1T8KA

Crystal structure of apo acyl carrier protein from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
b'STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structure of apo acyl carrier protein and a proposal to engineer protein crystallization through metal ions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2004-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1t8kA00
2VSQA 2LKIA 2MF4A 2ROQA 2FADA 2N5HA 2GDXA 2X2BA 3EJEA 2KR5A 2XZ1C 2KOOA 2FVFA 2FVAA 1ACPA 2FQ1A 2FACA 2JGPA 2KG6A 2AF8A 2KW2A 3LMOA 2L0QA 4R0MA 3CE7A 4PXHB 2CQ8A 2KG8A 1X3OA 1NQ4A 5KP7B 1KLPA 2KWLA 1VKUA 5KP6B 2FQ2A 3RG2A 2EHTA 2FQ0A 2CGQA 2MR7A 2AVAA 2LTEA 2KGEA 2AFDA 1HY8A 2KGAA 2KOQA 2GDYA 2K94A 2N6YA 2KGCA 2L4BA 4DG9A 2GDWA 2L9FA 2KOSA 2LIWA 2AFEA 5CZDB 5KP8B 2CG5B 2JU1A 4NEOA 4CA3A 2LL8A 1AF8A 2MY5A 2L22A 1OR5A 2KOPA 4H2WC 1L0IA 5EJDA 1F80D 4HKGA 2KG9A 3EJBA 2MVUA 2N6ZA 2N98A 2FAEA 1L0HA 2N5IA 2M5RA 2LOLA 2MD9A 2QNWA 2XZ0D 4BPHA 1DV5A 2KORA 2LMLA 2PNGA 1DNYA 2KGDA 2K93A 2JU2A 4IZ6A 1HQBA 2K2QA 3EJDA 2FVEA 2K0YA 2DNWA 2K92A 5HVCA 2CNRA 4BPGA 3GZLA 1T8KA 2LPKA 2K0XA 2MVVA 3NY7B 2MR8A 3GZMA 4PWVB 4H2YC 4BPFA 2LIUA 4MRTC 2JQ4A 2EHSA 5HV8A 2FHSC 2N50A 4H2XC
chains in the Genus database with same CATH superfamily
1JJ2O 1YJWP 2ROQA 1N8RQ 2OARA 1ZNVA 2N5HA 4U0AA 3EJEA 1K30A 4COCA 3CCLP 2PEKA 5HGLA 1A43A 4XFZA 2FVAA 2OTLP 2AF8A 1MZ8A 3LMOA 2K5XA 2CQ8A 2PEIA 2JYLA 3CC7P 5DCKA 1EIAA 3G21A 2M8LA 1KLPA 4U0EA 2KWLA 1A8OA 1VQ9P 2FQ2A 1E6JP 2MR7A 2AFDA 1K8AQ 3CC4P 1VQNP 4QKOA 3DS4A 4F37A 2KGCA 2L9FA 3CCUP 2EIAA 5HGNA 5CZDB 3CXCO 2CG5B 4CA3A 4U0DA 3G71P 3NTEA 1VQ4P 4XFXA 2M8NA 2KG9A 2NO8A 2VLQA 2GZFA 1UJZA 4U0FA 2LF4A 4XROA 2M5RA 1AYIA 3G6EP 2BHVA 4BPHA 2KORA 4PH0A 1Q82Q 2KGDA 2PEJA 2K2QA 2FVEA 3G0VA 2PENA 4XFYA 2K0YA 1VQ5P 2K92A 1M90Q 2CNRA 2CWOA 3DS2A 2LPKA 1VQLP 2MVVA 3GZMA 4H2YC 4MRTC 2JQ4A 2EHSA 2PEQA 3GKLC 2JO0A 4UHPB 2M8PA 2LKIA 2VLPA 5BS2A 2FADA 2GDXA 3CCRP 3G28A 2X2BA 2XZ1C 2FQ1A 2FACA 2JGPA 3E2DA 3CCSP 1IUQA 2L0QA 2QA4P 4PXHB 5HGOA 2BUOA 3OW2O 5I4TG 