3I56P

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3i56P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3i56P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3i56P02
2OTJP 1JJ2O 1YHQP 1VQ9P 1Q7YQ 3G4SP 1VQ6P 3CCVP 1YJNP 3CCQP 3CCRP 1VQ5P 1K73Q 3I56P 3CXCO 2OTLP 3CCUP 1KC8Q 1YJWP 1M1KQ 3CPWO 1YJ9P 3CD6P 1S72P 3CC4P 3CCLP 1K9MQ 1YI2P 3CC7P 1VQ8P 1Q86Q 3CC2P 3CCEP 3OW2O 1VQMP 1VQ7P 1KD1Q 3CMAP 2QEXP 1YITP 3G71P 1Q81Q 1QVGO 3CMEP 1Q82Q 1VQNP 1KQSO 1N8RQ 1VQKP 1W2BO 1VQOP 1QVFO 1M90Q 1VQ4P 1VQPP 1K8AQ 1NJIQ 2QA4P 3G6EP 3CCJP 3I55P 3CCMP 3CCSP 1VQLP 1YIJP
chains in the Genus database with same CATH superfamily
2E75C 4Y28J 3LRYA 2M5AA 2LTEA 2AFDA 4KT0J 3IR9A 4UB6H 2E42A 2JEEA 1S1CX 3HUSC 2FQ2A 4D6TE 1RY3A 4D6TJ 2BASA 2E5YA 2IFMA 4RESB 5K5GB 2AEFA 3H4EA 2BHVA 2QM8A 2R5DA 2KNCA 3SWYA 5KAIE 2V4HA 1NTKD 2P2UA 5HV8A 1IJDB 2LXCB 3A5TA 3M9HA 2CQ8A 4YXDC 1N73A 1Q7YQ 2PEKA 3AE6C 3MP7B 2JJLA 3VP8A 1PEMA 1K9MQ 3A0BE 1S9KD 1HWTC 2G3AA 2ZXEB 5DJTB 5AVQB 1K30A 1H88A 4MRTC 1OX3A 1JTHB 1QRJA 2JBGA 2J5UA 5KLVG 2EFJA 1VF5D 2QJYC 4BPHA 1BDCA 2K37A 1AV1A 2ZVOB 4I7ZC 3USSA 2Z44A 1M57D 1JY3N 5HGOA 5GTIH 1RF1B 2JGPA 1SQXD 2KORA 1PGQA 4GDOA 4ASWA 2IX7C 2OGUA 1FZCA 4PH1A 1VQPP 2BCCD 3IN6A 2HPCA 2M8LA 3HTKA 2KLUA 3EFGA 2QM7A 1AA0A 2L4BA 1S72P 4M3LA 2QG4A 1VQ8P 2GDWA 1IC2A 1LWUC 2JR8A 2K0XA 4EDFA 1J1DC 2PEQA 1L4AB 2KOGA 4HKGA 1USEA 3PHLA 4NPFX 3JC22 4U0FA 1SFCB 1DX7A 1RO2A 3LW5H 2KOPA 1JCCA 5H2FH 4PD4D 4NPEA 4ZMDA 4K35A 4R4LA 2OYHC 1URQC 3E2DA 2FVFA 3OW2O 2RMZA 1KQSO 2AXTH 2FBWC 3M0DA 1IFJA 3M06A 3F5HA 2NRGA 2WT7B 2HR3A 1YJNP 1KB9E 1VL2A 2SPZA 4GR6A 2O3JA 1P84D 1KZUB 2WPQA 2OYIB 3B5ND 3GZLA 4OH8B 2Q6QA 3U43A 2AXCA 1IFNA 1LJ2A 1DEBA 2KOQA 3L71D 5AW2B 1T3JA 2A06E 3ITKA 1LT9B 1EDIA 3DTJA 1N7SB 1L0NK 4L73A 3I56P 4XFYA 3F89A 1YYCA 3CXHI 3VMYA 3HE4B 2I1KA 3BCCD 1OIPA 1DD3A 4YXWH 3G28A 1AVYA 1JM0A 3PTZA 3MTUE 1D1DA 4XFXA 1SQVG 1SQQG 2XNXA 1IK9A 2FYZA 1IZNB 5BU5A 4H0LB 5KLIB 3CMAP 2K0YA 3H32B 7CEIA 1KYOD 1PZQA 1AQTA 4IFFA 2D2CC 1G2CA 2CK3H 2PGDA 2C9LY 3AEDC 3WUUA 2PY8A 1VDFA 3H1IE 1AJYA 3H1IJ 4PJ0E 2LMLA 2KG8A 4GOEA 5KAIH 4C7NA 4COPA 5BVZA 1KD1Q 4IL6H 1UNKA 2FQ0A 1G1IA 2IDBA 1N8RQ 5C39A 3KZIH 1ZXGA 4PV1D 2NZ2A 1SLQA 5AVYB 3PH0A 1ZRTE 3Q20A 1QX8A 2M3BA 1DEEG 3FWNA 5AW4B 3MZWB 1KMIZ 2Z4EA 2P10A 1PPJG 4IOIH 2WVRA 1KILE 1EDJA 1W2BO 2Z5HA 3AE3C 4RO0A 1W2EA 4LGDE 2BUOA 3TGUG 1ZW0A 1FJPA 3H1JD 1BSNA 1FS0E 5AVVB 1DV5A 2KW2A 3E7KA 2E75D 5KAFH 1SQBK 2UWJE 3H1LG 4EOTA 3DS1A 4XE5B 4Y99C 1T8ZA 3NXSA 1BGYG 2KLVA 2IZ1A 5CBNA 1GL2B 2MVUA 4CPGA 2PENA 4MN4C 2FY8A 4AYCA 1NQ4A 3Q2YA 2L91A 2YO3A 1OW7A 2KP8A 4IZ6A 1VQMP 3L74E 5APVA 3L74J 3TF5A 1L0NJ 2FYUG 4PD4H 2LXBA 4HJGH 2CWOA 3GF7A 2E76C 5AVXB 3L72G 1SQPK 4WY4B 3GKLC 4GKGA 5HGLA 1FDIA 1VQ5P 1RE4C 3P8MC 4BPFA 3JCUH 1M6NA 1NVOA 1M7LA 4AQRD 2N6ZA 3BVHA 3VOPA 2CGQA 3A2AA 3CMEP 3LMOA 2RN0A 1VQNP 2BEZF 2MF4A 2H7HA 1L0LG 3VP9A 5AW3B 2M8NA 1FBMA 1N73C 1K73Q 3O6QA 1A02J 4PH0A 1EQ7A 4H13B 2MR7A 2W27A 2IBZD 2XZ0D 2VLNA 2W6JH 3SWKA 2N98A 3HD7D 3NTEA 1K8AQ 3RK2C 5KJ7D 1QL2A 1ZLLA 3IFMA 2LL8A 5CJ4A 1UIIA 3Q1MA 1OXZA 1VKUA 4D6TG 2K92A 4XFJA 2WPTA 2WSCH 4NPDA 1JUNA 3I5CA 2VLQA 3AE5C 1BCCD 1K04A 1FZCC 2FADA 3G29A 2P1JA 1JB0J 3S4RA 1UJZA 3FX0A 1NHLA 2GZFA 2K93A 3P8CD 3BATA 3L70D 4KJMA 1LNQA 3GHGB 1KILB 3OJAB 3TNUB 3E1RA 2ZT9C 3U1AA 1KYOH 1CW5A 5GTIE 4COCA 1URQD 5AVRB 4DT0A 2W83C 2DNWA 1PP9E 5CCGC 4L76A 2W90A 2Z45A 1PP9J 2KODA 2FYNB 5HGNA 1GW4A 4W7YA 2O01H 3I55P 5L8RJ 5GTHH 1SQBE 1JMBA 5EW5E 1SQBJ 1HBWA 1ZN5A 4WVZA 1GDTA 2CG5B 3T97A 2O1KA 5CCHD 3CL3D 