3I56P

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3i56P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3i56P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3i56P02
1QVFO 3CCLP 1K8AQ 1QVGO 2OTLP 1VQ4P 3CPWO 1KQSO 3CXCO 1VQLP 1Q81Q 2QEXP 1M90Q 3G71P 1YI2P 3CC7P 3G4SP 1YJNP 3CCVP 1NJIQ 2OTJP 1M1KQ 3I55P 1YJWP 1W2BO 3CCJP 1YHQP 1VQ8P 3CC2P 3G6EP 1VQMP 1S72P 1VQ9P 1VQPP 3CCQP 3CCSP 1N8RQ 3CCMP 3I56P 3CCRP 3CD6P 3CCUP 1YIJP 1VQ5P 1VQOP 1Q7YQ 3CCEP 1VQNP 1VQKP 1Q82Q 1Q86Q 3CMEP 1VQ6P 1KD1Q 1YJ9P 3CC4P 1K9MQ 2QA4P 1KC8Q 1VQ7P 1JJ2O 3CMAP 1YITP 3OW2O 1K73Q
chains in the Genus database with same CATH superfamily
2FHSC 3B5IA 1RQUA 1KILA 4D6TG 1BDCA 4YPCA 2BCCD 2I8DA 5APYA 1A02F 2KNCA 2WVRA 2KG8A 2JKVA 1NHLA 1N7LA 1SQXK 4DCKA 1ZMBA 3WMM0 1VF5B 1BE3D 2BHVA 1QLED 4IFDK 3HD7A 1K05A 2DW3A 1L0NE 2XXMA 2HPCA 3V6IA 1L4AD 2RN0A 1SQVE 1G1JA 1VDFA 1VF5C 3NY7B 1L0LE 2PNGA 2L91A 2BEZF 4C46A 1VF5D 4XE5B 1PZQA 1JO5A 3V2QA 1KC8Q 1FDOA 1M74A 1YTZT 2BEQD 3L37A 3CXCO 3G71P 3L75E 2WSCJ 4XFXA 1L0NJ 4BWNA 1J2JB 2QNWA 1SQVJ 3L73E 4PD4E 2JO0A 1L0LJ 3I56P 2ZXEB 2XZ0D 1HGZA 3V2RA 2MJZA 1DX7A 1NWQA 5EW5E 3L71G 4H2YC 3L75J 2R32A 2OYHB 1HTLC 4I6MC 1EDKA 2W8ZA 3L73J 4COPA 1FOSF 1VQ9P 3ABVC 4I2LC 2KOOA 4LLHA 5APQA 2LMLA 4NPFX 4EDFA 1H0TB 2GA1A 4BPFA 4M3LA 2P1JA 2OYHC 1SQBE 2WMMA 3M91A 5E79E 2M5AA 3RK2B 2LPKA 1JMMA 4TLFA 3CXHH 1YQ4C 3H0DA 1GW4A 2K88A 5KJ7A 4N6JA 2Z46A 4C7NB 2KSEA 2N9BA 3GW6A 3L70D 2YO2A 2PEIA 1PGQA 1VQLP 1MKMA 1NTZE 2KYVA 3A0BH 4H0LB 5TISE 3B5NA 3L72E 3DS4A 2RMZA 4WB4A 5EFWB 5KKZB 3NMDA 2OQQA 5GTIH 4H0LC 1ZRTE 3VMZA 1FAVA 1NTZJ 2KOGA 3JC22 1EXIA 2FYUG 1AF8A 5KKZC 3TNUB 4JF7A 1SQBG 4UB6H 2PEKA 4L73A 3KXDA 4WY4B 2A45G 1CI6A 5AW2B 3E1RA 4AQRD 1ZOYC 1USDA 2M3EA 1VL2A 4LGDE 1NOHA 2GUVA 3PP5A 1SQXE 2WPQA 2K93A 5AW0B 4WY4C 2AFDA 4XRQA 3IR9A 1JEKA 2Q5UA 3KZIH 3L72G 2O3JA 1K30A 2C9LY 3V2NA 4YXWH 4ZNCA 2WSFH 3KDPB 3CI9A 3H32A 3P7KA 5B5EH 1KQSO 1JTHA 1SQQG 4WYMA 1SQXJ 1A02J 2FVEA 3I55P 2ZYDA 4PH0A 2YKPA 5EJDA 1L0HA 1LJ2A 4BRYA 3G3ZA 1OW8A 4DZOA 1PGOA 4GOEA 4HJGH 1P84H 2ZXXA 1FZGA 3WBHA 2L5GB 1JTHB 4COCA 3QWOC 3H1JD 1LTIC 3BCCE 3T97A 3S9OA 2J58A 2NPSC 5CZDB 3BASA 2NPSD 1ZN5A 2PRRA 2QA4P 1Y8AA 1LTJC 2YKOA 2Z5HA 4R0MA 2OTLP 1VQ4P 2HODA 4GKGA 2PENA 4XROA 1NTMD 1A43A 3BCCJ 1OX3A 3G21A 3HTKB 1EZVI 1GU4A 3VRLC 3VYIA 3CX5H 2BCCE 3II6A 5C39A 3DS5A 3H25A 3WU2E 1YYCA 4OGQB 3GF7A 4EIJA 3EQ2A 1N86A 1NKZB 1ZR2A 2O1KA 1BE3E 2M5RA 1AQ5A 3EJDA 5JPAA 1YJWP 2H8PD 1CEIA 3D6ZA 4OGQC 2LOLA 1CZQA 2BCCJ 2LR2A 3IFMA 4OGQD 1BGYD 3PRJA 1YJ9P 2R3SA 3EFFK 2KOQA 1PP9D 1MZ8A 1NVOA 3VTPC 2N5HA 2WT7A 2WWWA 3AEFC 1M8OB 2AFEA 3LW5H 4HB1A 2XZ1C 2K0XA 2XZRA 5APVA 2JR8A 1Q7YQ 1KD1Q 1UJZA 4AUWA 3D71A 2LTEA 4ASWA 3OAKA 1EC5A 2FXOA 4C7RA 1F80D 2WPVB 2IX7C 3G4SP 4U0AA 2Z5IA 1LTSC 4JYBA 1OZHA 4PJ0H 1DV5A 2QSIA 1BE3G 4JPZB 2JU1A 2FQ0A 1FJKA 1BDDA 1DEEG 3L74G 1LNQA 2GM4A 2PAJA 3C9IA 5AVYB 1PEQA 1NTMK 3M9QA 2M8RA 4PV1B 2K1AA 2QJPB 1PEUA 2C0WA 2OYIA 4Y28J 3RBXA 2JGPA 1T8ZA 2IBZG 5CBNA 1GK6A 1NTKD 4PV1C 1HUCA 1T8KA 1IFJA 3P8CD 2QJPC 3L70E 4ZKUA 3DS0A 1YHQP 2VSQA 2Y9ZA 2LXBA 3SSUA 4U3FD 2H89C 1R5LA 2R3CA 1NU1J 1IMQA 1G2CA 1JOCA 1GMJA 1YITP 1RE4A 5F2NA 2IFNA 2FFDB 2L22A 3L70J 3MZWB 2Z4EA 3VMXA 2MR8A 2OTJP 3RGUA 1EZVD 1AJYA 2KUBA 1IUQA 1AVOA 1QGKB 3O6QA 2H43A 2WPRA 3PLNA 3VMAA 2KK7A 3I5CA 4R4LA 1SQPG 2CPSA 2H7HA 3DS3A 1DNYA 2KSJA 1RF1A 2KGDA 1N2DC 2E74D 3GHGB 4L74A 4F37A 1PIXA 3TK1A 5AVZB 2BQ1E 1URQB 1JB0J 2N6ZA 4CPGA 1Q82Q 2D2CB 1GD2E 1IC2A 1LTAC 3KYQA 1LTGC 1VHNA 1OIPA 1URQC 3HE5B 3VP8A 1SFCB 2OTKE 1N73A 2YXQB 1URQD 3TGUG 1AV1A 1NTKK 2K0YA 3GLMA 2O1JA 1SFCC 2JBGA 5BS2A 1LT1A 2QE7H 2Z44A 1SFCD 1ZMEC 3H1JE 3JCUH 3H1KJ 2K3RA 3BVHA 1IJDB 3HZQA 1JY2O 