1T8KA

Crystal structure of apo acyl carrier protein from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Acyl carrier protein
publication title Structure of apo acyl carrier protein and a proposal to engineer protein crystallization through metal ions.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2004-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1t8kA00
2VSQA 2MD9A 2MR8A 2MVUA 2QNWA 4BPHA 4BPGA 4NEOA 1F80D 2K93A 1VKUA 1L0HA 2L4BA 4H2XC 5KP7B 2JQ4A 5KP8B 2AF8A 2KR5A 1NQ4A 5HV8A 2K92A 2LKIA 2EHSA 2LPKA 3NY7B 3EJEA 2KOOA 1T8KA 2MY5A 2N50A 2KOSA 2ROQA 2FVAA 2KWLA 2JU1A 2N5HA 2XZ0D 3LMOA 2LTEA 2GDYA 2JU2A 4MRTC 1HQBA 2DNWA 2LOLA 2K2QA 2AFEA 2K0XA 2L0QA 2JGPA 2CQ8A 2EHTA 2LMLA 2PNGA 1DNYA 2CG5B 4PXHB 2K0YA 3GZLA 1L0IA 5KP6B 2FQ2A 2FVEA 4CA3A 4R0MA 2L22A 4BPFA 2KW2A 2X2BA 4H2WC 2FADA 2CNRA 2KOPA 2KOQA 2KGDA 2LIUA 2GDWA 2GDXA 2MF4A 3RG2A 2KG9A 2KG8A 1DV5A 2KGAA 1HY8A 1ACPA 3CE7A 5CZDB 2KG6A 2LL8A 3EJDA 1OR5A 1X3OA 2AVAA 2FVFA 2FQ0A 4DG9A 2KGEA 5HVCA 2FQ1A 2N6ZA 2M5RA 4PWVB 4IZ6A 2FAEA 1KLPA 2N5IA 2LIWA 2CGQA 4HKGA 3GZMA 2MR7A 2FHSC 2AFDA 2N6YA 2N98A 5EJDA 2MVVA 2K94A 2KORA 4H2YC 2KGCA 2L9FA 2XZ1C 3EJBA 1AF8A 2FACA
chains in the Genus database with same CATH superfamily
1K73Q 1EIAA 2MR8A 3LRYA 3Q20A 1Q81Q 2EIAA 1F80D 2EFJA 1MZ8A 1VKUA 2VLOA 2L4BA 4H2XC 5HV8A 4PH0A 2LPKA 1YJNP 1JJ2O 3P05A 1VQ4P 1VQ7P 2FVAA 3LMOA 2LTEA 2LOLA 3WBHA 4COPA 1UNKA 2L0QA 2LMLA 1DNYA 2XT1A 1M1KQ 2FVEA 2KW2A 3CCRP 2PENA 1VQ6P 3DS1A 3U43A 3CCQP 2VLNA 2M8LA 2VLPA 3RG2A 2JBGA 3DTJA 1GXGA 1HY8A 3G1IA 1ACPA 3CCEP 3CE7A 5CZDB 3CC2P 2LL8A 4F37A 3EJDA 3VRLC 1X3OA 1Z6MA 2FQ0A 2GYKA 2KGEA 2QEXP 1VQOP 2N6ZA 2M5RA 4UHPB 2FAEA 3I56P 3DS0A 2K0DX 3CPWO 2OTJP 1UJZA 2VLQA 5F2OA 2M8NA 2Z45A 2N98A 1N8RQ 4XFZA 2XZ1C 2JB0A 3EJBA 2VSQA 2MVUA 1KD1Q 1A8OA 1M74A 1A43A 3E2DA 1YHQP 2PEOA 1L0HA 3DS3A 3G0VA 3I55P 4WYMA 3CXCO 1VQLP 2JQ4A 1KQSO 3GKLC 3CCUP 1YJ9P 2WPTA 2EHSA 3G4SP 1K9MQ 3NY7B 3EJEA 1IUQA 2N50A 5HGLA 2ROQA 2KWLA 5F2NA 3G26A 5DCKA 2GDYA 4QNBA 3H4EA 2JU2A 4U0FA 2K2QA 