1W2BO

Trigger factor ribosome binding domain in complex with 50s
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1w2bO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1w2bO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1w2bO03
1S72P 3CXCO 1KQSO 1K8AQ 1Q86Q 3CPWO 1YITP 1N8RQ 1QVFO 3G6EP 1M1KQ 1VQOP 3G71P 3CMAP 1YIJP 1Q7YQ 3CCUP 3CCVP 3I55P 3CCQP 1YI2P 1QVGO 3CCJP 3CCRP 2OTLP 1JJ2O 1VQ4P 1YJNP 1M90Q 1VQLP 3CCMP 1VQKP 1VQ8P 3I56P 1VQ9P 3CC2P 1Q82Q 2OTJP 1YHQP 3CCSP 3OW2O 3CC7P 1VQ5P 3CC4P 1VQ6P 1W2BO 1Q81Q 1YJWP 3CCEP 3G4SP 1KD1Q 1K9MQ 1NJIQ 2QEXP 3CD6P 1VQNP 1K73Q 1VQMP 1VQ7P 3CMEP 3CCLP 2QA4P 1VQPP 1YJ9P 1KC8Q
chains in the Genus database with same CATH superfamily
1NO4A 3NXSA 2JWDA 2FXPA 3KQGA 1S5LH 1LTIC 1AA0A 5L8RJ 3AEGC 4KT0J 3SFEC 1JY2N 3VN0A 3RK2B 2YMYA 3E1RA 2V7QJ 2ZT9B 1E5WA 1DNYA 3G28A 1PL5A 1AJYA 3A0BH 4D6TE 2W6JH 5B66E 1SQPK 5C39A 1IFJA 3LW5H 1RQVA 2FBWC 4DCKA 2E42A 2O01N 1NTKG 5AVSB 1MFTA 1DD4A 1URQC 3CWBJ 2CQ8A 2JO0A 1VF5C 3CCJP 2FQ0A 3PTZA 4MRTC 2JQ4A 4IL6X 1LJ2A 5APYA 1BCCG 4BRYB 1IUQA 5KAIH 3H0DA 3MD0A 3FXEA 2N5IA 2LR2A 1KV4A 2HG5D 2AXTE 3L72D 1G1JA 2V7QH 3F89A 2ZJSE 2VRSA 5DJTB 1KMIZ 2WPRA 5KAFE 3L73D 1G2CB 1EDLA 4U0EA 3L72E 2EHSA 4WY4A 2WSFH 3L75D 3PH0A 2XNXA 2KZIA 3L73E 5DCKA 1OZHA 2WMMA 2I1KA 1FZCB 3GLMA 2KGCA 3CCEP 1NAYA 2HPCA 2O01J 1E6JP 2CK3H 1BXIA 1KQSO 4D6TG 1GK4A 4KJMA 4R0MA 5AW8B 2XT1A 3AEDC 2K1AA 3DS2A 3ZDMA 3K5BA 1PP9J 3RBXA 1AUMA 1FDOA 1WT6A 5TISH 1MZ9A 4EIJA 2Q5UA 2M0BA 5BS1A 2NPSC 2VLQA 1SQXG 4UB8E 3L36A 1KORA 3WU2H 2V4HA 2RMZA 2OYOA 3L70D 1M6NA 4CPGA 1JJ2O 3RL0C 2Z46A 5E79E 3P32A 2OTJP 1JY2O 1Y8AA 1J2JB 2NZ2A 1WMKA 4WYMA 1AFOA 3P7KA 2Z4EA 2B9BA 2FKWB 3GHGA 2KNCA 4GOEA 1P84I 3TGUD 2PFXA 4EOTA 3V2NA 5HV8A 3HTKA 3RGUA 2RN0A 3VP8A 3DPHA 1J1EC 3A0HH 1EDJA 3H1HG 2YMKA 1ZR2A 2JAZA 1SQBD 4PJ0E 2FYUG 1EMVA 3BRVB 1OXZA 1VQPP 4Y28J 1BE3D 3P05A 1PGOA 3FWLA 3GG2A 2C0XA 5KJ7C 5TJHA 1SQBE 4WY4B 1PGJA 2BEQD 4C7NA 1KLPA 1KB9H 1PV3A 4IFMA 2ROQA 2P58A 3HD7A 2XKMA 3B5IA 5KKZC 2N50A 1VHNA 1K73Q 2WPQA 4U3FD 1OMIA 2KZJA 1S9KD 2XNDH 2HPCB 1N7SA 2GDWA 1JOCA 2JU2A 3WUVA 3KZIH 1T2KC 2NO8A 1S9KE 1FDIA 5BU8B 3I56P 3L71E 4W7YA 3HZQA 2XZRA 3IN6A 3RK3D 1H88A 1OVRA 1BGYD 1OFCX 3HUSA 4XA4A 4GDOA 1ZRTD 1UIIA 3E2DA 2KOOA 3L72J 1N73C 5I4TG 2N5HA 1NOHA 3M1MA 1MFZA 1ZRTE 2KR5A 3L73J 3V2RA 4GR6A 1IFDA 2LF4A 4GR2A 2PP6A 3OW2O 1FC2C 2B88A 1CI6A 3R2PA 4YXDC 3AE7C 4HYTB 2GM4A 3GHGB 5AW5B 2KNCB 4I2LC 1NU1E 4BWNA 1R5SA 1CW5A 2P9XA 2N1TC 2M3BA 5F2KA 1L0LD 2K2QA 3JC22 3N4XA 2Q7CA 3HTKB 1MV8A 4XRQA 1D7MA 1SQVE 1U57A 1KYOI 1VQMP 1AQTA 3D6YA 3G6EP 3KXDA 4H13C 4N3YB 4I6MC 3AE8C 2GYKA 4HKGA 4C7NB 1OR5A 4I1LA 3AE2C 2AEJA 3LIDA 3HD7B 2OYIC 4U0DA 3H1KE 5KLVG 4YPCA 1RO0A 1SQQK 1N7SB 2XU6A 3FGAD 2FHSC 1Q82Q 4IFFA 1M74A 1KILA 4U0CA 1X9VA 3HUSB 3Q5SA 4XFYA 5CZDB 2ZAEB 1FJPA 1OW7A 4N78D 1S5LE 1ACPA 2H43A 1SQBJ 1NU1G 2BEZF 1DX7A 5E79H 5CBNA 1KQGB 1JB0J 3A0BE 4I7ZB 3CX5H 1SQVG 5CJ4A 1U7MA 3B5ND 1CI6B 4NEOA 2JBGA 1XTGB 1SFCD 2J59M 2GZGA 3WUUA 3EQ2A 1EZVD 1IK9A 2J5UA 3L71J 3CCSP 4PD4I 3MUDC 5KAIE 1ZNVA 1S5LX 2QNWA 2P67A 3U59A 4ZMDA 3QWOC 4H0LB 1NTMG 2BQ1E 2YXQB 3V4WA 2PEIA 3H1KG 2I1JA 5CJ0A 1M90Q 2HR3A 2ZXXA 4UB6E 3P8CD 1PFIA 1JY3N 1GPJA 2YO2A 1RO2A 2FY8A 1SP4A 4AYCA 5F2NA 1VL2A 2E75B 3P8CE 2NRGA 3VP9A 1HH0A 1NU1J 1PGPA 2AVAA 2FQ1A 1HGZA 2FVEA 3L74D 1ZOYC 1R8EA 2A45G 2E74D 1PGQA 2QE7H 1SQVJ 1X79B 1AYIA 3GKLC 1E79H 1AV1A 1KILE 3L74E 1BDCA 1K8AQ 1EDKA 1KILB 1OVUA 1L0HA 3MGEA 2VLNA 2PY8A 1IFPA 3G9RA 2M3EA 1URQA 2GZFA 4HJGH 5CCHC 2XV5A 2FAEA 1S72P 3AECC 3H1KJ 2KXPB 5KLIC 2YIUB 3Q3DA 3PLNA 1FOSF 1AF8A 2Q3IA 2FFDC 2LIUA 5M1BA 1JMMA 2C9NY 1NTKD 2R44A 2ZYGA 1IJDB 3NFQA 1L0LK 1N2DC 2E76C 1PPJE 3CPWO 2FYZA 4OWFA 