1KC8Q

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kc8Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kc8Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kc8Q03
3CCQP 1VQPP 1YI2P 1YIJP 1KC8Q 1YITP 3I56P 1M1KQ 1VQ8P 3G6EP 3G4SP 1VQKP 3CD6P 1YHQP 1N8RQ 1VQOP 3CMEP 3CXCO 1VQMP 2QA4P 3CPWO 3G71P 2QEXP 1VQ9P 2OTLP 1VQ7P 1W2BO 1NJIQ 3I55P 3CCUP 3OW2O 2OTJP 1K73Q 1YJWP 3CC2P 3CMAP 1VQ5P 1VQ6P 1YJNP 3CCJP 1Q7YQ 1YJ9P 3CCRP 1Q81Q 1Q86Q 1KQSO 1QVFO 3CCMP 1M90Q 3CCEP 3CCSP 1QVGO 1S72P 1JJ2O 1K8AQ 1Q82Q 1VQ4P 1VQLP 3CCLP 3CC4P 1VQNP 1K9MQ 3CC7P 1KD1Q 3CCVP
chains in the Genus database with same CATH superfamily
2AXCA 1E5WA 1GL2A 5K5GB 3WUTA 1OR5A 3L72J 3FWLA 1NTKK 5CCGC 4PV1D 3OW2O 5AW1B 2AXTH 3D71A 3O6QB 3JC22 3H1JJ 3KYQA 2Z45A 1SFCC 1TU3F 2MVVA 1N7SC 1OW6A 5H2FH 5KAFE 4IL6E 1EDJA 1LTAC 2KOSA 4R4MA 4PWVB 2FQ2A 2P7JA 2IYPA 2KK7A 5TJHA 2FADA 1QVFO 2M8RA 1JUNA 5KLVK 3BVHA 3CX5I 5CCGD 5CJ4A 2FY8A 2I8DA 3H1IE 4JQ0D 2LXCB 1SFCD 5AVSB 1KILE 1N7SD 5CCGA 4PH0A 3NMDA 2JYGA 1P84I 1R5LA 1XTCC 3H1IG 1SFCA 1EC5A 1N7SA 5JPAA 1T6AA 3L75J 1NTMJ 1Q82Q 2KSJA 3CCVP 3MUDA 4DOJA 1KQFB 2A06D 4U3FE 4ZMDA 1L0LJ 1FZCC 1NTKD 5AW5B 3HTKB 3A0BH 5HGLA 5HGNA 1NKNA 1A02F 2AFEA 1X0TA 4U3FG 1N73A 5CBNA 4GIFA 1VF5C 3M1MA 3D6YA 4XFXA 3CLQA 5CCHC 3W68A 2M8LA 1FBMA 3KZIE 2XZ0D 1PP9D 1RF1C 3H1HD 1SP4A 2GUSA 3C9IA 2LIUA 2H43A 2K88A 4L73A 2N5IA 1ZW0A 2ZYGA 1BCCE 4UB6E 2M0BA 1JNMA 1M8OB 5KLVD 3CC4P 3AEFC 2JP3A 1PGPA 1BCCG 1Q2NA 2YO2A 1RE3C 4ZKUA 1NO4A 2QJPB 2MVUA 3G9RA 2K94A 3SWFA 1FZCA 1RY3A 2E42A 4H0LB 1VF5D 2FFDA 1NU1K 2IPPA 1SLQA 3CCEP 5CCHD 3PP5A 5CZDB 2IFNA 2M3EA 4W80A 2PEQA 1IC2A 4GT1A 3U1AA 1WMKA 1YQ3C 3M0AA 1L4AC 1NTZJ 2AFDA 4NPFX 2FYUE 3VOPA 1IJDB 1JOCA 3M06A 1OVVA 4H44B 1VQNP 2FYUG 3L71E 1NVOA 3CX5H 2XV5A 5APQA 2I1JA 4N6JA 1LTJB 5AW2B 3TNUA 3B71A 1H88A 3L71G 4WY4B 2IFMA 1OX3A 2D2CC 5DCKA 3V6IA 3Q1MA 1BXIA 1D1DA 3CXHH 2DW3A 2PAJA 2ZXXA 1L4AD 3H32A 2N1TA 1CW5A 4ASWA 3L4FA 2FVAA 1LT1A 5M1BA 2RKLA 1GD2E 3AE5C 2ZT9B 2WWWA 1MV8A 4Y99C 2UWJE 2K3RA 2XXMA 1LWUA 2M5AB 4QKOA 2N9YB 1EXIA 3CCJP 1ZP0C 3HRNA 1SQPK 5F2KA 1NU1D 5KKZB 1OVRA 1LT9B 2LL8A 1RH5B 5KJ7A 1ZMEC 2D2CD 2M8PA 4DCKA 1YITP 2PEIA 2R32A 3H1LE 1E0HA 3TK1A 3Q20A 2E74C 3E7KA 4RJTA 2E76C 2P67A 2O3JA 4HB1A 2OTLP 4H13B 1IFPA 2AXTE 3HE5B 3AEDC 3H1LG 2R3SA 4W7ZA 4JYCA 2H7HA 1U7MA 5H2FE 1URQB 1GL2B 5AVRB 4WB4A 3EJEA 1EZVE 4PJ0H 4AUWA 2W27A 1N2DC 1IK7A 2QA4P 1E79H 2WITA 2FXPA 3L70E 5F2NA 1S3JA 1GPJA 1Q90D 1SQVK 1EZVG 1KORA 3BCCD 1OZHA 3V2RA 4PV1B 1Q86Q 3L70G 1LTBC 2E74D 2CNRA 2E76D 2IBZE 3B5IA 1NKZB 3SWKA 3SFEC 2IBZG 4JYBA 4U0CA 2E75C 2W8ZA 2YIUB 1T8KA 4XFYA 3O6QA 1QL2A 1SQPD 4W7YA 1KB9D 3MTUE 1VKUA 3RGUA 2ZJSE 2FHSC 1HVVA 2PEKA 4GOEA 2KOOA 3A0BE 1MUUA 2FYZA 2LTEA 1OIPA 1DEBA 2HYNA 1FU1A 1DD4A 1SFCB 1KZUB 1FJKA 2L6EA 1N7SB 1M6EX 3LRYA 1LJ2A 2WMMA 3FXDA 1AF8A 1AUMA 1BSHA 5GTIH 3O8ZA 5EFWB 1PEQA 3GJNA 2E75D 2HODB 3USSA 2LPKA 2JJLA 2OYHC 2FKWB 3L75E 2Z44A 1NTME 2PEOA 1J1DB 2X2BA 1N73B 3GHGC 4U7JA 1SQVD 4U3FJ 1ZN5A 1KQSO 4LLHA 4YXWH 3L75G 1NTMG 3G26A 1L0LE 4YTPC 3WBHA 2KIKA 3GMAA 1L0LG 1JB0J 2H8PD 5AVZB 3G1IA 1KB9I 2SPZA 1ZOYC 3RL0C 5AW0B 4R4LA 2JGPA 3VTPC 4N3YB 5APVA 3L73D 1BCCJ 2MR7A 3RBXA 2L91A 2XDJA 1NYHA 2ZVNB 1FZCB 1L0IA 1FOSF 1FDIA 2KW2A 1JTHA 2OYHA 2FFDB 4CPGA 4TT3H 2MY5A 3GHGA 3N4XA 5KAIH 2Q5UA 3VMYA 2KG6A 3L72D 3CX5E 1MKMA 1T3JA 1L0LK 3RL0D 2QEXP 1X9VA 2FBWC 3H1JD 4KJMA 4M0IA 2IZ0A 3II6A 1P84E 3H25A 3CWBE 3QH9A 3RG6C 1JY3P 2WSEJ 3Q3DA 1QGKB 2B89A 1AVYA 3TNUB 1YTZT 3CWBG 4N78E 3L71J 4M3LA 3G21A 4K3AA 3H1KD 1IFNA 5BS1A 3V2PA 2MKVA 2XZ1C 1HWTC 3H32B 3V4WA 1S72P 5TISH 2KR5A 1BGYE 1ZRTD 1KTMA 1JY2N 1H8AA 1DEEG 3AE7C 1SQQJ 2YKPA 3Q5RA 1GTWA 1BGYG 1LTJA 1LWUB 3IAOA 