1W2BO

Trigger factor ribosome binding domain in complex with 50s
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1w2bO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1w2bO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1w2bO03
3I56P 1QVFO 1Q7YQ 1K73Q 3CMAP 2QA4P 3CPWO 1KQSO 3G4SP 3G71P 1NJIQ 3CCEP 1KD1Q 1VQOP 1VQ9P 3CCMP 3OW2O 3CC7P 1YJWP 1YJNP 1W2BO 3G6EP 1Q81Q 3CCRP 1K9MQ 1K8AQ 1VQ8P 1Q82Q 3CCSP 1N8RQ 3CC4P 3CC2P 1Q86Q 1VQNP 3CCVP 1VQMP 3CCQP 1VQ4P 3CXCO 1M90Q 1VQ6P 3CMEP 1YIJP 1VQ7P 1YHQP 1S72P 1VQLP 3I55P 3CD6P 2OTLP 1VQPP 2QEXP 2OTJP 1YITP 1VQKP 1KC8Q 1JJ2O 1YJ9P 1VQ5P 3CCJP 3CCLP 1QVGO 1YI2P 3CCUP 1M1KQ
chains in the Genus database with same CATH superfamily
2VLQA 4Y99C 4ZKUA 1GW3A 3H32A 4DG9A 3H1LJ 2YKQA 2H7HA 1PP9E 1OX3A 1U7JA 2H43A 4C7NA 3L71J 3Q3DA 3R4YA 1RH5B 2N6ZA 2JU2A 1NTKE 2W27A 1ZW0A 1HH0A 2H8PD 4IL6E 2KYVA 1P84H 1PGQA 1Q2NA 3A3YB 2ERHA 2WPSA 1IFDA 2Z45A 2W83C 2NPSC 1RF1A 1KN7A 2Q5UA 1Q81Q 1NTME 2KXPB 2FXPA 4XA4A 1EZVG 2KG9A 1KILA 4JBZA 3VMZA 1SQPJ 1FOSF 1LTIC 2E75B 1PEMA 1LTJB 1OW7A 1HTLC 2ROQA 3V4QA 2LOLA 1KB9D 1YYCA 3CLQA 2KZJA 2Z44A 5AVYB 4A7PA 4PH1A 3H1JJ 2JWDA 2OTLP 3RGUA 1UIXA 1S9KD 3PLNA 4C46A 3P7KA 1NYHA 4H44B 4DZOA 1L0NK 1FOSE 2XZRA 2IBZG 1LWUB 1GW4A 1L0IA 3MUDC 3VMXA 1PEQA 3M0AA 4U3FD 4U0FA 4JYBA 3B4QA 1NTZK 1OW6A 4N78E 1PGJA 5BVZA 1PGPA 3AE7C 2M5RA 4IL6H 1HGZA 2YMKA 4EYYQ 1HJBA 3N4XA 4ZMDA 1RF1C 3G3ZA 3SWKA 1USDA 3CWBE 2NRGA 5TJHA 2FYNC 4JPZB 2FQ2A 1KILC 2LF4A 3OJAB 3H1LE 1GTWA 3MGNA 1T3UA 1VPCA 1L0NJ 1LT9B 2R32A 4OGQD 2A45I 4IOIH 4XFJA 5KP7B 3EWKA 2IPPA 2X2BA 5E79E 1NU1D 1MUUA 1VQ9P 2CG5B 2VLPA 3WUUA 1ZMBA 1KFNA 4JYCA 1LJ2A 3LW5J 1YHQP 3L73G 1SQPE 2KLVA 1R8EA 1SLQA 3VN0A 1ZRTE 1FR2A 1ZV8A 1M74A 1G2CB 2KUBA 3F89A 2FYUG 2E43A 1URQD 2M5AA 2D2CB 2GDYA 5TISE 1MZ9A 4H0LB 2M8PA 2YMYA 3P05A 1VQ6P 3G1GA 1ZOYC 3FX0A 2KOPA 4B86A 2FVFA 3AE8C 2Q3IA 5EFWB 3I56P 5APSA 2XKMA 3T97B 1MV8A 1W2BO 3V2PA 2BASA 1HUCA 3EJBA 2O01J 1N8RQ 3AE4C 2V7QJ 1HY8A 2FFDB 2QE7H 1YJ9P 2KLUA 1WT6A 4TLFA 2WSEJ 5DJTB 3G4SP 1G1JA 1JB0J 2BEZF 3CXHE 3L74G 2PFXA 2WPTA 1GK6A 1XTGB 3NXSA 3BASA 2PY8A 2CNRA 4D6TD 3L70G 3AE1C 1JCDA 1YTZI 4L76A 1X3OA 3H1KG 2PENA 1GL2A 4L74A 3AECC 5C39A 3H25A 3HTKA 2QVAA 1OXZA 2E5TA 1F80D 2A06E 1EZVI 3OAKA 2EHTA 1K9MQ 5TISH 1JY2N 3L75E 1FZEA 2G3AA 5M1BA 3HYBA 2WWWA 1EXJA 1SQVD 2PEMA 2FYUK 5CBNA 3UIAA 2FQ0A 3EJDA 2FHSC 3BRTB 5K5GB 2K37A 3BRVB 1ZR4A 4EOTA 2K93A 3CX5D 1URQC 2JGPA 2KNCB 1KYOI 2DNWA 1H0TA 1EOQA 1UNKA 2GA1A 3MIWA 4JF7A 4H0LD 3D6ZA 1KC8Q 2OGUA 5HGMA 3EFFK 2MD9A 1FZAA 2IBZI 2QSIA 1EDKA 4Y99B 2LKMA 1YJWP 3H1HD 3HUSA 3CXHH 4PD4D 2WT7B 2AFDA 2ZFCA 1AV1A 1LNQA 2FY8A 2XV5A 2XNXA 2OYIC 3L73J 1HWTC 3KHUA 4I7ZC 3TGUE 2JP3A 2FYUJ 1GL2C 1BCCD 2QA4P 2MF4A 2P10A 2P2UA 4H13B 1JO5A 2NPSB 3ABVC 2ONTA 1LTAC 4U3FG 1IC2A 3HD7D 3PH0A 1K05A 1NO4A 1QX8A 3VTPC 2WPRA 5BS2A 1CSBA 3CCLP 2MVUA 1RHZB 1DV5A 3II6A 3CPWO 2PGDA 3WUTA 3JC22 3S4RA 3RK3E 2WQYC 1G1IA 2VRSA 3M91A 2AVAA 1VQNP 2LMLA 1D7MA 1HGVA 2ITAA 1PPJD 2QJKC 5AW5B 2WSSH 1EQ7A 3LW5H 1BGYJ 3HD7A 2HR3A 5BU8B 3JCUE 3S9OA 2HPCB 3WU2H 5KP8B 1M1KQ 1JCCA 3M9HA 1KORA 4IPYA 1SFCB 4BRYA 3MP7B 3L71G 5APQA 4DOJA 3L74J 3H32B 2Z4EA 3L70J 1L0LD 3DS3A 3AEFC 4C7NB 2LKIA 3DS2A 1IFPA 1CZQA 3RL0C 3H1KJ 4IFDK 3H0DA 2W6AA 1R5SA 1LP1A 2AEFA 2AXTE 3CCRP 2QJYB 1RO2A 2IZ1A 2LIWA 1RF1B 2WITA 2V7QH 1XTCC 4F37A 3G0VA 2FYNB 1OVUA 4IFMA 1KILB 2MR8A 5GTHE 2R5BA 2WSEH 3VMAA 1JEKA 2LPKA 3GKLC 1IO4A 2KODA 3L73E 2BHVA 2NPSD 2A45G 4XFYA 4U7JA 5DJUB 1N2DC 3HD7C 2NZ2A 2FBWC 2KZIA 1VDFA 5AVUB 3G1IA 1PIXA 2WSFJ 2N1TA 4L73A 2OYHB 3MTUE 1JUNA 4KT0J 1FJKA 5H2FE 2ZT9C 2KB7P 1FDIA 2LL8A 3CMAP 1L4AA 2HYNA 3G9RA 1OVRA 3AE6C 2XZ0D 5CCHD 1OZHA 4D6TG 1OVVA 3CC4P 1SS1A 2AXTH 