1W2BO

Trigger factor ribosome binding domain in complex with 50s
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1w2bO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1w2bO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1w2bO03
3CXCO 1QVGO 1VQ5P 1N8RQ 1Q86Q 3CCEP 3CC4P 3CCJP 3CPWO 1YI2P 1S72P 1VQ9P 1VQOP 3CCLP 3CCRP 3CC2P 3CCUP 3CCSP 3I56P 1VQPP 3G71P 1QVFO 1VQNP 3CD6P 3CCMP 1VQ8P 3CCVP 1YJWP 1YHQP 1W2BO 1YJ9P 1VQ4P 1VQLP 1NJIQ 3CCQP 3OW2O 1VQ6P 1KD1Q 3G4SP 1VQMP 1M1KQ 1VQ7P 3CMAP 1Q81Q 1VQKP 1JJ2O 2QEXP 2OTJP 1YITP 1Q7YQ 1YJNP 1KQSO 3CC7P 2OTLP 1M90Q 2QA4P 1YIJP 1K9MQ 1K8AQ 3I55P 3G6EP 3CMEP 1K73Q 1KC8Q 1Q82Q
chains in the Genus database with same CATH superfamily
1FZCB 5AW5B 2XNXA 1A02F 2P9XA 2N1TA 3HD7B 1L0LJ 3CX5H 1R8EA 1NTKG 2GUVA 3VOPA 1AQTA 2M8RA 1PP9G 1BGYJ 1PFIA 1CI6A 3DS2A 4H13D 5E79H 4EI2A 1S2EA 2FHSC 1N8RQ 2JR8A 2QNWA 1JY3O 5H2FH 1BDDA 2L0QA 1AVOA 2KB7P 1D1DA 2M5AA 1PEMA 3S4RA 1NO4A 5B5EH 3GMAA 2GYKA 2NRGA 1KZUB 3RGUA 2KW2A 1S3JA 1LJ2A 2O01J 5B66E 3L4FA 3SFDC 4D6TG 3G4SP 4WVZA 4H13C 1IMPA 2YXRB 3R2PA 5EJDA 1L4AD 4I7ZB 1AUMA 3MHVA 2YO3A 2W83C 1SQXE 2WSSH 3HYBA 3DS0A 2PY8A 2GDYA 3R4YA 3L71J 4O9BA 2VLQA 1SQQK 2C0XA 1CW5A 4IFMA 3HE4A 2JBGA 1ZRTE 3L75J 1CZQA 3D6YA 1JY2P 1IFIA 2V7QH 5AW3B 3CCLP 1JY3N 1NKZB 2KWLA 1DEBA 1L4AC 3GZLA 1KORA 4GIFA 1OFCX 4PJ0E 5F2NA 4PD4E 1AYIA 2K92A 3JC22 1HJBA 1MUUA 2G3AA 2R3SA 1QRJA 1VQOP 1YTZI 3EQ2A 2C9LY 2CPBA 1GK6A 2K9JB 2E43A 1XTCC 2JU1A 1W2BO 5BU8B 2J59M 5EW5E 4OH8B 3NFQA 2HR3A 1OWAA 2LMLA 2O01H 4TLFA 3AEDC 3H1KJ 1M6EX 3HUSC 2EIAA 1FOSE 1P84E 2A45H 4N3YB 1E79H 1BDCA 3L37A 1F80D 3F89A 3VTPC 3TGUE 1NU1G 3TNUA 1H8AA 4F37A 1GK4A 3WUTA 1L0IA 3H1LE 1EZVE 2RN0A 1NTZE 1YJWP 1RQUA 3NTNA 4DZOA 4U3FD 1S9KE 3LRYA 1SQBJ 3B4QA 1LT9B 3QH9A 3W67A 1DD3A 1L0NJ 3V6IA 1OVUA 3H1IG 1VDFA 1T8KA 2QJPB 3CCMP 1IFJA 2P67A 2WVRA 2HYNA 1SQPJ 3EWKA 1UNKA 4N78E 5BU5A 5CCHA 2EHSA 1URQA 2O01N 3E7KA 3CX5E 3H0DA 1OIPA 2N1TD 3ITKA 3MUDA 2AEFA 4XRQA 1HQBA 4L74A 2JP3A 1X0TA 3H1HG 1JEKA 1N7LA 1JUNA 5E79E 3CC2P 1RE4C 1BE3J 1QVFO 4N78D 3M0DC 1MV8A 3CX5D 2IBZD 1KILA 1IC2A 5H2FE 2AEJA 2ZYGA 3NMDA 1IO4A 1HH0A 3PRJA 4NPDA 4IOIH 1NTMK 3NY7B 2HLOA 1RF1C 1NHLA 2YIUC 1N7SA 1ZMEC 5HGMA 1GZLA 4U0BA 2DNWA 1M8OB 3JCUH 1AA0A 2N1TC 1YYCA 4IL6E 1YIJP 4PV1D 2WSCJ 3AE2C 1PEQA 1RHZB 4PH0A 3DS4A 3L36A 2FYUK 4HKGA 2LF4A 1U7MA 1W2EA 5CJ0A 1KB9E 1NTMJ 3P8MC 2NPSD 1PPJD 1OR5A 4DT0A 1WRGA 1G2CB 5KKZB 1L0LE 3KZIH 2RMZA 1DD4A 2D2CD 3G21A 2GZIA 1T8ZA 1OW8A 2JKVA 1S5LH 1MKMA 1VF5D 1KYOH 4BRYA 3EFGA 3Q1MA 2JYLA 4DJGA 2MJZA 3PTZA 3V4QA 2P10A 4PV1C 3IF4A 1UIXA 2DGYA 2EFJA 1LWUC 2PNGA 1SS1A 2KS1A 5HGLA 3Q5PA 1LP1B 3M06A 1KV4A 4M0IA 2FXOA 2NPSC 3UIAA 5KLVK 2KOSA 3WU2E 1X8YA 3ABVC 3V2QA 1FDMA 5HGNA 5KLIB 1UJZA 2FFDA 3LW5J 4XROA 2D2CC 1KC8Q 4L75A 1EOQA 2K3RA 2IBZI 3CX5I 3PLNA 2VLPA 5AW6B 2BEQD 1VF5C 4K35A 2B89A 1VQMP 1N2DC 2XZ1C 3MIWA 4H2YC 4IPYA 4ASWA 3CXHE 4KHXA 1LTBC 1Y47A 2P2UA 2RKLA 3L71E 3VN0A 3SSUA 2M8LA 2IFNA 3A0HH 4HB1A 3USSA 2M0BA 2JJLA 1LTJB 3L75E 4BPGA 3N7NA 1SQXG 1HGVA 2QA4P 2N5IA 2FYZA 3L73J 5CCHD 1H89A 2IDBA 1URQD 3AE7C 3L75D 1KILE 4OVNF 4R4MA 5KTBA 4QMAA 2K88A 1Q81Q 5CCGA 1GD2E 2ZT9D 5APXA 3CLQA 5AVXB 3AEGC 2KS1B 4GR2A 1VQ6P 1FZAA 1MZ8A 3RG6C 1KILD 1JY2O 3AE9C 1L4AA 3H25A 2FY8A 2POHA 4U3FJ 1LNQA 1GL2B 3AECC 3H1KE 1SQQD 1T3JA 1JJ2O 1GXHA 2W6AA 1EIAA 2L91A 2LL8A 5APVA 2KOPA 4BPFA 1PZQA 4H44B 3JCUE 4Y28J 1RF0C 1A02J 1S5LX 5CCHC 2N6YA 3MGEA 1URQC 3H1KD 2P58A 4I1LA 4RJTA 1KFNA 3IN6A 3RK2B 1SQBE 1GDTA 1KFMA 2BCCJ 2ZT9C 2K93A 2PAJA 3P32A 5AVWB 3RK3D 3U43A 4IFFA 3Q5SA 1J1DC 1VL2A 1L0NE 4H13B 3B4SA 1M6NA 3L70G 1IK7A 1KILC 2IX7C 3TGUG 5AVUB 3KDPB 1OXZA 1SQPE 3H1LG 3SFEC 1EZVG 1NTZG 3HE5A 1IJDB 4EYYQ 