1PL5A 4WY4A 3EFFK 1XTGB 2O1JA 3D6ZA 4B86A 2JQ4A 4XFJA 2CPBA 3LW5J 1NTZK 1FZBA 2AEMA 3FXEA 4GODA 5KP8B 1PIXA 2D2CB 3TGUJ 1KMIZ 2K0DX 1PGJA 1NAYA 1PPJD 1KB9H 2FAEA 4U0EA 4BRYA 2Q1KA 3ABVC 5GTHH 1VQKP 4DG9A 1YHQP 1KYOD 2BUOA 3EFGA 4Y99B 3A5TA 2NPSC 2KLVA 2KGDA 3AEEC 5APTA 3AE4C 5AW3B 1JY2O 2QSIA 3FGAD 3B4QA 3Q2YA 2MR8A 2WSFH 1IO4A 2YXQB 2P10A 4BPFA 1KC8Q 1Y47A 2MJZA 3NTNA 1W2EA 4WYMA 1BDCA 2CK3H 2QJKB 1YBKA 3DS2A 1IUQA 1UNKA 2L22A 1G2CB 2QM8A 5GTIE 1PFIA 2Q9IA 2J58A 3MP7B 4YXDC 3SFDC 2NPSD 1IZNB 3PHLA 1NTZD 3VP8A 2EG5A 4A7PA 2OQQA 3L74J 1VQ5P 1RF0C 5AVUB 2R5BA 3D70A 4COCA 3CI9A 2HR3A 5I4TG 1SQBJ 3G4SP 1IFDA 3RK3C 3TDKA 5AVTB 2JU1A 2E75B 3CXHI 4H2XC 3KXDA 2J5UA 1LTGC 3AE2C 1BE3D 2WPVB 3VRLC 2JYLA 3AE1C 1LGHB 1PGQA 4IFFA 1VQOP 3ZDMA 2HODA 2BEZF 3T97A 2ERHA 5APSA 1GXGA 1X22A 2QIWA 3R4YA 4H2YC 2XZRA 1X79B 5KAIE 1SVFA 3ITKA 3RK3D 4IZ6A 4K35A 1DNYA 2KYVA 1JTHB 1GU4A 2OYHB 4HKGA 1JCDA 3GHGB 2M3BA 4ZKPA 1HTLC 4WVZA 3HD7C 1D7MA 4PD4D 1L0HA 1M7LA 2FXOA 2B87A 2POHA 3CCLP 1QLED 2KUBA 1VQ8P 1N86A 3V5BA 3V2NA 2E43A 1ZMBA 4IFDK 3G1GA 2B88A 1RNIA 3HUSC 1PGOA 3BATA 2KNCA 5F2OA 4XE5B 3RL0B 1Q7YQ 3NXSA 1FZGA 5TISE 1KILC 3B5NC 2OARA 3CCQP 1S4XA 3CWBJ 2PNGA 3HD7D 5CCHA 2GM4A 3R2PA 1RF1A 1K73Q 4XFZA 4H2WC 1E6JP 3HD7A 5APUA 1LNQA 5BU8B 1KYOH 2HFED 4I1LA 1H0TB 1AFOA 1AQTA 5DJUB 1BGYJ 4NPEA 2GZEA 1RE3A 3H1ID 2CQ8A 3AECC 1KILD 3B5ND 1T8ZA 3AE3C 2K1AA 2K0YA 1QX8A 2FQ0A 1SQQE 1LTSC 4EOTA 3P8CE 2YKOA 3B5NA 5GTHE 4UHPB 3I56P 1FS0E 4LGDE 1SQQG 3HE4A 1DIPA 5AW4B 4GR6A 1L4AA 1W5CE 3BRTB 1OW7A 2GA1A 4U3FD 2FYUK 2CG5B 2ZXEB 3WU2H 3IFMA 4BRYB 2HLOA 3IR9A 1FZAA 3CC7P 3CD6P 1M1JC 3TGUE 2K92A 4DJGA 2ZVOB 2Y9YA 1Z56A 1EQ7A 1PV3A 1S9KE 3TGUG 1F80D 4C7NB 3PH0A 1NAFA 1JJ2O 1BCCD 1A02J 2KODA 1HUCA 2OYIC 5EW5E 3P8MC 1KFMA 5E79H 2AEJA 4OVNF 2JO1A 5AW9B 1ZV8A 3H1HJ 4LC1A 2JBGA 2Q7CA 4I7ZB 2IYOA 3KDPB 3M9BA 4I2LC 1LTTC 4PXHB 1PEMA 5KLVJ 4D6TE 1M1JA 1N8RQ 3MIWA 2EIAA 3CPWO 4OGQC 2L0QA 1S5LX 1KFNA 4D6TG 2FYUD 2XU6A 3U43A 2EHSA 1G2CA 3L36A 1HGVA 3L71D 3S4RA 3L74E 2KG8A 2OYIA 3FX0A 1OFCX 3S1KA 1A43A 1JMMA 3VYIA 1RO2A 3L74G 3NTEA 3MZWB 1SQBE 4OGQD 2ONTA 3FWNA 2KOPA 3Q5SA 3G0VA 1SQBG 5AVXB 3T97B 1CI6B 2JB0A 1LP1A 2KWLA 1EOQA 3G3ZA 2DNWA 1YJNP 1EDIA 4IL6X 2JU2A 3GG2A 2BCCE 3JSVC 2L4BA 5KAFH 1VQPP 1YI2P 2W90A 4PH1A 3RK3B 4I6MC 2BCCG 1M57D 1ZR2A 3H1LD 1S2EA 2QJYC 1GK6A 2AEFA 1GZLA 2YXRB 2B87B 2KS1A 1MFTA 3CCSP 4EIJA 4DT0A 2CGQA 1SQXE 1NU1J 2LKIA 5APXA 2CPSA 1U7JA 2JKVA 1L0NE 3RL0g 1IK9A 1SQXG 1EZVD 2P58A 2KNCB 1H89A 1GU5A 3L70D 2KOQA 4GKGA 1L0NG 2GZGA 1FR2A 1NTMK 4H0LC 1AA0A 4RO0A 2M8NA 3KPEA 1Q81Q 1CZQA 1S1CX 1VF5B 2FACA 3A0HH 2IBZD 3LMOA 3EWKA 3CXCO 1UIIA 5CMZA 4EDFA 1RF1B 3A7OA 2EHTA 4F37A 2A45I 1AVOA 1RE4C 5BS2A 3HD7B 1VHNA 3CXHE 2HPCA 2W6AA 4H44C 2WT7A 5AVVB 2WTYA 2KB7P 4U0BA 2FYNC 3OA7A 4H0LD 3H47A 5C39A 3L37A 3P32A 2K2QA 2QVAA 2B9BA 1W2BO 1NJIQ 1G1IA 4YPCA 4C7RA 3RBZA 3WU2E 4IFMA 3IF4A 1KILB 3GF3A 2WVRA 4XRQA 3B5NB 3GLMA 4KHXA 1SQPJ 3AEAC 3M91A 3GZLA 3HE4B 2ZT9C 1NOHA 1WT6A 1L4AB 1H0TA 1ZR4A 2R3CA 1VQ9P 3H6PA 1BAJA 4H44D 3DS4A 1RE4A 1X8YA 1NWQA 2GZJA 3L75D 5DJTB 1NTMD 2NRGA 2AF8A 3M0DC 1LT9C 1K8AQ 1NQ4A 1HBWA 3AE9C 2OGUA 4GR2A 1UJZA 3AE8C 3LIDA 5KLIC 4PJ0E 1CEIA 2WSFJ 2GDWA 1L0LD 1HJBA 2H89C 2WZ7A 2V7QH 2LXBA 2IZ1A 5BU5A 2WSCH 2YMYA 1MZ9A 1M56D 2JR8A 2ZT9D 1SQVJ 2Y0DA 1K05A 2A06E 1GL2C 1IFIA 1FZFA 2WPQA 2L9FA 1J2JB 1NTKE 2Z46A 2A06G 2WSSH 4IOIH 3L35A 1RQVA 2RMZA 2KGCA 1A8OA 1NTKG 4U0AA 4C7NA 2LIWA 2LR2A 1M1JB 3EQ2A 3CX5D 2PY8A 1PP9E 1VQMP 2E74B 3H1HE 2E76B 4D6TJ 5B5EH 1X3OA 5CHXA 1GL2D 1PP9G 2A45H 3H1HG 3KHUA 3VMAA 5KLVE 3F5HA 2I1KA 3TYYA 1J1EC 1P84D 1JY2P 2XNXA 4WBAA 3CWBD 4RESB 5CJ0A 5KLVG 2OYIB 1DH3A 3CMEP 2G3AA 4TLFA 3QWOC 2VLNA 