3I56P

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L2P
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3i56P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3i56P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3i56P02
2QEXP 1W2BO 1Q7YQ 1M90Q 3CCSP 1QVGO 3CC2P 2QA4P 1YI2P 3CXCO 3CCMP 1Q82Q 3G6EP 1Q81Q 1K9MQ 1VQ6P 1YJ9P 1M1KQ 3CCQP 3CCEP 1K73Q 1YJWP 1VQNP 3CCRP 3CMAP 1Q86Q 1N8RQ 3CCUP 1K8AQ 1VQMP 3CCJP 3G4SP 1VQ9P 1VQLP 1QVFO 3G71P 1YITP 3CC4P 1NJIQ 3CMEP 1KQSO 3I55P 2OTLP 1S72P 3I56P 1VQ8P 1YHQP 1KC8Q 1YJNP 3CCLP 1VQOP 1VQ7P 1VQ4P 3CC7P 3CD6P 3OW2O 1VQPP 1YIJP 1JJ2O 1KD1Q 1VQKP 2OTJP 3CPWO 3CCVP 1VQ5P
chains in the Genus database with same CATH superfamily
3BCCE 5F2KA 1KLPA 2KOOA 1VQ6P 2K0DX 3H1HE 4R4LA 1OW8A 3NTNA 1N7SC 3JCUE 4H44B 3FX0A 1ZLLA 1VQ5P 3EJBA 2DNWA 3CE7A 3O6QB 5APSA 2H7HA 2P10A 2QG4A 1FDIA 1VQMP 5KLIC 4KT0J 2PY8A 5EJDA 2AXCA 2EIAA 3AEBC 3L75G 3H1JJ 1VQPP 1KTMA 1PP9D 2M5AB 3P7KA 2IPPA 5AVQB 2JDIH 5CCGD 2H8PD 5EFWB 4W80A 2P58A 1NKZB 3AEFC 2EFJA 2IFNA 1HJ0A 3R2PA 5APTA 1URQD 4AUWA 1AYIA 5KKZB 1NO4A 2N50A 4XA4A 2P1JA 2JU1A 4JYCA 2QJKB 3TDKA 5BS2A 1EXIA 1W5CE 2HLOA 2NPSA 1MKMA 2LOLA 1D1DA 2PNGA 3G9RA 2YKOA 5CMZA 1LJ2A 1RF1B 3Q5PA 2ERHA 2LTEA 2Q3EA 3W68A 2XKMA 1L0NE 3C8VA 3SFEC 3AE8C 3L72D 3U1AA 4WWIA 1JTHB 2KOGA 2GZGA 1BDCA 2E74C 4L76A 3HD7D 5HVCA 2VSQA 5HGOA 2PEQA 1L0NJ 1OFCX 2Y0DA 2QIWA 4GDOA 1KV4A 3HE5A 1IFNA 3H32B 4TLFA 2IDBA 3CCEP 1HH0A 4BWNA 3U1CA 2N1TD 2FBWC 1HWTC 3G71P 4H13B 4HKZH 1OZHA 2FACA 1GDTA 4IL6X 2HPCA 4XFXA 4C7NA 2ZJSE 4WYMA 1SQVD 1LGHB 2E74D 4BPGA 1NTZE 2KUBA 2N6ZA 4AQRD 2KS1B 3SWKA 3H1JE 3N4XA 3OJAB 1NU1J 3GHGB 1GL2B 3G26A 2B9BA 2XT1A 1IK9A 2CNRA 4L74A 4XFJA 2YKQA 1KB9D 2M0BA 1R8EA 1NTZJ 1BCCD 4XRQA 1YBKA 2QJYB 2DW3A 4EYYQ 3LMOA 1NYHA 2KZIA 3R4YA 2J58A 3V2NA 2OYIC 1DD3A 3CCQP 2KZJA 1L2PA 2E5YA 3CCUP 1LNQA 3M91A 1HF9A 3I5CA 3EFGA 3BRTB 2XNXA 1NTMD 2J5UA 4I2LC 5KLVJ 1IFDA 1LTJC 2I1JA 1IMPA 1LTJA 5APQA 4PH1A 1J2JB 4M3LA 1QRJA 3MP7B 5AVSB 2C0WA 2WITA 3H1HJ 2KB7P 3T97B 2GDWA 5APVA 2PEMA 3M0AA 2GUSA 3G21A 1L0NG 4RESB 2FVEA 1BCCG 3K5BA 3A5TA 2KGAA 2W27A 1FZGA 2H43A 1KORA 5E79H 3HUSA 1M1KQ 1VPCA 1U57A 1FJKA 1K30A 2CPBA 3HE5B 2WSEJ 3RK3E 1YTZI 2LMLA 1EMVA 1QEXA 1NTMJ 2M8RA 3B5IA 3E1RA 3AEEC 1ZR2A 2YXQB 4M0IA 1NOHA 1KQGB 2HR3A 2OYIB 2L9FA 1L4AD 2Y0EA 2N1TB 2HPCB 3CMAP 2H89C 3CCJP 2HODA 1H89A 2M3EA 3Q20A 2KOPA 1NQ4A 1N7SB 1JY2N 3U43A 3Q2YA 2YMYA 2D2CC 5AW0B 2OARA 2LR2A 2KYVA 4WY4A 4WY4C 4UB8E 2VLOA 1EOQA 1VF5B 2KR5A 2JEEA 4PWVB 3V5BA 1J1DB 1G2CA 2KWLA 5C39A 4GOEA 1RF0C 2WSFH 3AE6C 3PTZA 4OGQB 1LTSC 3WU2H 2R44A 1UJZA 1YHQP 4PJ0H 2PEIA 1M1JA 1P84D 3NY7B 2KLUA 1EC5A 4D6TD 2POHA 5CCGC 1JOCA 1NWQA 1N86A 3RK2C 1MV8A 2K5XA 2PP6A 3BCCG 2ZVNB 4NEOA 4HB1A 1X8YA 3CX5E 1SQBK 2JBGA 4QKOA 2WSCJ 1BDDA 1IFIA 2RH0A 2QJYC 5DJUB 3AE2C 1OW6A 2W6BA 1P84E 1SQQD 2NO8A 1F80D 5AW6B 5KAIE 4PD4H 2Z5HA 3L72E 2R32A 1H8AA 4EI2A 1HUCA 4ZMDA 2W6AA 4JYBA 2MR8A 3A0BE 3H1LG 1VQ9P 1HY8A 2LPKA 1SQVK 1URQB 5GTIE 1AF8A 4IOIH 1EZVD 3AEAC 1DEBA 1NVOA 3H1IG 1JJ2O 1SQQE 1L0LE 5AVVB 3D71A 1SFCC 3PP5A 2KSJA 3AEGC 4LLHA 2AXTH 3VP8A 1KC8Q 3HTKB 2YKPA 2JR8A 2FHSC 1SQPE 4N6JA 1LTTC 4H2WC 2PGDA 3PLNA 3MUDA 3EJDA 1PV3A 1SQVE 4U0CA 2R3CA 5CJ0A 2FVAA 1SQXG 1FR2A 3FXEA 1FAVA 2V7QH 3H1JD 1JY3P 1ZMEC 1SQVG 5KLIB 3A0HH 2EHSA 1PEQA 3A3YB 1PL5A 2E42A 1W2BO 3M9HA 1KMIZ 5AVXB 1HGVA 1CI6A 1YJ9P 3CI9A 3PH0A 1RE4A 1N7LA 2OQQA 2LL8A 1S2EA 3B4SA 3CMEP 4OH8B 2K3RA 3A0BH 1RE3C 3B5NB 2WVRA 5KP7B 1WMKA 2E75C 3Q3DA 1FZEA 2WPRA 1M8OB 3VMZA 3BASA 5H2FH 1EXJA 1ZMBA 2AFEA 2BCCD 1H0TA 1GL2D 1L4AB 2G8YA 1GU4A 3LIEA 3ZDMA 1PGOA 3TYYA 2JO0A 4JBZA 3P05A 1FOSE 3L70J 3M9BA 1FZFA 4PJ0E 2W90A 2KGCA 4JF7A 2ZYDA 4PD4I 1DEEG 3L75J 1BAJA 