5HGMA 4RKUJ 1Y47A 1M1JA 2N9YB 1J1EB 4GODA 5HGNA 2YO3A 3H1JJ 1VQPP 1N8RQ 1NTME 3MGEA 5L8RJ 3Q1MA 3A2AA 2WPSA 1J1EC 3L36A 1OWAA 4GR6A 3VN0A 2KWLA 4IZ6A 1UNKA 3GMAA 3M0AA 1RF0A 2W83C 3AEGC 4GOFA 4MN4C 1K04A 2PY8A 2HR3A 3L35A 2KGEA 1NTMJ 1L4AB 1BCCG 3CMEP 5KAIE 3SFEC 4IL6X 2NO8A 3HE4B 2EHSA 1XTCC 1BGYE 2LL8A 1L4AC 1N7SC 5CJ0A 5CJ4A 3HUSC 1H8AA 1KYOH 1PP9E 2AXCA 2FAEA 2OARA 1S72P 3A7OA 1PPJD 1N7SD 3NTEA 4UHPB 2WSEJ 4U0EA 1E0HA 2H88C 1AYIA 1Q86Q 3UIAA 1KTMA 1K73Q 1PGPA 2AXTH 2QJYC 1EIAA 1BGYJ 3V4WA 1EOQA 3KPEA 5AVVB 1PP9J 2KW2A 3PHLA 2OYHA 1HQBA 1OVUA 3LIDA 1ZP0C 2P2UA 5I4TG 2ZFCA 1PFIA 1LT9B 1H0TA 4YXDC 1Q81Q 2R44A 3AEDC 3AE6C 2FBWC 2PEQA 1BGYG 1TU3F 1J1DB 3F89A 1LT9C 3H6PA 1L0NG 5E79H 2ZAEB 3HD7D 2B89A 1SS1A 2CNRA 3B4QA 2A45H 1SQVG 4C7NA 2CGQA 1L0LG 3RG6C 3BRVB 5KTBA 3CC7P 1J1DC 1Y9BA 1NTKE 1RH5B 1H89A 3P8CE 1NU1D 3CD6P 4GT1A 4U7JA 3L75G 5TISH 1RO0A 1AVYA 1DEBA 3L73G 2FKWB 4U3FE 3CCLP 2JEEA 2QEXP 2CPBA 1NTKJ 1KQFB 2YXRB 3SWFA 2FVAA 4N78D 3TNUA 1EDIA 1EMVA 5GTHH 2C0XA 5CHXA 1Z6MA 1EZVE 1QRJA 1IFMA 3LRYA 4HH2A 4WY4A 4U3FJ 3CXHE 2P67A 3R4YA 5APUA 1YJNP 1VKUA 2Q1KA 3OA7A 1WRGA 5AVTB 2GZGA 3TDKA 1VQMP 2JYGA 3A0BE 2B9BA 5B66E 3FXDA 3GG2A 2E5TA 4ZMDA 3B8EB 2ERHA 1K8AQ 2FY8A 5KJ7C 1D7MA 3G9RA 4U3FG 1RO2A 1KYOI 3GZLA 5KJ7D 1YBKA 3NTNA 1NTZG 5AVWB 4M0IA 2N6YA 2R5BA 5KP6B 1GZLA 1OW7A 1X9VA 2NPSA 3B5ND 1EZVG 5KAFH 3G26A 3O8ZA 3H1KD 2JO1A 2OGUA 1NU1K 2KXPB 2PGDA 4GR2A 3CCUP 2KIKA 3MGNA 1IFIA 2JB0A 1JCDA 2FVFA 3H1LD 2G8YA 2NPSB 3FGAD 2N1TC 1MFZA 2Y0CA 3KZIE 2BASA 5F2KA 1U7MA 1JM0A 5AW5B 2ZT9D 2N1TD 1S5LX 1LTJB 1NJIQ 3HRNA 3P8MC 2ITAA 2YKQA 3M0DA 4D6TD 3HTKA 5B5EE 1IFPA 3CCMP 2HLOA 3HYBA 1SQXG 3U1AA 3RL0D 2ZJSE 2A45I 2LIWA 1FDIA 3RK3B 2WSFJ 1PV3A 3K5BA 1HVVA 2K37A 3Q2YA 2EFJA 3CC2P 1FBMA 3AE1C 4W7YA 3CXHI 4BPGA 1IO4A 5BU5A 3RK3C 2K94A 1JJ2O 3JSVC 1HH0A 3RK3D 1YI2P 5H2FE 2G3AA 3S1KA 4K3AA 2GDYA 2CQ8A 2ONTA 3TYYA 3G1GA 3G6EP 5F2OA 2W90A 1R8EA 3G28A 2KOPA 2XKMA 3BCCG 4UB8H 1PPJE 2MVVA 2JYLA 2PFXA 1HJ0A 2CWOA 1KZUB 3DPHA 1LWUB 2VRSA 2QJKC 1OR5A 4OWFA 3E2DA 2XV6A 3OJAB 2DGYA 1G1IA 1KORA 3L71D 2O01H 2VLOA 5K5GB 4PWVB 4IL6E 1NKNA 4I7ZC 1LWUC 2FYNC 5AVRB 3V5BA 1MUUA 1KFMA 3A0HE 2BCCG 1FZEA 2POHA 3C8VA 5HVCA 2V7QH 3S4RA 2HG5D 1NO4A 3DTJA 2JU2A 2KG9A 1BSNA 1KYOD 1A8OA 1L0IA 3VP9A 3SWYA 3H1IJ 3CC4P 4XFYA 2B87B 3D70A 2WZ7A 2A06D 4RESB 1M56D 1M90Q 1RNIA 4GDOA 2MKVA 1W2BO 1GW3A 1ZNVA 2MF4A 1OW6A 1ZW0A 1EDLA 1P84I 1NU1E 1S2EA 4U0FA 3H1HJ 1FU1A 3LW5J 1T3JA 1YTZI 3PH0A 3QH9A 3FXEA 2FFDA 2QIWA 2FYUD 3ITKA 1FZCB 2VLPA 4QKOA 3CCQP 4IPYA 5BVZA 1SVFA 2CK3H 1CSBA 5KLVJ 5DJUB 3EFGA 4N78E 1VQ7P 1KQLA 3MHVA 3AE5C 4H44B 4PH1A 2QVAA 2WTYA 2K2QA 5CCHC 1FZCC 3N7NA 2E74B 4TT3H 5AW9B 4IFMA 5CCHD 4H13B 4W80A 3GHGA 3IF4A 1JY3N 3W67A 4H44C 3CXHD 3CX5I 1AA0A 2E76D 1URQA 1RE3A 2Q3IA 4H44D 4L75A 2E74C 3NFQA 1KB9H 1GPJA 4H13C 4R4MA 1BAJA 2GZJA 1NU1G 1ZR4A 4PXHB 4H13D 1S4XA 2LKIA 1SQQD 2W27A 3AEEC 3HE5A 5APXA 1M57D 1SFCA 5APWA 3L70G 1DD3A 2WITA 2FXPA 2KS1B 2I1KA 1E6JP 1XTGB 2XDJA 3IAOA 1X22A 2IBZI 2KI7B 4WWIA 1JMBA 3CWBJ 1FZBA 1X0TA 4NPEA 2R5DA 3CCJP 3TSIA 2JWAA 3H1KE 3BRTB 5AW7B 2JWDA 1LP1B 1SLQA 4DT0A 1LTBC 3WUUA 2MD9A 3CMAP 3MP7B 4QNBA 2L4BA 1MFTA 3VMYA 5CMZA 3Q5SA 3H1LE 1LGHB 3IN6A 1Z56A 2FYUK 1QEXA 1RF1C 2NZ2A 1X3OA 3E1IA 1DH3A 2NRGA 2B88A 4D6TE 2KR5A 3D6YA 2PEJA 3B71A 3P32A 3B4SA 4DJGA 3H1LJ 3R2PA 3M9HA 3RBZA 3FWLA 2E75D 2BUOA 1PEOA 2QRXA 2Q3EA 2XU6A 3SFDC 4DOJA 4D6TJ 2N5IA 1L4AA 3M06A 1S5LE 4Z1MH 2GUSA 3JCUE 1P84D 3H1KG 5CCGC 2K5XA 4U0BA 2IYOA 4U0CA 3HE4A 2WSEH 2L6EA 1KLPA 1S3JA 1SQQK 5CCGD 3RK3E 2ZVOB 1N7SB 3AE7C 1GL2B 3HUSB 5AW6B 2W6JH 2M3BA 3H1JG 3CL3D 3F5HA 3PJSK 3GF3A 2WSCH 2GZFA 2YMKA 4MRTC 3MUDC 3CPWO 1OXZA 1AUMA 2FQ2A 1QL1A 