3E2DA 1IMQA 1QRJA 2PENA 4N78D 3CC2P 2NPSA 1KN7A 2H88C 2PP6A 2JWAA 1HQBA 1KYOI 2VLOA 3MUDC 3VMXA 2WPTA 1KQLA 1RHZB 1BGYD 4ASVA 1LP1B 3PJSK 4OGQB 5APWA 4L75A 2QG4A 4NPDA 3K5BA 2MD9A 4BPGA 2E5TA 4GDOA 3RK2C 2EFJA 3CMAP 4CA3A 2LKMA 1J1DC 2KORA 1N73C 2N6YA 4KT0J 3MHVA 2P2UA 1VL2A 3H1KJ 1SS1A 1VQ4P 2R5DA 2RN0A 2W6BA 2Q3EA 3DS5A 3DPHA 2QE7H 1T2KC 1M74A 2XT1A 1AQ5A 2BCCJ 1U57A 1L2PA 1CI6A 4IPYA 5B66H 2FQ1A 3U1CA 3E1RA 2VLPA 1RF0A 2KS1B 5BVZA 5HGOA 5KP6B 1MZ8A 1QVGO 3WUUA 3A0HE 3EJDA 3RK2D 1SQXJ 5HVCA 1QL1A 2JO0A 1FC2C 2C0WA 2Z5HA 1YJWP 1IFJA 2FFDC 1L0NJ 5HV8A 1NU1E 1YJ9P 4JBZA 1T2KD 2KZIA 3G29A 2WQYC 4ZNCA 1NHLA 4HH2A 2KG9A 5AW6B 1NU1G 3RG2A 1YTZI 5AVQB 2PFXA 1YYCA 3AEBC 2BASA 3DS0A 2QJYB 1OXZA 3C1LA 2HPCB 1ZXGA 4L74A 2WT7B 3JCUH 1Y8AA 3Q5PA 2P9XA 1GXHA 5AW8B 2C0XA 1EDKA 1DV5A 3P05A 2GYKA 3CL3D 2YMKA 1R5SA 2W83C 4O9BA 3VP9A 1RQUA 2JAZA 3AEGC 2E1MA 3WMM0 3BCCE 1HY8A 2QNWA 1JMBA 3P7KA 3CCMP 1ZLLA 3BCCG 1G1JA 1QEXA 2N1TC 2JWDA 4Y28J 2VSQA 1AJYA 4PD4I 4RKUJ 1LWUC 3HUSA 2Q3IA 1SQPE 2N6ZA 4DZOA 1M6NA 1KB9E 1HH0A 5KJ7C 1IFMA 3EJBA 2C9LY 4C46A 2CWOA 1KILA 3PTZA 1SQPG 1DD3A 2K93A 2FYNB 1M1KQ 1FAVA 2W6JH 2M5RA 3BASA 2N1TD 4HKZH 2Z4EA 1P84H 1USEA 3BRVB 5AVWB 2IX7C 2YNYA 1K9MQ 2Q6QA 3GKLC 1BE3J 3MGNA 3C8VA 5CBOA 3U59A 2ITAA 3N7NA 3I55P 5KJ7D 1JEKA 5B5EE 1SQVE 2K0XA 4U0FA 1NTKJ 1USDA 3VN0A 2GZFA 2ZFCA 1SQQK 3M9HA 3AE6C 1SQVG 2A45G 2GZIA 5KLIB 1GW3A 3DS3A 3LIEA 4COPA 2YO3A 3VMZA 2QJKC 4JPZB 3TF5A 2J59M 1PP9J 2C9NY 4BPHA 1KV4A 3L73E 1ACPA 2O01N 1KD1Q 3TSIA 3L73G 5APYA 1FOSE 3GF7A 2BHVA 3G71P 3CCUP 2NPSB 1IMPA 2LMLA 7CEIA 1GK4A 2PEMA 3NFQA 2L5GB 3L72E 3B4SA 3H0DA 1S5LH 2WPRA 2KGAA 2K9JA 3OJAB 3L72G 2OYOA 3H1JE 4UB8H 1K30A 2KZJA 1KLPA 5B66E 4R0MA 3DTJA 2LF4A 1PEUA 2Y0CA 4PD4H 1EMVA 3H1JG 1T3UA 1J1EB 2OTKE 3DS1A 4GOFA 2K37A 2ZYDA 3CE7A 1SQQD 3A3YB 3P8CD 3PRJA 1GW4A 5KP7B 4BWNA 2PEJA 3A2AA 3H1KE 2K5XA 2IDBA 2O1KA 3H1IJ 1WRGA 3CCRP 4WWIA 1ZRTE 1VPCA 2VRSA 3H1KG 1PZQA 1JY3N 4MRTC 4XA4A 1RO0A 1PEOA 1YQ4C 4IL6H 2P1JA 3KQGA 2GDYA 3HZQA 3TGUD 3RK2B 1HJ0A 2OTJP 1S9KD 2NZ2A 2LOLA 4U0DA 1ZNVA 1FDOA 3JCUE 2DGYA 1SQBK 1VQLP 2QM7A 2E5YA 4OH8B 1R8EA 1EDLA 2ZAEB 2KSEA 4QNBA 1OW8A 1EXJA 1KQGB 2N98A 4OWFA 2GUVA 2QJPC 1PPJE 3HTKA 1GDTA 2XKMA 2JDIH 3H4EA 1PPJG 2WPSA 1KYOE 3M9QA 2O01J 2Y9ZA 2BQ1E 3G6EP 2KGEA 5EJDA 4D6TD 4AQRD 1NH4A 2KI7B 3GW6A 1Z6MA 1FE6A 1HGZA 2R44A 1JY3O 5KTBA 3BCCJ 2KXPB 2ROQA 1OWAA 2BEQD 1SQXK 4HYTB 2RH0A 2YKQA 2N5HA 4L76A 3I5CA 2KOGA 1L0NK 2PGDA 1LTJC 1FDMA 3NY7B 3L74D 3KZIH 4MN4C 3HUSB 3MD0A 1VDFA 4WY4C 1VQ6P 1LTIC 1JO5A 4EYYQ 2V7QJ 4UB6H 1DX7A 2AVAA 2O01H 2FYUJ 4XROA 2KP8A 2WSCJ 1NTZE 1AYIA 1SQBD 1GMJA 1EZVI 2JEEA 1K04A 3OAKA 1FJPA 4Z1MH 4HJGH 1NTZG 3V4QA 3IN6A 2VLQA 5L8RJ 1NGMB 2GDXA 4JF7A 2PRRA 1MFZA 2XNDH 3S9OA 2QRXA 2IBZI 3E1IA 2N1TB 2FXMA 2FVEA 5KKZC 2BCCD 1JM0A 2N9BA 4QMAA 1EIAA 4WY4D 1JCCA 2KLUA 1HF9A 2N50A 2Z5IA 4EI2A 1VQ7P 2XV6A 3GZMA 4H13C 5E79E 2WSEH 3WUVA 2MF4A 1BE3E 2K9YA 3SWYA 4NEOA 3SSUA 1URQC 1SQXD 5AVYB 1OVUA 4BXLA 5AW7B 1BE3G 3B8EB 1L0ND 1BDDA 1FZEA 3H1LJ 2M5AA 3MGEA 3RK3E 4PV1C 1M90Q 4I7ZC 3M0DA 1LT9A 1S5LE 3V2QA 4H13D 1YIJP 3UIAA 1CSBA 3W67A 1N7LA 3L73J 2FVFA 2HG5D 5HGMA 4UB8E 1UIXA 2G8YA 1OMIA 2NO8A 4PD4E 3HYBA 1URQD 3LW5H 2YIUC 3HE5A 2ZYAA 1AV1A 3L70J 2Y0EA 1BSNA 2V4HA 3CXHD 3G28A 1Y9BA 2K9JB 3PLNA 4AYCA 3F89A 1URQA
chains in the Genus database with same CATH topology
