1KC8Q

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kc8Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kc8Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kc8Q03
3CC2P 1YJWP 1N8RQ 3G6EP 3CCUP 1QVFO 3CCMP 1M90Q 1VQ8P 1KC8Q 1K73Q 1KD1Q 1VQMP 1YJNP 2OTJP 1YITP 1VQPP 1K9MQ 1VQKP 3CCRP 3I55P 3CXCO 1Q86Q 1VQLP 3CC4P 3CCQP 2QA4P 1VQ7P 1S72P 1VQ6P 1Q81Q 3CC7P 2OTLP 1QVGO 1M1KQ 3G71P 1YHQP 1VQ5P 3CCSP 3OW2O 1W2BO 1KQSO 2QEXP 1VQOP 3CMAP 1Q7YQ 1VQNP 1YJ9P 1JJ2O 3CD6P 3G4SP 3I56P 3CCEP 3CCVP 1Q82Q 1VQ4P 1VQ9P 1YI2P 3CCJP 1NJIQ 3CCLP 3CMEP 1K8AQ 3CPWO 1YIJP
chains in the Genus database with same CATH superfamily
2MVUA 3L72J 3AE8C 5BS1A 3IF4A 2HPCB 2KG8A 1M1JA 1UNKA 5E79H 3FX0A 5KJ7D 1M7LA 1EZVI 1S2EA 3AE9C 1FE6A 2ZVOB 4XFZA 3P8MC 1KYOD 2P10A 1BGYE 2YO2A 4L76A 1PEOA 2N5IA 4XROA 2DGYA 3OA7A 5KLVD 1QL1A 2BASA 2NPSC 2UWJE 3A0HE 1QLED 1WRGA 5APWA 3T97A 2WSCH 4IZ6A 2MY5A 1NU1J 1N7SC 5KLIB 5BU5A 3H32B 2FXPA 1NTMD 3GW6A 1SQVK 1CSBA 1GZLA 2L22A 1NTZE 1IUQA 3TGUD 4AQRD 1ACPA 3VMYA 1N73A 4EI2A 1LTJC 2IZ0A 3GLMA 4NPEA 2KXPB 1BSNA 1S4XA 3FWLA 1S3JA 1RE3A 1IC2A 1YI2P 2A45G 1PP9E 2H89C 1LTAC 2K88A 2IDBA 2O01H 3H1KG 1HVVA 3QWOC 2AXCA 2ROQA 3E7KA 4D6TG 1UIIA 1FZAA 4U3FG 2JWDA 2JKVA 1PPJE 4H13C 2M5RA 3WBHA 1SQBJ 1PGPA 3JCUE 1MUUA 4CPGA 1RE4A 2K0YA 3NTNA 1H0TA 4LGDE 1CW5A 1EC5A 3H1HE 3H1IJ 2R5BA 3Q2YA 1L4AD 1LNQA 2JR8A 3KZIE 5H2FE 4ZKPA 1YHQP 4WB4A 4KHXA 3VRLC 3H0DA 4WY4A 1HTLC 1UJZA 2KNCA 1SQVE 1NAFA 1VQPP 1K30A 2J5UA 3BATA 2KLVA 3BRVB 2N1TD 1H88A 2KZJA 2NO8A 5KAIE 1NTKK 2HPCA 3M1MA 4QNBA 2B89A 5HV8A 3M91A 2K0XA 1NOHA 1YYCA 3CXHD 1SQXJ 4I1LA 1SQBD 4PH0A 3JSVC 1AQTA 3BVHA 3B5IA 1YJWP 5AVQB 1DX7A 1A8OA 1X3OA 1Y8AA 3M0DA 1N2DC 1GD2E 1KORA 1MFTA 2E43A 3H1ID 2XZ1C 3V2NA 1QX8A 2Q3IA 2IBZD 1KQSO 3EJBA 2HG5D 2P1JA 1E0HA 1USDA 3CX5H 4K35A 1L4AC 1K9MQ 2KZIA 5APUA 2MR7A 2E76D 3H32A 3Q1MA 2VLQA 2I1JA 2XZRA 1IMQA 2HYNA 3PTZA 1KB9E 2J58A 4PD4I 3DS5A 5CJ0A 4ZMDA 4UB6H 2AFDA 1NAYA 2QG4A 2XV6A 2XNDH 1L0LJ 3U1AA 5AW3B 2N1TC 3EJDA 1FDMA 2LF4A 3RL0C 1EMVA 2DNWA 1HH0A 5B66H 1JMMA 3P32A 4JYCA 3AE4C 2KYVA 3MHVA 3CCSP 5GTIH 2PEMA 1W5CE 4GOFA 1NTKE 1AVOA 3G1GA 5AW9B 1L2PA 3G6EP 2O1JA 2ZYDA 2QIWA 2QNWA 1RQUA 1N86A 1LGHB 2Q3EA 1T2KD 2E42A 1BGYJ 1VDFA 1RF0C 5HGOA 1KILE 2R3CA 1T8ZA 2GZIA 2N98A 2E76C 2FFDB 1SLQA 3HD7B 3MD0A 2PEQA 3GHGB 3HRNA 2XU6A 3CXHI 2KUBA 1GXHA 3D6ZA 2O1KA 1HY8A 1KYOE 2R44A 3P8CE 1CEIA 2ZT9D 3RK3B 3L36A 1GL2B 1NTZJ 3LIDA 1PFIA 2JBGA 1ZMBA 3HZQA 1M57D 3L37A 1OW6A 5CCGC 3IR9A 2Q6QA 2R32A 4U0FA 2OARA 4L75A 4WWIA 1QL2A 2WSEJ 3G21A 1JJ2O 1BCCE 1PP9J 1NTME 3CD6P 3H1JG 3TGUE 4EOTA 5CCHA 2Q9IA 1DIPA 5CBNA 2KOGA 1SQPG 2JU2A 1LT1A 1GXGA 1T2KC 3GZLA 1KMIZ 2LL8A 3HTKB 2FYUG 5KP6B 2NPSB 3L74D 1X8YA 3FXDA 1NVOA 1P84H 3RL0g 1RO2A 3H1HJ 3AE2C 3CC2P 1N7SB 1URQC 3G28A 2M8LA 4LC1A 5C39A 4NPFX 1H8AA 2XZ0D 3R2PA 4DG9A 2JYGA 5APYA 4PXHB 2CGQA 4L73A 1TU3F 1LTJB 1IFMA 1AJYA 1T6AA 4GT1A 1G2CB 2WT7A 3GKLC 1SQVJ 4PH1A 2EFJA 3NXSA 1FDIA 3PP5A 4RESB 1Q2NA 2PENA 2WPSA 2Y9ZA 5APQA 3L70G 1E5WA 5APTA 2JU1A 2K2QA 1VQ5P 3V5BA 4XFJA 5BU8B 2KSEA 1BE3G 2FVAA 2MKVA 2IPPA 3C8VA 3GF3A 1JY3P 1D1DA 2K94A 4H13B 1KTMA 2CWOA 4Z1MH 3JC22 1JY3O 3Q3DA 1HUCA 3VTPC 2ONTA 2FFDA 2FBWC 3HD7A 1JY2P 1E79H 1RH5B 3GHGA 1RY3A 1ZRTD 2IX7C 1S5LE 1ZOYC 1DD3A 2A06G 1GL2A 1NKZB 1MFZA 4IFDK 3LMOA 1YTZT 2IBZE 4PV1C 3AECC 3ZDMA 3VN0A 2GZFA 2KR5A 1FJKA 2BEQD 4UB8E 3UIAA 2M0BA 1HBWA 4GOEA 4XA4A 1L0ND 1NU1G 1ZV8A 5TJHA 3ABVC 5JPAA 2OTJP 1U7MA 1R5SA 2L91A 3ITKA 1NTKJ 3EFFK 2WQYC 1PZQA 4DT0A 2BCCD 2D2CD 1OW7A 1PGQA 2H8PD 3CWBJ 2GA1A 2NPSA 5B5EE 3CCUP 2K9JB 3DTJA 1N7SA 2ZAEB 1L4AB 3P7KA 3CL3D 4IPYA 5AVYB 4DJGA 5F2NA 1IMPA 3DS0A 1JEKA 2FKWB 1X79B 1EQ7A 2ZFCA 1J2JB 2W83C 1VQMP 