1M1JC 1GL2C 2K9JB 2QJYB 1WT6A 2KZIA 4Y99C 1IK9A 1GL2D 1H88A 4IOIH 1OMIA 3CX5D 3L71E 4NEOA 1EQ7A 2Z45A 4EYYQ 3OW2O 1NTMG 4O9BA 5AW3B 3EJBA 1KB9I 1KILB 1PL5A 4YTPC 1BSHA 4PD4H 2QM8A 1LT9A 3MD0A 3L74D 2MY5A 2AEMA 1M1KQ 1FDMA 5HGLA 2KNCB 1AFOA 4XA4A 4NPDA 3H1ID 5DCKA 5KP7B 2HFED 1RF0C 4LC1A 1KILC 3L71J 1KYOE 1JNMA 1W2EA 3HD7B 1KILD 1QVGO 2P10A 3E7KA 4EI2A 2IBZD 3M9BA 1BXIA 2HPCB 1OFCX 2A06E 4JBZA 2AXTE 3CCSP 2AEJA 1UIXA 2Y0EA 4XFJA 3Q5RA 3WUTA 3H4EA 3HD7C 1NGMB 3USSA 5BU8B 3H1HD 2FYZA 1JY2N 1GDTA 1PP9G 3MTUE 4QMAA 2K9YA 2E5YA 1S9KD 4JYCA 3V2PA 1E79H 2KG6A 5KLVD 1DIPA 2J59M 1JUNA 3Q3DA 1GXHA 2MR7A 2FYUE 2P58A 1GTWA 2Q6QA 2ZYGA 1KV4A 5BS1A 1SQPD 4WBAA 2K0DX 1ZLLA 1FS0E 1FC2C 1JY3P 2KB7P 1FJPA 3RG2A 2GDXA 3LIEA 4IFFA 2A06G 5AVUB 2MVUA 2FYUJ 5KLIB 1NAYA 3RK2C 3WUVA 1WMKA 2AVAA 1SQBJ 2M5AB 5B66H 3RK2D 2PEOA 4HYTB 5AVXB 1NYHA 4H2WC 5KLIC 1MZ9A 2HYNA 5HGOA 1NTKG 1SQQE 2IFMA 3GJNA 4ZKPA 2FQ1A 1M6EX 3TGUD 3EWKA 5GTHE 3CWBD 4U0DA 1FZAA 4H0LD 3B5NB 2KLVA 2Y9YA 1HF9A 3L72J 3L4FA 5GTIE 3C1LA 2N1TA 1ZXGA 2VLQA 2IYPA 3CCRP 2OYOA 4K35A 1SQQJ 4KHXA 3B5NC 2KZJA 4UB6E 2WPTA 1NH4A 2XT1A 3V4QA 4PD4I 1KB9D 5CBOA 2KP8A 4BXLA 1E5WA 4OH8B 3P05A 2ZT9B 3G29A 2N1TB 5KLVK 3BATA 1LTJA 1CI6B 4WY4D 4CA3A 2DNWA 2KGAA 3H47A 2KODA 1EXJA 1OVVA 3RL0B 4EOTA 1SQPK 2ZT9C 5APSA 2Q9IA 1RHZB 4RJTA 1M6NA 2JAZA 2YMYA 3FWNA 1KFNA 3VOPA 1DD4A 1D1DA 5KAFE 3RL0C 3AE2C 4KT0J 1HBWA 3CCEP 3H32B 1BCCD 1S1CX 4H2XC 3AE8C 2VLNA 4A7PA 2P7JA 1P84E 3WU2H 2M8PA 4BRYB 3TF5A 1X8YA 1LTTC 3MIWA 2FADA 1VPCA 2IZ1A 5H2FH 1VQ6P 2IPPA 1NAFA 1K9MQ 2LF4A 2GZIA 2FXMA 3T97B 1FOSE 1LWUA 4OVNF 3N4XA 2LXCB 2QJKB 1AQTA 4BPHA 1VQNP 1YQ3C 5AW1B 3AE4C 3M0DC 2HODB 1U7JA 5M1BA 1KN7A 4I7ZB 3CX5E 3A5TA 1RQVA 4IL6H 2FYNB 1IFNA 1KMIZ 1GU5A 3DS2A 3U43A 4WVZA 3L74E 1JY3O 5AVSB 3A0HH 2C9NY 2X2BA 1UIIA 4W7ZA 1NQ4A 1EDJA 2W6BA 1FR2A 2JJLA 3H1IE 1QVFO 1OVRA 1L0ND 2B87A 1KQGB 1BE3J 1SQVD 4UB8E 2K92A 1ZV8A 1L0LD 1RY3A 1KILE 2ROQA 2E43A 2IBZE 3L74J 1IFDA 1ACPA 3KQGA 2E1MA 1JY2P 1Q90D 4KJMA 1VQKP 4I1LA 3SWKA 3L75D 3M1MA 1HGVA 5DJTB 2WT7B 3H1HE 3AEAC 4PD4D 3L73D 4ASVA 2CG5B 4HKZH 3W68A 1PPJG 2IDBA 1W5CE 4HKGA 2GDWA 1VQ8P 2IZ0A 1R5SA 2P9XA 5CCHA 1S9KE 1FZCA 1VQ5P 1JCCA 2O01J 5KLVE 4PJ0E 2XV5A 3H1IG 1CW5A 3ZDMA 1PGJA 1SQPE 5AVQB 2LKMA 2V7QJ 1QX8A 3DS1A 3U1CA 1PEMA 4B86A 3PTZA 4L76A 2L0QA 1SQBD 1GK4A 2J5UA 2E76B 4AYCA 3EJEA 2XNDH 4N3YB 3KHUA 2UWJE 2LIUA 4GIFA 4PV1D 2RKLA 2JQ4A 1SQPJ 3H1HG 1FE6A 2OYIB 2E76C 3A3YB 1L2PA 2QM7A 2QG4A 2GYKA 4DG9A 1VQOP 1NTZD 7CEIA 1L0NK 2KS1A 2M8LA 1T3UA 3L72D 3NXSA 1SQVK 4RO0A 2OYIC 1L0LK 5KLVG 3TGUE 3CCVP 2XNXA 3CWBE 5AW4B 2N50A 1T6AA 1ZRTD 1G2CB 2AEFA 1HJBA 2FFDC 3G1IA 2E42A 3U59A 1LP1A 2SPZA 2RH0A 2EG5A 2Y0DA 2Q7CA 2M8NA 1IK7A 2KOSA 1HY8A 4XFZA 1USEA 3TGUJ 2PP6A 1KB9E 3O6QB 3Q20A 1RE4C 1SP4A 1U57A 2FACA 1IMPA 2YNYA 3RL0g 1FZFA 2I1JA 1GXGA 2V4HA 5AW8B 3Q5PA 1RF1B 4JQ0D 3AEBC 1SQXD 3GHGC 3G0VA 1Q2NA 3LMOA 3AECC 2M0BA 1RE3C 2EHTA 3AE9C 2E75B 2D2CC 2KGCA 3CE7A 1M7LA 2KORA 5CCGA 3AE3C 2AF8A 5TJHA 3CWBG 1SQBK 2D2CD 2WSSH 1HWTC 3GKLC 5HV8A 2YIUB 2JDIH 2WQYC 2E75C 1BCCE 3FX0A 5APTA 1IZNB 1N73B 5KP8B 1S5LH 2KLUA 2YIUC 3MUDA 2W6AA 2N98A 1NTZK 1N7SA 1GL2A 2PEMA 3HUSA 3BCCD 1N73C 2JP3A 1X79B 1BCCJ 1T2KC 2L9FA 2O01N 1QL2A 3GZMA 1MV8A 5KAIH 2K9JA 1T2KD 2EIAA 3H1LG 2ZYAA 2GZEA 1YIJP 3CLQA 1M1JB 4Y99B 2ZVNB
chains in the Genus database with same CATH topology