3T97A 1SFCA 2Z45A 2SPZA 3M0DC 4PV1C 2OYHA 3M0DA 2WT7B 1EDLA 1U7JA 2M5RA 4UB8H 5BU8B 1H88A 3G0VA 3KDPB 3IR9A 1KILA 1BCCJ 1RF1C 1BSHA 3L37A 1DH3A 2PRRA 3FGAD 3FXDA 1YQ3C 4ASVA 1G1JA 2FADA 2IX7C 2QM8A 1M1JB 2QM7A 2M8NA 3CD6P 4AYCA 4GR6A 1K05A 4C46A 5TISH 5GTHH 2GDYA 1FJPA 1CZQA 1Q81Q 4U0EA 4Z1MH 4H0LB 2XXMA 3GHGA 1PEOA 4XE5B 2WSCH 3I56P 1NTZK 3F5HA 1A43A 2ZYAA 5M1BA 2FFDB 2CK3H 2OYHB 1LWUB 4C7RA 1S72P 1BCCE 1YI2P 1LTBC 1AVOA 4DG9A 2Q6QA 1QGKB 4WB4A 1K73Q 3KXDA 3SFDC 1QVFO 4TT3H 2PENA 5CZDB 3TGUD 3L75E 2N6YA 2N5IA 1KILE 1YYCA 4H44C 1S4XA 2R3SA 2JP3A 4DZOA 1Y8AA 3NFQA 5AW1B 2O01H 5TJHA 2W83C 4W7YA 2L4BA 2IFMA 1AQTA 1OVVA 2K94A 3WUVA 2Q7CA 2XZ1C 1VQOP 3IFMA 2RKLA 4U3FE 4DCKA 4PD4E 5KAIH 1DNYA 2BEZF 5KKZC 1QVGO 1EZVG 3KHUA 3VMXA 2EG5A 1UIXA 2EHTA 3LRYA 3LIDA 3CX5H 4U0BA 1PEMA 4PV1D 2AVAA 2FYNB 3I55P 3AE5C 1L0IA 5B5EE 3GZMA 1LTAC 3DS3A 2B89A 2WSSH 4U3FD 1Q7YQ 1XTCC 3EFFK 2QE7H 3AE4C 3SWYA 4GOFA 3FWNA 3AE7C 4EIJA 2KOQA 4KHXA 1BGYG 2XDJA 5KLVG 1HQBA 1AV1A 1QX8A 3E7KA 1K04A 1IFPA 2L5GB 2JKVA 3B5NC 1OVRA 3B5NA 1S3JA 3CC7P 2V7QJ 2E75B 1SQBD 3AE1C 2C9LY 1X0TA 3F89A 1KFNA 1RF1A 2LF4A 4K3AA 4F37A 1RH5B 4UHPB 4O9BA 2Y9YA 1VQNP 1GMJA 2QNWA 2P7JA 1URQA 3WMM0 2KW2A 2K9JB 2KK7A 1S9KE 1RF0A 1NAFA 1Z6MA 2M8PA 1T8ZA 1HJBA 1PPJG 2IBZG 2WSEH 1FZCB 3TNUB 1M7LA 1FOSF 3MGNA 1LWUC 2N9BA 3RK2D 3L4FA 5E79E 4HKGA 1RQVA 1MZ8A 1S9KD 4BPFA 4IPYA 1P84I 4N78D 2PEKA 3MD0A 2MKVA 3AE3C 1FZAA 4N3YB 3H0DA 1TU3F 2ZAEB 2I8DA 3JSVC 3HUSC 1XTGB 2L6EA 2KP8A 1FC2C 2K0XA 5BU5A 1S5LX 1KFMA 3VMYA 4XROA 1Q82Q 2E5TA 1AJYA 2HG5D 4L75A 2K93A 2IBZE 3V2PA 4BPHA 2GZJA 4UB6E 4R4MA 5KJ7A 1A8OA 1OMIA 4BXLA 1KILC 4ZKUA 3C1LA 1OXZA 1K9MQ 1RY3A 2O1JA 1DX7A 1AQ5A 4H0LC 2K1AA 1L0HA 2JWAA 1X9VA 3RK3B 3KQGA 4HH2A 7CEIA 1SQVJ 5BVZA 2AF8A 1U7MA 4DJGA 3CXCO 2L0QA 1MZ9A 2QSIA 3CLQA 3TGUJ 2QVAA 1JEKA 1IZNB 2HODB 5AW9B 1EIAA 2KSEA 4I7ZC 4NPFX 1M57D 2WPSA 4WY4B 3L75D 3M9QA 3GLMA 1A02F 1M90Q 4GODA 1NTKG 4GR2A 2FFDA 2ZXEB 5KAFH 3DPHA 2CQ8A 1OX3A 2E1MA 5APWA 1M6EX 2Q1KA 1NJIQ 1N7SD 3CL3D 3WUUA 1YJNP 2ZT9D 1X79B 4U3FG 3CCLP 3P8MC 2KI7B 2ZFCA 4HJGH 3L72J 1NTMK 3EJEA 3CWBD 2I1KA 1SQXD 1Q86Q 1HBWA 3RK3C 4XFZA 2XV6A 1VQ8P 4WVZA 1G2CB 1GZLA 2BCCG 3DTJA 4A7PA 4YPCA 3PHLA 3CC2P 4COCA 2FYNC 2FYUE 3HRNA 1BE3E 1JY2P 2JJLA 2LIWA 2OGUA 3HD7A 2GZEA 1YJWP 2WPQA 3TSIA 2K37A 1VF5C 3VOPA 2E75D 1SQPG 2B87B 2D2CB 2PFXA 5CJ4A 1NU1E 3L74G 3L70D 1M56D 3QWOC 4CPGA 1J1EB 3OAKA 1IJDB 1BE3D 1GW3A 5KLVK 4IFMA 1SQQG 1JY3O 3AEDC 2L22A 1S5LH 1ZRTE 3RK3D 1S5LE 3H1JG 1GXHA 5KJ7C 3A2AA 1JM0A 2XV5A 1LWUA 3H1LE 1RE3A 3KYQA 1OIPA 2KXPB 5CHXA 1LTIC 2VRSA 2FQ0A 5GTHE 5TISE 2RMZA 1PPJD 3LW5J 4NPEA 1T2KC 3L71J 1LT9C 1JMMA 2VLPA 1S1CX 1LTJB 4U0FA 3RG2A 5GTIH 1RO0A 1ZXGA 1BE3G 4OWFA 2BQ1E 4I1LA 3EWKA 3CWBG 2MF4A 3BATA 2LKIA 3L71E 4Y99B 2K92A 2N98A 2YO3A 4EOTA 2Q9IA 3L73D 2G3AA 3GMAA 5JPAA 1JCDA 3QH9A 4D6TE 5CCGA 3NXSA 3EQ2A 4HYTB 2WQYC 2GYKA 5KLVE 2C0XA 3CX5D 3SWFA 1EDJA 5BS1A 1LP1B 4BRYA 3CCSP 1NTZG 3CXHI 2E43A 2K2QA 2RN0A 3H1HD 3KPEA 1BGYE 4C7NB 5B66H 3LW5H 4U7JA 1CEIA 1BSNA 3RL0C 3V2RA 2IBZI 5CCHD 1BGYJ 1JY3N 3MHVA 1EZVE 1KZUB 1WT6A 1GW4A 1M74A 4R0MA 1HTLC 1L0NK 3CPWO 3BCCD 2VLNA 1L4AA 1DV5A 1KILB 2FYUJ 4MN4C 2FQ2A 2WT7A 3KZIH 2P2UA 3CC4P 3UIAA 2IYOA 5K5GB 5HGMA 1Y9BA 2JB0A 1L0LD 4H2YC 3VRLC 2OTJP 4D6TJ 1KN7A 3TNUA 3RGUA 3G1IA 4XFYA 2YIUC 4UB6H 3TK1A 3BRVB 2XU6A 1SQPD 1FZCA 1KB9E 3IAOA 1GU5A 2QJKC 1E6JP 3H1IE 3U59A 3HYBA 5AW5B 1PP9E 1N73C 2KG9A 5AVWB 3KZIE 2D2CD 1KB9I 5F2OA 2FXMA 1AFOA 5HGNA 2K9JA 4WBAA 2FXOA 3L73J 3AECC 2FFDC 3DS5A 2OYHC 1VKUA 1ZW0A 2GUVA 3M1MA 3H1LJ 4GKGA 5F2NA 5AVYB 2NRGA 2DGYA 4LC1A 4ASWA 1RO2A 2PAJA 3H1KG 2CPSA 5DCKA 1AA0A 1NTMG 3MIWA 3W67A 4H13D 1SQQK 1FE6A 1PGJA 2FYUD 1EZVI 3AE9C 