1YITP 1EMVA 4GR6A 5KP7B 5KP6B 2EFJA 2AVAA 1RO2A 2LTEA 2KGEA 1HY8A 7CEIA 3DS1A 1UNKA 2L6EA 2K94A 2N6YA 3CD6P 2PEOA 3G26A 3G1GA 5HGMA 2L4BA 4XRQA 3H4EA 5KP8B 2XXMA 3CCQP 1AF8A 2MY5A 1K9MQ 1OR5A 2KOPA 4U0BA 5EJDA 1F80D 3WBHA 2Z44A 3Q20A 1Q86Q 2PEMA 1VQ6P 4M0IA 2N5IA 2QNWA 1VQPP 2GZGA 2K93A 5EW5E 2ONTA 1YI2P 4QNBA 5HVCA 4BPGA 2GYKA 3GZLA 1M1KQ 3B4QA 3DS5A 3CPWO 1S72P 3CMAP 2MF4A 2KR5A 5BS1A 2KOOA 2KG6A 1CEIA 2JB0A 2KW2A 3DS0A 2KG8A 5F2KA 1NQ4A 3G4SP 1RO0A 1ZMBA 2P9XA 2VLNA 1QVFO 3CC2P 2JBGA 1BXIA 1VHNA 3LRYA 2FQ0A 1YJNP 2CGQA 1KQSO 1VQKP 3P05A 2Z46A 2GDYA 1VQ7P 3G29A 3B5IA 1VQOP 4DG9A 3RG6C 3DTJA 3U43A 2KOSA 3I55P 1W2BO 2AFEA 2JYGA 2JU1A 4NEOA 2LL8A 2L22A 3CCVP 4H2WC 1YIJP 1KC8Q 2DGYA 1YHQP 3EJBA 1GXHA 2FAEA 1NJIQ 2LOLA 3CCEP 2XZ0D 3VRLC 1DV5A 4COPA 3CCJP 2JU2A 1QRJA 1HQBA 5F2OA 1T8KA 3NY7B 4BPFA 4PWVB 2ERHA 5HV8A 2GZIA 4PH1A 2VSQA 3MGEA 1KD1Q 3HZQA 2EG5A 3H47A 1M74A 3CCMP 1RNIA 3M1MA 5F2NA 2FVFA 1ACPA 3HYBA 1K73Q 1M6NA 2GZEA 4R0MA 3CE7A 2VLOA 1X3OA 3GJNA 1FR2A 4WYMA 1VKUA 4GR2A 3RG2A 2EHTA 1AUMA 2JAZA 3I56P 4IPYA 2KGAA 2KOQA 1M6EX 1GXGA 1VQ8P 2GDWA 1QVGO 2XT1A 2LIWA 2KODA 2K0DX 1YJ9P 2WPTA 3CMEP 1IMQA 1EOQA 1L0IA 1Z6MA 4HKGA 2MVUA 2N6ZA 2N98A 3G1IA 1L0HA 2OTJP 1VQMP 2E1MA 3DPHA 1Q81Q 2MD9A 3H0DA 2PY8A 2LMLA 2PNGA 1IMPA 1GPJA 1D1DA 5JPAA 2XV6A 1DNYA 2Z45A 4IZ6A 3EJDA 3DS3A 2DNWA 1E0HA 2K0XA 2GZJA 2MR8A 2QEXP 2LIUA 1BAJA 2FHSC 2N50A 4H2XC 4U0CA 1Q7YQ
chains in the Genus database with same CATH topology
2VSQA 2LKIA 2MF4A 2ROQA 2FADA 2N5HA 2GDXA 2X2BA 3EJEA 2KR5A 2XZ1C 2KOOA 2FVFA 2FVAA 1ACPA 2FQ1A 2FACA 2JGPA 2KG6A 2AF8A 2KW2A 3LMOA 2L0QA 4R0MA 3CE7A 4PXHB 2CQ8A 2KG8A 1X3OA 1NQ4A 5KP7B 1KLPA 2KWLA 1VKUA 5KP6B 2FQ2A 3RG2A 2EHTA 2FQ0A 2CGQA 2MR7A 2AVAA 2LTEA 2KGEA 2AFDA 1HY8A 2KGAA 2KOQA 2GDYA 2K94A 2N6YA 2KGCA 2L4BA 4DG9A 2GDWA 2L9FA 2KOSA 2LIWA 2AFEA 5CZDB 5KP8B 2CG5B 2JU1A 4NEOA 4CA3A 2LL8A 1AF8A 2MY5A 2L22A 1OR5A 2KOPA 4H2WC 1L0IA 5EJDA 1F80D 4HKGA 2KG9A 3EJBA 2MVUA 2N6ZA 2N98A 2FAEA 1L0HA 2N5IA 2M5RA 2LOLA 2MD9A 2QNWA 2XZ0D 4BPHA 1DV5A 2KORA 