1KC8Q

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kc8Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kc8Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kc8Q03
1NJIQ 1VQPP 2OTJP 3CC4P 3CC7P 1Q81Q 1KQSO 2OTLP 3G6EP 1Q86Q 3G71P 1QVFO 1VQMP 3CCVP 3CCJP 1YJNP 3CPWO 1JJ2O 1VQ9P 1KC8Q 3CCRP 1YITP 3CXCO 1VQ4P 1VQNP 1K73Q 1Q7YQ 3G4SP 1VQ7P 3CCEP 1M90Q 3CMEP 1K8AQ 3CMAP 3CC2P 1K9MQ 1KD1Q 1YHQP 3I55P 1VQ8P 3CCMP 3I56P 3CCSP 1YIJP 1S72P 3CD6P 1VQLP 3OW2O 1W2BO 2QA4P 1YJ9P 1Q82Q 1QVGO 3CCUP 1N8RQ 3CCLP 1VQOP 1YJWP 1VQKP 1VQ6P 1YI2P 1VQ5P 2QEXP 3CCQP 1M1KQ
chains in the Genus database with same CATH superfamily
2GYKA 2JJLA 1JEKA 3A7OA 5AW9B 4WB4A 2YO3A 1M1JB 3S4RA 1ZMBA 1J1DB 3L70J 2KOSA 4D6TJ 2P67A 3M1MA 3H1KE 4IOIH 1NTKG 2WT7A 1LTGC 2YO2A 1YTZT 2WQYC 1BDCA 1BGYD 5HVCA 1S72P 3ZDMA 2PNGA 3R4YA 2QA4P 1T8ZA 3RK3B 1H0TB 3K5BA 3A3YB 5DJUB 3G9RA 1LTJA 3M0DA 1PGQA 2IBZI 2JU1A 2BEQD 1N73C 2AFEA 1GMJA 1IFNA 2G3AA 2FYUK 5AW0B 2BCCE 3V6IA 5AVZB 1SQBK 1VQLP 4QKOA 4HYTB 4IFFA 1Q2NA 1ZW0A 2Q3EA 2BASA 5AW7B 1RNIA 2WPQA 3DS1A 3M0AA 3CX5E 4H44B 3A0BH 4I7ZB 1AVOA 4HKZH 3RG6C 4ASWA 5APSA 2OGUA 1AYIA 3OA7A 2N9YB 4H2XC 3GHGC 2MR8A 3V2RA 1SQXJ 1KILB 1YBKA 2A45G 2JWDA 1DD3A 1HBWA 1YTZI 1JY3O 1D1DA 1RQUA 3B71A 2W6JH 1NTZK 2K2QA 2WPSA 2Y0EA 4H0LB 3E2DA 4WYMA 2WITA 3AE2C 4H2WC 1GXGA 2PY8A 1AF8A 3W67A 3H1KD 1JY2P 3HUSC 2Q5UA 3CE7A 4EI2A 1IFJA 1HGVA 5B66H 5C39A 5GTHE 2CPSA 2XDJA 5KLVE 2H89C 1K73Q 1UIIA 1GXHA 2XKMA 4BPGA 3H1IG 1VPCA 4GR2A 1BGYE 3TNUA 4D6TG 1R5SA 4L75A 2K1AA 3TSIA 4C46A 3R2PA 2FAEA 2LKIA 1X8YA 3RK2B 1NU1J 3VRLC 2JP3A 1PP9D 3F5HA 5AW4B 2SPZA 3L75D 2E74D 1IC2A 4KHXA 5APVA 1NVOA 2KZIA 5APQA 5AVQB 4DZOA 1N86A 1EXJA 2RMZA 1T8KA 2FYUJ 1KB9H 1L0LE 2W27A 1D7MA 2KG8A 1LTJC 1M90Q 3SSUA 1YIJP 2BHVA 4D6TD 1OVUA 1GTWA 4GOEA 5KLIB 3L74G 1AFOA 2JEEA 1X3OA 4Y28J 1DEEG 5E79H 1LNQA 3L75E 3G3ZA 3TNUB 3MUDA 3SWYA 2N1TD 2KSJA 3WMM0 1YYCA 4PH1A 5K5GB 1KQLA 2IDBA 2QJYC 4ZKUA 1VL2A 2KS1B 3AE5C 3VMAA 1AVYA 2B89A 4NPEA 2PFXA 3SWKA 3ITKA 1EXIA 3OAKA 2ZYGA 1USEA 5KLVD 5AVWB 5HV8A 3DS5A 1N8RQ 1SQPG 3Q3DA 3Q5SA 1IFMA 2JQ4A 3B5ND 5KLVK 1PFIA 1FBMA 1SFCD 3D71A 2O1KA 1VQNP 1BE3E 3D6YA 3M91A 1K30A 1KILA 2J59M 3V4QA 1N7SD 1JMBA 1PGJA 2QIWA 2FVAA 1YI2P 4C7NB 4OWFA 2YKQA 2L0QA 4GODA 2E76B 3EWKA 2E43A 2D2CD 4HKGA 5CBOA 1KYOI 2OYHB 2WWWA 1YITP 2B9BA 2IBZE 3VP8A 1H8AA 3FGAD 1JTHA 4UB6E 2KG9A 1M1JC 1QL2A 3CCMP 4DCKA 3WUVA 1JO5A 5BVZA 1T6AA 1BDDA 3VOPA 5BU8B 1M1KQ 4H13D 1DX7A 5KP7B 3CC7P 4I1LA 4ASVA 2FFDA 3DS2A 2I1KA 1KB9E 4U3FD 1HJBA 3AEFC 3BASA 3G1GA 3DS3A 2ONTA 2XXMA 1SFCA 2Y0DA 2YMKA 2QM8A 3TGUE 4PWVB 3L4FA 1LT9A 2L5GB 2ZVOB 5CCGD 2EHTA 1IFIA 2FACA 2GDYA 2KR5A 2IPPA 2PRRA 2AXCA 3PHLA 5HGMA 2Z44A 2O3JA 1KV4A 3EQ2A 2WTYA 1BCCE 4AUWA 3VYIA 1YJ9P 2N98A 1VQ6P 2E75B 2QEXP 3H32A 3V2NA 5H2FH 5AVRB 3RK3E 2YIUC 2OTLP 2OYIC 1IUQA 2YXRB 5KAIE 1RO2A 3CXHI 4RJTA 5BS1A 1KFNA 1J2JB 3RBXA 4U0DA 4WVZA 2LTEA 1FZCC 2R32A 1W2BO 3CMEP 1L4AB 3G1IA 3AE7C 1MFTA 3MIWA 3B5NA 3L72D 3L70D 2GDXA 1LT9C 2PGDA 3HD7D 5HGNA 1NWQA 1N7SA 4IZ6A 2M8PA 1VQ8P 2PEJA 1NTKJ 4BPHA 2K5XA 2MVVA 3NTEA 2AVAA 1NTMG 1HUCA 1NU1K 4PV1C 3L70G 4IL6X 3FWNA 1SQVJ 2GM4A 5BS2A 1M8OB 1OMIA 3BRVB 2L6EA 2P10A 3MD0A 1DD4A 2H7HA 1OR5A 3TDKA 1LWUA 5HGOA 2JO1A 2WVRA 4EYYQ 1KILC 3RK3D 3WU2E 1SFCC 1JCDA 2ZAEB 3FXEA 3QWOC 2L91A 3CWBG 4K3AA 2KNCB 1FZBA 2LOLA 3P05A 3F89A 4Z1MH 2JAZA 1UJZA 1S5LX 1KYOD 2FKWB 1S4XA 1JTHB 1MZ9A 2GZIA 2GZGA 1PPJG 2KK7A 2KOPA 2W8ZA 2E74C 2M8LA 3MZWB 5APXA 2P7JA 3PH0A 2HODA 5F2KA 1RE4C 3L73D 1NGMB 3H25A 1H88A 2OYIA 1IZNB 1KN7A 1N2DC 4Y99C 3KPEA 1FE6A 4QMAA 3CX5D 4DT0A 5DCKA 2V7QH 3HD7B 2OYHA 3VN0A 3G28A 4GIFA 2K94A 2KWLA 2WMMA 1PGOA 3H32B 1KZUB 3BCCD 3CXCO 1L0NK 1GPJA 