GD2E 2FKWB 2IBZD 2M3EA 1SQVK 1MUUA 1SQXJ 1NTZJ 2PNGA 2DW3A 4PV1C 3FXEA 2KLUA 2JJLA 3GJNA 1ACPA 3BCCE 3FWLA 5KKZB 4Z1MH 2GM4A 1URQC 3L70D 2WTYA 3G29A 2WSCH 3OAKA 4GOEA 1FOSE 2EFJA 2K0XA 3CMEP 5AW4B 1BCCD 5AVXB 1K05A 3GF3A 3HE4A 3W68A 2H89C 1VQMP 1OW7A 3HUSA 2XV5A 1N86A 3H1KG 4WB4A 4ZMDA 1GW4A 3CCSP 3G4SP 4AUWA 1RE4A 3CD6P 2PAJA 2W6BA 1L0NE 3L73G 2LR2A 1LTJA 4BRYA 1SQVE 1GK6A 1MZ9A 1SQQD 3H1HE 4HH2A 1YBKA 4IFFA 3H1JE 1JCCA 4COCA 2O1KA 3C1LA 2KS1A 1SQBD 2IBZE 3V4QA 2FYNB 3A3YB 3JCUH 2Z5IA 4XFJA 1K04A 2KORA 1NHLA 2XU6A 3PP5A 5GTIH 1LGHB 5KLVG 3C8VA 2FYNC 3IFMA 3BCCD 2JP3A 2IFMA 1UIXA 3M1MA 3H1KE 3ABVC 4IPYA 2ROQA 3NMDA 4L73A 3FWNA 3L74E 2QJPC 1RQUA 3AE6C 1BE3D 1GXHA 3V2QA 3KDPB 3IN6A 1N7SD 1ZMEC 2XDJA 3PJSK 3AE8C 3HZQA 3QH9A 2YO2A 4KJMA 4UHPB 3VP8A 4GODA 4O9BA 3CCQP 4RESB 1IZNB 2GDWA 1SQQE 2KK7A 2K1AA 2E75C 4I7ZC 1JNMA 1S5LX 1FDMA 3RK2B 1KQFB 1LT1A 3CPWO 1AV1A 4C7RA 1SFCC 2X2BA 1NTMK 5TISE 3TGUG 2KLVA 4M0IA 4L75A 5KP6B 1A43A 5KLVD 1HJ0A 3L73E 1OXZA 3O6QB 1OVUA 3U1CA 2MVUA 2PGDA 1SQPG 1VHNA 1L4AA 2B9BA 1AUMA 5AVSB 3OA7A 1NTKD 1JM0A 1OFCX 2QIWA 3L72G 1KN7A 3MUDA 4DOJA 1QRJA 3G6EP 1D1DA 2C0XA 3GHGC 3MIWA 3PTZA 3GMAA 2RH0A 1OZHA 3CC7P 3H1IG 2OYHB 2FXMA 1CEIA 2B89A 2ZYGA 1Q90D 3L72D 1LWUB 4EI2A 3EJBA 1KB9D 2FFDB 4KT0J 1IFJA 3BASA 4CA3A 1KYOI 2A45I 3EFGA 4XFYA 3V2PA 3KZIH 3HE4B 4CPGA 3AE4C 5APTA 2GZJA 1M8OB 1NTMG 3L74D 1YTZT 4MRTC 1SQVG 2VLNA 1BCCG 4OGQC 1Y47A 1S3JA 2QNWA 1BDDA 2AXTE 3NTNA 1OVVA 2CGQA 1ZRTD 1NU1J 4H44C 5APXA 1IMQA 2PFXA 2ZT9D 1F80D 2BCCJ 2LL8A 1YJNP 1IFNA 1QX8A 1FZEA 2VRSA 3LMOA 1OR5A 4L76A 4R4MA 1A8OA 2MJZA 1FU1A 1W2BO 4C46A 2MY5A 3V6IA 1WMKA 4PD4I 2NPSB 4H2WC 2AXTH 1QEXA 2Q3IA 2CNRA 1BCCE 4PH1A 2L5GB 1H8AA 5CCGA 3Q20A 3L73D 3H6PA 1PPJG 2KZIA 1CSBA 3BCCJ 4QKOA 2JEEA 1PGJA 3H1JG 1Z6MA 2KWLA 1QVFO 1UNKA 4NPDA 2KXPB 1EMVA 5KLIC 4H0LC 1FBMA 3DS3A 5B66H 5B5EE 2FXPA 4F37A 3M9BA 1K8AQ 3NXSA 2BHVA 1NTZK 3L35A 2OYIB 3I5CA 2G3AA 2WPTA 3EFFK 1IFDA 1BAJA 2LPKA 3R2PA 4JPZB 3V2NA 4IL6H 1H88A 1SQPE 2D2CB 1SQXD 2XNXA 2N5HA 4AQRD 2PP6A 1HGZA 3L75E 2HYNA 2K3RA 2O1JA 3P8CD 2E75B 5H2FE 3OW2O 2V7QH 2KIKA 1NWQA 5E79H 3H1KD 2NZ2A 5APSA 2KOQA 2QJYC 1PV3A 1LWUC 3PHLA 4ZNCA 3D71A 3ZDMA 2E5YA 1QGKB 3Q2YA 1KMIZ 2J59M 2KUBA 1LTIC 2GZIA 3HE5B 2KNCA 1DV5A 2CG5B 2OTKE 1VF5C 1IC2A 1GK4A 2Y9YA 3T97B 1WRGA 3L74G 2QJPB 2IDBA 3V4WA 1BGYD 3H1JJ 2PEIA 3B5IA 1HJBA 2FYUG 1IK9A 1SFCD 1AQ5A 1RNIA 3BRTB 5C39A 4WY4C 2E43A 1JCDA 1QLED 1GL2A 3TSIA 4NPFX 1Q7YQ 2FVAA 2MF4A 3B5ND 3AEGC 4H13D 2K9JB 4TLFA 1EZVG 1M1JB 5KLVE 2VLOA 1S1CX 1T2KC 4XFZA 1SS1A 1Y9BA 1SQBK 3F89A 1JY2O 2J58A 1KQLA 2RN0A 3V5BA 1DX7A 2L4BA 1AJYA 1HVVA 1P84H 5AVQB 2PEJA 2SPZA 5CCHC 1KYOE 2Z45A 3H4EA 1EZVI 3L71E 3M0DC 3W67A 2R3CA 3AEDC 3KXDA 1IUQA 3AECC 1GPJA 3JC22 3VMAA 5KAIE 1D7MA 5CBOA 3LRYA 3RK3D 3CWBG 3AEEC 1N73C 1GMJA 1SQQG 2IYOA 3L70E 1GU5A 1RO0A 5AVZB 4HB1A 2EG5A 4OGQD 1EDIA 2GZGA 3MHVA 1FZGA 3B5NC 4TT3H 3WUUA 2M5RA 3GKLC 1URQB 1VQ4P 3B71A 5AW7B 3WBHA 3M06A 1BE3G 3GW6A 2GZEA 3HD7D 5HGLA 2FACA 1H0TA 1AA0A 2WSEJ 2HODB 1E79H 3DS1A 2Q6QA 1T3UA 1AF8A 3TNUB 2N1TC 1R8EA 2KW2A 1JY2P 4JQ0D 3G1IA 1N7SB 3G26A 2WPSA 3D6YA 2WSCJ 3O8ZA 2IZ1A 1EOQA 2AEMA 1PGPA 3CXCO 4UB6E 4AYCA 2M5AA 4BXLA 4RKUJ 1XTGB 1FS0E 3VTPC 