3RL0D 3G28A 1QL2A 1Y47A 2FYUG 3DS2A 3DS0A 3G1GA 3H25A 3O6QA 2FQ1A 2KG6A 2A06D 1R5SA 3O8ZA 1MUUA 3RBZA 2J59M 1GXGA 1OWAA 1CW5A 2P67A 3B4QA 1GL2C 2A45H 2Z5IA 4ZKPA 1KQLA 4JPZB 1BE3J 3CCMP 2NPSD 2M5AA 2MD9A 1Z56A 2KORA 4H2XC 4I6MC 4QNBA 3GZLA 5CBOA 3P8CE 3BCCJ 2QA4P 1X3OA 2KG8A 1NTZD 2PEJA 1SP4A 1LT9B 3USSA 2MVVA 1SQBJ 1HGZA 1YITP 3S9OA 2QJPC 2BUOA 2K88A 2FY8A 2JQ4A 1GK4A 2FKWB 2P9XA 2Z46A 3H4EA 1NTKK 1KQFB 2OYIA 3G6EP 2HFED 3MUDC 2N1TC 2E76C 3ABVC 3FWLA 2N1TA 2L91A 2BASA 5KP8B 3L71D 1SQXE 2WMMA 3NMDA 1PP9G 2MVUA 3B71A 4ZNCA 1OW7A 1N73A 2O01N 1IK7A 3CWBJ 3TGUE 4PV1B 1AUMA 3TGUG 4U0DA 5AVUB 3GF7A 4IL6H 2UWJE 2KGEA 3HE4A 5CCHC 1WRGA 5KLVD 1ZV8A 1RE4C 2BCCE 4PH0A 1JB0J 2WSFJ 3S1KA 3HD7C 3GKLC 2CWOA 1DIPA 3TF5A 1KYOI 3OW2O 1L0LG 2IYPA 2WPVB 2K0YA 1Q2NA 4PD4D 2XZ0D 2YNYA 1NTKD 1PFIA 2AFDA 4OGQD 4OGQC 2E76D 1JO5A 2WPTA 1X22A 1ZRTD 1NGMB 4GIFA 3CXHE 4COPA 2OTKE 1JCCA 3L72G 3G3ZA 2YMKA 1D7MA 1H0TB 3JCUH 2A45G 2XZRA 1NTKE 3B8EB 2YXRB 3VYIA 3L70G 3CCRP 3V4QA 1ZNVA 3MTUE 2KNCA 4YTPC 3E1IA 4RKUJ 5AW2B 2IZ0A 1BXIA 1PGPA 3H1LD 1OR5A 1AVYA 2WWWA 3L35A 3G4SP 1JTHA 5I4TG 2YO2A 1USDA 2ZYGA 1VL2A 2Y9ZA 3H1KD 3H6PA 1K8AQ 5HGLA 1IO4A 2FXPA 5AVZB 1SS1A 4W7ZA 1IC2A 1IUQA 3GG2A 4Y99C 4QMAA 2IZ1A 4RO0A 4DOJA 3C9IA 2MY5A 1J1DC 1T6AA 3P32A 2FYZA 2W8ZA 1JUNA 2M3BA 2R5DA 3CXHH 2ZXXA 2KODA 3D6ZA 3L36A 3Q1MA 3H1KE 1SVFA 2O01J 1NU1K 3RBXA 2GZIA 1A02J 1ACPA 1RHZB 2ONTA 2ROQA 4WY4D 4KJMA 1YIJP 1VQKP 1VHNA 2PEOA 1MFTA 2XNDH 2FYUK 1T2KD 1N8RQ 3II6A 1PZQA 4EDFA 1GL2A 1J1EC 5AW3B 2OYOA 4LGDE 3L74E 4IL6E 5AW7B 1ZR4A 1MFZA 3NTEA 2NPSC 3H1KJ 1PIXA 3IN6A 2LXCB 2CGQA 3RL0g 3GF3A 1SLQA 3WBHA 2GA1A 3VN0A 1BGYD 3GHGC 3M06A 4NPDA 5APYA 2FVFA 4IZ6A 1KQSO 4DT0A 2IBZD 2AEMA 3RK2B 4OVNF 3RG6C 4MRTC 5L8RJ 4L73A 1EDKA 2ZVOB 3V4WA 3L74D 2GM4A 3Q5RA 1VF5D 1FBMA 4IFDK 2LIUA 2AEFA 2Z4EA 3RL0B 4U3FJ 5APXA 4CA3A 2BHVA 3VP9A 1URQC 2AXTE 3HTKA 1FU1A 4U0AA 3SSUA 1SFCB 5APUA 2AEJA 2K9YA 3H1ID 3ITKA 2O3JA 3PJSK 2Q3IA 2N9YB 2WTYA 2NPSB 3H1HG 1LP1A 5B66E 2GDXA 1RQUA 1Q90D 3Q5SA 5HV8A 5KTBA 1T8KA 3JC22 1T3JA 2E76B 1EQ7A 3L73G 2Y0CA 2CG5B 4B86A 1EDIA 5KP6B 2QEXP 3VTPC 1JNMA 2M8LA 4I7ZB 2W6JH 1VDFA 1P84H 2Q5UA 2ZT9B 1IFMA 1VQLP 3L74J 4PXHB 1ZOYC 1JY2O 2JYLA 5B5EH 2C9NY 3PRJA 4D6TG 5AVRB 1N2DC 1NH4A 1HVVA 3CCVP 1OVUA 2JGPA 4N78E 2N5HA 3GJNA 4GT1A 3CWBE 1JMBA 1L4AC 1VQ4P 1R5LA 3G29A 3CXHD 5KJ7D 1KD1Q 2R5BA 4BRYB 5H2FE 2ZT9C 3L71G 1L0LJ 1M6NA 1LT1A 5AW8B 1FZBA 2B88A 2A06E 1GTWA 4JQ0D 2QRXA 1QLED 1L0ND 5CBNA 3A0HE 1KYOH 2JYGA 1PEUA 1SQBE 1ZP0C 1ZN5A 2V4HA 3IF4A 3HE4B 3L70E 2KLVA 1FS0E 2MJZA 3P8CD 1QL1A 1KB9H 1RNIA 1SQXK 3HUSB 2WZ7A 2YIUB 3DS4A 2JWDA 1SQPK 4H44D 1NU1D 1KYOD 3D70A 3B5ND 1SFCD 4H0LD 3E2DA 3MGEA 1CI6B 1NKNA 1SQBG 1NTKJ 1UIIA 2KNCB 1NU1G 2ITAA 2GZFA 1KILD 2Z44A 3WUTA 3HZQA 2JAZA 4K35A 5AW4B 3A7OA 1N7SA 1G1IA 1GD2E 3HD7B 2X2BA 2KIKA 1KYOE 1LT9A 1E0HA 3V6IA 4RJTA 2KGDA 1PGQA 3S4RA 4IFFA 1FZCC 3VMAA 1FDMA 2A06G 1T3UA 1LTGC 1N73B 1M1JC 1W2EA 2A45I 1FDOA 1NHLA 1IMQA 1PPJE 2B87A 1E5WA 3N7NA 2E74B 2BCCJ 5CCHA 1GPJA 1DD4A 2JU2A 1IFJA 1GK6A 3H47A 1YQ4C 3V2QA 2O1KA 3CX5I 1CSBA 1UNKA 1SQPJ 2KS1A 2LXBA 1NTME 2FAEA 3D6YA 3DS1A 5DJTB 3MZWB 5KAFE 3L73E 1VQ7P 1SQXJ 4YXWH 5EW5E 1NAYA 2QJPB 2MR7A 2H88C 3WU2E 2VLQA 1USEA 3BVHA 2JO1A 3GW6A 1YTZT 2BEQD 1SQQJ 4H13C 2LKMA 1PP9J 2KOSA 1E79H 3H32A 3H1IJ 2HYNA 2OTLP 5AVTB 3OA7A 1L0LK 4Y28J 2NZ2A 4YXDC
chains in the Genus database with same CATH topology