1BCCD 1NTKE 2ZVNB 2POHA 4L75A 3U43A 1T3UA 1GL2C 3A0HE 1BCCE 1L4AD 3EWKA 3N7NA 4L73A 2P10A 2GZEA 4UHPB 4PV1C 1L0NG 4PH1A 5B5EH 3I5CA 1KB9D 2FYNC 3V6IA 2K88A 1YYCA 2K0DX 3I55P 1LTAC 2OTLP 1FDMA 3IAOA 3B71A 1EQ7A 3AE9C 1USDA 2LOLA 4R4LA 2ONTA 4EYYQ 3RK2D 2YNYA 2ZT9D 5KP6B 4HB1A 4DOJA 2NPSA 3KZIE 3G0VA 1RHZB 4D6TD 1Y9BA 1A02J 2H88C 2A45H 5CCGC 1X8YA 3VMAA 4H44C 2Y0CA 1T8KA 1URQB 1VF5B 1LT9C 2WSFJ 2L9FA 2MF4A 1PPJG 3KDPB 2JP3A 2QM8A 1SQXD 1LTGC 4ZKUA 1YTZI 1RF1C 2KUBA 1YHQP 3QH9A 4AQRD 1PEMA 1SQXE 2R5BA 3S1KA 3UIAA 4BXLA 3L74J 1CEIA 3CXCO 5CBOA 3V5BA 2JYGA 2AFDA 2X2BA 3AE3C 5APUA 1NAFA 4XFXA 3R4YA 3II6A 2W27A 2KODA 4UB6H 5KJ7A 2WVRA 1RE3C 3L4FA 1HGVA 5AW7B 1GXGA 1EIAA 3CXHE 3H1HD 5DJUB 2FYUD 2XXMA 3CCVP 1FAVA 2EHTA 4N6JA 3MIWA 3S9OA 2LL8A 3H1HE 2YKPA 2M8PA 2FYUE 3GZMA 3V4QA 2XV6A 1NTKJ 3H1JG 1S1CX 1ZN5A 1FZEA 3TDKA 3RG2A 1DH3A 3E1IA 4OGQC 3CCUP 2GUSA 2GDXA 2GDYA 1N73A 2Z5HA 1T3JA 2NPSB 1NTZG 1BCCJ 2KWLA 1MZ8A 4W80A 2KLVA 4DZOA 1VQ7P 3B4QA 1PEUA 3M0DC 4WB4A 2I8DA 2QSIA 3RL0B 1Q90D 1HF9A 4C46A 1Q7YQ 2LMLA 3CX5D 3WMM0 2UWJE 1VQKP 1KB9I 4JBZA 2N98A 3M0AA 2N1TA 3FXDA 3CX5E 2CG5B 1JCDA 1Q86Q 5H2FH 4ZNCA 1NTKK 2KG8A 1PEQA 1J1EB 3RG6C 1VDFA 2IBZI 5EFWB 2M8NA 1GU4A 1SS1A 4EI2A 2XDJA 1UNKA 2AEFA 2O1KA 4WY4D 2FQ2A 3AEAC 1EXIA 5HGMA 4D6TJ 3VMZA 3AEEC 2OYIA 1A02F 5KKZB 2QJYC 3GF7A 2PEQA 4LLHA 1GU5A 3NMDA 1SQXJ 4IOIH 5AW3B 4DJGA 4NPFX 3SSUA 1NWQA 4IFDK 3L71D 1M1JC 1SQQG 2E5TA 3Q5RA 5KLVD 1N73B 5CMZA 4OH8B 3W68A 3CCLP 5KLVE 7CEIA 3ITKA 1SLQA 1FZFA 2LXBA 1H8AA 3Q1MA 1RH5B 3AE6C 2DW3A 3VMXA 3H1HJ 1IZNB 2FACA 2BUOA 1VQ6P 1FZAA 2FYUJ 2Y9ZA 1NU1D 3L70G 5AW2B 2K5XA 2IDBA 3CI9A 4TLFA 1LT1A 4U7JA 1HY8A 2N1TB 3H1IG 3VOPA 3MUDA 3CMAP 3DS1A 1SQVD 1LGHB 5BU5A 3RK3C 4QKOA 3TNUA 3CC4P 1SVFA 1Q81Q 1M7LA 2A06G 4RESB 2JO1A 3G3ZA 2KB7P 2QVAA 4H13B 2VLOA 3LIEA 1AVYA 3DS3A 2WPTA 3CXHH 2P1JA 1GZLA 3HD7D 2W83C 3BCCG 4U0BA 5JPAA 1BE3G 1IMPA 1NTMD 2QJKC 3FWNA 1NVOA 2OYIB 2HODA 3H1KD 5CHXA 3JCUE 2K92A 1N7SD 1FR2A 1JUNA 4DT0A 2ZVOB 2R3SA 5B5EE 3H4EA 1E0HA 4M3LA 3G21A 1JY2P 2XZ0D 1NTME 2QJPC 4HH2A 3SFDC 1FZBA 1R5LA 2Q3EA 1YIJP 3BRTB 4GOFA 1LWUC 3Q20A 3OAKA 3P8MC 2JDIH 5HGLA 1IK7A 3GMAA 4ZKPA 2QG4A 2AF8A 5CCHA 5AVTB 1HVVA 2CGQA 2K9YA 3M06A 2PEKA 3CCMP 3NTNA 2KOSA 3H1LG 1KYOH 1NJIQ 2PAJA 2FFDA 2OYHC 2KI7B 3GJNA 1EC5A 2K0XA 1JNMA 3W67A 2N9YB 1GK6A 5AVUB 3M9HA 4H0LD 2G8YA 1VQ9P 3IF4A 3MTUE 1FBMA 4JYCA 2KLUA 2Z45A 3VMYA 2JU1A 1LTSC 2QEXP 1GL2A 1SQPE 4GKGA 5KLVJ 2JWAA 3PJSK 1LNQA 2B87A 1SQBK 1DEBA 2E75D 1BSHA 5AW6B 2L22A 1JTHA 2HODB 3S4RA 1VQNP 1UIXA 5AW0B 2C0WA 3B5NC 1D1DA 1SFCC 1GW4A 2W8ZA 1NYHA 2R3CA 1L0ND 2LXCB 3NY7B 2EIAA 2H8PD 1RF0C 3SWFA 1DEEG 1KILD 2YKOA 2IFMA 3G1IA 1L0NE 1J1DC 1NGMB 3D70A 3USSA 1QGKB 2KGDA 3CL3D 3RBZA 2CPBA 5CCGA 2N6ZA 1HWTC 2PENA 4Y99C 1M1KQ 3C9IA 1U7JA 1LP1A 1LTJC 2LPKA 1LT9A 1HJ0A 1KQLA 4PD4H 1FZGA 4JF7A 2W6AA 2M8LA 5KLIB 1JMBA 1RF1A 1QVFO 2L91A 1FS0E 1NTMJ 3MZWB 2MY5A 1SQPG 5AVVB 2FFDB 2LIWA 5AVXB 3TK1A 2K94A 1NU1K 5BS2A 4PWVB 1QX8A 4RKUJ 2KW2A 1DV5A 2E74C 1PPJD 2E76B 4BPFA 2H89C 5AVZB 2L4BA 2WPVB 3OA7A 2BCCE 2D2CD 1SQVK 2QA4P 2PEMA 1OX3A 5H2FE 1RE3A 1GL2B 4IZ6A 2YXRB 2XZ1C 3SWKA 5EJDA 3H47A 2B87B 4PV1B 4COPA 2D2CB 2Q9IA 3SWYA 2FYNB 3JCUH 5AW1B 2B89A 1JTHB 3AEFC 1NKZB 2R5DA 1KTMA 4EDFA 2HYNA 1W2EA 1ZP0C 3CWBG 2E43A 4YXWH 2YKQA 2WPSA 3V2QA 1BAJA 4RJTA 1G2CA 1X0TA 1QRJA 3CMEP 1SQPJ 1EZVI 1IMQA 2KGEA 1UJZA 3TSIA 2MVUA 1URQD 3M0DA 3EJEA 1VF5D 2WSCH 4H44B 2N6YA 5KP7B 3H1JD 1LP1B 1L4AC 1LT9B 4IL6E 3O6QA 1NTZD 1YITP 4H2XC 3H1JE 3B4SA 2BCCG 2Z5IA 1P84E 1T8ZA 2IBZE 2KORA 1RF1B 1PEOA 1QVGO 1NKNA 1NTZE 3BASA 4Z1MH 5AVYB 5GTIH 2W90A 1KFMA 1L0NJ 3RK2C 2ZT9C 2L6EA 3V2PA 1OW8A 1RE4C 1NH4A 2P7JA 2DGYA 5K5GB 3DS5A 3PRJA 2L0QA 