3IR9A 2JU2A 5K5GB 1M57D 2AF8A 3H1ID 1RY3A 1KILE 4WBAA 1VQ6P 3CX5H 3CX5D 2FADA 3N7NA 3RGUA 1PP9D 2KR5A 3L36A 1GU4A 5KAIH 2WPQA 1DNYA 2ZT9B 2P10A 1KYOD 5AVRB 3CWBE 1RF0A 1KILA 1T8ZA 1LT9C 3RG6C 4PJ0E 2KOPA 1NKZB 1M1JA 2K9JA 1NH4A 1RE4C 1E5WA 2YMKA 3L70J 2QEXP 2WPRA 4H0LB 4OH8B 4EDFA 3LIDA 3SWFA 2M8PA 3H1LJ 1SQXE 1P84D 1RF0C 3B8EB 1NTZG 5AW8B 2QG4A 3BATA 3TGUE 2Z46A 3VN0A 1NYHA 1RF1A 1FZFA 2QA4P 4GT1A 3CCJP 2E76D 2Q1KA 3CI9A 1EXIA 2NPSA 2KOSA 1YITP 3T97A 2LKMA 2JYGA 1IK7A 2KNCB 3TYYA 3H32A 4PV1B 1S9KE 4UB8E 1BSNA 2IYPA 2QJYB 1T6AA 5APUA 4U3FG 1PEQA 1J1EB 1VQKP 2Y0DA 2K88A 5APWA 2FQ1A 1HH0A 4U3FE 1RE3A 2BCCE 2XZRA 4WY4D 2LIWA 1NU1D 3CC4P 2PRRA 4H13B 3RL0C 3TGUJ 3CE7A 2QJKB 1GW3A 4HJGH 2K92A 5CCGC 2FYUE 1LTJC 2WPVB 4YXWH 1T2KD 2KGDA 5M1BA 1NTZD 5BU5A 1NGMB 1LJ2A 1MFZA 2FFDA 1PP9E 2YXRB 2K93A 2Z4EA 1AYIA 1ZV8A 2RMZA 1PEMA 3GG2A 2M5AB 3Q5RA 3AE3C 4IOIH 2WITA 2FBWC 4DZOA 1KQSO 4EIJA 3HTKA 1L0LG 2OYHC 4I1LA 1EDJA 2W8ZA 3IAOA 3WU2E 3C9IA 1KILC 3FXDA 5EFWB 3TNUA 2NRGA 3O6QA 1BSHA 1L0LD 1A02J 1JMBA 4COPA 1NKNA 2AEFA 1L0NJ 4Y99B 4PH0A 2GYKA 1DIPA 3CCVP 2C9NY 1NTMJ 2Z44A 2KOGA 3ITKA 4BWNA 2E1MA 3E1RA 3KZIE 2V4HA 1LTAC 1L0IA 3BVHA 4PD4H 2WZ7A 1JTHB 4H2XC 1Q81Q 1M74A 2KGEA 3S9OA 4D6TE 1G1JA 1YJWP 3VOPA 2W6AA 1U7JA 3K5BA 3DS4A 4OWFA 1LP1B 4R4LA 1JO5A 3GF7A 4PJ0H 1W5CE 4BPGA 1OW6A 2FYZA 1VL2A 2CWOA 3H1HG 2N1TA 2AVAA 2ERHA 4JYBA 2N1TD 3AE1C 1BDCA 3VMZA 1AVYA 3H0DA 1ZR2A 2JBGA 2KOOA 1W2EA 2A45G 2FHSC 2VLQA 4YPCA 3UIAA 2JDIH 5KJ7A 4U0BA 2H8PD 2ONTA 3B4QA 3H1IE 2YIUC 1ZN5A 3MTUE 2ZJSE 2MR7A 1GL2B 3G71P 5CJ0A 1HUCA 4N3YB 3HYBA 1ZW0A 4BRYB 1KQGB 2JKVA 1PPJE 1LTJB 2BQ1E 2GDXA 3KQGA 1BCCJ 3KHUA 4ZKPA 4U0DA 1E0HA 1BGYE 3A0HH 1OVRA 4LLHA 2W6JH 3M91A 1H89A 2WSSH 1OX3A 1YTZI 3H1HD 1PEUA 2R5BA 2I8DA 2K9YA 3HD7A 2LXBA 2Q7CA 2KGAA 5GTIE 4IL6X 2KZJA 5AVTB 2KB7P 1J1DB 3MZWB 3L74J 5DJUB 4WY4A 4PD4D 1VDFA 3VMXA 1QL2A 1LNQA 5EJDA 1MZ8A 2BASA 1KC8Q 1KFMA 1NAFA 2OQQA 2BCCD 2CK3H 3M9QA 4XRQA 3B5NA 3PLNA 3I56P 3G1GA 3HUSC 3D70A 1FZBA 2N1TB 2ZXXA 2LOLA 2WSEH 3D6ZA 4MN4C 2JQ4A 5CBNA 3RL0g 2P58A 1LTSC 5EW5E 2QJKC 3P7KA 1G2CA 2L0QA 4ZKUA 2YMYA 4K35A 1TU3F 2K94A 5TISH 3Q1MA 3WUVA 2PY8A 3L72J 3B4SA 2WT7A 5CCHA 4EOTA 1L2PA 1VF5D 5CCHD 2MR8A 2LMLA 1GDTA 1BGYJ 1SQPD 3MGNA 1SVFA 1X9VA 2JWAA 1FZCA 2DNWA 3TF5A 1R5SA 1N2DC 4PD4E 2YNYA 4NEOA 4D6TJ 1KILD 2FQ2A 2ZYDA 2QM7A 1IFMA 4C7NB 1RHZB 1Y8AA 1M6NA 3DS5A 2OYOA 1NTKE 1VQ5P 1SQVJ 5HGMA 4LC1A 2AEJA 2E74B 1DEBA 5B66E 5BS1A 5TJHA 2WSFH 1NU1K 2Q3EA 1K73Q 1Z56A 2OYHA 5AW6B 1UJZA 2R44A 5HGOA 5HVCA 1RF1B 1FOSF 2YKPA 4XE5B 5F2NA 3CWBD 1IJDB 4HKGA 2IPPA 3A0HE 1AVOA 1L4AB 1X8YA 1L0NK 4JF7A 5KTBA 4WYMA 4C7NA 3SFEC 2IFNA 3AE5C 1M56D 2KSEA 1EC5A 2UWJE 1IFIA 4U0EA 1ZP0C 2PEQA 2GUVA 3BCCG 2GZFA 5L8RJ 2KP8A 1S9KD 4N78E 1L4AD 2XZ1C 2PEOA 5GTHH 2L6EA 1VPCA 1JUNA 3M9HA 3TGUD 4IFDK 1VQ7P 2ITAA 2FY8A 1PIXA 3GZLA 4D6TG 1SQBE 1EZVD 1PFIA 1YIJP 1JB0J 1NU1E 3G0VA 4WY4B 3V2RA 3L4FA 5JPAA 3S4RA 3CC2P 1ZMBA 4IZ6A 4GOFA 2D2CC 2XXMA 3MP7B 2WMMA 3H1LG 2W83C 5KLVJ 2K5XA 1X79B 4QNBA 2JYLA 1BE3J 2OARA 2O01J 1AFOA 2VLPA 2VSQA 2FYUK 3RBXA 3B5NB 1PL5A 5KAFE 3USSA 1USEA 3F5HA 2HFED 1JY2N 3DPHA 1KILB 3JCUE 1GL2D 5KLIB 1N7SA 1HY8A 3L71J 1VQ8P 4A7PA 3RG2A 2B87A 1JOCA 2JWDA 2AXCA 2N6ZA 2O01H 1PZQA 1N73A 2EHSA 2KODA 3KYQA 4NPEA 2IBZI 1Q2NA 2R32A 5AW2B 1M1KQ 4I6MC 5DCKA 1NAYA 1EQ7A 4U0AA 1IMPA 2WVRA 1NOHA 1PEOA 3HD7B 1SQXG 1YHQP 5AVUB 2O3JA 3VP9A 3EJEA 5GTHE 2FXOA 1KB9H 1NJIQ 3WU2H 2POHA 2E74C 4I2LC 4XFXA 3RL0B 1HBWA 4D6TD 4DJGA 3L72E 2WWWA 1KZUB 5CZDB 1VF5B 1WT6A 1S72P 4GR6A 3L75J 1YI2P 1GL2C 3HUSB 1VQLP 2I1JA 1SQBJ 2JU1A 1YQ4C 3Q3DA 1SP4A 4PV1D 3U59A 4W7YA 2DGYA 3H1KJ 2CPBA 1U57A 3TDKA 1RQVA 3PRJA 1M7LA 1GTWA 3H1JD 3BRVB 4IFMA