3MGEA 2K0XA 2PEIA 2JGPA 1Q7YQ 2CG5B 1YJWP 2FQ2A 2L22A 4M0IA 1W2BO 2X2BA 2FADA 3DS2A 2GDXA 1Q86Q 1VQKP 2PEQA 2KG9A 2KG8A 3G28A 4DG9A 5HVCA 2K5XA 4U0BA 1IMQA 1KLPA 2CGQA 4HKGA 2FHSC 2AFDA 1BXIA 2N6YA 4H2YC 2KGCA 3H47A 2BHVA 2E1MA 2EG5A 2FACA 2QNWA 3HYBA 4BPHA 4BPGA 2PY8A 1VHNA 4NEOA 2K93A 2ERHA 5HGMA 3M1MA 1ZMBA 2PEJA 5KP7B 5KP8B 1K30A 2AF8A 1YI2P 2KR5A 2K92A 2LKIA 2P9XA 5BS2A 3CC4P 1VQ9P 3CD6P 1T8KA 4U0CA 2KOSA 1EOQA 2QA4P 2GZGA 2N5HA 2XZ0D 1VQMP 2M8PA 4XFXA 1AYIA 2DNWA 4GR2A 5F2KA 2GZJA 7CEIA 4COCA 2PNGA 2EHTA 4PXHB 3GJNA 3CCLP 3G21A 4CA3A 2GZEA 5BS1A 2JYGA 4BPFA 2Z44A 4H2WC 2CNRA 1CEIA 2KOQA 2KGDA 2LIUA 2GDWA 4IPYA 3DS4A 3G6EP 2KG6A 1Q82Q 2ONTA 1GXHA 1OR5A 2LF4A 3G71P 2FVFA 4PH1A 5EW5E 1RO0A 2FQ1A 2LIWA 1YIJP 1VQNP 3H0DA 3GZMA 1RNIA 4XRQA 4QKOA 5EJDA 2OTLP 2K94A 2KORA 3OW2O 5I4TG 1AF8A 3CCVP 2XXMA 2MD9A 1QRJA 2GZFA 1VQ5P 5HGOA 1K8AQ 3DPHA 2GZIA 2JYLA 2KODA 5JPAA 2PEMA 1M90Q 1IMPA 4XROA 3CC7P 1YITP 1E0HA 1NQ4A 3CMEP 4GR6A 3G29A 2Z46A 2KOOA 3NTEA 2MY5A 2JU1A 2OARA 1AUMA 1VQPP 3B4QA 4MRTC 1HQBA 2NO8A 1M6EX 1RO2A 3HZQA 2AFEA 1ZNVA 1GPJA 2CQ8A 4XFYA 3RG6C 2K0YA 3GZLA 1EMVA 1L0IA 5KP6B 4U0DA 1M6NA 1NJIQ 4R0MA 2KOPA 1KC8Q 2JAZA 2MF4A 3CCJP 1DV5A 2JO0A 2KGAA 1QVGO 2XV6A 2AVAA 1VQ8P 3CCSP 2CWOA 1S72P 1D1DA 2L6EA 2BUOA 3B5IA 4PWVB 4IZ6A 1E6JP 1QVFO 2N5IA 4U0EA 2MR7A 3DS5A 2PEKA 4U0AA 1FR2A 3CMAP 3G1GA 2MVVA 1BAJA 2L9FA 3CCMP 2DGYA 5HGNA
chains in the Genus database with same CATH topology
2VSQA 2MD9A 2MR8A 2MVUA 2QNWA 4BPHA 4BPGA 4NEOA 1F80D 2K93A 1VKUA 1L0HA 2L4BA 4H2XC 5KP7B 2JQ4A 5KP8B 2AF8A 2KR5A 1NQ4A 5HV8A 2K92A 2LKIA 2EHSA 2LPKA 3NY7B 3EJEA 2KOOA 1T8KA 2MY5A 2N50A 2KOSA 2ROQA 2FVAA 2KWLA 2JU1A 2N5HA 2XZ0D 3LMOA 2LTEA 2GDYA 2JU2A 4MRTC 1HQBA 2DNWA 2LOLA 2K2QA 2AFEA 2K0XA 2L0QA 2JGPA 2CQ8A 2EHTA 2LMLA 2PNGA 1DNYA 2CG5B 4PXHB 2K0YA 3GZLA 1L0IA 5KP6B 2FQ2A 2FVEA 4CA3A 4R0MA 2L22A 4BPFA 2KW2A 2X2BA 4H2WC 2FADA 2CNRA 2KOPA 2KOQA 2KGDA 2LIUA 2GDWA 2GDXA 2MF4A 3RG2A 2KG9A 2KG8A 1DV5A 2KGAA 1HY8A 1ACPA 3CE7A 5CZDB 2KG6A 2LL8A 3EJDA 1OR5A 