3CE7A 2KS1A 4WVZA 1PP9G 3CC2P 2QRXA 3CXHD 4JQ0D 1X3OA 3C8VA 1JEKA 1K9MQ 2FADA 2H7HA 2KIKA 1PZQA 2ZYDA 4OGQD 5HGOA 1WRGA 2KP8A 2JEEA 4MN4C 1GTWA 1M1JA 3OJAB 4U0AA 3EJDA 1L0NK 1QL2A 2CWOA 2Y9YA 2BCCJ 2NPSD 4OGQB 2PGDA 2R32A 2E5YA 1JM0A 2O1JA 2LTEA 1K04A 1RQUA 2KOPA 1YQ3C 4RO0A 2IBZG 1S4XA 2KYVA 2QIWA 2KOGA 3RL0D 1AQ5A 2JYLA 2WT7A 3L75E 5APWA 2KG6A 2MR7A 1ZMBA 4B86A 1NHLA 1SQQD 2K93A 5APTA 2K3RA 2VLPA 1FZCC 1FU1A 1H0TA 3O6QB 1G1IA 1IFNA 3H6PA 1ZW0A 1KYOD 1Y47A 1SQQE 2KSEA 5KP8B 2Z44A 2DNWA 5GTHE 1VQLP 1KZUB 2Q1KA 1W2BO 1KYOE 4JPZB 1YTZT 4F37A 4NPEA 2EG5A 3KPEA 2AFEA 1H89A 3WBHA 1M57D 4XFJA 3HRNA 3KHUA 3VTPC 1Z56A 3WUTA 1A43A 4CA3A 5KJ7D 1JY3P 2QM7A 5AW9B 1MKMA 3TF5A 2M5AA 2CNRA 1NQ4A 1FJKA 1FOSE 3H1ID 3DTJA 3BATA 4GODA 2JGPA 2KS1B 4L76A 3H25A 3L70E 3U1AA 3ABVC 2MKVA 3MHVA 1AVOA 3TYYA 3H1JJ 2O01H 3H1IE 4K35A 3L72G 3BVHA 2QJYB 2A06D 4AUWA 3DS0A 3CCRP 1NTZJ 4COCA 1T2KD 1M8OB 4KHXA 5APSA 3L73G 2Y0DA 4TT3H 2IPPA 2A06E 1CSBA 3TGUE 1YJWP 3L75G 1KD1Q 3BCCD 1LWUA 2MR8A 1M1JB 2LKIA 2W6BA 5F2OA 3T97A 1T6AA 2YO3A 3BCCE 3CCQP 1USEA 2JB0A 2O3JA 4GT1A 1BE3E 1K30A 1YQ4C 2K0YA 4WY4C 1N86A 2N9BA 2WT7B 1HBWA 1TU3F 1GDTA 2OTKE 4IL6H 1KC8Q 1EXJA 1ZXGA 2EFJA 4PD4D 3CXHI 1EDIA 1OWAA 1P84H 1OVVA 3M9BA 4BPHA 2KG9A 1H0TB 4U3FE 2OYHA 2N1TD 1NTZK 2ZFCA 3MGNA 4DG9A 4PH0A 1IFMA 3A5TA 3HE4A 4LGDE 4PD4E 1N7LA 1GXHA 2LKMA 2G3AA 3AEBC 1SQXK 2CPSA 4W7ZA 2FVAA 1GMJA 4M0IA 3H1LD 5AVQB 3RK3E 5B66H 1BGYE 3RK3B 2OGUA 4H13D 3H1LE 1VQ8P 3L75J 2M5AB 1FE6A 3M91A 2OARA 4HKZH 3U1CA 3A3YB 4LC1A 3EFFK 3TGUG 2WSEJ 3EJBA 1VKUA 2IZ0A 3JSVC 1ZMEC 4YTPC 1RY3A 1ZV8A 2IFNA 1Q2NA 1VQOP 1XTCC 2QJKB 2KSJA 1SQQJ 2Q6QA 4JYBA 1SQBG 2J58A 1L0IA 2E1MA 3B5NA 2WTYA 2AXTH 1SFCA 2P2UA 3GHGC 3AE5C 1ZLLA 2QJPB 2FYUK 2BHVA 1RF0A 3CLQA 1BSNA 1IC2A 3VYIA 5KAFH 1L0LE 4BPGA 3CX5I 4H2YC 1LWUB 1N8RQ 2M8RA 2WZ7A 2PRRA 3T97B 3Q2YA 3G29A 4XFZA 4OVNF 4U3FG 1QEXA 3CC7P 3E7KA 3L70J 3L71G 2MJZA 3G26A 3EFGA 4ASWA 1HQBA 1S3JA 4O9BA 1LTJA 2ERHA 5AVRB 2WSEH 1W5CE 3H1IJ 1IFIA 1OIPA 1MUUA 3A2AA 3HD7C 3G71P 2MD9A 1BGYG 3D71A 1GD2E 5GTHH 2GZJA 4PXHB 2OYHB 3TGUJ 1PIXA 1N7SC 4XE5B 2MVVA 3HE4B 4GIFA 5HGNA 2BASA 2ZXEB 1QLED 4UB8H 1DD3A 2JJLA 3A7OA 3FX0A 3PHLA 3BCCJ 3LMOA 3HUSC 1BE3J 1IO4A 1CZQA 2AEMA 5GTIE 2RH0A 1SQPD 4N78E 4WWIA 4QMAA 5AW4B 2ZYAA 3CD6P 4H2WC 3TNUB 1YJ9P 3IR9A 1L0LG 1KFNA 2IX7C 2C9LY 4I7ZC 1KN7A 4U3FJ 2WQYC 2ITAA 2GZIA 1GW3A 2L5GB 3B5NB 2HFED 1SFCB 4QNBA 1L2PA 4PJ0H 1VPCA 1EZVE 3G1GA 4WBAA 2HLOA 1BGYJ 1QL1A 2GUVA 1F80D 2VSQA 1A8OA 3VRLC 1J1DB 3H1LJ 4H0LC 2K37A 1ZR4A 1HTLC 3HE5A 4Y99B 1M56D 3H32A 3CWBD 2PNGA 5CCHD 1BDDA 2K9JA 1EOQA 1DIPA 1L4AA 2KK7A 1LTJB 2Y0EA 3B8EB 5KLVK 2IYOA 5APVA 2E75C 3CWBE 2FXMA 1YJNP 4U0FA 3NTEA 1VQ5P 4NPDA 2OQQA 1L0LJ 2FXOA 3PP5A 1JO5A 2E76D 2IYPA 5AVWB 1OW6A 4IPYA 2E74B 3O8ZA 2M5RA 5KTBA 1X22A 1YBKA 2BCCD 5TISE 1KILC 1RE4A 1GL2D 4C7RA 5BVZA 4PV1D 5HVCA 1EZVG 3WU2E 2RKLA 5APXA 4L74A 2SPZA 3GZLA 3F5HA 2WSCJ 1HJBA 1VQ4P 5EW5E 4K3AA 2YIUC 3HYBA 4BRYA 3GF3A 2A45I 3G4SP 3KYQA 1JCCA 4ASVA 2JR8A 4XROA 2GA1A 1PP9D 1S2EA 1NTMK 1M6EX 2PEJA 1LTTC 2WWWA 1HUCA 3RL0g 1YI2P 5APQA 3IFMA 1PP9E 3MP7B 1KQFB 3DS4A 5CCGD 2FVFA 1K05A 3D6ZA 2WITA 4H44D 2D2CC 4A7PA 1RNIA 2KOQA 3HE5B 3M9QA 3LW5J 2PEOA 3C1LA 3H32B 3L74G 2WSSH 2K9JB 3Q5PA 1L4AB 4R4MA 1KB9E 3L35A 1FZCA 3AE4C 2JKVA 2KGAA 1P84D 3AE1C 2IBZD 3GW6A 1Z6MA 1JY3O 3L37A 2AXCA 3LRYA 1LTBC 2IZ1A
chains in the Genus database with same CATH topology