chains in the Genus database with same CATH topology
4QNBA 1VQ5P 2JYLA 1K9MQ 2OARA 4IPYA 5F2KA 2CWOA 1BAJA 3MGEA 5HGMA 2M8LA 2PEKA 4XFYA 1EIAA 1VQ6P 4U0FA 2PEJA 2XT1A 3H47A 2Z45A 3H0DA 3DPHA 5BS1A 1M6EX 3H4EA 2BUOA 1KC8Q 1IUQA 3G29A 5BS2A 3HZQA 2LF4A 1K73Q 2EFJA 1VQ8P 2PENA 1PEMA 3CMEP 3RG6C 3OW2O 4XROA 3LRYA 4XRQA 1K30A 1JJ2O 4U0BA 2ONTA 2XV6A 5HGOA 3I56P 1RO0A 3CCQP 1KQSO 5I4TG 2KODA 1VQMP 3G1GA 2EG5A 1YJNP 5F2NA 4U0CA 2JO0A 2M8NA 1YJ9P 1A8OA 1M1KQ 2QEXP 2EIAA 3G71P 5DCKA 2M8PA 1KD1Q 3CCSP 1W2BO 3G4SP 4WYMA 3CPWO 1Q82Q 4U0AA 3HYBA 1VQ4P 3DS2A 3WBHA 3CD6P 1PEOA 3G21A 4M0IA 4U0EA 3G28A 5HGLA 1YHQP 3P05A 2PEQA 2Z46A 4COPA 1QVGO 1VQOP 4GR2A 3E2DA 1A43A 1VQPP 3DS1A 2PEMA 4PH0A 2QA4P 3CCJP 2PEIA 1NJIQ 2BQ1E 3B5IA 2PY8A 2PEOA 4PH1A 3CCVP 1VQNP 4COCA 2L6EA 2Z44A 3CMAP 4XFXA 2E1MA 3Q20A 1YITP 4U0DA 3CCMP 2JYGA 3G1IA 1E6JP 1RNIA 3G26A 3CCLP 1AUMA 1S72P 3VRLC 1VQ7P 1QVFO 4GR6A 1YI2P 1Q81Q 2P9XA 1Q86Q 1M74A 1RO2A 1QRJA 3G6EP 1YIJP 1D1DA 3CCRP 1Q7YQ 3DS0A 1VQLP 5F2OA 1EOQA 1PEQA 3G0VA 1YJWP 1VQKP 3DS3A 3CC7P 1VQ9P 3CXCO 1PEUA 5JPAA 3CC2P 1ZMBA 3CCEP 1K8AQ 3I55P 2OTLP 2OTJP 2DGYA 2BHVA 3DTJA 3DS4A 1N8RQ 1M90Q 2XXMA 3NTEA 5HGNA 1M6NA 4XFZA 3M1MA 3DS5A 3CCUP 3CC4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 P;  1VQ5 P;  1YI2 P;  1Q81 Q;  3CME P;  3OW2 O;  1K9M Q;  1Q86 Q;  3G6E P;  1YIJ P;  1JJ2 O;  1YHQ P;  3CCR P;  1Q7Y Q;  1VQL P;  1QVG O;  3I56 P;  3CCQ P;  1VQO P;  1YJW P;  1VQK P;  1KQS O;  1VQP P;  1VQ6 P;  1VQM P;  3CC7 P;  2QA4 P;  1YJN P;  3CCJ P;  1VQ9 P;  3CXC O;  1NJI Q;  3CCV P;  1VQ7 P;  3CC2 P;  1K8A Q;  3I55 P;  3CCE P;  1VQN P;  2OTL P;  2OTJ P;  3CMA P;  1N8R Q;  1M90 Q;  1YJ9 P;  1YIT P;  1M1K Q;  2QEX P;  1KC8 Q;  1VQ8 P;  3CCM P;  3G71 P;  3CCU P;  1KD1 Q;  3CC4 P;  3CCS P;  1W2B O;  3G4S P;  3CCL P;  3CPW O;  1S72 P;  1K73 Q;  1Q82 Q;  1VQ4 P;  1QVF O; 
#chains in the Genus database with same CATH topology
 1K9M Q;  3A2A A;  1NTK J;  4Y99 C;  3MGE A;  3L73 J;  1VKU A;  3S1K A;  3CXH D;  2XT1 A;  1OWA A;  3RBZ A;  5B5E H;  3CWB J;  1M6E X;  3RL0 D;  3NFQ A;  1DEE G;  2E74 D;  3CL3 D;  3EWK A;  1PP9 J;  2FAE A;  5AW5 B;  2IZ0 A;  1JY3 N;  3KPE A;  1LT9 A;  4M3L A;  1L0L K;  1NVO A;  2QSI A;  2Y9Z A;  4WVZ A;  1J1E C;  1R5L A;  4U0C A;  4ASW A;  2JO0 A;  4OGQ B;  2KGC A;  3H1L E;  3AE9 C;  3R4Y A;  1MV8 A;  2BCC G;  1PPJ D;  1BE3 E;  1LP1 A;  2ZT9 C;  3Q5P A;  4YXD C;  3FX0 A;  2K0Y A;  3AE7 C;  2L9F A;  3P32 A;  3G21 A;  2L22 A;  3H1H J;  3RK2 D;  2PEM A;  1DD4 A;  4GIF A;  2ZFC A;  2N6Y A;  1KOR A;  2H7H A;  4JBZ A;  2HPC A;  3VYI A;  1ZOY C;  3GZM A;  2KI7 B;  1NTM E;  3L37 A;  1SQB G;  2M0B A;  2JO1 A;  3MUD C;  5KJ7 D;  2AFE A;  2ZXE B;  3CLQ A;  1QL1 A;  3OJA B;  2KG6 A;  