1RO0A 2QEXP 1W2BO 1Q7YQ 4XROA 3CCMP 1Q82Q 2PEOA 5F2KA 1Q81Q 2Z44A 2M8LA 1VQ6P 4U0EA 1YJ9P 3HZQA 2BQ1E 3G1IA 2XXMA 5HGOA 2PEMA 1Q86Q 1N8RQ 2PEQA 1VQLP 4XFYA 1PEOA 4XFZA 2JYLA 3G21A 3CMEP 2XV6A 3I56P 1VQ8P 1A43A 3CCLP 4COPA 1E6JP 3CC7P 3HYBA 3NTEA 3DTJA 1A8OA 3VRLC 4QNBA 3CCVP 5JPAA 1VQ5P 1S72P 3CC2P 4COCA 2QA4P 1YI2P 5F2OA 5HGNA 1K9MQ 2LF4A 2PEJA 3WBHA 1M1KQ 3CCEP 1K73Q 1ZMBA 1YJWP 1K30A 1VQNP 3CCRP 1VQMP 1VQ9P 1QVFO 3G71P 1YITP 1KQSO 2PY8A 2BUOA 2PENA 3RG6C 2EIAA 1VQ4P 3B5IA 5BS1A 2JO0A 3DS5A 3G29A 1VQPP 1JJ2O 2P9XA 2Z46A 4XFXA 1KD1Q 2M8PA 3H4EA 3G4SP 3P05A 4M0IA 5I4TG 3M1MA 4WYMA 3CCSP 3H47A 3CXCO 3G6EP 5F2NA 1M6NA 2EFJA 2DGYA 3CMAP 1K8AQ 5HGLA 1RO2A 3CCJP 3G26A 2BHVA 5DCKA 1BAJA 3DS1A 2XT1A 3Q20A 1KC8Q 1EIAA 1IUQA 4U0AA 1VQOP 1VQ7P 2JYGA 2Z45A 1PEUA 2OARA 4XRQA 1M74A 4IPYA 1EOQA 5BS2A 1AUMA 3CPWO 4U0DA 1M90Q 1QVGO 3G0VA 4GR2A 2EG5A 2PEKA 3G28A 2KODA 1RNIA 3CCQP 3LRYA 3DPHA 1D1DA 3DS2A 3DS4A 3DS0A 4U0CA 3CCUP 3G1GA 4U0BA 3H0DA 1PEMA 2E1MA 3CC4P 1M6EX 4PH0A 1NJIQ 2OTLP 3I55P 1YHQP 5HGMA 1YJNP 2CWOA 2PEIA 3E2DA 3MGEA 2ONTA 2L6EA 2M8NA 3DS3A 3CD6P 3OW2O 4U0FA 1PEQA 1YIJP 4PH1A 4GR6A 1QRJA 1VQKP 2OTJP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX P;  1W2B O;  1Q7Y Q;  1M90 Q;  3CCS P;  1QVG O;  3CC2 P;  2QA4 P;  1YI2 P;  3CXC O;  3CCM P;  1Q82 Q;  3G6E P;  1Q81 Q;  1K9M Q;  1VQ6 P;  1YJ9 P;  1M1K Q;  3CCQ P;  3CCE P;  1K73 Q;  1YJW P;  1VQN P;  3CCR P;  3CMA P;  1Q86 Q;  1N8R Q;  3CCU P;  1K8A Q;  1VQM P;  3CCJ P;  3G4S P;  1VQ9 P;  1VQL P;  1QVF O;  3G71 P;  1YIT P;  3CC4 P;  1NJI Q;  3CME P;  1KQS O;  3I55 P;  2OTL P;  1S72 P;  3I56 P;  1VQ8 P;  1YHQ P;  1KC8 Q;  1YJN P;  3CCL P;  1VQO P;  1VQ7 P;  1VQ4 P;  3CC7 P;  3CD6 P;  3OW2 O;  1VQP P;  1YIJ P;  1JJ2 O;  1KD1 Q;  1VQK P;  2OTJ P;  3CPW O;  3CCV P;  1VQ5 P; 
#chains in the Genus database with same CATH topology
 3BCC E;  5F2K A;  1KLP A;  2KOO A;  1VQ6 P;  2K0D X;  3H1H E;  4R4L A;  1OW8 A;  3NTN A;  1N7S C;  3JCU E;  4H44 B;  3FX0 A;  1ZLL A;  1VQ5 P;  3EJB A;  2DNW A;  3CE7 A;  3O6Q B;  5APS A;  2H7H A;  2P10 A;  2QG4 A;  1FDI A;  1VQM P;  5KLI C;  4KT0 J;  2PY8 A;  5EJD A;  2AXC A;  2EIA A;  3AEB C;  3L75 G;  3H1J J;  1VQP P;  1KTM A;  1PP9 D;  2M5A B;  3P7K A;  2IPP A;  5AVQ B;  2JDI H;  5CCG D;  2H8P D;  5EFW B;  4W80 A;  2P58 A;  1NKZ B;  3AEF C;  2EFJ A;  2IFN A;  1HJ0 A;  3R2P A;  5APT A;  1URQ D;  4AUW A;  1AYI A;  5KKZ B;  1NO4 A;  2N50 A;  4XA4 A;  2P1J A;  2JU1 A;  4JYC A;  2QJK B;  3TDK A;  5BS2 A;  1EXI A;  1W5C E;  2HLO A;  2NPS A;  1MKM A;  2LOL A;  1D1D A;  2PNG A;  3G9R A;  2YKO A;  5CMZ A;  1LJ2 A;  1RF1 B;  3Q5P A;  2ERH A;  2LTE A;  2Q3E A;  3W68 A;  2XKM A;  1L0N E;  3C8V A;  3SFE C;  3AE8 C;  3L72 D;  3U1A A;  4WWI A;  1JTH B;  2KOG A;  2GZG A;  1BDC A;  2E74 C;  4L76 A;  3HD7 D;  5HVC A;  2VSQ A;  5HGO A;  2PEQ A;  1L0N J;  1OFC X;  2Y0D A;  2QIW A;  4GDO A;  1KV4 A;  3HE5 A;  1IFN A;  3H32 B;  4TLF A;  2IDB A;  3CCE P;  1HH0 A;  4BWN A;  3U1C A;  2N1T D;  2FBW C;  1HWT C;  3G71 P;  4H13 B;  4HKZ H;  1OZH A;  2FAC A;  1GDT A;  4IL6 X;  2HPC A;  4XFX A;  4C7N A;  2ZJS E;  4WYM A;  1SQV D;  1LGH B;  2E74 D;  4BPG A;  1NTZ E;  2KUB A;  2N6Z A;  4AQR D;  2KS1 B;  3SWK A;  3H1J E;  3N4X A;  3OJA B;  1NU1 J;  3GHG B;  1GL2 B;  3G26 A;  2B9B A;  2XT1 A;  1IK9 A;  2CNR A;  4L74 A;  4XFJ A;  2YKQ A;  1KB9 D;  2M0B A;  1R8E A;  1NTZ J;  1BCC D;  4XRQ A;  1YBK A;  2QJY B;  2DW3 A;  4EYY Q;  3LMO A;  1NYH A;  2KZI A;  3R4Y A;  2J58 A;  3V2N A;  2OYI C;  1DD3 A;  3CCQ P;  2KZJ A;  1L2P A;  2E5Y A;  3CCU P;  1LNQ A;  3M91 A;  1HF9 A;  3I5C A;  3EFG A;  3BRT B;  2XNX A;  1NTM D;  2J5U A;  4I2L C;  5KLV J;  1IFD A;  1LTJ C;  2I1J A;  1IMP A;  1LTJ A;  5APQ A;  4PH1 A;  1J2J B;  4M3L A;  1QRJ A;  3MP7 B;  5AVS B;  2C0W A;  2WIT A;  3H1H J;  2KB7 P;  3T97 B;  2GDW A;  5APV A;  2PEM A;  3M0A A;  2GUS A;  3G21 A;  1L0N G;  4RES B;  2FVE A;  1BCC G;  3K5B A;  3A5T A;  2KGA A;  2W27 A;  1FZG A;  2H43 