1S5LE 2A45I 2XV6A 2V4HA 3MD0A 4H0LD 3O6QA 2XZRA 2JO1A 3EFFK 1AQ5A 1BE3E 2O1KA 1RQVA 1VPCA 2K1AA 3DS1A 1NTKK 2ZXEB 2E74D 2VLOA 4C46A 1KYOD 4JF7A 4QNBA 5CBNA 1H0TB 2LR2A 5AVQB 1JMMA 4JPZB 3RK3C 1PGOA 2WZ7A 1RE4A 3M0DA 1ACPA 5KAFE 1L4AB 4U7JA 2LTEA 4RO0A 3KYQA 1AF8A 3CCSP 3G1IA 4NEOA 1JCCA 1FAVA 3HZQA 2QJKB 1RF1A 2FXMA 1LGHB 1PEOA 2LXBA 4H0LC 3FXEA 2XU6A 2B87B 3G6EP 2HODA 1BCCD 2MR7A 1QVGO 4XFJA 2E74C 3Q3DA 3HUSB 1NTME 3V2NA 2I8DA 1KLPA 1AFOA 1R5LA 3H1JD 2N9BA 3L72J 1PGJA 5GTHH 2OYHB 2LXCB 2V7QJ 2KZJA 1FZGA 2OYIB 1NTMD 2KNCB 2A06D 1OMIA 5AW2B 3HE5B 4W80A 4UB6H 1FJKA 3G71P 4GKGA 1HWTC 3I5CA 1PEUA 3NTEA 1Y8AA 5GTIH 2FFDC 2JDIH 5TJHA 1DNYA 2IPPA 1L0LG 3OA7A 5CBOA 2H88C 3BCCD 2KYVA 1BGYG 3M1MA 5CCGD 3D6ZA 1LWUA 5DJTB 2MD9A 1AV1A 1TU3F 3A2AA 2M3EA 3VRLC 3GKLC 2PRRA 1KYOI 3G28A 2NPSA 4C7NA 2M8PA 1KQFB 2K0YA 1M1JC 2YKOA 1RH5B 2WMMA 1LTIC 1VQ8P 3CWBJ 2YIUB 3AEFC 4OWFA 2N50A 1ZN5A 3CC7P 2N1TB 1NU1K 1Z6MA 2Z5HA 2PGDA 2H43A 2A45G 5CCGC 4PH1A 3SWYA 4R0MA 3GF3A 4YPCA 2XDJA 2BEZF 1CI6B 3G3ZA 3TSIA 5KLVD 3A0BH 1QEXA 3H6PA 3WMM0 2N6ZA 1ZLLA 3L73E 4C7RA 3RBXA 1EMVA 2PEKA 3HD7D 1M57D 3L71G 2W90A 2KODA 4H2XC 3GW6A 4R4LA 2FQ0A 1S72P 3V4WA 2Z4EA 1E0HA 4TT3H 1SQQJ 2P7JA 2YXQB 2QG4A 1KTMA 2M5AB 1VQLP 2Q3IA 2Q1KA 3L75G 3L73D 5L8RJ 4AYCA 2JAZA 2RH0A 1A8OA 1OX3A 1SQVG 1J1EC 2R5DA 1G1IA 1NYHA 2GZFA 4U3FE 4PV1B 1JM0A 4WY4A 4ZNCA 2K37A 2E5YA 3A7OA 3G9RA 2YMYA 2HPCA 1LTGC 3A3YB 3HD7C 1HUCA 3B5IA 2AXCA 2K0DX 5TISE 2BCCE 2SPZA 1JOCA 2MR8A 2M8NA 2GM4A 3H1KG 5K5GB 1VF5B 1RF0A 1HF9A 2KOGA 4PWVB 3KPEA 4N6JA 3HE4B 1FU1A 1HGZA 1ZP0C 2IBZE 5AVSB 4XE5B 2BCCD 5EFWB 3RBZA 2M3BA 5GTHE 3DS5A 3H32A 2Z44A 1SQBG 4XA4A 3U59A 3M91A 2W27A 1L0NG 4KT0J 4CPGA 1SP4A 2JEEA 3W68A 1MFTA 1ZW0A 2VRSA 1OZHA 2WPRA 3PHLA 2NZ2A 2H89C 1SQPG 1MFZA 5B5EE 4I7ZC 1KD1Q 4CA3A 1BCCJ 1YJNP 1BE3G 1Q90D 2K0XA 5AW7B 4U0FA 4MRTC 1PPJE 3VP9A 3TNUB 3H1JJ 1LT1A 5KAIH 2QM8A 4MN4C 1WT6A 2KXPB 4A7PA 2FBWC 3LIEA 1FZFA 1FZEA 3FXDA 3OJAB 2FVFA 1J2JB 1IK9A 4LGDE 2PP6A 2XXMA 4COPA 3I55P 2P1JA 4L73A 2WPTA 1NTKD 3B5ND 3L72E 2UWJE 2R32A 1PP9D 3WBHA 2BASA 2FYNB 1K04A 1YJ9P 1VQ4P 1URQB 2KORA 4B86A 1Q7YQ 3GHGC 4I2LC 3BCCJ 4NPFX 1FR2A 2FYUJ 4YXDC 3A0BE 3KHUA 3L72D 3P05A 1J1DB 2Y0DA 5AW0B 1Q86Q 1FC2C 1WMKA 1EQ7A 2QSIA 1G1JA 1KILB 1Q2NA 2AFDA 4JBZA 1SQXK 4D6TE 4XFYA 3CL3D 1S4XA 4M3LA 4BXLA 4ZKPA 2Q3EA 2QVAA 3MP7B 2CG5B 2KOOA 3GJNA 3BASA 3B5NC 1N7SB 5DJUB 1LTAC 4D6TD 5KJ7A 4YXWH 2XT1A 1IFPA 2QE7H 2K5XA 4KJMA 4RKUJ 1FDIA 2IZ1A 4WY4D 1MZ9A 4U0EA 3RK3B 1NQ4A 4I6MC 3CWBE 5KLVJ 4EDFA 3AE1C 4AUWA 4Z1MH 2LIWA 4OGQB 1M1JA 4WBAA 4W7ZA 3AE8C 3C1LA 2OQQA 2WT7A 3D71A 3B71A 3CWBD 3S1KA 4H0LB 5AVVB 2QJYC 1N86A 1VQ9P 4HYTB 4BRYB 1YQ4C 2GZEA 2E74B 3GLMA 3GF7A 4XFXA 2I1JA 2FQ1A 1PGQA 4WY4C 4K3AA 4LLHA 4EOTA 1SQQE 4WB4A 1HBWA 2ZVOB 1Q82Q 1NTZK 3CC4P 4JYBA 2JO0A 3B8EB 2WQYC 2KP8A 5AVRB 5CMZA 3Q2YA 1W5CE 2J5UA 4AQRD 1NKNA 3TYYA 2FXPA 3U1AA 1RE3C 3L73G 2FFDB 2W6BA 3AE6C 2LIUA 1ZMBA 5JPAA 1K73Q 1JNMA 1NU1D 3RK3E 2KGAA 2KSEA 3G29A 1EDJA 3AE3C 1ZOYC 3L74J 1DV5A 1JTHA 4PXHB 5APYA 2L6EA 5KAIE 1D7MA 2KI7B 2QEXP 3CI9A 3VMXA 2LOLA 3WUUA 1X22A 1GU4A 2CGQA 4U3FG 1T6AA 4HJGH 2O3JA 3CCJP 3AEEC 2KUBA 4Y99C 2ZXXA 3Q20A 1ZXGA 2KSJA 3KZIE 3HD7A 3FX0A 3IFMA 5BVZA 3D70A 1KYOE 3DPHA 3E1IA 2E76D 1K9MQ 1OVRA 2QRXA 1GPJA 2BCCG 2E42A 1KQGB 3QWOC 4EIJA 1ZNVA 1GXGA 3C8VA 4PJ0H 4PD4H 2ITAA 1JY2N 1PV3A 3IAOA 2IBZG 3FWLA 3NXSA 2KZIA 3VMYA 3AEBC 2GUSA 4GDOA 1DX7A 2MF4A 1NAFA 2JQ4A 3G0VA 3F5HA 1VQPP 1BCCE 2CWOA 2C9NY 1QX8A 1P84H 1L0LK 2BUOA 1RO0A 1YITP 1JO5A 2N5HA 2E76C 3H1JE 2PEIA 2XKMA 1NTKJ 4DG9A 5KJ7D 1PP9J 2QIWA 2YKPA 1GL2D 1LTJC 3M9HA 1FOSF 1RO2A 2A06E 1LTTC 2JWDA 1NH4A 4H44D 3EJEA 5HV8A 3GG2A 3A0HE 1M90Q 1PPJG 2CQ8A 2QM7A 2WPQA 2KOQA 