1NAFA 2IFNA 3H1KE 1AFOA 2EG5A 3H1KJ 5CHXA 2QJKB 3HE5A 2P9XA 2MR8A 3M0DC 3LW5J 5F2NA 1JMMA 5H2FE 3P32A 1IUQA 2AVAA 2IYPA 4QMAA 1KYOI 1RF1A 1T2KC 2O01N 2Q1KA 3DPHA 2ZJSE 1PPJD 3NMDA 2KYVA 1AUMA 2MY5A 1A43A 1SQPE 1SQPJ 3TGUD 4IFMA 1SQXK 2MJZA 2AXTE 1AQ5A 2KG6A 2MKVA 3A3YB 3CCJP 1LTGC 2I1JA 5BS1A 4H2YC 1HUCA 3CXCO 3CD6P 1S3JA 4L74A 3H1LD 3PP5A 1E6JP 1BGYD 3L75D 3S9OA 3HD7B 1LTJC 2D2CD 1GK4A 1KQGB 2ZYAA 3PJSK 1TU3F 4IPYA 2HODB 3Q5SA 3Q5PA 2FYUD 3H1HD 2FKWB 2QE7H 3L72D 1UIXA 2LIWA 1VHNA 1HY8A 4U7JA 2FFDB 2WSEH 1J1DB 1H8AA 1CEIA 2PP6A 5KTBA 2KK7A 2KSEA 2N1TB 4BWNA 1JY2N 2YKPA 1RE3C 3U59A 1AVOA 2JWAA 1NU1D 3G71P 2E74C 2AEMA 2A06G 5APXA 3MHVA 1GXGA 3CX5H 1LT9A 1N7SA 1LTIC 3KXDA 4LLHA 2JQ4A 2WPVB 1ACPA 1RE4A 4BXLA 3CC7P 2GDXA 3B5IA 4IL6E 1DNYA 3V4WA 2HYNA 2FVAA 3RL0C 3KZIE 5CJ0A 3AEFC 1U57A 5APUA 3KHUA 3FXEA 1Y9BA 1YBKA 4H44C 2NPSC 1S9KE 3H32A 3G1IA 1GW3A 1JY3P 3H47A 1MFZA 1JY3O 2RH0A 3CX5I 2OQQA 2LKMA 1OMIA 4ZNCA 3H1IG 3Q5RA 2KXPB 3NY7B 4OWFA 2GZGA 1IFDA 1ZP0C 4DOJA 3FWLA 4U3FD 2E76D 4RKUJ 3G4SP 1SQXE 1SQXJ 3V2NA 1X0TA 1QGKB 1J1EB 3G0VA 5KAFE 2BCCE 1FZGA 2BCCJ 5AVTB 2B88A 4M0IA 1HVVA 3DS0A 4OGQB 3QH9A 1LGHB 2WPSA 2W6BA 5AW7B 1L2PA 3KDPB 3VMZA 2GUVA 1EXIA 3VRLC 2QVAA 5CCGA 4PD4E 1M56D 1M1JB 4QNBA 5KP7B 5E79H 1NTMD 1IO4A 2L6EA 1VQ9P 2WQYC 1X8YA 2ERHA 3RK3C 2HG5D 1K05A 1KQFB 5M1BA 1DD4A 3JCUE 2GUSA 2QEXP 3E1IA 2N9YB 1EC5A 4U0AA 1Q90D 1GL2A 2EIAA 3CWBD 1MUUA 3KQGA 1NTZD 1P84E 3L74G 2N5HA 1L0NG 1YJWP 1YJ9P 2M8PA 2ZT9D 2QNWA 2G8YA 4GIFA 3M9BA 3L71E 4WY4A 4BRYA 2XDJA 5CCGD 2Q9IA 1EDLA 1NH4A 3NTNA 3BCCE 1X79B 3BCCJ 1OVUA 3CCQP 3RBZA 5APQA 1M1KQ 1RNIA 2KGEA 1EZVD 2FAEA 5B66H 2KOOA 2M8RA 2M3EA 2WSCJ 3AE9C 2J59M 2K1AA 1LTJA 3AE7C 1VF5B 3CCMP 3RL0g 2IYOA 1PIXA 1KYOE 2Q5UA 4WWIA 1T2KD 4JQ0D 1M6EX 1IFPA 1ZV8A 2H8PD 2KNCB 2DW3A 1NKZB 1H0TB 5AW1B 1XTGB 4JPZB 1NWQA 2C9NY 4NEOA 1N7LA 3EFFK 2O01J 5GTHE 3AEAC 1Y47A 1RE3A 1RF1C 4I1LA 1LTBC 2K88A 2PAJA 2KGCA 2Z46A 3AEBC 3GHGA 3G1GA 1KILA 1FOSE 3AEGC 2P58A 1YQ4C 3H1ID 1PP9G 5AW0B 4CA3A 1L4AC 4HB1A 3L73E 1OZHA 3BASA 3L73J 1SFCC 5KLVD 4IL6X 2KI7B 1LT1A 1SQBG 1FC2C 1L0HA 1X9VA 3H1JE 1WT6A 4JYCA 1Z6MA 3H1JJ 2NPSA 3V6IA 1ZMBA 2OTLP 2GZIA 2LIUA 3CPWO 3H1KG 3HTKB 2WSSH 5AVUB 2ZT9B 1HJBA 1YITP 1BE3E 1HJ0A 1WRGA 1BE3J 3B5NB 1GD2E 4ZKPA 1Y8AA 3L37A 1H89A 3MD0A 2FVEA 2E74D 3CE7A 3AE4C 1PEQA 5AW6B 2Q3IA 1VQLP 2PEIA 1SQPG 3CCVP 2LOLA 3TSIA 2OYIC 2WTYA 2Q7CA 2B9BA 5AW9B 3H0DA 1EXJA 3CCEP 3C1LA 1NAYA 3C9IA 2KGDA 3P7KA 2XT1A 4RJTA 1LT9C 2WSEJ 2R32A 1N7SC 2GM4A 3RL0D 2NO8A 4N6JA 4AUWA 2K0DX 4H44D 2A45H 3GJNA 2MVVA 2M0BA 3VYIA 3EJBA 2VLOA 4C7RA 3CX5E 2JDIH 4OVNF 3A0HH 5KP8B 1L0ND 2JU1A 1CI6B 5CZDB 2HODA 3PLNA 4H0LC 2ONTA 4U0BA 2QJPB 3MGNA 1ZR2A 1P84H 3M91A 5KLIC 2K9YA 2IBZE 4GR2A 3N4XA 3VMAA 3N7NA 3R4YA 1LP1A 1N86A 2ZFCA 2E43A 1Q81Q 2FYUK 4PD4I 2P67A 4W7ZA 2FACA 2N1TA 3KPEA 3A7OA 2QA4P 4PV1B 5KKZB 3HZQA 3W67A 1L0IA 2YIUB 3MUDA 3CCRP 2A45I 1CSBA 1BCCE 1BCCJ 4GODA 1A02F 2XU6A 3H6PA 3P8CE 3L70E 1FDMA 1SQVD 2VLPA 3L70J 1SQQD 1NU1K 3EJDA 1VQOP 1DIPA 2Z5IA 1P84I 1NYHA 1JJ2O 5B5EH 1VQ6P 1S4XA 1E0HA 1PGJA 3DS5A 3WBHA 1RF0A 3RK3D 3GZMA 2E75B 4DZOA 4C7NB 1NTKK 1X22A 1OW6A 2JB0A 2Y0DA 5APTA 1GZLA 1KFNA 4GOFA 3HUSB 5BU8B 2B87B 1YHQP 1HF9A 2KGAA 1WMKA 4N78D 4XA4A 1HGZA 3CC2P 2Y0CA 1JTHA 1PEOA 4LC1A 1GL2C 1SQXG 1YQ3C 2XNDH 2GZJA 2JU2A 5E79E 1OW8A 2PEOA 3SWFA 4EIJA 2BCCG 3TGUE 3BRVB 2H43A 3AE8C 4H2XC 2YKQA 1MZ9A 1FE6A 1S5LE 4WY4C 1IFMA 1ZMEC 3B4SA 3H1KD 2L5GB 1ZOYC 2K5XA 2QJYB 4U0DA 1NKNA 2YNYA 3L75E 4I7ZB 3G9RA 1L4AA 3L75J 1Q86Q 2JYGA 3G26A 2GZEA 1T8KA 