3I56P

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3i56P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3i56P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3i56P02
1QVFO 1M90Q 1QVGO 1N8RQ 3CC4P 1JJ2O 1K9MQ 3G71P 1YJWP 3CXCO 3I55P 1VQ5P 3CCEP 1YHQP 3G4SP 1Q86Q 3CCRP 1YJ9P 3CCSP 3CCQP 1VQOP 3CCUP 1YI2P 1S72P 2QA4P 1NJIQ 3CC2P 1KC8Q 1VQKP 3G6EP 3CCMP 1KD1Q 3CMEP 1YIJP 1YITP 1VQ8P 1VQMP 2OTJP 1VQNP 3CCLP 1K8AQ 1VQ7P 1VQLP 1Q81Q 3CCVP 3CMAP 1Q7YQ 1YJNP 3I56P 1VQ4P 2OTLP 3CCJP 1KQSO 1M1KQ 1W2BO 1VQ6P 3CC7P 1Q82Q 3OW2O 1VQ9P 2QEXP 3CD6P 1K73Q 1VQPP 3CPWO
chains in the Genus database with same CATH superfamily
3G26A 3FX0A 3HTKB 4RESB 3M06A 1K9MQ 1YJ9P 2K2QA 1G1IA 2YIUC 2MY5A 2ZYDA 1JM0A 2C0XA 4GR6A 2KP8A 2N9BA 1NTKD 1M1KQ 3MHVA 2QG4A 1K73Q 1RF1B 1SQPG 3B5IA 3P05A 1LTGC 1FZBA 2A45H 1Q86Q 3CCRP 4WWIA 2N98A 2XU6A 2KXPB 4CA3A 5B66H 4DOJA 1VQ8P 3MTUE 2Z5HA 2M5AB 2GZJA 3NTEA 2P2UA 2ZAEB 1S3JA 2BCCG 4H2YC 1RQUA 3KZIH 1OFCX 5KLIB 1JOCA 3H1KD 1SP4A 4B86A 2WWWA 2QNWA 5CHXA 3RK3D 1VQKP 5AW1B 1JUNA 1HTLC 2G3AA 3F89A 2W6JH 3MUDA 1NOHA 1YQ4C 1JJ2O 3V2NA 2EFJA 5KKZC 2FAEA 2KYVA 1SQQD 5M1BA 3CCQP 1N7SA 2ROQA 1IUQA 1G1JA 3R2PA 1URQA 2WSCH 1P84I 1AV1A 1K04A 4Y99B 2OTKE 2PEKA 1FE6A 3LW5H 3GW6A 2WT7B 3VMXA 4PD4H 5DJUB 1AFOA 3AEGC 4HKGA 2BCCD 1GTWA 2GZIA 2E5YA 2K9YA 3H1LE 2WPRA 3MUDC 3A0BE 2XT1A 4COPA 2EG5A 1SQVK 5APUA 3P8CE 2WPVB 1PL5A 3AEFC 2W90A 3EFFK 2C9NY 1R5LA 2ZXEB 1N7SC 3G29A 1FZCB 2B87A 3G4SP 2FYUG 3VTPC 3H1HG 2BUOA 3L73D 2M3EA 1URQC 5AVYB 2IYOA 2WSFH 3IN6A 2K37A 3KQGA 1EDKA 4R4LA 1RNIA 2JBGA 2LPKA 3B4SA 4AYCA 3HE5A 1R5SA 4QNBA 1GL2A 2K5XA 4U7JA 5KLVK 1JTHB 3OAKA 4I7ZC 3A5TA 2YXRB 1KYOH 3H1JJ 2KGAA 2BEQD 2R44A 2PFXA 4TLFA 2FQ2A 2J5UA 1IFIA 2POHA 2VLNA 4ZKUA 3AE3C 4C7NB 3AEDC 4Z1MH 1DV5A 2NO8A 1KILB 3BCCG 2N5IA 1KQFB 4LLHA 4NPEA 1NWQA 1FZAA 1P84H 1Y47A 1HH0A 4H13D 3L72G 2GYKA 3H1HD 3L36A 1QX8A 3CD6P 1SQBE 4PXHB 2QJYC 2OYIB 3SWKA 1GL2C 1GMJA 1NVOA 2FYZA 1J1EB 3PH0A 4H0LC 1LGHB 4BXLA 1EQ7A 3TGUJ 3H47A 3MP7B 2Q1KA 1SQVD 5KJ7D 3LRYA 3E1RA 3CMAP 2BQ1E 3OA7A 4IOIH 3JCUH 3L71E 3H1KJ 3AE9C 1QL1A 1EDLA 2E75C 3G21A 1G2CA 2ONTA 1BCCJ 1QRJA 3IFMA 2JKVA 2P7JA 2MVVA 2I1JA 3CXHI 2JP3A 2JU2A 3F5HA 3BCCD 1WRGA 3L74D 3HD7B 3I56P 5HGMA 1SQQJ 4R0MA 4N6JA 2WSEJ 3H4EA 3AEEC 5KLVD 1Z6MA 3Q2YA 3CE7A 1M1JA 1YJWP 1LNQA 1PGOA 1EC5A 1DNYA 1L0IA 5BVZA 1KFNA 5H2FH 4LC1A 1BGYG 4H2XC 3CC7P 2OYOA 3RG6C 1BAJA 2LIUA 1R8EA 1IJDB 2GM4A 1M8OB 1FZEA 4WBAA 5E79H 1M57D 4WB4A 2FXMA 3TNUB 1NTKE 5KAIE 1LTJA 2K93A 3NY7B 1CSBA 3HUSA 2P58A 2PAJA 4U0BA 2HODB 3AECC 2AEMA 3CWBJ 2Y9YA 3EQ2A 1M1JC 2E76D 3L73J 5KJ7A 1N73B 3HYBA 1JMBA 1ZV8A 2KUBA 3GF7A 1U7MA 1NU1G 1YHQP 3P8MC 2WVRA 2WPSA 2M8PA 1GD2E 3RL0B 1NJIQ 3ABVC 2JWDA 2FVEA 2KNCA 2LL8A 1K30A 2LKIA 1SFCC 3NTNA 3VP9A 1X0TA 3RK3E 3CCEP 2O01J 3L37A 5CBOA 1LTJC 1CW5A 3HUSC 1L0NJ 5HVCA 2KG9A 2WTYA 1E5WA 1MZ8A 1S9KD 1CI6A 1ZR2A 2QJPB 1MUUA 3E1IA 1SQPE 5CCGA 2WZ7A 5L8RJ 4EIJA 1ZW0A 3CCSP 1M6EX 4GIFA 3VP8A 1P84E 2WITA 2ZT9D 1SQBK 4BWNA 4PH1A 2HG5D 4WY4C 1YQ3C 1NKNA 3PLNA 3RBXA 1Q82Q 3V4WA 3H1LD 2HR3A 3RG2A 4K35A 2BCCE 3AE6C 2Q7CA 4PWVB 4DZOA 2L9FA 4OGQC 3G71P 4YXWH 3H25A 1L0LG 1LTTC 1SQVJ 1ZN5A 3P8CD 4HKZH 2KIKA 3RK2D 3CC2P 1JCDA 4XRQA 1OVRA 1OMIA 3TYYA 3MGEA 1OVUA 2D2CD 3GHGB 5APTA 2L91A 3G1IA 5CCGC 2A45G 2KGCA 2LKMA 3L74J 2XZ0D 2KS1B 1N86A 2ERHA 5KLVJ 3PP5A 1KMIZ 1E79H 2RH0A 2NPSB 4M3LA 5APWA 3Q1MA 2E5TA 2QIWA 2H89C 1RF0A 1BXIA 2GZGA 3I55P 4YPCA 2M3BA 2KSEA 1Y9BA 1Q90D 5B5EH 1VQOP 3IAOA 1RO2A 2RMZA 1J1DB 1EZVG 1T2KC 1VQMP 1HGZA 3II6A 2Y0DA 5AVQB 1FAVA 2FVAA 3CCJP 3FXEA 3ZDMA 2PEQA 1OX3A 1NTKK 1QVFO 3TF5A 2CQ8A 1SVFA 4YTPC 4BRYA 2ZVNB 2B9BA 2GDWA 2FYUE 1VKUA 2M8NA 1LTBC 3MGNA 1SQBD 2A45I 