1W2BO

Trigger factor ribosome binding domain in complex with 50s
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1w2bO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1w2bO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1w2bO03
1K73Q 1N8RQ 1NJIQ 1VQMP 3CPWO 1YI2P 3CC4P 3CCQP 1YHQP 3CD6P 1KD1Q 1W2BO 1VQNP 1YJNP 3G6EP 1VQ7P 1QVFO 1YIJP 1VQPP 1VQOP 3CCMP 3I55P 3CCUP 2QA4P 3CMEP 1Q86Q 1VQ8P 3CMAP 1YJ9P 3CCEP 3CC2P 3CCJP 1VQ4P 3G71P 1JJ2O 1QVGO 3OW2O 1K9MQ 1KC8Q 1VQ5P 1K8AQ 2OTLP 1Q82Q 1Q7YQ 1Q81Q 1KQSO 1VQLP 3CCLP 1M90Q 3G4SP 1VQ6P 1YJWP 3CCRP 2QEXP 3CCVP 3I56P 3CCSP 1S72P 2OTJP 1M1KQ 1YITP 1VQ9P 3CXCO 1VQKP 3CC7P
chains in the Genus database with same CATH superfamily
1VQMP 3WUUA 1G2CA 1IO4A 3EJDA 2LPKA 1OIPA 5AVRB 3FXEA 1KYOD 1SQPE 3U43A 2OYIA 2Y0DA 1QVGO 5APTA 1RQVA 1QX8A 3MZWB 1KFMA 2YXQB 1YBKA 3CXCO 2W6JH 5CZDB 3CPWO 3H1IG 1LTBC 1HTLC 2GZFA 1G2CB 1VQOP 2PP6A 3N4XA 3L74G 4R4LA 1ZN5A 2G8YA 3E1RA 1FDMA 2BEQD 2HODB 2K1AA 1FJKA 3AE8C 5KTBA 5KJ7A 1M1JB 2XZ1C 1WRGA 2FYZA 2JB0A 2VRSA 2JP3A 1T3JA 2OTKE 2HR3A 1BDDA 3WMM0 3H1JE 2YO2A 4CPGA 2KXPB 2H8PD 1EDLA 3PHLA 4U3FD 1JEKA 1SQBG 1KILC 4IL6X 1SFCA 1KMIZ 1X79B 1NVOA 1BCCG 1OZHA 1SQPJ 5AW0B 1ZR4A 1JM0A 4EI2A 5AVXB 3BASA 2A06D 3I55P 2E75D 1IJDB 4H13B 2C0XA 2P1JA 1GL2D 2ERHA 3SFEC 4B86A 2P58A 1AFOA 3V2RA 1L4AB 3E2DA 2L22A 1QGKB 1GMJA 2N1TB 1KTMA 3MUDC 3L71J 1NGMB 1NTKE 3AECC 4HYTB 3KZIH 4HKGA 4AYCA 3ZDMA 2EG5A 3L36A 4UB8E 3GF3A 5HGNA 1SQXJ 2RMZA 2Y9YA 1T6AA 1H0TB 3H1JJ 4OGQB 1VQ6P 3VOPA 3EJBA 1PGJA 1D7MA 3CC7P 3HZQA 2KUBA 3CC4P 4DJGA 4WWIA 3Q20A 5F2OA 1AQTA 1YJNP 3G6EP 5AVYB 2QA4P 2IFMA 5BVZA 2A45G 2K0YA 2AXCA 3G29A 1KV4A 1YQ3C 3L73G 2KSEA 1PEMA 4R4MA 1K30A 1AQ5A 1JOCA 1OW8A 2EHSA 1P84H 2IBZI 3IR9A 1CZQA 3C9IA 2KWLA 3AE5C 2M8NA 2PEQA 3H6PA 5APSA 2OGUA 3VN0A 1NTKJ 2KS1A 2N9BA 3QH9A 1LWUA 2KOOA 2O01N 2KI7B 3CCQP 4I7ZC 1KB9I 1SQVJ 2LXBA 3CLQA 1E5WA 3KXDA 2AEJA 2AXTE 1JCCA 4N6JA 1JNMA 2E74D 1GL2C 3CX5H 2M5AA 1Q81Q 5KLVD 1Q2NA 4JYCA 2OYHA 1LTJB 1NU1G 3P05A 3AE6C 2C9NY 2R3CA 1N7SA 1S9KE 2LIUA 2KNCA 2ZXEB 2HPCB 3TK1A 2ZYDA 4XFJA 1KYOH 3CCEP 2IBZD 1W5CE 5KJ7D 3H1IE 2R32A 2KOSA 2NPSB 2M5AB 3V4QA 3VMXA 1IUQA 1LGHB 2P10A 1PGPA 2XZRA 1BSNA 3JCUH 2QJYC 2KNCB 2IYOA 5CJ4A 1NTMG 1NAYA 1KB9D 1BGYG 1SFCD 1CI6A 1YJWP 1HGZA 2J58A 1N73A 1N8RQ 3H1LJ 2Q7CA 1SQBE 3TGUD 3CD6P 3HUSB 1A43A 2BCCG 2JWAA 1BCCE 2Q9IA 3MP7B 1HY8A 3GLMA 2W90A 1KN7A 5GTIH 2ZT9B 1S5LH 3GZMA 2O01H 1ZW0A 4IL6H 1IZNB 1MFZA 4YXDC 2LOLA 5KAIH 3AE9C 1PP9J 3M06A 4GT1A 4EDFA 4O9BA 4H0LB 3IF4A 1D1DA 1KORA 2OYIC 1M1JC 2E74C 1OWAA 4L76A 1VQLP 2KYVA 2QEXP 3HE4B 2RH0A 2JJLA 2FKWB 1K73Q 1IFNA 2VLPA 4U3FG 1M6NA 1EMVA 3HTKB 3USSA 1SQQD 4GR6A 1SQBJ 4GIFA 1AVOA 2GDYA 2KOPA 4XE5B 2LMLA 4IFFA 2XKMA 3G26A 2A06G 1JY3P 1BE3J 2WPRA 1DD4A 4H13C 1LT9A 3CMEP 3IAOA 2P7JA 3JSVC 4JYBA 5B5EH 3KZIE 2ZYAA 1URQA 2YO3A 3L72D 1Q90D 4WYMA 2E43A 1PZQA 2FAEA 4M0IA 3MUDA 3PP5A 2KOQA 3RK3D 1XTGB 1A02J 3V5BA 2H89C 4I2LC 1LT9B 1IK7A 4PV1B 2JR8A 3L70G 4OGQC 1T8KA 1URQB 2WSEJ 3FWLA 1N7SD 2KB7P 1UIXA 3MTUE 2IX7C 2Z44A 3N7NA 2KGDA 1NU1E 2E1MA 2KZIA 1DIPA 1P84E 2FYNB 4YTPC 1A02F 2GDXA 3S4RA 3HE5A 5AVUB 2FHSC 2QJPB 5GTHH 2HLOA 1GU4A 2WT7A 4BPGA 2XXMA 5JPAA 3M9BA 4NPEA 1VQPP 3H1HD 1CEIA 2FADA 2ZJSE 3G1IA 4PH0A 1J1EB 5AW8B 5DJUB 3VYIA 1L0LE 3CX5E 1NTME 1R5LA 2E5TA 3B71A 4GR2A 2L6EA 1LTGC 2JAZA 1EDKA 1DX7A 2JEEA 2WVRA 1FZGA 2WT7B 2WSFJ 1KB9H 1S1CX 1AV1A 4NPFX 2QG4A 1NKNA 5M1BA 1KYOE 1KQSO 2QSIA 2BCCE 5I4TG 2I1KA 2K92A 4W7ZA 2FXPA 1S72P 1NU1J 1VQ9P 3GHGB 2WSSH 3Q5SA 3RBZA 1IMQA 2QRXA 2IBZG 2NPSC 4YXWH 1L0NJ 2AFDA 2R44A 1SLQA 2M3BA 2CGQA 2FYUD 2BUOA 3VTPC 3WBHA 1NTZD 1OVUA 3H4EA 1L0LJ 1HH0A 3LW5J 2YKQA 2QE7H 2KORA 1FAVA 2ONTA 4JQ0D 2GZGA 