2EG5A 4QNBA 5F2NA 3B5IA 1K8AQ 2M8NA 1KQSO 1Q81Q 4XFZA 1YI2P 4WYMA 2PEOA 5HGNA 2ONTA 1M1KQ 1RO2A 3I55P 2OTJP 2PEQA 5HGLA 3Q20A 4PH0A 1VQ8P 3G1GA 3G6EP 5F2OA 2M8PA 1IUQA 5DCKA 3CCQP 1VQPP 1N8RQ 3MGEA 3G28A 2P9XA 4M0IA 4IPYA 5HGOA 3H0DA 1VQ5P 1Q7YQ 2Z46A 1VQ6P 1KD1Q 1ZMBA 1K9MQ 2LF4A 1M6EX 4GR6A 3DS3A 2JYLA 3WBHA 1JJ2O 1VQ7P 2PEIA 2PEJA 2BHVA 4PH1A 2CWOA 3G0VA 4COCA 1QVGO 4U0DA 3DPHA 3RG6C 1VQLP 3G26A 3CC7P 3G4SP 3E2DA 2XV6A 4U0AA 2BUOA 2DGYA 1PEOA 2XXMA 2PY8A 3DS4A 3DS1A 3CCSP 2BQ1E 3CCRP 1PEMA 3H4EA 3CD6P 4GR2A 3CCUP 1VQNP 1RO0A 1Q82Q 3CMEP 2QA4P 1KC8Q 1M74A 2XT1A 3CCLP 2OTLP 1VQ4P 1PEQA 5F2KA 3CXCO 4U0BA 2QEXP 3G71P 2PENA 1BAJA 3DTJA 4U0CA 4XROA 1A43A 3P05A 3G21A 2L6EA 3G29A 3DS2A 4XFXA 1NJIQ 3VRLC 1A8OA 2OARA 1S72P 2JO0A 1PEUA 3NTEA 3CCMP 2PEKA 3I56P 3HYBA 4U0EA 3DS5A 1VQOP 1QRJA 3H47A 2KODA 1Q86Q 3LRYA 3CC4P 2PEMA 1E6JP 4XFYA 2M8LA 1K73Q 1QVFO 1EIAA 5BS1A 3CPWO 1M90Q 1M6NA 1RNIA 1EOQA 1AUMA 1YJNP 5BS2A 3CCVP 2EFJA 2Z44A 5JPAA 1YJWP 3DS0A 3CCJP 1W2BO 1YHQP 1D1DA 4COPA 3CC2P 4XRQA 1VQMP 2JYGA 1VQ9P 2EIAA 2E1MA 1YIJP 3HZQA 3G1IA 3CCEP 1K30A 5HGMA 1VQKP 2Z45A 1YJ9P 5I4TG 4U0FA 3CMAP 1YITP 3OW2O 3M1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF O;  3CCL P;  1K8A Q;  1QVG O;  2OTL P;  1VQ4 P;  3CPW O;  1KQS O;  3CXC O;  1VQL P;  1Q81 Q;  2QEX P;  1M90 Q;  3G71 P;  1YI2 P;  3CC7 P;  3G4S P;  1YJN P;  3CCV P;  1NJI Q;  2OTJ P;  1M1K Q;  3I55 P;  1YJW P;  1W2B O;  3CCJ P;  1YHQ P;  1VQ8 P;  3CC2 P;  3G6E P;  1VQM P;  1S72 P;  1VQ9 P;  1VQP P;  3CCQ P;  3CCS P;  1N8R Q;  3CCM P;  3I56 P;  3CCR P;  3CD6 P;  3CCU P;  1YIJ P;  1VQ5 P;  1VQO P;  1Q7Y Q;  3CCE P;  1VQN P;  1VQK P;  1Q82 Q;  1Q86 Q;  3CME P;  1VQ6 P;  1KD1 Q;  1YJ9 P;  3CC4 P;  1K9M Q;  2QA4 P;  1KC8 Q;  1VQ7 P;  1JJ2 O;  3CMA P;  1YIT P;  3OW2 O;  1K73 Q; 
#chains in the Genus database with same CATH topology
 2FHS C;  3B5I A;  1RQU A;  1KIL A;  4D6T G;  1BDC A;  4YPC A;  2BCC D;  2I8D A;  5APY A;  1A02 F;  2KNC A;  2WVR A;  2KG8 A;  2JKV A;  1NHL A;  1N7L A;  1SQX K;  4DCK A;  1ZMB A;  3WMM 0;  1VF5 B;  1BE3 D;  2BHV A;  1QLE D;  4IFD K;  3HD7 A;  1K05 A;  2DW3 A;  1L0N E;  2XXM A;  2HPC A;  3V6I A;  1L4A D;  2RN0 A;  1SQV E;  1G1J A;  1VDF A;  1VF5 C;  3NY7 B;  1L0L E;  2PNG A;  2L91 A;  2BEZ F;  4C46 A;  1VF5 D;  4XE5 B;  1PZQ A;  1JO5 A;  3V2Q A;  1KC8 Q;  1FDO A;  1M74 A;  1YTZ T;  2BEQ D;  3L37 A;  3CXC O;  3G71 P;  3L75 E;  2WSC J;  4XFX A;  1L0N J;  4BWN A;  1J2J B;  2QNW A;  1SQV J;  3L73 E;  4PD4 E;  2JO0 A;  1L0L J;  3I56 P;  2ZXE B;  2XZ0 D;  1HGZ A;  3V2R A;  2MJZ A;  1DX7 A;  1NWQ A;  5EW5 E;  3L71 G;  4H2Y C;  3L75 J;  2R32 A;  2OYH B;  1HTL C;  4I6M C;  1EDK A;  2W8Z A;  3L73 J;  4COP A;  1FOS F;  1VQ9 P;  3ABV C;  4I2L C;  2KOO A;  4LLH A;  5APQ A;  2LML A;  4NPF X;  4EDF A;  1H0T B;  2GA1 A;  4BPF A;  4M3L A;  2P1J A;  2OYH C;  1SQB E;  2WMM A;  3M91 A;  5E79 E;  2M5A A;  3RK2 B;  2LPK A;  1JMM A;  4TLF A;  3CXH H;  1YQ4 C;  3H0D A;  1GW4 A;  2K88 A;  5KJ7 A;  4N6J A;  2Z46 A;  4C7N B;  2KSE A;  2N9B A;  3GW6 A;  3L70 D;  2YO2 A;  2PEI A;  1PGQ A;  1VQL P;  1MKM A;  1NTZ E;  2KYV A;  3A0B H;  4H0L B;  5TIS E;  3B5N A;  3L72 E;  3DS4 A;  2RMZ A;  4WB4 A;  5EFW B;  5KKZ B;  3NMD A;  2OQQ A;  5GTI H;  4H0L C;  1ZRT E;  3VMZ A;  1FAV A;  1NTZ J;  2KOG A;  3JC2 2;  1EXI A;  2FYU G;  1AF8 A;  5KKZ C;  3TNU B;  4JF7 A;  1SQB G;  4UB6 H;  2PEK A;  4L73 A;  3KXD A;  4WY4 B;  2A45 G;  1CI6 A;  5AW2 B;  3E1R A;  4AQR D;  1ZOY C;  1USD A;  2M3E A;  1VL2 A;  4LGD E;  1NOH A;  2GUV A;  3PP5 A;  1SQX E;  2WPQ A;  2K93 A;  5AW0 B;  4WY4 C;  2AFD A;  4XRQ A;  3IR9 A;  1JEK A;  2Q5U A;  3KZI H;  3L72 G;  2O3J A;  1K30 A;  2C9L Y;  3V2N A;  4YXW H;  4ZNC A;  2WSF H;  3KDP B;  3CI9 A;  3H32 A;  3P7K A;  5B5E H;  1KQS O;  1JTH A;  1SQQ G;  4WYM A;  1SQX J;  1A02 J;  2FVE A;  3I55 P;  2ZYD A;  4PH0 A;  2YKP A;  5EJD A;  1L0H A;  1LJ2 A;  4BRY A;  3G3Z A;  1OW8 A;  4DZO A;  1PGO A;  4GOE A;  4HJG H;  1P84 H;  2ZXX A;  1FZG A;  3WBH