4ZKUA 2Y0CA 3RK2D 1H88A 2GDWA 1KMIZ 3CCVP 3BCCE 1N73C 3SWFA 2ZVNB 2FYUE 3FWNA 4LC1A 2AXTH 3O6QB 1GMJA 1KQSO 5CJ4A 4H2WC 1DEEG 4ASVA 5KJ7C 1T3UA 4D6TJ 3L72G 2WPVB 1GL2C 3GHGA 4JYCA 2ZYDA 3JSVC 2FYUD 2IYPA 2K9JA 3DTJA 1SFCD 5AVTB 4H44C 2ZYAA 1VHNA 3E1RA 1NVOA 2OTLP 2LPKA 2BQ1E 2WWWA 1EDLA 2Q7CA 2WSFH 3RK2C 3U1CA 3L35A 4U0DA 3RL0D 1A43A 3M0AA 4IL6H 1RF1B 1IFMA 2R3CA 2Z45A 2FKWB 3M9BA 1SQVK 3B5NA 2E75D 1PL5A 2HODB 2LKMA 5KLVE 5CZDB 2Q6QA 1LT9A 5F2OA 3IR9A 1KB9H 1HVVA 1M74A 3DS3A 5I4TG 4BPHA 1SFCC 1FJPA 2W6JH 2AEMA 1SQXD 1YBKA 3BVHA 4JQ0D 3CWBG 1CEIA 4U0CA 1BSHA 2VLNA 1SQVJ 3RL0C 3P7KA 2H7HA 3BRTB 2ZJSE 3OW2O 1ZRTD 1GTWA 2E75C 1NU1J 3RL0g 4YTPC 1ZR2A 1OW6A 1NGMB 5AVZB 1QL2A 3GHGB 3CCEP 1EDIA 1SQBK 2QJKC 1LWUB 3WU2H 2IYOA 1EXIA 4WWIA 1L0NK 2JU2A 4PD4D 1NWQA 1Y9BA 3H1IJ 2WITA 1BSNA 2MVUA 1FZCC 1SQQG 1SQPK 2KG6A 2MKVA 2NPSB 4C7NB 2KGEA 4GODA 1KN7A 3L74E 3L70E 3CXCO 2KK7A 3BRVB 1RE3A 2ZFCA 2D2CB 3B5NB 2OYHC 4IZ6A 3H1HJ 5KP8B 2OYIC 3CXHH 2YMKA 1P84D 2K2QA 3L74D 3WUVA 3L70D 1USDA 1YQ3C 2CNRA 3TGUD 3TDKA 1G2CA 1GW3A 3H1LD 1EZVD 1NTZD 1QGKB 2KR5A 2JGPA 4UB8H 2L4BA 2XZ0D 1S9KD 1YHQP 2Y0EA 4NPEA 4BWNA 3MTUE 2JYGA 2R44A 4UB6E 1KQLA 3AE5C 4GT1A 5GTIE 1FE6A 3CE7A 2AXTE 1IFNA 3RG2A 5CHXA 2M5RA 4IL6X 1LP1A 2QJYB 2IFMA 1JB0J 3M9QA 1NAYA 3A5TA 2ONTA 3H4EA 2JB0A 2H8PD 5HGOA 2ROQA 2OARA 3VMZA 4WY4B 2FVAA 2EG5A 3C9IA 2B9BA 1YI2P 3P8CE 4W7YA 2DW3A 1Z56A 2AF8A 1OVVA 2HPCB 2FVEA 3HTKA 5HVCA 2B88A 1NTKE 1PGPA 2OTJP 4GR6A 1NOHA 1R5SA 1PP9E 1FS0E 3P8CD 2ERHA 1AVYA 5AVYB 1ZR4A 4PD4I 1JY3P 1BCCG 1DIPA 2GZGA 3AE4C 1EXJA 1IMQA 3MGNA 2OTKE 2PFXA 3H1JG 2N98A 1SVFA 1LTJA 2WTYA 1FDOA 2ZT9B 1IUQA 1M7LA 1VQKP 1PIXA 3VMAA 1DH3A 1EC5A 3H32B 4COCA 1T2KD 4XFZA 1KB9D 1NTMG 1BGYE 1P84I 2A06G 1YTZT 7CEIA 4Y99B 1NJIQ 2E5TA 1VQ7P 1AJYA 1L0LD 1EZVI 3T97A 2XV5A 2BHVA 2MVVA 2PENA 1N73A 1BGYD 2GDXA 1USEA 4HKZH 3G1GA 2PEOA 3EJBA 3OAKA 2XNDH 2IZ0A 2JWAA 3BCCG 3V2PA 2C0WA 2FYUG 3CCQP 5KAFH 5F2KA 2PEQA 1LT9C 1GL2A 3BATA 3N4XA 3GZMA 3LIDA 1IZNB 2KGDA 1T2KC 2QJPC 2E1MA 2WSCH 3PH0A 1VQNP 1SQXJ 2I1KA 3HTKB 1ZV8A 2YO2A 3EJDA 3TF5A 4GOFA 2PEMA 3E2DA 3SWKA 5APTA 1QLED 4DCKA 2HFED 5KP7B 2OGUA 2KG9A 1FZBA 2FAEA 2AVAA 2E76B 4L76A 2Z5IA 1BXIA 2GA1A 3K5BA 5KP6B 2YKQA 1JCDA 1HJ0A 5M1BA 3Q5RA 2FADA 2FACA 3LMOA 4UB8E 2N9YB 1U57A 3CXHD 3V5BA 3L71D 2YNYA 2W8ZA 5KLVG 1SFCA 1SQVE 2Y9YA 1S1CX 1K30A 3I56P 2VSQA 1NU1E 1QL1A 3T97B 4ZMDA 3ZDMA 1SQVD 2Y9ZA 1H0TA 5APSA 5APWA 1N73B 1KB9I 2WPSA 3HRNA 3II6A 4HH2A 2KLUA 2EHTA 2FQ2A 2KLVA 2Q5UA 2WSEJ 5B66H 2X2BA 1RY3A 3TK1A 1E6JP 3PJSK 3LW5H 4RESB 5AW9B 2Q9IA 3H1IE 3VP8A 3G26A 1XTGB 3L70J 2L22A 3TGUJ 4QKOA 1HTLC 2K94A 1FBMA 5KKZC 3H1LJ 1NTZJ 1IFDA 1L0HA 2O1JA 1N7SD 3CMEP 2G8YA 2B87A 3H1ID 5AW4B 2FYNC 2GZJA 2LKIA 3H1HE 3CCRP 1X3OA 1GU5A 1FZCA 3MUDC 3HUSA 5C39A 1X79B 1M1JB 2WT7B 1EDKA 1X9VA 4WYMA 3L74G 3H1HD 2OYHA 1L2PA 4U0AA 1JMBA 3O8ZA 5AW8B 1CSBA 2OYIA 1VQ5P 2L9FA 1HY8A 1SQBD 2KNCA 4GOEA 4DOJA 4OGQD 2NO8A 5AW1B 2KG8A 2AFEA 1L0ND 1VKUA 5KLIC 3H47A 1SFCB 3V2RA 2HG5D 4UHPB 1N7SC 3VYIA 1SQPD 2R5BA 5DCKA 1RNIA 3CPWO 1SLQA 3AEAC 3CXHI 1U7JA 3CD6P 2KIKA 2WSEH 3FGAD 5BS2A 1E5WA 3RL0B 1BE3D 2OYOA 2L5GB 2WSFJ 5APQA 3S9OA 5BS1A 1OW7A 3KQGA 2ZAEB 2CPSA 2E75B 2PEJA 1GW4A 1LTSC 1UIIA 2CK3H 4IFDK 2J58A 1J1EB 4OGQC 2Z46A 3CCUP 1JTHB 3KXDA 1BAJA 2MY5A 3PP5A 2KGCA 1M56D 1M1KQ 3CMAP 1K05A 3MZWB 5TISH 2K9YA 1K8AQ 5APUA
chains in the Genus database with same CATH topology