1RO0A 3Q1MA 3TGUG 2DW3A 3VP8A 3Q5PA 3W68A 5GTIE 3D6YA 3CWBG 4UB6E 3HUSC 2D2CD 3P32A 4IL6E 1VKUA 1PFIA 4PV1D 5KAIE 1QL2A 2BCCJ 1GW3A 1URQD 3B5NB 5BS1A 2YKOA 2A06E 2ZT9C 4PJ0H 1JJ2O 1L0ND 1OX3A 2GYKA 4U0CA 2B89A 3Q3DA 3BVHA 3EWKA 5AW5B 3M91A 4H0LC 1JY3O 1QLED 4H44B 3M1MA 1FOSE 2ZAEB 4OH8B 2HODA 2KK7A 2L5GB 1M1JA 1HJBA 4WVZA 1AVYA 2V7QJ 5HGOA 2K3RA 4XROA 3L70E 1OFCX 3KQGA 2K0DX 3E7KA 3Q5RA 4K35A 4XFZA 3IN6A 3OAKA 2MJZA 1SQQG 3L75G 4D6TJ 2HFED 3DTJA 4ASWA 2Y9ZA 3EFGA 3RK2B 3AE3C 3M0AA 2JO1A 4EYYQ 3V4WA 4KT0J 2AF8A 3L72G 1S5LX 3RBXA 1L4AA 3NXSA 4PWVB 4Z1MH 2LTEA 1A8OA 3CCRP 2N1TA 3CL3D 4U0AA 2GDWA 2WSCH 2E76B 1KD1Q 2D2CC 1LT9C 2L91A 2OQQA 4PV1C 3A0HH 1URQC 4QMAA 1M74A 2PEIA 5APYA 1H0TA 3L70J 5CMZA 4D6TD 3A0BH 5DCKA 5CCGA 2GUVA 4PD4I 1T8ZA 1PGQA 3GMAA 1GD2E 2VSQA 3WU2E 4IOIH 1JY2N 4N78E 1EZVG 1PGOA 5DJTB 5GTHE 2FYNC 1FOSF 1L0HA 2M5RA 2UWJE 5KP8B 2O1JA 4L74A 4H2XC 2MR8A 2JDIH 2QJKB 1VF5B 2FY8A 2ZVNB 4GODA 1ZMBA 2M8PA 3KDPB 1SQPD 1SQXK 2FVFA 3H1HG 3TNUA 1DV5A 3LMOA 3LIEA 3MGEA 4NPDA 1J1EC 2QIWA 1WT6A 3P8CD 1ZLLA 1KB9E 4BRYB 1HQBA 5KKZC 2LL8A 1ZRTD 1FS0E 1HGVA 4C46A 1NJIQ 1FZFA 1H89A 3L71D 4PD4D 4WY4B 2KIKA 3TNUB 5KLVK 1IFIA 3V6IA 3TGUE 3CWBE 4COPA 1SQXD 1J1DB 1BDCA 2R3SA 2V4HA 3H1KG 3G4SP 3A5TA 3H1JD 3GHGC 2EFJA 1LTJA 2BASA 3CCSP 3LRYA 2P67A 1U7MA 4H2YC 1RE3A 2HPCA 2Q5UA 4OWFA 4BPHA 1FJPA 1OW7A 2XV6A 1NWQA 2NPSA 5H2FE 2Q3IA 3CCLP 1NAFA 1DEBA 1SQVK 2FYUG 3DS1A 3HYBA 5CJ0A 2RN0A 5CCHA 4AUWA 1JTHB 3AEEC 3R2PA 1RF1B 4YPCA 1GPJA 5AW9B 4K3AA 3T97B 1Z56A 1EQ7A 5KAFE 2Q6QA 5KLIC 3G71P 5E79H 1M57D 3D71A 4PJ0E 1KQFB 1K04A 1NH4A 3BCCG 1NTKD 3VMZA 2W6AA 1X8YA 1KZUB 2AEFA 3L74E 1J2JB 2PEKA 3L75E 3TSIA 3E1IA 3CWBJ 1HWTC 1HVVA 4U0BA 3HUSA 4H13D 2AFEA 2PGDA 3B5NC 2LKMA 1SQVD 4AQRD 2M3EA 3VMAA 3Q2YA 1L4AD 4TT3H 2JYLA 2POHA 2GUSA 2N1TD 3ABVC 1PL5A 3K5BA 3KPEA 3R4YA 3L72E 4H44C 2Z4EA 2W8ZA 2KGAA 3B4QA 2KG8A 2K2QA 4KHXA 3RK3E 4OGQD 3NFQA 1VF5D 4LGDE 4RKUJ 5CCGD 1IFPA 5AVZB 2FACA 4XFYA 5AW6B 5BU5A 3HE4A 5HGMA 2BQ1E 4Y99B 2V7QH 1LJ2A 1FBMA 5AW3B 3S1KA 3OA7A 1NHLA 3O8ZA 2MVVA 1SQQK 3G0VA 2Q3EA 2Z46A 1JCDA 1EXJA 3H1IJ 2CG5B 3HTKA 2B87B 3CCJP 3V2QA 3II6A 4IFMA 3L74J 4HJGH 1K9MQ 2GA1A 4GOFA 3L4FA 3QWOC 1EZVE 4PXHB 4DCKA 2WPQA 3RL0B 3RK2C 1ZMEC 1EDJA 3H1LD 3P8MC 1E79H 3OJAB 2XT1A 5KP7B 3CCUP 1Q86Q 2NRGA 3BRTB 5HVCA 3A0HE 3H1HE 2PEOA 2DNWA 2J5UA 1S9KD 3UIAA 2N5IA 4U7JA 1BCCJ 2E76C 3A0BE 1G1IA 1RY3A 4KJMA 1VQ7P 1PP9D 4IZ6A 3L73E 1YJ9P 3CC2P 1L4AC 2FBWC 1R8EA 2K9JA 4I6MC 1MKMA 2YKPA 4IFDK 2N1TC 1BSHA 5B66H 1E6JP 4MRTC 5CBOA 4PD4H 1RQUA 1FZEA 2CNRA 3H1KE 2GZJA 3SSUA 4RESB 2WMMA 2NPSD 5F2KA 2RKLA 3U1AA 2QJKC 1VF5C 1KILB 1SQBD 5CCGC 3CE7A 2K9JB 1M7LA 1Y8AA 3EFFK 1CW5A 1IK9A 2OTJP 2W6BA 2N50A 2FVAA 3H32A 2E42A 2JU1A 5TISH 1H88A 1BE3D 3L37A 1OMIA 2FYUE 3ITKA 4GOEA 2H7HA 2PY8A 1WMKA 2A45I 1GDTA 2CPBA 2WITA 1RE4A 1VQ5P 1NYHA 3C8VA 2CK3H 1KILE 2K9YA 4Y28J 3TF5A 3L71G 3EQ2A 3L73J 4ASVA 1RF0A 3MHVA 2KLVA 3H32B 1VPCA 2PFXA 1ZOYC 3BCCE 3D70A 1FDIA 1SQXG 1M8OB 2ZT9D 1J1DC 3FX0A 2CQ8A 3GF7A 3BATA 3H1KJ 4U0FA 3GHGA 1BGYE 2FQ2A 4UB8H 3L35A 1YQ4C 4H0LD 3SWKA 3G9RA 2JU2A 2IDBA 2N9YB 3H0DA 2FYUK 4L75A 2QNWA 1G1JA 2O3JA 5KLVG 1NTZK 1JB0J 1HUCA 4ZMDA 1PV3A 4QNBA 1LTJC 1FZCB 5E79E 1IMPA 1RF1C 1RE3C 1HBWA 2KW2A 1JY3N 3G1GA 1YIJP 2J59M 3JCUE 7CEIA 2WQYC 5AVVB 2WWWA 1X0TA 2C9LY 3BCCJ 3O6QA 1M1KQ 5CCHC 1N2DC 2GM4A 1SQVG 5AW4B 3B8EB 1AF8A 2KLUA 1YTZT 1L0NK 4NEOA 3B5NA 1K05A 1NTMJ 3W67A 3RG2A 1BGYJ 3CI9A 2E75B 1GZLA 3RGUA 2G3AA 1GL2B 4U3FE 1X9VA 5AW7B 3GW6A 4PH1A 3O6QB 1S5LE 1NU1D 1AYIA 2AVAA 2LIWA 1W2BO 3SFDC 3I5CA 1SVFA 1UJZA 4I1LA 3PRJA 1OVVA 1PEOA 2Y0CA 4TLFA 1H8AA 3U59A 4Y99C 1PIXA 3PH0A 5BU8B 1GW4A 2NO8A 5CBNA 2X2BA 1VL2A 1QEXA 4N3YB 1L0LD 1X3OA 1IFDA 