3H25A 2BEZF 4KT0J 1LTJA 4U0DA 1VQ7P 1KQLA 1FS0E 3VOPA 2KS1B 4ASVA 2N6YA 2JO1A 4HYTB 2HFED 3CE7A 2N1TB 2P2UA 1NYHA 3RL0B 3MGNA 5AVUB 1AA0A 2XT1A 3VP8A 2QRXA 2JJLA 2OGUA 2KG6A 4YPCA 2AFEA 2JEEA 1S9KD 1ZXGA 1EIAA 4U7JA 1BSHA 2JYLA 1NTMJ 4RJTA 3TSIA 2E74C 1SQPD 3TGUJ 5GTHH 1QGKB 2N9YB 1HGVA 1IFNA 3TNUA 5HVCA 1XTGB 2FYUD 2YMKA 5AVXB 2QJYB 2QE7H 2CPBA 1SQQG 5HGNA 5AW5B 3CC7P 3A3YB 3A0BE 3EWKA 2N6ZA 4NEOA 2E76B 1JTHA 3H1KE 3P8CD 2AXTE 3WU2H 3D71A 5AVSB 2CNRA 2PP6A 1ZR2A 1GW4A 4XFYA 1IFDA 1FOSE 1N8RQ 3RK2D 2QSIA 3AE5C 2GYKA 2XV5A 5AW4B 4IL6H 3BASA 3CCQP 4HB1A 1VQ6P 1AUMA 2M3EA 3VYIA 1LTTC 1A02J 3B5ND 3L74E 1MKMA 3AE6C 2KSJA 2WVRA 1OW8A 3AEGC 1BCCD 2MF4A 5HGLA 1J1EC 2JQ4A 1KB9I 5KAFE 1FZBA 4JF7A 2ZJSE 1IO4A 2PY8A 3QH9A 3VMXA 1MV8A 3DS1A 2M3BA 3OW2O 2OYIC 4GODA 1L0LG 1KILC 4WVZA 5TISE 1L0NK 1NH4A 2EG5A 1YIJP 2H43A 1L4AA 5KJ7C 1DD4A 3A5TA 4W7ZA 2JGPA 2V4HA 3VMAA 2LMLA 2XKMA 4R0MA 1RNIA 3RGUA 1LTBC 2WSFJ 1URQB 2N5HA 1FZFA 3RK2C 1IFPA 2KS1A 1GDTA 1HGZA 1NQ4A 3L73D 1YJNP 2N1TA 3M0AA 3B5NC 3M9QA 4U0BA 4JPZB 2M5AB 1ZRTE 3O8ZA 3CX5D 1OZHA 3GG2A 1VF5D 3CCVP 3RG2A 2LXCB 2WPTA 1KYOI 4H2YC 2YXRB 4XRQA 1IFIA 1NTZG 4TT3H 3NTEA 5AVZB 1PEUA 2FQ2A 3OAKA 2M8RA 1FDOA 2W6JH 3V2RA 1L0NE 4I7ZC 3FGAD 3HUSC 1OVUA 3A2AA 3AEEC 3H47A 3M06A 4PD4H 1PP9G 1SQPK 1BXIA 4YXDC 4U0AA 4AYCA 2KGCA 1LT9C 5BVZA 2BCCE 2RN0A 5CHXA 3G4SP 2FYUK 3H1LG 2W6AA 4C7NB 4UHPB 4COCA 4WY4D 4PV1B 3EJEA 1NKNA 5CCGA 4PJ0E 2PEKA 1PL5A 4A7PA 4MN4C 2VLOA 1OVRA 1VF5C 2LR2A 4I2LC 1RHZB 4QMAA 2PEOA 5CJ4A 2POHA 1YQ3C 4H0LD 5E79E 3CPWO 2FQ1A 5BS2A 2YNYA 2LOLA 3S9OA 2WTYA 3WUTA 3WMM0 4YTPC 3S1KA 3N4XA 2PEJA 3V2QA 3LW5J 4OVNF 2FADA 1SQVG 1NHLA 2KLUA 2PFXA 1GMJA 1AQ5A 1SQQD 3CXHH 5KP7B 3RBZA 1URQA 4H44D 3G29A 3WUVA 3SSUA 1AFOA 1EZVG 1S9KE 3H1JE 4YXWH 1FZCC 3H1KJ 2JO0A 1AYIA 1SQPE 1IK9A 4EIJA 3NMDA 3W67A 4IOIH 2QM8A 5KKZC 3CCLP 3CCEP 3B8EB 2FYUE 3N7NA 3H6PA 2FAEA 1DV5A 2M5AA 4R4LA 1GU4A 2QA4P 3L74J 2Z45A 2FVFA 2I8DA 1P84D 1ZR4A 4H0LC 4C7RA 4B86A 2QJKC 4R4MA 2IBZI 2E74B 2KGEA 2K92A 3I5CA 1QVGO 4N6JA 2AEMA 3GF7A 3D6YA 1OFCX 4H44C 3H1KD 1L0HA 1M6EX 1Q82Q 4D6TD 1JY3N 1NO4A 1ZP0C 4U3FD 5AW2B 2P67A 5AW7B 3II6A 2LIWA 2PRRA 1BE3E 1VPCA 4C7NA 3U1CA 2L5GB 3L71G 2MD9A 3CWBG 4RKUJ 1UIXA 2YO3A 2XXMA 2WPQA 3KPEA 2DW3A 1DEEG 1K8AQ 2L6EA 2JAZA 1IZNB 2G3AA 3AEFC 2G8YA 3DPHA 5APVA 1Q90D 2QVAA 3P05A 1DH3A 2AEFA 1NGMB 2ZT9C 3E1IA 2K9YA 1FU1A 1J1EB 1G1JA 1FC2C 2IYOA 2MJZA 4GR6A 2CPSA 3DS3A 2O3JA 3CCJP 5AW6B 2FVEA 3L73E 2QM7A 2V7QJ 2OYIB 5CCHD 1KILB 5KLVG 2CK3H 1USEA 3SFEC 1IK7A 3CX5E 1W2BO 3M9BA 1L0NJ 2PGDA 3I56P 1YBKA 1HQBA 3L75G 1KQGB 1QEXA 3BCCG 3IAOA 4COPA 1NTMG 3PHLA 3A0HH 3RK2B 2WZ7A 3V4QA 3H1LD 2BCCJ 4UB6E 2HODB 3MUDA 1SQQK 1J1DC 4RO0A 3B5NB 3L72G 3NY7B 1JY2O 3FWNA 1EXJA 2A45I 2MVVA 5F2OA 2WSSH 1E6JP 5B66E 4GR2A 1YTZI 3CC4P 1PIXA 3BRTB 5GTIE 2LIUA 2YMYA 2C9NY 4ZNCA 2LPKA 1N7LA 2JB0A 4N78D 1U57A 5AW8B 1GW3A 1ZMEC 1K05A 2WSEH 1KC8Q 2B88A 2GUSA 4OWFA 1M56D 2KOOA 4I6MC 1GTWA 1GPJA 1KN7A 4HKZH 4I7ZB 4C46A 3HUSB 3T97B 3HD7D 1EZVD 2P58A 2WPRA 3JCUH 3HE4B 3IFMA 2OYHC 2KGDA 1LJ2A 2WSCJ 3AEAC 1L0LK 2ZXEB 3HTKA 2K37A 2KOQA 2PNGA 4IL6X 4OH8B 3H1JJ 1LT9B 3DS4A 3RK3D 4EDFA 3AE3C 1AF8A 1M8OB 1Q81Q 5AVRB 1GL2D 5CZDB 1WT6A 1SQPJ 5H2FH 3KZIH 3LIEA 1ZLLA 4GKGA 1KILD 3USSA 3HE5B 2QJPC 4TLFA 4W80A 1SQQE 3C9IA 3D70A 2FYUJ 3TK1A 4HH2A 4EYYQ 3MZWB 1LWUC 1OVVA 1VF5B 2YXQB 4OGQD 2ERHA 3W68A 2B87B 1SQBG 2IZ1A 4K3AA 1G2CA 3EQ2A 4O9BA 2OYIA 1KILA 4GDOA 2Y0DA 2O01J 3GJNA 3H1IG 5KAIH 3B4QA 4BPHA 2IBZG 5KJ7A 3KHUA 2VSQA 2L9FA 2NPSD 3CCRP 2SPZA 1H0TB 1FBMA 1S1CX 3H1JD 3MP7B 1P84E 2D2CC 1Y9BA 1BCCJ 2QEXP 3K5BA 4ASWA 2HR3A 3L35A 1FZCB 3RK3C 3SWFA 1SFCD 3F89A 1BE3J 3KQGA 1D7MA 1GL2C 1KD1Q 3L71D 1L0LE 3VP9A 