2LMLA 2PNGA 1DNYA 2KGDA 2K93A 2JU2A 4IZ6A 1HQBA 2K2QA 3EJDA 2FVEA 2K0YA 2DNWA 2K92A 5HVCA 2CNRA 4BPGA 3GZLA 1T8KA 2LPKA 2K0XA 2MVVA 3NY7B 2MR8A 3GZMA 4PWVB 4H2YC 4BPFA 2LIUA 4MRTC 2JQ4A 2EHSA 5HV8A 2FHSC 2N50A 4H2XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSQ A;  2LKI A;  2MF4 A;  2ROQ A;  2FAD A;  2N5H A;  2GDX A;  2X2B A;  3EJE A;  2KR5 A;  2XZ1 C;  2KOO A;  2FVF A;  2FVA A;  1ACP A;  2FQ1 A;  2FAC A;  2JGP A;  2KG6 A;  2AF8 A;  2KW2 A;  3LMO A;  2L0Q A;  4R0M A;  3CE7 A;  4PXH B;  2CQ8 A;  2KG8 A;  1X3O A;  1NQ4 A;  5KP7 B;  1KLP A;  2KWL A;  1VKU A;  5KP6 B;  2FQ2 A;  3RG2 A;  2EHT A;  2FQ0 A;  2CGQ A;  2MR7 A;  2AVA A;  2LTE A;  2KGE A;  2AFD A;  1HY8 A;  2KGA A;  2KOQ A;  2GDY A;  2K94 A;  2N6Y A;  2KGC A;  2L4B A;  4DG9 A;  2GDW A;  2L9F A;  2KOS A;  2LIW A;  2AFE A;  5CZD B;  5KP8 B;  2CG5 B;  2JU1 A;  4NEO A;  4CA3 A;  2LL8 A;  1AF8 A;  2MY5 A;  2L22 A;  1OR5 A;  2KOP A;  4H2W C;  1L0I A;  5EJD A;  1F80 D;  4HKG A;  2KG9 A;  3EJB A;  2MVU A;  2N6Z A;  2N98 A;  2FAE A;  1L0H A;  2N5I A;  2M5R A;  2LOL A;  2MD9 A;  2QNW A;  2XZ0 D;  4BPH A;  1DV5 A;  2KOR A;  2LML A;  2PNG A;  1DNY A;  2KGD A;  2K93 A;  2JU2 A;  4IZ6 A;  1HQB A;  2K2Q A;  3EJD A;  2FVE A;  2K0Y A;  2DNW A;  2K92 A;  5HVC A;  2CNR A;  4BPG A;  3GZL A;  1T8K A;  2LPK A;  2K0X A;  2MVV A;  3NY7 B;  2MR8 A;  3GZM A;  4PWV B;  4H2Y C;  4BPF A;  2LIU A;  4MRT C;  2JQ4 A;  2EHS A;  5HV8 A;  2FHS C;  2N50 A;  4H2X C; 
#chains in the Genus database with same CATH topology
 1JJ2 O;  1YJW P;  2ROQ A;  1N8R Q;  2OAR A;  1ZNV A;  2N5H A;  4U0A A;  3EJE A;  1K30 A;  4COC A;  3CCL P;  2PEK A;  5HGL A;  1A43 A;  4XFZ A;  2FVA A;  2OTL P;  2AF8 A;  1MZ8 A;  3LMO A;  2K5X A;  2CQ8 A;  2PEI A;  2JYL A;  3CC7 P;  5DCK A;  1EIA A;  3G21 A;  2M8L A;  1KLP A;  4U0E A;  2KWL A;  1A8O A;  1VQ9 P;  2FQ2 A;  1E6J P;  2MR7 A;  2AFD A;  1K8A Q;  3CC4 P;  1VQN P;  4QKO A;  3DS4 A;  4F37 A;  2KGC A;  2L9F A;  3CCU P;  2EIA A;  5HGN A;  5CZD B;  3CXC O;  2CG5 B;  4CA3 A;  4U0D A;  