4XRQA 3FXDA 3LIDA 1LT1A 2WPSA 2K37A 2XNXA 3H1LG 2N5HA 1JO5A 4BWNA 2KR5A 1YHQP 2FQ1A 1L0IA 1FR2A 2LR2A 2PNGA 3MD0A 1EXIA 2KP8A 2QM7A 4U3FJ 1PEUA 3WUTA 2BCCD 2QM8A 2IZ0A 2LF4A 2JQ4A 2O01J 4BXLA 1PEQA 4DZOA 3M9HA 3P8CE 5B5EE 5L8RJ 1VHNA 3I56P 1S2EA 3AE2C 5CHXA 4ZNCA 1PPJD 1U57A 1PP9G 2JBGA 2JKVA 5B66E 4LLHA 1EC5A 1ZRTE 1AJYA 1USEA 4R0MA 2IYPA 4ZKPA 3L71E 3WUVA 4PD4E 1LTIC 3CXHI 2OYIB 1RH5B 1OW6A 4U0EA 3M0DC 1T2KC 1M90Q 2FXOA 2E74B 3CCVP 1FZAA 1SQXE 4HH2A 2N6ZA 2YNYA 1QRJA 4COCA 4JPZB 5TISE 2K0XA 1IFMA 2PEMA 3OW2O 1TU3F 1SQPK 4JBZA 2QVAA 1Q82Q 2YIUB 2VLOA 2WSEH 4W7YA 1KFNA 1BE3G 5KLVE 2IZ1A 1KQLA 2ITAA 1LTAC 5EW5E 2FFDA 1OVRA 2M8RA 1U7JA 3DPHA 1VQ4P 1BXIA 5C39A 2A45H 4BRYA 3CXHD 1SFCB 3VP9A 2IBZE 2KSJA 2ZFCA 2QJPC 4L73A 3AEDC 3B5ND 4WY4A 4OVNF 1ZXGA 1X22A 2IPPA 4U0DA 2FFDB 3JC22 5APXA 1RE4C 1SQVE 5HGLA 2K5XA 3L70D 4WB4A 1GTWA 1RF0C 2Y0EA 5BS2A 2LXCB 1ZR2A 1NKZB 1FC2C 4H44D 2AEMA 2B88A 1QVFO 1CSBA 1AUMA 1HJ0A 4LC1A 2WSFH 2XV5A 1EIAA 1FZCC 3GJNA 2FVEA 5KLVJ 2HG5D 3C1LA 1NQ4A 1HF9A 1GU5A 3DS4A 1JTHA 1RF1A 4GDOA 1DH3A 3TDKA 3HD7A 3T97A 4EIJA 1R5SA 2N6YA 1NTKK 1UIIA 1QL1A 2L4BA 3RG6C 3NTNA 5AW2B 3RL0g 3RK2D 2PAJA 2WPVB 1GXGA 1NTZG 2P9XA 1JY2O 2I1JA 3EJEA 2OYOA 2KG9A 3HD7B 3CCMP 2BHVA 1NOHA 2E75C 4DT0A 3H1LE 3FWNA 1ACPA 3HRNA 2JGPA 3LW5H 3V2PA 3PLNA 3PJSK 2YMYA 4ZKUA 1SS1A 2L9FA 2GZEA 3DS5A 2KOGA 2KS1B 4N78D 4QKOA 1FU1A 1SQQE 2E76D 3TGUJ 1LWUB 1ZV8A 3DS3A 4UHPB 2EIAA 1T3UA 1S4XA 2E5YA 3PTZA 3RK3B 3M9QA 2W27A 4WBAA 1L0NG 1PP9E 2WPTA 1EDIA 1Y9BA 2MKVA 2OYHB 3A7OA 2WZ7A 2XDJA 1N7SB 1L0LG 2K94A 2B87A 1DD3A 2I8DA 1FDOA 3AE7C 5K5GB 3H47A 2JYGA 1L2PA 3AEAC 2L0QA 2O1KA 2Q1KA 4XA4A 1GK4A 3GZLA 3CWBD 3V2NA 3S9OA 2K93A 2SPZA 2Z5HA 2Z45A 1SQQJ 1BE3E 4C7NA 3MGNA 1K8AQ 1CI6B 3L75J 4EOTA 2VLNA 4UB6H 2PENA 1PPJG 2LKIA 3DS0A 1RHZB 4RJTA 4WY4D 1N73B 1YYCA 1Y47A 2OARA 5APUA 5EFWB 3CMAP 3KYQA 4C7NB 3L72J 1AA0A 3GKLC 3CXHH 3U1CA 3M0DA 1Z6MA 1N7LA 2H43A 4DOJA 3TYYA 2KGEA 1SQBK 4W80A 2JWDA 3H1ID 2NZ2A 3F5HA 4D6TG 5AVWB 2YIUC 3L74D 2OTLP 5KJ7C 1DEEG 1KILA 3L75D 2H88C 1FE6A 3H25A 5KP6B 3KHUA 2N98A 2PRRA 1GXHA 3HD7D 4H2WC 1YI2P 4HKZH 1OXZA 1VQNP 1EZVI 1GK6A 1ZNVA 4M3LA 5F2NA 1SFCC 5APWA 4MN4C 4F37A 3A3YB 3DS2A 2ZVOB 2B9BA 1FZBA 2IFNA 1SQPG 2R5DA 5CCHD 2WSCJ 1KLPA 2C0WA 5AVSB 1BCCD 1JMMA 1MZ9A 2FFDC 2ZYGA 3H1HJ 5APQA 2D2CB 1ZP0C 3AEGC 2CWOA 2MVUA 4IPYA 1NTZE 2KODA 1M6EX 2ZXXA 2KZJA 2JO0A 1E0HA 4WY4C 1JUNA 1JMBA 2ROQA 4BPFA 2YMKA 3SWYA 5EJDA 1EZVD 3FGAD 2YXRB 1KC8Q 3H1JG 1IC2A 1FZCA 2MF4A 3WU2H 1LTSC 1BAJA 1VQKP 1L0NE 5APVA 2K88A 4HB1A 3A2AA 2MY5A 1S3JA 3BRVB 2XNDH 5TJHA 3NMDA 2M8LA 2M0BA 2FXMA 3RL0D 4A7PA 5AVQB 1VDFA 3P7KA 4DG9A 1LNQA 2FYUJ 1M56D 5KKZB 1P84I 3L73D 1NTZJ 3NTEA 3HE5B 2CPSA 3HD7C 3AE4C 1NO4A 3GG2A 1EOQA 1MUUA 1RO2A 1RNIA 2KG6A 2P2UA 3G28A 3F89A 1NU1K 1W2EA 1UNKA 1GL2A 2EHTA 1NTKG 1SP4A 2MD9A 1OR5A 1LWUC 5AW1B 2DGYA 2R5BA 3H1KD 3G3ZA 2KGCA 3B4SA 1IFJA 1MV8A 2FQ0A 2Z5IA 4RO0A 3VMYA 3RK3C 1PPJE 5HV8A 1MFTA 3CX5I 4I7ZB 3B5IA 1VQ8P 2BEZF 3MIWA 1T2KD 2OYHC 3G21A 1KQGB 4JF7A 1L0LK 1XTCC 1N7SC 4CA3A 1F80D 2XU6A 2GZIA 1NTMK 1KYOI 3SWFA 2AXTH 1P84D 1USDA 2WTYA 2W83C 5H2FH 3IFMA 2MR7A 1KILD 5KLIB 1N86A 1Q7YQ 3AEBC 1LP1A 3AEFC 4C7RA 2VLQA 1YITP 3D6ZA 3BCCD 4D6TE 2XZ0D 5KAFH 2HYNA 1JY2P 4GKGA 4XFXA 2PEJA 3VRLC 2QJYB 1MZ8A 3AE1C 3CX5D 1NTMD 1DNYA 1LTTC 1YTZI 1BGYD 5AVTB 3RL0C 1LP1B 1N73C 3NY7B 3CXHE
chains in the Genus database with same CATH topology