1X3OA 2AVAA 2FVFA 2FQ0A 4DG9A 2KGEA 5HVCA 2FQ1A 2N6ZA 2M5RA 4PWVB 4IZ6A 2FAEA 1KLPA 2N5IA 2LIWA 2CGQA 4HKGA 3GZMA 2MR7A 2FHSC 2AFDA 2N6YA 2N98A 5EJDA 2MVVA 2K94A 2KORA 4H2YC 2KGCA 2L9FA 2XZ1C 3EJBA 1AF8A 2FACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSQ A;  2MD9 A;  2MR8 A;  2MVU A;  2QNW A;  4BPH A;  4BPG A;  4NEO A;  1F80 D;  2K93 A;  1VKU A;  1L0H A;  2L4B A;  4H2X C;  5KP7 B;  2JQ4 A;  5KP8 B;  2AF8 A;  2KR5 A;  1NQ4 A;  5HV8 A;  2K92 A;  2LKI A;  2EHS A;  2LPK A;  3NY7 B;  3EJE A;  2KOO A;  1T8K A;  2MY5 A;  2N50 A;  2KOS A;  2ROQ A;  2FVA A;  2KWL A;  2JU1 A;  2N5H A;  2XZ0 D;  3LMO A;  2LTE A;  2GDY A;  2JU2 A;  4MRT C;  1HQB A;  2DNW A;  2LOL A;  2K2Q A;  2AFE A;  2K0X A;  2L0Q A;  2JGP A;  2CQ8 A;  2EHT A;  2LML A;  2PNG A;  1DNY A;  2CG5 B;  4PXH B;  2K0Y A;  3GZL A;  1L0I A;  5KP6 B;  2FQ2 A;  2FVE A;  4CA3 A;  4R0M A;  2L22 A;  4BPF A;  2KW2 A;  2X2B A;  4H2W C;  2FAD A;  2CNR A;  2KOP A;  2KOQ A;  2KGD A;  2LIU A;  2GDW A;  2GDX A;  2MF4 A;  3RG2 A;  2KG9 A;  2KG8 A;  1DV5 A;  2KGA A;  1HY8 A;  1ACP A;  3CE7 A;  5CZD B;  2KG6 A;  2LL8 A;  3EJD A;  1OR5 A;  1X3O A;  2AVA A;  2FVF A;  2FQ0 A;  4DG9 A;  2KGE A;  5HVC A;  2FQ1 A;  2N6Z A;  2M5R A;  4PWV B;  4IZ6 A;  2FAE A;  1KLP A;  2N5I A;  2LIW A;  2CGQ A;  4HKG A;  3GZM A;  2MR7 A;  2FHS C;  2AFD A;  2N6Y A;  2N98 A;  5EJD A;  2MVV A;  2K94 A;  2KOR A;  4H2Y C;  2KGC A;  2L9F A;  2XZ1 C;  3EJB A;  1AF8 A;  2FAC A; 
#chains in the Genus database with same CATH topology
 1K73 Q;  1EIA A;  2MR8 A;  3LRY A;  3Q20 A;  1Q81 Q;  2EIA A;  1F80 D;  2EFJ A;  1MZ8 A;  1VKU A;  2VLO A;  2L4B A;  4H2X C;  5HV8 A;  4PH0 A;  2LPK A;  1YJN P;  1JJ2 O;  3P05 A;  1VQ4 P;  1VQ7 P;  2FVA A;  3LMO A;  2LTE A;  2LOL A;  3WBH A;  4COP A;  1UNK A;  2L0Q A;  2LML A;  1DNY A;  2XT1 A;  1M1K Q;  2FVE A;  2KW2 A;  3CCR P;  2PEN A;  1VQ6 P;  3DS1 A;  3U43 A;  3CCQ P;  2VLN A;  2M8L A;  2VLP A;  3RG2 A;  2JBG A;  3DTJ A;  1GXG A;  1HY8 A;  3G1I A;  1ACP A;  3CCE P;  3CE7 A;  5CZD B;  3CC2 P;  