1N73 B;  1LTT C;  1SQQ K;  2KYV A;  1X0T A;  1NTK G;  2B87 B;  1RE3 C;  1RF1 C;  3L75 D;  3P8C E;  1SQP K;  5F2K A;  2M8L A;  3A5T A;  1CW5 A;  4U0F A;  1J2J B;  1SFC A;  2M3B A;  3H1L D;  1OIP A;  4HKZ H;  2E75 D;  3H32 B;  4PXH B;  1DH3 A;  5E79 E;  2YXQ B;  3L70 G;  1NO4 A;  5KAF H;  3EQ2 A;  2Q9I A;  1KB9 E;  1J1D C;  2B88 A;  1L0H A;  5AVY B;  1X22 A;  2A06 E;  3JSV C;  5BVZ A;  3LIE A;  2N5I A;  1KTM A;  2E76 C;  2Z5H A;  1KYO H;  2A45 H;  3E7K A;  2YO3 A;  3DS2 A;  1CI6 B;  3E1I A;  1S2E A;  4BPH A;  2ZYA A;  4GR2 A;  2KSJ A;  1N7S C;  3WUT A;  3SWK A;  2R3S A;  5CJ4 A;  4KHX A;  3CMA P;  1CZQ A;  2C9L Y;  4B86 A;  1CI6 A;  3SWY A;  4W80 A;  2H43 A;  2H88 C;  2V7Q J;  1SQV D;  1NTM D;  3AE2 C;  2P9X A;  1Q86 Q;  1RO2 A;  1HQB A;  3DS0 A;  2R5D A;  5KLV K;  5CHX A;  2N98 A;  5CCG D;  3CCE P;  2OTL P;  2N9B A;  2ZAE B;  4Y28 J;  1IO4 A;  2JB0 A;  3U1A A;  5HGN A;  3L71 D;  2N50 A;  2MKV A;  2NPS D;  5H2F H;  3SSU A;  4LGD E;  1NTK K;  2WSF J;  1MFT A;  2IX7 C;  3LW5 J;  4RJT A;  1SFC B;  1HWT C;  2J5U A;  1EIA A;  1NTZ E;  3QWO C;  3H47 A;  1SQP J;  2AFD A;  2JAZ A;  3TK1 A;  1LTB C;  2PEN A;  1L0L J;  4XRO A;  2LTE A;  3P8M C;  1JJ2 O;  1EXJ A;  3IF4 A;  4GDO A;  2MD9 A;  5AW1 B;  4EYY Q;  5KJ7 C;  1AQT A;  4XA4 A;  2E42 A;  1H0T B;  3H1I J;  3GLM A;  1XTC C;  1YJ9 P;  2WQY C;  4L74 A;  1FJK A;  2A06 D;  1KD1 Q;  1URQ A;  4UB8 H;  2Q5U A;  1L0N G;  1LWU A;  1Q82 Q;  1HGV A;  1ZXG A;  1JMM A;  4W7Z A;  2HPC B;  5KKZ C;  3N4X A;  3FGA D;  1QVG O;  3II6 A;  2Y0C A;  2I1K A;  1S5L H;  2OGU A;  2K37 A;  1VQN P;  5BU8 B;  4H0L D;  1PGQ A;  3NY7 B;  2K2Q A;  4H44 D;  4H13 C;  2IBZ G;  3M0A A;  1GXG A;  2QRX A;  1E6J P;  2P2U A;  3CCL P;  2LKI A;  1NU1 G;  3HD7 C;  1URQ D;  3RK2 C;  2CQ8 A;  2MVV A;  1U7M A;  4H44 B;  3H25 A;  1USD A;  3G3Z A;  2HOD A;  3CXH H;  2OTJ P;  1LT9 B;  4UB6 H;  2FVE A;  2YIU B;  3AEB C;  3CCU P;  5APV A;  2QM8 A;  1ZR4 A;  3MD0 A;  1HF9 A;  1IFP A;  1KV4 A;  3VMY A;  2O01 N;  2PEK A;  5KP8 B;  3RK3 C;  2HR3 A;  2N9Y B;  2JGP A;  4DT0 A;  3A0B H;  3CX5 E;  1NQ4 A;  1OW8 A;  5AVW B;  2CPS A;  1BXI A;  1L0N D;  5BS2 A;  2OYI C;  1KLP A;  2LF4 A;  1P84 E;  3CXH I;  5KP7 B;  3SFD C;  2HLO A;  2W27 A;  3A7O A;  2G8Y A;  3HRN A;  2KG8 A;  1ZRT E;  5AVV B;  1T8K A;  2M8N A;  2Y0E A;  5DJT B;  4K3A A;  2XKM A;  2EIA A;  1N7L A;  3HE5 A;  1FR2 A;  3P05 A;  2QVA A;  5APY A;  1VQO P;  2P67 A;  1HTL C;  3RK3 E;  4U3F D;  1FE6 A;  4R0M A;  2XZ0 D;  3WMM 0;  2KS1 B;  2KG9 A;  2P1J A;  4U7J A;  3EJD A;  5AW0 B;  3L71 G;  4I7Z B;  2LXC B;  4QMA A;  4DG9 A;  3CCR P;  1SQQ J;  5F2O A;  4H2Y C;  1KB9 I;  1L4A C;  1ZLL A;  2FYU D;  3PH0 A;  4PWV B;  2GDY A;  1SLQ A;  1VQ9 P;  1FZC C;  3DTJ A;  1N8R Q;  3AEF C;  1M90 Q;  4U3F J;  2BEQ D;  1KFN A;  1S4X A;  4RO0 A;  1X3O A;  1S5L E;  5AW3 B;  2K0D X;  2ZVO B;  1FZA A;  1GZL A;  1UII A;  3A0B E;  4HYT B;  2JR8 A;  2E76 B;  2D2C D;  1JY3 O;  2BEZ F;  1G1I A;  2QE7 H;  2FYU J;  3G9R A;  2P7J A;  4N6J A;  2NPS C;  1FDO A;  1A02 F;  2BUO A;  1FC2 C;  2E5T A;  4IL6 E;  1M1J C;  3CXH E;  2ZVN B;  3L75 G;  2FQ0 A;  4N78 D;  1FAV A;  1K30 A;  1JEK A;  1L0L E;  2XV6 A;  2XND H;  1FZC B;  4WWI