1RF1C 2C9LY 5KKZB 2EHTA 3PH0A 3E1RA 3U59A 1SQXG 2KGAA 2Q5UA 2ZYAA 1VL2A 2H88C 1JNMA 3EFGA 1JCDA 2OTKE 1LTIC 1PGJA 1T3UA 4OGQC 1KB9H 4D6TE 3FXEA 2KP8A 2KK7A 2P7JA 2K5XA 1Y47A 4U3FE 4U0CA 1RO0A 1LTGC 2FXMA 5K5GB 2MR8A 5HGMA 4H0LB 2GM4A 2C0XA 2QJKB 1S72P 2YIUC 5L8RJ 5APSA 1ZNVA 2KB7P 1H89A 1Q7YQ 4H13D 3L73J 1VQ4P 1KQFB 1KZUB 3L70D 3HUSA 4M3LA 2JDIH 4DZOA 2ZYGA 3HE4A 4H44B 3PJSK 5DJUB 2BUOA 1BE3D 1Z56A 5I4TG 2Z44A 3L75D 1KLPA 3BCCD 2IFMA 2OYOA 2WITA 1LT9A 1BAJA 2K93A 1SFCC 2K9JA 1JUNA 2HLOA 4Y99C 3HE5A 4LLHA 3C1LA 1VQLP 2W27A 3L72D 2K3RA 1U7JA 2FXOA 2B87A 2ZVNB 2A06D 1KYOH 2BHVA 1KFMA 3G1IA 2ZT9B 1AV1A 2LXBA 1OXZA 4PD4D 4DCKA 1BGYG 1FAVA 3H1LE 3SWYA 3O6QB 1HJBA 1OWAA 2GDWA 2KI7B 2FYNC 1NU1D 1YJ9P 1GK6A 1PEMA 1CI6B 3Q5SA 3L74G 1JOCA 5AVTB 2WWWA 1CZQA 1S5LX 1M1JC 4JBZA 3DS2A 2KIKA 1HF9A 1FZCA 4NPDA 2E5YA 2EIAA 2AVAA 2E75D 4N78E 1RF0A 4Y28J 1EOQA 1ZW0A 1RQVA 1VQ9P 2AEJA 1K73Q 1J1DB 1MZ8A 1SVFA 2IYPA 4WBAA 2FACA 4JQ0D 4BPGA 4MRTC 1IJDB 2CG5B 3RL0D 2L4BA 1AVYA 1OMIA 2XDJA 1SQQJ 1EZVE 1R5LA 4ZKUA 1KV4A 2KORA 1HJ0A 1PPJG 2GZGA 3KDPB 1OX3A 3RK3E 1N73C 4KJMA 4CA3A 1WMKA 3V4WA 1T3JA 3KYQA 2RH0A 1M1KQ 2VRSA 2L0QA 5GTHE 1PGOA 3SWKA 4W7YA 3H1HG 3E2DA 2M8NA 2JWAA 1VQOP 2FYZA 2JP3A 1EXIA 1RE3C 2Z5IA 1F80D 1PEQA 2KOSA 3LRYA 2AF8A 2E75C 1JO5A 2OYHB 3WU2E 3Q20A 3IN6A 5KLVK 2N50A 3U43A 3WUUA 7CEIA 1RE4C 4H2WC 1NWQA 4IL6E 1JCCA 2WSFH 5AVWB 2OQQA 2KOPA 4M0IA 4IFFA 1SQXD 2O01N 1FR2A 1S5LH 3CX5I 2QJPB 2KW2A 2WT7B 2RMZA 1L0NG 5CCGD 1HWTC 1LWUB 2LTEA 1NTMK 4D6TJ 1ZN5A 4U3FJ 1JM0A 2Y9YA 4WY4C 4QKOA 2Z5HA 5EJDA 1GK4A 3O6QA 3V2PA 5F2KA 1YQ4C 4UB8H 5KTBA 3L71E 3CWBE 2FHSC 2PAJA 2BCCG 4JYBA 1M6NA 1CI6A 3Q5RA 1A02F 2GZEA 4HKGA 5DJTB 1DEBA 2QJYC 1EDJA 1OR5A 3MIWA 4GIFA 5EW5E 2GZJA 2D2CB 4BWNA 3M0DC 3NFQA 5B5EH 1URQD 3B4SA 1L0LD 2WPVB 1JB0J 3Q5PA 1NU1K 1DNYA 5CBOA 1T8KA 1M74A 5APXA 1RF1B 5KLVE 2H7HA 2CQ8A 1A43A 2IFNA 3L70E 1QVFO 5KLIC 3MTUE 2KWLA 3SFDC 4BXLA 2WMMA 2KODA 1Z6MA 1NTKG 4OGQB 3L75E 3BCCE 3G9RA 3L4FA 2GDXA 1JY2N 2LKIA 2NZ2A 1BGYD 1OIPA 1FZEA 4DOJA 3AEBC 2YIUB 3HYBA 3H1LJ 3H4EA 3L72E 3GMAA 3TF5A 4WYMA 1BDDA 1SQBK 2A06E 4N3YB 4U0EA 3CMAP 5EFWB 3LW5H 3RBXA 2OYHA 2R5DA 2YKQA 2I1KA 2VLPA 1NTZD 4PD4E 1LTSC 3CI9A 1EDLA 5KP8B 3I55P 1EDKA 1SFCB 2NRGA 2OTLP 1X9VA 4XE5B 4Y99B 1VKUA 1NU1E 2A45H 4HJGH 3A0BH 4L74A 2E5TA 4H2XC 4PV1D 2LKMA 2N9BA 1LWUA 2AXTH 1PP9D 2J59M 1M90Q 1P84I 1YITP 1IFJA 3CXCO 3RG6C 1BCCG 2Q7CA 3TGUG 4IFMA 3M9HA 2BQ1E 2EHSA 1PPJD 2Y0EA 1VHNA 2Z46A 1LP1B 2X2BA 2XNXA 5AVVB 1SQXK 3VMZA 2GDYA 3CLQA 5DCKA 4BRYB 3H1HD 2Z4EA 2FYNB 1SP4A 3TNUB 5KAFH 1FJPA 3B71A 1SS1A 2W90A 3CXHE 1M1JB 1SQBE 2FY8A 2E1MA 2YKPA 1NJIQ 5TISH 2YKOA 3TDKA 5CCHC 3G3ZA 1JTHB 1SQVD 1FZGA 1RF1A 2GUVA 3H1IE 3PRJA 2M8PA 2R3SA 3F5HA 3L73G 3PLNA 3G71P 4AUWA 1X0TA 2P9XA 1PV3A 3CMEP 2W6BA 3GZMA 1BDCA 3V6IA 5CMZA 3G0VA 2ZXXA 1N73B 1FOSF 2ITAA 2E74D 3L71J 2K1AA 1SQXE 3A7OA 4XFXA 3CCMP 1EDIA 3TYYA 3S4RA 2B9BA 5AW0B 1R8EA 2V7QH 4PWVB 3AEDC 1KB9D 1L0IA 1SFCA 2E75B 1VQ8P 5M1BA 1VQKP 1Q86Q 1MZ9A 2FQ0A 1X22A 3AE7C 3MUDC 2VLNA 2FFDC 3OJAB 3HD7C 5KLVJ 2C0WA 3G26A 1VQNP 3GHGC 1NTZK 1N7SD 1K04A 3L70J 1NTKD 1KFNA 2HODA 3MGEA 3L75J 1LP1A 3CWBD 1JMBA 3B5NA 1QRJA 3BCCJ 4WY4B 1GU5A 1G1IA 4BPFA 3AE1C 4PJ0H 2PEIA 4F37A 1XTCC 2KNCB 3R4YA 4BRYA 2Q1KA 2W8ZA 2K0DX 5AW1B 2Y0CA 2KG9A 2RKLA 1W2EA 3KXDA
chains in the Genus database with same CATH topology