4BPFA 1N73B 4RESB 3CD6P 2H43A 4B86A 3V2QA 1L0LK 3IR9A 3L72G 1FU1A 2ZT9D 3CCQP 3E1RA 5APTA 5AW6B 1T3JA 3Q5RA 3A0HH 1TU3F 2KS1A 2PEKA 4PJ0E 1NTKE 2KLVA 5EFWB 4R4LA 1VQ7P 1SQQE 4N3YB 3HUSA 5DJTB 3TGUJ 5EJDA 1JY3P 1VQKP 1RH5B 2K93A 5CMZA 3CCRP 1P84E 2KW2A 2MVUA 2R5DA 1IMPA 1NH4A 5B5EH 1L0NG 2BEZF 3IN6A 1GDTA 1M56D 1ZOYC 3H6PA 1S2EA 1F80D 2AFDA 1L4AD 4R0MA 1N7SC 2EG5A 2OTJP 2Z5HA 2B87A 1QVFO 2QJYB 3CL3D 1FJPA 1VQ9P 1Z56A 2RN0A 2A45H 1QX8A 3CCEP 2W6AA 3MGNA 1SQXG 3QH9A 1OX3A 1GL2C 1H89A 1ZV8A 2WPVB 2YXQB 2ZT9C 3VP9A 3FX0A 2K0DX 1FZFA 1VQOP 4ZKPA 2D2CB 4D6TE 3UIAA 2QJPB 3G26A 1U7JA 1FC2C 2POHA 2W83C 2Y9YA 3Q1MA 3W68A 1L0LD 1EZVI 4JYCA 1L0LJ 2Q3IA 4AYCA 4N6JA 2VLOA 1NTZJ 1OXZA 5CCGA 3EFFK 1SQVG 1SQBE 4PD4I 1A02F 3G71P 1LP1A 2Z45A 3HD7A 4NEOA 1U57A 3C9IA 3H1JJ 3AEBC 1L4AA 2VLPA 1NTKD 3VMYA 1VDFA 4I6MC 2OYHC 4YTPC 3WUUA 2LPKA 1HQBA 1T2KD 2KGCA 4QNBA 2E76C 3MHVA 3RL0g 5M1BA 2QSIA 2GUSA 4HH2A 4JYBA 5HGLA 3CI9A 1PEMA 2FQ1A 2KOGA 1QRJA 2A45I 5KJ7A 2JYLA 2KLUA 3NMDA 3NTNA 2R5BA 1GL2D 2YKPA 2FYUE 1Q82Q 3GLMA 1M1JA 1RE4A 2KNCA 3C8VA 4PD4D 2PEMA 4PXHB 1KB9I 5B66E 2KG6A 2I1JA 4CPGA 4BWNA 3II6A 3E7KA 1KILE 3I56P 4BRYA 4WY4C 5APUA 4DOJA 1X9VA 1EDKA 1IFDA 5F2NA 1S1CX 3H1JE 2H88C 4IFMA 2Z4EA 1KLPA 2IFNA 2IZ1A 3BVHA 3P8CE 1USDA 5AVUB 4PD4H 4W7ZA 2OYIB 1IK9A 1T2KC 2K88A 2ROQA 3KYQA 2XV6A 2J5UA 2HODB 3JSVC 2XZ0D 1DIPA 3MUDC 3LW5J 4L74A 2NRGA 3CXHE 1JMMA 5B5EE 1S3JA 3TYYA 1L4AC 5BU5A 5KAFE 2AEJA 2VSQA 1KQFB 3AEEC 5CZDB 1CEIA 4U0EA 1L2PA 2YMYA 2LIWA 1HH0A 2KI7B 3VMZA 1KORA 1SQVD 1KC8Q 2PEIA 5APYA 1H0TA 2M0BA 4GOFA 2P9XA 2AXTE 5H2FE 4UB8H 3AE1C 1SQPE 1VKUA 1ZN5A 1SQPD 2N1TB 3H1IJ 2GUVA 1MV8A 1LT1A 5APWA 3AE9C 3JCUH 2O01N 1XTCC 1DNYA 1KFMA 4OGQC 3GJNA 1ZR2A 1Q81Q 4L73A 5CJ0A 3L72J 1BE3D 2VLQA 1G1IA 5CCGC 1LTTC 2N5IA 1SQPJ 3H1ID 3M9BA 2K37A 2P58A 1M7LA 5KLVJ 2XT1A 2DNWA 3CCUP 4I7ZC 2N5HA 1M57D 2BQ1E 2IBZG 4OGQB 2ZYAA 3B5NC 3KZIH 1RQVA 4U0CA 2FYNC 1W5CE 3WBHA 3MTUE 2O1JA 2R3CA 5L8RJ 2EFJA 1PPJD 3G0VA 2E74B 2E1MA 2C0XA 1EDLA 1LTAC 4GR6A 1GK6A 1R8EA 2CNRA 3Q5PA 1VQPP 1CI6A 1KTMA 1BCCJ 3CWBD 2FVFA 4U3FE 3RK2C 1NHLA 2ZFCA 2JKVA 2CWOA 4BRYB 3HE4A 2B88A 2M5AA 1RHZB 2RH0A 4M0IA 4XFXA 1OFCX 1KD1Q 3NY7B 2M5AB 1OVVA 3D70A 3O6QA 2JO0A 1CZQA 1P84D 1GU5A 2KSEA 1M6NA 4NPFX 4WY4D 2FY8A 1EOQA 3LIEA 3CXHH 1SLQA 3L75J 3AEAC 2LXCB 1EZVE 1L0HA 1E6JP 4XE5B 2LKMA 1G2CA 2WSCJ 3M9HA 1LWUC 4H44D 3SFEC 1PP9G 1MKMA 1LGHB 2M3BA 1AQTA 1LTBC 4EIJA 2E75C 1FJKA 1K8AQ 2JDIH 2KOOA 1M6EX 4K35A 1NTMD 3B4SA 1RF1A 2M3EA 3OJAB 2JYGA 1GW3A 4H13B 4HB1A 1QLED 4YPCA 3IF4A 1WRGA 2JWAA 1L0LG 5AVVB 5AW3B 2N1TC 2N9BA 3I55P 1QEXA 1K05A 1RF0A 2FHSC 1VF5C 2GZEA 1RY3A 3GF7A 1JNMA 3KXDA 2JU2A 1ZNVA 2ERHA 3GG2A 1UIXA 1Q86Q 1NTZD 3L71D 3H4EA 1Q7YQ 4UB8E 2HR3A 1NAFA 2XNXA 3CCLP 1S5LE 2JB0A 2HPCA 1LP1B 1SQXK 4HJGH 3SWFA 2W90A 1G2CB 3FWLA 1KQGB 2BCCG 2E75D 5KP8B 1J1EB 1PEOA 1PPJE 1NTMJ 1JM0A 2OARA 2H8PD 3GW6A 1Q90D 4XFZA 2R3SA 1K04A 1OW6A 2FQ0A 1L0NJ 2YIUB 4XROA 4WBAA 3RL0C 1ZR4A 4PD4E 3B4QA 3GF3A 2KXPB 3CCVP 5AW5B 3CPWO 1OW7A 3HE5A 1T3UA 3L74J 3N4XA 3O6QB 3A2AA 3G4SP 2WSFJ 2QVAA 2MD9A 2AEFA 2ZVNB 1L0NE 2QJKC 4MRTC 4U0FA 3H0DA 5KKZC 5KLIC 4YXWH 3RL0B 4YXDC 3O8ZA 1NTZE 2ZJSE 3VTPC 4N78D 2FQ2A 1SVFA 3PJSK 3PP5A 3AE3C 2MKVA 2KGAA 1E5WA 4U0BA 5I4TG 1RE3A 3TK1A 2G8YA 3P8MC 3L72E 5KAIH 4PV1B 3JC22 1KQSO 1KMIZ 1SQQG 1GU4A 1SQQD 1NTZG 1FZCB 2L9FA 4C7RA 1RF1C 3RBZA 4CA3A 2IX7C 1N7SB 2GZJA 2WSEJ 3H1LE 5CJ4A 1KYOH 1CW5A 5KTBA 1UNKA 2JBGA 2KUBA 4H44C 2CQ8A 1FDMA 2FYZA 3WU2H 4GT1A 3A5TA 2WPTA 4IPYA 1NKZB 1SQVE 2GA1A 2LIUA 2W6BA 3AE6C 3L35A 1ZXGA 1IFPA 2WSEH 1EZVD 3JCUE 3M9QA 2KP8A 1L0ND 2PEQA 2M5RA 1FOSE 1LTIC 2C0WA 4JBZA 1BCCG 3S9OA 2MY5A 1Y47A 1SS1A 1FS0E 1SQXE 1YJNP 2FYNB 3Q2YA 