1K73Q 1VQMP 3NTEA 1YI2P 3G0VA 1KD1Q 2Z46A 1VQNP 1EOQA 2XXMA 5JPAA 1M6NA 1RO2A 1RNIA 1QVFO 1VQPP 1AUMA 2EG5A 5F2NA 5BS1A 2PY8A 3CCEP 3CCJP 3G28A 1EIAA 2XV6A 5HGNA 3G1IA 1JJ2O 4PH0A 1QVGO 1K9MQ 1M74A 2PEIA 1VQ5P 4GR6A 3H47A 2JYGA 3CCLP 4U0EA 1M90Q 1VQ6P 5DCKA 1IUQA 3DS1A 3DS2A 4U0CA 3HYBA 3CCVP 2DGYA 4GR2A 2L6EA 3DS4A 4PH1A 3CXCO 3CC7P 1QRJA 3G26A 3HZQA 3CPWO 3CC4P 1W2BO 3Q20A 5F2OA 1YJNP 4COCA 3G6EP 2XT1A 1VQOP 3M1MA 3CCUP 2QA4P 2CWOA 3CMEP 1Q86Q 3B5IA 4IPYA 1VQ8P 2Z45A 2KODA 2PEMA 3G71P 3OW2O 2PEOA 1K8AQ 1PEOA 3RG6C 3G29A 1Q82Q 1KQSO 5I4TG 2PENA 1M6EX 3G21A 1YJWP 1PEMA 3DS0A 4U0FA 4WYMA 1S72P 5HGOA 1VQ9P 1K30A 2PEKA 2P9XA 4XROA 2M8PA 1ZMBA 1N8RQ 2JO0A 4M0IA 4U0BA 2OARA 3CD6P 1A43A 1VQ7P 4XFZA 3CCMP 3MGEA 2BHVA 3H0DA 3CMAP 1YJ9P 3CC2P 3DPHA 4XRQA 2JYLA 1VQ4P 2M8NA 1KC8Q 2PEQA 1Q7YQ 4QNBA 3DS5A 1E6JP 3DTJA 1YITP 1BAJA 1YHQP 1VQKP 2BUOA 1NJIQ 3WBHA 3CCQP 4XFXA 3DS3A 3H4EA 2EIAA 3G1GA 2Z44A 2PEJA 1YIJP 1PEUA 3I55P 3VRLC 4U0DA 1D1DA 2E1MA 2M8LA 4COPA 5F2KA 5HGLA 2LF4A 2ONTA 2OTLP 3E2DA 1Q81Q 1VQLP 1RO0A 4XFYA 3G4SP 1PEQA 1A8OA 2EFJA 3CCRP 2QEXP 3I56P 3CCSP 2OTJP 3P05A 3LRYA 5HGMA 2BQ1E 5BS2A 1M1KQ 4U0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 Q;  1N8R Q;  1NJI Q;  1VQM P;  3CPW O;  1YI2 P;  3CC4 P;  3CCQ P;  1YHQ P;  3CD6 P;  1KD1 Q;  1W2B O;  1VQN P;  1YJN P;  3G6E P;  1VQ7 P;  1QVF O;  1YIJ P;  1VQP P;  1VQO P;  3CCM P;  3I55 P;  3CCU P;  2QA4 P;  3CME P;  1Q86 Q;  1VQ8 P;  3CMA P;  1YJ9 P;  3CCE P;  3CC2 P;  3CCJ P;  1VQ4 P;  3G71 P;  1JJ2 O;  1QVG O;  3OW2 O;  1K9M Q;  1KC8 Q;  1VQ5 P;  1K8A Q;  2OTL P;  1Q82 Q;  1Q7Y Q;  1Q81 Q;  1KQS O;  1VQL P;  3CCL P;  1M90 Q;  3G4S P;  1VQ6 P;  1YJW P;  3CCR P;  2QEX P;  3CCV P;  3I56 P;  3CCS P;  1S72 P;  2OTJ P;  1M1K Q;  1YIT P;  1VQ9 P;  3CXC O;  1VQK P;  3CC7 P; 
#chains in the Genus database with same CATH topology
 1VQM P;  3WUU A;  1G2C A;  1IO4 A;  3EJD A;  2LPK A;  1OIP A;  5AVR B;  3FXE A;  1KYO D;  1SQP E;  3U43 A;  2OYI A;  2Y0D A;  1QVG O;  5APT A;  1RQV A;  1QX8 A;  3MZW B;  1KFM A;  2YXQ B;  1YBK A;  3CXC O;  2W6J H;  5CZD B;  3CPW O;  3H1I G;  1LTB C;  1HTL C;  2GZF A;  1G2C B;  1VQO P;  2PP6 A;  3N4X A;  3L74 G;  4R4L A;  1ZN5 A;  2G8Y A;  3E1R A;  1FDM A;  2BEQ D;  2HOD B;  2K1A A;  1FJK A;  3AE8 C;  5KTB A;  5KJ7 A;  1M1J B;  2XZ1 C;  1WRG A;  2FYZ A;  2JB0 A;  2VRS A;  2JP3 A;  1T3J A;  2OTK E;  2HR3 A;  1BDD A;  3WMM 0;  3H1J E;  2YO2 A;  4CPG A;  2KXP B;  2H8P D;  1EDL A;  3PHL A;  4U3F D;  1JEK A;  1SQB G;  1KIL C;  4IL6 X;  1SFC A;  1KMI Z;  1X79 B;  1NVO A;  1BCC G;  1OZH A;  1SQP J;  5AW0 B;  1ZR4 A;  1JM0 A;  4EI2 A;  5AVX B;  3BAS A;  2A06 D;  3I55 P;  2E75 D;  1IJD B;  4H13 B;  2C0X A;  2P1J A;  1GL2 D;  2ERH A;  3SFE C;  4B86 A;  2P58 A;  1AFO A;  3V2R A;  1L4A B;  3E2D A;  2L22 A;  1QGK B;  1GMJ A;  2N1T B;  1KTM A;  3MUD C;  3L71 J;  1NGM B;  1NTK E;  3AEC C;  4HYT B;  3KZI H;  4HKG A;  4AYC A;  3ZDM A;  2EG5 A;  3L36 A;  4UB8 E;  3GF3 A;  5HGN A;  1SQX J;  2RMZ A;  2Y9Y A;  1T6A A;  1H0T B;  3H1J J;  4OGQ B;  1VQ6 P;  3VOP A;  3EJB A;  1PGJ A;  1D7M A;  3CC7 P;  3HZQ A;  2KUB A;  3CC4 P;  4DJG A;  4WWI A;  3Q20 A;  5F2O A;  1AQT A;  1YJN P;  3G6E P;  5AVY B;  2QA4 P;  2IFM A;  5BVZ A;  2A45 G;  2K0Y A;  2AXC A;  3G29 A;  1KV4 A;  1YQ3 C;  3L73 G;  2KSE A;  1PEM A;  4R4M A;  1K30 A;  1AQ5 A;  1JOC A;  1OW8 A;  2EHS A;  1P84 H;  2IBZ I;  3IR9 A;  1CZQ A;  3C9I A;  2KWL A;  3AE5 C;  2M8N A;  2PEQ A;  3H6P A;  5APS A;  2OGU A;  3VN0 A;  1NTK J;  2KS1 A;  2N9B A;  3QH9 A;  1LWU A;  2KOO A;  2O01 N;  2KI7 B;  3CCQ P;  4I7Z C;  1KB9 I;  1SQV J;  2LXB A;  3CLQ A;  1E5W A;  3KXD A;  2AEJ A;  2AXT E;  1JCC A;  4N6J A;  1JNM A;  2E74 D;  1GL2 C;  3CX5 H;  2M5A A;  1Q81 Q;  5KLV D;  1Q2N A;  4JYC A;  2OYH A;  1LTJ B;  1NU1 G;  3P05 A;  3AE6 C;  2C9N Y;  2R3C A;  1N7S A;  1S9K E;  2LIU A;  2KNC A;  2ZXE B;  2HPC B;  3TK1 A;  2ZYD A;  4XFJ A;  1KYO H;  3CCE P;  2IBZ D;  1W5C E;  5KJ7 D;  3H1I