A;  1KOR A;  5E79 H;  3HUS A;  1M1K Q;  1VPC A;  1U57 A;  1FJK A;  1K30 A;  2CPB A;  3HE5 B;  2WSE J;  3RK3 E;  1YTZ I;  2LML A;  1EMV A;  1QEX A;  1NTM J;  2M8R A;  3B5I A;  3E1R A;  3AEE C;  1ZR2 A;  2YXQ B;  4M0I A;  1NOH A;  1KQG B;  2HR3 A;  2OYI B;  2L9F A;  1L4A D;  2Y0E A;  2N1T B;  2HPC B;  3CMA P;  2H89 C;  3CCJ P;  2HOD A;  1H89 A;  2M3E A;  3Q20 A;  2KOP A;  1NQ4 A;  1N7S B;  1JY2 N;  3U43 A;  3Q2Y A;  2YMY A;  2D2C C;  5AW0 B;  2OAR A;  2LR2 A;  2KYV A;  4WY4 A;  4WY4 C;  4UB8 E;  2VLO A;  1EOQ A;  1VF5 B;  2KR5 A;  2JEE A;  4PWV B;  3V5B A;  1J1D B;  1G2C A;  2KWL A;  5C39 A;  4GOE A;  1RF0 C;  2WSF H;  3AE6 C;  3PTZ A;  4OGQ B;  1LTS C;  3WU2 H;  2R44 A;  1UJZ A;  1YHQ P;  4PJ0 H;  2PEI A;  1M1J A;  1P84 D;  3NY7 B;  2KLU A;  1EC5 A;  4D6T D;  2POH A;  5CCG C;  1JOC A;  1NWQ A;  1N86 A;  3RK2 C;  1MV8 A;  2K5X A;  2PP6 A;  3BCC G;  2ZVN B;  4NEO A;  4HB1 A;  1X8Y A;  3CX5 E;  1SQB K;  2JBG A;  4QKO A;  2WSC J;  1BDD A;  1IFI A;  2RH0 A;  2QJY C;  5DJU B;  3AE2 C;  1OW6 A;  2W6B A;  1P84 E;  1SQQ D;  2NO8 A;  1F80 D;  5AW6 B;  5KAI E;  4PD4 H;  2Z5H A;  3L72 E;  2R32 A;  1H8A A;  4EI2 A;  1HUC A;  4ZMD A;  2W6A A;  4JYB A;  2MR8 A;  3A0B E;  3H1L G;  1VQ9 P;  1HY8 A;  2LPK A;  1SQV K;  1URQ B;  5GTI E;  1AF8 A;  4IOI H;  1EZV D;  3AEA C;  1DEB A;  1NVO A;  3H1I G;  1JJ2 O;  1SQQ E;  1L0L E;  5AVV B;  3D71 A;  1SFC C;  3PP5 A;  2KSJ A;  3AEG C;  4LLH A;  2AXT H;  3VP8 A;  1KC8 Q;  3HTK B;  2YKP A;  2JR8 A;  2FHS C;  1SQP E;  4N6J A;  1LTT C;  4H2W C;  2PGD A;  3PLN A;  3MUD A;  3EJD A;  1PV3 A;  1SQV E;  4U0C A;  2R3C A;  5CJ0 A;  2FVA A;  1SQX G;  1FR2 A;  3FXE A;  1FAV A;  2V7Q H;  3H1J D;  1JY3 P;  1ZME C;  1SQV G;  5KLI B;  3A0H H;  2EHS A;  1PEQ A;  3A3Y B;  1PL5 A;  2E42 A;  1W2B O;  3M9H A;  1KMI Z;  5AVX B;  1HGV A;  1CI6 A;  1YJ9 P;  3CI9 A;  3PH0 A;  1RE4 A;  1N7L A;  2OQQ A;  2LL8 A;  1S2E A;  3B4S A;  3CME P;  4OH8 B;  2K3R A;  3A0B H;  1RE3 C;  3B5N B;  2WVR A;  5KP7 B;  1WMK A;  2E75 C;  3Q3D A;  1FZE A;  2WPR A;  1M8O B;  3VMZ A;  3BAS A;  5H2F H;  1EXJ A;  1ZMB A;  2AFE A;  2BCC D;  1H0T A;  1GL2 D;  1L4A B;  2G8Y A;  1GU4 A;  3LIE A;  3ZDM A;  1PGO A;  3TYY A;  2JO0 A;  4JBZ A;  3P05 A;  1FOS E;  3L70 J;  3M9B A;  1FZF A;  4PJ0 E;  2W90 A;  2KGC A;  4JF7 A;  2ZYD A;  4PD4 I;  1DEE G;  3L75 J;  1BAJ A;  3T97 A;  1SFC A;  2Z45 A;  2SPZ A;  3M0D C;  4PV1 C;  2OYH A;  3M0D A;  2WT7 B;  1EDL A;  1U7J A;  2M5R A;  4UB8 H;  5BU8 B;  1H88 A;  3G0V A;  3KDP B;  3IR9 A;  1KIL A;  1BCC J;  1RF1 C;  1BSH A;  3L37 A;  1DH3 A;  2PRR A;  3FGA D;  3FXD A;  1YQ3 C;  4ASV A;  1G1J A;  2FAD A;  2IX7 C;  2QM8 A;  1M1J B;  2QM7 A;  2M8N A;  3CD6 P;  4AYC A;  4GR6 A;  1K05 A;  4C46 A;  5TIS H;  5GTH H;  2GDY A;  1FJP A;  1CZQ A;  1Q81 Q;  4U0E A;  4Z1M H;  4H0L B;  2XXM A;  3GHG A;  1PEO A;  4XE5 B;  2WSC H;  3I56 P;  1NTZ K;  3F5H A;  1A43 A;  2ZYA A;  5M1B A;  2FFD B;  2CK3 H;  2OYH B;  1LWU B;  4C7R A;  1S72 P;  1BCC E;  1YI2 P;  1LTB C;  1AVO A;  4DG9 A;  2Q6Q A;  1QGK B;  4WB4 A;  1K73 Q;  3KXD A;  3SFD C;  1QVF O;  4TT3 H;  2PEN A;  5CZD B;  3TGU D;  3L75 E;  2N6Y A;  2N5I A;  1KIL E;  1YYC A;  4H44 C;  1S4X A;  2R3S A;  2JP3 A;  4DZO A;  1Y8A A;  3NFQ A;  5AW1 B;  2O01 H;  5TJH A;  2W83 C;  4W7Y A;  2L4B A;  2IFM A;  1AQT A;  1OVV A;  2K94 A;  3WUV A;  2Q7C A;  2XZ1 C;  1VQO P;  3IFM A;  2RKL A;  4U3F E;  4DCK A;  4PD4 E;  5KAI H;  1DNY A;  2BEZ F;  5KKZ C;  1QVG O;  1EZV G;  3KHU A;  3VMX A;  2EG5 A;  1UIX A;  2EHT A;  3LRY A;  3LID A;  3CX5 H;  4U0B A;  1PEM A;  4PV1 D;  2AVA A;  2FYN B;  3I55 P;  3AE5 C;  1L0I A;  5B5E E;  3GZM A;  1LTA C;  3DS3 A;  2B89 A;  2WSS H;  4U3F D;  1Q7Y Q;  1XTC C;  3EFF K;  2QE7 H;  3AE4 C;  3SWY A;  4GOF A;  3FWN A;  3AE7 C;  4EIJ A;  2KOQ A;  4KHX A;  1BGY G;  2XDJ A;  5KLV G;  1HQB A;  1AV1 A;  1QX8 A;  3E7K A;  1K04 A;  1IFP A;  2L5G B;  2JKV A;  3B5N C;  1OVR A;  3B5N A;  1S3J A;  3CC7 P;  2V7Q J;  2E75 B;  1SQB D;  3AE1 C;  2C9L Y;  1X0T A;  3F89 A;  1KFN A;  1RF1 A;  2LF4 A;  4K3A A;  4F37 A;  1RH5 B;  4UHP B;  4O9B A;  2Y9Y A;  1VQN P;  1GMJ A;  2QNW A;  2P7J A;  1URQ A;  3WMM 0;  2KW2 A;  2K9J B;  2KK7 A;  1S9K E;  1RF0 A;  1NAF A;  1Z6M A;  2M8P A;  1T8Z A;  1HJB A;  1PPJ G;  2IBZ G;  2WSE H;  1FZC B;  3TNU B;  1M7L A;  1FOS F;  3MGN A;  1LWU C;  2N9B A;  3RK2 D;  3L4F A;  5E79 E;  4HKG A;  1RQV A;  1MZ8 A;  1S9K D;  4BPF A;  4IPY A;  1P84 I;  4N78 D;  2PEK A;  3MD0 A;  2MKV A;  3AE3 C;  1FZA A;  4N3Y B;  3H0D A;  1TU3 F;  2ZAE B;  2I8D A;  3JSV C;  3HUS C;  1XTG B;  2L6E A;  2KP8 A;  1FC2 C;  2K0X A;  5BU5 A;  1S5L X;  1KFM A;  3VMY A;  4XRO A;  1Q82 Q;  2E5T A;  1AJY A;  2HG5 D;  4L75 A;  2K93 A;  2IBZ E;  3V2P A;  4BPH A;  2GZJ A;  4UB6 E;  4R4M A;  5KJ7 A;  1A8O A;  1OMI A;  4BXL A;  1KIL C;  4ZKU A;  3C1L A;  1OXZ A;  1K9M Q;  1RY3 A;  2O1J A;  1DX7 A;  1AQ5 A;  4H0L C;  2K1A A;  1L0H A;  2JWA A;  1X9V A;  3RK3 B;  3KQG A;  4HH2 A;  7CEI A;  1SQV J;  5BVZ A;  2AF8 A;  1U7M A;  4DJG A;  3CXC O;  2L0Q A;  1MZ9 A;  2QSI A;  3CLQ A;  3TGU J;  2QVA A;  1JEK A;  1IZN B;  2HOD B;  5AW9 B;  1EIA A;  2KSE A;  4I7Z C;  4NPF X;  1M57 D;  2WPS A;  4WY4 B;  3L75 D;  3M9Q A;  3GLM A;  1A02 F;  1M90 Q;  4GOD A;  1NTK G;  4GR2 A;  2FFD A;  2ZXE B;  5KAF H;  3DPH A;  2CQ8 A;  1OX3 A;  2E1M A;  5APW A;  1M6E X;  2Q1K A;  1NJI Q;  1N7S D;  3CL3 D;  3WUU A;  1YJN P;  2ZT9 D;  1X79 B;  4U3F G;  3CCL P;  3P8M C;  2KI7 B;  2ZFC A;  4HJG H;  3L72 J;  1NTM K;  3EJE A;  3CWB D;  2I1K A;  1SQX D;  1Q86 Q;  1HBW A;  3RK3 C;  4XFZ A;  2XV6 A;  1VQ8 P;  4WVZ A;  1G2C B;  1GZL A;  2BCC G;  3DTJ A;  4A7P A;  4YPC A;  3PHL A;  3CC2 P;  4COC A;  2FYN C;  2FYU E;  3HRN A;  1BE3 E;  1JY2 P;  2JJL A;  2LIW A;  2OGU A;  3HD7 A;  2GZE A;  1YJW P;  2WPQ A;  3TSI A;  2K37 A;  1VF5 C;  3VOP A;  2E75 D;  1SQP G;  2B87 B;  2D2C B;  2PFX A;  5CJ4 A;  1NU1 E;  3L74 G;  3L70 D;  1M56 D;  3QWO C;  4CPG A;  1J1E B;  3OAK A;  1IJD B;  1BE3 D;  1GW3 A;  5KLV K;  4IFM A;  1SQQ G;  1JY3 O;  3AED C;  2L22 A;  1S5L H;  1ZRT E;  3RK3 D;  1S5L E;  3H1J G;  1GXH A;  5KJ7 C;  3A2A A;  1JM0 A;  2XV5 A;  1LWU A;  3H1L E;  1RE3 A;  3KYQ A;  1OIP A;  2KXP B;  5CHX A;  1LTI C;  2VRS A;  2FQ0 A;  5GTH E;  5TIS E;  2RMZ A;  1PPJ D;  3LW5 J;  4NPE A;  1T2K C;  3L71 J;  1LT9 C;  1JMM A;  2VLP A;  1S1C X;  1LTJ B;  4U0F A;  3RG2 A;  5GTI H;  1RO0 A;  1ZXG A;  1BE3 G;  4OWF A;  2BQ1 E;  4I1L A;  3EWK A;  3CWB G;  2MF4 A;  3BAT A;  2LKI A;  3L71 E;  4Y99 B;  2K92 A;  2N98 A;  2YO3 A;  4EOT A;  2Q9I A;  3L73 D;  2G3A A;  3GMA A;  5JPA A;  1JCD A;  3QH9 A;  4D6T E;  5CCG A;  3NXS A;  3EQ2 A;  4HYT B;  2WQY C;  2GYK A;  5KLV E;  2C0X A;  3CX5 D;  3SWF A;  1EDJ A;  5BS1 A;  1LP1 B;  4BRY A;  3CCS P;  1NTZ G;  3CXH I;  2E43 A;  2K2Q A;  2RN0 A;  3H1H D;  3KPE A;  1BGY E;  4C7N B;  5B66 H;  3LW5 H;  4U7J A;  1CEI A;  1BSN A;  3RL0 C;  3V2R A;  2IBZ I;  5CCH D;  1BGY J;  1JY3 N;  3MHV A;  1EZV E;  1KZU B;  1WT6 A;  1GW4 A;  1M74 A;  4R0M A;  1HTL C;  1L0N K;  3CPW O;  3BCC D;  2VLN A;  1L4A A;  1DV5 A;  1KIL B;  2FYU J;  4MN4 C;  2FQ2 A;  2WT7 A;  3KZI H;  2P2U A;  3CC4 P;  3UIA A;  2IYO A;  5K5G B;  5HGM A;  1Y9B A;  2JB0 A;  1L0L D;  4H2Y C;  3VRL C;  2OTJ P;  4D6T J;  1KN7 A;  3TNU A;  3RGU A;  3G1I A;  4XFY A;  2YIU C;  4UB6 H;  3TK1 A;  3BRV B;  2XU6 A;  1SQP D;  1FZC A;  1KB9 E;  