1OIPA 1G1JA 3HZQA 1SFCB 1OW8A 1VF5D 3T97B 4A7PA 1K9MQ 2UWJE 1JOCA 3PTZA 4GDOA 3AE8C 4WY4A 2MR7A 2ZXEB 2FYUG 2Q7CA 2BCCD 2C9LY 1Y8AA 3PLNA 4I2LC 1ZMEC 2LXBA 5E79E 3C1LA 2ZT9B 7CEIA 2K9JA 1BSHA 1NU1D 3AE4C 1WMKA 3WUTA 1NU1G 3RGUA 5CCHC 2NZ2A 3IAOA 4WWIA 1X22A 1FZGA 3L70E 2ITAA 2Q1KA 2AXTH 2V4HA 1NTKK 2O01H 2L22A 1JB0J 3KQGA 3H1KG 1AJYA 1AA0A 1QGKB 2CK3H 1ZP0C 1NU1E 4GKGA 2K9YA 2AEMA 2BUOA 3H1KJ 5AVTB 1PEQA 1OVRA 4M3LA 1J1DC 3AEGC 1HVVA 4LLHA 1NTMK 2FXPA 1QVGO 1RE3C 2HFED 1VHNA 3HE5B 1J1EC 1AV1A 5KP6B 2E5YA 1NO4A 1P84H 3HRNA 2ZYDA 2QM7A 5JPAA 3E1IA 2Q9IA 1SQXD 1JUNA 4IL6H 2JR8A 1SP4A 2O01J 2L4BA 1KYOE 4Y99B 2XNDH 3P7KA 3OW2O 2KGEA 5KAFH 4R4MA 5GTIH 2E5TA 1BE3J 2LMLA 2FFDB 4LGDE 1E0HA 3G6EP 1JY2N 4EOTA 1NAYA 1EDIA 2XZRA 2FBWC 5AVXB 1FR2A 3G29A 3H1LD 1HY8A 1LTJB 4W7YA 1GL2A 1QL1A 3V2PA 2MJZA 2FADA 5F2OA 2WSFH 2RKLA 3EJBA 3HTKA 3CLQA 2PAJA 1N7LA 3SFDC 3TGUG 1YHQP 3T97A 3DPHA 2CGQA 1YQ4C 1PGPA 3L71E 1X79B 1NQ4A 2BCCJ 3LIDA 4KT0J 2NO8A 1U7MA 1SQBJ 4U3FG 1HTLC 1EMVA 1MZ8A 1SQQK 5KLVG 1P84I 4XRQA 2KIKA 3H1IE 4H0LC 3CC4P 3L71G 2QJKB 2R44A 4WY4B 1PZQA 2LL8A 1IO4A 5CHXA 1EC5A 1X0TA 1ZRTE 3AEDC 3BCCJ 2K9JB 2PEOA 5AW1B 1PP9J 1YJWP 3M0DC 1FDOA 3KDPB 4DJGA 4N78E 4AQRD 3G21A 2VRSA 2M8NA 4OGQD 3BCCE 3DS0A 2HPCB 5KJ7C 2KB7P 2OTKE 3GZMA 3TGUD 2X2BA 2N1TA 1EQ7A 2WT7B 2IYPA 3P32A 5CCHA 2WPRA 2MF4A 1MFZA 2OYOA 3GKLC 1NKNA 2FXMA 1JY2O 2CPBA 2K3RA 1GD2E 2E76D 1ZLLA 3S1KA 2N6ZA 2JGPA 3LMOA 3V4WA 4IFDK 4BXLA 4RO0A 4COCA 2WSSH 2DW3A 3BCCG 3D6ZA 2OQQA 3B8EB 3CMAP 3NFQA 3P8CD 3VMXA 1BGYG 2GDWA 3U43A 3L75G 1CSBA 3GZLA 3CWBE 3M06A 3A0BE 4IL6E 2B87B 3L71J 3L36A 1Y9BA 2Y9ZA 1A8OA 1VQMP 1W2EA 1EDJA 1DV5A 1IJDB 2AF8A 1LTSC 1EZVG 3LW5H 1A02J 2KODA 2GZFA 1NOHA 2HLOA 3A0HE 2WZ7A 4XFJA 2C9NY 4OH8B 3L74D 3L73J 1GZLA 2D2CC 2WSCH 3NXSA 2NPSD 3EJEA 5GTHH 3CCJP 4C7NA 1BXIA 2KYVA 1A43A 3EJDA 4U7JA 1HWTC 1S5LH 1DEBA 1SQBD 1LWUB 3L74E 1OZHA 1E79H 1GW4A 3U59A 1CI6B 1PL5A 2N6YA 2PP6A 3HYBA 1JCCA 5AW8B 2PENA 1IK7A 2HYNA 3CX5H 1RF0C 2P1JA 3HTKB 5CBNA 3H1JG 3L37A 2HG5D 1NYHA 4UHPB 1GL2B 3ABVC 1FDIA 3H1HD 3DS4A 1BAJA 3I5CA 3IFMA 2ZXXA 1URQA 1BGYJ 3CC2P 3V5BA 1URQB 4JF7A 4JQ0D 1S9KD 2QE7H 3CWBJ 1BCCD 2FXOA 2NPSB 1BE3G 3B5NB 4H2YC 1RO0A 1FOSF 5AVYB 1N73A 1L0IA 4F37A 3H1JD 1Z6MA 4OVNF 3HE4B 1YQ3C 2IZ0A 5TISH 3H1HJ 3H1LG 1R5LA 4O9BA 1EIAA 2IFMA 2KZJA 1M74A 2K92A 1ZRTD 3B5IA 5EW5E 1LT9B 4EDFA 4TT3H 4ZMDA 1BSNA 2P2UA 4PH0A 2Q6QA 1AQ5A 4H13C 4RKUJ 2Y0CA 2KORA 2KGDA 4L76A 3AECC 1DH3A 5GTIE 3BATA 4ZNCA 2LF4A 1SQQJ 1FZAA 3PRJA 3USSA 4MN4C 3RL0D 1WT6A 1HGZA 4DG9A 1RF1B 1MUUA 2LR2A 3U1CA 2E42A 3RK2D 2J58A 2YKOA 1VF5B 3DTJA 4U3FJ 4XA4A 3MP7B 1SQBG 2DGYA 1URQD 4LC1A 2XZ1C 1NTME 3GMAA 3H47A 1JJ2O 5AW2B 4KJMA 1VQ4P 2FFDC 2EHSA 2QNWA 4U0AA 1AUMA 3HUSB 1IMQA 2I8DA 2NPSC 1HJ0A 1PV3A 4XFYA 2CG5B 1GK4A 2M8RA 2Z46A 5CCHD 3FXDA 3H1HG 3H1LJ 2IYOA 2QJPC 1OWAA 4H0LD 2K0YA 4NPDA 3GHGB 1S9KE 5TISE 3RG2A 2A06E 3GHGA 4JPZB 2K0XA 1SQPK 3CXHD 3EFGA 3CX5I 1VQ5P 3KHUA 1LJ2A 1XTGB 2XU6A 3HD7C 3BRTB 1NJIQ 3N7NA 3Q20A 2XV5A 3L73E 5KKZB 2KOQA 3H1HE 4PV1D 1PEUA 5KJ7D 2Z5IA 1PP9E 3U1AA 3CCSP 4W80A 1HF9A 3KZIE 1URQC 2V7QJ 2FYUD 1KB9D 1FZCA 2A06G 2FVEA 5AVSB 5TJHA 3LRYA 3TF5A 3MGEA 2A06D 2N50A 1ACPA 2NPSA 2YNYA 4PJ0H 1PIXA 1JY3N 2EIAA 4COPA 3L73G 2QRXA 1FAVA 1KILD 3RK3C 2VLNA 4TLFA 1FZEA 1SQVK 2QG4A 2IBZD 4UB6H
chains in the Genus database with same CATH topology