1PGOA 1M90Q 1HQBA 2CPSA 1KQFB 3RK3C 1FZCA 2AEJA 4U3FJ 1YITP 4HKGA 1EDIA 3IR9A 1P84D 1NU1K 1RF0A 2Y9ZA 2I1KA 2CPBA 2K0YA 1FAVA 2E74D 3FGAD 2SPZA 5AW8B 1BE3D 2O3JA 1N7SA 5GTIE 3L74E 5GTHH 1NH4A 3M1MA 1NQ4A 1T3JA 4QMAA 3L70E 3DS1A 1SQVG 3TNUA 3A2AA 1OR5A 1KB9I 1CW5A 2MJZA 1NTZG 3D70A 2UWJE 4W80A 1YTZT 2W6JH 4HYTB 3CC7P 3GJNA 2W8ZA 4RKUJ 1D1DA 1KLPA 5AVTB 5F2OA 1KILD 3C1LA 3TYYA 1SQXD 1X0TA 4O9BA 4NPFX 5CZDB 4HH2A 4WY4A 1LT1A 4OGQB 3GF7A 5HV8A 3L4FA 3H1HG 2LXCB 5H2FH 1PP9D 2I8DA 1FDOA 1M57D 1L4AC 5KLVD 1BXIA 1PL5A 3O6QA 3RG2A 5CCGA 2ZXEB 3NFQA 4WYMA 1JNMA 1E6JP 2GDXA 1NTKD 1VQ5P 3H1ID 3ZDMA 1ZP0C 4EIJA 1AQ5A 1KFMA 1RF0C 3PP5A 2IYPA 1A02F 2PEOA 1YQ3C 2K0XA 5AVXB 2RKLA 1NTMD 3EJEA 5GTIH 1URQB 2YO2A 1GDTA 1RO0A 5CCHC 2P9XA 3CCJP 2PP6A 2B87A 3L72G 2KORA 2CK3H 1GU5A 3G26A 1AQTA 3VP9A 2FVAA 1M1JA 2E5YA 2POHA 4YTPC 1AJYA 4NPDA 2E74C 1MFZA 2I1JA 2L6EA 3PRJA 4K3AA 2P58A 4BXLA 1SQVK 3G21A 4UB8E 3B5NA 5AW6B 2FYZA 2KG6A 2OTKE 2OYIB 3E1IA 3CL3D 5CBOA 3IFMA 1S1CX 2OQQA 3VOPA 2GZFA 1GL2B 1FZFA 2QJPC 2RMZA 3HTKB 2K88A 1JMMA 4D6TJ 2M8NA 1L0LG 3S1KA 4QKOA 1QRJA 3TK1A 5KLIC 2XU6A 5CCGC 1PV3A 1S4XA 3E7KA 4N78D 2R3SA 1EMVA 3L71E 2FKWB 1JY2P 5KP6B 2QRXA 1N86A 1ZXGA 4XFXA 1SQVJ 3CWBD 1VQKP 2QJKB 2E76D 3CD6P 1H0TB 4L75A 3BCCG 2E42A 1EDLA 3H1LD 1NTZJ 2M0BA 2KS1A 2JJLA 3KPEA 2XT1A 3IF4A 4KJMA 2WSCH 1TU3F 4DCKA 2ZJSE 2K9JB 1MZ8A 2P7JA 1USEA 3D71A 3U43A 1FZBA 2C0XA 1OMIA 2J59M 1QVFO 3RL0B 4H2WC 4UB8H 1FC2C 2N5HA 1VHNA 3H1HJ 5HVCA 1RE3A 1X9VA 3AEBC 2Y9YA 1Y47A 1ZN5A 1VQ7P 3H1JE 4U0CA 3LMOA 1SQPD 1ZRTD 1U57A 3VMYA 1BCCJ 3H4EA 1CI6B 2RN0A 1JY3N 3MGEA 1L0LK 5CJ0A 3HE4A 1BGYG 1GL2D 1Z6MA 3P8MC 4MRTC 3CX5I 3NTNA 1BE3G 3L72J 2JKVA 4QNBA 1DD4A 3HD7B 5E79H 4GOFA 3O8ZA 3QH9A 3LIDA 2KOOA 1T2KC 4K35A 2N9BA 2GZIA 1JMBA 1LWUA 4M0IA 3RBZA 1BSNA 4PD4I 5KTBA 2ZT9B 2K94A 1X8YA 1VQOP 1H8AA 3GG2A 3CXHD 1KV4A 1L0NE 2E76C 1RE4A 4M3LA 4CPGA 1M6NA 2W90A 3FXEA 2KR5A 1RE3C 1L0LJ 3RL0g 1SQVE 3WMM0 3PHLA 5I4TG 1NTZE 5DCKA 5EW5E 2YIUC 3GW6A 2A45H 4RESB 2K0DX 5KLVG 2YKPA 5APVA 2QM8A 1Q82Q 1S3JA 3L75D 3RL0D 1MKMA 2KW2A 4LLHA 2E75C 3H1IG 1VL2A 1HBWA 1IJDB 1R5LA 2XNDH 3FWLA 1LT9A 3RG6C 1YBKA 1IFMA 3BCCJ 1SQQD 2L4BA 4XRQA 3G6EP 1K8AQ 1OWAA 1Q86Q 5B5EE 1X22A 2OYOA 3VYIA 3GZLA 1EZVE 1SQBD 1AUMA 4U0EA 3EFGA 4WBAA 4RO0A 4GOEA 2IFNA 4H44C 1A8OA 3M0DA 3C8VA 3FXDA 1E0HA 2KP8A 3DS0A 4UHPB 1LTGC 1GD2E 1RE4C 1KYOE 1ZNVA 1MFTA 3L72E 3TGUD 4U0BA 2ZVNB 3M06A 5AW3B 3OW2O 1VKUA 4N3YB 2IBZE 4Y28J 4GT1A 3GHGA 3LIEA 1SQXK 2VLOA 2ZT9D 3T97A 2HLOA 2YXQB 4U0DA 3NY7B 2PEKA 1AA0A 4BPFA 2HFED 4XROA 1JM0A 1BE3J 3A0HE 3TNUB 1PEOA 2IYOA 1BDCA 1LT9C 3HE5A 5KLVK 2IX7C 4OWFA 2P67A 2WTYA 4Z1MH 3RK3D 2FVEA 1NHLA 5AVSB 2CGQA 4YPCA 4C7RA 3L35A 2E74B 2EIAA 1YIJP 1NTKK 3HUSC 3VRLC 3V5BA 5B5EH 2Q1KA 1FS0E 4NPEA 1NU1G 2C0WA 1AVOA 4W7YA 1RQVA 3Q1MA 2M3BA 3AEGC 1KD1Q 1NTMK 5CMZA 1NOHA 2BCCD 3CC2P 3CCQP 3CMEP 2MR7A 2O01H 1VQLP 1S72P 4PJ0E 5AVZB 4XE5B 1GZLA 2JO0A 4IZ6A 1T8KA 1QVGO 3O6QB 3MHVA 3SSUA 1KYOH 3Q5SA 1FE6A 5KLIB 3BCCE 1CEIA 2N6YA 2QG4A 4IFFA 2GDWA 3C9IA 2N1TD 1IUQA 5KLVJ 1P84I 2LTEA 3A5TA 1N7LA 4DJGA 4GKGA 1OW8A 5BU5A 1JY2O 1LTBC 4WWIA 3GHGC 2EFJA 1NTKJ 2BUOA 3H1IJ 2ZXXA 2BQ1E 1ZMEC 2FYUE 1L4AD 1VF5D 3DTJA 2KI7B 3JCUH 3CI9A 4W7ZA 3QWOC 3A0HH 2LR2A 2B9BA 3G28A 1Q90D 2GM4A 5F2KA 3P8CE 1VQPP 1RQUA 3L73D 1N73A 2N50A 2ZYGA 5AVVB 1PFIA 1K04A 2WT7A 1N7SD 4RJTA 5APTA 2L22A 4HJGH 2HODA 2YNYA 2O1KA 2PRRA 1DNYA 1IMPA 1BGYE 4U0AA 4DT0A 1DEBA 2E1MA 3RK2D 1UJZA 2B89A 4PJ0H 3B4SA 1E79H 4PH0A 2FXMA 2EHSA 3PTZA 2KOQA 1S5LX 3BVHA 2YO3A 1SP4A 2DGYA 5KJ7A 2AXCA 1JTHA 3GLMA 4WY4D 3H1KE 1H89A 1QGKB 3KQGA 1WRGA 3A7OA 5EJDA 2QNWA 2JYLA 2Q6QA 3SFDC 5AW9B 1Y9BA 2KOGA 1AF8A 3L74D 3L75G 2HPCA 4PXHB 5CCGD 3L70D 