A;  2L5G B;  1JTH B;  4COC A;  3QWO C;  3H1J D;  1LTI C;  3BCC E;  3T97 A;  3S9O A;  2J58 A;  2NPS C;  5CZD B;  3BAS A;  2NPS D;  1ZN5 A;  2PRR A;  2QA4 P;  1Y8A A;  1LTJ C;  2YKO A;  2Z5H A;  4R0M A;  2OTL P;  1VQ4 P;  2HOD A;  4GKG A;  2PEN A;  4XRO A;  1NTM D;  1A43 A;  3BCC J;  1OX3 A;  3G21 A;  3HTK B;  1EZV I;  1GU4 A;  3VRL C;  3VYI A;  3CX5 H;  2BCC E;  3II6 A;  5C39 A;  3DS5 A;  3H25 A;  3WU2 E;  1YYC A;  4OGQ B;  3GF7 A;  4EIJ A;  3EQ2 A;  1N86 A;  1NKZ B;  1ZR2 A;  2O1K A;  1BE3 E;  2M5R A;  1AQ5 A;  3EJD A;  5JPA A;  1YJW P;  2H8P D;  1CEI A;  3D6Z A;  4OGQ C;  2LOL A;  1CZQ A;  2BCC J;  2LR2 A;  3IFM A;  4OGQ D;  1BGY D;  3PRJ A;  1YJ9 P;  2R3S A;  3EFF K;  2KOQ A;  1PP9 D;  1MZ8 A;  1NVO A;  3VTP C;  2N5H A;  2WT7 A;  2WWW A;  3AEF C;  1M8O B;  2AFE A;  3LW5 H;  4HB1 A;  2XZ1 C;  2K0X A;  2XZR A;  5APV A;  2JR8 A;  1Q7Y Q;  1KD1 Q;  1UJZ A;  4AUW A;  3D71 A;  2LTE A;  4ASW A;  3OAK A;  1EC5 A;  2FXO A;  4C7R A;  1F80 D;  2WPV B;  2IX7 C;  3G4S P;  4U0A A;  2Z5I A;  1LTS C;  4JYB A;  1OZH A;  4PJ0 H;  1DV5 A;  2QSI A;  1BE3 G;  4JPZ B;  2JU1 A;  2FQ0 A;  1FJK A;  1BDD A;  1DEE G;  3L74 G;  1LNQ A;  2GM4 A;  2PAJ A;  3C9I A;  5AVY B;  1PEQ A;  1NTM K;  3M9Q A;  2M8R A;  4PV1 B;  2K1A A;  2QJP B;  1PEU A;  2C0W A;  2OYI A;  4Y28 J;  3RBX A;  2JGP A;  1T8Z A;  2IBZ G;  5CBN A;  1GK6 A;  1NTK D;  4PV1 C;  1HUC A;  1T8K A;  1IFJ A;  3P8C D;  2QJP C;  3L70 E;  4ZKU A;  3DS0 A;  1YHQ P;  2VSQ A;  2Y9Z A;  2LXB A;  3SSU A;  4U3F D;  2H89 C;  1R5L A;  2R3C A;  1NU1 J;  1IMQ A;  1G2C A;  1JOC A;  1GMJ A;  1YIT P;  1RE4 A;  5F2N A;  2IFN A;  2FFD B;  2L22 A;  3L70 J;  3MZW B;  2Z4E A;  3VMX A;  2MR8 A;  2OTJ P;  3RGU A;  1EZV D;  1AJY A;  2KUB A;  1IUQ A;  1AVO A;  1QGK B;  3O6Q A;  2H43 A;  2WPR A;  3PLN A;  3VMA A;  2KK7 A;  3I5C A;  4R4L A;  1SQP G;  2CPS A;  2H7H A;  3DS3 A;  1DNY A;  2KSJ A;  1RF1 A;  2KGD A;  1N2D C;  2E74 D;  3GHG B;  4L74 A;  4F37 A;  1PIX A;  3TK1 A;  5AVZ B;  2BQ1 E;  1URQ B;  1JB0 J;  2N6Z A;  4CPG A;  1Q82 Q;  2D2C B;  1GD2 E;  1IC2 A;  1LTA C;  3KYQ A;  1LTG C;  1VHN A;  1OIP A;  1URQ C;  3HE5 B;  3VP8 A;  1SFC B;  2OTK E;  1N73 A;  2YXQ B;  1URQ D;  3TGU G;  1AV1 A;  1NTK K;  2K0Y A;  3GLM A;  2O1J A;  1SFC C;  2JBG A;  5BS2 A;  1LT1 A;  2QE7 H;  2Z44 A;  1SFC D;  1ZME C;  3H1J E;  3JCU H;  3H1K J;  2K3R A;  3BVH A;  1IJD B;  3HZQ A;  1JY2 O;  5HGM A;  4RKU J;  1Y47 A;  1M1J A;  2N9Y B;  1J1E B;  4GOD A;  5HGN A;  2YO3 A;  3H1J J;  1VQP P;  1N8R Q;  1NTM E;  3MGE A;  5L8R J;  3Q1M A;  3A2A A;  2WPS A;  1J1E C;  3L36 A;  1OWA A;  4GR6 A;  3VN0 A;  2KWL A;  4IZ6 A;  1UNK A;  3GMA A;  3M0A A;  1RF0 A;  2W83 C;  3AEG C;  4GOF A;  4MN4 C;  1K04 A;  2PY8 A;  2HR3 A;  3L35 A;  2KGE A;  1NTM J;  1L4A B;  1BCC G;  3CME P;  5KAI E;  3SFE C;  4IL6 X;  2NO8 A;  3HE4 B;  2EHS A;  1XTC C;  1BGY E;  2LL8 A;  1L4A C;  1N7S C;  5CJ0 A;  5CJ4 A;  3HUS C;  1H8A A;  1KYO H;  1PP9 E;  2AXC A;  2FAE A;  2OAR A;  1S72 P;  3A7O A;  1PPJ D;  1N7S D;  3NTE A;  4UHP B;  2WSE J;  4U0E A;  1E0H A;  2H88 C;  1AYI A;  1Q86 Q;  3UIA A;  1KTM A;  1K73 Q;  1PGP A;  2AXT H;  2QJY C;  1EIA A;  1BGY J;  3V4W A;  1EOQ A;  3KPE A;  5AVV B;  1PP9 J;  2KW2 A;  3PHL A;  2OYH A;  1HQB A;  1OVU A;  3LID A;  1ZP0 C;  2P2U A;  5I4T G;  2ZFC A;  1PFI A;  1LT9 B;  1H0T A;  4YXD C;  1Q81 Q;  2R44 A;  3AED C;  3AE6 C;  2FBW C;  2PEQ A;  1BGY G;  1TU3 F;  1J1D B;  3F89 A;  1LT9 C;  3H6P A;  1L0N G;  5E79 H;  2ZAE B;  3HD7 D;  2B89 A;  1SS1 A;  2CNR A;  3B4Q A;  2A45 H;  1SQV G;  4C7N A;  2CGQ A;  1L0L G;  3RG6 C;  3BRV B;  5KTB A;  3CC7 P;  1J1D C;  1Y9B A;  1NTK E;  1RH5 B;  1H89 A;  3P8C E;  1NU1 