4U0DA 1KQSO 3DS3A 2XT1A 1A43A 4IPYA 3DS2A 2DGYA 2XXMA 3CCVP 3I55P 1RO0A 3DS5A 2OTLP 3H47A 4U0BA 5JPAA 1AUMA 1VQ8P 3DTJA 3I56P 4COPA 3CC2P 1Q82Q 3HZQA 2PEQA 2OARA 3G28A 2ONTA 2M8PA 1M74A 1K9MQ 2QEXP 3CD6P 5BS1A 3H4EA 4U0CA 1VQNP 3G21A 1YJ9P 3E2DA 2XV6A 1K8AQ 5I4TG 4XFYA 1D1DA 1VQOP 3M1MA 3WBHA 1YIJP 1M6NA 3CCUP 3G0VA 3DS0A 2JO0A 5HGOA 3MGEA 2EIAA 3CCJP 4COCA 3CCRP 1JJ2O 3Q20A 4GR6A 1VQ4P 2E1MA 2LF4A 2PY8A 2Z46A 3HYBA 4GR2A 2OTJP 3OW2O 1BAJA 4WYMA 1QRJA 3G1IA 4U0AA 3G4SP 1IUQA 1YJWP 4QNBA 1KD1Q 2BHVA 2CWOA 5HGLA 3H0DA 1VQ7P 3CMEP 3CCLP 3G1GA 4XROA 1PEUA 1S72P 2PENA 1N8RQ 5F2OA 1M1KQ 1M6EX 2PEJA 1Q7YQ 1A8OA 3CCQP 2P9XA 1YI2P 3G29A 3VRLC 4XFZA 5F2KA 2PEKA 3CCMP 1K30A 1VQKP 3DPHA 3DS4A 2JYLA 1YHQP 3CCSP 3CC7P 2BUOA 1ZMBA 1VQ6P 3G26A 4XRQA 1PEMA 2M8LA 1NJIQ 1VQMP 2QA4P 1VQPP 1YITP 1RNIA 1KC8Q 3P05A 1EOQA 1QVFO 4U0EA 3CXCO 2PEOA 1Q86Q 3CPWO 2EFJA 3G6EP 2BQ1E 2JYGA 1PEQA 2PEIA 3RG6C 3G71P 3CMAP 1PEOA 4M0IA 2M8NA 5BS2A 1QVGO 2Z44A 3DS1A 4XFXA 1YJNP 5DCKA 1M90Q 1VQLP 4U0FA 3NTEA 4PH0A 1VQ9P 2KODA 1VQ5P 3CC4P 1W2BO 1Q81Q 3B5IA 3CCEP 1RO2A 2EG5A 2Z45A 5HGNA 1K73Q 5F2NA 5HGMA 3LRYA 1EIAA 4PH1A 2L6EA 1E6JP 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 P;  3CXC O;  1KQS O;  1K8A Q;  1Q86 Q;  3CPW O;  1YIT P;  1N8R Q;  1QVF O;  3G6E P;  1M1K Q;  1VQO P;  3G71 P;  3CMA P;  1YIJ P;  1Q7Y Q;  3CCU P;  3CCV P;  3I55 P;  3CCQ P;  1YI2 P;  1QVG O;  3CCJ P;  3CCR P;  2OTL P;  1JJ2 O;  1VQ4 P;  1YJN P;  1M90 Q;  1VQL P;  3CCM P;  1VQK P;  1VQ8 P;  3I56 P;  1VQ9 P;  3CC2 P;  1Q82 Q;  2OTJ P;  1YHQ P;  3CCS P;  3OW2 O;  3CC7 P;  1VQ5 P;  3CC4 P;  1VQ6 P;  1W2B O;  1Q81 Q;  1YJW P;  3CCE P;  3G4S P;  1KD1 Q;  1K9M Q;  1NJI Q;  2QEX P;  3CD6 P;  1VQN P;  1K73 Q;  1VQM P;  1VQ7 P;  3CME P;  3CCL P;  2QA4 P;  1VQP P;  1YJ9 P;  1KC8 Q; 
#chains in the Genus database with same CATH topology
 1NO4 A;  3NXS A;  2JWD A;  2FXP A;  3KQG A;  1S5L H;  1LTI C;  1AA0 A;  5L8R J;  3AEG C;  4KT0 J;  3SFE C;  1JY2 N;  3VN0 A;  3RK2 B;  2YMY A;  3E1R A;  2V7Q J;  2ZT9 B;  1E5W A;  1DNY A;  3G28 A;  1PL5 A;  1AJY A;  3A0B H;  4D6T E;  2W6J H;  5B66 E;  1SQP K;  5C39 A;  1IFJ A;  3LW5 H;  1RQV A;  2FBW C;  4DCK A;  2E42 A;  2O01 N;  1NTK G;  5AVS B;  1MFT A;  1DD4 A;  1URQ C;  3CWB J;  2CQ8 A;  2JO0 A;  1VF5 C;  3CCJ P;  2FQ0 A;  3PTZ A;  4MRT C;  2JQ4 A;  4IL6 X;  1LJ2 A;  5APY A;  1BCC G;  4BRY B;  1IUQ A;  5KAI H;  3H0D A;  3MD0 A;  3FXE A;  2N5I A;  2LR2 A;  1KV4 A;  2HG5 D;  2AXT E;  3L72 D;  1G1J A;  2V7Q H;  3F89 A;  2ZJS E;  2VRS A;  5DJT B;  1KMI Z;  2WPR A;  5KAF E;  3L73 D;  1G2C B;  1EDL A;  4U0E A;  3L72 E;  2EHS A;  4WY4 A;  2WSF H;  3L75 D;  3PH0 A;  2XNX A;  2KZI A;  3L73 E;  5DCK A;  1OZH A;  2WMM A;  2I1K A;  1FZC B;  3GLM A;  2KGC A;  3CCE P;  1NAY A;  2HPC A;  2O01 J;  1E6J P;  2CK3 H;  1BXI A;  1KQS O;  4D6T G;  1GK4 A;  4KJM A;  4R0M A;  5AW8 B;  2XT1 A;  3AED C;  2K1A A;  3DS2 A;  3ZDM A;  3K5B A;  1PP9 J;  3RBX A;  1AUM A;  1FDO A;  1WT6 A;  5TIS H;  1MZ9 A;  4EIJ A;  2Q5U A;  2M0B A;  5BS1 A;  2NPS C;  2VLQ A;  1SQX G;  4UB8 E;  3L36 A;  1KOR A;  3WU2 H;  2V4H A;  2RMZ A;  2OYO A;  3L70 D;  1M6N A;  4CPG A;  1JJ2 O;  3RL0 C;  2Z46 A;  5E79 E;  3P32 A;  2OTJ P;  1JY2 O;  1Y8A A;  1J2J B;  2NZ2 A;  1WMK A;  4WYM A;  1AFO A;  3P7K A;  2Z4E A;  2B9B A;  2FKW B;  3GHG A;  2KNC A;  4GOE A;  1P84 I;  3TGU D;  2PFX A;  4EOT A;  3V2N A;  5HV8 A;  3HTK A;  3RGU A;  2RN0 A;  3VP8 A;  3DPH A;  1J1E C;  3A0H H;  1EDJ A;  3H1H G;  2YMK A;  1ZR2 A;  2JAZ A;  1SQB D;  4PJ0 E;  2FYU G;  1EMV A;  3BRV B;  1OXZ A;  1VQP P;  4Y28 J;  1BE3 D;  3P05 A;  1PGO A;  3FWL A;  3GG2 A;  2C0X A;  5KJ7 C;  5TJH A;  1SQB E;  4WY4 B;  1PGJ A;  2BEQ D;  4C7N A;  1KLP A;  1KB9 H;  1PV3 A;  4IFM A;  2ROQ A;  2P58 A;  3HD7 A;  2XKM A;  3B5I A;  5KKZ C;  2N50 A;  1VHN A;  1K73 Q;  2WPQ A;  4U3F D;  1OMI A;  2KZJ A;  1S9K D;  2XND H;  2HPC B;  1N7S A;  2GDW A;  1JOC A;  2JU2 A;  3WUV A;  3KZI H;  1T2K C;  