1RO0A 2JYLA 4GR2A 1PEOA 1VQKP 1YHQP 1N8RQ 1VQOP 3DS3A 4XFXA 2BUOA 2EIAA 3HZQA 2PEKA 2M8LA 4COPA 3CPWO 2QEXP 2E1MA 3OW2O 2XXMA 4M0IA 2OTJP 2EFJA 3CMAP 4U0DA 3CCJP 2M8NA 2L6EA 2Z45A 1M6EX 3LRYA 1Q81Q 5F2KA 3CCMP 1AUMA 2DGYA 3RG6C 1VQ4P 1VQLP 3CC4P 1PEQA 3DS5A 1KD1Q 3DPHA 4QNBA 1KC8Q 2M8PA 1EIAA 1YITP 3I56P 2PEIA 1M74A 2XT1A 3CXCO 3Q20A 2BHVA 4WYMA 3G71P 2Z46A 4GR6A 2OTLP 1VQ7P 1A43A 2XV6A 4IPYA 3CCUP 3G21A 2Z44A 5BS2A 1RO2A 2PEOA 3NTEA 1A8OA 4U0AA 5BS1A 1M6NA 2PEMA 1KQSO 1QVFO 3DS2A 5HGOA 3CCEP 1IUQA 1QVGO 1S72P 3H4EA 3CCLP 3H0DA 2CWOA 3CC7P 2ONTA 3G26A 2PEQA 1M1KQ 3CD6P 4U0BA 1VQ8P 3G6EP 2BQ1E 3G0VA 3H47A 1ZMBA 2EG5A 2PY8A 3WBHA 3G1GA 2QA4P 1VQMP 1K30A 1W2BO 2JO0A 5F2NA 1NJIQ 4PH0A 1RNIA 1EOQA 2LF4A 3DTJA 2JYGA 1YJWP 1PEUA 1VQ5P 3G1IA 5F2OA 1YJNP 3MGEA 1Q7YQ 1YJ9P 1Q86Q 3G29A 1M90Q 5JPAA 1JJ2O 3DS1A 4XRQA 1Q82Q 1VQNP 1K9MQ 2OARA 4COCA 3CCVP 3B5IA 5I4TG 3CCQP 1VQPP 1YI2P 1YIJP 2KODA 3G4SP 4PH1A 3CMEP 5HGMA 2PEJA 3E2DA 1VQ9P 4U0CA 1BAJA 1QRJA 3I55P 2PENA 3DS0A 5HGLA 5DCKA 5HGNA 3DS4A 1K73Q 3HYBA 4XFZA 3CC2P 1VQ6P 4U0FA 1D1DA 1E6JP 4XFYA 3CCRP 4U0EA 3CCSP 4XROA 3G28A 1K8AQ 2P9XA 3P05A 3VRLC 3M1MA 1PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ P;  1VQP P;  1YI2 P;  1YIJ P;  1KC8 Q;  1YIT P;  3I56 P;  1M1K Q;  1VQ8 P;  3G6E P;  3G4S P;  1VQK P;  3CD6 P;  1YHQ P;  1N8R Q;  1VQO P;  3CME P;  3CXC O;  1VQM P;  2QA4 P;  3CPW O;  3G71 P;  2QEX P;  1VQ9 P;  2OTL P;  1VQ7 P;  1W2B O;  1NJI Q;  3I55 P;  3CCU P;  3OW2 O;  2OTJ P;  1K73 Q;  1YJW P;  3CC2 P;  3CMA P;  1VQ5 P;  1VQ6 P;  1YJN P;  3CCJ P;  1Q7Y Q;  1YJ9 P;  3CCR P;  1Q81 Q;  1Q86 Q;  1KQS O;  1QVF O;  3CCM P;  1M90 Q;  3CCE P;  3CCS P;  1QVG O;  1S72 P;  1JJ2 O;  1K8A Q;  1Q82 Q;  1VQ4 P;  1VQL P;  3CCL P;  3CC4 P;  1VQN P;  1K9M Q;  3CC7 P;  1KD1 Q;  3CCV P; 
#chains in the Genus database with same CATH topology
 2AXC A;  1E5W A;  1GL2 A;  5K5G B;  3WUT A;  1OR5 A;  3L72 J;  3FWL A;  1NTK K;  5CCG C;  4PV1 D;  3OW2 O;  5AW1 B;  2AXT H;  3D71 A;  3O6Q B;  3JC2 2;  3H1J J;  3KYQ A;  2Z45 A;  1SFC C;  1TU3 F;  2MVV A;  1N7S C;  1OW6 A;  5H2F H;  5KAF E;  4IL6 E;  1EDJ A;  1LTA C;  2KOS A;  4R4M A;  4PWV B;  2FQ2 A;  2P7J A;  2IYP A;  2KK7 A;  5TJH A;  2FAD A;  1QVF O;  2M8R A;  1JUN A;  5KLV K;  3BVH A;  3CX5 I;  5CCG D;  5CJ4 A;  2FY8 A;  2I8D A;  3H1I E;  4JQ0 D;  2LXC B;  1SFC D;  5AVS B;  1KIL E;  1N7S D;  5CCG A;  4PH0 A;  3NMD A;  2JYG A;  1P84 I;  1R5L A;  1XTC C;  3H1I G;  1SFC A;  1EC5 A;  1N7S A;  5JPA A;  1T6A A;  3L75 J;  1NTM J;  1Q82 Q;  2KSJ A;  3CCV P;  3MUD A;  4DOJ A;  1KQF B;  2A06 D;  4U3F E;  4ZMD A;  1L0L J;  1FZC C;  1NTK D;  5AW5 B;  3HTK B;  3A0B H;  5HGL A;  5HGN A;  1NKN A;  1A02 F;  2AFE A;  1X0T A;  4U3F G;  1N73 A;  5CBN A;  4GIF A;  1VF5 C;  3M1M A;  3D6Y A;  4XFX A;  3CLQ A;  5CCH C;  3W68 A;  2M8L A;  1FBM A;  3KZI E;  2XZ0 D;  1PP9 D;  1RF1 C;  3H1H D;  1SP4 A;  2GUS A;  3C9I A;  2LIU A;  2H43 A;  2K88 A;  4L73 A;  2N5I A;  1ZW0 A;  2ZYG A;  1BCC E;  4UB6 E;  2M0B A;  1JNM A;  1M8O B;  5KLV D;  3CC4 P;  3AEF C;  2JP3 A;  1PGP A;  1BCC G;  1Q2N A;  2YO2 A;  1RE3 C;  4ZKU A;  1NO4 A;  2QJP B;  2MVU A;  3G9R A;  2K94 A;  3SWF A;  1FZC A;  1RY3 A;  2E42 A;  4H0L B;  1VF5 D;  2FFD A;  1NU1 K;  2IPP A;  1SLQ A;  3CCE P;  5CCH D;  3PP5 A;  5CZD B;  2IFN A;  2M3E A;  4W80 A;  2PEQ A;  1IC2 A;  4GT1 A;  3U1A A;  1WMK A;  1YQ3 C;  3M0A A;  1L4A C;  1NTZ J;  2AFD A;  4NPF X;  2FYU E;  3VOP A;  1IJD B;  1JOC A;  3M06 A;  1OVV A;  4H44 B;  1VQN P;  2FYU G;  3L71 E;  1NVO A;  3CX5 H;  2XV5 A;  5APQ A;  2I1J A;  4N6J A;  1LTJ B;  5AW2 B;  3TNU A;  3B71 A;  1H88 A;  3L71 G;  4WY4 B;  2IFM A;  1OX3 A;  2D2C C;  5DCK A;  3V6I A;  3Q1M A;  1BXI A;  1D1D A;  3CXH H;  2DW3 A;  2PAJ A;  2ZXX A;  1L4A D;  3H32 A;  2N1T A;  1CW5 A;  4ASW A;  3L4F A;  2FVA A;  1LT1 A;  5M1B A;  2RKL A;  1GD2 E;  3AE5 C;  2ZT9 B;  2WWW A;  1MV8 A;  4Y99 C;  2UWJ E;  2K3R A;  2XXM A;  1LWU A;  2M5A B;  4QKO A;  2N9Y B;  1EXI A;  3CCJ P;  1ZP0 C;  