E;  2R32 A;  2KOS A;  2NPS B;  2M5A B;  3V4Q A;  3VMX A;  1IUQ A;  1LGH B;  2P10 A;  1PGP A;  2XZR A;  1BSN A;  3JCU H;  2QJY C;  2KNC B;  2IYO A;  5CJ4 A;  1NTM G;  1NAY A;  1KB9 D;  1BGY G;  1SFC D;  1CI6 A;  1YJW P;  1HGZ A;  2J58 A;  1N73 A;  1N8R Q;  3H1L J;  2Q7C A;  1SQB E;  3TGU D;  3CD6 P;  3HUS B;  1A43 A;  2BCC G;  2JWA A;  1BCC E;  2Q9I A;  3MP7 B;  1HY8 A;  3GLM A;  2W90 A;  1KN7 A;  5GTI H;  2ZT9 B;  1S5L H;  3GZM A;  2O01 H;  1ZW0 A;  4IL6 H;  1IZN B;  1MFZ A;  4YXD C;  2LOL A;  5KAI H;  3AE9 C;  1PP9 J;  3M06 A;  4GT1 A;  4EDF A;  4O9B A;  4H0L B;  3IF4 A;  1D1D A;  1KOR A;  2OYI C;  1M1J C;  2E74 C;  1OWA A;  4L76 A;  1VQL P;  2KYV A;  2QEX P;  3HE4 B;  2RH0 A;  2JJL A;  2FKW B;  1K73 Q;  1IFN A;  2VLP A;  4U3F G;  1M6N A;  1EMV A;  3HTK B;  3USS A;  1SQQ D;  4GR6 A;  1SQB J;  4GIF A;  1AVO A;  2GDY A;  2KOP A;  4XE5 B;  2LML A;  4IFF A;  2XKM A;  3G26 A;  2A06 G;  1JY3 P;  1BE3 J;  2WPR A;  1DD4 A;  4H13 C;  1LT9 A;  3CME P;  3IAO A;  2P7J A;  3JSV C;  4JYB A;  5B5E H;  3KZI E;  2ZYA A;  1URQ A;  2YO3 A;  3L72 D;  1Q90 D;  4WYM A;  2E43 A;  1PZQ A;  2FAE A;  4M0I A;  3MUD A;  3PP5 A;  2KOQ A;  3RK3 D;  1XTG B;  1A02 J;  3V5B A;  2H89 C;  4I2L C;  1LT9 B;  1IK7 A;  4PV1 B;  2JR8 A;  3L70 G;  4OGQ C;  1T8K A;  1URQ B;  2WSE J;  3FWL A;  1N7S D;  2KB7 P;  1UIX A;  3MTU E;  2IX7 C;  2Z44 A;  3N7N A;  2KGD A;  1NU1 E;  2E1M A;  2KZI A;  1DIP A;  1P84 E;  2FYN B;  4YTP C;  1A02 F;  2GDX A;  3S4R A;  3HE5 A;  5AVU B;  2FHS C;  2QJP B;  5GTH H;  2HLO A;  1GU4 A;  2WT7 A;  4BPG A;  2XXM A;  5JPA A;  3M9B A;  4NPE A;  1VQP P;  3H1H D;  1CEI A;  2FAD A;  2ZJS E;  3G1I A;  4PH0 A;  1J1E B;  5AW8 B;  5DJU B;  3VYI A;  1L0L E;  3CX5 E;  1NTM E;  1R5L A;  2E5T A;  3B71 A;  4GR2 A;  2L6E A;  1LTG C;  2JAZ A;  1EDK A;  1DX7 A;  2JEE A;  2WVR A;  1FZG A;  2WT7 B;  2WSF J;  1KB9 H;  1S1C X;  1AV1 A;  4NPF X;  2QG4 A;  1NKN A;  5M1B A;  1KYO E;  1KQS O;  2QSI A;  2BCC E;  5I4T G;  2I1K A;  2K92 A;  4W7Z A;  2FXP A;  1S72 P;  1NU1 J;  1VQ9 P;  3GHG B;  2WSS H;  3Q5S A;  3RBZ A;  1IMQ A;  2QRX A;  2IBZ G;  2NPS C;  4YXW H;  1L0N J;  2AFD A;  2R44 A;  1SLQ A;  2M3B A;  2CGQ A;  2FYU D;  2BUO A;  3VTP C;  3WBH A;  1NTZ D;  1OVU A;  3H4E A;  1L0L J;  1HH0 A;  3LW5 J;  2YKQ A;  2QE7 H;  2KOR A;  1FAV A;  2ONT A;  4JQ0 D;  2GZG A;  1RO0 A;  3Q1M A;  3TGU G;  2DW3 A;  3VP8 A;  3Q5P A;  3W68 A;  5GTI E;  3D6Y A;  3CWB G;  4UB6 E;  3HUS C;  2D2C D;  3P32 A;  4IL6 E;  1VKU A;  1PFI A;  4PV1 D;  5KAI E;  1QL2 A;  2BCC J;  1GW3 A;  1URQ D;  3B5N B;  5BS1 A;  2YKO A;  2A06 E;  2ZT9 C;  4PJ0 H;  1JJ2 O;  1L0N D;  1OX3 A;  2GYK A;  4U0C A;  2B89 A;  3Q3D A;  3BVH A;  3EWK A;  5AW5 B;  3M91 A;  4H0L C;  1JY3 O;  1QLE D;  4H44 B;  3M1M A;  1FOS E;  2ZAE B;  4OH8 B;  2HOD A;  2KK7 A;  2L5G B;  1M1J A;  1HJB A;  4WVZ A;  1AVY A;  2V7Q J;  5HGO A;  2K3R A;  4XRO A;  3L70 E;  1OFC X;  3KQG A;  2K0D X;  3E7K A;  3Q5R A;  4K35 A;  4XFZ A;  3IN6 A;  3OAK A;  2MJZ A;  1SQQ G;  3L75 G;  4D6T J;  2HFE D;  3DTJ A;  4ASW A;  2Y9Z A;  3EFG A;  3RK2 B;  3AE3 C;  3M0A A;  2JO1 A;  4EYY Q;  3V4W A;  4KT0 J;  2AF8 A;  3L72 G;  1S5L X;  3RBX A;  1L4A A;  3NXS A;  4PWV B;  4Z1M H;  2LTE A;  1A8O A;  3CCR P;  2N1T A;  3CL3 D;  4U0A A;  2GDW A;  2WSC H;  2E76 B;  1KD1 Q;  2D2C C;  1LT9 C;  2L91 A;  2OQQ A;  4PV1 C;  3A0H H;  1URQ C;  4QMA A;  1M74 A;  2PEI A;  5APY A;  1H0T A;  3L70 J;  5CMZ A;  4D6T D;  3A0B H;  5DCK A;  5CCG A;  2GUV A;  4PD4 I;  1T8Z A;  1PGQ A;  3GMA A;  1GD2 E;  2VSQ A;  3WU2 E;  4IOI H;  1JY2 N;  4N78 E;  1EZV G;  1PGO A;  5DJT B;  5GTH E;  2FYN C;  1FOS F;  1L0H A;  2M5R A;  2UWJ E;  5KP8 B;  2O1J A;  