3B5IA 3RG6C 3CCEP 2E1MA 5HGLA 2M8PA 1YI2P 1VQ9P 2P9XA 3CCLP 3CCRP 3CC2P 3CCSP 1VQNP 1QVFO 3G1IA 3WBHA 1VQ8P 2M8NA 3DTJA 1YJ9P 1VQ4P 4XFXA 3HZQA 2PEMA 4M0IA 3E2DA 1JJ2O 2OTJP 4GR6A 3DS2A 1Q7YQ 1PEOA 1EIAA 5F2NA 3CC7P 2OTLP 5HGNA 2BQ1E 4WYMA 3G6EP 4U0AA 4XROA 3P05A 1KC8Q 1Q82Q 3CXCO 1QVGO 1VQ5P 1EOQA 1Q86Q 1N8RQ 3CC4P 3G0VA 1QRJA 1VQOP 2JO0A 3MGEA 3DS5A 4PH1A 1VQPP 4U0DA 2Z44A 5HGMA 2CWOA 1A43A 1W2BO 2Z45A 4U0BA 1D1DA 1VQMP 2BUOA 4XFYA 1PEMA 3H47A 1RO0A 1YITP 2PEIA 1YIJP 4IPYA 1M6EX 1ZMBA 1M6NA 2EIAA 2PEKA 5DCKA 1IUQA 5JPAA 1K73Q 1VQKP 2KODA 5F2OA 1RNIA 4COCA 3CPWO 3G29A 4XFZA 1S72P 1PEQA 4PH0A 3DS4A 1K30A 1M74A 3I56P 3G71P 2M8LA 3DS3A 5I4TG 1RO2A 2LF4A 3CD6P 1PEUA 2XT1A 3NTEA 1YJWP 2L6EA 5BS2A 1YHQP 1VQLP 1NJIQ 1KD1Q 3G4SP 2JYGA 1VQ7P 2QEXP 2XV6A 2BHVA 1A8OA 5BS1A 1YJNP 1AUMA 2PENA 3LRYA 4U0EA 1M90Q 2QA4P 4U0FA 2PEJA 3HYBA 3DS0A 3G1GA 4U0CA 2PEOA 3G21A 3CCJP 3DS1A 2PY8A 3M1MA 1E6JP 2Z46A 3Q20A 3CCUP 1BAJA 3CCMP 3G26A 3CCVP 4QNBA 2JYLA 3CCQP 3OW2O 5F2KA 2PEQA 3VRLC 3CMAP 1Q81Q 1M1KQ 2ONTA 3H0DA 3DPHA 3H4EA 1KQSO 2DGYA 2EFJA 2XXMA 4XRQA 1K9MQ 1K8AQ 4GR2A 4COPA 5HGOA 3I55P 3CMEP 2OARA 2EG5A 1VQ6P 3G28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC O;  1QVG O;  1VQ5 P;  1N8R Q;  1Q86 Q;  3CCE P;  3CC4 P;  3CCJ P;  3CPW O;  1YI2 P;  1S72 P;  1VQ9 P;  1VQO P;  3CCL P;  3CCR P;  3CC2 P;  3CCU P;  3CCS P;  3I56 P;  1VQP P;  3G71 P;  1QVF O;  1VQN P;  3CD6 P;  3CCM P;  1VQ8 P;  3CCV P;  1YJW P;  1YHQ P;  1W2B O;  1YJ9 P;  1VQ4 P;  1VQL P;  1NJI Q;  3CCQ P;  3OW2 O;  1VQ6 P;  1KD1 Q;  3G4S P;  1VQM P;  1M1K Q;  1VQ7 P;  3CMA P;  1Q81 Q;  1VQK P;  1JJ2 O;  2QEX P;  2OTJ P;  1YIT P;  1Q7Y Q;  1YJN P;  1KQS O;  3CC7 P;  2OTL P;  1M90 Q;  2QA4 P;  1YIJ P;  1K9M Q;  1K8A Q;  3I55 P;  3G6E P;  3CME P;  1K73 Q;  1KC8 Q;  1Q82 Q; 
#chains in the Genus database with same CATH topology
 1FZC B;  5AW5 B;  2XNX A;  1A02 F;  2P9X A;  2N1T A;  3HD7 B;  1L0L J;  3CX5 H;  1R8E A;  1NTK G;  2GUV A;  3VOP A;  1AQT A;  2M8R A;  1PP9 G;  1BGY J;  1PFI A;  1CI6 A;  3DS2 A;  4H13 D;  5E79 H;  4EI2 A;  1S2E A;  2FHS C;  1N8R Q;  2JR8 A;  2QNW A;  1JY3 O;  5H2F H;  1BDD A;  2L0Q A;  1AVO A;  2KB7 P;  1D1D A;  2M5A A;  1PEM A;  3S4R A;  1NO4 A;  5B5E H;  3GMA A;  2GYK A;  2NRG A;  1KZU B;  3RGU A;  2KW2 A;  1S3J A;  1LJ2 A;  2O01 J;  5B66 E;  3L4F A;  3SFD C;  4D6T G;  3G4S P;  4WVZ A;  4H13 C;  1IMP A;  2YXR B;  3R2P A;  5EJD A;  1L4A D;  4I7Z B;  1AUM A;  3MHV A;  2YO3 A;  2W83 C;  1SQX E;  2WSS H;  3HYB A;  3DS0 A;  2PY8 A;  2GDY A;  3R4Y A;  3L71 J;  4O9B A;  2VLQ A;  1SQQ K;  2C0X A;  1CW5 A;  4IFM A;  3HE4 A;  2JBG A;  1ZRT E;  3L75 J;  1CZQ A;  3D6Y A;  1JY2 P;  1IFI A;  2V7Q H;  5AW3 B;  3CCL P;  1JY3 N;  1NKZ B;  2KWL A;  1DEB A;  1L4A C;  3GZL A;  1KOR A;  4GIF A;  1OFC X;  4PJ0 E;  5F2N A;  4PD4 E;  1AYI A;  2K92 A;  3JC2 2;  1HJB A;  1MUU A;  2G3A A;  2R3S A;  1QRJ A;  1VQO P;  1YTZ I;  3EQ2 A;  2C9L Y;  2CPB A;  1GK6 A;  2K9J B;  2E43 A;  1XTC C;  2JU1 A;  1W2B O;  5BU8 B;  2J59 M;  5EW5 E;  4OH8 B;  3NFQ A;  2HR3 A;  1OWA A;  2LML A;  2O01 H;  4TLF A;  3AED C;  3H1K J;  1M6E X;  3HUS C;  2EIA A;  1FOS E;  1P84 E;  2A45 H;  4N3Y B;  1E79 H;  1BDC A;  3L37 A;  1F80 D;  3F89 A;  3VTP C;  3TGU E;  1NU1 G;  3TNU A;  1H8A A;  4F37 A;  1GK4 A;  3WUT A;  1L0I A;  3H1L E;  1EZV E;  2RN0 A;  1NTZ E;  1YJW P;  1RQU A;  3NTN A;  4DZO A;  4U3F D;  1S9K E;  3LRY A;  1SQB J;  3B4Q A;  1LT9 B;  3QH9 A;  3W67 A;  1DD3 A;  1L0N J;  3V6I A;  1OVU A;  3H1I G;  1VDF A;  1T8K A;  2QJP B;  3CCM P;  1IFJ A;  2P67 A;  2WVR A;  2HYN A;  1SQP J;  3EWK A;  1UNK A;  4N78 E;  5BU5 A;  5CCH A;  2EHS A;  1URQ A;  2O01 N;  3E7K A;  3CX5 E;  3H0D A;  1OIP A;  2N1T D;  3ITK A;  3MUD A;  2AEF A;  4XRQ A;  1HQB A;  4L74 A;  2JP3 A;  1X0T A;  3H1H G;  1JEK A;  1N7L A;  1JUN A;  5E79 E;  3CC2 P;  1RE4 C;  1BE3 J;  1QVF O;  4N78 D;  3M0D C;  1MV8 A;  3CX5 D;  2IBZ D;  1KIL A;  1IC2 A;  5H2F E;  2AEJ A;  2ZYG A;  