4COCA 5F2KA 2XT1A 5BS1A 1K73Q 4COPA 3I55P 2LF4A 2PEKA 1M6NA 3G0VA 2BUOA 2OTLP 5I4TG 1EIAA 1RNIA 2Z44A 1QVGO 4XFZA 1YHQP 2JYLA 3CCSP 2PEMA 2PEOA 1BAJA 3VRLC 3H0DA 1RO2A 1M6EX 1Q82Q 1PEOA 3G1GA 4XROA 2DGYA 3CPWO 3CC2P 5F2OA 5BS2A 3G6EP 4XFXA 1E6JP 3CCMP 3G28A 1M90Q 2M8LA 4GR2A 1YJNP 5JPAA 1YITP 1VQPP 2OTJP 1K30A 3CCRP 3CXCO 3RG6C 1VQLP 3CC4P 5HGNA 2PEJA 3CC7P 4U0BA 2JYGA 2BQ1E 1M1KQ 3M1MA 1M74A 3E2DA 2M8NA 4QNBA 2QEXP 1VQOP 2Z46A 5HGOA 2XXMA 2BHVA 3CCVP 3G1IA 4XFYA 4PH0A 1K8AQ 4PH1A 1A43A 1PEQA 2EFJA 1IUQA 2L6EA 3B5IA 1YJWP 5DCKA 1N8RQ 3CCUP 1QVFO 3DPHA 1VQ8P 1KC8Q 1A8OA 3G29A 1KD1Q 2KODA 3P05A 1VQKP 2PEQA 3LRYA 1Q86Q 3CCQP 2PENA 4XRQA 1VQ6P 1AUMA 3DTJA 3Q20A 2JO0A 3NTEA 1VQ5P 1PEUA 4IPYA 1KQSO 5F2NA 3G26A 3DS0A 1VQNP 1YJ9P 2E1MA 4GR6A 1PEMA 3DS3A 3CCLP 1YI2P 3CCJP 1NJIQ 4U0CA 3CCEP 5HGLA 3HYBA 1RO0A 1D1DA 4M0IA 1ZMBA 3HZQA 3MGEA 1VQMP 2CWOA 5HGMA 1K9MQ 3H4EA 3DS4A 4U0DA 1QRJA 3H47A 2QA4P 1VQ7P 1S72P 3DS2A 1Q81Q 4WYMA 2Z45A 2M8PA 2ONTA 2PEIA 2PY8A 3G71P 4U0AA 4U0FA 3WBHA 2EIAA 3DS1A 3OW2O 2OARA 1W2BO 3DS5A 4U0EA 1Q7YQ 3G21A 3CMAP 2P9XA 1JJ2O 1EOQA 3CD6P 3G4SP 2XV6A 3I56P 1VQ4P 1VQ9P 3CMEP 2EG5A 1YIJP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 P;  1YJW P;  1N8R Q;  3G6E P;  3CCU P;  1QVF O;  3CCM P;  1M90 Q;  1VQ8 P;  1KC8 Q;  1K73 Q;  1KD1 Q;  1VQM P;  1YJN P;  2OTJ P;  1YIT P;  1VQP P;  1K9M Q;  1VQK P;  3CCR P;  3I55 P;  3CXC O;  1Q86 Q;  1VQL P;  3CC4 P;  3CCQ P;  2QA4 P;  1VQ7 P;  1S72 P;  1VQ6 P;  1Q81 Q;  3CC7 P;  2OTL P;  1QVG O;  1M1K Q;  3G71 P;  1YHQ P;  1VQ5 P;  3CCS P;  3OW2 O;  1W2B O;  1KQS O;  2QEX P;  1VQO P;  3CMA P;  1Q7Y Q;  1VQN P;  1YJ9 P;  1JJ2 O;  3CD6 P;  3G4S P;  3I56 P;  3CCE P;  3CCV P;  1Q82 Q;  1VQ4 P;  1VQ9 P;  1YI2 P;  3CCJ P;  1NJI Q;  3CCL P;  3CME P;  1K8A Q;  3CPW O;  1YIJ P; 
#chains in the Genus database with same CATH topology
 2MVU A;  3L72 J;  3AE8 C;  5BS1 A;  3IF4 A;  2HPC B;  2KG8 A;  1M1J A;  1UNK A;  5E79 H;  3FX0 A;  5KJ7 D;  1M7L A;  1EZV I;  1S2E A;  3AE9 C;  1FE6 A;  2ZVO B;  4XFZ A;  3P8M C;  1KYO D;  2P10 A;  1BGY E;  2YO2 A;  4L76 A;  1PEO A;  2N5I A;  4XRO A;  2DGY A;  3OA7 A;  5KLV D;  1QL1 A;  2BAS A;  2NPS C;  2UWJ E;  3A0H E;  1QLE D;  1WRG A;  5APW A;  3T97 A;  2WSC H;  4IZ6 A;  2MY5 A;  1NU1 J;  1N7S C;  5KLI B;  5BU5 A;  3H32 B;  2FXP A;  1NTM D;  3GW6 A;  1SQV K;  1CSB A;  1GZL A;  2L22 A;  1NTZ E;  1IUQ A;  3TGU D;  4AQR D;  1ACP A;  3VMY A;  1N73 A;  4EI2 A;  1LTJ C;  2IZ0 A;  3GLM A;  4NPE A;  2KXP B;  1BSN A;  1S4X A;  3FWL A;  1S3J A;  1RE3 A;  1IC2 A;  1YI2 P;  2A45 G;  1PP9 E;  2H89 C;  1LTA C;  2K88 A;  2IDB A;  2O01 H;  3H1K G;  1HVV A;  3QWO C;  2AXC A;  2ROQ A;  3E7K A;  4D6T G;  1UII A;  1FZA A;  4U3F G;  2JWD A;  2JKV A;  1PPJ E;  4H13 C;  2M5R A;  3WBH A;  1SQB J;  1PGP A;  3JCU E;  1MUU A;  4CPG A;  1RE4 A;  2K0Y A;  3NTN A;  1H0T A;  4LGD E;  1CW5 A;  1EC5 A;  3H1H E;  3H1I J;  2R5B A;  3Q2Y A;  1L4A D;  1LNQ A;  2JR8 A;  3KZI E;  5H2F E;  4ZKP A;  1YHQ P;  4WB4 A;  4KHX A;  3VRL C;  3H0D A;  4WY4 A;  1HTL C;  1UJZ A;  2KNC A;  1SQV E;  1NAF A;  1VQP P;  1K30 A;  2J5U A;  3BAT A;  2KLV A;  3BRV B;  2N1T D;  1H88 A;  2KZJ A;  2NO8 A;  5KAI E;  1NTK K;  2HPC A;  3M1M A;  4QNB A;  2B89 A;  5HV8 A;  3M91 A;  2K0X A;  1NOH A;  1YYC A;  3CXH D;  1SQX J;  4I1L A;  1SQB D;  4PH0 A;  3JSV C;  1AQT A;  3BVH A;  3B5I A;  1YJW P;  5AVQ B;  1DX7 A;  1A8O A;  1X3O A;  1Y8A A;  3M0D A;  1N2D C;  1GD2 E;  1KOR A;  1MFT A;  2E43 A;  3H1I D;  2XZ1 C;  3V2N A;  1QX8 A;  2Q3I A;  2IBZ D;  1KQS O;  3EJB A;  2HG5 D;  2P1J A;  1E0H A;  1USD A;  3CX5 H;  4K35 A;  1L4A C;  1K9M Q;  2KZI A;  5APU A;  2MR7 A;  2E76 D;  3H32 A;  3Q1M A;  2VLQ A;  2I1J A;  2XZR A;  1IMQ A;  2HYN A;  3PTZ A;  1KB9 E;  2J58 A;  4PD4 I;  3DS5 A;  5CJ0 A;  4ZMD A;  4UB6 H;  2AFD A;  1NAY A;  2QG4 A;  2XV6 A;  2XND H;  1L0L J;  3U1A A;  5AW3 B;  2N1T C;  3EJD A;  1FDM A;  2LF4 A;  3RL0 C;  1EMV A;  2DNW A;  1HH0 A;  5B66 H;  1JMM A;  3P32 A;  4JYC A;  3AE4 C;  