4L74 A;  4H2X C;  2MR8 A;  2JDI H;  2QJK B;  1VF5 B;  2FY8 A;  2ZVN B;  4GOD A;  1ZMB A;  2M8P A;  3KDP B;  1SQP D;  1SQX K;  2FVF A;  3H1H G;  3TNU A;  1DV5 A;  3LMO A;  3LIE A;  3MGE A;  4NPD A;  1J1E C;  2QIW A;  1WT6 A;  3P8C D;  1ZLL A;  1KB9 E;  4BRY B;  1HQB A;  5KKZ C;  2LL8 A;  1ZRT D;  1FS0 E;  1HGV A;  4C46 A;  1NJI Q;  1FZF A;  1H89 A;  3L71 D;  4PD4 D;  4WY4 B;  2KIK A;  3TNU B;  5KLV K;  1IFI A;  3V6I A;  3TGU E;  3CWB E;  4COP A;  1SQX D;  1J1D B;  1BDC A;  2R3S A;  2V4H A;  3H1K G;  3G4S P;  3A5T A;  3H1J D;  3GHG C;  2EFJ A;  1LTJ A;  2BAS A;  3CCS P;  3LRY A;  2P67 A;  1U7M A;  4H2Y C;  1RE3 A;  2HPC A;  2Q5U A;  4OWF A;  4BPH A;  1FJP A;  1OW7 A;  2XV6 A;  1NWQ A;  2NPS A;  5H2F E;  2Q3I A;  3CCL P;  1NAF A;  1DEB A;  1SQV K;  2FYU G;  3DS1 A;  3HYB A;  5CJ0 A;  2RN0 A;  5CCH A;  4AUW A;  1JTH B;  3AEE C;  3R2P A;  1RF1 B;  4YPC A;  1GPJ A;  5AW9 B;  4K3A A;  3T97 B;  1Z56 A;  1EQ7 A;  5KAF E;  2Q6Q A;  5KLI C;  3G71 P;  5E79 H;  1M57 D;  3D71 A;  4PJ0 E;  1KQF B;  1K04 A;  1NH4 A;  3BCC G;  1NTK D;  3VMZ A;  2W6A A;  1X8Y A;  1KZU B;  2AEF A;  3L74 E;  1J2J B;  2PEK A;  3L75 E;  3TSI A;  3E1I A;  3CWB J;  1HWT C;  1HVV A;  4U0B A;  3HUS A;  4H13 D;  2AFE A;  2PGD A;  3B5N C;  2LKM A;  1SQV D;  4AQR D;  2M3E A;  3VMA A;  3Q2Y A;  1L4A D;  4TT3 H;  2JYL A;  2POH A;  2GUS A;  2N1T D;  3ABV C;  1PL5 A;  3K5B A;  3KPE A;  3R4Y A;  3L72 E;  4H44 C;  2Z4E A;  2W8Z A;  2KGA A;  3B4Q A;  2KG8 A;  2K2Q A;  4KHX A;  3RK3 E;  4OGQ D;  3NFQ A;  1VF5 D;  4LGD E;  4RKU J;  5CCG D;  1IFP A;  5AVZ B;  2FAC A;  4XFY A;  5AW6 B;  5BU5 A;  3HE4 A;  5HGM A;  2BQ1 E;  4Y99 B;  2V7Q H;  1LJ2 A;  1FBM A;  5AW3 B;  3S1K A;  3OA7 A;  1NHL A;  3O8Z A;  2MVV A;  1SQQ K;  3G0V A;  2Q3E A;  2Z46 A;  1JCD A;  1EXJ A;  3H1I J;  2CG5 B;  3HTK A;  2B87 B;  3CCJ P;  3V2Q A;  3II6 A;  4IFM A;  3L74 J;  4HJG H;  1K9M Q;  2GA1 A;  4GOF A;  3L4F A;  3QWO C;  1EZV E;  4PXH B;  4DCK A;  2WPQ A;  3RL0 B;  3RK2 C;  1ZME C;  1EDJ A;  3H1L D;  3P8M C;  1E79 H;  3OJA B;  2XT1 A;  5KP7 B;  3CCU P;  1Q86 Q;  2NRG A;  3BRT B;  5HVC A;  3A0H E;  3H1H E;  2PEO A;  2DNW A;  2J5U A;  1S9K D;  3UIA A;  2N5I A;  4U7J A;  1BCC J;  2E76 C;  3A0B E;  1G1I A;  1RY3 A;  4KJM A;  1VQ7 P;  1PP9 D;  4IZ6 A;  3L73 E;  1YJ9 P;  3CC2 P;  1L4A C;  2FBW C;  1R8E A;  2K9J A;  4I6M C;  1MKM A;  2YKP A;  4IFD K;  2N1T C;  1BSH A;  5B66 H;  1E6J P;  4MRT C;  5CBO A;  4PD4 H;  1RQU A;  1FZE A;  2CNR A;  3H1K E;  2GZJ A;  3SSU A;  4RES B;  2WMM A;  2NPS D;  5F2K A;  2RKL A;  3U1A A;  2QJK C;  1VF5 C;  1KIL B;  1SQB D;  5CCG C;  3CE7 A;  2K9J B;  1M7L A;  1Y8A A;  3EFF K;  1CW5 A;  1IK9 A;  2OTJ P;  2W6B A;  2N50 A;  2FVA A;  3H32 A;  2E42 A;  2JU1 A;  5TIS H;  1H88 A;  1BE3 D;  3L37 A;  1OMI A;  2FYU E;  3ITK A;  4GOE A;  2H7H A;  2PY8 A;  1WMK A;  2A45 I;  1GDT A;  2CPB A;  2WIT A;  1RE4 A;  1VQ5 P;  1NYH A;  3C8V A;  2CK3 H;  1KIL E;  2K9Y A;  4Y28 J;  3TF5 A;  3L71 G;  3EQ2 A;  3L73 J;  4ASV A;  1RF0 A;  3MHV A;  2KLV A;  3H32 B;  1VPC A;  2PFX A;  1ZOY C;  3BCC E;  3D70 A;  1FDI A;  1SQX G;  1M8O B;  2ZT9 D;  1J1D C;  3FX0 A;  2CQ8 A;  3GF7 A;  3BAT A;  3H1K J;  4U0F A;  3GHG A;  1BGY E;  2FQ2 A;  4UB8 H;  3L35 A;  1YQ4 C;  4H0L D;  3SWK A;  3G9R A;  2JU2 A;  2IDB A;  2N9Y B;  3H0D A;  2FYU K;  4L75 A;  2QNW A;  1G1J A;  2O3J A;  5KLV G;  1NTZ K;  1JB0 J;  1HUC A;  4ZMD A;  1PV3 A;  4QNB A;  1LTJ C;  1FZC B;  5E79 E;  1IMP A;  1RF1 C;  1RE3 C;  1HBW A;  2KW2 A;  1JY3 N;  3G1G A;  1YIJ P;  2J59 M;  3JCU E;  7CEI A;  2WQY C;  5AVV B;  2WWW A;  1X0T A;  2C9L Y;  3BCC J;  3O6Q A;  1M1K Q;  5CCH C;  1N2D C;  2GM4 A;  1SQV G;  5AW4 B;  3B8E B;  