3NMD A;  1IO4 A;  1HH0 A;  3PRJ A;  4NPD A;  4IOI H;  1NTM K;  3NY7 B;  2HLO A;  1RF1 C;  1NHL A;  2YIU C;  1N7S A;  1ZME C;  5HGM A;  1GZL A;  4U0B A;  2DNW A;  1M8O B;  3JCU H;  1AA0 A;  2N1T C;  1YYC A;  4IL6 E;  1YIJ P;  4PV1 D;  2WSC J;  3AE2 C;  1PEQ A;  1RHZ B;  4PH0 A;  3DS4 A;  3L36 A;  2FYU K;  4HKG A;  2LF4 A;  1U7M A;  1W2E A;  5CJ0 A;  1KB9 E;  1NTM J;  3P8M C;  2NPS D;  1PPJ D;  1OR5 A;  4DT0 A;  1WRG A;  1G2C B;  5KKZ B;  1L0L E;  3KZI H;  2RMZ A;  1DD4 A;  2D2C D;  3G21 A;  2GZI A;  1T8Z A;  1OW8 A;  2JKV A;  1S5L H;  1MKM A;  1VF5 D;  1KYO H;  4BRY A;  3EFG A;  3Q1M A;  2JYL A;  4DJG A;  2MJZ A;  3PTZ A;  3V4Q A;  2P10 A;  4PV1 C;  3IF4 A;  1UIX A;  2DGY A;  2EFJ A;  1LWU C;  2PNG A;  1SS1 A;  2KS1 A;  5HGL A;  3Q5P A;  1LP1 B;  3M06 A;  1KV4 A;  4M0I A;  2FXO A;  2NPS C;  3UIA A;  5KLV K;  2KOS A;  3WU2 E;  1X8Y A;  3ABV C;  3V2Q A;  1FDM A;  5HGN A;  5KLI B;  1UJZ A;  2FFD A;  3LW5 J;  4XRO A;  2D2C C;  1KC8 Q;  4L75 A;  1EOQ A;  2K3R A;  2IBZ I;  3CX5 I;  3PLN A;  2VLP A;  5AW6 B;  2BEQ D;  1VF5 C;  4K35 A;  2B89 A;  1VQM P;  1N2D C;  2XZ1 C;  3MIW A;  4H2Y C;  4IPY A;  4ASW A;  3CXH E;  4KHX A;  1LTB C;  1Y47 A;  2P2U A;  2RKL A;  3L71 E;  3VN0 A;  3SSU A;  2M8L A;  2IFN A;  3A0H H;  4HB1 A;  3USS A;  2M0B A;  2JJL A;  1LTJ B;  3L75 E;  4BPG A;  3N7N A;  1SQX G;  1HGV A;  2QA4 P;  2N5I A;  2FYZ A;  3L73 J;  5CCH D;  1H89 A;  2IDB A;  1URQ D;  3AE7 C;  3L75 D;  1KIL E;  4OVN F;  4R4M A;  5KTB A;  4QMA A;  2K88 A;  1Q81 Q;  5CCG A;  1GD2 E;  2ZT9 D;  5APX A;  3CLQ A;  5AVX B;  3AEG C;  2KS1 B;  4GR2 A;  1VQ6 P;  1FZA A;  1MZ8 A;  3RG6 C;  1KIL D;  1JY2 O;  3AE9 C;  1L4A A;  3H25 A;  2FY8 A;  2POH A;  4U3F J;  1LNQ A;  1GL2 B;  3AEC C;  3H1K E;  1SQQ D;  1T3J A;  1JJ2 O;  1GXH A;  2W6A A;  1EIA A;  2L91 A;  2LL8 A;  5APV A;  2KOP A;  4BPF A;  1PZQ A;  4H44 B;  3JCU E;  4Y28 J;  1RF0 C;  1A02 J;  1S5L X;  5CCH C;  2N6Y A;  3MGE A;  1URQ C;  3H1K D;  2P58 A;  4I1L A;  4RJT A;  1KFN A;  3IN6 A;  3RK2 B;  1SQB E;  1GDT A;  1KFM A;  2BCC J;  2ZT9 C;  2K93 A;  2PAJ A;  3P32 A;  5AVW B;  3RK3 D;  3U43 A;  4IFF A;  3Q5S A;  1J1D C;  1VL2 A;  1L0N E;  4H13 B;  3B4S A;  1M6N A;  3L70 G;  1IK7 A;  1KIL C;  2IX7 C;  3TGU G;  5AVU B;  3KDP B;  1OXZ A;  1SQP E;  3H1L G;  3SFE C;  1EZV G;  1NTZ G;  3HE5 A;  1IJD B;  4EYY Q;  1S5L E;  2A45 I;  2XV6 A;  2V4H A;  3MD0 A;  4H0L D;  3O6Q A;  2XZR A;  2JO1 A;  3EFF K;  1AQ5 A;  1BE3 E;  2O1K A;  1RQV A;  1VPC A;  2K1A A;  3DS1 A;  1NTK K;  2ZXE B;  2E74 D;  2VLO A;  4C46 A;  1KYO D;  4JF7 A;  4QNB A;  5CBN A;  1H0T B;  2LR2 A;  5AVQ B;  1JMM A;  4JPZ B;  3RK3 C;  1PGO A;  2WZ7 A;  1RE4 A;  3M0D A;  1ACP A;  5KAF E;  1L4A B;  4U7J A;  2LTE A;  4RO0 A;  3KYQ A;  1AF8 A;  3CCS P;  3G1I A;  4NEO A;  1JCC A;  1FAV A;  3HZQ A;  2QJK B;  1RF1 A;  2FXM A;  1LGH B;  1PEO A;  2LXB A;  4H0L C;  3FXE A;  2XU6 A;  2B87 B;  3G6E P;  2HOD A;  1BCC D;  2MR7 A;  1QVG O;  4XFJ A;  2E74 C;  3Q3D A;  3HUS B;  1NTM E;  3V2N A;  2I8D A;  1KLP A;  1AFO A;  1R5L A;  3H1J D;  2N9B A;  3L72 J;  1PGJ A;  5GTH H;  2OYH B;  2LXC B;  2V7Q J;  2KZJ A;  1FZG A;  2OYI B;  1NTM D;  2KNC B;  2A06 D;  1OMI A;  5AW2 B;  3HE5 B;  4W80 A;  4UB6 H;  1FJK A;  3G71 P;  4GKG A;  1HWT C;  3I5C A;  1PEU A;  3NTE A;  1Y8A A;  5GTI H;  2FFD C;  2JDI H;  5TJH A;  1DNY A;  2IPP A;  1L0L G;  3OA7 A;  5CBO A;  2H88 C;  3BCC D;  2KYV A;  1BGY G;  3M1M A;  5CCG D;  3D6Z A;  1LWU A;  5DJT B;  2MD9 A;  1AV1 A;  1TU3 F;  3A2A A;  2M3E A;  3VRL C;  3GKL C;  2PRR A;  1KYO I;  3G28 A;  2NPS A;  4C7N A;  2M8P A;  1KQF B;  2K0Y A;  1M1J C;  2YKO A;  1RH5 B;  2WMM A;  1LTI C;  1VQ8 P;  3CWB J;  2YIU B;  