2N1TC 2ZYDA 3CWBJ 1SFCA 4UB6E 4H2XC 1J1DC 1NVOA 3Q2YA 1LTSC 1GXHA 1FJPA 1N73C 1SQQG 1NU1J 2OARA 2KK7A 4GDOA 3MUDA 5KLVE 2IDBA 1HVVA 2M5AB 2E76B 1VF5C 1SQBG 2VLNA 2BEQD 4ASVA 2K92A 4OVNF 3H1IE 2YXRB 3TDKA 3U1AA 1FZCC 1BCCG 1E5WA 3L36A 4H13C 3PJSK 3K5BA 1KB9E 2YIUB 2PEQA 1UIIA 1GK4A 1M56D 1SVFA 1IFNA 1N7SC 2IFMA 3B71A 1PEUA 1ACPA 4MN4C 2MVVA 5BS1A 1FDMA 3V2NA 2XV6A 3B5ND 1S9KE 3SWFA 2FADA 5KJ7C 2JQ4A 3TGUG 2QM7A 1QEXA 3OA7A 3HE4B 2H89C 2FAEA 3RK2C 2Q3EA 2VSQA 1JY3P 1ZR2A 1PPJG 2WVRA 3A0BE 4U3FE 2GZGA 2O1JA 5B66E 2HG5D 1SFCC 4PV1D 2FACA 4UB6H 1K73Q 2OYHA 4I7ZB 4WY4C 3AE9C 3AE5C 4WVZA 2KG8A 5HGLA 4GR2A 1ZLLA 4R0MA 2CQ8A 2Y0CA 2L0QA 2GZJA 1RNIA 2XZ1C 1QLED 2WPQA 1JJ2O 4I1LA 2J5UA 3DS5A 1SQQK 4HKZH 1M7LA 1AVYA 3U1CA 4CA3A 1NJIQ 2QJYC 2J58A 3HZQA 1T2KD 2BCCG 5APYA 2K2QA 3ITKA 1SQBK 1KB9H 1KMIZ 1L0HA 2K5XA 2WSFH 3USSA 3D6YA 3H47A 1NU1E 3W67A 1WMKA 3VP8A 1S5LE 2JWAA 1IK7A 1RY3A 3L71D 3GF3A 3L75J 1M1JC 1NKZB 4R4LA 2XDJA 1AFOA 1IK9A 3A0BH 3HUSB 3IAOA 1U7MA 1EDJA 1Q7YQ 2XXMA 3B5NC 1SQQJ 5B66H 2DW3A 2OYHC 3AEDC 2E75D 5AVQB 1EXIA 2JB0A 1GPJA 2JDIH 2JU1A 1SQBJ 3MD0A 2RH0A 3NMDA 1QL2A 1LGHB 3CXHI 1W5CE 2YKOA 1HJ0A 3EQ2A 4LC1A 1J1EC 3HRNA 1NWQA 1NKNA 1FBMA 3MZWB 4PV1C 4EI2A 2JYGA 1IZNB 4GODA 1VQMP 4H44D 2GZEA 3CXCO 1EIAA 1LTJA 3P32A 5AVRB 3H1JD 2JEEA 3Q5RA 3GHGB 2Z46A 3TGUJ 1URQA 5AW2B 4COCA 2C9LY 3V2RA 3AEAC 1S5LH 4D6TE 2L9FA 2PNGA 1Y8AA 1VQ4P 1OIPA 1KQLA 4GIFA 3HE5B 2M8RA 1T6AA 5KKZC 1FU1A 3JSVC 4BRYB 3B8EB 1KQGB 2G8YA 7CEIA 4EDFA 3V2QA 4H2YC 2KIKA 2FQ1A 3DPHA 3CCMP 2M8LA 3G29A 1H88A 1KZUB 1T8ZA 3AEEC 2OYIA 1LP1B 1SQXG 4GR6A 1LTTC 2ZYAA 4OGQC 5KAIE 3RK3B 3Q5PA 2WPVB 2W6BA 1PP9G 3CX5E 2KGDA 1L0ND 2BCCJ 2A06D 2QIWA 1DD3A 1JOCA 2L91A 2KGAA 1NTKG 5AW4B 1LTJC 2N5IA 5L8RJ 1NGMB 1AYIA 1NTZD 1SQQE 2R3CA 3LRYA 2PEJA 2EG5A 1GMJA 3H1HE 4ASWA 2L5GB 1NTMG 5HGOA 5APXA 2D2CD 4PD4E 5AVWB 5AW0B 1SQBE 3WBHA 2N9YB 1X79B 3WU2E 3I55P 2NO8A 4I2LC 2FXOA 3BATA 2JR8A 2N1TB 2Q7CA 1J1DB 3R2PA 1BCCE 3GMAA 2R5DA 4COPA 2K9JA 1BAJA 1N73B 1LWUC 2JBGA 3DS4A 5AW1B 1W2EA 2Z5IA 3M9QA 3AE3C 1G2CA 3KDPB 4TT3H 1L4AB 2Y0EA 1VF5B 2B88A 1EZVD 2HODB 1DEEG 1DH3A 3E2DA 1FZGA 5KAIH 1FZCB 2P1JA 2AFEA 3GZMA 2GUSA 4AQRD 3B5IA 3SWYA 3CX5H 1PPJE 3U59A 1GU4A 1J2JB 4R4MA 1N7SB 2KOSA 2O01N 1KYOD 1QL1A 1CI6A 1M8OB 3L72D 3AE2C 1JTHB 3RBXA 2ZVOB 4ZKPA 3RK2B 2FFDA 3TF5A 2IBZD 3N7NA 1JY3O 2K3RA 1L0LE 1A43A 2JO1A 5AW7B 2Q9IA 4PD4H 3CWBG 2K1AA 4N6JA 3H1LG 5KAFE 4IL6X 2PAJA 4YXDC 4YXWH 1BDDA 2BCCE 2C9NY 5CJ4A 4WY4B 1VQ8P 3H6PA 3M0DC 2QJPB 2JAZA 3E1RA 2R44A 3I5CA 4OH8B 2OTJP 4HB1A 4BPHA 3M9BA 1SQXJ 3KXDA 2D2CC 3CCUP 4H0LC 1DIPA 3NTEA 2ZAEB 2WZ7A 2N98A 1PP9J 2KSEA 2Y0DA 3W68A 2IZ0A 4BPGA 3KYQA 2PEIA 4JQ0D 3CCVP 5APUA 4NEOA 1M6EX 4AUWA 1SQPG 4ZNCA 2MY5A 1BSHA 1DX7A 3V6IA 4LGDE 3WUVA 2KNCA 3BCCD 3KZIE 3L37A 3CE7A 2B87B 3V4WA 1NTMJ 2AEMA 1EC5A 1KTMA 5APWA 3H1JG 1L2PA 3F5HA 1K30A 2FFDC 1M1JB 2QEXP 4AYCA 4H13D 1IMQA 2KGCA 1YI2P 1Z56A 1S2EA 2FYUD 3TSIA 3B5NB 2M3EA 5KAFH 2LIUA 3CCSP 1IFJA 5KJ7D 2MKVA 3P8CD 3FWNA 1P84E 2LXBA 3Q20A 2KSJA 2NPSA 1YQ4C 1BE3E 4KHXA 2KWLA 4XFZA 3SFEC 2H88C 2WSCJ 1PZQA 1J1EB 2AF8A 4WB4A 2KGEA 1HF9A 4PV1B 2GYKA 1A02J 4BWNA 3IN6A 1SFCD 1NAYA 4PWVB 1BGYD 2GUVA 1GXGA 5JPAA 4I6MC 1KQSO 3G71P 2K9YA 2Z5HA 3CCEP 1OFCX 1L0NG 2A06G 2WMMA 1YJNP 5F2NA 5CCHA 3KZIH 1KILE 5CHXA 5HGNA 1SQPK 2KS1B 1SQXE 1IFIA 2V4HA 2CWOA 5KKZB 3H1KD 1NAFA
chains in the Genus database with same CATH topology