2NO8 A;  1S9K E;  1FDI A;  5BU8 B;  3I56 P;  3L71 E;  4W7Y A;  3HZQ A;  2XZR A;  3IN6 A;  3RK3 D;  1H88 A;  1OVR A;  1BGY D;  1OFC X;  3HUS A;  4XA4 A;  4GDO A;  1ZRT D;  1UII A;  3E2D A;  2KOO A;  3L72 J;  1N73 C;  5I4T G;  2N5H A;  1NOH A;  3M1M A;  1MFZ A;  1ZRT E;  2KR5 A;  3L73 J;  3V2R A;  4GR6 A;  1IFD A;  2LF4 A;  4GR2 A;  2PP6 A;  3OW2 O;  1FC2 C;  2B88 A;  1CI6 A;  3R2P A;  4YXD C;  3AE7 C;  4HYT B;  2GM4 A;  3GHG B;  5AW5 B;  2KNC B;  4I2L C;  1NU1 E;  4BWN A;  1R5S A;  1CW5 A;  2P9X A;  2N1T C;  2M3B A;  5F2K A;  1L0L D;  2K2Q A;  3JC2 2;  3N4X A;  2Q7C A;  3HTK B;  1MV8 A;  4XRQ A;  1D7M A;  1SQV E;  1U57 A;  1KYO I;  1VQM P;  1AQT A;  3D6Y A;  3G6E P;  3KXD A;  4H13 C;  4N3Y B;  4I6M C;  3AE8 C;  2GYK A;  4HKG A;  4C7N B;  1OR5 A;  4I1L A;  3AE2 C;  2AEJ A;  3LID A;  3HD7 B;  2OYI C;  4U0D A;  3H1K E;  5KLV G;  4YPC A;  1RO0 A;  1SQQ K;  1N7S B;  2XU6 A;  3FGA D;  2FHS C;  1Q82 Q;  4IFF A;  1M74 A;  1KIL A;  4U0C A;  1X9V A;  3HUS B;  3Q5S A;  4XFY A;  5CZD B;  2ZAE B;  1FJP A;  1OW7 A;  4N78 D;  1S5L E;  1ACP A;  2H43 A;  1SQB J;  1NU1 G;  2BEZ F;  1DX7 A;  5E79 H;  5CBN A;  1KQG B;  1JB0 J;  3A0B E;  4I7Z B;  3CX5 H;  1SQV G;  5CJ4 A;  1U7M A;  3B5N D;  1CI6 B;  4NEO A;  2JBG A;  1XTG B;  1SFC D;  2J59 M;  2GZG A;  3WUU A;  3EQ2 A;  1EZV D;  1IK9 A;  2J5U A;  3L71 J;  3CCS P;  4PD4 I;  3MUD C;  5KAI E;  1ZNV A;  1S5L X;  2QNW A;  2P67 A;  3U59 A;  4ZMD A;  3QWO C;  4H0L B;  1NTM G;  2BQ1 E;  2YXQ B;  3V4W A;  2PEI A;  3H1K G;  2I1J A;  5CJ0 A;  1M90 Q;  2HR3 A;  2ZXX A;  4UB6 E;  3P8C D;  1PFI A;  1JY3 N;  1GPJ A;  2YO2 A;  1RO2 A;  2FY8 A;  1SP4 A;  4AYC A;  5F2N A;  1VL2 A;  2E75 B;  3P8C E;  2NRG A;  3VP9 A;  1HH0 A;  1NU1 J;  1PGP A;  2AVA A;  2FQ1 A;  1HGZ A;  2FVE A;  3L74 D;  1ZOY C;  1R8E A;  2A45 G;  2E74 D;  1PGQ A;  2QE7 H;  1SQV J;  1X79 B;  1AYI A;  3GKL C;  1E79 H;  1AV1 A;  1KIL E;  3L74 E;  1BDC A;  1K8A Q;  1EDK A;  1KIL B;  1OVU A;  1L0H A;  3MGE A;  2VLN A;  2PY8 A;  1IFP A;  3G9R A;  2M3E A;  1URQ A;  2GZF A;  4HJG H;  5CCH C;  2XV5 A;  2FAE A;  1S72 P;  3AEC C;  3H1K J;  2KXP B;  5KLI C;  2YIU B;  3Q3D A;  3PLN A;  1FOS F;  1AF8 A;  2Q3I A;  2FFD C;  2LIU A;  5M1B A;  1JMM A;  2C9N Y;  1NTK D;  2R44 A;  2ZYG A;  1IJD B;  3NFQ A;  1L0L K;  1N2D C;  2E76 C;  1PPJ E;  3CPW O;  2FYZ A;  4OWF A;  1BCC D;  1NTK E;  2ZVN B;  2POH A;  4L75 A;  3U43 A;  1T3U A;  1GL2 C;  3A0H E;  1BCC E;  1L4A D;  3EWK A;  3N7N A;  4L73 A;  2P10 A;  2GZE A;  4UHP B;  4PV1 C;  1L0N G;  4PH1 A;  5B5E H;  3I5C A;  1KB9 D;  2FYN C;  3V6I A;  2K88 A;  1YYC A;  2K0D X;  3I55 P;  1LTA C;  2OTL P;  1FDM A;  3IAO A;  3B71 A;  1EQ7 A;  3AE9 C;  1USD A;  2LOL A;  4R4L A;  2ONT A;  4EYY Q;  3RK2 D;  2YNY A;  2ZT9 D;  5KP6 B;  4HB1 A;  4DOJ A;  2NPS A;  3KZI E;  3G0V A;  1RHZ B;  4D6T D;  1Y9B A;  1A02 J;  2H88 C;  2A45 H;  5CCG C;  1X8Y A;  3VMA A;  4H44 C;  2Y0C A;  1T8K A;  1URQ B;  1VF5 B;  1LT9 C;  2WSF J;  2L9F A;  2MF4 A;  1PPJ G;  3KDP B;  2JP3 A;  2QM8 A;  1SQX D;  1LTG C;  4ZKU A;  1YTZ I;  1RF1 C;  2KUB A;  1YHQ P;  3QH9 A;  4AQR D;  1PEM A;  1SQX E;  2R5B A;  3S1K A;  3UIA A;  4BXL A;  3L74 J;  1CEI A;  3CXC O;  5CBO A;  3V5B A;  2JYG A;  2AFD A;  2X2B A;  3AE3 C;  5APU A;  1NAF A;  4XFX A;  3R4Y A;  3II6 A;  2W27 A;  2KOD A;  4UB6 H;  5KJ7 A;  2WVR A;  1RE3 C;  3L4F A;  1HGV A;  5AW7 B;  1GXG A;  1EIA A;  3CXH E;  3H1H D;  5DJU B;  2FYU D;  2XXM A;  3CCV P;  1FAV A;  2EHT A;  4N6J A;  3MIW A;  3S9O A;  2LL8 A;  3H1H E;  2YKP A;  2M8P A;  2FYU E;  3GZM A;  3V4Q A;  2XV6 A;  1NTK J;  3H1J G;  1S1C X;  1ZN5 A;  1FZE A;  3TDK A;  3RG2 A;  1DH3 A;  3E1I A;  4OGQ C;  3CCU P;  2GUS A;  