4JF7A 2E74B 3B71A 3H1HE 4L75A 4H44B 2FKWB 4EI2A 2LOLA 1NTZG 2AEJA 2VRSA 1RE3C 3Q3DA 1LWUB 2GUSA 1AQ5A 2K88A 4NPFX 3V5BA 1VF5B 3MD0A 4GDOA 5EW5E 1LP1A 1H88A 4DG9A 1L4AB 3AEBC 3HTKA 4D6TG 4I2LC 2R5DA 3M0DA 3D71A 1EZVI 3SWYA 3I5CA 3DTJA 2W6BA 2FXPA 3B5NC 3BCCE 3CL3D 4A7PA 3CXHE 1KB9H 3S4RA 3L75G 3V2RA 1RF1A 1RHZB 2PNGA 3EJDA 2Z44A 2N50A 1ZRTD 3C1LA 1SQPK 3GF3A 3L72E 5GTHH 1J2JB 2HPCA 2QM7A 5APSA 1RE4A 1N7SD 4RKUJ 3AE1C 2M5AA 4JQ0D 4U3FG 4EYYQ 1OIPA 1URQD 1T3JA 4PD4I 1X79B 3H1LJ 3DS2A 3M0DC 1BDCA 5CMZA 1S5LX 2N9YB 2N1TB 1H0TA 4GODA 2FYNB 3HE4A 3O6QB 1RF1C 4PH0A 5GTIH 3SSUA 1JO5A 1YBKA 2HFED 2K3RA 2XZRA 2AFDA 1RE4C 1BE3G 4COCA 2HYNA 1S2EA 1PEOA 3L70G 1A8OA 4IPYA 1HGVA 4HH2A 2X2BA 4ASWA 3GG2A 2K0DX 5CZDB 2K9JB 1KLPA 2KGDA 3LMOA 2IBZG 1KYOI 5KLIC 1MFTA 1IC2A 1HUCA 2IZ1A 2PEJA 1XTCC 4KT0J 1SQXG 1PP9G 1GL2D 2JWAA 2GDYA 4H0LD 2CPBA 1S9KE 3H32B 2KOPA 3E2DA 1MZ9A 1SQPD 1WMKA 1NTMG 2WPQA 3H6PA 1OW6A 4U0EA 3CWBG 4ZMDA 1PGPA 3M0AA 3SFDC 1P84D 1LTAC 2E75D 2H8PD 2FYUK 1SQBJ 3BATA 3M91A 2MR8A 4Y99C 5APVA 1S5LH 2J59M 3V6IA 3H1IG 2DW3A 2W27A 2QRXA 2VLQA 4XFXA 2L4BA 3OJAB 4IL6E 3L71J 2R5BA 4JBZA 1EXIA 3DPHA 1ZR4A 1N2DC 2IBZI 1DX7A 4PV1B 1PGQA 2IBZD 4QKOA 1PV3A 1IZNB 2JR8A 1FR2A 1L0NG 4PJ0H 4C7NA 2MJZA 5KP7B 1FZCC 5AVVB 2JYLA 1PEMA 3VRLC 1S1CX 2ZVOB 3FGAD 1MKMA 4F37A 1LT1A 5CJ0A 5JPAA 3QH9A 2WMMA 5TISH 2YKQA 1FOSE 2YNYA 2MD9A 3H1ID 3U1CA 1U57A 2I1KA 2QEXP 3WBHA 2YXQB 2GZFA 5K5GB 2O3JA 2A06G 3MZWB 1L0LE 4W7ZA 1DEEG 5HGNA 1NTKJ 2KG8A 5F2NA 4AQRD 2Z4EA 1KILC 2K0XA 2IYPA 1RQVA 2CPSA 1SFCD 1JNMA 1M74A 1VPCA 2FYUD 4GT1A 2CWOA 2Q6QA 2LR2A 2XZ1C 2Z45A 1W2BO 1VDFA 2V7QJ 3A0HH 2P67A 2WSEH 2FY8A 4GOEA 3VOPA 1KQGB 5KAFH 3RK3B 4DT0A 2OYIC 5B66E 2WSFJ 4QMAA 1L2PA 1J1EC 1VHNA 5AW4B 2PRRA 1Z56A 2FACA 2XKMA 2BEZF 2O1JA 2BASA 1MFZA 3R4YA 3KZIE 3M9BA 5APYA 2JJLA 2RKLA 1JEKA 2KLVA 2FFDB 1PZQA 3VMYA 1EZVE 1A43A 1AVYA 4WY4D 1UIXA 3CXHD 4BPHA 2MKVA 5BS1A 4OGQD 1SQPJ 3CX5H 3HD7C 3WUTA 4KJMA 1ZXGA 1ZRTE 3N7NA 4XROA 3L72D 1MV8A 4JPZB 1JY3P 1JY3O 1KV4A 2DGYA 4XA4A 4L73A 1NTZE 1NU1K 4C46A 3FWNA 5CCGD 2CNRA 3USSA 4H2WC 5BU8B 4I6MC 1SFCA 2BCCJ 2XXMA 4L74A 4PD4E 3CCUP 2O01H 1K05A 1GXGA 1SLQA 2LF4A 2EHTA 1FJKA 1X9VA 4D6TE 1VQ7P 1VQ4P 1OW8A 3Q5SA 3TSIA 2OGUA 4U0AA 1AVOA 3S9OA 1QVGO 2AF8A 1U7JA 1N73C 1T2KD 1KZUB 3L75E 2MVUA 5APXA 1GK6A 5HGOA 3H0DA 2KZJA 1HJBA 4HJGH 2AXTH 3RL0C 1LJ2A 1RO0A 3D6ZA 4WY4A 4IFDK 4N78D 5DCKA 1KYOE 2FXOA 4U3FE 1BGYD 3AE7C 2JYGA 4H13B 2QM8A 1IO4A 2K0YA 1IFNA 1AQTA 2XV6A 1YTZI 1L0LK 5F2OA 5CBNA 2W6AA 3M9QA 2PEMA 4OVNF 5AW5B 2W8ZA 2QJPC 1JB0J 1HQBA 1JY2P 1JY2O 2FYUJ 2QSIA 3BASA 3WMM0 1FU1A 3H1HJ 7CEIA 2M5RA 3NXSA 3VMZA 3GHGA 2PENA 1PFIA 2L0QA 2QJKB 5AW8B 1NO4A 1NU1D 1A02J 1PPJG 3WU2H 2HLOA 1H8AA 2KGEA 5KP6B 2KS1A 5AW9B 1BE3E 3IR9A 3B5ND 3AE2C 2O1KA 3L35A 1IFMA 1HBWA 1UIIA 3L70E 3PRJA 1AUMA 2NPSA 1NQ4A 3GJNA 2P10A 1RY3A 3L4FA 2IBZE 2CGQA 3JCUE 1OZHA 3C9IA 1SQXE 3V2PA 4DJGA 1YTZT 1CEIA 3HZQA 1CI6B 3BCCJ 4DCKA 1HF9A 1EOQA 1ZNVA 3GHGC 2OYHB 1H89A 1KB9I 4I1LA 1KC8Q 1KB9D 2Q3EA 5CCHA 3QWOC 1PEUA 1NTME 1FDIA 2IFNA 2R32A 3E7KA 3L72J 3KDPB 4M0IA 1RE3A 2N6ZA 2P9XA 2NPSC 2UWJE 4KHXA 5DJTB 2H43A 4AUWA 2LIWA 2YKOA 1NTZK 3H1IE 2E1MA 4IFFA 1LWUA 3Q20A 1L0LD 5H2FE 2E43A 3K5BA 4U0FA 2I8DA 1J1DC 2EIAA 1OVVA 3EFGA 1AJYA 2M8RA 3NMDA 2KWLA 5E79E 4EOTA 2KOQA 2ZXXA 2YKPA 1T3UA 2W83C 1PGJA 4XE5B 3GKLC 3B5NA 1LT9B 1IMQA 2GUVA 5CCHC 2WSSH 2IPPA 2IDBA 1AF8A 1VQNP 1PIXA 2V4HA 2E74C 2K92A 5APQA 1FJPA 1EXJA 4H44C 1NHLA 1XTGB 3AEAC 1LWUC 2YMYA 2QA4P 3H1JG 4WVZA 3RGUA 1Q2NA 2DNWA 1EIAA 1DH3A 1TU3F 1VF5C 4HYTB 4EDFA 1IK9A 3A0BH 2Y9ZA 1BGYJ 1L4AC 1EZVD 3CPWO 1E0HA 2JQ4A 2A06E 2IX7C 1EDIA 3KHUA 2ZT9B 1YI2P 3T97B 5AVXB 2Z46A 3SFEC 2N1TA 1KD1Q 3GLMA 