A;  4DCK A;  1DD3 A;  5I4T G;  2FFD C;  1T3J A;  3M0D A;  4OVN F;  1PGO A;  2EHT A;  2OYI A;  2GA1 A;  1JTH A;  5AW9 B;  1EZV E;  1OMI A;  2A06 G;  2NO8 A;  2W90 A;  3CX5 I;  3RK3 B;  3GHG B;  2WT7 B;  3G28 A;  5APQ A;  1FJP A;  1ZNV A;  5HV8 A;  3E2D A;  4JYC A;  1VQP P;  4ASV A;  2FVF A;  2L91 A;  4YTP C;  1BGY G;  1G2C B;  1LTG C;  4BPF A;  5CMZ A;  3CCM P;  1EDK A;  2C0W A;  3Q5S A;  3VRL C;  1FDI A;  2YKO A;  1YYC A;  4GKG A;  1PP9 G;  1EDL A;  2GUS A;  1JY3 P;  7CEI A;  2LIU A;  1YQ3 C;  2M8R A;  3HTK B;  3AEA C;  3U43 A;  1P84 I;  1RH5 B;  1SQX K;  3I55 P;  1MKM A;  2RKL A;  2YKQ A;  3GHG A;  2HG5 D;  3LW5 H;  3NTE A;  1GD2 E;  2FKW B;  2IBZ D;  2M3E A;  1SQV K;  1MUU A;  1SQX J;  1NTZ J;  2PNG A;  2DW3 A;  4PV1 C;  3FXE A;  2KLU A;  2JJL A;  3GJN A;  1ACP A;  3BCC E;  3FWL A;  5KKZ B;  4Z1M H;  2GM4 A;  1URQ C;  3L70 D;  2WTY A;  3G29 A;  2WSC H;  3OAK A;  4GOE A;  1FOS E;  2EFJ A;  2K0X A;  3CME P;  5AW4 B;  1BCC D;  5AVX B;  1K05 A;  3GF3 A;  3HE4 A;  3W68 A;  2H89 C;  1VQM P;  1OW7 A;  3HUS A;  2XV5 A;  1N86 A;  3H1K G;  4WB4 A;  4ZMD A;  1GW4 A;  3CCS P;  3G4S P;  4AUW A;  1RE4 A;  3CD6 P;  2PAJ A;  2W6B A;  1L0N E;  3L73 G;  2LR2 A;  1LTJ A;  4BRY A;  1SQV E;  1GK6 A;  1MZ9 A;  1SQQ D;  3H1H E;  4HH2 A;  1YBK A;  4IFF A;  3H1J E;  1JCC A;  4COC A;  2O1K A;  3C1L A;  2KS1 A;  1SQB D;  2IBZ E;  3V4Q A;  2FYN B;  3A3Y B;  3JCU H;  2Z5I A;  4XFJ A;  1K04 A;  2KOR A;  1NHL A;  2XU6 A;  3PP5 A;  5GTI H;  1LGH B;  5KLV G;  3C8V A;  2FYN C;  3IFM A;  3BCC D;  2JP3 A;  2IFM A;  1UIX A;  3M1M A;  3H1K E;  3ABV C;  4IPY A;  2ROQ A;  3NMD A;  4L73 A;  3FWN A;  3L74 E;  2QJP C;  1RQU A;  3AE6 C;  1BE3 D;  1GXH A;  3V2Q A;  3KDP B;  3IN6 A;  1N7S D;  1ZME C;  2XDJ A;  3PJS K;  3AE8 C;  3HZQ A;  3QH9 A;  2YO2 A;  4KJM A;  4UHP B;  3VP8 A;  4GOD A;  4O9B A;  3CCQ P;  4RES B;  1IZN B;  2GDW A;  1SQQ E;  2KK7 A;  2K1A A;  2E75 C;  4I7Z C;  1JNM A;  1S5L X;  1FDM A;  3RK2 B;  1KQF B;  1LT1 A;  3CPW O;  1AV1 A;  4C7R A;  1SFC C;  2X2B A;  1NTM K;  5TIS E;  3TGU G;  2KLV A;  4M0I A;  4L75 A;  5KP6 B;  1A43 A;  5KLV D;  1HJ0 A;  3L73 E;  1OXZ A;  3O6Q B;  1OVU A;  3U1C A;  2MVU A;  2PGD A;  1SQP G;  1VHN A;  1L4A A;  2B9B A;  1AUM A;  5AVS B;  3OA7 A;  1NTK D;  1JM0 A;  1OFC X;  2QIW A;  3L72 G;  1KN7 A;  3MUD A;  4DOJ A;  1QRJ A;  3G6E P;  1D1D A;  2C0X A;  3GHG C;  3MIW A;  3PTZ A;  3GMA A;  2RH0 A;  1OZH A;  3CC7 P;  3H1I G;  2OYH B;  2FXM A;  1CEI A;  2B89 A;  2ZYG A;  1Q90 D;  3L72 D;  1LWU B;  4EI2 A;  3EJB A;  1KB9 D;  2FFD B;  4KT0 J;  1IFJ A;  3BAS A;  4CA3 A;  1KYO I;  2A45 I;  3EFG A;  4XFY A;  3V2P A;  3KZI H;  3HE4 B;  4CPG A;  3AE4 C;  5APT A;  2GZJ A;  1M8O B;  1NTM G;  3L74 D;  1YTZ T;  4MRT C;  1SQV G;  2VLN A;  1BCC G;  4OGQ C;  1Y47 A;  1S3J A;  2QNW A;  1BDD A;  2AXT E;  3NTN A;  1OVV A;  2CGQ A;  1ZRT D;  1NU1 J;  4H44 C;  5APX A;  1IMQ A;  2PFX A;  2ZT9 D;  1F80 D;  2BCC J;  2LL8 A;  1YJN P;  1IFN A;  1QX8 A;  1FZE A;  2VRS A;  3LMO A;  1OR5 A;  4L76 A;  4R4M A;  1A8O A;  2MJZ A;  1FU1 A;  1W2B O;  4C46 A;  2MY5 A;  3V6I A;  1WMK A;  4PD4 I;  2NPS B;  4H2W C;  2AXT H;  1QEX A;  2Q3I A;  2CNR A;  1BCC E;  4PH1 A;  2L5G B;  