2KYV A;  3MHV A;  3CCS P;  5GTI H;  2PEM A;  1W5C E;  4GOF A;  1NTK E;  1AVO A;  3G1G A;  5AW9 B;  1L2P A;  3G6E P;  2O1J A;  2ZYD A;  2QIW A;  2QNW A;  1RQU A;  1N86 A;  1LGH B;  2Q3E A;  1T2K D;  2E42 A;  1BGY J;  1VDF A;  1RF0 C;  5HGO A;  1KIL E;  2R3C A;  1T8Z A;  2GZI A;  2N98 A;  2E76 C;  2FFD B;  1SLQ A;  3HD7 B;  3MD0 A;  2PEQ A;  3GHG B;  3HRN A;  2XU6 A;  3CXH I;  2KUB A;  1GXH A;  3D6Z A;  2O1K A;  1HY8 A;  1KYO E;  2R44 A;  3P8C E;  1CEI A;  2ZT9 D;  3RK3 B;  3L36 A;  1GL2 B;  1NTZ J;  3LID A;  1PFI A;  2JBG A;  1ZMB A;  3HZQ A;  1M57 D;  3L37 A;  1OW6 A;  5CCG C;  3IR9 A;  2Q6Q A;  2R32 A;  4U0F A;  2OAR A;  4L75 A;  4WWI A;  1QL2 A;  2WSE J;  3G21 A;  1JJ2 O;  1BCC E;  1PP9 J;  1NTM E;  3CD6 P;  3H1J G;  3TGU E;  4EOT A;  5CCH A;  2Q9I A;  1DIP A;  5CBN A;  2KOG A;  1SQP G;  2JU2 A;  1LT1 A;  1GXG A;  1T2K C;  3GZL A;  1KMI Z;  2LL8 A;  3HTK B;  2FYU G;  5KP6 B;  2NPS B;  3L74 D;  1X8Y A;  3FXD A;  1NVO A;  1P84 H;  3RL0 g;  1RO2 A;  3H1H J;  3AE2 C;  3CC2 P;  1N7S B;  1URQ C;  3G28 A;  2M8L A;  4LC1 A;  5C39 A;  4NPF X;  1H8A A;  2XZ0 D;  3R2P A;  4DG9 A;  2JYG A;  5APY A;  4PXH B;  2CGQ A;  4L73 A;  1TU3 F;  1LTJ B;  1IFM A;  1AJY A;  1T6A A;  4GT1 A;  1G2C B;  2WT7 A;  3GKL C;  1SQV J;  4PH1 A;  2EFJ A;  3NXS A;  1FDI A;  3PP5 A;  4RES B;  1Q2N A;  2PEN A;  2WPS A;  2Y9Z A;  5APQ A;  3L70 G;  1E5W A;  5APT A;  2JU1 A;  2K2Q A;  1VQ5 P;  3V5B A;  4XFJ A;  5BU8 B;  2KSE A;  1BE3 G;  2FVA A;  2MKV A;  2IPP A;  3C8V A;  3GF3 A;  1JY3 P;  1D1D A;  2K94 A;  4H13 B;  1KTM A;  2CWO A;  4Z1M H;  3JC2 2;  1JY3 O;  3Q3D A;  1HUC A;  3VTP C;  2ONT A;  2FFD A;  2FBW C;  3HD7 A;  1JY2 P;  1E79 H;  1RH5 B;  3GHG A;  1RY3 A;  1ZRT D;  2IX7 C;  1S5L E;  1ZOY C;  1DD3 A;  2A06 G;  1GL2 A;  1NKZ B;  1MFZ A;  4IFD K;  3LMO A;  1YTZ T;  2IBZ E;  4PV1 C;  3AEC C;  3ZDM A;  3VN0 A;  2GZF A;  2KR5 A;  1FJK A;  2BEQ D;  4UB8 E;  3UIA A;  2M0B A;  1HBW A;  4GOE A;  4XA4 A;  1L0N D;  1NU1 G;  1ZV8 A;  5TJH A;  3ABV C;  5JPA A;  2OTJ P;  1U7M A;  1R5S A;  2L91 A;  3ITK A;  1NTK J;  3EFF K;  2WQY C;  1PZQ A;  4DT0 A;  2BCC D;  2D2C D;  1OW7 A;  1PGQ A;  2H8P D;  3CWB J;  2GA1 A;  2NPS A;  5B5E E;  3CCU P;  2K9J B;  3DTJ A;  1N7S A;  2ZAE B;  1L4A B;  3P7K A;  3CL3 D;  4IPY A;  5AVY B;  4DJG A;  5F2N A;  1IMP A;  3DS0 A;  1JEK A;  2FKW B;  1X79 B;  1EQ7 A;  2ZFC A;  1J2J B;  2W83 C;  1VQM P;  3H25 A;  2BEZ F;  4KT0 J;  1LTJ A;  4U0D A;  1VQ7 P;  1KQL A;  1FS0 E;  3VOP A;  2KS1 B;  4ASV A;  2N6Y A;  2JO1 A;  4HYT B;  2HFE D;  3CE7 A;  2N1T B;  2P2U A;  1NYH A;  3RL0 B;  3MGN A;  5AVU B;  1AA0 A;  2XT1 A;  3VP8 A;  2QRX A;  2JJL A;  2OGU A;  2KG6 A;  4YPC A;  2AFE A;  2JEE A;  1S9K D;  1ZXG A;  1EIA A;  4U7J A;  1BSH A;  2JYL A;  1NTM J;  4RJT A;  3TSI A;  2E74 C;  1SQP D;  3TGU J;  5GTH H;  1QGK B;  2N9Y B;  1HGV A;  1IFN A;  3TNU A;  5HVC A;  1XTG B;  2FYU D;  2YMK A;  5AVX B;  2QJY B;  2QE7 H;  2CPB A;  1SQQ G;  5HGN A;  5AW5 B;  3CC7 P;  3A3Y B;  3A0B E;  3EWK A;  2N6Z A;  4NEO A;  2E76 B;  1JTH A;  3H1K E;  3P8C D;  2AXT E;  3WU2 H;  3D71 A;  5AVS B;  2CNR A;  2PP6 A;  1ZR2 A;  1GW4 A;  4XFY A;  1IFD A;  1FOS E;  1N8R Q;  3RK2 D;  2QSI A;  3AE5 C;  2GYK A;  2XV5 A;  5AW4 B;  4IL6 H;  3BAS A;  3CCQ P;  4HB1 A;  1VQ6 P;  1AUM A;  2M3E A;  3VYI A;  1LTT C;  1A02 J;  3B5N D;  3L74 E;  1MKM A;  3AE6 C;  2KSJ A;  2WVR A;  1OW8 A;  3AEG C;  1BCC D;  2MF4 A;  5HGL A;  1J1E C;  2JQ4 A;  1KB9 I;  5KAF E;  1FZB A;  4JF7 A;  2ZJS E;  1IO4 A;  2PY8 A;  3QH9 A;  3VMX A;  1MV8 A;  3DS1 A;  2M3B A;  3OW2 O;  2OYI C;  4GOD A;  1L0L G;  1KIL C;  4WVZ A;  5TIS E;  1L0N K;  1NH4 A;  2EG5 A;  1YIJ P;  2H43 A;  