4BRYB 2K94A 5AVRB 3O6QA 1OW7A 2SPZA 2RN0A 3O8ZA 4CPGA 1JY3N 1GW4A 2JO1A 1QEXA 3RK2B 4WYMA 1NU1J 1GU5A 4RO0A 1NTZD 2JB0A 2XNDH 3TGUG 4HB1A 1DD3A 3MIWA 2D2CB 4PD4D 2XDJA 3D6YA 3H1KG 2ITAA 3H1JD 1ZMBA 4NEOA 3OW2O 3PJSK 1F80D 2YIUB 4D6TD 1AA0A 1RH5B 3CXCO 3G3ZA 1BCCG 2QVAA 3CI9A 4N3YB 2N1TC 4OH8B 5BS2A 1SQXK 3C8VA 2EHSA 2FYNC 4GKGA 1PEQA 1SQQG 3D70A 3H32A 3L75D 1NAYA 2KW2A 4W80A 1NTMK 3W68A 2VLPA 2ZYGA 1IFPA 2HPCB 1KILD 1HWTC 1OR5A 3M1MA 2L22A 4N78E 2WT7A 2OQQA 1KYOD 4U3FD 3TGUD 1BGYE 2B88A 1S4XA 2O01N 1JMMA 5B5EE 2KR5A 1L0LJ 3GZMA 5AVSB 1HY8A 3TK1A 2R3SA 1H0TB 3CCMP 1BCCD 3V2QA 3HE4B 1JY2N 1USEA 1D7MA 1FZCA 5KKZB 3L73G 1L0NK 4C7RA 1NGMB 3G28A 1NU1E 1FZFA 1BE3D 2L5GB 2CG5B 2JO0A 3L70D 1OWAA 2KB7P 3CCVP 4UB8H 1JTHA 3AE4C 3HD7D 1QLED 2C9LY 1NH4A 2VSQA 4BPFA 1SQXD 3KYQA 4PV1C 4XFZA 1PP9D 2YMKA 5KAIH 1VL2A 1YITP 1L0HA 2MF4A 4MN4C 2J58A 1KILA 4GOFA 2OTLP 3ITKA 1N7SB 2CK3H 1M56D 2Z5IA 2KSJA 1X3OA 1M90Q 2V7QH 1NTMD 3RBZA 3G1GA 1URQB 1KB9E 3CWBD 3CX5I 3A3YB 3CX5D 4XFYA 2JGPA 2WSCJ 2FBWC 2OYIA 2OTJP 1ZLLA 5GTHE 1PPJE 1NTZJ 4I7ZB 3LW5J 1VQPP 1N8RQ 2Q3IA 1FDMA 1SQVG 1GPJA 1BSHA 2KOSA 3LIEA 3WUUA 3RL0D 1GW3A 3Q5PA 4D6TJ 5BU5A 2B87B 4L76A 2FFDA 3DS5A 5AW2B 1L0ND 1M7LA 2KLUA 2KK7A 1NAFA 3L74G 1T8KA 3IF4A 1ZMEC 3HD7A 5GTIE 2FQ0A 1A02F 3L75J 1YYCA 1FC2C 3HE5B 5KLVG 3RK3C 2QJYB 2YO2A 1GL2B 3HRNA 3PHLA 4H0LB 1VQ6P 3CLQA 3RL0g 3KPEA 4MRTC 3JSVC 3LIDA 3A2AA 1W2EA 4U3FJ 1HJ0A 2PEIA 4NPDA 2PGDA 2A06D 3P32A 4YXDC 4LGDE 1GZLA 2LXCB 2E75B 2FFDC 2K1AA 1VQLP 4U0DA 4ZKPA 2VLOA 1T6AA 3TNUA 1OXZA 3G0VA 3N4XA 2HODA 3DS1A 1GK4A 2L6EA 3JC22 1N73A 4ZNCA 2GZEA 2XV5A 1LTSC 3WUVA 2C0WA 1IMPA 2B89A 4UB6H 1BE3J 5AW0B 1W5CE 5C39A 1NKZB 3GMAA 5CJ4A 1S5LE 3L70J 4JYCA 5KP8B 1IFDA 3H1JE 3B4QA 1FZGA 3VN0A 3NFQA 4UB8E 3CCLP 1G2CB 3U1AA 1Q81Q 2P1JA 1SQXJ 1PP9J 3FXDA 1FS0E 2NPSD 3VMAA 1IFJA 1BSNA 2GDXA 4PJ0E 2PEOA 4Y28J 5AW3B 1LTIC 2AXCA 3AE8C 4UHPB 2IFMA 1NTMJ 1M1JB 2GA1A 2XNXA 5AVWB 1KFMA 1EDJA 2ZFCA 5HGLA 1KILE 1QGKB 2H88C 2E42A 2YO3A 1DIPA 2KZIA 5TISE 5CCHD 4JYBA 1GDTA 1Y8AA 3H1LG 1SFCB 3H1IJ 3W67A 2NZ2A 1USDA 3TGUE 3G6EP 1ZOYC 1DD4A 2E74D 5AVTB 4H44D 3U59A 3UIAA 1UNKA 3H1KE 1EMVA 4H13C 1LTJB 5AVZB 2Q5UA 3P7KA 1ZP0C 3HUSB 2G8YA 4W7YA 1BCCE 2JDIH 3V4QA 1T8ZA 3CXHH 2AEFA 2AFEA 1QL2A 2MR7A 1D1DA 4ASVA 1VF5D 1BDDA 5F2KA 2LMLA 1L4AD 3DS4A 5KJ7C 1SQQE 3M9HA 3A0HE 2OYHA 5AVUB 2QJKC 5KAFE 2KNCB 2N6YA 1VQ5P 2FHSC 5EFWB 2Y0EA 3AE5C 4WY4B 1KTMA 2QE7H 1GU4A 2FQ1A 3SWFA 1WT6A 4OGQB 1X8YA 2Y0CA 3B8EB 1KQSO 4BPGA 1KN7A 3PTZA 1PP9E 2PP6A 4IZ6A 2M8LA 4U0CA 4GR2A 2JEEA 4IL6X 2JU1A 5HV8A 2KORA 3FWLA 2KODA 2OYHC 3CWBE 2H7HA 1LT9A 1N7LA 3CX5E 1AYIA 3CMEP 1SQBG 3KXDA 3BRVB 3L73E 3A7OA 1FOSF 1PPJD 2N1TD 4OWFA 3TDKA 1S72P 5AW7B 3DS0A 1JCCA 2AVAA 4UB6E 2OARA 1Q7YQ 2NRGA 3L71G 2FVFA 2E76B 4TT3H 1VQ9P 1L4AA 2ZYAA 2E76C 3EWKA 5KTBA 3G9RA 1L0NE 3EJBA 4O9BA 2PY8A 2IZ0A 1UJZA 2KI7B 1K8AQ 1SS1A 2KG6A 1KQLA 1LT9C 3T97A 2R3CA 2WPTA 3BVHA 5TJHA 2LXBA 1M6NA 4IFMA 5EJDA 1E6JP 2KOOA 1HVVA 1FDOA 1YIJP 2BHVA 1CZQA 2AXTE 3DS3A 2Q9IA 1IK7A 1RF0C 4XFJA 2LTEA 4IL6H 2M0BA 2JAZA 1SQVE 3L71D 3EJEA 1NTKG 5AW6B 5I4TG 3VYIA 1KORA 2ZT9C 2WQYC 3B5NB 3Q5RA 3S1KA 1GXHA 1NYHA 3CC4P 3BRTB 4K3AA 3L74E 4PV1D 1ACPA 4R4MA 3U43A 1SQQK 3GZLA 3RK2C 1X22A 5KLVE 4RJTA 1FBMA 3WU2E 2ZJSE 1YJNP 2N5HA 2KOGA 2K9JA 2D2CC 1DEBA 1LP1B 2FADA
chains in the Genus database with same CATH topology