2XV6A 1VQPP 3CC7P 5BS2A 1KQSO 1D1DA 1Q86Q 3G71P 2PEKA 3DS4A 3H47A 2L6EA 1BAJA 2Z45A 1JJ2O 3DS2A 3H4EA 3E2DA 1VQ4P 1ZMBA 5F2OA 4WYMA 4COCA 2CWOA 3M1MA 1Q7YQ 1VQ7P 4U0AA 2PY8A 1AUMA 3G1GA 4M0IA 4XFXA 3CMAP 3DS3A 3CC2P 5HGOA 1YHQP 1KD1Q 3DPHA 2ONTA 4PH1A 1S72P 2XXMA 2QA4P 3CCLP 4QNBA 1VQKP 4XFYA 2JO0A 4U0EA 2Z46A 5HGLA 1A8OA 1VQMP 1PEMA 1KC8Q 2PEIA 4IPYA 3P05A 3CCRP 2BUOA 1RO0A 1M6NA 1K73Q 5HGMA 2Z44A 1PEQA 1PEOA 2P9XA 1QRJA 2OARA 1EOQA 2KODA 2JYLA 2PEQA 3DS5A 4XFZA 1VQLP 1QVGO 1YJ9P 4GR2A 1Q82Q 1N8RQ 4XRQA 1VQ6P 1E6JP 2M8LA 1VQ5P 2QEXP 1EIAA 4XROA 2EG5A 1NJIQ 2OTJP 1M74A 3CC4P 3Q20A 5F2KA 1Q81Q 2OTLP 3B5IA 1IUQA 1QVFO 3CCVP 1RNIA 3CCJP 3CPWO 1YJNP 1VQ9P 2PEMA 3DS1A 5JPAA 1RO2A 1VQNP 3VRLC 3HZQA 3CCQP 5BS1A 1A43A 3G4SP 3CCEP 1K30A 4PH0A 1K8AQ 4U0DA 1PEUA 1M6EX 1K9MQ 3I56P 2XT1A 3CCSP 2PEOA 4U0FA 3OW2O 1W2BO 3CMEP 3H0DA 3CCUP 3G1IA 5DCKA 1VQOP 1YJWP 3RG6C 1YI2P 3LRYA 3MGEA 2BQ1E 3G21A 2LF4A 2M8NA 3G6EP 3G28A 2JYGA 4U0CA 3DS0A 3G26A 5F2NA 2EIAA 4COPA 1YITP 3HYBA 3CXCO 3WBHA 5HGNA 1M90Q 4U0BA 5I4TG 2PENA 2EFJA 3G0VA 2M8PA 2E1MA 3I55P 1VQ8P 2PEJA 3CCMP 3DTJA 1YIJP 2BHVA 3CD6P 3NTEA 4GR6A 2DGYA 3G29A 1M1KQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI Q;  1VQP P;  2OTJ P;  3CC4 P;  3CC7 P;  1Q81 Q;  1KQS O;  2OTL P;  3G6E P;  1Q86 Q;  3G71 P;  1QVF O;  1VQM P;  3CCV P;  3CCJ P;  1YJN P;  3CPW O;  1JJ2 O;  1VQ9 P;  1KC8 Q;  3CCR P;  1YIT P;  3CXC O;  1VQ4 P;  1VQN P;  1K73 Q;  1Q7Y Q;  3G4S P;  1VQ7 P;  3CCE P;  1M90 Q;  3CME P;  1K8A Q;  3CMA P;  3CC2 P;  1K9M Q;  1KD1 Q;  1YHQ P;  3I55 P;  1VQ8 P;  3CCM P;  3I56 P;  3CCS P;  1YIJ P;  1S72 P;  3CD6 P;  1VQL P;  3OW2 O;  1W2B O;  2QA4 P;  1YJ9 P;  1Q82 Q;  1QVG O;  3CCU P;  1N8R Q;  3CCL P;  1VQO P;  1YJW P;  1VQK P;  1VQ6 P;  1YI2 P;  1VQ5 P;  2QEX P;  3CCQ P;  1M1K Q; 
#chains in the Genus database with same CATH topology
 2GYK A;  2JJL A;  1JEK A;  3A7O A;  5AW9 B;  4WB4 A;  2YO3 A;  1M1J B;  3S4R A;  1ZMB A;  1J1D B;  3L70 J;  2KOS A;  4D6T J;  2P67 A;  3M1M A;  3H1K E;  4IOI H;  1NTK G;  2WT7 A;  1LTG C;  2YO2 A;  1YTZ T;  2WQY C;  1BDC A;  1BGY D;  5HVC A;  1S72 P;  3ZDM A;  2PNG A;  3R4Y A;  2QA4 P;  1T8Z A;  3RK3 B;  1H0T B;  3K5B A;  3A3Y B;  5DJU B;  3G9R A;  1LTJ A;  3M0D A;  1PGQ A;  2IBZ I;  2JU1 A;  2BEQ D;  1N73 C;  2AFE A;  1GMJ A;  1IFN A;  2G3A A;  2FYU K;  5AW0 B;  2BCC E;  3V6I A;  5AVZ B;  1SQB K;  1VQL P;  4QKO A;  4HYT B;  4IFF A;  1Q2N A;  1ZW0 A;  2Q3E A;  2BAS A;  5AW7 B;  1RNI A;  2WPQ A;  3DS1 A;  3M0A A;  3CX5 E;  4H44 B;  3A0B H;  4I7Z B;  1AVO A;  4HKZ H;  3RG6 C;  4ASW A;  5APS A;  2OGU A;  1AYI A;  3OA7 A;  2N9Y B;  4H2X C;  3GHG C;  2MR8 A;  3V2R A;  1SQX J;  1KIL B;  1YBK A;  2A45 G;  2JWD A;  1DD3 A;  1HBW A;  1YTZ I;  1JY3 O;  1D1D A;  1RQU A;  3B71 A;  2W6J H;  1NTZ K;  2K2Q A;  2WPS A;  2Y0E A;  4H0L B;  3E2D A;  4WYM A;  2WIT A;  3AE2 C;  4H2W C;  1GXG A;  2PY8 A;  1AF8 A;  3W67 A;  3H1K D;  1JY2 P;  3HUS C;  2Q5U A;  3CE7 A;  4EI2 A;  1IFJ A;  1HGV A;  5B66 H;  5C39 A;  5GTH E;  2CPS A;  2XDJ A;  5KLV E;  2H89 C;  1K73 Q;  1UII A;  1GXH A;  2XKM A;  4BPG A;  3H1I G;  1VPC A;  4GR2 A;  1BGY E;  3TNU A;  4D6T G;  1R5S A;  4L75 A;  2K1A A;  3TSI A;  4C46 A;  3R2P A;  2FAE A;  2LKI A;  1X8Y A;  3RK2 B;  1NU1 J;  3VRL C;  2JP3 A;  1PP9 D;  3F5H A;  5AW4 B;  2SPZ A;  3L75 D;  2E74 D;  1IC2 A;  4KHX A;  5APV A;  1NVO A;  2KZI A;  5APQ A;  5AVQ B;  4DZO A;  1N86 A;  1EXJ A;  2RMZ A;  1T8K A;  2FYU J;  1KB9 H;  1L0L E;  2W27 A;  1D7M A;  2KG8 A;  1LTJ C;  1M90 Q;  3SSU A;  1YIJ P;  2BHV A;  4D6T D;  1OVU A;  1GTW A;  4GOE A;  5KLI B;  3L74 G;  1AFO A;  2JEE A;  1X3O A;  4Y28 J;  1DEE G;  5E79 H;  1LNQ A;  3L75 E;  3G3Z A;  3TNU B;  3MUD A;  3SWY A;  2N1T D;  2KSJ A;  3WMM 0;  1YYC A;  4PH1 A;  5K5G B;  1KQL A;  2IDB A;  2QJY C;  4ZKU A;  1VL2 A;  2KS1 B;  3AE5 C;  3VMA A;  1AVY A;  2B89 A;  4NPE A;  2PFX A;  3SWK A;  3ITK A;  1EXI A;  3OAK A;  2ZYG A;  1USE A;  5KLV D;  5AVW B;  5HV8 A;  3DS5 A;  1N8R Q;  1SQP