3HRN A;  1SQP K;  5F2K A;  1NU1 D;  5KKZ B;  1OVR A;  1LT9 B;  2LL8 A;  1RH5 B;  5KJ7 A;  1ZME C;  2D2C D;  2M8P A;  4DCK A;  1YIT P;  2PEI A;  2R32 A;  3H1L E;  1E0H A;  3TK1 A;  3Q20 A;  2E74 C;  3E7K A;  4RJT A;  2E76 C;  2P67 A;  2O3J A;  4HB1 A;  2OTL P;  4H13 B;  1IFP A;  2AXT E;  3HE5 B;  3AED C;  3H1L G;  2R3S A;  4W7Z A;  4JYC A;  2H7H A;  1U7M A;  5H2F E;  1URQ B;  1GL2 B;  5AVR B;  4WB4 A;  3EJE A;  1EZV E;  4PJ0 H;  4AUW A;  2W27 A;  1N2D C;  1IK7 A;  2QA4 P;  1E79 H;  2WIT A;  2FXP A;  3L70 E;  5F2N A;  1S3J A;  1GPJ A;  1Q90 D;  1SQV K;  1EZV G;  1KOR A;  3BCC D;  1OZH A;  3V2R A;  4PV1 B;  1Q86 Q;  3L70 G;  1LTB C;  2E74 D;  2CNR A;  2E76 D;  2IBZ E;  3B5I A;  1NKZ B;  3SWK A;  3SFE C;  2IBZ G;  4JYB A;  4U0C A;  2E75 C;  2W8Z A;  2YIU B;  1T8K A;  4XFY A;  3O6Q A;  1QL2 A;  1SQP D;  4W7Y A;  1KB9 D;  3MTU E;  1VKU A;  3RGU A;  2ZJS E;  2FHS C;  1HVV A;  2PEK A;  4GOE A;  2KOO A;  3A0B E;  1MUU A;  2FYZ A;  2LTE A;  1OIP A;  1DEB A;  2HYN A;  1FU1 A;  1DD4 A;  1SFC B;  1KZU B;  1FJK A;  2L6E A;  1N7S B;  1M6E X;  3LRY A;  1LJ2 A;  2WMM A;  3FXD A;  1AF8 A;  1AUM A;  1BSH A;  5GTI H;  3O8Z A;  5EFW B;  1PEQ A;  3GJN A;  2E75 D;  2HOD B;  3USS A;  2LPK A;  2JJL A;  2OYH C;  2FKW B;  3L75 E;  2Z44 A;  1NTM E;  2PEO A;  1J1D B;  2X2B A;  1N73 B;  3GHG C;  4U7J A;  1SQV D;  4U3F J;  1ZN5 A;  1KQS O;  4LLH A;  4YXW H;  3L75 G;  1NTM G;  3G26 A;  1L0L E;  4YTP C;  3WBH A;  2KIK A;  3GMA A;  1L0L G;  1JB0 J;  2H8P D;  5AVZ B;  3G1I A;  1KB9 I;  2SPZ A;  1ZOY C;  3RL0 C;  5AW0 B;  4R4L A;  2JGP A;  3VTP C;  4N3Y B;  5APV A;  3L73 D;  1BCC J;  2MR7 A;  3RBX A;  2L91 A;  2XDJ A;  1NYH A;  2ZVN B;  1FZC B;  1L0I A;  1FOS F;  1FDI A;  2KW2 A;  1JTH A;  2OYH A;  2FFD B;  4CPG A;  4TT3 H;  2MY5 A;  3GHG A;  3N4X A;  5KAI H;  2Q5U A;  3VMY A;  2KG6 A;  3L72 D;  3CX5 E;  1MKM A;  1T3J A;  1L0L K;  3RL0 D;  2QEX P;  1X9V A;  2FBW C;  3H1J D;  4KJM A;  4M0I A;  2IZ0 A;  3II6 A;  1P84 E;  3H25 A;  3CWB E;  3QH9 A;  3RG6 C;  1JY3 P;  2WSE J;  3Q3D A;  1QGK B;  2B89 A;  1AVY A;  3TNU B;  1YTZ T;  3CWB G;  4N78 E;  3L71 J;  4M3L A;  3G21 A;  4K3A A;  3H1K D;  1IFN A;  5BS1 A;  3V2P A;  2MKV A;  2XZ1 C;  1HWT C;  3H32 B;  3V4W A;  1S72 P;  5TIS H;  2KR5 A;  1BGY E;  1ZRT D;  1KTM A;  1JY2 N;  1H8A A;  1DEE G;  3AE7 C;  1SQQ J;  2YKP A;  3Q5R A;  1GTW A;  1BGY G;  1LTJ A;  1LWU B;  3IAO A;  1PL5 A;  4WY4 A;  3EFF K;  1XTG B;  2O1J A;  3D6Z A;  4B86 A;  2JQ4 A;  4XFJ A;  2CPB A;  3LW5 J;  1NTZ K;  1FZB A;  2AEM A;  3FXE A;  4GOD A;  5KP8 B;  1PIX A;  2D2C B;  3TGU J;  1KMI Z;  2K0D X;  1PGJ A;  1NAY A;  1PPJ D;  1KB9 H;  2FAE A;  4U0E A;  4BRY A;  2Q1K A;  3ABV C;  5GTH H;  1VQK P;  4DG9 A;  1YHQ P;  1KYO D;  2BUO A;  3EFG A;  4Y99 B;  3A5T A;  2NPS C;  2KLV A;  2KGD A;  3AEE C;  5APT A;  3AE4 C;  5AW3 B;  1JY2 O;  2QSI A;  3FGA D;  3B4Q A;  3Q2Y A;  2MR8 A;  2WSF H;  1IO4 A;  2YXQ B;  2P10 A;  4BPF A;  1KC8 Q;  1Y47 A;  2MJZ A;  3NTN A;  1W2E A;  4WYM A;  1BDC A;  2CK3 H;  2QJK B;  1YBK A;  3DS2 A;  1IUQ A;  1UNK A;  2L22 A;  1G2C B;  2QM8 A;  5GTI E;  1PFI A;  2Q9I A;  2J58 A;  3MP7 B;  4YXD C;  3SFD C;  2NPS D;  1IZN B;  3PHL A;  1NTZ D;  3VP8 A;  2EG5 A;  4A7P A;  2OQQ A;  3L74 J;  1VQ5 P;  1RF0 C;  5AVU B;  2R5B A;  3D70 A;  4COC A;  3CI9 A;  2HR3 A;  5I4T G;  1SQB J;  3G4S P;  1IFD A;  3RK3 C;  3TDK A;  5AVT B;  2JU1 A;  2E75 B;  3CXH I;  4H2X C;  3KXD A;  2J5U A;  1LTG C;  3AE2 C;  1BE3 D;  2WPV B;  3VRL C;  2JYL A;  3AE1 C;  1LGH B;  1PGQ A;  4IFF A;  1VQO P;  3ZDM A;  2HOD A;  2BEZ F;  3T97 A;  2ERH A;  5APS A;  1GXG A;  1X22 A;  2QIW A;  3R4Y A;  4H2Y C;  2XZR A;  1X79 B;  5KAI E;  