3G26A 1M90Q 3G1IA 2XXMA 3G1GA 3HYBA 3G0VA 1K9MQ 1YHQP 1YJ9P 3DS1A 1AUMA 5HGNA 3CCUP 2M8PA 4XFYA 5F2NA 2QA4P 1NJIQ 3E2DA 3H47A 2L6EA 2LF4A 1D1DA 1EIAA 2PY8A 4GR6A 2Z44A 2OTJP 3M1MA 4U0EA 2XT1A 1K8AQ 1VQ7P 1K30A 3LRYA 1M74A 5F2KA 4COPA 3CMAP 1VQ4P 2EG5A 2BQ1E 2CWOA 3DS4A 4U0AA 2Z45A 1W2BO 1M1KQ 1K73Q 1VQPP 3B5IA 3CPWO 1QVGO 1N8RQ 3G21A 3P05A 1VQ5P 3I55P 3CCEP 3HZQA 3G29A 2ONTA 1EOQA 3G4SP 3CCRP 1Q86Q 1VQOP 1QRJA 1YI2P 1M6NA 1E6JP 2Z46A 1RO2A 2BUOA 3DS2A 1KC8Q 3CCMP 1KD1Q 1YIJP 1VQ8P 1VQMP 5HGOA 2BHVA 1PEUA 3H0DA 3CCLP 3DS3A 1Q81Q 4XFXA 1RNIA 3I56P 3NTEA 3DS5A 5HGMA 3CCJP 1KQSO 3DPHA 2PEQA 1RO0A 4M0IA 3H4EA 1QVFO 1YJWP 2P9XA 4QNBA 3G28A 5DCKA 4WYMA 3CCSP 2PEOA 2M8LA 1M6EX 4GR2A 4U0CA 2M8NA 5I4TG 4PH0A 2E1MA 2JYGA 1VQKP 1A43A 2JO0A 3Q20A 3WBHA 2JYLA 2KODA 4PH1A 2XV6A 3VRLC 1PEMA 3CCVP 4U0FA 5F2OA 2EIAA 1VQ6P 5BS1A 1ZMBA 3CC7P 1Q82Q 3OW2O 4COCA 3CMEP 5HGLA 3RG6C 1BAJA 2PEMA 3CC4P 1JJ2O 1PEOA 3G71P 1A8OA 5JPAA 4IPYA 3CXCO 2EFJA 4XROA 3CCQP 4XFZA 1S72P 1IUQA 2PEIA 3DS0A 3CC2P 5BS2A 4XRQA 2PENA 3G6EP 1YITP 2DGYA 1VQNP 4U0BA 2OARA 3MGEA 1VQLP 1PEQA 1Q7YQ 4U0DA 1YJNP 2OTLP 2PEJA 3CD6P 1VQ9P 2QEXP 3DTJA 2PEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF O;  1M90 Q;  1QVG O;  1N8R Q;  3CC4 P;  1JJ2 O;  1K9M Q;  3G71 P;  1YJW P;  3CXC O;  3I55 P;  1VQ5 P;  3CCE P;  1YHQ P;  3G4S P;  1Q86 Q;  3CCR P;  1YJ9 P;  3CCS P;  3CCQ P;  1VQO P;  3CCU P;  1YI2 P;  1S72 P;  2QA4 P;  1NJI Q;  3CC2 P;  1KC8 Q;  1VQK P;  3G6E P;  3CCM P;  1KD1 Q;  3CME P;  1YIJ P;  1YIT P;  1VQ8 P;  1VQM P;  2OTJ P;  1VQN P;  3CCL P;  1K8A Q;  1VQ7 P;  1VQL P;  1Q81 Q;  3CCV P;  3CMA P;  1Q7Y Q;  1YJN P;  3I56 P;  1VQ4 P;  2OTL P;  3CCJ P;  1KQS O;  1M1K Q;  1W2B O;  1VQ6 P;  3CC7 P;  1Q82 Q;  3OW2 O;  1VQ9 P;  2QEX P;  3CD6 P;  1K73 Q;  1VQP P;  3CPW O; 
#chains in the Genus database with same CATH topology
 3G26 A;  3FX0 A;  3HTK B;  4RES B;  3M06 A;  1K9M Q;  1YJ9 P;  2K2Q A;  1G1I A;  2YIU C;  2MY5 A;  2ZYD A;  1JM0 A;  2C0X A;  4GR6 A;  2KP8 A;  2N9B A;  1NTK D;  1M1K Q;  3MHV A;  2QG4 A;  1K73 Q;  1RF1 B;  1SQP G;  3B5I A;  3P05 A;  1LTG C;  1FZB A;  2A45 H;  1Q86 Q;  3CCR P;  4WWI A;  2N98 A;  2XU6 A;  2KXP B;  4CA3 A;  5B66 H;  4DOJ A;  1VQ8 P;  3MTU E;  2Z5H A;  2M5A B;  2GZJ A;  3NTE A;  2P2U A;  2ZAE B;  1S3J A;  2BCC G;  4H2Y C;  1RQU A;  3KZI H;  1OFC X;  5KLI B;  1JOC A;  3H1K D;  1SP4 A;  4B86 A;  2WWW A;  2QNW A;  5CHX A;  3RK3 D;  1VQK P;  5AW1 B;  1JUN A;  1HTL C;  2G3A A;  3F89 A;  2W6J H;  3MUD A;  1NOH A;  1YQ4 C;  1JJ2 O;  3V2N A;  2EFJ A;  5KKZ C;  2FAE A;  2KYV A;  1SQQ D;  5M1B A;  3CCQ P;  1N7S A;  2ROQ A;  1IUQ A;  1G1J A;  3R2P A;  1URQ A;  2WSC H;  1P84 I;  1AV1 A;  1K04 A;  4Y99 B;  2OTK E;  2PEK A;  1FE6 A;  3LW5 H;  3GW6 A;  2WT7 B;  3VMX A;  4PD4 H;  5DJU B;  1AFO A;  3AEG C;  4HKG A;  2BCC D;  1GTW A;  2GZI A;  2E5Y A;  2K9Y A;  3H1L E;  2WPR A;  3MUD C;  3A0B E;  2XT1 A;  4COP A;  2EG5 A;  1SQV K;  5APU A;  3P8C E;  2WPV B;  1PL5 A;  3AEF C;  2W90 A;  3EFF K;  2C9N Y;  1R5L A;  2ZXE B;  1N7S C;  3G29 A;  1FZC B;  2B87 A;  3G4S P;  2FYU G;  3VTP C;  3H1H G;  2BUO A;  3L73 D;  2M3E A;  1URQ C;  5AVY B;  2IYO A;  2WSF H;  3IN6 A;  2K37 A;  3KQG A;  1EDK A;  4R4L A;  1RNI A;  2JBG A;  2LPK A;  3B4S A;  4AYC A;  3HE5 A;  1R5S A;  4QNB A;  1GL2 A;  2K5X A;  4U7J A;  5KLV K;  1JTH B;  3OAK A;  4I7Z C;  3A5T A;  2YXR B;  1KYO H;  3H1J J;  2KGA A;  2BEQ D;  2R44 A;  2PFX A;  4TLF A;  2FQ2 A;  2J5U A;  1IFI A;  2POH A;  2VLN A;  4ZKU A;  3AE3 C;  4C7N B;  3AED C;  4Z1M H;  1DV5 A;  2NO8 A;  1KIL B;  3BCC G;  2N5I A;  1KQF B;  4LLH A;  4NPE A;  1NWQ A;  1FZA A;  1P84 H;  1Y47 A;  1HH0 A;  4H13 D;  3L72 G;  2GYK A;  3H1H D;  3L36 A;  1QX8 A;  3CD6 P;  1SQB E;  4PXH B;  2QJY C;  2OYI B;  3SWK A;  1GL2 C;  1GMJ A;  1NVO A;  2FYZ A;  1J1E B;  3PH0 A;  4H0L C;  1LGH B;  4BXL A;  1EQ7 A;  3TGU J;  3H47 A;  3MP7 B;  2Q1K A;  1SQV D;  5KJ7 D;  3LRY A;  3E1R A;  3CMA P;  2BQ1 E;  3OA7 A;  4IOI H;  3JCU H;  3L71 