2LL8 A;  4F37 A;  3EJD A;  3VRL C;  1X3O A;  1Z6M A;  2FQ0 A;  2GYK A;  2KGE A;  2QEX P;  1VQO P;  2N6Z A;  2M5R A;  4UHP B;  2FAE A;  3I56 P;  3DS0 A;  2K0D X;  3CPW O;  2OTJ P;  1UJZ A;  2VLQ A;  5F2O A;  2M8N A;  2Z45 A;  2N98 A;  1N8R Q;  4XFZ A;  2XZ1 C;  2JB0 A;  3EJB A;  2VSQ A;  2MVU A;  1KD1 Q;  1A8O A;  1M74 A;  1A43 A;  3E2D A;  1YHQ P;  2PEO A;  1L0H A;  3DS3 A;  3G0V A;  3I55 P;  4WYM A;  3CXC O;  1VQL P;  2JQ4 A;  1KQS O;  3GKL C;  3CCU P;  1YJ9 P;  2WPT A;  2EHS A;  3G4S P;  1K9M Q;  3NY7 B;  3EJE A;  1IUQ A;  2N50 A;  5HGL A;  2ROQ A;  2KWL A;  5F2N A;  3G26 A;  5DCK A;  2GDY A;  4QNB A;  3H4E A;  2JU2 A;  4U0F A;  2K2Q A;  3MGE A;  2K0X A;  2PEI A;  2JGP A;  1Q7Y Q;  2CG5 B;  1YJW P;  2FQ2 A;  2L22 A;  4M0I A;  1W2B O;  2X2B A;  2FAD A;  3DS2 A;  2GDX A;  1Q86 Q;  1VQK P;  2PEQ A;  2KG9 A;  2KG8 A;  3G28 A;  4DG9 A;  5HVC A;  2K5X A;  4U0B A;  1IMQ A;  1KLP A;  2CGQ A;  4HKG A;  2FHS C;  2AFD A;  1BXI A;  2N6Y A;  4H2Y C;  2KGC A;  3H47 A;  2BHV A;  2E1M A;  2EG5 A;  2FAC A;  2QNW A;  3HYB A;  4BPH A;  4BPG A;  2PY8 A;  1VHN A;  4NEO A;  2K93 A;  2ERH A;  5HGM A;  3M1M A;  1ZMB A;  2PEJ A;  5KP7 B;  5KP8 B;  1K30 A;  2AF8 A;  1YI2 P;  2KR5 A;  2K92 A;  2LKI A;  2P9X A;  5BS2 A;  3CC4 P;  1VQ9 P;  3CD6 P;  1T8K A;  4U0C A;  2KOS A;  1EOQ A;  2QA4 P;  2GZG A;  2N5H A;  2XZ0 D;  1VQM P;  2M8P A;  4XFX A;  1AYI A;  2DNW A;  4GR2 A;  5F2K A;  2GZJ A;  7CEI A;  4COC A;  2PNG A;  2EHT A;  4PXH B;  3GJN A;  3CCL P;  3G21 A;  4CA3 A;  2GZE A;  5BS1 A;  2JYG A;  4BPF A;  2Z44 A;  4H2W C;  2CNR A;  1CEI A;  2KOQ A;  2KGD A;  2LIU A;  2GDW A;  4IPY A;  3DS4 A;  3G6E P;  2KG6 A;  1Q82 Q;  2ONT A;  1GXH A;  1OR5 A;  2LF4 A;  3G71 P;  2FVF A;  4PH1 A;  5EW5 E;  1RO0 A;  2FQ1 A;  2LIW A;  1YIJ P;  1VQN P;  3H0D A;  3GZM A;  1RNI A;  4XRQ A;  4QKO A;  5EJD A;  2OTL P;  2K94 A;  2KOR A;  3OW2 O;  5I4T G;  1AF8 A;  3CCV P;  2XXM A;  2MD9 A;  1QRJ A;  2GZF A;  1VQ5 P;  5HGO A;  1K8A Q;  3DPH A;  2GZI A;  2JYL A;  2KOD A;  5JPA A;  