3IAO A;  1GU5 A;  2QJK C;  1E6J P;  3H1I E;  3U59 A;  3HYB A;  5AW5 B;  1PP9 E;  1N73 C;  2KG9 A;  5AVW B;  3KZI E;  2D2C D;  1KB9 I;  5F2O A;  2FXM A;  1AFO A;  5HGN A;  2K9J A;  4WBA A;  2FXO A;  3L73 J;  3AEC C;  2FFD C;  3DS5 A;  2OYH C;  1VKU A;  1ZW0 A;  2GUV A;  3M1M A;  3H1L J;  4GKG A;  5F2N A;  5AVY B;  2NRG A;  2DGY A;  4LC1 A;  4ASW A;  1RO2 A;  2PAJ A;  3H1K G;  2CPS A;  5DCK A;  1AA0 A;  1NTM G;  3MIW A;  3W67 A;  4H13 D;  1SQQ K;  1FE6 A;  1PGJ A;  2FYU D;  1EZV I;  3AE9 C;  3RL0 D;  3G28 A;  1QL2 A;  1Y47 A;  2FYU G;  3DS2 A;  3DS0 A;  3G1G A;  3H25 A;  3O6Q A;  2FQ1 A;  2KG6 A;  2A06 D;  1R5S A;  3O8Z A;  1MUU A;  3RBZ A;  2J59 M;  1GXG A;  1OWA A;  1CW5 A;  2P67 A;  3B4Q A;  1GL2 C;  2A45 H;  2Z5I A;  4ZKP A;  1KQL A;  4JPZ B;  1BE3 J;  3CCM P;  2NPS D;  2M5A A;  2MD9 A;  1Z56 A;  2KOR A;  4H2X C;  4I6M C;  4QNB A;  3GZL A;  5CBO A;  3P8C E;  3BCC J;  2QA4 P;  1X3O A;  2KG8 A;  1NTZ D;  2PEJ A;  1SP4 A;  1LT9 B;  3USS A;  2MVV A;  1SQB J;  1HGZ A;  1YIT P;  3S9O A;  2QJP C;  2BUO A;  2K88 A;  2FY8 A;  2JQ4 A;  1GK4 A;  2FKW B;  2P9X A;  2Z46 A;  3H4E A;  1NTK K;  1KQF B;  2OYI A;  3G6E P;  2HFE D;  3MUD C;  2N1T C;  2E76 C;  3ABV C;  3FWL A;  2N1T A;  2L91 A;  2BAS A;  5KP8 B;  3L71 D;  1SQX E;  2WMM A;  3NMD A;  1PP9 G;  2MVU A;  3B71 A;  4ZNC A;  1OW7 A;  1N73 A;  2O01 N;  1IK7 A;  3CWB J;  3TGU E;  4PV1 B;  1AUM A;  3TGU G;  4U0D A;  5AVU B;  3GF7 A;  4IL6 H;  2UWJ E;  2KGE A;  3HE4 A;  5CCH C;  1WRG A;  5KLV D;  1ZV8 A;  1RE4 C;  2BCC E;  4PH0 A;  1JB0 J;  2WSF J;  3S1K A;  3HD7 C;  3GKL C;  2CWO A;  1DIP A;  3TF5 A;  1KYO I;  3OW2 O;  1L0L G;  2IYP A;  2WPV B;  2K0Y A;  1Q2N A;  4PD4 D;  2XZ0 D;  2YNY A;  1NTK D;  1PFI A;  2AFD A;  4OGQ D;  4OGQ C;  2E76 D;  1JO5 A;  2WPT A;  1X22 A;  1ZRT D;  1NGM B;  4GIF A;  3CXH E;  4COP A;  2OTK E;  1JCC A;  3L72 G;  3G3Z A;  2YMK A;  1D7M A;  1H0T B;  3JCU H;  2A45 G;  2XZR A;  1NTK E;  3B8E B;  2YXR B;  3VYI A;  3L70 G;  3CCR P;  3V4Q A;  1ZNV A;  3MTU E;  2KNC A;  4YTP C;  3E1I A;  4RKU J;  5AW2 B;  2IZ0 A;  1BXI A;  1PGP A;  3H1L D;  1OR5 A;  1AVY A;  2WWW A;  3L35 A;  3G4S P;  1JTH A;  5I4T G;  2YO2 A;  1USD A;  2ZYG A;  1VL2 A;  2Y9Z A;  3H1K D;  3H6P A;  1K8A Q;  5HGL A;  1IO4 A;  2FXP A;  5AVZ B;  1SS1 A;  4W7Z A;  1IC2 A;  1IUQ A;  3GG2 A;  4Y99 C;  4QMA A;  2IZ1 A;  4RO0 A;  4DOJ A;  3C9I A;  2MY5 A;  1J1D C;  1T6A A;  3P32 A;  2FYZ A;  2W8Z A;  1JUN A;  2M3B A;  2R5D A;  3CXH H;  2ZXX A;  2KOD A;  3D6Z A;  3L36 A;  3Q1M A;  3H1K E;  1SVF A;  2O01 J;  1NU1 K;  3RBX A;  2GZI A;  1A02 J;  1ACP A;  1RHZ B;  2ONT A;  2ROQ A;  4WY4 D;  4KJM A;  1YIJ P;  1VQK P;  1VHN A;  2PEO A;  1MFT A;  2XND H;  2FYU K;  1T2K D;  1N8R Q;  3II6 A;  1PZQ A;  4EDF A;  1GL2 A;  1J1E C;  5AW3 B;  2OYO A;  4LGD E;  3L74 E;  4IL6 E;  5AW7 B;  1ZR4 A;  1MFZ A;  3NTE A;  2NPS C;  3H1K J;  1PIX A;  3IN6 A;  2LXC B;  2CGQ A;  3RL0 g;  3GF3 A;  1SLQ A;  3WBH A;  2GA1 A;  3VN0 A;  1BGY D;  3GHG C;  3M06 A;  4NPD A;  5APY A;  2FVF A;  4IZ6 A;  1KQS O;  4DT0 A;  2IBZ D;  2AEM A;  3RK2 B;  4OVN F;  3RG6 C;  4MRT C;  5L8R J;  4L73 A;  1EDK A;  2ZVO B;  3V4W A;  3L74 D;  2GM4 A;  3Q5R A;  1VF5 D;  1FBM A;  4IFD K;  2LIU A;  2AEF A;  2Z4E A;  3RL0 B;  4U3F J;  5APX A;  4CA3 A;  2BHV A;  3VP9 A;  1URQ C;  2AXT E;  3HTK A;  1FU1 A;  4U0A A;  3SSU A;  1SFC B;  5APU A;  2AEJ A;  2K9Y A;  3H1I D;  3ITK A;  2O3J A;  3PJS K;  2Q3I A;  2N9Y B;  2WTY A;  2NPS B;  3H1H G;  1LP1 A;  5B66 E;  2GDX A;  1RQU A;  1Q90 D;  3Q5S A;  5HV8 A;  5KTB A;  1T8K A;  3JC2 2;  1T3J A;  2E76 B;  1EQ7 A;  3L73 G;  2Y0C A;  2CG5 B;  4B86 A;  1EDI A;  5KP6 B;  2QEX P;  3VTP C;  1JNM A;  