1SFCA 1SQPD 1E79H 2H88C 3CXHD 4C46A 3UIAA 3D70A 1MZ8A 3R2PA 2FYUE 3H1HE 2FYUJ 5HVCA 1OVVA 3CLQA 3H1HJ 1JY2P 3SSUA 4H13C 3CCUP 1IMPA 2KZJA 2VSQA 1JY2O 1NTMK 3LIEA 3CCLP 1PEUA 3B71A 1RQVA 1QLED 3D71A 5B66E 3B8EB 4EI2A 2JO1A 3RG6C 2WZ7A 3DS2A 1GK6A 1PL5A 1LWUB 2WT7A 3Q3DA 3G6EP 3K5BA 2KSJA 3L35A 1NU1E 4H2WC 1NTZK 1BSHA 1NU1J 4XRQA 2ITAA 3OA7A 2IPPA 2OYIA 2OYHB 1URQB 3RBXA 5APSA 2QSIA 1L0LD 1OR5A 3SFEC 2B89A 3BCCG 3GHGC 2DGYA 1KILC 3O8ZA 4DG9A 1NJIQ 2MD9A 3HE4A 3RG2A 1NTKE 1GXHA 1NTKJ 1PV3A 1AF8A 4K3AA 4DCKA 1N2DC 2C0XA 2FYNC 3IAOA 5APYA 1JOCA 2L0QA 4Z1MH 2KS1B 2OYOA 4R0MA 4D6TD 1M74A 5AW8B 3LIDA 1GU5A 1H0TA 1DH3A 3ABVC 1NGMB 1GPJA 2JP3A 1GMJA 2QJKC 2CPSA 2XV5A 4U3FE 4U3FJ 1IMQA 1JNMA 2WSFH 1KTMA 1USDA 1KFMA 2IBZI 1N7SD 3M9QA 3EWKA 4B86A 4O9BA 4R4MA 1R8EA 4XROA 3D6ZA 4W80A 1JEKA 3T97B 1VQKP 1M90Q 2D2CB 4YTPC 4I2LC 1YIJP 2LPKA 3HE5B 3L73G 1G1JA 2ZAEB 3AE1C 2R3SA 3WUVA 4H0LD 2KB7P 3W68A 3HD7C 2QRXA 1ZNVA 2FQ1A 2X2BA 3H1JG 1NTME 2AFEA 5KJ7C 1S2EA 1NTMJ 5KLVK 2HLOA 1LTAC 4JF7A 2K9JB 3VN0A 3VTPC 1BE3G 3RK2D 1FZFA 3B5NA 2W6AA 2CPBA 1R5LA 2BEQD 3CWBE 3CWBJ 2FFDC 1NTZE 1NTZJ 2PEMA 4U0EA 2N1TC 4UHPB 3A0HE 1S5LH 4HH2A 2PFXA 5AVZB 5DCKA 5TISH 1VPCA 3MUDC 5BS2A 2XZ1C 3CXHH 3NFQA 1SS1A 3L71J 5AVSB 1S5LX 1LTSC 3U1CA 3G3ZA 2WMMA 5EJDA 2FHSC 1EZVE 3DS4A 5CCHC 2R44A 3S1KA 4Y99B 4HYTB 2ROQA 1RH5B 4QKOA 1RF0C 3AECC 1ZR4A 1CI6A 1KB9D 1QVGO 2YMKA 2JO0A 4WYMA 2M5AB 1RO0A 2Y9ZA 2IBZG 3VMXA 3GLMA 1X3OA 1GL2D 2BQ1E 2E76B 5B5EE 1E5WA 3TK1A 1KC8Q 2L9FA 2A06D 2OARA 2JWDA 1PGOA 2E5TA 2V7QH 1HTLC 2FXPA 3D6YA 3WU2H 2ZVNB 1A8OA 1BCCG 4WY4D 2WWWA 2P7JA 1BXIA 3GW6A 1J1EC 1EDKA 1U7MA 4HKZH 3L70G 3IF4A 1YTZI 1N73B 5HGMA 2POHA 4JBZA 3FGAD 1GTWA 1QL1A 3L4FA 3L36A 4OGQC 1Q82Q 4I6MC 5TJHA 4KHXA 5AVWB 3TNUA 2O1JA 2I8DA 1SQVK 1SQQK 2YMYA 4U0CA 3HRNA 3RK2B 5KLVE 3AE2C 2JYLA 5KLVJ 3OAKA 4H13D 1HH0A 1M1JC 3EQ2A 3HUSA 1Q2NA 2B87A 5I4TG 3AEEC 2AEJA 1GU4A 1FZCB 1FOSF 2OTJP 5F2KA 2OTKE 5CMZA 2HPCB 5DJUB 2PNGA 1FDOA 2VRSA 3A0BH 1YTZT 1ZRTD 2Y0EA 2HFED 1PFIA 3L73D 2M5RA 1NO4A 2IZ0A 5KP6B 2XZRA 1RQUA 2LF4A 1KILD 1T3UA 1EOQA 1IK7A 2R3CA 2GYKA 2YXRB 5F2OA 1KLPA 1AYIA 1R5SA 2WITA 1BE3D 4YPCA 3KYQA 3CCSP 3L75G 2JAZA 2K3RA 2KR5A 1MFTA 2NPSD 1KORA 2KG9A 2K94A 3HD7A 1D7MA 1L0NE 1Z56A 3H1HG 1VF5C 5KJ7A 1OWAA 3L74D 1KQLA 4XFZA 1FZAA 3WUTA 3FXDA 4UB8E 1F80D 5APWA 4BRYB 2L22A 4BPGA 3H25A 3CC4P 1FAVA 2LR2A 4UB6E 1LWUA 3BRTB 2FFDA 3TYYA 2FXMA 2H89C 1NU1G 2Q3EA 2KIKA 3CX5D 4WBAA 1HQBA 2XV6A 3V2RA 2OYHA 1URQA 1EMVA 1LTJB 3EJEA 1OFCX 1CZQA 5JPAA 1KB9H 3PRJA 1NOHA 2ZYDA 1FR2A 1SQVE 3M0AA 3V2PA 1SQQE 1SQVJ 1SQQJ 3V2QA 3P05A 4A7PA 1NTKG 3V5BA 2C0WA 1L0LK 2GA1A 1U7JA 2WSFJ 1G2CB 2YXQB 1BAJA 3RK3E 5CCHA 1FJKA 3II6A 1XTCC 1IFIA 4WB4A 1M8OB 1VQ7P 1KV4A 2KS1A 2KUBA 2JKVA 4L75A 2XXMA 4PXHB 1SP4A 2E74B 3QWOC 4TT3H 1EZVI 4N78E 1FU1A 2N1TD 2EHSA 2R5BA 1EIAA 1KB9I 4ASVA 3ZDMA 2W8ZA 2N5IA 1SVFA 1JO5A 1FZEA 3B5NC 4U3FG 2Y9YA 1MV8A 2KOSA 1QVFO 3DS3A 2RKLA 2AF8A 3GMAA 1PP9D 1PPJE 3RL0B 2KWLA 4PJ0H 3SFDC 1W5CE 2ZXXA 1FZBA 4N3YB 4H44B 1KN7A 2NPSB 1SQBD 3TGUJ 4DJGA 3GG2A 3V4QA 3MIWA 4GT1A 3TDKA 1VQ4P 5CBOA 3JSVC 1OVRA 5TISE 5EFWB 3MGEA 1MKMA 3H1LE 1PGPA 2KZIA 3H1LJ 2PEJA 1NTMG 1BGYE 4IFDK 1BGYJ 2J58A 2XKMA 3CXHE 2K2QA 1M1JA 1BDDA 3HYBA 1HGVA 3M1MA 1QEXA 3GF3A 2N9BA 2K9JA 2QJPC 2N50A 3B4QA 2A45G 3C8VA 1JCDA 2LKIA 2N6YA 3CWBG 5AW5B 4F37A 1NTZG 1T6AA 1RHZB 3L72E 1YI2P 3L72J 2ZYGA 2EHTA 1LTTC 2E1MA 4PV1C 2WPRA 2FXOA 5KKZC 4OGQD 2YIUC 2YO2A 3G21A 4TLFA 4ZKUA 3WMM0 1L0LE 2CNRA 2YKOA 1L0LJ 3L71G 3RK3B 4EYYQ 4PWVB 2V7QJ 2QIWA 2GDYA 3RGUA 1LP1B 1L4AD 2PRRA 3WU2E 1EZVG 3O6QB 3CI9A 4JYBA 1SFCD 4UB8H 1J2JB