2PEM A;  1M90 Q;  1IMP A;  4XRO A;  3CC7 P;  1YIT P;  1E0H A;  1NQ4 A;  3CME P;  4GR6 A;  3G29 A;  2Z46 A;  2KOO A;  3NTE A;  2MY5 A;  2JU1 A;  2OAR A;  1AUM A;  1VQP P;  3B4Q A;  4MRT C;  1HQB A;  2NO8 A;  1M6E X;  1RO2 A;  3HZQ A;  2AFE A;  1ZNV A;  1GPJ A;  2CQ8 A;  4XFY A;  3RG6 C;  2K0Y A;  3GZL A;  1EMV A;  1L0I A;  5KP6 B;  4U0D A;  1M6N A;  1NJI Q;  4R0M A;  2KOP A;  1KC8 Q;  2JAZ A;  2MF4 A;  3CCJ P;  1DV5 A;  2JO0 A;  2KGA A;  1QVG O;  2XV6 A;  2AVA A;  1VQ8 P;  3CCS P;  2CWO A;  1S72 P;  1D1D A;  2L6E A;  2BUO A;  3B5I A;  4PWV B;  4IZ6 A;  1E6J P;  1QVF O;  2N5I A;  4U0E A;  2MR7 A;  3DS5 A;  2PEK A;  4U0A A;  1FR2 A;  3CMA P;  3G1G A;  2MVV A;  1BAJ A;  2L9F A;  3CCM P;  2DGY A;  5HGN A; 
#chains in the Genus database with same CATH homology
 2VSQ A;  2MD9 A;  2MR8 A;  2MVU A;  2QNW A;  4BPH A;  4BPG A;  4NEO A;  1F80 D;  2K93 A;  1VKU A;  1L0H A;  2L4B A;  4H2X C;  5KP7 B;  2JQ4 A;  5KP8 B;  2AF8 A;  2KR5 A;  1NQ4 A;  5HV8 A;  2K92 A;  2LKI A;  2EHS A;  2LPK A;  3NY7 B;  3EJE A;  2KOO A;  1T8K A;  2MY5 A;  2N50 A;  2KOS A;  2ROQ A;  2FVA A;  2KWL A;  2JU1 A;  2N5H A;  2XZ0 D;  3LMO A;  2LTE A;  2GDY A;  2JU2 A;  4MRT C;  1HQB A;  2DNW A;  2LOL A;  2K2Q A;  2AFE A;  2K0X A;  2L0Q A;  2JGP A;  2CQ8 A;  2EHT A;  2LML A;  2PNG A;  1DNY A;  2CG5 B;  4PXH B;  2K0Y A;  3GZL A;  1L0I A;  5KP6 B;  2FQ2 A;  2FVE A;  4CA3 A;  4R0M A;  2L22 A;  4BPF A;  2KW2 A;  2X2B A;  4H2W C;  2FAD A;  2CNR A;  2KOP A;  2KOQ A;  2KGD A;  2LIU A;  2GDW A;  2GDX A;  2MF4 A;  3RG2 A;  2KG9 A;  2KG8 A;  1DV5 A;  2KGA A;  1HY8 A;  1ACP A;  3CE7 A;  5CZD B;  2KG6 A;  2LL8 A;  3EJD A;  1OR5 A;  1X3O A;  2AVA A;  2FVF A;  2FQ0 A;  4DG9 A;  2KGE A;  5HVC A;  2FQ1 A;  2N6Z A;  2M5R A;  4PWV B;  4IZ6 A;  2FAE A;  1KLP A;  2N5I A;  2LIW A;  2CGQ A;  4HKG A;  3GZM A;  2MR7 A;  2FHS C;  2AFD A;  2N6Y A;  2N98 A;  5EJD A;  2MVV A;  2K94 A;  2KOR A;  4H2Y C;  2KGC A;  2L9F A;  2XZ1 C;  3EJB A;  1AF8 A;  2FAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...