2M8L A;  4I7Z B;  2W6J H;  1VDF A;  1P84 H;  2Q5U A;  2ZT9 B;  1IFM A;  1VQL P;  3L74 J;  4PXH B;  1ZOY C;  1JY2 O;  2JYL A;  5B5E H;  2C9N Y;  3PRJ A;  4D6T G;  5AVR B;  1N2D C;  1NH4 A;  1HVV A;  3CCV P;  1OVU A;  2JGP A;  4N78 E;  2N5H A;  3GJN A;  4GT1 A;  3CWB E;  1JMB A;  1L4A C;  1VQ4 P;  1R5L A;  3G29 A;  3CXH D;  5KJ7 D;  1KD1 Q;  2R5B A;  4BRY B;  5H2F E;  2ZT9 C;  3L71 G;  1L0L J;  1M6N A;  1LT1 A;  5AW8 B;  1FZB A;  2B88 A;  2A06 E;  1GTW A;  4JQ0 D;  2QRX A;  1QLE D;  1L0N D;  5CBN A;  3A0H E;  1KYO H;  2JYG A;  1PEU A;  1SQB E;  1ZP0 C;  1ZN5 A;  2V4H A;  3IF4 A;  3HE4 B;  3L70 E;  2KLV A;  1FS0 E;  2MJZ A;  3P8C D;  1QL1 A;  1KB9 H;  1RNI A;  1SQX K;  3HUS B;  2WZ7 A;  2YIU B;  3DS4 A;  2JWD A;  1SQP K;  4H44 D;  1NU1 D;  1KYO D;  3D70 A;  3B5N D;  1SFC D;  4H0L D;  3E2D A;  3MGE A;  1CI6 B;  1NKN A;  1SQB G;  1NTK J;  1UII A;  2KNC B;  1NU1 G;  2ITA A;  2GZF A;  1KIL D;  2Z44 A;  3WUT A;  3HZQ A;  2JAZ A;  4K35 A;  5AW4 B;  3A7O A;  1N7S A;  1G1I A;  1GD2 E;  3HD7 B;  2X2B A;  2KIK A;  1KYO E;  1LT9 A;  1E0H A;  3V6I A;  4RJT A;  2KGD A;  1PGQ A;  3S4R A;  4IFF A;  1FZC C;  3VMA A;  1FDM A;  2A06 G;  1T3U A;  1LTG C;  1N73 B;  1M1J C;  1W2E A;  2A45 I;  1FDO A;  1NHL A;  1IMQ A;  1PPJ E;  2B87 A;  1E5W A;  3N7N A;  2E74 B;  2BCC J;  5CCH A;  1GPJ A;  1DD4 A;  2JU2 A;  1IFJ A;  1GK6 A;  3H47 A;  1YQ4 C;  3V2Q A;  2O1K A;  3CX5 I;  1CSB A;  1UNK A;  1SQP J;  2KS1 A;  2LXB A;  1NTM E;  2FAE A;  3D6Y A;  3DS1 A;  5DJT B;  3MZW B;  5KAF E;  3L73 E;  1VQ7 P;  1SQX J;  4YXW H;  5EW5 E;  1NAY A;  2QJP B;  2MR7 A;  2H88 C;  3WU2 E;  2VLQ A;  1USE A;  3BVH A;  2JO1 A;  3GW6 A;  1YTZ T;  2BEQ D;  1SQQ J;  4H13 C;  2LKM A;  1PP9 J;  2KOS A;  1E79 H;  3H32 A;  3H1I J;  2HYN A;  2OTL P;  5AVT B;  3OA7 A;  1L0L K;  4Y28 J;  2NZ2 A;  4YXD C; 
#chains in the Genus database with same CATH homology
 1RO0 A;  2QEX P;  1W2B O;  1Q7Y Q;  4XRO A;  3CCM P;  1Q82 Q;  2PEO A;  5F2K A;  1Q81 Q;  2Z44 A;  2M8L A;  1VQ6 P;  4U0E A;  1YJ9 P;  3HZQ A;  2BQ1 E;  3G1I A;  2XXM A;  5HGO A;  2PEM A;  1Q86 Q;  1N8R Q;  2PEQ A;  1VQL P;  4XFY A;  1PEO A;  4XFZ A;  2JYL A;  3G21 A;  3CME P;  2XV6 A;  3I56 P;  1VQ8 P;  1A43 A;  3CCL P;  4COP A;  1E6J P;  3CC7 P;  3HYB A;  3NTE A;  3DTJ A;  1A8O A;  3VRL C;  4QNB A;  3CCV P;  5JPA A;  1VQ5 P;  1S72 P;  3CC2 P;  4COC A;  2QA4 P;  1YI2 P;  5F2O A;  5HGN A;  1K9M Q;  2LF4 A;  2PEJ A;  3WBH A;  1M1K Q;  3CCE P;  1K73 Q;  1ZMB A;  1YJW P;  1K30 A;  1VQN P;  3CCR P;  1VQM P;  1VQ9 P;  1QVF O;  3G71 P;  1YIT P;  1KQS O;  2PY8 A;  2BUO A;  2PEN A;  3RG6 C;  2EIA A;  1VQ4 P;  3B5I A;  5BS1 A;  2JO0 A;  3DS5 A;  3G29 A;  1VQP P;  1JJ2 O;  2P9X A;  2Z46 A;  4XFX A;  1KD1 Q;  2M8P A;  3H4E A;  3G4S P;  3P05 A;  4M0I A;  5I4T G;  3M1M A;  4WYM A;  3CCS P;  3H47 A;  3CXC O;  3G6E P;  5F2N A;  1M6N A;  2EFJ A;  2DGY A;  3CMA P;  1K8A Q;  5HGL A;  1RO2 A;  3CCJ P;  3G26 A;  2BHV A;  5DCK A;  1BAJ A;  3DS1 A;  2XT1 A;  3Q20 A;  1KC8 Q;  1EIA A;  1IUQ A;  4U0A A;  1VQO P;  1VQ7 P;  2JYG A;  2Z45 A;  1PEU A;  2OAR A;  4XRQ A;  1M74 A;  4IPY A;  1EOQ A;  5BS2 A;  1AUM A;  3CPW O;  4U0D A;  1M90 Q;  1QVG O;  3G0V A;  4GR2 A;  2EG5 A;  2PEK A;  3G28 A;  2KOD A;  1RNI A;  3CCQ P;  3LRY A;  3DPH A;  1D1D A;  3DS2 A;  3DS4 A;  3DS0 A;  4U0C A;  3CCU P;  3G1G A;  4U0B A;  3H0D A;  1PEM A;  2E1M A;  3CC4 P;  1M6E X;  4PH0 A;  1NJI Q;  2OTL P;  3I55 P;  1YHQ P;  5HGM A;  1YJN P;  2CWO A;  2PEI A;  3E2D A;  3MGE A;  2ONT A;  2L6E A;  2M8N A;  3DS3 A;  3CD6 P;  3OW2 O;  4U0F A;  1PEQ A;  1YIJ P;  4PH1 A;  4GR6 A;  1QRJ A;  1VQK P;  2OTJ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...