G;  3Q3D A;  3Q5S A;  1IFM A;  2JQ4 A;  3B5N D;  5KLV K;  1PFI A;  1FBM A;  1SFC D;  3D71 A;  2O1K A;  1VQN P;  1BE3 E;  3D6Y A;  3M91 A;  1K30 A;  1KIL A;  2J59 M;  3V4Q A;  1N7S D;  1JMB A;  1PGJ A;  2QIW A;  2FVA A;  1YI2 P;  4C7N B;  4OWF A;  2YKQ A;  2L0Q A;  4GOD A;  2E76 B;  3EWK A;  2E43 A;  2D2C D;  4HKG A;  5CBO A;  1KYO I;  2OYH B;  2WWW A;  1YIT P;  2B9B A;  2IBZ E;  3VP8 A;  1H8A A;  3FGA D;  1JTH A;  4UB6 E;  2KG9 A;  1M1J C;  1QL2 A;  3CCM P;  4DCK A;  3WUV A;  1JO5 A;  5BVZ A;  1T6A A;  1BDD A;  3VOP A;  5BU8 B;  1M1K Q;  4H13 D;  1DX7 A;  5KP7 B;  3CC7 P;  4I1L A;  4ASV A;  2FFD A;  3DS2 A;  2I1K A;  1KB9 E;  4U3F D;  1HJB A;  3AEF C;  3BAS A;  3G1G A;  3DS3 A;  2ONT A;  2XXM A;  1SFC A;  2Y0D A;  2YMK A;  2QM8 A;  3TGU E;  4PWV B;  3L4F A;  1LT9 A;  2L5G B;  2ZVO B;  5CCG D;  2EHT A;  1IFI A;  2FAC A;  2GDY A;  2KR5 A;  2IPP A;  2PRR A;  2AXC A;  3PHL A;  5HGM A;  2Z44 A;  2O3J A;  1KV4 A;  3EQ2 A;  2WTY A;  1BCC E;  4AUW A;  3VYI A;  1YJ9 P;  2N98 A;  1VQ6 P;  2E75 B;  2QEX P;  3H32 A;  3V2N A;  5H2F H;  5AVR B;  3RK3 E;  2YIU C;  2OTL P;  2OYI C;  1IUQ A;  2YXR B;  5KAI E;  1RO2 A;  3CXH I;  4RJT A;  5BS1 A;  1KFN A;  1J2J B;  3RBX A;  4U0D A;  4WVZ A;  2LTE A;  1FZC C;  2R32 A;  1W2B O;  3CME P;  1L4A B;  3G1I A;  3AE7 C;  1MFT A;  3MIW A;  3B5N A;  3L72 D;  3L70 D;  2GDX A;  1LT9 C;  2PGD A;  3HD7 D;  5HGN A;  1NWQ A;  1N7S A;  4IZ6 A;  2M8P A;  1VQ8 P;  2PEJ A;  1NTK J;  4BPH A;  2K5X A;  2MVV A;  3NTE A;  2AVA A;  1NTM G;  1HUC A;  1NU1 K;  4PV1 C;  3L70 G;  4IL6 X;  3FWN A;  1SQV J;  2GM4 A;  5BS2 A;  1M8O B;  1OMI A;  3BRV B;  2L6E A;  2P10 A;  3MD0 A;  1DD4 A;  2H7H A;  1OR5 A;  3TDK A;  1LWU A;  5HGO A;  2JO1 A;  2WVR A;  4EYY Q;  1KIL C;  3RK3 D;  3WU2 E;  1SFC C;  1JCD A;  2ZAE B;  3FXE A;  3QWO C;  2L91 A;  3CWB G;  4K3A A;  2KNC B;  1FZB A;  2LOL A;  3P05 A;  3F89 A;  4Z1M H;  2JAZ A;  1UJZ A;  1S5L X;  1KYO D;  2FKW B;  1S4X A;  1JTH B;  1MZ9 A;  2GZI A;  2GZG A;  1PPJ G;  2KK7 A;  2KOP A;  2W8Z A;  2E74 C;  2M8L A;  3MZW B;  5APX A;  2P7J A;  3PH0 A;  2HOD A;  5F2K A;  1RE4 C;  3L73 D;  1NGM B;  3H25 A;  1H88 A;  2OYI A;  1IZN B;  1KN7 A;  1N2D C;  4Y99 C;  3KPE A;  1FE6 A;  4QMA A;  3CX5 D;  4DT0 A;  5DCK A;  2V7Q H;  3HD7 B;  2OYH A;  3VN0 A;  3G28 A;  4GIF A;  2K94 A;  2KWL A;  2WMM A;  1PGO A;  3H32 B;  1KZU B;  3BCC D;  3CXC O;  1L0N K;  1GPJ A;  4BPF A;  1N73 B;  4RES B;  3CD6 P;  2H43 A;  4B86 A;  3V2Q A;  1L0L K;  3IR9 A;  3L72 G;  1FU1 A;  2ZT9 D;  3CCQ P;  3E1R A;  5APT A;  5AW6 B;  1T3J A;  3Q5R A;  3A0H H;  1TU3 F;  2KS1 A;  2PEK A;  4PJ0 E;  1NTK E;  2KLV A;  5EFW B;  4R4L A;  1VQ7 P;  1SQQ E;  4N3Y B;  3HUS A;  5DJT B;  3TGU J;  5EJD A;  1JY3 P;  1VQK P;  1RH5 B;  2K93 A;  5CMZ A;  3CCR P;  1P84 E;  2KW2 A;  2MVU A;  2R5D A;  1IMP A;  1NH4 A;  5B5E H;  1L0N G;  2BEZ F;  3IN6 A;  1GDT A;  1M56 D;  1ZOY C;  3H6P A;  1S2E A;  1F80 D;  2AFD A;  1L4A D;  4R0M A;  1N7S C;  2EG5 A;  2OTJ P;  2Z5H A;  2B87 A;  1QVF O;  2QJY B;  3CL3 D;  1FJP A;  1VQ9 P;  1Z56 A;  2RN0 A;  2A45 H;  1QX8 A;  3CCE P;  2W6A A;  3MGN A;  1SQX G;  3QH9 A;  1OX3 A;  1GL2 C;  1H89 A;  1ZV8 A;  2WPV B;  2YXQ B;  2ZT9 C;  3VP9 A;  3FX0 A;  2K0D X;  1FZF A;  1VQO P;  4ZKP A;  2D2C B;  4D6T E;  3UIA A;  2QJP B;  3G26 A;  1U7J A;  1FC2 C;  2POH A;  2W83 C;  2Y9Y A;  3Q1M A;  3W68 A;  1L0L D;  1EZV I;  4JYC A;  1L0L J;  2Q3I A;  4AYC A;  4N6J A;  2VLO A;  1NTZ J;  1OXZ A;  5CCG A;  3EFF K;  1SQV G;  1SQB E;  4PD4 I;  1A02 F;  3G71 P;  1LP1 A;  2Z45 A;  3HD7 A;  4NEO A;  1U57 A;  3C9I A;  3H1J J;  3AEB C;  1L4A A;  2VLP A;  1NTK D;  3VMY A;  1VDF A;  4I6M C;  2OYH C;  4YTP