D;  3CD6 P;  4GT1 A;  4U7J A;  3L75 G;  5TIS H;  1RO0 A;  1AVY A;  1DEB A;  3L73 G;  2FKW B;  4U3F E;  3CCL P;  2JEE A;  2QEX P;  2CPB A;  1NTK J;  1KQF B;  2YXR B;  3SWF A;  2FVA A;  4N78 D;  3TNU A;  1EDI A;  1EMV A;  5GTH H;  2C0X A;  5CHX A;  1Z6M A;  1EZV E;  1QRJ A;  1IFM A;  3LRY A;  4HH2 A;  4WY4 A;  4U3F J;  3CXH E;  2P67 A;  3R4Y A;  5APU A;  1YJN P;  1VKU A;  2Q1K A;  3OA7 A;  1WRG A;  5AVT B;  2GZG A;  3TDK A;  1VQM P;  2JYG A;  3A0B E;  2B9B A;  5B66 E;  3FXD A;  3GG2 A;  2E5T A;  4ZMD A;  3B8E B;  2ERH A;  1K8A Q;  2FY8 A;  5KJ7 C;  1D7M A;  3G9R A;  4U3F G;  1RO2 A;  1KYO I;  3GZL A;  5KJ7 D;  1YBK A;  3NTN A;  1NTZ G;  5AVW B;  4M0I A;  2N6Y A;  2R5B A;  5KP6 B;  1GZL A;  1OW7 A;  1X9V A;  2NPS A;  3B5N D;  1EZV G;  5KAF H;  3G26 A;  3O8Z A;  3H1K D;  2JO1 A;  2OGU A;  1NU1 K;  2KXP B;  2PGD A;  4GR2 A;  3CCU P;  2KIK A;  3MGN A;  1IFI A;  2JB0 A;  1JCD A;  2FVF A;  3H1L D;  2G8Y A;  2NPS B;  3FGA D;  2N1T C;  1MFZ A;  2Y0C A;  3KZI E;  2BAS A;  5F2K A;  1U7M A;  1JM0 A;  5AW5 B;  2ZT9 D;  2N1T D;  1S5L X;  1LTJ B;  1NJI Q;  3HRN A;  3P8M C;  2ITA A;  2YKQ A;  3M0D A;  4D6T D;  3HTK A;  5B5E E;  1IFP A;  3CCM P;  2HLO A;  3HYB A;  1SQX G;  3U1A A;  3RL0 D;  2ZJS E;  2A45 I;  2LIW A;  1FDI A;  3RK3 B;  2WSF J;  1PV3 A;  3K5B A;  1HVV A;  2K37 A;  3Q2Y A;  2EFJ A;  3CC2 P;  1FBM A;  3AE1 C;  4W7Y A;  3CXH I;  4BPG A;  1IO4 A;  5BU5 A;  3RK3 C;  2K94 A;  1JJ2 O;  3JSV C;  1HH0 A;  3RK3 D;  1YI2 P;  5H2F E;  2G3A A;  3S1K A;  4K3A A;  2GDY A;  2CQ8 A;  2ONT A;  3TYY A;  3G1G A;  3G6E P;  5F2O A;  2W90 A;  1R8E A;  3G28 A;  2KOP A;  2XKM A;  3BCC G;  4UB8 H;  1PPJ E;  2MVV A;  2JYL A;  2PFX A;  1HJ0 A;  2CWO A;  1KZU B;  3DPH A;  1LWU B;  2VRS A;  2QJK C;  1OR5 A;  4OWF A;  3E2D A;  2XV6 A;  3OJA B;  2DGY A;  1G1I A;  1KOR A;  3L71 D;  2O01 H;  2VLO A;  5K5G B;  4PWV B;  4IL6 E;  1NKN A;  4I7Z C;  1LWU C;  2FYN C;  5AVR B;  3V5B A;  1MUU A;  1KFM A;  3A0H E;  2BCC G;  1FZE A;  2POH A;  3C8V A;  5HVC A;  2V7Q H;  3S4R A;  2HG5 D;  1NO4 A;  3DTJ A;  2JU2 A;  2KG9 A;  1BSN A;  1KYO D;  1A8O A;  1L0I A;  3VP9 A;  3SWY A;  3H1I J;  3CC4 P;  4XFY A;  2B87 B;  3D70 A;  2WZ7 A;  2A06 D;  4RES B;  1M56 D;  1M90 Q;  1RNI A;  4GDO A;  2MKV A;  1W2B O;  1GW3 A;  1ZNV A;  2MF4 A;  1OW6 A;  1ZW0 A;  1EDL A;  1P84 I;  1NU1 E;  1S2E A;  4U0F A;  3H1H J;  1FU1 A;  3LW5 J;  1T3J A;  1YTZ I;  3PH0 A;  3QH9 A;  3FXE A;  2FFD A;  2QIW A;  2FYU D;  3ITK A;  1FZC B;  2VLP A;  4QKO A;  3CCQ P;  4IPY A;  5BVZ A;  1SVF A;  2CK3 H;  1CSB A;  5KLV J;  5DJU B;  3EFG A;  4N78 E;  1VQ7 P;  1KQL A;  3MHV A;  3AE5 C;  4H44 B;  4PH1 A;  2QVA A;  2WTY A;  2K2Q A;  5CCH C;  1FZC C;  3N7N A;  2E74 B;  4TT3 H;  5AW9 B;  4IFM A;  5CCH D;  4H13 B;  4W80 A;  3GHG A;  3IF4 A;  1JY3 N;  3W67 A;  4H44 C;  3CXH D;  3CX5 I;  1AA0 A;  2E76 D;  1URQ A;  1RE3 A;  2Q3I A;  4H44 D;  4L75 A;  2E74 C;  3NFQ A;  1KB9 H;  1GPJ A;  4H13 C;  4R4M A;  1BAJ A;  2GZJ A;  1NU1 G;  1ZR4 A;  4PXH B;  4H13 D;  1S4X A;  2LKI A;  1SQQ D;  2W27 A;  3AEE C;  3HE5 A;  5APX A;  1M57 D;  1SFC A;  5APW A;  3L70 G;  1DD3 A;  2WIT A;  2FXP A;  2KS1 B;  2I1K A;  1E6J P;  1XTG B;  2XDJ A;  3IAO A;  1X22 A;  2IBZ I;  2KI7 B;  4WWI A;  1JMB A;  3CWB J;  1FZB A;  1X0T A;  4NPE A;  2R5D A;  3CCJ P;  3TSI A;  2JWA A;  3H1K E;  3BRT B;  5AW7 B;  2JWD A;  1LP1 B;  1SLQ A;  4DT0 A;  1LTB C;  3WUU A;  2MD9 A;  3CMA P;  3MP7 B;  4QNB A;  2L4B A;  1MFT A;  3VMY A;  5CMZ A;  3Q5S A;  3H1L E;  1LGH B;  3IN6 A;  1Z56 A;  2FYU K;  1QEX A;  1RF1 C;  2NZ2 A;  1X3O A;  3E1I A;  1DH3 A;  2NRG A;  2B88 A;  4D6T E;  2KR5 A;  3D6Y A;  2PEJ A;  3B71 A;  3P32 A;  3B4S