1L4A A;  5KJ7 C;  1DD4 A;  3A5T A;  4W7Z A;  2JGP A;  2V4H A;  3VMA A;  2LML A;  2XKM A;  4R0M A;  1RNI A;  3RGU A;  1LTB C;  2WSF J;  1URQ B;  2N5H A;  1FZF A;  3RK2 C;  1IFP A;  2KS1 A;  1GDT A;  1HGZ A;  1NQ4 A;  3L73 D;  1YJN P;  2N1T A;  3M0A A;  3B5N C;  3M9Q A;  4U0B A;  4JPZ B;  2M5A B;  1ZRT E;  3O8Z A;  3CX5 D;  1OZH A;  3GG2 A;  1VF5 D;  3CCV P;  3RG2 A;  2LXC B;  2WPT A;  1KYO I;  4H2Y C;  2YXR B;  4XRQ A;  1IFI A;  1NTZ G;  4TT3 H;  3NTE A;  5AVZ B;  1PEU A;  2FQ2 A;  3OAK A;  2M8R A;  1FDO A;  2W6J H;  3V2R A;  1L0N E;  4I7Z C;  3FGA D;  3HUS C;  1OVU A;  3A2A A;  3AEE C;  3H47 A;  3M06 A;  4PD4 H;  1PP9 G;  1SQP K;  1BXI A;  4YXD C;  4U0A A;  4AYC A;  2KGC A;  1LT9 C;  5BVZ A;  2BCC E;  2RN0 A;  5CHX A;  3G4S P;  2FYU K;  3H1L G;  2W6A A;  4C7N B;  4UHP B;  4COC A;  4WY4 D;  4PV1 B;  3EJE A;  1NKN A;  5CCG A;  4PJ0 E;  2PEK A;  1PL5 A;  4A7P A;  4MN4 C;  2VLO A;  1OVR A;  1VF5 C;  2LR2 A;  4I2L C;  1RHZ B;  4QMA A;  2PEO A;  5CJ4 A;  2POH A;  1YQ3 C;  4H0L D;  5E79 E;  3CPW O;  2FQ1 A;  5BS2 A;  2YNY A;  2LOL A;  3S9O A;  2WTY A;  3WUT A;  3WMM 0;  4YTP C;  3S1K A;  3N4X A;  2PEJ A;  3V2Q A;  3LW5 J;  4OVN F;  2FAD A;  1SQV G;  1NHL A;  2KLU A;  2PFX A;  1GMJ A;  1AQ5 A;  1SQQ D;  3CXH H;  5KP7 B;  3RBZ A;  1URQ A;  4H44 D;  3G29 A;  3WUV A;  3SSU A;  1AFO A;  1EZV G;  1S9K E;  3H1J E;  4YXW H;  1FZC C;  3H1K J;  2JO0 A;  1AYI A;  1SQP E;  1IK9 A;  4EIJ A;  3NMD A;  3W67 A;  4IOI H;  2QM8 A;  5KKZ C;  3CCL P;  3CCE P;  3B8E B;  2FYU E;  3N7N A;  3H6P A;  2FAE A;  1DV5 A;  2M5A A;  4R4L A;  1GU4 A;  2QA4 P;  3L74 J;  2Z45 A;  2FVF A;  2I8D A;  1P84 D;  1ZR4 A;  4H0L C;  4C7R A;  4B86 A;  2QJK C;  4R4M A;  2IBZ I;  2E74 B;  2KGE A;  2K92 A;  3I5C A;  1QVG O;  4N6J A;  2AEM A;  3GF7 A;  3D6Y A;  1OFC X;  4H44 C;  3H1K D;  1L0H A;  1M6E X;  1Q82 Q;  4D6T D;  1JY3 N;  1NO4 A;  1ZP0 C;  4U3F D;  5AW2 B;  2P67 A;  5AW7 B;  3II6 A;  2LIW A;  2PRR A;  1BE3 E;  1VPC A;  4C7N A;  3U1C A;  2L5G B;  3L71 G;  2MD9 A;  3CWB G;  4RKU J;  1UIX A;  2YO3 A;  2XXM A;  2WPQ A;  3KPE A;  2DW3 A;  1DEE G;  1K8A Q;  2L6E A;  2JAZ A;  1IZN B;  2G3A A;  3AEF C;  2G8Y A;  3DPH A;  5APV A;  1Q90 D;  2QVA A;  3P05 A;  1DH3 A;  2AEF A;  1NGM B;  2ZT9 C;  3E1I A;  2K9Y A;  1FU1 A;  1J1E B;  1G1J A;  1FC2 C;  2IYO A;  2MJZ A;  4GR6 A;  2CPS A;  3DS3 A;  2O3J A;  3CCJ P;  5AW6 B;  2FVE A;  3L73 E;  2QM7 A;  2V7Q J;  2OYI B;  5CCH D;  1KIL B;  5KLV G;  2CK3 H;  1USE A;  3SFE C;  1IK7 A;  3CX5 E;  1W2B O;  3M9B A;  1L0N J;  2PGD A;  3I56 P;  1YBK A;  1HQB A;  3L75 G;  1KQG B;  1QEX A;  3BCC G;  3IAO A;  4COP A;  1NTM G;  3PHL A;  3A0H H;  3RK2 B;  2WZ7 A;  3V4Q A;  3H1L D;  2BCC J;  4UB6 E;  2HOD B;  3MUD A;  1SQQ K;  1J1D C;  4RO0 A;  3B5N B;  3L72 G;  3NY7 B;  1JY2 O;  3FWN A;  1EXJ A;  2A45 I;  2MVV A;  5F2O A;  2WSS H;  1E6J P;  5B66 E;  4GR2 A;  1YTZ I;  3CC4 P;  1PIX A;  3BRT B;  5GTI E;  2LIU A;  2YMY A;  2C9N Y;  4ZNC A;  2LPK A;  1N7L A;  2JB0 A;  4N78 D;  1U57 A;  5AW8 B;  1GW3 A;  1ZME C;  1K05 A;  2WSE H;  1KC8 Q;  2B88 A;  2GUS A;  4OWF A;  1M56 D;  2KOO A;  4I6M C;  1GTW A;  1GPJ A;  1KN7 A;  4HKZ H;  4I7Z B;  4C46 A;  3HUS B;  3T97 B;  3HD7 D;  1EZV D;  2P58 A;  2WPR A;  3JCU H;  3HE4 B;  3IFM A;  2OYH C;  2KGD A;  1LJ2 A;  2WSC J;  3AEA C;  1L0L K;  2ZXE B;  3HTK A;  2K37 A;  2KOQ A;  2PNG A;  4IL6 X;  4OH8 B;  3H1J J;  1LT9 B;  3DS4 A;  3RK3 D;  4EDF A;  3AE3 C;  1AF8 A;  1M8O B;  1Q81 Q;  5AVR B;  1GL2 D;  5CZD B;  1WT6 A;  1SQP J;  5H2F H;  3KZI H;  3LIE A;  1ZLL A;  4GKG A;  1KIL D;  3USS A;  3HE5 B;  2QJP C;  4TLF A;  4W80 A;  1SQQ E;  3C9I A;  3D70 A;  2FYU J;  3TK1 A;  4HH2 A;  