E;  3H1K J;  3AE9 C;  1QL1 A;  1EDL A;  2E75 C;  3G21 A;  1G2C A;  2ONT A;  1BCC J;  1QRJ A;  3IFM A;  2JKV A;  2P7J A;  2MVV A;  2I1J A;  3CXH I;  2JP3 A;  2JU2 A;  3F5H A;  3BCC D;  1WRG A;  3L74 D;  3HD7 B;  3I56 P;  5HGM A;  1SQQ J;  4R0M A;  4N6J A;  2WSE J;  3H4E A;  3AEE C;  5KLV D;  1Z6M A;  3Q2Y A;  3CE7 A;  1M1J A;  1YJW P;  1LNQ A;  1PGO A;  1EC5 A;  1DNY A;  1L0I A;  5BVZ A;  1KFN A;  5H2F H;  4LC1 A;  1BGY G;  4H2X C;  3CC7 P;  2OYO A;  3RG6 C;  1BAJ A;  2LIU A;  1R8E A;  1IJD B;  2GM4 A;  1M8O B;  1FZE A;  4WBA A;  5E79 H;  1M57 D;  4WB4 A;  2FXM A;  3TNU B;  1NTK E;  5KAI E;  1LTJ A;  2K93 A;  3NY7 B;  1CSB A;  3HUS A;  2P58 A;  2PAJ A;  4U0B A;  2HOD B;  3AEC C;  2AEM A;  3CWB J;  2Y9Y A;  3EQ2 A;  1M1J C;  2E76 D;  3L73 J;  5KJ7 A;  1N73 B;  3HYB A;  1JMB A;  1ZV8 A;  2KUB A;  3GF7 A;  1U7M A;  1NU1 G;  1YHQ P;  3P8M C;  2WVR A;  2WPS A;  2M8P A;  1GD2 E;  3RL0 B;  1NJI Q;  3ABV C;  2JWD A;  2FVE A;  2KNC A;  2LL8 A;  1K30 A;  2LKI A;  1SFC C;  3NTN A;  3VP9 A;  1X0T A;  3RK3 E;  3CCE P;  2O01 J;  3L37 A;  5CBO A;  1LTJ C;  1CW5 A;  3HUS C;  1L0N J;  5HVC A;  2KG9 A;  2WTY A;  1E5W A;  1MZ8 A;  1S9K D;  1CI6 A;  1ZR2 A;  2QJP B;  1MUU A;  3E1I A;  1SQP E;  5CCG A;  2WZ7 A;  5L8R J;  4EIJ A;  1ZW0 A;  3CCS P;  1M6E X;  4GIF A;  3VP8 A;  1P84 E;  2WIT A;  2ZT9 D;  1SQB K;  4BWN A;  4PH1 A;  2HG5 D;  4WY4 C;  1YQ3 C;  1NKN A;  3PLN A;  3RBX A;  1Q82 Q;  3V4W A;  3H1L D;  2HR3 A;  3RG2 A;  4K35 A;  2BCC E;  3AE6 C;  2Q7C A;  4PWV B;  4DZO A;  2L9F A;  4OGQ C;  3G71 P;  4YXW H;  3H25 A;  1L0L G;  1LTT C;  1SQV J;  1ZN5 A;  3P8C D;  4HKZ H;  2KIK A;  3RK2 D;  3CC2 P;  1JCD A;  4XRQ A;  1OVR A;  1OMI A;  3TYY A;  3MGE A;  1OVU A;  2D2C D;  3GHG B;  5APT A;  2L91 A;  3G1I A;  5CCG C;  2A45 G;  2KGC A;  2LKM A;  3L74 J;  2XZ0 D;  2KS1 B;  1N86 A;  2ERH A;  5KLV J;  3PP5 A;  1KMI Z;  1E79 H;  2RH0 A;  2NPS B;  4M3L A;  5APW A;  3Q1M A;  2E5T A;  2QIW A;  2H89 C;  1RF0 A;  1BXI A;  2GZG A;  3I55 P;  4YPC A;  2M3B A;  2KSE A;  1Y9B A;  1Q90 D;  5B5E H;  1VQO P;  3IAO A;  1RO2 A;  2RMZ A;  1J1D B;  1EZV G;  1T2K C;  1VQM P;  1HGZ A;  3II6 A;  2Y0D A;  5AVQ B;  1FAV A;  2FVA A;  3CCJ P;  3FXE A;  3ZDM A;  2PEQ A;  1OX3 A;  1NTK K;  1QVF O;  3TF5 A;  2CQ8 A;  1SVF A;  4YTP C;  4BRY A;  2ZVN B;  2B9B A;  2GDW A;  2FYU E;  1VKU A;  2M8N A;  1LTB C;  3MGN A;  1SQB D;  2A45 I;  4JF7 A;  2E74 B;  3B71 A;  3H1H E;  4L75 A;  4H44 B;  2FKW B;  4EI2 A;  2LOL A;  1NTZ G;  2AEJ A;  2VRS A;  1RE3 C;  3Q3D A;  1LWU B;  2GUS A;  1AQ5 A;  2K88 A;  4NPF X;  3V5B A;  1VF5 B;  3MD0 A;  4GDO A;  5EW5 E;  1LP1 A;  1H88 A;  4DG9 A;  1L4A B;  3AEB C;  3HTK A;  4D6T G;  4I2L C;  2R5D A;  3M0D A;  3D71 A;  1EZV I;  3SWY A;  3I5C A;  3DTJ A;  2W6B A;  2FXP A;  3B5N C;  3BCC E;  3CL3 D;  4A7P A;  3CXH E;  1KB9 H;  3S4R A;  3L75 G;  3V2R A;  1RF1 A;  1RHZ B;  2PNG A;  3EJD A;  2Z44 A;  2N50 A;  1ZRT D;  3C1L A;  1SQP K;  3GF3 A;  3L72 E;  5GTH H;  1J2J B;  2HPC A;  2QM7 A;  5APS A;  1RE4 A;  1N7S D;  4RKU J;  3AE1 C;  2M5A A;  4JQ0 D;  4U3F G;  4EYY Q;  1OIP A;  1URQ D;  1T3J A;  4PD4 I;  1X79 B;  3H1L J;  3DS2 A;  3M0D C;  1BDC A;  5CMZ A;  1S5L X;  2N9Y B;  2N1T B;  1H0T A;  4GOD A;  2FYN B;  3HE4 A;  3O6Q B;  1RF1 C;  4PH0 A;  5GTI H;  3SSU A;  1JO5 A;  1YBK A;  2HFE D;  2K3R A;  2XZR A;  2AFD A;  1RE4 C;  1BE3 G;  4COC A;  2HYN A;  1S2E A;  1PEO A;  3L70 G;  1A8O A;  4IPY A;  1HGV A;  4HH2 A;  2X2B A;  4ASW A;  3GG2 A;  2K0D X;  5CZD B;  2K9J B;  1KLP A;  2KGD A;  3LMO A;  2IBZ G;  1KYO I;  5KLI C;  1MFT A;  1IC2 A;  1HUC A;  2IZ1 A;  2PEJ A;  1XTC C;  4KT0 J;  1SQX G;  1PP9 G;  1GL2 D;  2JWA A;  2GDY