1H8A A;  5CCG A;  3Q20 A;  3L73 D;  3H6P A;  1PPJ G;  2KZI A;  1CSB A;  3BCC J;  4QKO A;  2JEE A;  1PGJ A;  3H1J G;  1Z6M A;  2KWL A;  1QVF O;  1UNK A;  4NPD A;  2KXP B;  1EMV A;  5KLI C;  4H0L C;  1FBM A;  3DS3 A;  5B66 H;  5B5E E;  2FXP A;  4F37 A;  3M9B A;  1K8A Q;  3NXS A;  2BHV A;  1NTZ K;  3L35 A;  2OYI B;  3I5C A;  2G3A A;  2WPT A;  3EFF K;  1IFD A;  1BAJ A;  2LPK A;  3R2P A;  4JPZ B;  3V2N A;  4IL6 H;  1H88 A;  1SQP E;  2D2C B;  1SQX D;  2XNX A;  2N5H A;  4AQR D;  2PP6 A;  1HGZ A;  3L75 E;  2HYN A;  2K3R A;  2O1J A;  3P8C D;  2E75 B;  5H2F E;  3OW2 O;  2V7Q H;  2KIK A;  1NWQ A;  5E79 H;  3H1K D;  2NZ2 A;  5APS A;  2KOQ A;  2QJY C;  1PV3 A;  1LWU C;  3PHL A;  4ZNC A;  3D71 A;  3ZDM A;  2E5Y A;  1QGK B;  3Q2Y A;  1KMI Z;  2J59 M;  2KUB A;  1LTI C;  2GZI A;  3HE5 B;  2KNC A;  1DV5 A;  2CG5 B;  2OTK E;  1VF5 C;  1IC2 A;  1GK4 A;  2Y9Y A;  3T97 B;  1WRG A;  3L74 G;  2QJP B;  2IDB A;  3V4W A;  1BGY D;  3H1J J;  2PEI A;  3B5I A;  1HJB A;  2FYU G;  1IK9 A;  1SFC D;  1AQ5 A;  1RNI A;  3BRT B;  5C39 A;  4WY4 C;  2E43 A;  1JCD A;  1QLE D;  1GL2 A;  3TSI A;  4NPF X;  1Q7Y Q;  2FVA A;  2MF4 A;  3B5N D;  3AEG C;  4H13 D;  2K9J B;  4TLF A;  1EZV G;  1M1J B;  5KLV E;  2VLO A;  1S1C X;  1T2K C;  4XFZ A;  1SS1 A;  1Y9B A;  1SQB K;  3F89 A;  1JY2 O;  2J58 A;  1KQL A;  2RN0 A;  3V5B A;  1DX7 A;  2L4B A;  1AJY A;  1HVV A;  1P84 H;  5AVQ B;  2PEJ A;  2SPZ A;  5CCH C;  1KYO E;  2Z45 A;  3H4E A;  1EZV I;  3L71 E;  3M0D C;  3W67 A;  2R3C A;  3AED C;  3KXD A;  1IUQ A;  3AEC C;  1GPJ A;  3JC2 2;  3VMA A;  5KAI E;  1D7M A;  5CBO A;  3LRY A;  3RK3 D;  3CWB G;  3AEE C;  1N73 C;  1GMJ A;  1SQQ G;  2IYO A;  3L70 E;  1GU5 A;  1RO0 A;  5AVZ B;  4HB1 A;  2EG5 A;  4OGQ D;  1EDI A;  2GZG A;  3MHV A;  1FZG A;  3B5N C;  4TT3 H;  3WUU A;  2M5R A;  3GKL C;  1URQ B;  1VQ4 P;  3B71 A;  5AW7 B;  3WBH A;  3M06 A;  1BE3 G;  3GW6 A;  2GZE A;  3HD7 D;  5HGL A;  2FAC A;  1H0T A;  1AA0 A;  2WSE J;  2HOD B;  1E79 H;  3DS1 A;  2Q6Q A;  1T3U A;  1AF8 A;  3TNU B;  2N1T C;  1R8E A;  2KW2 A;  1JY2 P;  4JQ0 D;  3G1I A;  1N7S B;  3G26 A;  2WPS A;  3D6Y A;  2WSC J;  3O8Z A;  2IZ1 A;  1EOQ A;  2AEM A;  1PGP A;  3CXC O;  4UB6 E;  4AYC A;  2M5A A;  4BXL A;  4RKU J;  1XTG B;  1FS0 E;  3VTP C;  3IR9 A;  2JU2 A;  5K5G B;  1M57 D;  2AF8 A;  3H1I D;  1RY3 A;  1KIL E;  4WBA A;  1VQ6 P;  3CX5 H;  3CX5 D;  2FAD A;  3N7N A;  3RGU A;  1PP9 D;  2KR5 A;  3L36 A;  1GU4 A;  5KAI H;  2WPQ A;  1DNY A;  2ZT9 B;  2P10 A;  1KYO D;  5AVR B;  3CWB E;  1RF0 A;  1KIL A;  1T8Z A;  1LT9 C;  3RG6 C;  4PJ0 E;  2KOP A;  1NKZ B;  1M1J A;  2K9J A;  1NH4 A;  1RE4 C;  1E5W A;  2YMK A;  3L70 J;  2QEX P;  2WPR A;  4H0L B;  4OH8 B;  4EDF A;  3LID A;  3SWF A;  2M8P A;  3H1L J;  1SQX E;  1P84 D;  1RF0 C;  3B8E B;  1NTZ G;  5AW8 B;  2QG4 A;  3BAT A;  3TGU E;  2Z46 A;  3VN0 A;  1NYH A;  1RF1 A;  1FZF A;  2QA4 P;  4GT1 A;  3CCJ P;  2E76 D;  2Q1K A;  3CI9 A;  1EXI A;  2NPS A;  2KOS A;  1YIT P;  3T97 A;  2LKM A;  2JYG A;  1IK7 A;  2KNC B;  3TYY A;  3H32 A;  4PV1 B;  1S9K E;  4UB8 E;  1BSN A;  2IYP A;  2QJY B;  1T6A A;  5APU A;  4U3F G;  1PEQ A;  1J1E B;  1VQK P;  2Y0D A;  2K88 A;  5APW A;  2FQ1 A;  1HH0 A;  4U3F E;  1RE3 A;  2BCC