3I56P 1QVFO 3H0DA 5DCKA 3E2DA 4XROA 3G26A 3DPHA 1PEOA 3CCMP 1YJWP 2PEQA 2M8LA 1W2BO 3G29A 3CCRP 1Q82Q 1N8RQ 3M1MA 1RO2A 2L6EA 3B5IA 3DS1A 1PEUA 2EIAA 1YIJP 1VQ7P 1K30A 3G21A 4U0CA 5BS1A 2QEXP 2XV6A 3VRLC 4GR6A 4U0AA 1YJ9P 2E1MA 2LF4A 1YI2P 3G0VA 1Q7YQ 2XXMA 3RG6C 4PH0A 3H4EA 2QA4P 3G4SP 2Z45A 1KD1Q 3CC7P 4XRQA 3G6EP 1Q81Q 1K8AQ 3MGEA 3CCSP 2PY8A 1D1DA 3CC2P 1Q86Q 2M8NA 3CCQP 5F2OA 2DGYA 2ONTA 3CMEP 1A43A 2KODA 1VQLP 1S72P 1QRJA 1AUMA 4U0EA 2JO0A 2PENA 5BS2A 2BHVA 3CCLP 4XFYA 1QVGO 3Q20A 1PEMA 2JYLA 1A8OA 1K73Q 4XFZA 4QNBA 3CPWO 3LRYA 1VQ9P 2PEJA 2EG5A 1ZMBA 3G1IA 1IUQA 1VQ8P 1K9MQ 5HGLA 5HGOA 3DS0A 4GR2A 2JYGA 1VQNP 1VQMP 3HYBA 2Z44A 3WBHA 3CXCO 1EIAA 4PH1A 1YHQP 3I55P 2OTLP 1RNIA 4XFXA 2OTJP 4WYMA 2EFJA 1VQKP 1E6JP 2PEMA 1JJ2O 2BUOA 1M74A 1VQ5P 3CD6P 3CCUP 1M1KQ 2BQ1E 2Z46A 3DS5A 4M0IA 4U0BA 3CMAP 4COPA 5JPAA 4COCA 1KQSO 3DTJA 3NTEA 2OARA 3G71P 1NJIQ 3CCEP 1BAJA 4IPYA 3HZQA 1VQOP 3OW2O 2PEOA 2XT1A 3DS4A 1YJNP 2M8PA 5F2NA 3CC4P 3G28A 2PEIA 1M6NA 3CCVP 1VQ4P 3P05A 5F2KA 3G1GA 1M90Q 1VQ6P 1EOQA 1M6EX 1PEQA 5HGNA 3DS3A 1VQPP 1RO0A 4U0DA 4U0FA 2CWOA 3DS2A 1YITP 2P9XA 1KC8Q 5HGMA 3H47A 3CCJP 2PEKA 5I4TG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 P;  1QVF O;  1Q7Y Q;  1K73 Q;  3CMA P;  2QA4 P;  3CPW O;  1KQS O;  3G4S P;  3G71 P;  1NJI Q;  3CCE P;  1KD1 Q;  1VQO P;  1VQ9 P;  3CCM P;  3OW2 O;  3CC7 P;  1YJW P;  1YJN P;  1W2B O;  3G6E P;  1Q81 Q;  3CCR P;  1K9M Q;  1K8A Q;  1VQ8 P;  1Q82 Q;  3CCS P;  1N8R Q;  3CC4 P;  3CC2 P;  1Q86 Q;  1VQN P;  3CCV P;  1VQM P;  3CCQ P;  1VQ4 P;  3CXC O;  1M90 Q;  1VQ6 P;  3CME P;  1YIJ P;  1VQ7 P;  1YHQ P;  1S72 P;  1VQL P;  3I55 P;  3CD6 P;  2OTL P;  1VQP P;  2QEX P;  2OTJ P;  1YIT P;  1VQK P;  1KC8 Q;  1JJ2 O;  1YJ9 P;  1VQ5 P;  3CCJ P;  3CCL P;  1QVG O;  1YI2 P;  3CCU P;  1M1K Q; 
#chains in the Genus database with same CATH topology
 2VLQ A;  4Y99 C;  4ZKU A;  1GW3 A;  3H32 A;  4DG9 A;  3H1L J;  2YKQ A;  2H7H A;  1PP9 E;  1OX3 A;  1U7J A;  2H43 A;  4C7N A;  3L71 J;  3Q3D A;  3R4Y A;  1RH5 B;  2N6Z A;  2JU2 A;  1NTK E;  2W27 A;  1ZW0 A;  1HH0 A;  2H8P D;  4IL6 E;  2KYV A;  1P84 H;  1PGQ A;  1Q2N A;  3A3Y B;  2ERH A;  2WPS A;  1IFD A;  2Z45 A;  2W83 C;  2NPS C;  1RF1 A;  1KN7 A;  2Q5U A;  1Q81 Q;  1NTM E;  2KXP B;  2FXP A;  4XA4 A;  1EZV G;  2KG9 A;  1KIL A;  4JBZ A;  3VMZ A;  1SQP J;  1FOS F;  1LTI C;  2E75 B;  1PEM A;  1LTJ B;  1OW7 A;  1HTL C;  2ROQ A;  3V4Q A;  2LOL A;  1KB9 D;  1YYC A;  3CLQ A;  2KZJ A;  2Z44 A;  5AVY B;  4A7P A;  4PH1 A;  3H1J J;  2JWD A;  2OTL P;  3RGU A;  1UIX A;  1S9K D;  3PLN A;  4C46 A;  3P7K A;  1NYH A;  4H44 B;  4DZO A;  1L0N K;  1FOS E;  2XZR A;  2IBZ G;  1LWU B;  1GW4 A;  1L0I A;  3MUD C;  3VMX A;  1PEQ A;  3M0A A;  4U3F D;  4U0F A;  4JYB A;  3B4Q A;  1NTZ K;  1OW6 A;  4N78 E;  1PGJ A;  5BVZ A;  1PGP A;  3AE7 C;  2M5R A;  4IL6 H;  1HGZ A;  2YMK A;  4EYY Q;  1HJB A;  3N4X A;  4ZMD A;  1RF1 C;  3G3Z A;  3SWK A;  1USD A;  3CWB E;  2NRG A;  5TJH A;  2FYN C;  4JPZ B;  2FQ2 A;  1KIL C;  2LF4 A;  3OJA B;  3H1L E;  1GTW A;  3MGN A;  1T3U A;  1VPC A;  1L0N J;  1LT9 B;  2R32 A;  4OGQ D;  2A45 I;  4IOI H;  4XFJ A;  5KP7 B;  3EWK A;  2IPP A;  2X2B A;  5E79 E;  1NU1 D;  1MUU A;  1VQ9 P;  2CG5 B;  2VLP A;  3WUU A;  1ZMB A;  1KFN A;  4JYC A;  1LJ2 A;  3LW5 J;  1YHQ P;  3L73 G;  1SQP E;  2KLV A;  1R8E A;  1SLQ A;  3VN0 A;  1ZRT E;  1FR2 A;  1ZV8 A;  1M74 A;  1G2C B;  2KUB A;  3F89 A;  2FYU G;  2E43 A;  1URQ D;  2M5A A;  2D2C B;  2GDY A;  5TIS E;  1MZ9 A;  4H0L B;  2M8P A;  2YMY A;  3P05 A;  1VQ6 P;  3G1G A;  1ZOY C;  3FX0 A;  2KOP A;  4B86 A;  2FVF A;  3AE8 C;  2Q3I A;  5EFW B;  3I56 P;  5APS A;  2XKM A;  3T97 B;  1MV8 A;  1W2B O;  3V2P A;  2BAS A;  1HUC A;  3EJB A;  2O01 J;  1N8R Q;  3AE4 C;  2V7Q J;  1HY8 A;  2FFD B;  2QE7 H;  1YJ9 P;  2KLU A;  1WT6 A;  4TLF A;  2WSE J;  5DJT B;  3G4S P;  1G1J A;  1JB0 J;  2BEZ F;  3CXH E;  3L74 G;  2PFX A;  2WPT A;  1GK6 A;  1XTG B;  3NXS A;  3BAS A;  2PY8 A;  2CNR A;  4D6T