1SVF A;  3ITK A;  3RK3 D;  4IZ6 A;  4K35 A;  1DNY A;  2KYV A;  1JTH B;  1GU4 A;  2OYH B;  4HKG A;  1JCD A;  3GHG B;  2M3B A;  4ZKP A;  1HTL C;  4WVZ A;  3HD7 C;  1D7M A;  4PD4 D;  1L0H A;  1M7L A;  2FXO A;  2B87 A;  2POH A;  3CCL P;  1QLE D;  2KUB A;  1VQ8 P;  1N86 A;  3V5B A;  3V2N A;  2E43 A;  1ZMB A;  4IFD K;  3G1G A;  2B88 A;  1RNI A;  3HUS C;  1PGO A;  3BAT A;  2KNC A;  5F2O A;  4XE5 B;  3RL0 B;  1Q7Y Q;  3NXS A;  1FZG A;  5TIS E;  1KIL C;  3B5N C;  2OAR A;  3CCQ P;  1S4X A;  3CWB J;  2PNG A;  3HD7 D;  5CCH A;  2GM4 A;  3R2P A;  1RF1 A;  1K73 Q;  4XFZ A;  4H2W C;  1E6J P;  3HD7 A;  5APU A;  1LNQ A;  5BU8 B;  1KYO H;  2HFE D;  4I1L A;  1H0T B;  1AFO A;  1AQT A;  5DJU B;  1BGY J;  4NPE A;  2GZE A;  1RE3 A;  3H1I D;  2CQ8 A;  3AEC C;  1KIL D;  3B5N D;  1T8Z A;  3AE3 C;  2K1A A;  2K0Y A;  1QX8 A;  2FQ0 A;  1SQQ E;  1LTS C;  4EOT A;  3P8C E;  2YKO A;  3B5N A;  5GTH E;  4UHP B;  3I56 P;  1FS0 E;  4LGD E;  1SQQ G;  3HE4 A;  1DIP A;  5AW4 B;  4GR6 A;  1L4A A;  1W5C E;  3BRT B;  1OW7 A;  2GA1 A;  4U3F D;  2FYU K;  2CG5 B;  2ZXE B;  3WU2 H;  3IFM A;  4BRY B;  2HLO A;  3IR9 A;  1FZA A;  3CC7 P;  3CD6 P;  1M1J C;  3TGU E;  2K92 A;  4DJG A;  2ZVO B;  2Y9Y A;  1Z56 A;  1EQ7 A;  1PV3 A;  1S9K E;  3TGU G;  1F80 D;  4C7N B;  3PH0 A;  1NAF A;  1JJ2 O;  1BCC D;  1A02 J;  2KOD A;  1HUC A;  2OYI C;  5EW5 E;  3P8M C;  1KFM A;  5E79 H;  2AEJ A;  4OVN F;  2JO1 A;  5AW9 B;  1ZV8 A;  3H1H J;  4LC1 A;  2JBG A;  2Q7C A;  4I7Z B;  2IYO A;  3KDP B;  3M9B A;  4I2L C;  1LTT C;  4PXH B;  1PEM A;  5KLV J;  4D6T E;  1M1J A;  1N8R Q;  3MIW A;  2EIA A;  3CPW O;  4OGQ C;  2L0Q A;  1S5L X;  1KFN A;  4D6T G;  2FYU D;  2XU6 A;  3U43 A;  2EHS A;  1G2C A;  3L36 A;  1HGV A;  3L71 D;  3S4R A;  3L74 E;  2KG8 A;  2OYI A;  3FX0 A;  1OFC X;  3S1K A;  1A43 A;  1JMM A;  3VYI A;  1RO2 A;  3L74 G;  3NTE A;  3MZW B;  1SQB E;  4OGQ D;  2ONT A;  3FWN A;  2KOP A;  3Q5S A;  3G0V A;  1SQB G;  5AVX B;  3T97 B;  1CI6 B;  2JB0 A;  1LP1 A;  2KWL A;  1EOQ A;  3G3Z A;  2DNW A;  1YJN P;  1EDI A;  4IL6 X;  2JU2 A;  3GG2 A;  2BCC E;  3JSV C;  2L4B A;  5KAF H;  1VQP P;  1YI2 P;  2W90 A;  4PH1 A;  3RK3 B;  4I6M C;  2BCC G;  1M57 D;  1ZR2 A;  3H1L D;  1S2E A;  2QJY C;  1GK6 A;  2AEF A;  1GZL A;  2YXR B;  2B87 B;  2KS1 A;  1MFT A;  3CCS P;  4EIJ A;  4DT0 A;  2CGQ A;  1SQX E;  1NU1 J;  2LKI A;  5APX A;  2CPS A;  1U7J A;  2JKV A;  1L0N E;  3RL0 g;  1IK9 A;  1SQX G;  1EZV D;  2P58 A;  2KNC B;  1H89 A;  1GU5 A;  3L70 D;  2KOQ A;  4GKG A;  1L0N G;  2GZG A;  1FR2 A;  1NTM K;  4H0L C;  1AA0 A;  4RO0 A;  2M8N A;  3KPE A;  1Q81 Q;  1CZQ A;  1S1C X;  1VF5 B;  2FAC A;  3A0H H;  2IBZ D;  3LMO A;  3EWK A;  3CXC O;  1UII A;  5CMZ A;  4EDF A;  1RF1 B;  3A7O A;  2EHT A;  4F37 A;  2A45 I;  1AVO A;  1RE4 C;  5BS2 A;  3HD7 B;  1VHN A;  3CXH E;  2HPC A;  2W6A A;  4H44 C;  2WT7 A;  5AVV B;  2WTY A;  2KB7 P;  4U0B A;  2FYN C;  3OA7 A;  4H0L D;  3H47 A;  5C39 A;  3L37 A;  3P32 A;  2K2Q A;  2QVA A;  2B9B A;  1W2B O;  1NJI Q;  1G1I A;  4YPC A;  4C7R A;  3RBZ A;  3WU2 E;  4IFM A;  3IF4 A;  1KIL B;  3GF3 A;  2WVR A;  4XRQ A;  3B5N B;  3GLM A;  4KHX A;  1SQP J;  3AEA C;  3M91 A;  3GZL A;  3HE4 B;  2ZT9 C;  1NOH A;  1WT6 A;  1L4A B;  1H0T A;  1ZR4 A;  2R3C A;  1VQ9 P;  3H6P A;  1BAJ A;  4H44 D;  3DS4 A;  1RE4 A;  1X8Y A;  1NWQ A;  2GZJ A;  3L75 D;  5DJT B;  1NTM D;  2NRG A;  2AF8 A;  3M0D C;  1LT9 C;  1K8A Q;  1NQ4 A;  1HBW A;  3AE9 C;  2OGU A;  4GR2 A;  1UJZ A;  3AE8 C;  3LID A;  5KLI C;  4PJ0 E;  1CEI A;  2WSF J;  2GDW A;  1L0L D;  1HJB A;  2H89 C;  2WZ7 A;  2V7Q H;  2LXB A;  2IZ1 A;  5BU5 A;  2WSC H;  2YMY A;  1MZ9 A;  1M56 D;  2JR8 A;  2ZT9 D;  1SQV J;  2Y0D A;  1K05 