3G71 P;  3NTE A;  1VQ4 P;  4XFX A;  2M8N A;  2KG9 A;  2NO8 A;  2VLQ A;  2GZF A;  1UJZ A;  4U0F A;  2LF4 A;  4XRO A;  2M5R A;  1AYI A;  3G6E P;  2BHV A;  4BPH A;  2KOR A;  4PH0 A;  1Q82 Q;  2KGD A;  2PEJ A;  2K2Q A;  2FVE A;  3G0V A;  2PEN A;  4XFY A;  2K0Y A;  1VQ5 P;  2K92 A;  1M90 Q;  2CNR A;  2CWO A;  3DS2 A;  2LPK A;  1VQL P;  2MVV A;  3GZM A;  4H2Y C;  4MRT C;  2JQ4 A;  2EHS A;  2PEQ A;  3GKL C;  2JO0 A;  4UHP B;  2M8P A;  2LKI A;  2VLP A;  5BS2 A;  2FAD A;  2GDX A;  3CCR P;  3G28 A;  2X2B A;  2XZ1 C;  2FQ1 A;  2FAC A;  2JGP A;  3E2D A;  3CCS P;  1IUQ A;  2L0Q A;  2QA4 P;  4PXH B;  5HGO A;  2BUO A;  3OW2 O;  5I4T G;  1YIT P;  1EMV A;  4GR6 A;  5KP7 B;  5KP6 B;  2EFJ A;  2AVA A;  1RO2 A;  2LTE A;  2KGE A;  1HY8 A;  7CEI A;  3DS1 A;  1UNK A;  2L6E A;  2K94 A;  2N6Y A;  3CD6 P;  2PEO A;  3G26 A;  3G1G A;  5HGM A;  2L4B A;  4XRQ A;  3H4E A;  5KP8 B;  2XXM A;  3CCQ P;  1AF8 A;  2MY5 A;  1K9M Q;  1OR5 A;  2KOP A;  4U0B A;  5EJD A;  1F80 D;  3WBH A;  2Z44 A;  3Q20 A;  1Q86 Q;  2PEM A;  1VQ6 P;  4M0I A;  2N5I A;  2QNW A;  1VQP P;  2GZG A;  2K93 A;  5EW5 E;  2ONT A;  1YI2 P;  4QNB A;  5HVC A;  4BPG A;  2GYK A;  3GZL A;  1M1K Q;  3B4Q A;  3DS5 A;  3CPW O;  1S72 P;  3CMA P;  2MF4 A;  2KR5 A;  5BS1 A;  2KOO A;  2KG6 A;  1CEI A;  2JB0 A;  2KW2 A;  3DS0 A;  2KG8 A;  5F2K A;  1NQ4 A;  3G4S P;  1RO0 A;  1ZMB A;  2P9X A;  2VLN A;  1QVF O;  3CC2 P;  2JBG A;  1BXI A;  1VHN A;  3LRY A;  2FQ0 A;  1YJN P;  2CGQ A;  1KQS O;  1VQK P;  3P05 A;  2Z46 A;  2GDY A;  1VQ7 P;  3G29 A;  3B5I A;  1VQO P;  4DG9 A;  3RG6 C;  3DTJ A;  3U43 A;  2KOS A;  3I55 P;  1W2B O;  2AFE A;  2JYG A;  2JU1 A;  4NEO A;  2LL8 A;  2L22 A;  3CCV P;  4H2W C;  1YIJ P;  1KC8 Q;  2DGY A;  1YHQ P;  3EJB A;  1GXH A;  2FAE A;  1NJI Q;  2LOL A;  3CCE P;  2XZ0 D;  3VRL C;  1DV5 A;  4COP A;  3CCJ P;  2JU2 A;  1QRJ A;  1HQB A;  5F2O A;  1T8K A;  3NY7 B;  4BPF A;  4PWV B;  2ERH A;  5HV8 A;  2GZI A;  4PH1 A;  2VSQ A;  3MGE A;  1KD1 Q;  3HZQ A;  2EG5 A;  3H47 A;  1M74 A;  3CCM P;  1RNI A;  3M1M A;  