D;  3L70 G;  3AE1 C;  1JCD A;  1YTZ I;  4L76 A;  1X3O A;  3H1K G;  2PEN A;  1GL2 A;  4L74 A;  3AEC C;  5C39 A;  3H25 A;  3HTK A;  2QVA A;  1OXZ A;  2E5T A;  1F80 D;  2A06 E;  1EZV I;  3OAK A;  2EHT A;  1K9M Q;  5TIS H;  1JY2 N;  3L75 E;  1FZE A;  2G3A A;  5M1B A;  3HYB A;  2WWW A;  1EXJ A;  1SQV D;  2PEM A;  2FYU K;  5CBN A;  3UIA A;  2FQ0 A;  3EJD A;  2FHS C;  3BRT B;  5K5G B;  2K37 A;  3BRV B;  1ZR4 A;  4EOT A;  2K93 A;  3CX5 D;  1URQ C;  2JGP A;  2KNC B;  1KYO I;  2DNW A;  1H0T A;  1EOQ A;  1UNK A;  2GA1 A;  3MIW A;  4JF7 A;  4H0L D;  3D6Z A;  1KC8 Q;  2OGU A;  5HGM A;  3EFF K;  2MD9 A;  1FZA A;  2IBZ I;  2QSI A;  1EDK A;  4Y99 B;  2LKM A;  1YJW P;  3H1H D;  3HUS A;  3CXH H;  4PD4 D;  2WT7 B;  2AFD A;  2ZFC A;  1AV1 A;  1LNQ A;  2FY8 A;  2XV5 A;  2XNX A;  2OYI C;  3L73 J;  1HWT C;  3KHU A;  4I7Z C;  3TGU E;  2JP3 A;  2FYU J;  1GL2 C;  1BCC D;  2QA4 P;  2MF4 A;  2P10 A;  2P2U A;  4H13 B;  1JO5 A;  2NPS B;  3ABV C;  2ONT A;  1LTA C;  4U3F G;  1IC2 A;  3HD7 D;  3PH0 A;  1K05 A;  1NO4 A;  1QX8 A;  3VTP C;  2WPR A;  5BS2 A;  1CSB A;  3CCL P;  2MVU A;  1RHZ B;  1DV5 A;  3II6 A;  3CPW O;  2PGD A;  3WUT A;  3JC2 2;  3S4R A;  3RK3 E;  2WQY C;  1G1I A;  2VRS A;  3M91 A;  2AVA A;  1VQN P;  2LML A;  1D7M A;  1HGV A;  2ITA A;  1PPJ D;  2QJK C;  5AW5 B;  2WSS H;  1EQ7 A;  3LW5 H;  1BGY J;  3HD7 A;  2HR3 A;  5BU8 B;  3JCU E;  3S9O A;  2HPC B;  3WU2 H;  5KP8 B;  1M1K Q;  1JCC A;  3M9H A;  1KOR A;  4IPY A;  1SFC B;  4BRY A;  3MP7 B;  3L71 G;  5APQ A;  4DOJ A;  3L74 J;  3H32 B;  2Z4E A;  3L70 J;  1L0L D;  3DS3 A;  3AEF C;  4C7N B;  2LKI A;  3DS2 A;  1IFP A;  1CZQ A;  3RL0 C;  3H1K J;  4IFD K;  3H0D A;  2W6A A;  1R5S A;  1LP1 A;  2AEF A;  2AXT E;  3CCR P;  2QJY B;  1RO2 A;  2IZ1 A;  2LIW A;  1RF1 B;  2WIT A;  2V7Q H;  1XTC C;  4F37 A;  3G0V A;  2FYN B;  1OVU A;  4IFM A;  1KIL B;  2MR8 A;  5GTH E;  2R5B A;  2WSE H;  3VMA A;  1JEK A;  2LPK A;  3GKL C;  1IO4 A;  2KOD A;  3L73 E;  2BHV A;  2NPS D;  2A45 G;  4XFY A;  4U7J A;  5DJU B;  1N2D C;  3HD7 C;  2NZ2 A;  2FBW C;  2KZI A;  1VDF A;  5AVU B;  3G1I A;  1PIX A;  2WSF J;  2N1T A;  4L73 A;  2OYH B;  3MTU E;  1JUN A;  4KT0 J;  1FJK A;  5H2F E;  2ZT9 C;  2KB7 P;  1FDI A;  2LL8 A;  3CMA P;  1L4A A;  2HYN A;  3G9R A;  1OVR A;  3AE6 C;  2XZ0 D;  5CCH D;  1OZH A;  4D6T G;  1OVV A;  3CC4 P;  1SS1 A;  2AXT H;  1PGO A;  1M90 Q;  1HQB A;  2CPS A;  1KQF B;  3RK3 C;  1FZC A;  2AEJ A;  4U3F J;  1YIT P;  4HKG A;  1EDI A;  3IR9 A;  1P84 D;  1NU1 K;  1RF0 A;  2Y9Z A;  2I1K A;  2CPB A;  2K0Y A;  1FAV A;  2E74 D;  3FGA D;  2SPZ A;  5AW8 B;  1BE3 D;  2O3J A;  1N7S A;  5GTI E;  3L74 E;  5GTH H;  1NH4 A;  3M1M A;  1NQ4 A;  1T3J A;  4QMA A;  3L70 E;  3DS1 A;  1SQV G;  3TNU A;  3A2A A;  1OR5 A;  1KB9 I;  1CW5 A;  2MJZ A;  1NTZ G;  3D70 A;  2UWJ E;  4W80 A;  1YTZ T;  2W6J H;  4HYT B;  3CC7 P;  3GJN A;  2W8Z A;  4RKU J;  1D1D A;  1KLP A;  5AVT B;  5F2O A;  1KIL D;  3C1L A;  3TYY A;  1SQX D;  1X0T A;  4O9B A;  4NPF X;  5CZD B;  4HH2 A;  4WY4 A;  1LT1 A;  4OGQ B;  3GF7 A;  5HV8 A;  3L4F A;  3H1H G;  2LXC B;  5H2F H;  1PP9 D;  2I8D A;  1FDO A;  1M57 D;  1L4A C;  5KLV D;  1BXI A;  1PL5 A;  3O6Q A;  3RG2 A;  5CCG A;  2ZXE B;  3NFQ A;  4WYM A;  1JNM A;  1E6J P;  2GDX A;  1NTK D;  1VQ5 P;  3H1I D;  3ZDM A;  1ZP0 C;  4EIJ A;  1AQ5 A;  1KFM A;  1RF0 C;  3PP5 A;  2IYP A;  1A02 F;  2PEO A;  1YQ3 C;  2K0X A;  5AVX B;  2RKL A;  1NTM D;  3EJE A;  5GTI H;  1URQ B;  2YO2 A;  1GDT A;  1RO0 A;  5CCH C;  2P9X A;  3CCJ P;  2PP6 A;  2B87 A;  3L72 G;  2KOR A;  2CK3 H;  1GU5 A;  3G26 A;  1AQT A;  3VP9 A;  2FVA A;  1M1J A;  2E5Y A;  2POH A;  4YTP C;  1AJY A;  4NPD A;  2E74 C;  1MFZ A;  2I1J A;  2L6E A;  3PRJ A;  4K3A A;  2P58 A;  4BXL A;  1SQV K;  3G21 A;  4UB8 E;  3B5N A;  5AW6 B;  2FYZ A;  2KG6 A;  2OTK E;  2OYI B;  3E1I A;  3CL3 D;  5CBO A;  3IFM A;  1S1C X;  2OQQ A;  3VOP A;  2GZF A;  1GL2 B;  1FZF A;  2QJP C;  2RMZ A;  3HTK B;  2K88 A;  1JMM A;  4D6T J;  2M8N A;  1L0L G;  3S1K A;  4QKO A;  1QRJ A;  3TK1 A;  5KLI C;  2XU6 A;  5CCG C;  1PV3 A;  1S4X A;  3E7K A;  4N78 D;  2R3S A;  1EMV A;  3L71 E;  2FKW B;  1JY2 P;  5KP6 B;  2QRX A;  1N86 A;  1ZXG A;  4XFX A;  1SQV J;  3CWB D;  1VQK P;  2QJK B;  2E76 D;  3CD6 P;  1H0T B;  4L75 A;  3BCC G;  2E42 A;  1EDL A;  3H1L D;  1NTZ J;  2M0B A;  2KS1 A;  2JJL A;  3KPE A;  2XT1 A;  3IF4 A;  4KJM A;  2WSC H;  1TU3 F;  4DCK A;  2ZJS E;  2K9J B;  1MZ8 A;  2P7J A;  1USE A;  3D71 A;  3U43 A;  1FZB A;  2C0X A;  1OMI A;  2J59 M;  1QVF O;  3RL0 B;  4H2W C;  4UB8 H;  1FC2 C;  2N5H A;  1VHN A;  3H1H J;  5HVC A;  1RE3 A;  1X9V A;  3AEB C;  2Y9Y A;  1Y47 A;  1ZN5 A;  1VQ7 P;  3H1J E;  4U0C A;  3LMO A;  1SQP D;  1ZRT D;  1U57 A;  3VMY A;  1BCC J;  3H4E A;  1CI6 B;  2RN0 A;  1JY3 N;  3MGE A;  1L0L K;  5CJ0 A;  3HE4 A;  1BGY G;  1GL2 D;  1Z6M A;  3P8M C;  4MRT C;  3CX5 I;  3NTN A;  1BE3 G;  3L72 J;  2JKV A;  4QNB A;  1DD4 A;  3HD7 B;  5E79 H;  4GOF A;  3O8Z A;  3QH9 A;  3LID A;  2KOO A;  1T2K C;  4K35 A;  2N9B A;  2GZI A;  1JMB A;  1LWU A;  4M0I A;  3RBZ A;  1BSN A;  4PD4 I;  5KTB A;  2ZT9 B;  2K94 A;  1X8Y A;  1VQO P;  1H8A A;  3GG2 A;  3CXH D;  1KV4 A;  1L0N E;  2E76 C;  1RE4 A;  4M3L A;  4CPG A;  1M6N A;  2W90 A;  3FXE A;  2KR5 A;  1RE3 C;  1L0L J;  3RL0 g;  1SQV E;  3WMM 0;  3PHL A;  5I4T G;  1NTZ E;  5DCK A;  5EW5 E;  2YIU C;  3GW6 A;  2A45 H;  4RES B;  2K0D X;  5KLV G;  2YKP A;  5APV A;  2QM8 A;  1Q82 Q;  1S3J A;  3L75 D;  3RL0 D;  1MKM A;  2KW2 A;  4LLH A;  2E75 C;  3H1I G;  1VL2 A;  1HBW A;  1IJD B;  1R5L A;  2XND H;  3FWL A;  1LT9 A;  3RG6 C;  1YBK A;  1IFM A;  3BCC J;  1SQQ D;  2L4B A;  4XRQ A;  3G6E P;  1K8A Q;  1OWA A;  1Q86 Q;  5B5E E;  1X22 A;  2OYO A;  3VYI A;  3GZL A;  1EZV E;  1SQB D;  1AUM A;  4U0E A;  3EFG A;  4WBA A;  4RO0 A;  4GOE A;  2IFN A;  4H44 C;  1A8O A;  3M0D A;  3C8V A;  3FXD A;  1E0H A;  2KP8 A;  3DS0 A;  4UHP B;  1LTG C;  1GD2 E;  1RE4 C;  1KYO E;  1ZNV A;  1MFT A;  3L72 E;  3TGU D;  4U0B A;  2ZVN B;  3M06 A;  5AW3 B;  3OW2 O;  1VKU A;  4N3Y B;  2IBZ E;  4Y28 J;  4GT1 A;  3GHG A;  3LIE A;  1SQX K;  2VLO A;  2ZT9 D;  3T97 A;  2HLO A;  2YXQ B;  4U0D A;  3NY7 B;  2PEK A;  1AA0 A;  4BPF A;  2HFE D;  4XRO A;  1JM0 A;  1BE3 J;  3A0H E;  3TNU B;  1PEO A;  2IYO A;  1BDC A;  1LT9 C;  3HE5 A;  5KLV K;  2IX7 C;  4OWF A;  2P67 A;  2WTY A;  4Z1M H;  3RK3 D;  2FVE A;  1NHL A;  5AVS B;  2CGQ A;  4YPC A;  4C7R A;  3L35 A;  2E74 B;  2EIA A;  1YIJ P;  1NTK K;  3HUS C;  3VRL C;  3V5B A;  5B5E H;  2Q1K A;  1FS0 E;  4NPE A;  1NU1 G;  2C0W A;  1AVO A;  4W7Y A;  1RQV A;  3Q1M A;  2M3B A;  3AEG C;  1KD1 Q;  1NTM K;  5CMZ A;  1NOH A;  2BCC D;  3CC2 P;  3CCQ P;  3CME P;  2MR7 A;  2O01 H;  1VQL P;  1S72 P;  4PJ0 E;  5AVZ B;  4XE5 B;  1GZL A;  2JO0 A;  4IZ6 A;  1T8K A;  1QVG O;  3O6Q B;  3MHV A;  3SSU A;  1KYO H;  3Q5S A;  1FE6 A;  5KLI B;  3BCC E;  1CEI A;  2N6Y A;  2QG4 A;  4IFF A;  2GDW A;  3C9I A;  2N1T D;  1IUQ A;  5KLV J;  1P84 I;  2LTE A;  3A5T A;  1N7L A;  4DJG A;  4GKG A;  1OW8 A;  5BU5 A;  1JY2 O;  1LTB C;  4WWI A;  3GHG C;  2EFJ A;  1NTK J;  2BUO A;  3H1I J;  2ZXX A;  2BQ1 E;  1ZME C;  2FYU E;  1L4A D;  1VF5 D;  3DTJ A;  2KI7 B;  3JCU H;  3CI9 A;  4W7Z A;  3QWO C;  3A0H H;  2LR2 A;  2B9B A;  3G28 A;  1Q90 D;  2GM4 A;  5F2K A;  3P8C E;  1VQP P;  1RQU A;  3L73 D;  1N73 A;  2N50 A;  2ZYG A;  5AVV B;  1PFI A;  1K04 A;  2WT7 A;  1N7S D;  4RJT A;  5APT A;  