A;  2A06 E;  1GL2 C;  1IFI A;  1FZF A;  2WPQ A;  2L9F A;  1J2J B;  1NTK E;  2Z46 A;  2A06 G;  2WSS H;  4IOI H;  3L35 A;  1RQV A;  2RMZ A;  2KGC A;  1A8O A;  1NTK G;  4U0A A;  4C7N A;  2LIW A;  2LR2 A;  1M1J B;  3EQ2 A;  3CX5 D;  2PY8 A;  1PP9 E;  1VQM P;  2E74 B;  3H1H E;  2E76 B;  4D6T J;  5B5E H;  1X3O A;  5CHX A;  1GL2 D;  1PP9 G;  2A45 H;  3H1H G;  3KHU A;  3VMA A;  5KLV E;  3F5H A;  2I1K A;  3TYY A;  1J1E C;  1P84 D;  1JY2 P;  2XNX A;  4WBA A;  3CWB D;  4RES B;  5CJ0 A;  5KLV G;  2OYI B;  1DH3 A;  3CME P;  2G3A A;  4TLF A;  3QWO C;  2VLN A;  3E2D A;  1IMQ A;  1QRJ A;  2PEN A;  4N78 D;  3CC2 P;  2NPS A;  1KN7 A;  2H88 C;  2PP6 A;  2JWA A;  1HQB A;  1KYO I;  2VLO A;  3MUD C;  3VMX A;  2WPT A;  1KQL A;  1RHZ B;  1BGY D;  4ASV A;  1LP1 B;  3PJS K;  4OGQ B;  5APW A;  4L75 A;  2QG4 A;  4NPD A;  3K5B A;  2MD9 A;  4BPG A;  2E5T A;  4GDO A;  3RK2 C;  2EFJ A;  3CMA P;  4CA3 A;  2LKM A;  1J1D C;  2KOR A;  1N73 C;  2N6Y A;  4KT0 J;  3MHV A;  2P2U A;  1VL2 A;  3H1K J;  1SS1 A;  1VQ4 P;  2R5D A;  2RN0 A;  2W6B A;  2Q3E A;  3DS5 A;  3DPH A;  2QE7 H;  1T2K C;  1M74 A;  2XT1 A;  1AQ5 A;  2BCC J;  1U57 A;  1L2P A;  1CI6 A;  4IPY A;  5B66 H;  2FQ1 A;  3U1C A;  3E1R A;  2VLP A;  1RF0 A;  2KS1 B;  5BVZ A;  5HGO A;  5KP6 B;  1MZ8 A;  1QVG O;  3WUU A;  3A0H E;  3EJD A;  3RK2 D;  1SQX J;  5HVC A;  1QL1 A;  2JO0 A;  1FC2 C;  2C0W A;  2Z5H A;  1YJW P;  1IFJ A;  2FFD C;  1L0N J;  5HV8 A;  1NU1 E;  1YJ9 P;  4JBZ A;  1T2K D;  2KZI A;  3G29 A;  2WQY C;  4ZNC A;  1NHL A;  4HH2 A;  2KG9 A;  5AW6 B;  1NU1 G;  3RG2 A;  1YTZ I;  5AVQ B;  2PFX A;  1YYC A;  3AEB C;  2BAS A;  3DS0 A;  2QJY B;  1OXZ A;  3C1L A;  2HPC B;  1ZXG A;  4L74 A;  2WT7 B;  3JCU H;  1Y8A A;  3Q5P A;  2P9X A;  1GXH A;  5AW8 B;  2C0X A;  1EDK A;  1DV5 A;  3P05 A;  2GYK A;  3CL3 D;  2YMK A;  1R5S A;  2W83 C;  4O9B A;  3VP9 A;  1RQU A;  2JAZ A;  3AEG C;  2E1M A;  3WMM 0;  3BCC E;  1HY8 A;  2QNW A;  1JMB A;  3P7K A;  3CCM P;  1ZLL A;  3BCC G;  1G1J A;  1QEX A;  2N1T C;  2JWD A;  4Y28 J;  2VSQ A;  1AJY A;  4PD4 I;  4RKU J;  1LWU C;  3HUS A;  2Q3I A;  1SQP E;  2N6Z A;  4DZO A;  1M6N A;  1KB9 E;  1HH0 A;  5KJ7 C;  1IFM A;  3EJB A;  2C9L Y;  4C46 A;  2CWO A;  1KIL A;  3PTZ A;  1SQP G;  1DD3 A;  2K93 A;  2FYN B;  1M1K Q;  1FAV A;  2W6J H;  2M5R A;  3BAS A;  2N1T D;  4HKZ H;  2Z4E A;  1P84 H;  1USE A;  3BRV B;  5AVW B;  2IX7 C;  2YNY A;  1K9M Q;  2Q6Q A;  3GKL C;  1BE3 J;  3MGN A;  3C8V A;  5CBO A;  3U59 A;  2ITA A;  3N7N A;  3I55 P;  5KJ7 D;  1JEK A;  5B5E E;  1SQV E;  2K0X A;  4U0F A;  1NTK J;  1USD A;  3VN0 A;  2GZF A;  2ZFC A;  1SQQ K;  3M9H A;  3AE6 C;  1SQV G;  2A45 G;  2GZI A;  5KLI B;  1GW3 A;  3DS3 A;  3LIE A;  4COP A;  2YO3 A;  3VMZ A;  2QJK C;  4JPZ B;  3TF5 A;  2J59 M;  1PP9 J;  2C9N Y;  4BPH A;  1KV4 A;  3L73 E;  1ACP A;  2O01 N;  1KD1 Q;  3TSI A;  3L73 G;  5APY A;  1FOS E;  3GF7 A;  2BHV A;  3G71 P;  3CCU P;  2NPS B;  1IMP A;  2LML A;  7CEI A;  1GK4 A;  2PEM A;  3NFQ A;  2L5G B;  3L72 E;  3B4S A;  3H0D A;  1S5L H;  2WPR A;  2KGA A;  2K9J A;  3OJA B;  3L72 G;  2OYO A;  3H1J E;  4UB8 H;  1K30 A;  2KZJ A;  1KLP A;  5B66 E;  4R0M A;  3DTJ A;  2LF4 A;  1PEU A;  2Y0C A;  4PD4 H;  1EMV A;  3H1J G;  1T3U A;  1J1E B;  2OTK E;  3DS1 A;  4GOF A;  2K37 A;  2ZYD A;  3CE7 A;  1SQQ D;  3A3Y B;  3P8C D;  3PRJ A;  1GW4 A;  5KP7 B;  4BWN A;  2PEJ A;  3A2A A;  3H1K E;  2K5X A;  2IDB A;  2O1K A;  3H1I J;  1WRG A;  3CCR P;  4WWI A;  1ZRT E;  1VPC A;  2VRS A;  3H1K G;  1PZQ A;  1JY3 N;  4MRT C;  4XA4 A;  1RO0 A;  1PEO A;  1YQ4 C;  4IL6 H;  2P1J A;  3KQG A;  2GDY A;  3HZQ A;  3TGU D;  3RK2 B;  1HJ0 A;  2OTJ P;  1S9K D;  2NZ2 A;  2LOL A;  4U0D A;  1ZNV A;  1FDO