2GDX A;  2GDY A;  1N73 A;  2Z5H A;  1T3J A;  2NPS B;  1NTZ G;  1BCC J;  2KWL A;  1MZ8 A;  4W80 A;  2KLV A;  4DZO A;  1VQ7 P;  3B4Q A;  1PEU A;  3M0D C;  4WB4 A;  2I8D A;  2QSI A;  3RL0 B;  1Q90 D;  1HF9 A;  4C46 A;  1Q7Y Q;  2LML A;  3CX5 D;  3WMM 0;  2UWJ E;  1VQK P;  1KB9 I;  4JBZ A;  2N98 A;  3M0A A;  2N1T A;  3FXD A;  3CX5 E;  2CG5 B;  1JCD A;  1Q86 Q;  5H2F H;  4ZNC A;  1NTK K;  2KG8 A;  1PEQ A;  1J1E B;  3RG6 C;  1VDF A;  2IBZ I;  5EFW B;  2M8N A;  1GU4 A;  1SS1 A;  4EI2 A;  2XDJ A;  1UNK A;  2AEF A;  2O1K A;  4WY4 D;  2FQ2 A;  3AEA C;  1EXI A;  5HGM A;  4D6T J;  3VMZ A;  3AEE C;  2OYI A;  1A02 F;  5KKZ B;  2QJY C;  3GF7 A;  2PEQ A;  4LLH A;  1GU5 A;  3NMD A;  1SQX J;  4IOI H;  5AW3 B;  4DJG A;  4NPF X;  3SSU A;  1NWQ A;  4IFD K;  3L71 D;  1M1J C;  1SQQ G;  2E5T A;  3Q5R A;  5KLV D;  1N73 B;  5CMZ A;  4OH8 B;  3W68 A;  3CCL P;  5KLV E;  7CEI A;  3ITK A;  1SLQ A;  1FZF A;  2LXB A;  1H8A A;  3Q1M A;  1RH5 B;  3AE6 C;  2DW3 A;  3VMX A;  3H1H J;  1IZN B;  2FAC A;  2BUO A;  1VQ6 P;  1FZA A;  2FYU J;  2Y9Z A;  1NU1 D;  3L70 G;  5AW2 B;  2K5X A;  2IDB A;  3CI9 A;  4TLF A;  1LT1 A;  4U7J A;  1HY8 A;  2N1T B;  3H1I G;  3VOP A;  3MUD A;  3CMA P;  3DS1 A;  1SQV D;  1LGH B;  5BU5 A;  3RK3 C;  4QKO A;  3TNU A;  3CC4 P;  1SVF A;  1Q81 Q;  1M7L A;  2A06 G;  4RES B;  2JO1 A;  3G3Z A;  2KB7 P;  2QVA A;  4H13 B;  2VLO A;  3LIE A;  1AVY A;  3DS3 A;  2WPT A;  3CXH H;  2P1J A;  1GZL A;  3HD7 D;  2W83 C;  3BCC G;  4U0B A;  5JPA A;  1BE3 G;  1IMP A;  1NTM D;  2QJK C;  3FWN A;  1NVO A;  2OYI B;  2HOD A;  3H1K D;  5CHX A;  3JCU E;  2K92 A;  1N7S D;  1FR2 A;  1JUN A;  4DT0 A;  2ZVO B;  2R3S A;  5B5E E;  3H4E A;  1E0H A;  4M3L A;  3G21 A;  1JY2 P;  2XZ0 D;  1NTM E;  2QJP C;  4HH2 A;  3SFD C;  1FZB A;  1R5L A;  2Q3E A;  1YIJ P;  3BRT B;  4GOF A;  1LWU C;  3Q20 A;  3OAK A;  3P8M C;  2JDI H;  5HGL A;  1IK7 A;  3GMA A;  4ZKP A;  2QG4 A;  2AF8 A;  5CCH A;  5AVT B;  1HVV A;  2CGQ A;  2K9Y A;  3M06 A;  2PEK A;  3CCM P;  3NTN A;  2KOS A;  3H1L G;  1KYO H;  1NJI Q;  2PAJ A;  2FFD A;  2OYH C;  2KI7 B;  3GJN A;  1EC5 A;  2K0X A;  1JNM A;  3W67 A;  2N9Y B;  1GK6 A;  5AVU B;  3M9H A;  4H0L D;  2G8Y A;  1VQ9 P;  3IF4 A;  3MTU E;  1FBM A;  4JYC A;  2KLU A;  2Z45 A;  3VMY A;  2JU1 A;  1LTS C;  2QEX P;  1GL2 A;  1SQP E;  4GKG A;  5KLV J;  2JWA A;  3PJS K;  1LNQ A;  2B87 A;  1SQB K;  1DEB A;  2E75 D;  1BSH A;  5AW6 B;  2L22 A;  1JTH A;  2HOD B;  3S4R A;  1VQN P;  1UIX A;  5AW0 B;  2C0W A;  3B5N C;  1D1D A;  1SFC C;  1GW4 A;  2W8Z A;  1NYH A;  2R3C A;  1L0N D;  2LXC B;  3NY7 B;  2EIA A;  2H8P D;  1RF0 C;  3SWF A;  1DEE G;  1KIL D;  2YKO A;  2IFM A;  3G1I A;  1L0N E;  1J1D C;  1NGM B;  3D70 A;  3USS A;  1QGK B;  2KGD A;  3CL3 D;  3RBZ A;  2CPB A;  5CCG A;  2N6Z A;  1HWT C;  2PEN A;  4Y99 C;  1M1K Q;  3C9I A;  1U7J A;  1LP1 A;  1LTJ C;  2LPK A;  1LT9 A;  1HJ0 A;  1KQL A;  4PD4 H;  1FZG A;  4JF7 A;  2W6A A;  2M8L A;  5KLI B;  1JMB A;  1RF1 A;  1QVF O;  2L91 A;  1FS0 E;  1NTM J;  3MZW B;  2MY5 A;  1SQP G;  5AVV B;  2FFD B;  2LIW A;  5AVX B;  3TK1 A;  2K94 A;  1NU1 K;  5BS2 A;  4PWV B;  1QX8 A;  4RKU J;  2KW2 A;  1DV5 A;  2E74 C;  1PPJ D;  2E76 B;  4BPF A;  2H89 C;  5AVZ B;  2L4B A;  2WPV B;  3OA7 A;  2BCC E;  2D2C D;  1SQV K;  2QA4 P;  2PEM A;  1OX3 A;  5H2F E;  1RE3 A;  1GL2 B;  4IZ6 A;  2YXR B;  2XZ1 C;  3SWK A;  5EJD A;  3H47 A;  2B87 B;  4PV1 B;  4COP A;  2D2C B;  2Q9I A;  3SWY A;  2FYN B;  3JCU H;  5AW1 B;  2B89 A;  1JTH B;  3AEF C;  1NKZ B;  2R5D A;  1KTM A;  4EDF A;  2HYN A;  1W2E A;  1ZP0 C;  3CWB G;  2E43 A;  4YXW H;  2YKQ A;  2WPS A;  3V2Q A;  1BAJ A;  4RJT A;  1G2C A;  1X0T A;  1QRJ A;  3CME P;  1SQP J;  1EZV I;  1IMQ A;  2KGE A;  1UJZ A;  3TSI A;  2MVU A;  1URQ D;  3M0D A;  3EJE A;  1VF5 D;  2WSC H;  4H44 B;  2N6Y A;  5KP7 B;  3H1J D;  1LP1 B;  1L4A C;  1LT9 B;  4IL6 E;  3O6Q A;  1NTZ D;  1YIT P;  4H2X C;  3H1J E;  3B4S A;  2BCC G;  2Z5I A;  1P84 E;  1T8Z A;  2IBZ E;  2KOR A;  1RF1 B;  1PEO A;  1QVG O;  1NKN A;  1NTZ E;  3BAS A;  4Z1M H;  5AVY B;  5GTI H;  2W90 A;  1KFM A;  1L0N J;  3RK2 C;  2ZT9 C;  2L6E A;  3V2P A;  1OW8 A;  1RE4 C;  1NH4 A;  2P7J A;  2DGY A;  5K5G B;  3DS5 A;  3PRJ A;  2L0Q A;  3CE7 A;  2KS1 A;  4WVZ A;  1PP9 G;  3CC2 P;  2QRX A;  3CXH D;  4JQ0 D;  1X3O A;  3C8V A;  1JEK A;  1K9M Q;  2FAD A;  2H7H A;  2KIK A;  1PZQ A;  2ZYD A;  4OGQ D;  5HGO A;  1WRG A;  2KP8 A;  2JEE A;  4MN4 C;  1GTW A;  1M1J A;  3OJA B;  4U0A A;  3EJD A;  1L0N K;  1QL2 A;  2CWO A;  2Y9Y A;  2BCC J;  2NPS D;  4OGQ B;  2PGD A;  2R32 A;  2E5Y A;  1JM0 A;  2O1J A;  2LTE A;  1K04 A;  1RQU A;  2KOP A;  1YQ3 C;  4RO0 A;  2IBZ G;  1S4X A;  2KYV A;  2QIW A;  2KOG A;  3RL0 D;  1AQ5 A;  2JYL A;  2WT7 A;  3L75 E;  5APW A;  2KG6 A;  2MR7 A;  1ZMB A;  4B86 A;  1NHL A;  1SQQ D;  2K93 A;  5APT A;  2K3R A;  2VLP A;  1FZC C;  1FU1 A;  1H0T A;  3O6Q B;  1G1I A;  1IFN A;  3H6P A;  1ZW0 A;  1KYO D;  1Y47 A;  1SQQ E;  2KSE A;  5KP8 B;  2Z44 A;  2DNW A;  5GTH E;  1VQL P;  1KZU B;  2Q1K A;  1W2B O;  1KYO E;  4JPZ B;  1YTZ T;  4F37 A;  4NPE A;  2EG5 A;  3KPE A;  2AFE A;  1H89 A;  3WBH A;  1M57 D;  4XFJ A;  3HRN A;  3KHU A;  3VTP C;  1Z56 A;  3WUT A;  1A43 A;  4CA3 A;  5KJ7 D;  1JY3 P;  2QM7 A;  5AW9 B;  1MKM A;  3TF5 A;  2M5A A;  2CNR A;  1NQ4 A;  1FJK A;  1FOS E;  3H1I D;  3DTJ A;  3BAT A;  4GOD A;  2JGP A;  2KS1 B;  4L76 A;  3H25 A;  3L70 E;  3U1A A;  3ABV C;  2MKV A;  3MHV A;  1AVO A;  3TYY A;  3H1J J;  2O01 H;  3H1I E;  4K35 A;  3L72 G;  3BVH A;  2QJY B;  2A06 D;  4AUW A;  3DS0 A;  3CCR P;  1NTZ J;  4COC A;  1T2K D;  1M8O B;  4KHX A;  5APS A;  3L73 G;  2Y0D A;  4TT3 H;  2IPP A;  2A06 E;  1CSB A;  3TGU E;  1YJW P;  3L75 G;  1KD1 Q;  3BCC D;  1LWU A;  2MR8 A;  1M1J B;  2LKI A;  2W6B A;  5F2O A;  3T97 A;  1T6A A;  2YO3 A;  3BCC E;  3CCQ P;  1USE A;  2JB0 A;  2O3J A;  4GT1 A;  1BE3 E;  1K30 A;  1YQ4 C;  2K0Y A;  4WY4 C;  1N86 A;  2N9B A;  2WT7 B;  1HBW A;  1TU3 F;  1GDT A;  2OTK E;  4IL6 H;  1KC8 Q;  1EXJ A;  1ZXG A;  2EFJ A;  4PD4 D;  3CXH I;  1EDI A;  1OWA A;  1P84 H;  1OVV A;  3M9B A;  4BPH A;  2KG9 A;  1H0T B;  4U3F E;  2OYH A;  2N1T D;  1NTZ K;  2ZFC A;  3MGN A;  4DG9 A;  4PH0 A;  1IFM A;  3A5T A;  3HE4 A;  4LGD E;  4PD4 E;  1N7L A;  1GXH A;  2LKM A;  2G3A A;  3AEB C;  1SQX K;  2CPS A;  4W7Z A;  2FVA A;  1GMJ A;  4M0I A;  3H1L D;  5AVQ B;  3RK3 E;  5B66 H;  1BGY E;  3RK3 B;  2OGU A;  4H13 D;  3H1L E;  1VQ8 P;  3L75 J;  2M5A B;  1FE6 A;  3M91 A;  2OAR A;  4HKZ H;  3U1C A;  3A3Y B;  4LC1 A;  3EFF K;  3TGU G;  2WSE J;  3EJB A;  1VKU A;  2IZ0 A;  3JSV C;  1ZME C;  4YTP C;  1RY3 A;  1ZV8 A;  2IFN A;  1Q2N A;  1VQO P;  1XTC C;  2QJK B;  2KSJ A;  1SQQ J;  2Q6Q A;  4JYB A;  1SQB G;  2J58 A;  1L0I A;  2E1M A;  3B5N A;  2WTY A;  2AXT H;  1SFC A;  2P2U A;  3GHG C;  3AE5 C;  1ZLL A;  2QJP B;  2FYU K;  2BHV A;  1RF0 A;  3CLQ A;  1BSN A;  1IC2 A;  3VYI A;  5KAF H;  1L0L E;  4BPG A;  3CX5 I;  4H2Y C;  1LWU B;  1N8R Q;  2M8R A;  2WZ7 A;  2PRR A;  3T97 B;  3Q2Y A;  3G29 A;  4XFZ A;  4OVN F;  4U3F G;  1QEX A;  3CC7 P;  3E7K A;  3L70 J;  3L71 G;  2MJZ A;  3G26 A;  3EFG A;  4ASW A;  1HQB A;  1S3J A;  4O9B A;  1LTJ A;  2ERH A;  5AVR B;  2WSE H;  1W5C E;  3H1I J;  1IFI A;  1OIP A;  1MUU A;  3A2A A;  3HD7 C;  3G71 P;  2MD9 A;  1BGY G;  3D71 A;  1GD2 E;  5GTH H;  2GZJ A;  4PXH B;  2OYH B;  3TGU J;  1PIX A;  1N7S C;  4XE5 B;  2MVV A;  3HE4 B;  4GIF A;  5HGN