1AF8 A;  2KLU A;  1YTZ T;  1L0N K;  4NEO A;  3B5N A;  1K05 A;  1NTM J;  3W67 A;  3RG2 A;  1BGY J;  3CI9 A;  2E75 B;  1GZL A;  3RGU A;  2G3A A;  1GL2 B;  4U3F E;  1X9V A;  5AW7 B;  3GW6 A;  4PH1 A;  3O6Q B;  1S5L E;  1NU1 D;  1AYI A;  2AVA A;  2LIW A;  1W2B O;  3SFD C;  3I5C A;  1SVF A;  1UJZ A;  4I1L A;  3PRJ A;  1OVV A;  1PEO A;  2Y0C A;  4TLF A;  1H8A A;  3U59 A;  4Y99 C;  1PIX A;  3PH0 A;  5BU8 B;  1GW4 A;  2NO8 A;  5CBN A;  2X2B A;  1VL2 A;  1QEX A;  4N3Y B;  1L0L D;  1X3O A;  1IFD A;  4XRQ A;  3FXD A;  3LID A;  1LT1 A;  2WPS A;  2K37 A;  2XNX A;  3H1L G;  2N5H A;  1JO5 A;  4BWN A;  2KR5 A;  1YHQ P;  2FQ1 A;  1L0I A;  1FR2 A;  2LR2 A;  2PNG A;  3MD0 A;  1EXI A;  2KP8 A;  2QM7 A;  4U3F J;  1PEU A;  3WUT A;  2BCC D;  2QM8 A;  2IZ0 A;  2LF4 A;  2JQ4 A;  2O01 J;  4BXL A;  1PEQ A;  4DZO A;  3M9H A;  3P8C E;  5B5E E;  5L8R J;  1VHN A;  3I56 P;  1S2E A;  3AE2 C;  5CHX A;  4ZNC A;  1PPJ D;  1U57 A;  1PP9 G;  2JBG A;  2JKV A;  5B66 E;  4LLH A;  1EC5 A;  1ZRT E;  1AJY A;  1USE A;  4R0M A;  2IYP A;  4ZKP A;  3L71 E;  3WUV A;  4PD4 E;  1LTI C;  3CXH I;  2OYI B;  1RH5 B;  1OW6 A;  4U0E A;  3M0D C;  1T2K C;  1M90 Q;  2FXO A;  2E74 B;  3CCV P;  1FZA A;  1SQX E;  4HH2 A;  2N6Z A;  2YNY A;  1QRJ A;  4COC A;  4JPZ B;  5TIS E;  2K0X A;  1IFM A;  2PEM A;  3OW2 O;  1TU3 F;  1SQP K;  4JBZ A;  2QVA A;  1Q82 Q;  2YIU B;  2VLO A;  2WSE H;  4W7Y A;  1KFN A;  1BE3 G;  5KLV E;  2IZ1 A;  1KQL A;  2ITA A;  1LTA C;  5EW5 E;  2FFD A;  1OVR A;  2M8R A;  1U7J A;  3DPH A;  1VQ4 P;  1BXI A;  5C39 A;  2A45 H;  4BRY A;  3CXH D;  1SFC B;  3VP9 A;  2IBZ E;  2KSJ A;  2ZFC A;  2QJP C;  4L73 A;  3AED C;  3B5N D;  4WY4 A;  4OVN F;  1ZXG A;  1X22 A;  2IPP A;  4U0D A;  2FFD B;  3JC2 2;  5APX A;  1RE4 C;  1SQV E;  5HGL A;  2K5X A;  3L70 D;  4WB4 A;  1GTW A;  1RF0 C;  2Y0E A;  5BS2 A;  2LXC B;  1ZR2 A;  1NKZ B;  1FC2 C;  4H44 D;  2AEM A;  2B88 A;  1QVF O;  1CSB A;  1AUM A;  1HJ0 A;  4LC1 A;  2WSF H;  2XV5 A;  1EIA A;  1FZC C;  3GJN A;  2FVE A;  5KLV J;  2HG5 D;  3C1L A;  1NQ4 A;  1HF9 A;  1GU5 A;  3DS4 A;  1JTH A;  1RF1 A;  4GDO A;  1DH3 A;  3TDK A;  3HD7 A;  3T97 A;  4EIJ A;  1R5S A;  2N6Y A;  1NTK K;  1UII A;  1QL1 A;  2L4B A;  3RG6 C;  3NTN A;  5AW2 B;  3RL0 g;  3RK2 D;  2PAJ A;  2WPV B;  1GXG A;  1NTZ G;  2P9X A;  1JY2 O;  2I1J A;  3EJE A;  2OYO A;  2KG9 A;  3HD7 B;  3CCM P;  2BHV A;  1NOH A;  2E75 C;  4DT0 A;  3H1L E;  3FWN A;  1ACP A;  3HRN A;  2JGP A;  3LW5 H;  3V2P A;  3PLN A;  3PJS K;  2YMY A;  4ZKU A;  1SS1 A;  2L9F A;  2GZE A;  3DS5 A;  2KOG A;  2KS1 B;  4N78 D;  4QKO A;  1FU1 A;  1SQQ E;  2E76 D;  3TGU J;  1LWU B;  1ZV8 A;  3DS3 A;  4UHP B;  2EIA A;  1T3U A;  1S4X A;  2E5Y A;  3PTZ A;  3RK3 B;  3M9Q A;  2W27 A;  4WBA A;  1L0N G;  1PP9 E;  2WPT A;  1EDI A;  1Y9B A;  2MKV A;  2OYH B;  3A7O A;  2WZ7 A;  2XDJ A;  1N7S B;  1L0L G;  2K94 A;  2B87 A;  1DD3 A;  2I8D A;  1FDO A;  3AE7 C;  5K5G B;  3H47 A;  2JYG A;  1L2P A;  3AEA C;  2L0Q A;  2O1K A;  2Q1K A;  4XA4 A;  1GK4 A;  3GZL A;  3CWB D;  3V2N A;  3S9O A;  2K93 A;  2SPZ A;  2Z5H A;  2Z45 A;  1SQQ J;  1BE3 E;  4C7N A;  3MGN A;  1K8A Q;  1CI6 B;  3L75 J;  4EOT A;  2VLN A;  4UB6 H;  2PEN A;  1PPJ G;  2LKI A;  3DS0 A;  1RHZ B;  4RJT A;  4WY4 D;  1N73 B;  1YYC A;  1Y47 A;  2OAR A;  5APU A;  5EFW B;  3CMA P;  3KYQ A;  4C7N B;  3L72 J;  1AA0 A;  3GKL C;  3CXH H;  3U1C A;  3M0D A;  1Z6M A;  1N7L A;  2H43 A;  4DOJ A;  3TYY A;  2KGE A;  1SQB K;  4W80 A;  2JWD A;  3H1I D;  2NZ2 A;  3F5H A;  4D6T G;  5AVW B;  2YIU C;  3L74 D;  2OTL P;  5KJ7 C;  1DEE G;  1KIL A;  3L75 D;  2H88 C;  1FE6 A;  3H25 A;  5KP6 B;  3KHU A;  2N98 A;  2PRR A;  1GXH A;  3HD7 D;  4H2W C;  1YI2 P;  4HKZ H;  1OXZ A;  