A;  3JCU E;  2DGY A;  1SQB K;  1VQL P;  2QM7 A;  2E5Y A;  4OH8 B;  1R8E A;  1EDL A;  2ZAE B;  2KSE A;  4QNB A;  1OW8 A;  1EXJ A;  1KQG B;  2N98 A;  4OWF A;  2GUV A;  2QJP C;  1PPJ E;  3HTK A;  1GDT A;  2XKM A;  2JDI H;  3H4E A;  1PPJ G;  2WPS A;  1KYO E;  3M9Q A;  2O01 J;  2Y9Z A;  2BQ1 E;  3G6E P;  2KGE A;  5EJD A;  4D6T D;  4AQR D;  1NH4 A;  2KI7 B;  3GW6 A;  1Z6M A;  1FE6 A;  1HGZ A;  2R44 A;  1JY3 O;  5KTB A;  3BCC J;  2KXP B;  2ROQ A;  1OWA A;  2BEQ D;  1SQX K;  4HYT B;  2RH0 A;  2YKQ A;  2N5H A;  4L76 A;  3I5C A;  2KOG A;  1L0N K;  2PGD A;  1LTJ C;  1FDM A;  3NY7 B;  3L74 D;  3KZI H;  4MN4 C;  3HUS B;  3MD0 A;  1VDF A;  4WY4 C;  1VQ6 P;  1LTI C;  1JO5 A;  4EYY Q;  2V7Q J;  4UB6 H;  1DX7 A;  2AVA A;  2O01 H;  2FYU J;  4XRO A;  2KP8 A;  2WSC J;  1NTZ E;  1AYI A;  1SQB D;  1GMJ A;  1EZV I;  2JEE A;  1K04 A;  3OAK A;  1FJP A;  4Z1M H;  4HJG H;  1NTZ G;  3V4Q A;  3IN6 A;  2VLQ A;  5L8R J;  1NGM B;  2GDX A;  4JF7 A;  2PRR A;  1MFZ A;  2XND H;  3S9O A;  2QRX A;  2IBZ I;  3E1I A;  2N1T B;  2FXM A;  2FVE A;  5KKZ C;  2BCC D;  1JM0 A;  2N9B A;  4QMA A;  1EIA A;  4WY4 D;  1JCC A;  2KLU A;  1HF9 A;  2N50 A;  2Z5I A;  4EI2 A;  1VQ7 P;  2XV6 A;  3GZM A;  4H13 C;  5E79 E;  2WSE H;  3WUV A;  2MF4 A;  1BE3 E;  2K9Y A;  3SWY A;  4NEO A;  3SSU A;  1URQ C;  1SQX D;  5AVY B;  1OVU A;  4BXL A;  5AW7 B;  1BE3 G;  3B8E B;  1L0N D;  1BDD A;  1FZE A;  3H1L J;  2M5A A;  3MGE A;  3RK3 E;  4PV1 C;  1M90 Q;  4I7Z C;  3M0D A;  1LT9 A;  1S5L E;  3V2Q A;  4H13 D;  1YIJ P;  3UIA A;  1CSB A;  3W67 A;  1N7L A;  3L73 J;  2FVF A;  2HG5 D;  5HGM A;  4UB8 E;  1UIX A;  2G8Y A;  1OMI A;  2NO8 A;  4PD4 E;  3HYB A;  1URQ D;  3LW5 H;  2YIU C;  3HE5 A;  2ZYA A;  1AV1 A;  3L70 J;  2Y0E A;  1BSN A;  2V4H A;  3CXH D;  3G28 A;  1Y9B A;  2K9J B;  3PLN A;  4AYC A;  3F89 A;  1URQ A; 
#chains in the Genus database with same CATH homology
 1RO0 A;  2JYL A;  4GR2 A;  1PEO A;  1VQK P;  1YHQ P;  1N8R Q;  1VQO P;  3DS3 A;  4XFX A;  2BUO A;  2EIA A;  3HZQ A;  2PEK A;  2M8L A;  4COP A;  3CPW O;  2QEX P;  2E1M A;  3OW2 O;  2XXM A;  4M0I A;  2OTJ P;  2EFJ A;  3CMA P;  4U0D A;  3CCJ P;  2M8N A;  2L6E A;  2Z45 A;  1M6E X;  3LRY A;  1Q81 Q;  5F2K A;  3CCM P;  1AUM A;  2DGY A;  3RG6 C;  1VQ4 P;  1VQL P;  3CC4 P;  1PEQ A;  3DS5 A;  1KD1 Q;  3DPH A;  4QNB A;  1KC8 Q;  2M8P A;  1EIA A;  1YIT P;  3I56 P;  2PEI A;  1M74 A;  2XT1 A;  3CXC O;  3Q20 A;  2BHV A;  4WYM A;  3G71 P;  2Z46 A;  4GR6 A;  2OTL P;  1VQ7 P;  1A43 A;  2XV6 A;  4IPY A;  3CCU P;  3G21 A;  2Z44 A;  5BS2 A;  1RO2 A;  2PEO A;  3NTE A;  1A8O A;  4U0A A;  5BS1 A;  1M6N A;  2PEM A;  1KQS O;  1QVF O;  3DS2 A;  5HGO A;  3CCE P;  1IUQ A;  1QVG O;  1S72 P;  3H4E A;  3CCL P;  3H0D A;  2CWO A;  3CC7 P;  2ONT A;  3G26 A;  2PEQ A;  1M1K Q;  3CD6 P;  4U0B A;  1VQ8 P;  3G6E P;  2BQ1 E;  3G0V A;  3H47 A;  1ZMB A;  2EG5 A;  2PY8 A;  3WBH A;  3G1G A;  2QA4 P;  1VQM P;  1K30 A;  1W2B O;  2JO0 A;  5F2N A;  1NJI Q;  4PH0 A;  1RNI A;  1EOQ A;  2LF4 A;  3DTJ A;  2JYG A;  1YJW P;  1PEU A;  1VQ5 P;  3G1I A;  5F2O A;  1YJN P;  3MGE A;  1Q7Y Q;  1YJ9 P;  1Q86 Q;  3G29 A;  1M90 Q;  5JPA A;  1JJ2 O;  3DS1 A;  4XRQ A;  1Q82 Q;  1VQN P;  1K9M Q;  2OAR A;  4COC A;  3CCV P;  3B5I A;  5I4T G;  3CCQ P;  1VQP P;  1YI2 P;  1YIJ P;  2KOD A;  3G4S P;  4PH1 A;  3CME P;  5HGM A;  2PEJ A;  3E2D A;  1VQ9 P;  4U0C A;  1BAJ A;  1QRJ A;  3I55 P;  2PEN A;  3DS0 A;  5HGL A;  5DCK A;  5HGN A;  3DS4 A;  1K73 Q;  3HYB A;  4XFZ A;  3CC2 P;  1VQ6 P;  4U0F A;  1D1D A;  1E6J P;  4XFY A;  3CCR P;  4U0E A;  3CCS P;  4XRO A;  3G28 A;  1K8A Q;  2P9X A;  3P05 A;  3VRL C;  3M1M A;  1PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...