5F2N A;  2FVF A;  1ACP A;  3HYB A;  1K73 Q;  1M6N A;  2GZE A;  4R0M A;  3CE7 A;  2VLO A;  1X3O A;  3GJN A;  1FR2 A;  4WYM A;  1VKU A;  4GR2 A;  3RG2 A;  2EHT A;  1AUM A;  2JAZ A;  3I56 P;  4IPY A;  2KGA A;  2KOQ A;  1M6E X;  1GXG A;  1VQ8 P;  2GDW A;  1QVG O;  2XT1 A;  2LIW A;  2KOD A;  2K0D X;  1YJ9 P;  2WPT A;  3CME P;  1IMQ A;  1EOQ A;  1L0I A;  1Z6M A;  4HKG A;  2MVU A;  2N6Z A;  2N98 A;  3G1I A;  1L0H A;  2OTJ P;  1VQM P;  2E1M A;  3DPH A;  1Q81 Q;  2MD9 A;  3H0D A;  2PY8 A;  2LML A;  2PNG A;  1IMP A;  1GPJ A;  1D1D A;  5JPA A;  2XV6 A;  1DNY A;  2Z45 A;  4IZ6 A;  3EJD A;  3DS3 A;  2DNW A;  1E0H A;  2K0X A;  2GZJ A;  2MR8 A;  2QEX P;  2LIU A;  1BAJ A;  2FHS C;  2N50 A;  4H2X C;  4U0C A;  1Q7Y Q; 
#chains in the Genus database with same CATH homology
 2VSQ A;  2LKI A;  2MF4 A;  2ROQ A;  2FAD A;  2N5H A;  2GDX A;  2X2B A;  3EJE A;  2KR5 A;  2XZ1 C;  2KOO A;  2FVF A;  2FVA A;  1ACP A;  2FQ1 A;  2FAC A;  2JGP A;  2KG6 A;  2AF8 A;  2KW2 A;  3LMO A;  2L0Q A;  4R0M A;  3CE7 A;  4PXH B;  2CQ8 A;  2KG8 A;  1X3O A;  1NQ4 A;  5KP7 B;  1KLP A;  2KWL A;  1VKU A;  5KP6 B;  2FQ2 A;  3RG2 A;  2EHT A;  2FQ0 A;  2CGQ A;  2MR7 A;  2AVA A;  2LTE A;  2KGE A;  2AFD A;  1HY8 A;  2KGA A;  2KOQ A;  2GDY A;  2K94 A;  2N6Y A;  2KGC A;  2L4B A;  4DG9 A;  2GDW A;  2L9F A;  2KOS A;  2LIW A;  2AFE A;  5CZD B;  5KP8 B;  2CG5 B;  2JU1 A;  4NEO A;  4CA3 A;  2LL8 A;  1AF8 A;  2MY5 A;  2L22 A;  1OR5 A;  2KOP A;  4H2W C;  1L0I A;  5EJD A;  1F80 D;  4HKG A;  2KG9 A;  3EJB A;  2MVU A;  2N6Z A;  2N98 A;  2FAE A;  1L0H A;  2N5I A;  2M5R A;  2LOL A;  2MD9 A;  2QNW A;  2XZ0 D;  4BPH A;  1DV5 A;  2KOR A;  2LML A;  2PNG A;  1DNY A;  2KGD A;  2K93 A;  2JU2 A;  4IZ6 A;  1HQB A;  2K2Q A;  3EJD A;  2FVE A;  2K0Y A;  2DNW A;  2K92 A;  5HVC A;  2CNR A;  4BPG A;  3GZL A;  1T8K A;  2LPK A;  2K0X A;  2MVV A;  3NY7 B;  2MR8 A;  3GZM A;  4PWV B;  4H2Y C;  4BPF A;  2LIU A;  4MRT C;  2JQ4 A;  2EHS A;  5HV8 A;  2FHS C;  2N50 A;  4H2X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...