C;  3WUU A;  2LPK A;  1HQB A;  1T2K D;  2KGC A;  4QNB A;  2E76 C;  3MHV A;  3RL0 g;  5M1B A;  2QSI A;  2GUS A;  4HH2 A;  4JYB A;  5HGL A;  3CI9 A;  1PEM A;  2FQ1 A;  2KOG A;  1QRJ A;  2A45 I;  5KJ7 A;  2JYL A;  2KLU A;  3NMD A;  3NTN A;  2R5B A;  1GL2 D;  2YKP A;  2FYU E;  1Q82 Q;  3GLM A;  1M1J A;  1RE4 A;  2KNC A;  3C8V A;  4PD4 D;  2PEM A;  4PXH B;  1KB9 I;  5B66 E;  2KG6 A;  2I1J A;  4CPG A;  4BWN A;  3II6 A;  3E7K A;  1KIL E;  3I56 P;  4BRY A;  4WY4 C;  5APU A;  4DOJ A;  1X9V A;  1EDK A;  1IFD A;  5F2N A;  1S1C X;  3H1J E;  2H88 C;  4IFM A;  2Z4E A;  1KLP A;  2IFN A;  2IZ1 A;  3BVH A;  3P8C E;  1USD A;  5AVU B;  4PD4 H;  4W7Z A;  2OYI B;  1IK9 A;  1T2K C;  2K88 A;  2ROQ A;  3KYQ A;  2XV6 A;  2J5U A;  2HOD B;  3JSV C;  2XZ0 D;  1DIP A;  3MUD C;  3LW5 J;  4L74 A;  2NRG A;  3CXH E;  1JMM A;  5B5E E;  1S3J A;  3TYY A;  1L4A C;  5BU5 A;  5KAF E;  2AEJ A;  2VSQ A;  1KQF B;  3AEE C;  5CZD B;  1CEI A;  4U0E A;  1L2P A;  2YMY A;  2LIW A;  1HH0 A;  2KI7 B;  3VMZ A;  1KOR A;  1SQV D;  1KC8 Q;  2PEI A;  5APY A;  1H0T A;  2M0B A;  4GOF A;  2P9X A;  2AXT E;  5H2F E;  4UB8 H;  3AE1 C;  1SQP E;  1VKU A;  1ZN5 A;  1SQP D;  2N1T B;  3H1I J;  2GUV A;  1MV8 A;  1LT1 A;  5APW A;  3AE9 C;  3JCU H;  2O01 N;  1XTC C;  1DNY A;  1KFM A;  4OGQ C;  3GJN A;  1ZR2 A;  1Q81 Q;  4L73 A;  5CJ0 A;  3L72 J;  1BE3 D;  2VLQ A;  1G1I A;  5CCG C;  1LTT C;  2N5I A;  1SQP J;  3H1I D;  3M9B A;  2K37 A;  2P58 A;  1M7L A;  5KLV J;  2XT1 A;  2DNW A;  3CCU P;  4I7Z C;  2N5H A;  1M57 D;  2BQ1 E;  2IBZ G;  4OGQ B;  2ZYA A;  3B5N C;  3KZI H;  1RQV A;  4U0C A;  2FYN C;  1W5C E;  3WBH A;  3MTU E;  2O1J A;  2R3C A;  5L8R J;  2EFJ A;  1PPJ D;  3G0V A;  2E74 B;  2E1M A;  2C0X A;  1EDL A;  1LTA C;  4GR6 A;  1GK6 A;  1R8E A;  2CNR A;  3Q5P A;  1VQP P;  1CI6 A;  1KTM A;  1BCC J;  3CWB D;  2FVF A;  4U3F E;  3RK2 C;  1NHL A;  2ZFC A;  2JKV A;  2CWO A;  4BRY B;  3HE4 A;  2B88 A;  2M5A A;  1RHZ B;  2RH0 A;  4M0I A;  4XFX A;  1OFC X;  1KD1 Q;  3NY7 B;  2M5A B;  1OVV A;  3D70 A;  3O6Q A;  2JO0 A;  1CZQ A;  1P84 D;  1GU5 A;  2KSE A;  1M6N A;  4NPF X;  4WY4 D;  2FY8 A;  1EOQ A;  3LIE A;  3CXH H;  1SLQ A;  3L75 J;  3AEA C;  2LXC B;  1EZV E;  1L0H A;  1E6J P;  4XE5 B;  2LKM A;  1G2C A;  2WSC J;  3M9H A;  1LWU C;  4H44 D;  3SFE C;  1PP9 G;  1MKM A;  1LGH B;  2M3B A;  1AQT A;  1LTB C;  4EIJ A;  2E75 C;  1FJK A;  1K8A Q;  2JDI H;  2KOO A;  1M6E X;  4K35 A;  1NTM D;  3B4S A;  1RF1 A;  2M3E A;  3OJA B;  2JYG A;  1GW3 A;  4H13 B;  4HB1 A;  1QLE D;  4YPC A;  3IF4 A;  1WRG A;  2JWA A;  1L0L G;  5AVV B;  5AW3 B;  2N1T C;  2N9B A;  3I55 P;  1QEX A;  1K05 A;  1RF0 A;  2FHS C;  1VF5 C;  2GZE A;  1RY3 A;  3GF7 A;  1JNM A;  3KXD A;  2JU2 A;  1ZNV A;  2ERH A;  3GG2 A;  1UIX A;  1Q86 Q;  1NTZ D;  3L71 D;  3H4E A;  1Q7Y Q;  4UB8 E;  2HR3 A;  1NAF A;  2XNX A;  3CCL P;  1S5L E;  2JB0 A;  2HPC A;  1LP1 B;  1SQX K;  4HJG H;  3SWF A;  2W90 A;  1G2C B;  3FWL A;  1KQG B;  2BCC G;  2E75 D;  5KP8 B;  1J1E B;  1PEO A;  1PPJ E;  1NTM J;  1JM0 A;  2OAR A;  2H8P D;  3GW6 A;  1Q90 D;  4XFZ A;  2R3S A;  1K04 A;  1OW6 A;  2FQ0 A;  1L0N J;  2YIU B;  4XRO A;  4WBA A;  3RL0 C;  1ZR4 A;  4PD4 E;  3B4Q A;  3GF3 A;  2KXP B;  3CCV P;  5AW5 B;  3CPW O;  1OW7 A;  3HE5 A;  1T3U A;  3L74 J;  3N4X A;  3O6Q B;  3A2A A;  3G4S P;  2WSF J;  2QVA A;  2MD9 A;  2AEF A;  2ZVN B;  1L0N E;  2QJK C;  4MRT C;  4U0F A;  3H0D A;  5KKZ C;  5KLI C;  4YXW H;  3RL0 B;  4YXD C;  3O8Z A;  1NTZ E;  2ZJS E;  3VTP C;  4N78 D;  2FQ2 A;  1SVF A;  3PJS K;  3PP5 A;  3AE3 C;  2MKV A;  2KGA A;  1E5W A;  4U0B A;  5I4T G;  1RE3 A;  3TK1 A;  2G8Y A;  3P8M C;  3L72 E;  5KAI H;  4PV1 B;  3JC2 2;  1KQS O;  1KMI Z;  1SQQ G;  1GU4 A;  1SQQ D;  1NTZ G;  1FZC B;  2L9F A;  4C7R A;  1RF1 C;  3RBZ A;  4CA3 A;  2IX7 C;  1N7S B;  2GZJ A;  2WSE J;  3H1L E;  5CJ4 A;  1KYO H;  1CW5 A;  5KTB A;  1UNK A;  2JBG A;  2KUB A;  4H44 C;  2CQ8 A;  1FDM A;  2FYZ A;  3WU2 H;  4GT1 A;  3A5T A;  2WPT A;  4IPY A;  1NKZ B;  1SQV E;  2GA1 A;  2LIU A;  2W6B A;  3AE6 C;  3L35 A;  1ZXG A;  1IFP A;  2WSE H;  1EZV D;  3JCU E;  3M9Q A;  2KP8 A;  1L0N D;  2PEQ A;  2M5R A;  1FOS E;  1LTI C;  2C0W A;  4JBZ A;  1BCC G;  3S9O A;  2MY5 A;  1Y47 A;  1SS1 A;  1FS0 E;  1SQX E;  1YJN P;  2FYN B;  3Q2Y A;  1OIP A;  1G1J A;  3HZQ A;  1SFC B;  1OW8 A;  1VF5 D;  3T97 B;  4A7P A;  1K9M Q;  2UWJ E;  1JOC A;  3PTZ A;  4GDO A;  3AE8 C;  4WY4 A;  2MR7 A;  2ZXE B;  2FYU G;  2Q7C A;  2BCC D;  2C9L Y;  1Y8A A;  3PLN A;  4I2L C;  1ZME C;  2LXB A;  5E79 E;  3C1L A;  2ZT9 B;  7CEI A;  2K9J A;  1BSH A;  1NU1 D;  3AE4 C;  1WMK A;  3WUT A;  1NU1 G;  3RGU A;  5CCH C;  2NZ2 A;  3IAO A;  4WWI A;  1X22 A;  1FZG A;  3L70 E;  2ITA A;  2Q1K A;  2AXT H;  2V4H A;  1NTK K;  2O01 H;  2L22 A;  1JB0 J;  3KQG A;  3H1K G;  1AJY A;  1AA0 A;  1QGK B;  2CK3 H;  1ZP0 C;  1NU1 E;  4GKG A;  2K9Y A;  2AEM A;  2BUO A;  3H1K J;  5AVT B;  1PEQ A;  1OVR A;  4M3L A;  1J1D C;  3AEG C;  1HVV A;  4LLH A;  1NTM K;  2FXP A;  1QVG O;  1RE3 C;  2HFE D;  1VHN A;  3HE5 B;  1J1E C;  1AV1 A;  5KP6 B;  2E5Y A;  1NO4 A;  1P84 H;  3HRN A;  2ZYD A;  2QM7 A;  5JPA A;  3E1I A;  2Q9I A;  1SQX D;  1JUN A;  4IL6 H;  2JR8 A;  1SP4 A;  2O01 J;  2L4B A;  1KYO E;  4Y99 B;  2XND H;  3P7K A;  3OW2 O;  2KGE A;  5KAF H;  4R4M A;  5GTI H;  2E5T A;  1BE3 J;  2LML A;  2FFD B;  4LGD E;  1E0H A;  3G6E P;  1JY2 N;  4EOT A;  1NAY A;  1EDI A;  2XZR A;  2FBW C;  5AVX B;  1FR2 A;  3G29 A;  3H1L D;  1HY8 A;  1LTJ B;  4W7Y A;  1GL2 A;  1QL1 A;  3V2P A;  2MJZ A;  2FAD A;  5F2O A;  2WSF H;  2RKL A;  3EJB A;  3HTK A;  3CLQ A;  2PAJ A;  1N7L A;  3SFD C;  3TGU G;  1YHQ P;  3T97 A;  3DPH A;  2CGQ A;  1YQ4 C;  1PGP A;  3L71 E;  1X79 B;  1NQ4 A;  2BCC J;  3LID A;  4KT0 J;  2NO8 A;  1U7M A;  1SQB J;  4U3F G;  1HTL C;  1EMV A;  1MZ8 A;  1SQQ K;  5KLV G;  1P84 I;  4XRQ A;  2KIK A;  3H1I E;  4H0L C;  3CC4 P;  3L71 G;  2QJK B;  2R44 A;  4WY4 B;  1PZQ A;  2LL8 A;  1IO4 A;  5CHX A;  1EC5 A;  1X0T A;  1ZRT E;  3AED C;  3BCC J;  2K9J B;  2PEO A;  5AW1 B;  1PP9 J;  1YJW P;  3M0D C;  1FDO A;  3KDP B;  4DJG A;  4N78 E;  4AQR D;  3G21 A;  2VRS A;  2M8N A;  4OGQ D;  3BCC E;  3DS0 A;  2HPC B;  5KJ7 C;  2KB7 P;  2OTK E;  3GZM A;  3TGU D;  2X2B A;  2N1T A;  1EQ7 A;  2WT7 B;  2IYP A;  3P32 A;  5CCH A;  2WPR A;  2MF4 A;  1MFZ A;  2OYO A;  3GKL C;  1NKN A;  2FXM A;  1JY2 O;  2CPB A;  2K3R A;  1GD2 E;  2E76 D;  1ZLL A;  3S1K A;  2N6Z A;  2JGP A;  3LMO A;  3V4W A;  4IFD K;  4BXL A;  4RO0 A;  4COC A;  2WSS H;  2DW3 A;  3BCC G;  3D6Z A;  2OQQ A;  3B8E B;  3CMA P;  3NFQ A;  3P8C D;  3VMX A;  1BGY G;  2GDW A;  3U43 A;  3L75 G;  1CSB A;  3GZL A;  3CWB E;  3M06 A;  3A0B E;  4IL6 E;  2B87 B;  3L71 J;  3L36 A;  1Y9B A;  2Y9Z A;  1A8O A;  1VQM P;  1W2E A;  1EDJ A;  1DV5 A;  1IJD B;  2AF8 A;  1LTS C;  1EZV G;  3LW5 H;  1A02 J;  2KOD A;  2GZF A;  1NOH A;  2HLO A;  3A0H E;  2WZ7 A;  4XFJ A;  2C9N Y;  4OH8 B;  3L74 D;  3L73 J;  1GZL A;  2D2C C;  2WSC H;  3NXS A;  2NPS D;  3EJE A;  5GTH H;  3CCJ P;  4C7N A;  1BXI A;  2KYV A;  1A43 A;  3EJD A;  4U7J A;  1HWT C;  1S5L H;  1DEB A;  1SQB D;  1LWU B;  3L74 E;  1OZH A;  1E79 H;  1GW4 A;  3U59 A;  1CI6 B;  1PL5 A;  2N6Y A;  2PP6 A;  3HYB A;  1JCC A;  5AW8 B;  2PEN A;  1IK7 A;  2HYN A;  3CX5 H;  1RF0 C;  2P1J A;  3HTK B;  5CBN A;  3H1J G;  3L37 A;  2HG5 D;  1NYH A;  4UHP B;  1GL2 B;  3ABV C;  1FDI A;  3H1H D;  3DS4 A;  1BAJ A;  3I5C A;  3IFM A;  2ZXX A;  1URQ A;  1BGY J;  3CC2 P;  3V5B A;  1URQ B;  4JF7 A;  4JQ0 D;  1S9K D;  2QE7 H;  3CWB J;  1BCC D;  2FXO A;  2NPS B;  1BE3 G;  3B5N B;  4H2Y C;  1RO0 A;  1FOS F;  5AVY B;  1N73 A;  1L0I A;  4F37 A;  3H1J D;  1Z6M A;  4OVN F;  3HE4 B;  1YQ3 C;  2IZ0 A;  5TIS H;  3H1H J;  3H1L G;  1R5L A;  4O9B A;  1EIA A;  2IFM A;  2KZJ A;  1M74 A;  2K92 A;  1ZRT D;  3B5I A;  5EW5 E;  1LT9 B;  4EDF A;  4TT3 H;  4ZMD A;  1BSN A;  2P2U A;  4PH0 A;  2Q6Q A;  1AQ5 A;  4H13 C;  4RKU J;  2Y0C A;  2KOR A;  2KGD A;  4L76 A;  3AEC C;  1DH3 A;  5GTI E;  3BAT A;  4ZNC A;  2LF4 A;  1SQQ J;  1FZA A;  3PRJ A;  3USS A;  4MN4 C;  3RL0 D;  1WT6 A;  1HGZ A;  4DG9 A;  1RF1 B;  1MUU A;  2LR2 A;  3U1C A;  2E42 A;  3RK2 D;  2J58 A;  2YKO A;  1VF5 B;  3DTJ A;  4U3F J;  4XA4 A;  3MP7 B;  1SQB G;  2DGY A;  1URQ D;  4LC1 A;  2XZ1 C;  1NTM E;  3GMA A;  3H47 A;  1JJ2 O;  5AW2 B;  4KJM A;  1VQ4 P;  2FFD C;  2EHS A;  2QNW A;  4U0A A;  1AUM A;  3HUS B;  1IMQ A;  2I8D A;  2NPS C;  1HJ0 A;  1PV3 A;  4XFY A;  2CG5 B;  1GK4 A;  2M8R A;  2Z46 A;  5CCH D;  3FXD A;  3H1H G;  3H1L J;  2IYO A;  2QJP C;  1OWA A;  4H0L D;  2K0Y A;  4NPD A;  3GHG B;  1S9K E;  5TIS E;  3RG2 A;  2A06 E;  3GHG A;  4JPZ B;  2K0X A;  1SQP K;  3CXH D;  3EFG A;  3CX5 I;  1VQ5 P;  3KHU A;  1LJ2 A;  1XTG B;  2XU6 A;  3HD7 C;  3BRT B;  1NJI Q;  3N7N A;  3Q20 A;  2XV5 A;  3L73 E;  5KKZ B;  2KOQ A;  3H1H E;  4PV1 D;  1PEU A;  5KJ7 D;  2Z5I A;  1PP9 E;  3U1A A;  3CCS P;  4W80 A;  1HF9 A;  3KZI E;  1URQ C;  2V7Q J;  2FYU D;  1KB9 D;  1FZC A;  2A06 G;  2FVE A;  5AVS B;  5TJH A;  3LRY A;  3TF5 A;  3MGE A;  2A06 D;  2N50 A;  1ACP A;  2NPS A;  2YNY A;  4PJ0 H;  1PIX A;  1JY3 N;  2EIA A;  4COP A;  3L73 G;  2QRX A;  1FAV A;  1KIL D;  3RK3 C;  2VLN A;  4TLF A;  1FZE A;  1SQV K;  2QG4 A;  2IBZ D;  4UB6 H; 
#chains in the Genus database with same CATH homology
 2XV6 A;  1VQP P;  3CC7 P;  5BS2 A;  1KQS O;  1D1D A;  1Q86 Q;  3G71 P;  2PEK A;  3DS4 A;  3H47 A;  2L6E A;  1BAJ A;  2Z45 A;  1JJ2 O;  3DS2 A;  3H4E A;  3E2D A;  1VQ4 P;  1ZMB A;  5F2O A;  4WYM A;  4COC A;  2CWO A;  3M1M A;  1Q7Y Q;  1VQ7 P;  4U0A A;  2PY8 A;  1AUM A;  3G1G A;  4M0I A;  4XFX A;  3CMA P;  3DS3 A;  3CC2 P;  5HGO A;  1YHQ P;  1KD1 Q;  3DPH A;  2ONT A;  4PH1 A;  1S72 P;  2XXM A;  2QA4 P;  3CCL P;  4QNB A;  1VQK P;  4XFY A;  2JO0 A;  4U0E A;  2Z46 A;  5HGL A;  1A8O A;  1VQM P;  1PEM A;  1KC8 Q;  2PEI A;  4IPY A;  3P05 A;  3CCR P;  2BUO A;  1RO0 A;  1M6N A;  1K73 Q;  5HGM A;  2Z44 A;  1PEQ A;  1PEO A;  2P9X A;  1QRJ A;  2OAR A;  1EOQ A;  2KOD A;  2JYL A;  2PEQ A;  3DS5 A;  4XFZ A;  1VQL P;  1QVG O;  1YJ9 P;  4GR2 A;  1Q82 Q;  1N8R Q;  4XRQ A;  1VQ6 P;  1E6J P;  2M8L A;  1VQ5 P;  2QEX P;  1EIA A;  4XRO A;  2EG5 A;  1NJI Q;  2OTJ P;  1M74 A;  3CC4 P;  3Q20 A;  5F2K A;  1Q81 Q;  2OTL P;  3B5I A;  1IUQ A;  1QVF O;  3CCV P;  1RNI A;  3CCJ P;  3CPW O;  1YJN P;  1VQ9 P;  2PEM A;  3DS1 A;  5JPA A;  1RO2 A;  1VQN P;  3VRL C;  3HZQ A;  3CCQ P;  5BS1 A;  1A43 A;  3G4S P;  3CCE P;  1K30 A;  4PH0 A;  1K8A Q;  4U0D A;  1PEU A;  1M6E X;  1K9M Q;  3I56 P;  2XT1 A;  3CCS P;  2PEO A;  4U0F A;  3OW2 O;  1W2B O;  3CME P;  3H0D A;  3CCU P;  3G1I A;  5DCK A;  1VQO P;  1YJW P;  3RG6 C;  1YI2 P;  3LRY A;  3MGE A;  2BQ1 E;  3G21 A;  2LF4 A;  2M8N A;  3G6E P;  3G28 A;  2JYG A;  4U0C A;  3DS0 A;  3G26 A;  5F2N A;  2EIA A;  4COP A;  1YIT P;  3HYB A;  3CXC O;  3WBH A;  5HGN A;  1M90 Q;  4U0B A;  5I4T G;  2PEN A;  2EFJ A;  3G0V A;  2M8P A;  2E1M A;  3I55 P;  1VQ8 P;  2PEJ A;  3CCM P;  3DTJ A;  1YIJ P;  2BHV A;  3CD6 P;  3NTE A;  4GR6 A;  2DGY A;  3G29 A;  1M1K Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...