2L22 A;  4HJG H;  2HOD A;  2YNY A;  2O1K A;  2PRR A;  1DNY A;  1IMP A;  1BGY E;  4U0A A;  4DT0 A;  1DEB A;  2E1M A;  3RK2 D;  1UJZ A;  2B89 A;  4PJ0 H;  3B4S A;  1E79 H;  4PH0 A;  2FXM A;  2EHS A;  3PTZ A;  2KOQ A;  1S5L X;  3BVH A;  2YO3 A;  1SP4 A;  2DGY A;  5KJ7 A;  2AXC A;  1JTH A;  3GLM A;  4WY4 D;  3H1K E;  1H89 A;  1QGK B;  3KQG A;  1WRG A;  3A7O A;  5EJD A;  2QNW A;  2JYL A;  2Q6Q A;  3SFD C;  5AW9 B;  1Y9B A;  2KOG A;  1AF8 A;  3L74 D;  3L75 G;  2HPC A;  4PXH B;  5CCG D;  3L70 D;  2N1T C;  2ZYD A;  3CWB J;  1SFC A;  4UB6 E;  4H2X C;  1J1D C;  1NVO A;  3Q2Y A;  1LTS C;  1GXH A;  1FJP A;  1N73 C;  1SQQ G;  1NU1 J;  2OAR A;  2KK7 A;  4GDO A;  3MUD A;  5KLV E;  2IDB A;  1HVV A;  2M5A B;  2E76 B;  1VF5 C;  1SQB G;  2VLN A;  2BEQ D;  4ASV A;  2K92 A;  4OVN F;  3H1I E;  2YXR B;  3TDK A;  3U1A A;  1FZC C;  1BCC G;  1E5W A;  3L36 A;  4H13 C;  3PJS K;  3K5B A;  1KB9 E;  2YIU B;  2PEQ A;  1UII A;  1GK4 A;  1M56 D;  1SVF A;  1IFN A;  1N7S C;  2IFM A;  3B71 A;  1PEU A;  1ACP A;  4MN4 C;  2MVV A;  5BS1 A;  1FDM A;  3V2N A;  2XV6 A;  3B5N D;  1S9K E;  3SWF A;  2FAD A;  5KJ7 C;  2JQ4 A;  3TGU G;  2QM7 A;  1QEX A;  3OA7 A;  3HE4 B;  2H89 C;  2FAE A;  3RK2 C;  2Q3E A;  2VSQ A;  1JY3 P;  1ZR2 A;  1PPJ G;  2WVR A;  3A0B E;  4U3F E;  2GZG A;  2O1J A;  5B66 E;  2HG5 D;  1SFC C;  4PV1 D;  2FAC A;  4UB6 H;  1K73 Q;  2OYH A;  4I7Z B;  4WY4 C;  3AE9 C;  3AE5 C;  4WVZ A;  2KG8 A;  5HGL A;  4GR2 A;  1ZLL A;  4R0M A;  2CQ8 A;  2Y0C A;  2L0Q A;  2GZJ A;  1RNI A;  2XZ1 C;  1QLE D;  2WPQ A;  1JJ2 O;  4I1L A;  2J5U A;  3DS5 A;  1SQQ K;  4HKZ H;  1M7L A;  1AVY A;  3U1C A;  4CA3 A;  1NJI Q;  2QJY C;  2J58 A;  3HZQ A;  1T2K D;  2BCC G;  5APY A;  2K2Q A;  3ITK A;  1SQB K;  1KB9 H;  1KMI Z;  1L0H A;  2K5X A;  2WSF H;  3USS A;  3D6Y A;  3H47 A;  1NU1 E;  3W67 A;  1WMK A;  3VP8 A;  1S5L E;  2JWA A;  1IK7 A;  1RY3 A;  3L71 D;  3GF3 A;  3L75 J;  1M1J C;  1NKZ B;  4R4L A;  2XDJ A;  1AFO A;  1IK9 A;  3A0B H;  3HUS B;  3IAO A;  1U7M A;  1EDJ A;  1Q7Y Q;  2XXM A;  3B5N C;  1SQQ J;  5B66 H;  2DW3 A;  2OYH C;  3AED C;  2E75 D;  5AVQ B;  1EXI A;  2JB0 A;  1GPJ A;  2JDI H;  2JU1 A;  1SQB J;  3MD0 A;  2RH0 A;  3NMD A;  1QL2 A;  1LGH B;  3CXH I;  1W5C E;  2YKO A;  1HJ0 A;  3EQ2 A;  4LC1 A;  1J1E C;  3HRN A;  1NWQ A;  1NKN A;  1FBM A;  3MZW B;  4PV1 C;  4EI2 A;  2JYG A;  1IZN B;  4GOD A;  1VQM P;  4H44 D;  2GZE A;  3CXC O;  1EIA A;  1LTJ A;  3P32 A;  5AVR B;  3H1J D;  2JEE A;  3Q5R A;  3GHG B;  2Z46 A;  3TGU J;  1URQ A;  5AW2 B;  4COC A;  2C9L Y;  3V2R A;  3AEA C;  1S5L H;  4D6T E;  2L9F A;  2PNG A;  1Y8A A;  1VQ4 P;  1OIP A;  1KQL A;  4GIF A;  3HE5 B;  2M8R A;  1T6A A;  5KKZ C;  1FU1 A;  3JSV C;  4BRY B;  3B8E B;  1KQG B;  2G8Y A;  7CEI A;  4EDF A;  3V2Q A;  4H2Y C;  2KIK A;  2FQ1 A;  3DPH A;  3CCM P;  2M8L A;  3G29 A;  1H88 A;  1KZU B;  1T8Z A;  3AEE C;  2OYI A;  1LP1 B;  1SQX G;  4GR6 A;  1LTT C;  2ZYA A;  4OGQ C;  5KAI E;  3RK3 B;  3Q5P A;  2WPV B;  2W6B A;  1PP9 G;  3CX5 E;  2KGD A;  1L0N D;  2BCC J;  2A06 D;  2QIW A;  1DD3 A;  1JOC A;  2L91 A;  2KGA A;  1NTK G;  5AW4 B;  1LTJ C;  2N5I A;  5L8R J;  1NGM B;  1AYI A;  1NTZ D;  1SQQ E;  2R3C A;  3LRY A;  2PEJ A;  2EG5 A;  1GMJ A;  3H1H E;  4ASW A;  2L5G B;  1NTM G;  5HGO A;  5APX A;  2D2C D;  4PD4 E;  5AVW B;  5AW0 B;  1SQB E;  3WBH A;  2N9Y B;  1X79 B;  3WU2 E;  3I55 P;  2NO8 A;  4I2L C;  2FXO A;  3BAT A;  2JR8 A;  2N1T B;  2Q7C A;  1J1D B;  3R2P A;  1BCC E;  3GMA A;  2R5D A;  4COP A;  2K9J A;  1BAJ A;  1N73 B;  1LWU C;  2JBG A;  3DS4 A;  5AW1 B;  1W2E A;  2Z5I A;  3M9Q A;  3AE3 C;  1G2C A;  3KDP B;  4TT3 H;  1L4A B;  2Y0E A;  1VF5 B;  2B88 A;  1EZV D;  2HOD B;  1DEE G;  1DH3 A;  