4EYY Q;  3MZW B;  1LWU C;  1OVV A;  1VF5 B;  2YXQ B;  4OGQ D;  2ERH A;  3W68 A;  2B87 B;  1SQB G;  2IZ1 A;  4K3A A;  1G2C A;  3EQ2 A;  4O9B A;  2OYI A;  1KIL A;  4GDO A;  2Y0D A;  2O01 J;  3GJN A;  3H1I G;  5KAI H;  3B4Q A;  4BPH A;  2IBZ G;  5KJ7 A;  3KHU A;  2VSQ A;  2L9F A;  2NPS D;  3CCR P;  2SPZ A;  1H0T B;  1FBM A;  1S1C X;  3H1J D;  3MP7 B;  1P84 E;  2D2C C;  1Y9B A;  1BCC J;  2QEX P;  3K5B A;  4ASW A;  2HR3 A;  3L35 A;  1FZC B;  3RK3 C;  3SWF A;  1SFC D;  3F89 A;  1BE3 J;  3KQG A;  1D7M A;  1GL2 C;  1KD1 Q;  3L71 D;  1L0L E;  3VP9 A;  1RF1 C;  2C9L Y;  5KKZ B;  2EHT A;  3PH0 A;  3E1R A;  3U59 A;  1SQX G;  2KGA A;  2Q5U A;  2ZYA A;  1VL2 A;  2H88 C;  1JNM A;  3EFG A;  1JCD A;  2OTK E;  1LTI C;  1PGJ A;  1T3U A;  4OGQ C;  1KB9 H;  4D6T E;  3FXE A;  2KP8 A;  2KK7 A;  2P7J A;  2K5X A;  1Y47 A;  4U3F E;  4U0C A;  1RO0 A;  1LTG C;  2FXM A;  5K5G B;  2MR8 A;  5HGM A;  4H0L B;  2GM4 A;  2C0X A;  2QJK B;  1S72 P;  2YIU C;  5L8R J;  5APS A;  1ZNV A;  2KB7 P;  1H89 A;  1Q7Y Q;  4H13 D;  3L73 J;  1VQ4 P;  1KQF B;  1KZU B;  3L70 D;  3HUS A;  4M3L A;  2JDI H;  4DZO A;  2ZYG A;  3HE4 A;  4H44 B;  3PJS K;  5DJU B;  2BUO A;  1BE3 D;  1Z56 A;  5I4T G;  2Z44 A;  3L75 D;  1KLP A;  3BCC D;  2IFM A;  2OYO A;  2WIT A;  1LT9 A;  1BAJ A;  2K93 A;  1SFC C;  2K9J A;  1JUN A;  2HLO A;  4Y99 C;  3HE5 A;  4LLH A;  3C1L A;  1VQL P;  2W27 A;  3L72 D;  2K3R A;  1U7J A;  2FXO A;  2B87 A;  2ZVN B;  2A06 D;  1KYO H;  2BHV A;  1KFM A;  3G1I A;  2ZT9 B;  1AV1 A;  2LXB A;  1OXZ A;  4PD4 D;  4DCK A;  1BGY G;  1FAV A;  3H1L E;  3SWY A;  3O6Q B;  1HJB A;  1OWA A;  2GDW A;  2KI7 B;  2FYN C;  1NU1 D;  1YJ9 P;  1GK6 A;  1PEM A;  1CI6 B;  3Q5S A;  3L74 G;  1JOC A;  5AVT B;  2WWW A;  1CZQ A;  1S5L X;  1M1J C;  4JBZ A;  3DS2 A;  2KIK A;  1HF9 A;  1FZC A;  4NPD A;  2E5Y A;  2EIA A;  2AVA A;  2E75 D;  4N78 E;  1RF0 A;  4Y28 J;  1EOQ A;  1ZW0 A;  1RQV A;  1VQ9 P;  2AEJ A;  1K73 Q;  1J1D B;  1MZ8 A;  1SVF A;  2IYP A;  4WBA A;  2FAC A;  4JQ0 D;  4BPG A;  4MRT C;  1IJD B;  2CG5 B;  3RL0 D;  2L4B A;  1AVY A;  1OMI A;  2XDJ A;  1SQQ J;  1EZV E;  1R5L A;  4ZKU A;  1KV4 A;  2KOR A;  1HJ0 A;  1PPJ G;  2GZG A;  3KDP B;  1OX3 A;  3RK3 E;  1N73 C;  4KJM A;  4CA3 A;  1WMK A;  3V4W A;  1T3J A;  3KYQ A;  2RH0 A;  1M1K Q;  2VRS A;  2L0Q A;  5GTH E;  1PGO A;  3SWK A;  4W7Y A;  3H1H G;  3E2D A;  2M8N A;  2JWA A;  1VQO P;  2FYZ A;  2JP3 A;  1EXI A;  1RE3 C;  2Z5I A;  1F80 D;  1PEQ A;  2KOS A;  3LRY A;  2AF8 A;  2E75 C;  1JO5 A;  2OYH B;  3WU2 E;  3Q20 A;  3IN6 A;  5KLV K;  2N50 A;  3U43 A;  3WUU A;  7CEI A;  1RE4 C;  4H2W C;  1NWQ A;  4IL6 E;  1JCC A;  2WSF H;  5AVW B;  2OQQ A;  2KOP A;  4M0I A;  4IFF A;  1SQX D;  2O01 N;  1FR2 A;  1S5L H;  3CX5 I;  2QJP B;  2KW2 A;  2WT7 B;  2RMZ A;  1L0N G;  5CCG D;  1HWT C;  1LWU B;  2LTE A;  1NTM K;  4D6T J;  1ZN5 A;  4U3F J;  1JM0 A;  2Y9Y A;  4WY4 C;  4QKO A;  2Z5H A;  5EJD A;  1GK4 A;  3O6Q A;  3V2P A;  5F2K A;  1YQ4 C;  4UB8 H;  5KTB A;  3L71 E;  3CWB E;  2FHS C;  2PAJ A;  2BCC G;  4JYB A;  1M6N A;  1CI6 A;  3Q5R A;  1A02 F;  2GZE A;  4HKG A;  5DJT B;  1DEB A;  2QJY C;  1EDJ A;  1OR5 A;  3MIW A;  4GIF A;  5EW5 E;  2GZJ A;  2D2C B;  4BWN A;  3M0D C;  3NFQ A;  5B5E H;  1URQ D;  3B4S A;  1L0L D;  2WPV B;  1JB0 J;  3Q5P A;  1NU1 K;  1DNY A;  5CBO A;  1T8K A;  1M74 A;  5APX A;  1RF1 B;  5KLV E;  2H7H A;  2CQ8 A;  1A43 A;  2IFN A;  3L70 E;  1QVF O;  5KLI C;  3MTU E;  2KWL A;  3SFD C;  4BXL A;  2WMM A;  2KOD A;  1Z6M A;  1NTK G;  4OGQ B;  3L75 E;  3BCC E;  3G9R A;  3L4F A;  2GDX A;  1JY2 N;  2LKI A;  2NZ2 A;  1BGY D;  1OIP A;  1FZE A;  4DOJ A;  3AEB C;  2YIU B;  3HYB A;  3H1L J;  3H4E A;  3L72 E;  3GMA A;  