A;  2BAS A;  2ZXE B;  1QLE D;  4UB8 H;  1DD3 A;  2JJL A;  3A7O A;  3FX0 A;  3PHL A;  3BCC J;  3LMO A;  3HUS C;  1BE3 J;  1IO4 A;  1CZQ A;  2AEM A;  5GTI E;  2RH0 A;  1SQP D;  4N78 E;  4WWI A;  4QMA A;  5AW4 B;  2ZYA A;  3CD6 P;  4H2W C;  3TNU B;  1YJ9 P;  3IR9 A;  1L0L G;  1KFN A;  2IX7 C;  2C9L Y;  4I7Z C;  1KN7 A;  4U3F J;  2WQY C;  2ITA A;  2GZI A;  1GW3 A;  2L5G B;  3B5N B;  2HFE D;  1SFC B;  4QNB A;  1L2P A;  4PJ0 H;  1VPC A;  1EZV E;  3G1G A;  4WBA A;  2HLO A;  1BGY J;  1QL1 A;  2GUV A;  1F80 D;  2VSQ A;  1A8O A;  3VRL C;  1J1D B;  3H1L J;  4H0L C;  2K37 A;  1ZR4 A;  1HTL C;  3HE5 A;  4Y99 B;  1M56 D;  3H32 A;  3CWB D;  2PNG A;  5CCH D;  1BDD A;  2K9J A;  1EOQ A;  1DIP A;  1L4A A;  2KK7 A;  1LTJ B;  2Y0E A;  3B8E B;  5KLV K;  2IYO A;  5APV A;  2E75 C;  3CWB E;  2FXM A;  1YJN P;  4U0F A;  3NTE A;  1VQ5 P;  4NPD A;  2OQQ A;  1L0L J;  2FXO A;  3PP5 A;  1JO5 A;  2E76 D;  2IYP A;  5AVW B;  1OW6 A;  4IPY A;  2E74 B;  3O8Z A;  2M5R A;  5KTB A;  1X22 A;  1YBK A;  2BCC D;  5TIS E;  1KIL C;  1RE4 A;  1GL2 D;  4C7R A;  5BVZ A;  4PV1 D;  5HVC A;  1EZV G;  3WU2 E;  2RKL A;  5APX A;  4L74 A;  2SPZ A;  3GZL A;  3F5H A;  2WSC J;  1HJB A;  1VQ4 P;  5EW5 E;  4K3A A;  2YIU C;  3HYB A;  4BRY A;  3GF3 A;  2A45 I;  3G4S P;  3KYQ A;  1JCC A;  4ASV A;  2JR8 A;  4XRO A;  2GA1 A;  1PP9 D;  1S2E A;  1NTM K;  1M6E X;  2PEJ A;  1LTT C;  2WWW A;  1HUC A;  3RL0 g;  1YI2 P;  5APQ A;  3IFM A;  1PP9 E;  3MP7 B;  1KQF B;  3DS4 A;  5CCG D;  2FVF A;  1K05 A;  3D6Z A;  2WIT A;  4H44 D;  2D2C C;  4A7P A;  1RNI A;  2KOQ A;  3HE5 B;  3M9Q A;  3LW5 J;  2PEO A;  3C1L A;  3H32 B;  3L74 G;  2WSS H;  2K9J B;  3Q5P A;  1L4A B;  4R4M A;  1KB9 E;  3L35 A;  1FZC A;  3AE4 C;  2JKV A;  2KGA A;  1P84 D;  3AE1 C;  2IBZ D;  3GW6 A;  1Z6M A;  1JY3 O;  3L37 A;  2AXC A;  3LRY A;  1LTB C;  2IZ1 A; 
#chains in the Genus database with same CATH homology
 4U0D A;  1KQS O;  3DS3 A;  2XT1 A;  1A43 A;  4IPY A;  3DS2 A;  2DGY A;  2XXM A;  3CCV P;  3I55 P;  1RO0 A;  3DS5 A;  2OTL P;  3H47 A;  4U0B A;  5JPA A;  1AUM A;  1VQ8 P;  3DTJ A;  3I56 P;  4COP A;  3CC2 P;  1Q82 Q;  3HZQ A;  2PEQ A;  2OAR A;  3G28 A;  2ONT A;  2M8P A;  1M74 A;  1K9M Q;  2QEX P;  3CD6 P;  5BS1 A;  3H4E A;  4U0C A;  1VQN P;  3G21 A;  1YJ9 P;  3E2D A;  2XV6 A;  1K8A Q;  5I4T G;  4XFY A;  1D1D A;  1VQO P;  3M1M A;  3WBH A;  1YIJ P;  1M6N A;  3CCU P;  3G0V A;  3DS0 A;  2JO0 A;  5HGO A;  3MGE A;  2EIA A;  3CCJ P;  4COC A;  3CCR P;  1JJ2 O;  3Q20 A;  4GR6 A;  1VQ4 P;  2E1M A;  2LF4 A;  2PY8 A;  2Z46 A;  3HYB A;  4GR2 A;  2OTJ P;  3OW2 O;  1BAJ A;  4WYM A;  1QRJ A;  3G1I A;  4U0A A;  3G4S P;  1IUQ A;  1YJW P;  4QNB A;  1KD1 Q;  2BHV A;  2CWO A;  5HGL A;  3H0D A;  1VQ7 P;  3CME P;  3CCL P;  3G1G A;  4XRO A;  1PEU A;  1S72 P;  2PEN A;  1N8R Q;  5F2O A;  1M1K Q;  1M6E X;  2PEJ A;  1Q7Y Q;  1A8O A;  3CCQ P;  2P9X A;  1YI2 P;  3G29 A;  3VRL C;  4XFZ A;  5F2K A;  2PEK A;  3CCM P;  1K30 A;  1VQK P;  3DPH A;  3DS4 A;  2JYL A;  1YHQ P;  3CCS P;  3CC7 P;  2BUO A;  1ZMB A;  1VQ6 P;  3G26 A;  4XRQ A;  1PEM A;  2M8L A;  1NJI Q;  1VQM P;  2QA4 P;  1VQP P;  1YIT P;  1RNI A;  1KC8 Q;  3P05 A;  1EOQ A;  1QVF O;  4U0E A;  3CXC O;  2PEO A;  1Q86 Q;  3CPW O;  2EFJ A;  3G6E P;  2BQ1 E;  2JYG A;  1PEQ A;  2PEI A;  3RG6 C;  3G71 P;  3CMA P;  1PEO A;  4M0I A;  2M8N A;  5BS2 A;  1QVG O;  2Z44 A;  3DS1 A;  4XFX A;  1YJN P;  5DCK A;  1M90 Q;  1VQL P;  4U0F A;  3NTE A;  4PH0 A;  1VQ9 P;  2KOD A;  1VQ5 P;  3CC4 P;  1W2B O;  1Q81 Q;  3B5I A;  3CCE P;  1RO2 A;  2EG5 A;  2Z45 A;  5HGN A;  1K73 Q;  5F2N A;  5HGM A;  3LRY A;  1EIA A;  4PH1 A;  2L6E A;  1E6J P;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...