1VQN P;  1EZV I;  1GK6 A;  1ZNV A;  4M3L A;  5F2N A;  1SFC C;  5APW A;  4MN4 C;  4F37 A;  3A3Y B;  3DS2 A;  2ZVO B;  2B9B A;  1FZB A;  2IFN A;  1SQP G;  2R5D A;  5CCH D;  2WSC J;  1KLP A;  2C0W A;  5AVS B;  1BCC D;  1JMM A;  1MZ9 A;  2FFD C;  2ZYG A;  3H1H J;  5APQ A;  2D2C B;  1ZP0 C;  3AEG C;  2CWO A;  2MVU A;  4IPY A;  1NTZ E;  2KOD A;  1M6E X;  2ZXX A;  2KZJ A;  2JO0 A;  1E0H A;  4WY4 C;  1JUN A;  1JMB A;  2ROQ A;  4BPF A;  2YMK A;  3SWY A;  5EJD A;  1EZV D;  3FGA D;  2YXR B;  1KC8 Q;  3H1J G;  1IC2 A;  1FZC A;  2MF4 A;  3WU2 H;  1LTS C;  1BAJ A;  1VQK P;  1L0N E;  5APV A;  2K88 A;  4HB1 A;  3A2A A;  2MY5 A;  1S3J A;  3BRV B;  2XND H;  5TJH A;  3NMD A;  2M8L A;  2M0B A;  2FXM A;  3RL0 D;  4A7P A;  5AVQ B;  1VDF A;  3P7K A;  4DG9 A;  1LNQ A;  2FYU J;  1M56 D;  5KKZ B;  1P84 I;  3L73 D;  1NTZ J;  3NTE A;  3HE5 B;  2CPS A;  3HD7 C;  3AE4 C;  1NO4 A;  3GG2 A;  1EOQ A;  1MUU A;  1RO2 A;  1RNI A;  2KG6 A;  2P2U A;  3G28 A;  3F89 A;  1NU1 K;  1W2E A;  1UNK A;  1GL2 A;  2EHT A;  1NTK G;  1SP4 A;  2MD9 A;  1OR5 A;  1LWU C;  5AW1 B;  2DGY A;  2R5B A;  3H1K D;  3G3Z A;  2KGC A;  3B4S A;  1IFJ A;  1MV8 A;  2FQ0 A;  2Z5I A;  4RO0 A;  3VMY A;  3RK3 C;  1PPJ E;  5HV8 A;  1MFT A;  3CX5 I;  4I7Z B;  3B5I A;  1VQ8 P;  2BEZ F;  3MIW A;  1T2K D;  2OYH C;  3G21 A;  1KQG B;  4JF7 A;  1L0L K;  1XTC C;  1N7S C;  4CA3 A;  1F80 D;  2XU6 A;  2GZI A;  1NTM K;  1KYO I;  3SWF A;  2AXT H;  1P84 D;  1USD A;  2WTY A;  2W83 C;  5H2F H;  3IFM A;  2MR7 A;  1KIL D;  5KLI B;  1N86 A;  1Q7Y Q;  3AEB C;  1LP1 A;  3AEF C;  4C7R A;  2VLQ A;  1YIT P;  3D6Z A;  3BCC D;  4D6T E;  2XZ0 D;  5KAF H;  2HYN A;  1JY2 P;  4GKG A;  4XFX A;  2PEJ A;  3VRL C;  2QJY B;  1MZ8 A;  3AE1 C;  3CX5 D;  1NTM D;  1DNY A;  1LTT C;  1YTZ I;  1BGY D;  5AVT B;  3RL0 C;  1LP1 B;  1N73 C;  3NY7 B;  3CXH E; 
#chains in the Genus database with same CATH homology
 1K73 Q;  1VQM P;  3NTE A;  1YI2 P;  3G0V A;  1KD1 Q;  2Z46 A;  1VQN P;  1EOQ A;  2XXM A;  5JPA A;  1M6N A;  1RO2 A;  1RNI A;  1QVF O;  1VQP P;  1AUM A;  2EG5 A;  5F2N A;  5BS1 A;  2PY8 A;  3CCE P;  3CCJ P;  3G28 A;  1EIA A;  2XV6 A;  5HGN A;  3G1I A;  1JJ2 O;  4PH0 A;  1QVG O;  1K9M Q;  1M74 A;  2PEI A;  1VQ5 P;  4GR6 A;  3H47 A;  2JYG A;  3CCL P;  4U0E A;  1M90 Q;  1VQ6 P;  5DCK A;  1IUQ A;  3DS1 A;  3DS2 A;  4U0C A;  3HYB A;  3CCV P;  2DGY A;  4GR2 A;  2L6E A;  3DS4 A;  4PH1 A;  3CXC O;  3CC7 P;  1QRJ A;  3G26 A;  3HZQ A;  3CPW O;  3CC4 P;  1W2B O;  3Q20 A;  5F2O A;  1YJN P;  4COC A;  3G6E P;  2XT1 A;  1VQO P;  3M1M A;  3CCU P;  2QA4 P;  2CWO A;  3CME P;  1Q86 Q;  3B5I A;  4IPY A;  1VQ8 P;  2Z45 A;  2KOD A;  2PEM A;  3G71 P;  3OW2 O;  2PEO A;  1K8A Q;  1PEO A;  3RG6 C;  3G29 A;  1Q82 Q;  1KQS O;  5I4T G;  2PEN A;  1M6E X;  3G21 A;  1YJW P;  1PEM A;  3DS0 A;  4U0F A;  4WYM A;  1S72 P;  5HGO A;  1VQ9 P;  1K30 A;  2PEK A;  2P9X A;  4XRO A;  2M8P A;  1ZMB A;  1N8R Q;  2JO0 A;  4M0I A;  4U0B A;  2OAR A;  3CD6 P;  1A43 A;  1VQ7 P;  4XFZ A;  3CCM P;  3MGE A;  2BHV A;  3H0D A;  3CMA P;  1YJ9 P;  3CC2 P;  3DPH A;  4XRQ A;  2JYL A;  1VQ4 P;  2M8N A;  1KC8 Q;  2PEQ A;  1Q7Y Q;  4QNB A;  3DS5 A;  1E6J P;  3DTJ A;  1YIT P;  1BAJ A;  1YHQ P;  1VQK P;  2BUO A;  1NJI Q;  3WBH A;  3CCQ P;  4XFX A;  3DS3 A;  3H4E A;  2EIA A;  3G1G A;  2Z44 A;  2PEJ A;  1YIJ P;  1PEU A;  3I55 P;  3VRL C;  4U0D A;  1D1D A;  2E1M A;  2M8L A;  4COP A;  5F2K A;  5HGL A;  2LF4 A;  2ONT A;  2OTL P;  3E2D A;  1Q81 Q;  1VQL P;  1RO0 A;  4XFY A;  3G4S P;  1PEQ A;  1A8O A;  2EFJ A;  3CCR P;  2QEX P;  3I56 P;  3CCS P;  2OTJ P;  3P05 A;  3LRY A;  5HGM A;  2BQ1 E;  5BS2 A;  1M1K Q;  4U0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...