A;  4H0L D;  2CPB A;  1S9K E;  3H32 B;  2KOP A;  3E2D A;  1MZ9 A;  1SQP D;  1WMK A;  1NTM G;  2WPQ A;  3H6P A;  1OW6 A;  4U0E A;  3CWB G;  4ZMD A;  1PGP A;  3M0A A;  3SFD C;  1P84 D;  1LTA C;  2E75 D;  2H8P D;  2FYU K;  1SQB J;  3BAT A;  3M91 A;  2MR8 A;  4Y99 C;  5APV A;  1S5L H;  2J59 M;  3V6I A;  3H1I G;  2DW3 A;  2W27 A;  2QRX A;  2VLQ A;  4XFX A;  2L4B A;  3OJA B;  4IL6 E;  3L71 J;  2R5B A;  4JBZ A;  1EXI A;  3DPH A;  1ZR4 A;  1N2D C;  2IBZ I;  1DX7 A;  4PV1 B;  1PGQ A;  2IBZ D;  4QKO A;  1PV3 A;  1IZN B;  2JR8 A;  1FR2 A;  1L0N G;  4PJ0 H;  4C7N A;  2MJZ A;  5KP7 B;  1FZC C;  5AVV B;  2JYL A;  1PEM A;  3VRL C;  1S1C X;  2ZVO B;  3FGA D;  1MKM A;  4F37 A;  1LT1 A;  5CJ0 A;  5JPA A;  3QH9 A;  2WMM A;  5TIS H;  2YKQ A;  1FOS E;  2YNY A;  2MD9 A;  3H1I D;  3U1C A;  1U57 A;  2I1K A;  2QEX P;  3WBH A;  2YXQ B;  2GZF A;  5K5G B;  2O3J A;  2A06 G;  3MZW B;  1L0L E;  4W7Z A;  1DEE G;  5HGN A;  1NTK J;  2KG8 A;  5F2N A;  4AQR D;  2Z4E A;  1KIL C;  2K0X A;  2IYP A;  1RQV A;  2CPS A;  1SFC D;  1JNM A;  1M74 A;  1VPC A;  2FYU D;  4GT1 A;  2CWO A;  2Q6Q A;  2LR2 A;  2XZ1 C;  2Z45 A;  1W2B O;  1VDF A;  2V7Q J;  3A0H H;  2P67 A;  2WSE H;  2FY8 A;  4GOE A;  3VOP A;  1KQG B;  5KAF H;  3RK3 B;  4DT0 A;  2OYI C;  5B66 E;  2WSF J;  4QMA A;  1L2P A;  1J1E C;  1VHN A;  5AW4 B;  2PRR A;  1Z56 A;  2FAC A;  2XKM A;  2BEZ F;  2O1J A;  2BAS A;  1MFZ A;  3R4Y A;  3KZI E;  3M9B A;  5APY A;  2JJL A;  2RKL A;  1JEK A;  2KLV A;  2FFD B;  1PZQ A;  3VMY A;  1EZV E;  1A43 A;  1AVY A;  4WY4 D;  1UIX A;  3CXH D;  4BPH A;  2MKV A;  5BS1 A;  4OGQ D;  1SQP J;  3CX5 H;  3HD7 C;  3WUT A;  4KJM A;  1ZXG A;  1ZRT E;  3N7N A;  4XRO A;  3L72 D;  1MV8 A;  4JPZ B;  1JY3 P;  1JY3 O;  1KV4 A;  2DGY A;  4XA4 A;  4L73 A;  1NTZ E;  1NU1 K;  4C46 A;  3FWN A;  5CCG D;  2CNR A;  3USS A;  4H2W C;  5BU8 B;  4I6M C;  1SFC A;  2BCC J;  2XXM A;  4L74 A;  4PD4 E;  3CCU P;  2O01 H;  1K05 A;  1GXG A;  1SLQ A;  2LF4 A;  2EHT A;  1FJK A;  1X9V A;  4D6T E;  1VQ7 P;  1VQ4 P;  1OW8 A;  3Q5S A;  3TSI A;  2OGU A;  4U0A A;  1AVO A;  3S9O A;  1QVG O;  2AF8 A;  1U7J A;  1N73 C;  1T2K D;  1KZU B;  3L75 E;  2MVU A;  5APX A;  1GK6 A;  5HGO A;  3H0D A;  2KZJ A;  1HJB A;  4HJG H;  2AXT H;  3RL0 C;  1LJ2 A;  1RO0 A;  3D6Z A;  4WY4 A;  4IFD K;  4N78 D;  5DCK A;  1KYO E;  2FXO A;  4U3F E;  1BGY D;  3AE7 C;  2JYG A;  4H13 B;  2QM8 A;  1IO4 A;  2K0Y A;  1IFN A;  1AQT A;  2XV6 A;  1YTZ I;  1L0L K;  5F2O A;  5CBN A;  2W6A A;  3M9Q A;  2PEM A;  4OVN F;  5AW5 B;  2W8Z A;  2QJP C;  1JB0 J;  1HQB A;  1JY2 P;  1JY2 O;  2FYU J;  2QSI A;  3BAS A;  3WMM 0;  1FU1 A;  3H1H J;  7CEI A;  2M5R A;  3NXS A;  3VMZ A;  3GHG A;  2PEN A;  1PFI A;  2L0Q A;  2QJK B;  5AW8 B;  1NO4 A;  1NU1 D;  1A02 J;  1PPJ G;  3WU2 H;  2HLO A;  1H8A A;  2KGE A;  5KP6 B;  2KS1 A;  5AW9 B;  1BE3 E;  3IR9 A;  3B5N D;  3AE2 C;  2O1K A;  3L35 A;  1IFM A;  1HBW A;  1UII A;  3L70 E;  3PRJ A;  1AUM A;  2NPS A;  1NQ4 A;  3GJN A;  2P10 A;  1RY3 A;  3L4F A;  2IBZ E;  2CGQ A;  3JCU E;  1OZH A;  3C9I A;  1SQX E;  3V2P A;  4DJG A;  1YTZ T;  1CEI A;  3HZQ A;  1CI6 B;  3BCC J;  4DCK A;  1HF9 A;  1EOQ A;  1ZNV A;  3GHG C;  2OYH B;  1H89 A;  1KB9 I;  4I1L A;  1KC8 Q;  1KB9 D;  2Q3E A;  5CCH A;  3QWO C;  1PEU A;  1NTM E;  1FDI A;  2IFN A;  2R32 A;  3E7K A;  3L72 J;  3KDP B;  4M0I A;  1RE3 A;  2N6Z A;  2P9X A;  2NPS C;  2UWJ E;  4KHX A;  5DJT B;  2H43 A;  4AUW A;  2LIW A;  2YKO A;  1NTZ K;  3H1I E;  2E1M A;  4IFF A;  1LWU A;  3Q20 A;  1L0L D;  5H2F E;  2E43 A;  3K5B A;  4U0F A;  2I8D A;  1J1D C;  2EIA A;  1OVV A;  3EFG A;  1AJY A;  2M8R A;  3NMD A;  2KWL A;  5E79 E;  4EOT A;  2KOQ A;  2ZXX A;  2YKP A;  1T3U A;  2W83 C;  1PGJ A;  4XE5 B;  3GKL C;  3B5N A;  1LT9 B;  1IMQ A;  2GUV A;  5CCH C;  2WSS H;  2IPP A;  2IDB A;  1AF8 A;  1VQN P;  1PIX A;  2V4H A;  2E74 C;  2K92 A;  5APQ A;  1FJP A;  1EXJ A;  4H44 C;  1NHL A;  1XTG B;  3AEA C;  1LWU C;  2YMY A;  2QA4 P;  3H1J G;  4WVZ A;  3RGU A;  1Q2N A;  2DNW A;  1EIA A;  1DH3 A;  1TU3 F;  1VF5 C;  4HYT B;  4EDF A;  1IK9 A;  3A0B H;  2Y9Z A;  1BGY J;  1L4A C;  1EZV D;  3CPW O;  1E0H A;  2JQ4 A;  2A06 E;  2IX7 C;  1EDI A;  3KHU A;  2ZT9 B;  1YI2 P;  3T97 B;  5AVX B;  2Z46 A;  3SFE C;  2N1T A;  1KD1 Q;  3GLM A;  4BRY B;  2K94 A;  5AVR B;  3O6Q A;  1OW7 A;  2SPZ A;  2RN0 A;  3O8Z A;  4CPG A;  1JY3 N;  1GW4 A;  2JO1 A;  1QEX A;  3RK2 B;  4WYM A;  1NU1 J;  1GU5 A;  4RO0 A;  1NTZ D;  2JB0 A;  2XND H;  3TGU G;  4HB1 A;  1DD3 A;  3MIW A;  2D2C B;  4PD4 D;  2XDJ A;  3D6Y A;  3H1K G;  2ITA A;  3H1J D;  1ZMB A;  4NEO A;  3OW2 O;  3PJS K;  1F80 D;  2YIU B;  4D6T D;  1AA0 A;  1RH5 B;  3CXC O;  3G3Z A;  1BCC G;  2QVA A;  3CI9 A;  4N3Y B;  2N1T C;  4OH8 B;  5BS2 A;  1SQX K;  3C8V A;  2EHS A;  2FYN C;  4GKG A;  1PEQ A;  1SQQ G;  3D70 A;  3H32 A;  3L75 D;  1NAY A;  2KW2 A;  4W80 A;  1NTM K;  3W68 A;  2VLP A;  2ZYG A;  1IFP A;  2HPC B;  1KIL D;  1HWT C;  1OR5 A;  3M1M A;  2L22 A;  4N78 E;  2WT7 A;  2OQQ A;  1KYO D;  4U3F D;  3TGU D;  1BGY E;  2B88 A;  1S4X A;  2O01 N;  1JMM A;  5B5E E;  2KR5 A;  1L0L J;  3GZM A;  5AVS B;  1HY8 A;  3TK1 A;  2R3S A;  1H0T B;  3CCM P;  1BCC D;  3V2Q A;  3HE4 B;  1JY2 N;  1USE A;  1D7M A;  1FZC A;  5KKZ B;  3L73 G;  1L0N K;  4C7R A;  1NGM B;  3G28 A;  1NU1 E;  1FZF A;  1BE3 D;  2L5G B;  2CG5 B;  2JO0 A;  3L70 D;  1OWA A;  2KB7 P;  3CCV P;  4UB8 H;  1JTH A;  3AE4 C;  3HD7 D;  1QLE D;  2C9L Y;  1NH4 A;  2VSQ A;  4BPF A;  1SQX D;  3KYQ A;  4PV1 C;  4XFZ A;  1PP9 D;  2YMK A;  5KAI H;  1VL2 A;  1YIT P;  1L0H A;  2MF4 A;  4MN4 C;  2J58 A;  1KIL A;  4GOF A;  2OTL P;  3ITK A;  1N7S B;  2CK3 H;  1M56 D;  2Z5I A;  2KSJ A;  1X3O A;  1M90 Q;  2V7Q H;  1NTM D;  3RBZ A;  3G1G A;  1URQ B;  1KB9 E;  3CWB D;  3CX5 I;  3A3Y B;  3CX5 D;  4XFY A;  2JGP A;  2WSC J;  2FBW C;  2OYI A;  2OTJ P;  1ZLL A;  5GTH E;  1PPJ E;  1NTZ J;  4I7Z B;  3LW5 J;  1VQP P;  1N8R Q;  2Q3I A;  1FDM A;  1SQV G;  1GPJ A;  1BSH A;  2KOS A;  3LIE A;  3WUU A;  3RL0 D;  1GW3 A;  3Q5P A;  4D6T J;  5BU5 A;  2B87 B;  4L76 A;  2FFD A;  3DS5 A;  5AW2 B;  1L0N D;  1M7L A;  2KLU A;  2KK7 A;  1NAF A;  3L74 G;  1T8K A;  3IF4 A;  1ZME C;  3HD7 A;  5GTI E;  2FQ0 A;  1A02 F;  3L75 J;  1YYC A;  1FC2 C;  3HE5 B;  5KLV G;  3RK3 C;  2QJY B;  2YO2 A;  1GL2 B;  3HRN A;  3PHL A;  4H0L B;  1VQ6 P;  3CLQ A;  3RL0 g;  3KPE A;  4MRT C;  3JSV C;  3LID A;  3A2A A;  1W2E A;  4U3F J;  1HJ0 A;  2PEI A;  4NPD A;  2PGD A;  2A06 D;  3P32 A;  4YXD C;  4LGD E;  1GZL A;  2LXC B;  2E75 B;  2FFD C;  2K1A A;  1VQL P;  4U0D A;  4ZKP A;  2VLO A;  1T6A A;  3TNU A;  1OXZ A;  3G0V A;  3N4X A;  2HOD A;  3DS1 A;  1GK4 A;  2L6E A;  3JC2 2;  1N73 A;  4ZNC A;  2GZE A;  2XV5 A;  1LTS C;  3WUV A;  2C0W A;  1IMP A;  2B89 A;  4UB6 H;  1BE3 J;  5AW0 B;  1W5C E;  5C39 A;  1NKZ B;  3GMA A;  5CJ4 A;  1S5L E;  3L70 J;  4JYC A;  5KP8 B;  1IFD A;  3H1J E;  3B4Q A;  1FZG A;  3VN0 A;  3NFQ A;  4UB8 E;  3CCL P;  1G2C B;  3U1A A;  1Q81 Q;  2P1J A;  1SQX J;  1PP9 J;  3FXD A;  1FS0 E;  2NPS D;  3VMA A;  1IFJ A;  1BSN A;  2GDX A;  4PJ0 E;  2PEO A;  4Y28 J;  5AW3 B;  1LTI C;  2AXC A;  3AE8 C;  4UHP B;  2IFM A;  1NTM J;  1M1J B;  2GA1 A;  2XNX A;  5AVW B;  1KFM A;  1EDJ A;  2ZFC A;  5HGL A;  1KIL E;  1QGK B;  2H88 C;  2E42 A;  2YO3 A;  1DIP A;  2KZI A;  5TIS E;  5CCH D;  4JYB A;  1GDT A;  1Y8A A;  3H1L G;  1SFC B;  3H1I J;  3W67 A;  2NZ2 A;  1USD A;  3TGU