A;  4DJG A;  3H1L J;  3R2P A;  3M9H A;  3RBZ A;  3FWL A;  2E75 D;  2BUO A;  1PEO A;  2QRX A;  2Q3E A;  2XU6 A;  3SFD C;  4DOJ A;  4D6T J;  2N5I A;  1L4A A;  3M06 A;  1S5L E;  4Z1M H;  2GUS A;  3JCU E;  1P84 D;  3H1K G;  5CCG C;  2K5X A;  4U0B A;  2IYO A;  4U0C A;  3HE4 A;  2WSE H;  2L6E A;  1KLP A;  1S3J A;  1SQQ K;  5CCG D;  3RK3 E;  2ZVO B;  1N7S B;  3AE7 C;  1GL2 B;  3HUS B;  5AW6 B;  2W6J H;  2M3B A;  3H1J G;  3CL3 D;  3F5H A;  3PJS K;  3GF3 A;  2WSC H;  2GZF A;  2YMK A;  4MRT C;  3MUD C;  3CPW O;  1OXZ A;  1AUM A;  2FQ2 A;  1QL1 A;  1M1J C;  1GL2 C;  2K9J B;  2QJY B;  1WT6 A;  2KZI A;  4Y99 C;  1IK9 A;  1GL2 D;  1H88 A;  4IOI H;  1OMI A;  3CX5 D;  3L71 E;  4NEO A;  1EQ7 A;  2Z45 A;  4EYY Q;  3OW2 O;  1NTM G;  4O9B A;  5AW3 B;  3EJB A;  1KB9 I;  1KIL B;  1PL5 A;  4YTP C;  1BSH A;  4PD4 H;  2QM8 A;  1LT9 A;  3MD0 A;  3L74 D;  2MY5 A;  2AEM A;  1M1K Q;  1FDM A;  5HGL A;  2KNC B;  1AFO A;  4XA4 A;  4NPD A;  3H1I D;  5DCK A;  5KP7 B;  2HFE D;  1RF0 C;  4LC1 A;  1KIL C;  3L71 J;  1KYO E;  1JNM A;  1W2E A;  3HD7 B;  1KIL D;  1QVG O;  2P10 A;  3E7K A;  4EI2 A;  2IBZ D;  3M9B A;  1BXI A;  2HPC B;  1OFC X;  2A06 E;  4JBZ A;  2AXT E;  3CCS P;  2AEJ A;  1UIX A;  2Y0E A;  4XFJ A;  3Q5R A;  3WUT A;  3H4E A;  3HD7 C;  1NGM B;  3USS A;  5BU8 B;  3H1H D;  2FYZ A;  1JY2 N;  1GDT A;  1PP9 G;  3MTU E;  4QMA A;  2K9Y A;  2E5Y A;  1S9K D;  4JYC A;  3V2P A;  1E79 H;  2KG6 A;  5KLV D;  1DIP A;  2J59 M;  1JUN A;  3Q3D A;  1GXH A;  2MR7 A;  2FYU E;  2P58 A;  1GTW A;  2Q6Q A;  2ZYG A;  1KV4 A;  5BS1 A;  1SQP D;  4WBA A;  2K0D X;  1ZLL A;  1FS0 E;  1FC2 C;  1JY3 P;  2KB7 P;  1FJP A;  3RG2 A;  2GDX A;  3LIE A;  4IFF A;  2A06 G;  5AVU B;  2MVU A;  2FYU J;  5KLI B;  1NAY A;  3RK2 C;  3WUV A;  1WMK A;  2AVA A;  1SQB J;  2M5A B;  5B66 H;  3RK2 D;  2PEO A;  4HYT B;  5AVX B;  1NYH A;  4H2W C;  5KLI C;  1MZ9 A;  2HYN A;  5HGO A;  1NTK G;  1SQQ E;  2IFM A;  3GJN A;  4ZKP A;  2FQ1 A;  1M6E X;  3TGU D;  3EWK A;  5GTH E;  3CWB D;  4U0D A;  1FZA A;  4H0L D;  3B5N B;  2KLV A;  2Y9Y A;  1HF9 A;  3L72 J;  3L4F A;  5GTI E;  3C1L A;  2N1T A;  1ZXG A;  2VLQ A;  2IYP A;  3CCR P;  2OYO A;  4K35 A;  1SQQ J;  4KHX A;  3B5N C;  2KZJ A;  4UB6 E;  2WPT A;  1NH4 A;  2XT1 A;  3V4Q A;  4PD4 I;  1KB9 D;  5CBO A;  2KP8 A;  4BXL A;  1E5W A;  4OH8 B;  3P05 A;  2ZT9 B;  3G29 A;  2N1T B;  5KLV K;  3BAT A;  1LTJ A;  1CI6 B;  4WY4 D;  4CA3 A;  2DNW A;  2KGA A;  3H47 A;  2KOD A;  1EXJ A;  1OVV A;  3RL0 B;  4EOT A;  1SQP K;  2ZT9 C;  5APS A;  2Q9I A;  1RHZ B;  4RJT A;  1M6N A;  2JAZ A;  2YMY A;  3FWN A;  1KFN A;  3VOP A;  1DD4 A;  1D1D A;  5KAF E;  3RL0 C;  3AE2 C;  4KT0 J;  1HBW A;  3CCE P;  3H32 B;  1BCC D;  1S1C X;  4H2X C;  3AE8 C;  2VLN A;  4A7P A;  2P7J A;  1P84 E;  3WU2 H;  2M8P A;  4BRY B;  3TF5 A;  1X8Y A;  1LTT C;  3MIW A;  2FAD A;  1VPC A;  2IZ1 A;  5H2F H;  1VQ6 P;  2IPP A;  1NAF A;  1K9M Q;  2LF4 A;  2GZI A;  2FXM A;  3T97 B;  1FOS E;  1LWU A;  4OVN F;  3N4X A;  2LXC B;  2QJK B;  1AQT A;  4BPH A;  1VQN P;  1YQ3 C;  5AW1 B;  3AE4 C;  3M0D C;  2HOD B;  1U7J A;  5M1B A;  1KN7 A;  4I7Z B;  3CX5 E;  3A5T A;  1RQV A;  4IL6 H;  2FYN B;  1IFN A;  1KMI Z;  1GU5 A;  3DS2 A;  3U43 A;  4WVZ A;  3L74 E;  1JY3 O;  5AVS B;  3A0H H;  2C9N Y;  2X2B A;  1UII A;  4W7Z A;  1NQ4 A;  1EDJ A;  2W6B A;  1FR2 A;  2JJL A;  3H1I E;  1QVF O;  1OVR A;  1L0N D;  2B87 A;  1KQG B;  1BE3 J;  1SQV D;  4UB8 E;  2K92 A;  1ZV8 A;  1L0L D;  1RY3 A;  1KIL E;  2ROQ A;  2E43 A;  2IBZ E;  3L74 J;  1IFD A;  1ACP A;  3KQG A;  2E1M A;  1JY2 P;  1Q90 D;  4KJM A;  1VQK P;  4I1L A;  3SWK A;  3L75 D;  3M1M A;  1HGV A;  5DJT B;  2WT7 B;  3H1H E;  3AEA C;  4PD4 D;  3L73 D;  4ASV A;  2CG5 B;  4HKZ H;  3W68 A;  1PPJ G;  2IDB A;  1W5C E;  4HKG A;  2GDW A;  1VQ8 P;  2IZ0 A;  1R5S A;  2P9X A;  5CCH A;  1S9K E;  1FZC A;  1VQ5 P;  1JCC A;  2O01 J;  5KLV E;  4PJ0 E;  2XV5 A;  3H1I G;  1CW5 A;  3ZDM A;  1PGJ A;  1SQP E;  5AVQ B;  2LKM A;  2V7Q J;  1QX8 A;  3DS1 A;  3U1C A;  1PEM A;  4B86 A;  3PTZ A;  4L76 A;  2L0Q A;  1SQB D;  1GK4 A;  2J5U A;  2E76 B;  4AYC A;  3EJE A;  2XND H;  4N3Y B;  3KHU A;  2UWJ E;  2LIU A;  4GIF A;  4PV1 D;  2RKL A;  2JQ4 A;  1SQP J;  3H1H G;  1FE6 A;  2OYI B;  2E76 C;  3A3Y B;  1L2P A;  2QM7 A;  2QG4 A;  2GYK A;  4DG9 A;  1VQO P;  1NTZ D;  7CEI A;  1L0N K;  2KS1 A;  2M8L A;  1T3U A;  3L72 D;  3NXS A;  1SQV K;  4RO0 A;  2OYI C;  1L0L K;  5KLV G;  3TGU E;  3CCV P;  2XNX A;  3CWB E;  5AW4 B;  2N50 A;  1T6A A;  1ZRT D;  1G2C B;  2AEF A;  1HJB A;  2FFD C;  3G1I A;  2E42 A;  3U59 A;  1LP1 A;  2SPZ A;  2RH0 A;  2EG5 A;  2Y0D A;  2Q7C A;  2M8N A;  1IK7 A;  2KOS A;  1HY8 A;  4XFZ A;  1USE A;  3TGU J;  2PP6 A;  1KB9 E;  3O6Q B;  3Q20 A;  1RE4 C;  1SP4 A;  1U57 A;  2FAC A;  1IMP A;  2YNY A;  3RL0 g;  1FZF A;  2I1J A;  1GXG A;  2V4H A;  5AW8 B;  3Q5P A;  1RF1 B;  4JQ0 D;  3AEB C;  1SQX D;  3GHG C;  3G0V A;  1Q2N A;  3LMO A;  3AEC C;  2M0B A;  1RE3 C;  2EHT A;  3AE9 C;  2E75 B;  2D2C C;  2KGC A;  3CE7 A;  1M7L A;  2KOR A;  5CCG A;  3AE3 C;  2AF8 A;  5TJH A;  3CWB G;  1SQB K;  2D2C D;  2WSS H;  1HWT C;  3GKL C;  5HV8 A;  2YIU B;  2JDI H;  2WQY C;  2E75 C;  1BCC E;  3FX0 A;  5APT A;  1IZN B;  1N73 B;  5KP8 B;  1S5L H;  2KLU A;  2YIU C;  3MUD A;  2W6A A;  2N98 A;  1NTZ K;  1N7S A;  1GL2 A;  2PEM A;  3HUS A;  3BCC D;  1N73 C;  2JP3 A;  1X79 B;  1BCC J;  1T2K C;  2L9F A;  2O01 N;  1QL2 A;  3GZM A;  1MV8 A;  5KAI H;  2K9J A;  1T2K D;  2EIA A;  3H1L G;  2ZYA A;  2GZE A;  1YIJ P;  3CLQ A;  1M1J B;  4Y99 B;  2ZVN B; 
#chains in the Genus database with same CATH homology
 2EG5 A;  4QNB A;  5F2N A;  3B5I A;  1K8A Q;  2M8N A;  1KQS O;  1Q81 Q;  4XFZ A;  1YI2 P;  4WYM A;  2PEO A;  5HGN A;  2ONT A;  1M1K Q;  1RO2 A;  3I55 P;  2OTJ P;  2PEQ A;  5HGL A;  3Q20 A;  4PH0 A;  1VQ8 P;  3G1G A;  3G6E P;  5F2O A;  2M8P A;  1IUQ A;  5DCK A;  3CCQ P;  1VQP P;  1N8R Q;  3MGE A;  3G28 A;  2P9X A;  4M0I A;  4IPY A;  5HGO A;  3H0D A;  1VQ5 P;  1Q7Y Q;  2Z46 A;  1VQ6 P;  1KD1 Q;  1ZMB A;  1K9M Q;  2LF4 A;  1M6E X;  4GR6 A;  3DS3 A;  2JYL A;  3WBH A;  1JJ2 O;  1VQ7 P;  2PEI A;  2PEJ A;  2BHV A;  4PH1 A;  2CWO A;  3G0V A;  4COC A;  1QVG O;  4U0D A;  3DPH A;  3RG6 C;  1VQL P;  3G26 A;  3CC7 P;  3G4S P;  3E2D A;  2XV6 A;  4U0A A;  2BUO A;  2DGY A;  1PEO A;  2XXM A;  2PY8 A;  3DS4 A;  3DS1 A;  3CCS P;  2BQ1 E;  3CCR P;  1PEM A;  3H4E A;  3CD6 P;  4GR2 A;  3CCU P;  1VQN P;  1RO0 A;  1Q82 Q;  3CME P;  2QA4 P;  1KC8 Q;  1M74 A;  2XT1 A;  3CCL P;  2OTL P;  1VQ4 P;  1PEQ A;  5F2K A;  3CXC O;  4U0B A;  2QEX P;  3G71 P;  2PEN A;  1BAJ A;  3DTJ A;  4U0C A;  4XRO A;  1A43 A;  3P05 A;  3G21 A;  2L6E A;  3G29 A;  3DS2 A;  4XFX A;  1NJI Q;  3VRL C;  1A8O A;  2OAR A;  1S72 P;  2JO0 A;  1PEU A;  3NTE A;  3CCM P;  2PEK A;  3I56 P;  3HYB A;  4U0E A;  3DS5 A;  1VQO P;  1QRJ A;  3H47 A;  2KOD A;  1Q86 Q;  3LRY A;  3CC4 P;  2PEM A;  1E6J P;  4XFY A;  2M8L A;  1K73 Q;  1QVF O;  1EIA A;  5BS1 A;  3CPW O;  1M90 Q;  1M6N A;  1RNI A;  1EOQ A;  1AUM A;  1YJN P;  5BS2 A;  3CCV P;  2EFJ A;  2Z44 A;  5JPA A;  1YJW P;  3DS0 A;  3CCJ P;  1W2B O;  1YHQ P;  1D1D A;  4COP A;  3CC2 P;  4XRQ A;  1VQM P;  2JYG A;  1VQ9 P;  2EIA A;  2E1M A;  1YIJ P;  3HZQ A;  3G1I A;  3CCE P;  1K30 A;  5HGM A;  1VQK P;  2Z45 A;  1YJ9 P;  5I4T G;  4U0F A;  3CMA P;  1YIT P;  3OW2 O;  3M1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...