3AEF C;  4OWF A;  2N50 A;  1ZN5 A;  3CC7 P;  2N1T B;  1NU1 K;  1Z6M A;  2Z5H A;  2PGD A;  2H43 A;  2A45 G;  5CCG C;  4PH1 A;  3SWY A;  4R0M A;  3GF3 A;  4YPC A;  2XDJ A;  2BEZ F;  1CI6 B;  3G3Z A;  3TSI A;  5KLV D;  3A0B H;  1QEX A;  3H6P A;  3WMM 0;  2N6Z A;  1ZLL A;  3L73 E;  4C7R A;  3RBX A;  1EMV A;  2PEK A;  3HD7 D;  1M57 D;  3L71 G;  2W90 A;  2KOD A;  4H2X C;  3GW6 A;  4R4L A;  2FQ0 A;  1S72 P;  3V4W A;  2Z4E A;  1E0H A;  4TT3 H;  1SQQ J;  2P7J A;  2YXQ B;  2QG4 A;  1KTM A;  2M5A B;  1VQL P;  2Q3I A;  2Q1K A;  3L75 G;  3L73 D;  5L8R J;  4AYC A;  2JAZ A;  2RH0 A;  1A8O A;  1OX3 A;  1SQV G;  1J1E C;  2R5D A;  1G1I A;  1NYH A;  2GZF A;  4U3F E;  4PV1 B;  1JM0 A;  4WY4 A;  4ZNC A;  2K37 A;  2E5Y A;  3A7O A;  3G9R A;  2YMY A;  2HPC A;  1LTG C;  3A3Y B;  3HD7 C;  1HUC A;  3B5I A;  2AXC A;  2K0D X;  5TIS E;  2BCC E;  2SPZ A;  1JOC A;  2MR8 A;  2M8N A;  2GM4 A;  3H1K G;  5K5G B;  1VF5 B;  1RF0 A;  1HF9 A;  2KOG A;  4PWV B;  3KPE A;  4N6J A;  3HE4 B;  1FU1 A;  1HGZ A;  1ZP0 C;  2IBZ E;  5AVS B;  4XE5 B;  2BCC D;  5EFW B;  3RBZ A;  2M3B A;  5GTH E;  3DS5 A;  3H32 A;  2Z44 A;  1SQB G;  4XA4 A;  3U59 A;  3M91 A;  2W27 A;  1L0N G;  4KT0 J;  4CPG A;  1SP4 A;  2JEE A;  3W68 A;  1MFT A;  1ZW0 A;  2VRS A;  1OZH A;  2WPR A;  3PHL A;  2NZ2 A;  2H89 C;  1SQP G;  1MFZ A;  5B5E E;  4I7Z C;  1KD1 Q;  4CA3 A;  1BCC J;  1YJN P;  1BE3 G;  1Q90 D;  2K0X A;  5AW7 B;  4U0F A;  4MRT C;  1PPJ E;  3VP9 A;  3TNU B;  3H1J J;  1LT1 A;  5KAI H;  2QM8 A;  4MN4 C;  1WT6 A;  2KXP B;  4A7P A;  2FBW C;  3LIE A;  1FZF A;  1FZE A;  3FXD A;  3OJA B;  2FVF A;  1J2J B;  1IK9 A;  4LGD E;  2PP6 A;  2XXM A;  4COP A;  3I55 P;  2P1J A;  4L73 A;  2WPT A;  1NTK D;  3B5N D;  3L72 E;  2UWJ E;  2R32 A;  1PP9 D;  3WBH A;  2BAS A;  2FYN B;  1K04 A;  1YJ9 P;  1VQ4 P;  1URQ B;  2KOR A;  4B86 A;  1Q7Y Q;  3GHG C;  4I2L C;  3BCC J;  4NPF X;  1FR2 A;  2FYU J;  4YXD C;  3A0B E;  3KHU A;  3L72 D;  3P05 A;  1J1D B;  2Y0D A;  5AW0 B;  1Q86 Q;  1FC2 C;  1WMK A;  1EQ7 A;  2QSI A;  1G1J A;  1KIL B;  1Q2N A;  2AFD A;  4JBZ A;  1SQX K;  4D6T E;  4XFY A;  3CL3 D;  1S4X A;  4M3L A;  4BXL A;  4ZKP A;  2Q3E A;  2QVA A;  3MP7 B;  2CG5 B;  2KOO A;  3GJN A;  3BAS A;  3B5N C;  1N7S B;  5DJU B;  1LTA C;  4D6T D;  5KJ7 A;  4YXW H;  2XT1 A;  1IFP A;  2QE7 H;  2K5X A;  4KJM A;  4RKU J;  1FDI A;  2IZ1 A;  4WY4 D;  1MZ9 A;  4U0E A;  3RK3 B;  1NQ4 A;  4I6M C;  3CWB E;  5KLV J;  4EDF A;  3AE1 C;  4AUW A;  4Z1M H;  2LIW A;  4OGQ B;  1M1J A;  4WBA A;  4W7Z A;  3AE8 C;  3C1L A;  2OQQ A;  2WT7 A;  3D71 A;  3B71 A;  3CWB D;  3S1K A;  4H0L B;  5AVV B;  2QJY C;  1N86 A;  1VQ9 P;  4HYT B;  4BRY B;  1YQ4 C;  2GZE A;  2E74 B;  3GLM A;  3GF7 A;  4XFX A;  2I1J A;  2FQ1 A;  1PGQ A;  4WY4 C;  4K3A A;  4LLH A;  4EOT A;  1SQQ E;  4WB4 A;  1HBW A;  2ZVO B;  1Q82 Q;  1NTZ K;  3CC4 P;  4JYB A;  2JO0 A;  3B8E B;  2WQY C;  2KP8 A;  5AVR B;  5CMZ A;  3Q2Y A;  1W5C E;  2J5U A;  4AQR D;  1NKN A;  3TYY A;  2FXP A;  3U1A A;  1RE3 C;  3L73 G;  2FFD B;  2W6B A;  3AE6 C;  2LIU A;  1ZMB A;  5JPA A;  1K73 Q;  1JNM A;  1NU1 D;  3RK3 E;  2KGA A;  2KSE A;  3G29 A;  1EDJ A;  3AE3 C;  1ZOY C;  3L74 J;  1DV5 A;  1JTH A;  4PXH B;  5APY A;  2L6E A;  5KAI E;  1D7M A;  2KI7 B;  2QEX P;  3CI9 A;  3VMX A;  2LOL A;  3WUU A;  1X22 A;  1GU4 A;  2CGQ A;  4U3F G;  1T6A A;  4HJG H;  2O3J A;  3CCJ P;  3AEE C;  2KUB A;  4Y99 C;  2ZXX A;  3Q20 A;  1ZXG A;  2KSJ A;  3KZI E;  3HD7 A;  3FX0 A;  3IFM A;  5BVZ A;  3D70 A;  1KYO E;  3DPH A;  3E1I A;  2E76 D;  1K9M Q;  1OVR A;  2QRX A;  1GPJ A;  2BCC G;  2E42 A;  1KQG B;  3QWO C;  4EIJ A;  1ZNV A;  1GXG A;  3C8V A;  4PJ0 H;  4PD4 H;  2ITA A;  1JY2 N;  1PV3 A;  3IAO A;  2IBZ G;  