3E2D A;  1FZG A;  5KAI H;  1FZC B;  2P1J A;  2AFE A;  3GZM A;  2GUS A;  4AQR D;  3B5I A;  3SWY A;  3CX5 H;  1PPJ E;  3U59 A;  1GU4 A;  1J2J B;  4R4M A;  1N7S B;  2KOS A;  2O01 N;  1KYO D;  1QL1 A;  1CI6 A;  1M8O B;  3L72 D;  3AE2 C;  1JTH B;  3RBX A;  2ZVO B;  4ZKP A;  3RK2 B;  2FFD A;  3TF5 A;  2IBZ D;  3N7N A;  1JY3 O;  2K3R A;  1L0L E;  1A43 A;  2JO1 A;  5AW7 B;  2Q9I A;  4PD4 H;  3CWB G;  2K1A A;  4N6J A;  3H1L G;  5KAF E;  4IL6 X;  2PAJ A;  4YXD C;  4YXW H;  1BDD A;  2BCC E;  2C9N Y;  5CJ4 A;  4WY4 B;  1VQ8 P;  3H6P A;  3M0D C;  2QJP B;  2JAZ A;  3E1R A;  2R44 A;  3I5C A;  4OH8 B;  2OTJ P;  4HB1 A;  4BPH A;  3M9B A;  1SQX J;  3KXD A;  2D2C C;  3CCU P;  4H0L C;  1DIP A;  3NTE A;  2ZAE B;  2WZ7 A;  2N98 A;  1PP9 J;  2KSE A;  2Y0D A;  3W68 A;  2IZ0 A;  4BPG A;  3KYQ A;  2PEI A;  4JQ0 D;  3CCV P;  5APU A;  4NEO A;  1M6E X;  4AUW A;  1SQP G;  4ZNC A;  2MY5 A;  1BSH A;  1DX7 A;  3V6I A;  4LGD E;  3WUV A;  2KNC A;  3BCC D;  3KZI E;  3L37 A;  3CE7 A;  2B87 B;  3V4W A;  1NTM J;  2AEM A;  1EC5 A;  1KTM A;  5APW A;  3H1J G;  1L2P A;  3F5H A;  1K30 A;  2FFD C;  1M1J B;  2QEX P;  4AYC A;  4H13 D;  1IMQ A;  2KGC A;  1YI2 P;  1Z56 A;  1S2E A;  2FYU D;  3TSI A;  3B5N B;  2M3E A;  5KAF H;  2LIU A;  3CCS P;  1IFJ A;  5KJ7 D;  2MKV A;  3P8C D;  3FWN A;  1P84 E;  2LXB A;  3Q20 A;  2KSJ A;  2NPS A;  1YQ4 C;  1BE3 E;  4KHX A;  2KWL A;  4XFZ A;  3SFE C;  2H88 C;  2WSC J;  1PZQ A;  1J1E B;  2AF8 A;  4WB4 A;  2KGE A;  1HF9 A;  4PV1 B;  2GYK A;  1A02 J;  4BWN A;  3IN6 A;  1SFC D;  1NAY A;  4PWV B;  1BGY D;  2GUV A;  1GXG A;  5JPA A;  4I6M C;  1KQS O;  3G71 P;  2K9Y A;  2Z5H A;  3CCE P;  1OFC X;  1L0N G;  2A06 G;  2WMM A;  1YJN P;  5F2N A;  5CCH A;  3KZI H;  1KIL E;  5CHX A;  5HGN A;  1SQP K;  2KS1 B;  1SQX E;  1IFI A;  2V4H A;  2CWO A;  5KKZ B;  3H1K D;  1NAF A; 
#chains in the Genus database with same CATH homology
 3I56 P;  1QVF O;  3H0D A;  5DCK A;  3E2D A;  4XRO A;  3G26 A;  3DPH A;  1PEO A;  3CCM P;  1YJW P;  2PEQ A;  2M8L A;  1W2B O;  3G29 A;  3CCR P;  1Q82 Q;  1N8R Q;  3M1M A;  1RO2 A;  2L6E A;  3B5I A;  3DS1 A;  1PEU A;  2EIA A;  1YIJ P;  1VQ7 P;  1K30 A;  3G21 A;  4U0C A;  5BS1 A;  2QEX P;  2XV6 A;  3VRL C;  4GR6 A;  4U0A A;  1YJ9 P;  2E1M A;  2LF4 A;  1YI2 P;  3G0V A;  1Q7Y Q;  2XXM A;  3RG6 C;  4PH0 A;  3H4E A;  2QA4 P;  3G4S P;  2Z45 A;  1KD1 Q;  3CC7 P;  4XRQ A;  3G6E P;  1Q81 Q;  1K8A Q;  3MGE A;  3CCS P;  2PY8 A;  1D1D A;  3CC2 P;  1Q86 Q;  2M8N A;  3CCQ P;  5F2O A;  2DGY A;  2ONT A;  3CME P;  1A43 A;  2KOD A;  1VQL P;  1S72 P;  1QRJ A;  1AUM A;  4U0E A;  2JO0 A;  2PEN A;  5BS2 A;  2BHV A;  3CCL P;  4XFY A;  1QVG O;  3Q20 A;  1PEM A;  2JYL A;  1A8O A;  1K73 Q;  4XFZ A;  4QNB A;  3CPW O;  3LRY A;  1VQ9 P;  2PEJ A;  2EG5 A;  1ZMB A;  3G1I A;  1IUQ A;  1VQ8 P;  1K9M Q;  5HGL A;  5HGO A;  3DS0 A;  4GR2 A;  2JYG A;  1VQN P;  1VQM P;  3HYB A;  2Z44 A;  3WBH A;  3CXC O;  1EIA A;  4PH1 A;  1YHQ P;  3I55 P;  2OTL P;  1RNI A;  4XFX A;  2OTJ P;  4WYM A;  2EFJ A;  1VQK P;  1E6J P;  2PEM A;  1JJ2 O;  2BUO A;  1M74 A;  1VQ5 P;  3CD6 P;  3CCU P;  1M1K Q;  2BQ1 E;  2Z46 A;  3DS5 A;  4M0I A;  4U0B A;  3CMA P;  4COP A;  5JPA A;  4COC A;  1KQS O;  3DTJ A;  3NTE A;  2OAR A;  3G71 P;  1NJI Q;  3CCE P;  1BAJ A;  4IPY A;  3HZQ A;  1VQO P;  3OW2 O;  2PEO A;  2XT1 A;  3DS4 A;  1YJN P;  2M8P A;  5F2N A;  3CC4 P;  3G28 A;  2PEI A;  1M6N A;  3CCV P;  1VQ4 P;  3P05 A;  5F2K A;  3G1G A;  1M90 Q;  1VQ6 P;  1EOQ A;  1M6E X;  1PEQ A;  5HGN A;  3DS3 A;  1VQP P;  1RO0 A;  4U0D A;  4U0F A;  2CWO A;  3DS2 A;  1YIT P;  2P9X A;  1KC8 Q;  5HGM A;  3H47 A;  3CCJ P;  2PEK A;  5I4T G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...