3TF5 A;  4WYM A;  1BDD A;  1SQB K;  2A06 E;  4N3Y B;  4U0E A;  3CMA P;  5EFW B;  3LW5 H;  3RBX A;  2OYH A;  2R5D A;  2YKQ A;  2I1K A;  2VLP A;  1NTZ D;  4PD4 E;  1LTS C;  3CI9 A;  1EDL A;  5KP8 B;  3I55 P;  1EDK A;  1SFC B;  2NRG A;  2OTL P;  1X9V A;  4XE5 B;  4Y99 B;  1VKU A;  1NU1 E;  2A45 H;  4HJG H;  3A0B H;  4L74 A;  2E5T A;  4H2X C;  4PV1 D;  2LKM A;  2N9B A;  1LWU A;  2AXT H;  1PP9 D;  2J59 M;  1M90 Q;  1P84 I;  1YIT P;  1IFJ A;  3CXC O;  3RG6 C;  1BCC G;  2Q7C A;  3TGU G;  4IFM A;  3M9H A;  2BQ1 E;  2EHS A;  1PPJ D;  2Y0E A;  1VHN A;  2Z46 A;  1LP1 B;  2X2B A;  2XNX A;  5AVV B;  1SQX K;  3VMZ A;  2GDY A;  3CLQ A;  5DCK A;  4BRY B;  3H1H D;  2Z4E A;  2FYN B;  1SP4 A;  3TNU B;  5KAF H;  1FJP A;  3B71 A;  1SS1 A;  2W90 A;  3CXH E;  1M1J B;  1SQB E;  2FY8 A;  2E1M A;  2YKP A;  1NJI Q;  5TIS H;  2YKO A;  3TDK A;  5CCH C;  3G3Z A;  1JTH B;  1SQV D;  1FZG A;  1RF1 A;  2GUV A;  3H1I E;  3PRJ A;  2M8P A;  2R3S A;  3F5H A;  3L73 G;  3PLN A;  3G71 P;  4AUW A;  1X0T A;  2P9X A;  1PV3 A;  3CME P;  2W6B A;  3GZM A;  1BDC A;  3V6I A;  5CMZ A;  3G0V A;  2ZXX A;  1N73 B;  1FOS F;  2ITA A;  2E74 D;  3L71 J;  2K1A A;  1SQX E;  3A7O A;  4XFX A;  3CCM P;  1EDI A;  3TYY A;  3S4R A;  2B9B A;  5AW0 B;  1R8E A;  2V7Q H;  4PWV B;  3AED C;  1KB9 D;  1L0I A;  1SFC A;  2E75 B;  1VQ8 P;  5M1B A;  1VQK P;  1Q86 Q;  1MZ9 A;  2FQ0 A;  1X22 A;  3AE7 C;  3MUD C;  2VLN A;  2FFD C;  3OJA B;  3HD7 C;  5KLV J;  2C0W A;  3G26 A;  1VQN P;  3GHG C;  1NTZ K;  1N7S D;  1K04 A;  3L70 J;  1NTK D;  1KFN A;  2HOD A;  3MGE A;  3L75 J;  1LP1 A;  3CWB D;  1JMB A;  3B5N A;  1QRJ A;  3BCC J;  4WY4 B;  1GU5 A;  1G1I A;  4BPF A;  3AE1 C;  4PJ0 H;  2PEI A;  4F37 A;  1XTC C;  2KNC B;  3R4Y A;  4BRY A;  2Q1K A;  2W8Z A;  2K0D X;  5AW1 B;  2Y0C A;  2KG9 A;  2RKL A;  1W2E A;  3KXD A; 
#chains in the Genus database with same CATH homology
 4COC A;  5F2K A;  2XT1 A;  5BS1 A;  1K73 Q;  4COP A;  3I55 P;  2LF4 A;  2PEK A;  1M6N A;  3G0V A;  2BUO A;  2OTL P;  5I4T G;  1EIA A;  1RNI A;  2Z44 A;  1QVG O;  4XFZ A;  1YHQ P;  2JYL A;  3CCS P;  2PEM A;  2PEO A;  1BAJ A;  3VRL C;  3H0D A;  1RO2 A;  1M6E X;  1Q82 Q;  1PEO A;  3G1G A;  4XRO A;  2DGY A;  3CPW O;  3CC2 P;  5F2O A;  5BS2 A;  3G6E P;  4XFX A;  1E6J P;  3CCM P;  3G28 A;  1M90 Q;  2M8L A;  4GR2 A;  1YJN P;  5JPA A;  1YIT P;  1VQP P;  2OTJ P;  1K30 A;  3CCR P;  3CXC O;  3RG6 C;  1VQL P;  3CC4 P;  5HGN A;  2PEJ A;  3CC7 P;  4U0B A;  2JYG A;  2BQ1 E;  1M1K Q;  3M1M A;  1M74 A;  3E2D A;  2M8N A;  4QNB A;  2QEX P;  1VQO P;  2Z46 A;  5HGO A;  2XXM A;  2BHV A;  3CCV P;  3G1I A;  4XFY A;  4PH0 A;  1K8A Q;  4PH1 A;  1A43 A;  1PEQ A;  2EFJ A;  1IUQ A;  2L6E A;  3B5I A;  1YJW P;  5DCK A;  1N8R Q;  3CCU P;  1QVF O;  3DPH A;  1VQ8 P;  1KC8 Q;  1A8O A;  3G29 A;  1KD1 Q;  2KOD A;  3P05 A;  1VQK P;  2PEQ A;  3LRY A;  1Q86 Q;  3CCQ P;  2PEN A;  4XRQ A;  1VQ6 P;  1AUM A;  3DTJ A;  3Q20 A;  2JO0 A;  3NTE A;  1VQ5 P;  1PEU A;  4IPY A;  1KQS O;  5F2N A;  3G26 A;  3DS0 A;  1VQN P;  1YJ9 P;  2E1M A;  4GR6 A;  1PEM A;  3DS3 A;  3CCL P;  1YI2 P;  3CCJ P;  1NJI Q;  4U0C A;  3CCE P;  5HGL A;  3HYB A;  1RO0 A;  1D1D A;  4M0I A;  1ZMB A;  3HZQ A;  3MGE A;  1VQM P;  2CWO A;  5HGM A;  1K9M Q;  3H4E A;  3DS4 A;  4U0D A;  1QRJ A;  3H47 A;  2QA4 P;  1VQ7 P;  1S72 P;  3DS2 A;  1Q81 Q;  4WYM A;  2Z45 A;  2M8P A;  2ONT A;  2PEI A;  2PY8 A;  3G71 P;  4U0A A;  4U0F A;  3WBH A;  2EIA A;  3DS1 A;  3OW2 O;  2OAR A;  1W2B O;  3DS5 A;  4U0E A;  1Q7Y Q;  3G21 A;  3CMA P;  2P9X A;  1JJ2 O;  1EOQ A;  3CD6 P;  3G4S P;  2XV6 A;  3I56 P;  1VQ4 P;  1VQ9 P;  3CME P;  2EG5 A;  1YIJ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...