E;  3G6E P;  1ZOY C;  1DD4 A;  2E74 D;  5AVT B;  4H44 D;  3U59 A;  3UIA A;  1UNK A;  3H1K E;  1EMV A;  4H13 C;  1LTJ B;  5AVZ B;  2Q5U A;  3P7K A;  1ZP0 C;  3HUS B;  2G8Y A;  4W7Y A;  1BCC E;  2JDI H;  3V4Q A;  1T8Z A;  3CXH H;  2AEF A;  2AFE A;  1QL2 A;  2MR7 A;  1D1D A;  4ASV A;  1VF5 D;  1BDD A;  5F2K A;  2LML A;  1L4A D;  3DS4 A;  5KJ7 C;  1SQQ E;  3M9H A;  3A0H E;  2OYH A;  5AVU B;  2QJK C;  5KAF E;  2KNC B;  2N6Y A;  1VQ5 P;  2FHS C;  5EFW B;  2Y0E A;  3AE5 C;  4WY4 B;  1KTM A;  2QE7 H;  1GU4 A;  2FQ1 A;  3SWF A;  1WT6 A;  4OGQ B;  1X8Y A;  2Y0C A;  3B8E B;  1KQS O;  4BPG A;  1KN7 A;  3PTZ A;  1PP9 E;  2PP6 A;  4IZ6 A;  2M8L A;  4U0C A;  4GR2 A;  2JEE A;  4IL6 X;  2JU1 A;  5HV8 A;  2KOR A;  3FWL A;  2KOD A;  2OYH C;  3CWB E;  2H7H A;  1LT9 A;  1N7L A;  3CX5 E;  1AYI A;  3CME P;  1SQB G;  3KXD A;  3BRV B;  3L73 E;  3A7O A;  1FOS F;  1PPJ D;  2N1T D;  4OWF A;  3TDK A;  1S72 P;  5AW7 B;  3DS0 A;  1JCC A;  2AVA A;  4UB6 E;  2OAR A;  1Q7Y Q;  2NRG A;  3L71 G;  2FVF A;  2E76 B;  4TT3 H;  1VQ9 P;  1L4A A;  2ZYA A;  2E76 C;  3EWK A;  5KTB A;  3G9R A;  1L0N E;  3EJB A;  4O9B A;  2PY8 A;  2IZ0 A;  1UJZ A;  2KI7 B;  1K8A Q;  1SS1 A;  2KG6 A;  1KQL A;  1LT9 C;  3T97 A;  2R3C A;  2WPT A;  3BVH A;  5TJH A;  2LXB A;  1M6N A;  4IFM A;  5EJD A;  1E6J P;  2KOO A;  1HVV A;  1FDO A;  1YIJ P;  2BHV A;  1CZQ A;  2AXT E;  3DS3 A;  2Q9I A;  1IK7 A;  1RF0 C;  4XFJ A;  2LTE A;  4IL6 H;  2M0B A;  2JAZ A;  1SQV E;  3L71 D;  3EJE A;  1NTK G;  5AW6 B;  5I4T G;  3VYI A;  1KOR A;  2ZT9 C;  2WQY C;  3B5N B;  3Q5R A;  3S1K A;  1GXH A;  1NYH A;  3CC4 P;  3BRT B;  4K3A A;  3L74 E;  4PV1 D;  1ACP A;  4R4M A;  3U43 A;  1SQQ K;  3GZL A;  3RK2 C;  1X22 A;  5KLV E;  4RJT A;  1FBM A;  3WU2 E;  2ZJS E;  1YJN P;  2N5H A;  2KOG A;  2K9J A;  2D2C C;  1DEB A;  1LP1 B;  2FAD A; 
#chains in the Genus database with same CATH homology
 3G26 A;  1M90 Q;  3G1I A;  2XXM A;  3G1G A;  3HYB A;  3G0V A;  1K9M Q;  1YHQ P;  1YJ9 P;  3DS1 A;  1AUM A;  5HGN A;  3CCU P;  2M8P A;  4XFY A;  5F2N A;  2QA4 P;  1NJI Q;  3E2D A;  3H47 A;  2L6E A;  2LF4 A;  1D1D A;  1EIA A;  2PY8 A;  4GR6 A;  2Z44 A;  2OTJ P;  3M1M A;  4U0E A;  2XT1 A;  1K8A Q;  1VQ7 P;  1K30 A;  3LRY A;  1M74 A;  5F2K A;  4COP A;  3CMA P;  1VQ4 P;  2EG5 A;  2BQ1 E;  2CWO A;  3DS4 A;  4U0A A;  2Z45 A;  1W2B O;  1M1K Q;  1K73 Q;  1VQP P;  3B5I A;  3CPW O;  1QVG O;  1N8R Q;  3G21 A;  3P05 A;  1VQ5 P;  3I55 P;  3CCE P;  3HZQ A;  3G29 A;  2ONT A;  1EOQ A;  3G4S P;  3CCR P;  1Q86 Q;  1VQO P;  1QRJ A;  1YI2 P;  1M6N A;  1E6J P;  2Z46 A;  1RO2 A;  2BUO A;  3DS2 A;  1KC8 Q;  3CCM P;  1KD1 Q;  1YIJ P;  1VQ8 P;  1VQM P;  5HGO A;  2BHV A;  1PEU A;  3H0D A;  3CCL P;  3DS3 A;  1Q81 Q;  4XFX A;  1RNI A;  3I56 P;  3NTE A;  3DS5 A;  5HGM A;  3CCJ P;  1KQS O;  3DPH A;  2PEQ A;  1RO0 A;  4M0I A;  3H4E A;  1QVF O;  1YJW P;  2P9X A;  4QNB A;  3G28 A;  5DCK A;  4WYM A;  3CCS P;  2PEO A;  2M8L A;  1M6E X;  4GR2 A;  4U0C A;  2M8N A;  5I4T G;  4PH0 A;  2E1M A;  2JYG A;  1VQK P;  1A43 A;  2JO0 A;  3Q20 A;  3WBH A;  2JYL A;  2KOD A;  4PH1 A;  2XV6 A;  3VRL C;  1PEM A;  3CCV P;  4U0F A;  5F2O A;  2EIA A;  1VQ6 P;  5BS1 A;  1ZMB A;  3CC7 P;  1Q82 Q;  3OW2 O;  4COC A;  3CME P;  5HGL A;  3RG6 C;  1BAJ A;  2PEM A;  3CC4 P;  1JJ2 O;  1PEO A;  3G71 P;  1A8O A;  5JPA A;  4IPY A;  3CXC O;  2EFJ A;  4XRO A;  3CCQ P;  4XFZ A;  1S72 P;  1IUQ A;  2PEI A;  3DS0 A;  3CC2 P;  5BS2 A;  4XRQ A;  2PEN A;  3G6E P;  1YIT P;  2DGY A;  1VQN P;  4U0B A;  2OAR A;  3MGE A;  1VQL P;  1PEQ A;  1Q7Y Q;  4U0D A;  1YJN P;  2OTL P;  2PEJ A;  3CD6 P;  1VQ9 P;  2QEX P;  3DTJ A;  2PEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...