3FWL A;  3NXS A;  2KZI A;  3VMY A;  3AEB C;  2GUS A;  4GDO A;  1DX7 A;  2MF4 A;  1NAF A;  2JQ4 A;  3G0V A;  3F5H A;  1VQP P;  1BCC E;  2CWO A;  2C9N Y;  1QX8 A;  1P84 H;  1L0L K;  2BUO A;  1RO0 A;  1YIT P;  1JO5 A;  2N5H A;  2E76 C;  3H1J E;  2PEI A;  2XKM A;  1NTK J;  4DG9 A;  5KJ7 D;  1PP9 J;  2QIW A;  2YKP A;  1GL2 D;  1LTJ C;  3M9H A;  1FOS F;  1RO2 A;  2A06 E;  1LTT C;  2JWD A;  1NH4 A;  4H44 D;  3EJE A;  5HV8 A;  3GG2 A;  3A0H E;  1M90 Q;  1PPJ G;  2CQ8 A;  2QM7 A;  2WPQ A;  2KOQ A;  4ZKU A;  2Y0C A;  3RK2 D;  1H88 A;  2GDW A;  1KMI Z;  3CCV P;  3BCC E;  1N73 C;  3SWF A;  2ZVN B;  2FYU E;  3FWN A;  4LC1 A;  2AXT H;  3O6Q B;  1GMJ A;  1KQS O;  5CJ4 A;  4H2W C;  1DEE G;  4ASV A;  5KJ7 C;  1T3U A;  4D6T J;  3L72 G;  2WPV B;  1GL2 C;  3GHG A;  4JYC A;  2ZYD A;  3JSV C;  2FYU D;  2IYP A;  2K9J A;  3DTJ A;  1SFC D;  5AVT B;  4H44 C;  2ZYA A;  1VHN A;  3E1R A;  1NVO A;  2OTL P;  2LPK A;  2BQ1 E;  2WWW A;  1EDL A;  2Q7C A;  2WSF H;  3RK2 C;  3U1C A;  3L35 A;  4U0D A;  3RL0 D;  1A43 A;  3M0A A;  4IL6 H;  1RF1 B;  1IFM A;  2R3C A;  2Z45 A;  2FKW B;  3M9B A;  1SQV K;  3B5N A;  2E75 D;  1PL5 A;  2HOD B;  2LKM A;  5KLV E;  5CZD B;  2Q6Q A;  1LT9 A;  5F2O A;  3IR9 A;  1KB9 H;  1HVV A;  1M74 A;  3DS3 A;  5I4T G;  4BPH A;  1SFC C;  1FJP A;  2W6J H;  2AEM A;  1SQX D;  1YBK A;  3BVH A;  4JQ0 D;  3CWB G;  1CEI A;  4U0C A;  1BSH A;  2VLN A;  1SQV J;  3RL0 C;  3P7K A;  2H7H A;  3BRT B;  2ZJS E;  3OW2 O;  1ZRT D;  1GTW A;  2E75 C;  1NU1 J;  3RL0 g;  4YTP C;  1ZR2 A;  1OW6 A;  1NGM B;  5AVZ B;  1QL2 A;  3GHG B;  3CCE P;  1EDI A;  1SQB K;  2QJK C;  1LWU B;  3WU2 H;  2IYO A;  1EXI A;  4WWI A;  1L0N K;  2JU2 A;  4PD4 D;  1NWQ A;  1Y9B A;  3H1I J;  2WIT A;  1BSN A;  2MVU A;  1FZC C;  1SQQ G;  1SQP K;  2KG6 A;  2MKV A;  2NPS B;  4C7N B;  2KGE A;  4GOD A;  1KN7 A;  3L74 E;  3L70 E;  3CXC O;  2KK7 A;  3BRV B;  1RE3 A;  2ZFC A;  2D2C B;  3B5N B;  2OYH C;  4IZ6 A;  3H1H J;  5KP8 B;  2OYI C;  3CXH H;  2YMK A;  1P84 D;  2K2Q A;  3L74 D;  3WUV A;  3L70 D;  1USD A;  1YQ3 C;  2CNR A;  3TGU D;  3TDK A;  1G2C A;  1GW3 A;  3H1L D;  1EZV D;  1NTZ D;  1QGK B;  2KR5 A;  2JGP A;  4UB8 H;  2L4B A;  2XZ0 D;  1S9K D;  1YHQ P;  2Y0E A;  4NPE A;  4BWN A;  3MTU E;  2JYG A;  2R44 A;  4UB6 E;  1KQL A;  3AE5 C;  4GT1 A;  5GTI E;  1FE6 A;  3CE7 A;  2AXT E;  1IFN A;  3RG2 A;  5CHX A;  2M5R A;  4IL6 X;  1LP1 A;  2QJY B;  2IFM A;  1JB0 J;  3M9Q A;  1NAY A;  3A5T A;  2ONT A;  3H4E A;  2JB0 A;  2H8P D;  5HGO A;  2ROQ A;  2OAR A;  3VMZ A;  4WY4 B;  2FVA A;  2EG5 A;  3C9I A;  2B9B A;  1YI2 P;  3P8C E;  4W7Y A;  2DW3 A;  1Z56 A;  2AF8 A;  1OVV A;  2HPC B;  2FVE A;  3HTK A;  5HVC A;  2B88 A;  1NTK E;  1PGP A;  2OTJ P;  4GR6 A;  1NOH A;  1R5S A;  1PP9 E;  1FS0 E;  3P8C D;  2ERH A;  1AVY A;  5AVY B;  1ZR4 A;  4PD4 I;  1JY3 P;  1BCC G;  1DIP A;  2GZG A;  3AE4 C;  1EXJ A;  1IMQ A;  3MGN A;  2OTK E;  2PFX A;  3H1J G;  2N98 A;  1SVF A;  1LTJ A;  2WTY A;  1FDO A;  2ZT9 B;  1IUQ A;  1M7L A;  1VQK P;  1PIX A;  3VMA A;  1DH3 A;  1EC5 A;  3H32 B;  4COC A;  1T2K D;  4XFZ A;  1KB9 D;  1NTM G;  1BGY E;  1P84 I;  2A06 G;  1YTZ T;  7CEI A;  4Y99 B;  1NJI Q;  2E5T A;  1VQ7 P;  1AJY A;  1L0L D;  1EZV I;  3T97 A;  2XV5 A;  2BHV A;  2MVV A;  2PEN A;  1N73 A;  1BGY D;  2GDX A;  1USE A;  4HKZ H;  3G1G A;  2PEO A;  3EJB A;  3OAK A;  2XND H;  2IZ0 A;  2JWA A;  3BCC G;  3V2P A;  2C0W A;  2FYU G;  3CCQ P;  5KAF H;  5F2K A;  2PEQ A;  1LT9 C;  1GL2 A;  3BAT A;  3N4X A;  3GZM A;  3LID A;  1IZN B;  2KGD A;  1T2K C;  2QJP C;  2E1M A;  2WSC H;  3PH0 A;  1VQN P;  1SQX J;  2I1K A;  3HTK B;  1ZV8 A;  2YO2 A;  3EJD A;  3TF5 A;  4GOF A;  2PEM A;  3E2D A;  3SWK A;  5APT A;  1QLE D;  4DCK A;  2HFE D;  5KP7 B;  2OGU A;  2KG9 A;  1FZB A;  2FAE A;  2AVA A;  2E76 B;  4L76 A;  2Z5I A;  1BXI A;  2GA1 A;  3K5B A;  5KP6 B;  2YKQ A;  1JCD A;  1HJ0 A;  5M1B A;  3Q5R A;  2FAD A;  2FAC A;  3LMO A;  4UB8 E;  2N9Y B;  1U57 A;  3CXH D;  3V5B A;  3L71 D;  2YNY A;  2W8Z A;  5KLV G;  1SFC A;  1SQV E;  2Y9Y A;  1S1C X;  1K30 A;  3I56 P;  2VSQ A;  1NU1 E;  1QL1 A;  3T97 B;  4ZMD A;  3ZDM A;  1SQV D;  2Y9Z A;  1H0T A;  5APS A;  5APW A;  1N73 B;  1KB9 I;  2WPS A;  3HRN A;  3II6 A;  4HH2 A;  2KLU A;  2EHT A;  2FQ2 A;  2KLV A;  2Q5U A;  2WSE J;  5B66 H;  2X2B A;  1RY3 A;  3TK1 A;  1E6J P;  3PJS K;  3LW5 H;  4RES B;  5AW9 B;  2Q9I A;  3H1I E;  3VP8 A;  3G26 A;  1XTG B;  3L70 J;  2L22 A;  3TGU J;  4QKO A;  1HTL C;  2K94 A;  1FBM A;  5KKZ C;  3H1L J;  1NTZ J;  1IFD A;  1L0H A;  2O1J A;  1N7S D;  3CME P;  2G8Y A;  2B87 A;  3H1I D;  5AW4 B;  2FYN C;  2GZJ A;  2LKI A;  3H1H E;  3CCR P;  1X3O A;  1GU5 A;  1FZC A;  3MUD C;  3HUS A;  5C39 A;  1X79 B;  1M1J B;  2WT7 B;  1EDK A;  1X9V A;  4WYM A;  3L74 G;  3H1H D;  2OYH A;  1L2P A;  4U0A A;  1JMB A;  3O8Z A;  5AW8 B;  1CSB A;  2OYI A;  1VQ5 P;  2L9F A;  1HY8 A;  1SQB D;  2KNC A;  4GOE A;  4DOJ A;  4OGQ D;  2NO8 A;  5AW1 B;  2KG8 A;  2AFE A;  1L0N D;  1VKU A;  5KLI C;  3H47 A;  1SFC B;  3V2R A;  2HG5 D;  4UHP B;  1N7S C;  3VYI A;  1SQP D;  2R5B A;  5DCK A;  1RNI A;  3CPW O;  1SLQ A;  3AEA C;  3CXH I;  1U7J A;  3CD6 P;  2KIK A;  2WSE H;  3FGA D;  5BS2 A;  1E5W A;  3RL0 B;  1BE3 D;  2OYO A;  2L5G B;  2WSF J;  5APQ A;  3S9O A;  5BS1 A;  1OW7 A;  3KQG A;  2ZAE B;  2CPS A;  2E75 B;  2PEJ A;  1GW4 A;  1LTS C;  1UII A;  2CK3 H;  4IFD K;  2J58 A;  1J1E B;  4OGQ C;  2Z46 A;  3CCU P;  1JTH B;  3KXD A;  1BAJ A;  2MY5 A;  3PP5 A;  2KGC A;  1M56 D;  1M1K Q;  3CMA P;  1K05 A;  3MZW B;  5TIS H;  2K9Y A;  1K8A Q;  5APU A; 
#chains in the Genus database with same CATH homology
 3B5I A;  3RG6 C;  3CCE P;  2E1M A;  5HGL A;  2M8P A;  1YI2 P;  1VQ9 P;  2P9X A;  3CCL P;  3CCR P;  3CC2 P;  3CCS P;  1VQN P;  1QVF O;  3G1I A;  3WBH A;  1VQ8 P;  2M8N A;  3DTJ A;  1YJ9 P;  1VQ4 P;  4XFX A;  3HZQ A;  2PEM A;  4M0I A;  3E2D A;  1JJ2 O;  2OTJ P;  4GR6 A;  3DS2 A;  1Q7Y Q;  1PEO A;  1EIA A;  5F2N A;  3CC7 P;  2OTL P;  5HGN A;  2BQ1 E;  4WYM A;  3G6E P;  4U0A A;  4XRO A;  3P05 A;  1KC8 Q;  1Q82 Q;  3CXC O;  1QVG O;  1VQ5 P;  1EOQ A;  1Q86 Q;  1N8R Q;  3CC4 P;  3G0V A;  1QRJ A;  1VQO P;  2JO0 A;  3MGE A;  3DS5 A;  4PH1 A;  1VQP P;  4U0D A;  2Z44 A;  5HGM A;  2CWO A;  1A43 A;  1W2B O;  2Z45 A;  4U0B A;  1D1D A;  1VQM P;  2BUO A;  4XFY A;  1PEM A;  3H47 A;  1RO0 A;  1YIT P;  2PEI A;  1YIJ P;  4IPY A;  1M6E X;  1ZMB A;  1M6N A;  2EIA A;  2PEK A;  5DCK A;  1IUQ A;  5JPA A;  1K73 Q;  1VQK P;  2KOD A;  5F2O A;  1RNI A;  4COC A;  3CPW O;  3G29 A;  4XFZ A;  1S72 P;  1PEQ A;  4PH0 A;  3DS4 A;  1K30 A;  1M74 A;  3I56 P;  3G71 P;  2M8L A;  3DS3 A;  5I4T G;  1RO2 A;  2LF4 A;  3CD6 P;  1PEU A;  2XT1 A;  3NTE A;  1YJW P;  2L6E A;  5BS2 A;  1YHQ P;  1VQL P;  1NJI Q;  1KD1 Q;  3G4S P;  2JYG A;  1VQ7 P;  2QEX P;  2XV6 A;  2BHV A;  1A8O A;  5BS1 A;  1YJN P;  1AUM A;  2PEN A;  3LRY A;  4U0E A;  1M90 Q;  2QA4 P;  4U0F A;  2PEJ A;  3HYB A;  3DS0 A;  3G1G A;  4U0C A;  2PEO A;  3G21 A;  3CCJ P;  3DS1 A;  2PY8 A;  3M1M A;  1E6J P;  2Z46 A;  3Q20 A;  3CCU P;  1BAJ A;  3CCM P;  3G26 A;  3CCV P;  4QNB A;  2JYL A;  3CCQ P;  3OW2 O;  5F2K A;  2PEQ A;  3VRL C;  3CMA P;  1Q81 Q;  1M1K Q;  2ONT A;  3H0D A;  3DPH A;  3H4E A;  1KQS O;  2DGY A;  2EFJ A;  2XXM A;  4XRQ A;  1K9M Q;  1K8A Q;  4GR2 A;  4COP A;  5HGO A;  3I55 P;  3CME P;  2OAR A;  2EG5 A;  1VQ6 P;  3G28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...