E;  2XZR A;  4WY4 D;  2LIW A;  1NU1 D;  3CC4 P;  2PRR A;  4H13 B;  3RL0 C;  3TGU J;  3CE7 A;  2QJK B;  1GW3 A;  4HJG H;  2K92 A;  5CCG C;  2FYU E;  1LTJ C;  2WPV B;  4YXW H;  1T2K D;  2KGD A;  5M1B A;  1NTZ D;  5BU5 A;  1NGM B;  1LJ2 A;  1MFZ A;  2FFD A;  1PP9 E;  2YXR B;  2K93 A;  2Z4E A;  1AYI A;  1ZV8 A;  2RMZ A;  1PEM A;  3GG2 A;  2M5A B;  3Q5R A;  3AE3 C;  4IOI H;  2WIT A;  2FBW C;  4DZO A;  1KQS O;  4EIJ A;  3HTK A;  1L0L G;  2OYH C;  4I1L A;  1EDJ A;  2W8Z A;  3IAO A;  3WU2 E;  3C9I A;  1KIL C;  3FXD A;  5EFW B;  3TNU A;  2NRG A;  3O6Q A;  1BSH A;  1L0L D;  1A02 J;  1JMB A;  4COP A;  1NKN A;  2AEF A;  1L0N J;  4Y99 B;  4PH0 A;  2GYK A;  1DIP A;  3CCV P;  2C9N Y;  1NTM J;  2Z44 A;  2KOG A;  3ITK A;  4BWN A;  2E1M A;  3E1R A;  3KZI E;  2V4H A;  1LTA C;  1L0I A;  3BVH A;  4PD4 H;  2WZ7 A;  1JTH B;  4H2X C;  1Q81 Q;  1M74 A;  2KGE A;  3S9O A;  4D6T E;  1G1J A;  1YJW P;  3VOP A;  2W6A A;  1U7J A;  3K5B A;  3DS4 A;  4OWF A;  1LP1 B;  4R4L A;  1JO5 A;  3GF7 A;  4PJ0 H;  1W5C E;  4BPG A;  1OW6 A;  2FYZ A;  1VL2 A;  2CWO A;  3H1H G;  2N1T A;  2AVA A;  2ERH A;  4JYB A;  2N1T D;  3AE1 C;  1BDC A;  3VMZ A;  1AVY A;  3H0D A;  1ZR2 A;  2JBG A;  2KOO A;  1W2E A;  2A45 G;  2FHS C;  2VLQ A;  4YPC A;  3UIA A;  2JDI H;  5KJ7 A;  4U0B A;  2H8P D;  2ONT A;  3B4Q A;  3H1I E;  2YIU C;  1ZN5 A;  3MTU E;  2ZJS E;  2MR7 A;  1GL2 B;  3G71 P;  5CJ0 A;  1HUC A;  4N3Y B;  3HYB A;  1ZW0 A;  4BRY B;  1KQG B;  2JKV A;  1PPJ E;  1LTJ B;  2BQ1 E;  2GDX A;  3KQG A;  1BCC J;  3KHU A;  4ZKP A;  4U0D A;  1E0H A;  1BGY E;  3A0H H;  1OVR A;  4LLH A;  2W6J H;  3M91 A;  1H89 A;  2WSS H;  1OX3 A;  1YTZ I;  3H1H D;  1PEU A;  2R5B A;  2I8D A;  2K9Y A;  3HD7 A;  2LXB A;  2Q7C A;  2KGA A;  5GTI E;  4IL6 X;  2KZJ A;  5AVT B;  2KB7 P;  1J1D B;  3MZW B;  3L74 J;  5DJU B;  4WY4 A;  4PD4 D;  1VDF A;  3VMX A;  1QL2 A;  1LNQ A;  5EJD A;  1MZ8 A;  2BAS A;  1KC8 Q;  1KFM A;  1NAF A;  2OQQ A;  2BCC D;  2CK3 H;  3M9Q A;  4XRQ A;  3B5N A;  3PLN A;  3I56 P;  3G1G A;  3HUS C;  3D70 A;  1FZB A;  2N1T B;  2ZXX A;  2LOL A;  2WSE H;  3D6Z A;  4MN4 C;  2JQ4 A;  5CBN A;  3RL0 g;  2P58 A;  1LTS C;  5EW5 E;  2QJK C;  3P7K A;  1G2C A;  2L0Q A;  4ZKU A;  2YMY A;  4K35 A;  1TU3 F;  2K94 A;  5TIS H;  3Q1M A;  3WUV A;  2PY8 A;  3L72 J;  3B4S A;  2WT7 A;  5CCH A;  4EOT A;  1L2P A;  1VF5 D;  5CCH D;  2MR8 A;  2LML A;  1GDT A;  1BGY J;  1SQP D;  3MGN A;  1SVF A;  1X9V A;  2JWA A;  1FZC A;  2DNW A;  3TF5 A;  1R5S A;  1N2D C;  4PD4 E;  2YNY A;  4NEO A;  4D6T J;  1KIL D;  2FQ2 A;  2ZYD A;  2QM7 A;  1IFM A;  4C7N B;  1RHZ B;  1Y8A A;  1M6N A;  3DS5 A;  2OYO A;  1NTK E;  1VQ5 P;  1SQV J;  5HGM A;  4LC1 A;  2AEJ A;  2E74 B;  1DEB A;  5B66 E;  5BS1 A;  5TJH A;  2WSF H;  1NU1 K;  2Q3E A;  1K73 Q;  1Z56 A;  2OYH A;  5AW6 B;  1UJZ A;  2R44 A;  5HGO A;  5HVC A;  1RF1 B;  1FOS F;  2YKP A;  4XE5 B;  5F2N A;  3CWB D;  1IJD B;  4HKG A;  2IPP A;  3A0H E;  1AVO A;  1L4A B;  1X8Y A;  1L0N K;  4JF7 A;  5KTB A;  4WYM A;  4C7N A;  3SFE C;  2IFN A;  3AE5 C;  1M56 D;  2KSE A;  1EC5 A;  2UWJ E;  1IFI A;  4U0E A;  1ZP0 C;  2PEQ A;  2GUV A;  3BCC G;  2GZF A;  5L8R J;  2KP8 A;  1S9K D;  4N78 E;  1L4A D;  2XZ1 C;  2PEO A;  5GTH H;  