chains in the Genus database with same CATH topology
3HZQA 2PENA 4U0CA 1M74A 3G4SP 1ZMBA 3CCQP 4IPYA 3CCRP 2OTLP 4U0DA 1M1KQ 3CPWO 5BS2A 1S72P 3CC4P 2JYLA 1RNIA 3LRYA 4COCA 1VQ8P 1Q86Q 2JYGA 1VQMP 3CMAP 3G0VA 3G26A 1YITP 2PEQA 2Z45A 4M0IA 2KODA 2CWOA 5I4TG 5HGNA 1VQOP 4U0FA 1VQ4P 1RO2A 2PY8A 3DS0A 1PEQA 3I55P 3CCMP 1VQLP 2PEIA 2XV6A 2OTJP 5F2KA 1JJ2O 3H4EA 3MGEA 3DS4A 5HGLA 2BHVA 1VQ6P 3CCVP 1VQ5P 3E2DA 5JPAA 3CCUP 2PEJA 3CCLP 1PEUA 1M6NA 3DS5A 3WBHA 1M6EX 4COPA 3H0DA 3CCEP 3OW2O 4XROA 1KD1Q 3P05A 3G71P 3CMEP 1QVGO 3RG6C 3HYBA 2JO0A 3M1MA 3VRLC 3DS2A 4WYMA 1VQNP 2EG5A 1KQSO 1RO0A 1N8RQ 1VQKP 2XT1A 1M90Q 2P9XA 3G6EP 4QNBA 5F2NA 2LF4A 1YIJP 2M8NA 1IUQA 2BQ1E 1EOQA 2L6EA 1BAJA 1YHQP 1Q7YQ 2PEKA 1VQ9P 1YJNP 1K73Q 3DPHA 4XRQA 3Q20A 1KC8Q 4GR6A 2OARA 1PEMA 1AUMA 1A43A 1YI2P 1K9MQ 3CC7P 3CC2P 4PH0A 3B5IA 1VQ7P 2QEXP 4U0AA 5F2OA 2Z46A 1PEOA 2E1MA 3G1GA 1K30A 2EIAA 1W2BO 2DGYA 2XXMA 1QRJA 3NTEA 1K8AQ 1NJIQ 2EFJA 3CCJP 3CCSP 1A8OA 2BUOA 2PEOA 3G21A 1EIAA 2ONTA 4U0BA 5BS1A 3DTJA 3I56P 3CXCO 4XFYA 2Z44A 4GR2A 1YJWP 3CD6P 3G1IA 1YJ9P 5HGOA 2M8PA 1E6JP 3H47A 5HGMA 3G28A 1Q81Q 1Q82Q 2PEMA 4U0EA 3G29A 1QVFO 4PH1A 4XFZA 3DS3A 1VQPP 3DS1A 2QA4P 1D1DA 5DCKA 2M8LA 4XFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ P;  1JJ2 O;  1YHQ P;  1VQ9 P;  1Q7Y Q;  3G4S P;  1VQ6 P;  3CCV P;  1YJN P;  3CCQ P;  3CCR P;  1VQ5 P;  1K73 Q;  3I56 P;  3CXC O;  2OTL P;  3CCU P;  1KC8 Q;  1YJW P;  1M1K Q;  3CPW O;  1YJ9 P;  3CD6 P;  1S72 P;  3CC4 P;  3CCL P;  1K9M Q;  1YI2 P;  3CC7 P;  1VQ8 P;  1Q86 Q;  3CC2 P;  3CCE P;  3OW2 O;  1VQM P;  1VQ7 P;  1KD1 Q;  3CMA P;  2QEX P;  1YIT P;  3G71 P;  1Q81 Q;  1QVG O;  3CME P;  1Q82 Q;  1VQN P;  1KQS O;  1N8R Q;  1VQK P;  1W2B O;  1VQO P;  1QVF O;  1M90 Q;  1VQ4 P;  1VQP P;  1K8A Q;  1NJI Q;  2QA4 P;  3G6E P;  3CCJ P;  3I55 P;  3CCM P;  3CCS P;  1VQL P;  1YIJ P; 
#chains in the Genus database with same CATH topology
 2E75 C;  4Y28 J;  3LRY A;  2M5A A;  2LTE A;  2AFD A;  4KT0 J;  3IR9 A;  4UB6 H;  2E42 A;  2JEE A;  1S1C X;  3HUS C;  2FQ2 A;  4D6T E;  1RY3 A;  4D6T J;  2BAS A;  2E5Y A;  2IFM A;  4RES B;  5K5G B;  2AEF A;  3H4E A;  2BHV A;  2QM8 A;  2R5D A;  2KNC A;  3SWY A;  5KAI E;  2V4H A;  1NTK D;  2P2U A;  5HV8 A;  1IJD B;  2LXC B;  3A5T A;  3M9H A;  2CQ8 A;  4YXD C;  1N73 A;  1Q7Y Q;  2PEK A;  3AE6 C;  3MP7 B;  2JJL A;  3VP8 A;  1PEM A;  1K9M Q;  3A0B E;  1S9K D;  1HWT C;  2G3A A;  2ZXE B;  5DJT B;  5AVQ B;  1K30 A;  1H88 A;  4MRT C;  1OX3 A;  1JTH B;  1QRJ A;  2JBG A;  2J5U A;  5KLV G;  2EFJ A;  1VF5 D;  2QJY C;  4BPH A;  1BDC A;  2K37 A;  1AV1 A;  2ZVO B;  4I7Z C;  3USS A;  2Z44 A;  1M57 D;  1JY3 N;  5HGO A;  5GTI H;  1RF1 B;  2JGP A;  1SQX D;  2KOR A;  1PGQ A;  4GDO A;  4ASW A;  2IX7 C;  2OGU A;  1FZC A;  4PH1 A;  1VQP P;  2BCC D;  3IN6 A;  2HPC A;  2M8L A;  3HTK A;  2KLU A;  3EFG A;  2QM7 A;  1AA0 A;  2L4B A;  1S72 P;  4M3L A;  2QG4 A;  1VQ8 P;  2GDW A;  1IC2 A;  1LWU C;  2JR8 A;  2K0X A;  4EDF A;  1J1D C;  2PEQ A;  1L4A B;  2KOG A;  4HKG A;  1USE A;  3PHL A;  4NPF X;  3JC2 2;  4U0F A;  1SFC B;  1DX7 A;  1RO2 A;  3LW5 H;  2KOP A;  1JCC A;  5H2F H;  4PD4 D;  4NPE A;  4ZMD A;  4K35 A;  4R4L A;  2OYH C;  1URQ C;  3E2D A;  2FVF A;  3OW2 O;  2RMZ A;  1KQS O;  2AXT H;  2FBW C;  3M0D A;  1IFJ A;  3M06 A;  3F5H A;  2NRG A;  2WT7 B;  2HR3 A;  1YJN P;  1KB9 E;  1VL2 A;  2SPZ A;  4GR6 A;  2O3J A;  1P84 D;  1KZU B;  2WPQ A;  2OYI B;  3B5N D;  3GZL A;  4OH8 B;  2Q6Q A;  3U43 A;  2AXC A;  1IFN A;  1LJ2 A;  1DEB A;  2KOQ A;  3L71 D;  5AW2 B;  1T3J A;  2A06 E;  3ITK A;  1LT9 B;  1EDI A;  3DTJ A;  1N7S B;  1L0N K;  4L73 A;  3I56 P;  4XFY A;  3F89 A;  1YYC A;  3CXH I;  3VMY A;  3HE4 B;  2I1K A;  3BCC D;  1OIP A;  1DD3 A;  4YXW H;  3G28 A;  1AVY A;  1JM0 A;  3PTZ A;  3MTU E;  1D1D A;  4XFX A;  1SQV G;  1SQQ G;  2XNX A;  1IK9 A;  2FYZ A;  1IZN B;  5BU5 A;  4H0L B;  5KLI B;  3CMA P;  2K0Y A;  3H32 B;  7CEI A;  1KYO D;  1PZQ A;  1AQT A;  4IFF A;  2D2C C;  1G2C A;  2CK3 H;  2PGD A;  2C9L Y;  3AED C;  3WUU A;  2PY8 A;  1VDF A;  3H1I E;  1AJY A;  3H1I J;  4PJ0 E;  2LML A;  2KG8 A;  4GOE A;  5KAI H;  4C7N A;  4COP A;  5BVZ A;  1KD1 Q;  4IL6 H;  1UNK A;  2FQ0 A;  1G1I A;  2IDB A;  1N8R Q;  5C39 A;  3KZI H;  1ZXG A;  4PV1 D;  2NZ2 A;  1SLQ A;  5AVY B;  3PH0 A;  1ZRT E;  3Q20 A;  1QX8 A;  2M3B A;  1DEE G;  3FWN A;  5AW4 B;  3MZW B;  1KMI Z;  2Z4E A;  2P10 A;  1PPJ G;  4IOI H;  2WVR A;  1KIL E;  1EDJ A;  1W2B O;  2Z5H A;  3AE3 C;  4RO0 A;  1W2E A;  4LGD E;  2BUO A;  3TGU G;  1ZW0 A;  1FJP A;  3H1J D;  1BSN A;  1FS0 E;  5AVV B;  1DV5 A;  2KW2 A;  3E7K A;  2E75 D;  5KAF H;  1SQB K;  2UWJ E;  3H1L G;  4EOT A;  3DS1 A;  4XE5 B;  4Y99 C;  1T8Z A;  3NXS A;  1BGY G;  2KLV A;  2IZ1 A;  5CBN A;  1GL2 B;  2MVU A;  4CPG A;  2PEN A;  4MN4 C;  2FY8 A;  4AYC A;  1NQ4 A;  3Q2Y A;  2L91 A;  2YO3 A;  1OW7 A;  2KP8 A;  4IZ6 A;  1VQM P;  3L74 E;  5APV A;  3L74 J;  3TF5 A;  1L0N J;  2FYU G;  4PD4 H;  2LXB A;  4HJG H;  2CWO A;  3GF7 A;  2E76 C;  5AVX B;  3L72 G;  1SQP K;  4WY4 B;  3GKL C;  4GKG A;  5HGL A;  1FDI A;  1VQ5 P;  1RE4 C;  3P8M C;  4BPF A;  3JCU H;  1M6N A;  1NVO A;  1M7L A;  4AQR D;  2N6Z A;  3BVH A;  3VOP A;  2CGQ A;  3A2A A;  3CME P;  3LMO A;  2RN0 A;  1VQN P;  2BEZ F;  2MF4 A;  2H7H A;  1L0L G;  3VP9 A;  5AW3 B;  2M8N A;  1FBM A;  1N73 C;  1K73 Q;  3O6Q A;  1A02 J;  4PH0 A;  1EQ7 A;  4H13 B;  2MR7 A;  2W27 A;  2IBZ D;  2XZ0 D;  2VLN A;  2W6J H;  3SWK A;  2N98 A;  3HD7 D;  3NTE A;  1K8A Q;  3RK2 C;  5KJ7 D;  1QL2 A;  1ZLL A;  3IFM A;  2LL8 A;  5CJ4 A;  1UII A;  3Q1M A;  1OXZ A;  1VKU A;  4D6T G;  2K92 A;  4XFJ A;  2WPT A;  2WSC H;  4NPD A;  1JUN A;  3I5C A;  2VLQ A;  3AE5 C;  1BCC D;  1K04 A;  1FZC C;  2FAD A;  3G29 A;  2P1J A;  1JB0 J;  3S4R A;  1UJZ A;  3FX0 A;  1NHL A;  2GZF A;  2K93 A;  3P8C D;  3BAT A;  3L70 D;  4KJM A;  1LNQ A;  3GHG B;  1KIL B;  3OJA B;  3TNU B;  3E1R A;  2ZT9 C;  3U1A A;  1KYO H;  1CW5 A;  5GTI E;  4COC A;  1URQ D;  5AVR B;  4DT0 A;  2W83 C;  2DNW A;  1PP9 E;  5CCG C;  4L76 A;  2W90 A;  2Z45 A;  1PP9 J;  2KOD A;  2FYN B;  5HGN A;  1GW4 A;  4W7Y A;  2O01 H;  3I55 P;  5L8R J;  5GTH H;  1SQB E;  1JMB A;  5EW5 E;  1SQB J;  1HBW A;  1ZN5 A;  4WVZ A;  1GDT A;  2CG5 B;  3T97 A;  2O1K A;  5CCH D;  3CL3 D;  1NAF A;  2IFN A;  3H1K E;  1AFO A;  2EG5 A;  3H1K J;  5CHX A;  2QJK B;  3HE5 A;  2P9X A;  2MR8 A;  3M0D C;  3LW5 J;  5F2N A;  1JMM A;  5H2F E;  3P32 A;  1IUQ A;  2AVA A;  2IYP A;  4QMA A;  1KYO I;  1RF1 A;  1T2K C;  2O01 N;  2Q1K A;  3DPH A;  2ZJS E;  1PPJ D;  3NMD A;  2KYV A;  1AUM A;  2MY5 A;  1A43 A;  1SQP E;  1SQP J;  3TGU D;  4IFM A;  1SQX K;  2MJZ A;  2AXT E;  1AQ5 A;  2KG6 A;  2MKV A;  3A3Y B;  3CCJ P;  1LTG C;  2I1J A;  5BS1 A;  4H2Y C;  1HUC A;  3CXC O;  3CD6 P;  1S3J A;  4L74 A;  3H1L D;  3PP5 A;  1E6J P;  1BGY D;  3L75 D;  3S9O A;  3HD7 B;  1LTJ C;  2D2C D;  1GK4 A;  1KQG B;  2ZYA A;  3PJS K;  1TU3 F;  4IPY A;  2HOD B;  3Q5S A;  3Q5P A;  2FYU D;  3H1H D;  2FKW B;  2QE7 H;  3L72 D;  1UIX A;  2LIW A;  1VHN