2L6E A;  1VPC A;  1JUN A;  3M9H A;  3TGU D;  4IFD K;  1VQ7 P;  2ITA A;  2FY8 A;  1PIX A;  3GZL A;  4D6T G;  1SQB E;  1EZV D;  1PFI A;  1YIJ P;  1JB0 J;  1NU1 E;  3G0V A;  4WY4 B;  3V2R A;  3L4F A;  5JPA A;  3S4R A;  3CC2 P;  1ZMB A;  4IZ6 A;  4GOF A;  2D2C C;  2XXM A;  3MP7 B;  2WMM A;  3H1L G;  2W83 C;  5KLV J;  2K5X A;  1X79 B;  4QNB A;  2JYL A;  1BE3 J;  2OAR A;  2O01 J;  1AFO A;  2VLP A;  2VSQ A;  2FYU K;  3RBX A;  3B5N B;  1PL5 A;  5KAF E;  3USS A;  1USE A;  3F5H A;  2HFE D;  1JY2 N;  3DPH A;  1KIL B;  3JCU E;  1GL2 D;  5KLI B;  1N7S A;  1HY8 A;  3L71 J;  1VQ8 P;  4A7P A;  3RG2 A;  2B87 A;  1JOC A;  2JWD A;  2AXC A;  2N6Z A;  2O01 H;  1PZQ A;  1N73 A;  2EHS A;  2KOD A;  3KYQ A;  4NPE A;  2IBZ I;  1Q2N A;  2R32 A;  5AW2 B;  1M1K Q;  4I6M C;  5DCK A;  1NAY A;  1EQ7 A;  4U0A A;  1IMP A;  2WVR A;  1NOH A;  1PEO A;  3HD7 B;  1SQX G;  1YHQ P;  5AVU B;  2O3J A;  3VP9 A;  3EJE A;  5GTH E;  2FXO A;  1KB9 H;  1NJI Q;  3WU2 H;  2POH A;  2E74 C;  4I2L C;  4XFX A;  3RL0 B;  1HBW A;  4D6T D;  4DJG A;  3L72 E;  2WWW A;  1KZU B;  5CZD B;  1VF5 B;  1WT6 A;  1S72 P;  4GR6 A;  3L75 J;  1YI2 P;  1GL2 C;  3HUS B;  1VQL P;  2I1J A;  1SQB J;  2JU1 A;  1YQ4 C;  3Q3D A;  1SP4 A;  4PV1 D;  3U59 A;  4W7Y A;  2DGY A;  3H1K J;  2CPB A;  1U57 A;  3TDK A;  1RQV A;  3PRJ A;  1M7L A;  1GTW A;  3H1J D;  3BRV B;  4IFM A; 
#chains in the Genus database with same CATH homology
 4QNB A;  1VQ5 P;  2JYL A;  1K9M Q;  2OAR A;  4IPY A;  5F2K A;  2CWO A;  1BAJ A;  3MGE A;  5HGM A;  2M8L A;  2PEK A;  4XFY A;  1EIA A;  1VQ6 P;  4U0F A;  2PEJ A;  2XT1 A;  3H47 A;  2Z45 A;  3H0D A;  3DPH A;  5BS1 A;  1M6E X;  3H4E A;  2BUO A;  1KC8 Q;  1IUQ A;  3G29 A;  5BS2 A;  3HZQ A;  2LF4 A;  1K73 Q;  2EFJ A;  1VQ8 P;  2PEN A;  1PEM A;  3CME P;  3RG6 C;  3OW2 O;  4XRO A;  3LRY A;  4XRQ A;  1K30 A;  1JJ2 O;  4U0B A;  2ONT A;  2XV6 A;  5HGO A;  3I56 P;  1RO0 A;  3CCQ P;  1KQS O;  5I4T G;  2KOD A;  1VQM P;  3G1G A;  2EG5 A;  1YJN P;  5F2N A;  4U0C A;  2JO0 A;  2M8N A;  1YJ9 P;  1A8O A;  1M1K Q;  2QEX P;  2EIA A;  3G71 P;  5DCK A;  2M8P A;  1KD1 Q;  3CCS P;  1W2B O;  3G4S P;  4WYM A;  3CPW O;  1Q82 Q;  4U0A A;  3HYB A;  1VQ4 P;  3DS2 A;  3WBH A;  3CD6 P;  1PEO A;  3G21 A;  4M0I A;  4U0E A;  3G28 A;  5HGL A;  1YHQ P;  3P05 A;  2PEQ A;  2Z46 A;  4COP A;  1QVG O;  1VQO P;  4GR2 A;  3E2D A;  1A43 A;  1VQP P;  3DS1 A;  2PEM A;  4PH0 A;  2QA4 P;  3CCJ P;  2PEI A;  1NJI Q;  2BQ1 E;  3B5I A;  2PY8 A;  2PEO A;  4PH1 A;  3CCV P;  1VQN P;  4COC A;  2L6E A;  2Z44 A;  3CMA P;  4XFX A;  2E1M A;  3Q20 A;  1YIT P;  4U0D A;  3CCM P;  2JYG A;  3G1I A;  1E6J P;  1RNI A;  3G26 A;  3CCL P;  1AUM A;  1S72 P;  3VRL C;  1VQ7 P;  1QVF O;  4GR6 A;  1YI2 P;  1Q81 Q;  2P9X A;  1Q86 Q;  1M74 A;  1RO2 A;  1QRJ A;  3G6E P;  1YIJ P;  1D1D A;  3CCR P;  1Q7Y Q;  3DS0 A;  1VQL P;  5F2O A;  1EOQ A;  1PEQ A;  3G0V A;  1YJW P;  1VQK P;  3DS3 A;  3CC7 P;  1VQ9 P;  3CXC O;  1PEU A;  5JPA A;  3CC2 P;  1ZMB A;  3CCE P;  1K8A Q;  3I55 P;  2OTL P;  2OTJ P;  2DGY A;  2BHV A;  3DTJ A;  3DS4 A;  1N8R Q;  1M90 Q;  2XXM A;  3NTE A;  5HGN A;  1M6N A;  4XFZ A;  3M1M A;  3DS5 A;  3CCU P;  3CC4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...