A;  1HY8 A;  4U7J A;  2FFD B;  2WSE H;  1J1D B;  1H8A A;  1CEI A;  2PP6 A;  5KTB A;  2KK7 A;  2KSE A;  2N1T B;  4BWN A;  1JY2 N;  2YKP A;  1RE3 C;  3U59 A;  1AVO A;  2JWA A;  1NU1 D;  3G71 P;  2E74 C;  2AEM A;  2A06 G;  5APX A;  3MHV A;  1GXG A;  3CX5 H;  1LT9 A;  1N7S A;  1LTI C;  3KXD A;  4LLH A;  2JQ4 A;  2WPV B;  1ACP A;  1RE4 A;  4BXL A;  3CC7 P;  2GDX A;  3B5I A;  4IL6 E;  1DNY A;  3V4W A;  2HYN A;  2FVA A;  3RL0 C;  3KZI E;  5CJ0 A;  3AEF C;  1U57 A;  5APU A;  3KHU A;  3FXE A;  1Y9B A;  1YBK A;  4H44 C;  2NPS C;  1S9K E;  3H32 A;  3G1I A;  1GW3 A;  1JY3 P;  3H47 A;  1MFZ A;  1JY3 O;  2RH0 A;  3CX5 I;  2OQQ A;  2LKM A;  1OMI A;  4ZNC A;  3H1I G;  3Q5R A;  2KXP B;  3NY7 B;  4OWF A;  2GZG A;  1IFD A;  1ZP0 C;  4DOJ A;  3FWL A;  4U3F D;  2E76 D;  4RKU J;  3G4S P;  1SQX E;  1SQX J;  3V2N A;  1X0T A;  1QGK B;  1J1E B;  3G0V A;  5KAF E;  2BCC E;  1FZG A;  2BCC J;  5AVT B;  2B88 A;  4M0I A;  1HVV A;  3DS0 A;  4OGQ B;  3QH9 A;  1LGH B;  2WPS A;  2W6B A;  5AW7 B;  1L2P A;  3KDP B;  3VMZ A;  2GUV A;  1EXI A;  3VRL C;  2QVA A;  5CCG A;  4PD4 E;  1M56 D;  1M1J B;  4QNB A;  5KP7 B;  5E79 H;  1NTM D;  1IO4 A;  2L6E A;  1VQ9 P;  2WQY C;  1X8Y A;  2ERH A;  3RK3 C;  2HG5 D;  1K05 A;  1KQF B;  5M1B A;  1DD4 A;  3JCU E;  2GUS A;  2QEX P;  3E1I A;  2N9Y B;  1EC5 A;  4U0A A;  1Q90 D;  1GL2 A;  2EIA A;  3CWB D;  1MUU A;  3KQG A;  1NTZ D;  1P84 E;  3L74 G;  2N5H A;  1L0N G;  1YJW P;  1YJ9 P;  2M8P A;  2ZT9 D;  2QNW A;  2G8Y A;  4GIF A;  3M9B A;  3L71 E;  4WY4 A;  4BRY A;  2XDJ A;  5CCG D;  2Q9I A;  1EDL A;  1NH4 A;  3NTN A;  3BCC E;  1X79 B;  3BCC J;  1OVU A;  3CCQ P;  3RBZ A;  5APQ A;  1M1K Q;  1RNI A;  2KGE A;  1EZV D;  2FAE A;  5B66 H;  2KOO A;  2M8R A;  2M3E A;  2WSC J;  3AE9 C;  2J59 M;  2K1A A;  1LTJ A;  3AE7 C;  1VF5 B;  3CCM P;  3RL0 g;  2IYO A;  1PIX A;  1KYO E;  2Q5U A;  4WWI A;  1T2K D;  4JQ0 D;  1M6E X;  1IFP A;  1ZV8 A;  2H8P D;  2KNC B;  2DW3 A;  1NKZ B;  1H0T B;  5AW1 B;  1XTG B;  4JPZ B;  1NWQ A;  2C9N Y;  4NEO A;  1N7L A;  3EFF K;  2O01 J;  5GTH E;  3AEA C;  1Y47 A;  1RE3 A;  1RF1 C;  4I1L A;  1LTB C;  2K88 A;  2PAJ A;  2KGC A;  2Z46 A;  3AEB C;  3GHG A;  3G1G A;  1KIL A;  1FOS E;  3AEG C;  2P58 A;  1YQ4 C;  3H1I D;  1PP9 G;  5AW0 B;  4CA3 A;  1L4A C;  4HB1 A;  3L73 E;  1OZH A;  3BAS A;  3L73 J;  1SFC C;  5KLV D;  4IL6 X;  2KI7 B;  1LT1 A;  1SQB G;  1FC2 C;  1L0H A;  1X9V A;  3H1J E;  1WT6 A;  4JYC A;  1Z6M A;  3H1J J;  2NPS A;  3V6I A;  1ZMB A;  2OTL P;  2GZI A;  2LIU A;  3CPW O;  3H1K G;  3HTK B;  2WSS H;  5AVU B;  2ZT9 B;  1HJB A;  1YIT P;  1BE3 E;  1HJ0 A;  1WRG A;  1BE3 J;  3B5N B;  1GD2 E;  4ZKP A;  1Y8A A;  3L37 A;  1H89 A;  3MD0 A;  2FVE A;  2E74 D;  3CE7 A;  3AE4 C;  1PEQ A;  5AW6 B;  2Q3I A;  1VQL P;  2PEI A;  1SQP G;  3CCV P;  2LOL A;  3TSI A;  2OYI C;  2WTY A;  2Q7C A;  2B9B A;  5AW9 B;  3H0D A;  1EXJ A;  3CCE P;  3C1L A;  1NAY A;  3C9I A;  2KGD A;  3P7K A;  2XT1 A;  4RJT A;  1LT9 C;  2WSE J;  2R32 A;  1N7S C;  2GM4 A;  3RL0 D;  2NO8 A;  4N6J A;  4AUW A;  2K0D X;  4H44 D;  2A45 H;  3GJN A;  2MVV A;  2M0B A;  3VYI A;  3EJB A;  2VLO A;  4C7R A;  3CX5 E;  2JDI H;  4OVN F;  3A0H H;  5KP8 B;  1L0N D;  2JU1 A;  1CI6 B;  5CZD B;  2HOD A;  3PLN A;  4H0L C;  2ONT A;  4U0B A;  2QJP B;  3MGN A;  1ZR2 A;  1P84 H;  3M91 A;  5KLI C;  2K9Y A;  2IBZ E;  4GR2 A;  3N4X A;  3VMA A;  3N7N A;  3R4Y A;  1LP1 A;  1N86 A;  2ZFC A;  2E43 A;  1Q81 Q;  2FYU K;  4PD4 I;  2P67 A;  4W7Z A;  2FAC A;  2N1T A;  3KPE A;  3A7O A;  2QA4 P;  4PV1 B;  5KKZ B;  3HZQ A;  3W67 A;  1L0I A;  2YIU B;  3MUD A;  3CCR P;  2A45 I;  1CSB A;  1BCC E;  1BCC J;  4GOD A;  1A02 F;  2XU6 A;  3H6P A;  3P8C E;  3L70 E;  1FDM A;  1SQV D;  2VLP A;  3L70 J;  1SQQ D;  1NU1 K;  3EJD A;  1VQO P;  1DIP A;  2Z5I A;  1P84 I;  1NYH A;  1JJ2 O;  5B5E H;  1VQ6 P;  1S4X A;  1E0H A;  1PGJ A;  3DS5 A;  3WBH A;  1RF0 A;  3RK3 D;  3GZM A;  2E75 B;  4DZO A;  4C7N B;  1NTK K;  1X22 A;  1OW6 A;  2JB0 A;  2Y0D A;  5APT A;  1GZL A;  1KFN A;  4GOF A;  3HUS B;  5BU8 B;  2B87 B;  1YHQ P;  1HF9 A;  2KGA A;  1WMK A;  4N78 D;  4XA4 A;  1HGZ A;  3CC2 P;  2Y0C A;  1JTH A;  1PEO A;  4LC1 A;  1GL2 C;  1SQX G;  1YQ3 C;  2XND H;  2GZJ A;  2JU2 A;  5E79 E;  1OW8 A;  2PEO A;  3SWF A;  4EIJ A;  2BCC G;  3TGU E;  3BRV B;  2H43 A;  3AE8 C;  4H2X C;  2YKQ A;  1MZ9 A;  1FE6 A;  1S5L E;  4WY4 C;  1IFM A;  1ZME C;  3B4S A;  3H1K D;  2L5G B;  1ZOY C;  2K5X A;  2QJY B;  4U0D A;  1NKN A;  2YNY A;  3L75 E;  4I7Z B;  3G9R A;  1L4A A;  3L75 J;  1Q86 Q;  2JYG A;  3G26 A;  2GZE A;  1T8K A;  1SFC A;  1SQP D;  1E79 H;  2H88 C;  3CXH D;  4C46 A;  3UIA A;  3D70 A;  1MZ8 A;  3R2P A;  2FYU E;  3H1H E;  2FYU J;  5HVC A;  1OVV A;  3CLQ A;  3H1H J;  1JY2 P;  3SSU A;  4H13 C;  3CCU P;  1IMP A;  2KZJ A;  2VSQ A;  1JY2 O;  1NTM K;  3LIE A;  3CCL P;  1PEU A;  3B71 A;  1RQV A;  1QLE D;  3D71 A;  5B66 E;  3B8E B;  4EI2 A;  2JO1 A;  3RG6 C;  2WZ7 A;  3DS2 A;  1GK6 A;  1PL5 A;  1LWU B;  2WT7 A;  3Q3D A;  3G6E P;  3K5B A;  2KSJ A;  3L35 A;  1NU1 E;  4H2W C;  1NTZ K;  1BSH A;  1NU1 J;  4XRQ A;  2ITA A;  3OA7 A;  2IPP A;  2OYI A;  2OYH B;  1URQ B;  3RBX A;  5APS A;  2QSI A;  1L0L D;  1OR5 A;  3SFE C;  2B89 A;  3BCC G;  3GHG C;  2DGY A;  1KIL C;  3O8Z A;  4DG9 A;  1NJI Q;  2MD9 A;  3HE4 A;  3RG2 A;  1NTK E;  1GXH A;  1NTK J;  1PV3 A;  1AF8 A;  4K3A A;  4DCK A;  1N2D C;  2C0X A;  2FYN C;  3IAO A;  5APY A;  1JOC A;  2L0Q A;  4Z1M H;  2KS1 B;  2OYO A;  4R0M A;  4D6T D;  1M74 A;  5AW8 B;  3LID A;  1GU5 A;  1H0T A;  1DH3 A;  3ABV C;  1NGM B;  1GPJ A;  2JP3 A;  1GMJ A;  2QJK C;  2CPS A;  2XV5 A;  4U3F E;  4U3F J;  1IMQ A;  1JNM A;  2WSF H;  1KTM A;  1USD A;  1KFM A;  2IBZ I;  1N7S D;  3M9Q A;  3EWK A;  4B86 A;  4O9B A;  4R4M A;  1R8E A;  4XRO A;  3D6Z A;  4W80 A;  1JEK A;  3T97 B;  1VQK P;  1M90 Q;  2D2C B;  4YTP C;  4I2L C;  1YIJ P;  2LPK A;  3HE5 B;  3L73 G;  1G1J A;  2ZAE B;  3AE1 C;  2R3S A;  3WUV A;  4H0L D;  2KB7 P;  3W68 A;  3HD7 C;  2QRX A;  1ZNV A;  2FQ1 A;  2X2B A;  3H1J G;  1NTM E;  2AFE A;  5KJ7 C;  1S2E A;  1NTM J;  5KLV K;  2HLO A;  1LTA C;  4JF7 A;  2K9J B;  3VN0 A;  3VTP C;  1BE3 G;  3RK2 D;  1FZF A;  3B5N A;  2W6A A;  2CPB A;  1R5L A;  2BEQ D;  3CWB E;  3CWB J;  2FFD C;  1NTZ E;  1NTZ J;  2PEM A;  4U0E A;  2N1T C;  4UHP B;  3A0H E;  1S5L H;  4HH2 A;  2PFX A;  5AVZ B;  5DCK A;  5TIS H;  1VPC A;  3MUD C;  5BS2 A;  2XZ1 C;  3CXH H;  3NFQ A;  1SS1 A;  3L71 J;  5AVS B;  1S5L X;  1LTS C;  3U1C A;  3G3Z A;  2WMM A;  5EJD A;  2FHS C;  1EZV E;  3DS4 A;  5CCH C;  2R44 A;  3S1K A;  4Y99 B;  4HYT B;  2ROQ A;  1RH5 B;  4QKO A;  1RF0 C;  3AEC C;  1ZR4 A;  1CI6 A;  1KB9 D;  1QVG O;  2YMK A;  2JO0 A;  4WYM A;  2M5A B;  1RO0 A;  2Y9Z A;  2IBZ G;  3VMX A;  3GLM A;  1X3O A;  1GL2 D;  2BQ1 E;  2E76 B;  5B5E E;  1E5W A;  3TK1 A;  1KC8 Q;  2L9F A;  2A06 D;  2OAR A;  2JWD A;  1PGO A;  2E5T A;  2V7Q H;  1HTL C;  2FXP A;  3D6Y A;  3WU2 H;  2ZVN B;  1A8O A;  1BCC G;  4WY4 D;  2WWW A;  2P7J A;  1BXI A;  3GW6 A;  1J1E C;  1EDK A;  1U7M A;  4HKZ H;  3L70 G;  3IF4 A;  1YTZ I;  1N73 B;  5HGM A;  2POH A;  4JBZ A;  3FGA D;  1GTW A;  1QL1 A;  3L4F A;  3L36 A;  4OGQ C;  1Q82 Q;  4I6M C;  5TJH A;  4KHX A;  5AVW B;  3TNU A;  2O1J A;  2I8D A;  1SQV K;  1SQQ K;  2YMY A;  4U0C A;  3HRN A;  3RK2 B;  5KLV E;  3AE2 C;  2JYL A;  5KLV J;  3OAK A;  4H13 D;  1HH0 A;  1M1J C;  3EQ2 A;  3HUS A;  1Q2N A;  2B87 A;  5I4T G;  3AEE C;  2AEJ A;  1GU4 A;  1FZC B;  1FOS F;  2OTJ P;  5F2K A;  2OTK E;  5CMZ A;  2HPC B;  5DJU B;  2PNG A;  1FDO A;  2VRS A;  3A0B H;  1YTZ T;  1ZRT D;  2Y0E A;  2HFE D;  1PFI A;  3L73 D;  2M5R A;  1NO4 A;  2IZ0 A;  5KP6 B;  2XZR A;  1RQU A;  2LF4 A;  1KIL D;  1T3U A;  1EOQ A;  1IK7 A;  2R3C A;  2GYK A;  2YXR B;  5F2O A;  1KLP A;  1AYI A;  1R5S A;  2WIT A;  1BE3 D;  4YPC A;  3KYQ A;  3CCS P;  3L75 G;  2JAZ A;  2K3R A;  2KR5 A;  1MFT A;  2NPS D;  1KOR A;  2KG9 A;  2K94 A;  3HD7 A;  1D7M A;  1L0N E;  1Z56 A;  3H1H G;  1VF5 C;  5KJ7 A;  1OWA A;  3L74 D;  1KQL A;  4XFZ A;  1FZA A;  3WUT A;  3FXD A;  4UB8 E;  1F80 D;  5APW A;  4BRY B;  2L22 A;  4BPG A;  3H25 A;  3CC4 P;  1FAV A;  2LR2 A;  4UB6 E;  1LWU A;  3BRT B;  2FFD A;  3TYY A;  2FXM A;  2H89 C;  1NU1 G;  2Q3E A;  2KIK A;  3CX5 D;  4WBA A;  1HQB A;  2XV6 A;  3V2R A;  2OYH A;  1URQ A;  1EMV A;  1LTJ B;  3EJE A;  1OFC X;  1CZQ A;  5JPA A;  1KB9 H;  3PRJ A;  1NOH A;  2ZYD A;  1FR2 A;  1SQV E;  3M0A A;  3V2P A;  1SQQ E;  1SQV J;  1SQQ J;  3V2Q A;  3P05 A;  4A7P A;  1NTK G;  3V5B A;  2C0W A;  1L0L K;  2GA1 A;  1U7J A;  2WSF J;  1G2C B;  2YXQ B;  1BAJ A;  3RK3 E;  5CCH A;  1FJK A;  3II6 A;  1XTC C;  1IFI A;  4WB4 A;  1M8O B;  1VQ7 P;  1KV4 A;  2KS1 A;  2KUB A;  2JKV A;  4L75 A;  2XXM A;  4PXH B;  1SP4 A;  2E74 B;  3QWO C;  4TT3 H;  1EZV I;  4N78 E;  1FU1 A;  2N1T D;  2EHS A;  2R5B A;  1EIA A;  1KB9 I;  4ASV A;  3ZDM A;  2W8Z A;  2N5I A;  1SVF A;  1JO5 A;  1FZE A;  3B5N C;  4U3F G;  2Y9Y A;  1MV8 A;  2KOS A;  1QVF O;  3DS3 A;  2RKL A;  2AF8 A;  3GMA A;  1PP9 D;  1PPJ E;  3RL0 B;  2KWL A;  4PJ0 H;  3SFD C;  1W5C E;  2ZXX A;  1FZB A;  4N3Y B;  4H44 B;  1KN7 A;  2NPS B;  1SQB D;  3TGU J;  4DJG A;  3GG2 A;  3V4Q A;  3MIW A;  4GT1 A;  3TDK A;  1VQ4 P;  5CBO A;  3JSV C;  1OVR A;  5TIS E;  5EFW B;  3MGE A;  1MKM A;  3H1L E;  1PGP A;  2KZI A;  3H1L J;  2PEJ A;  1NTM G;  1BGY E;  4IFD K;  1BGY J;  2J58 A;  2XKM A;  3CXH E;  2K2Q A;  1M1J A;  1BDD A;  3HYB A;  1HGV A;  3M1M A;  1QEX A;  3GF3 A;  2N9B A;  2K9J A;  2QJP C;  2N50 A;  3B4Q A;  2A45 G;  3C8V A;  1JCD A;  2LKI A;  2N6Y A;  3CWB G;  5AW5 B;  4F37 A;  1NTZ G;  1T6A A;  1RHZ B;  3L72 E;  1YI2 P;  3L72 J;  2ZYG A;  2EHT A;  1LTT C;  2E1M A;  4PV1 C;  2WPR A;  2FXO A;  5KKZ C;  4OGQ D;  2YIU C;  2YO2 A;  3G21 A;  4TLF A;  4ZKU A;  3WMM 0;  1L0L E;  2CNR A;  2YKO A;  1L0L J;  3L71 G;  3RK3 B;  4EYY Q;  4PWV B;  2V7Q J;  2QIW A;  2GDY A;  3RGU A;  1LP1 B;  1L4A D;  2PRR A;  3WU2 E;  1EZV G;  3O6Q B;  3CI9 A;  4JYB A;  1SFC D;  4UB8 H;  1J2J B; 
#chains in the Genus database with same CATH homology
 3HZQ A;  2PEN A;  4U0C A;  1M74 A;  3G4S P;  1ZMB A;  3CCQ P;  4IPY A;  3CCR P;  2OTL P;  4U0D A;  1M1K Q;  3CPW O;  5BS2 A;  1S72 P;  3CC4 P;  2JYL A;  1RNI A;  3LRY A;  4COC A;  1VQ8 P;  1Q86 Q;  2JYG A;  1VQM P;  3CMA P;  3G0V A;  3G26 A;  1YIT P;  2PEQ A;  2Z45 A;  4M0I A;  2KOD A;  2CWO A;  5I4T G;  5HGN A;  1VQO P;  4U0F A;  1VQ4 P;  1RO2 A;  2PY8 A;  3DS0 A;  1PEQ A;  3I55 P;  3CCM P;  1VQL P;  2PEI A;  2XV6 A;  2OTJ P;  5F2K A;  1JJ2 O;  3H4E A;  3MGE A;  3DS4 A;  5HGL A;  2BHV A;  1VQ6 P;  3CCV P;  1VQ5 P;  3E2D A;  5JPA A;  3CCU P;  2PEJ A;  3CCL P;  1PEU A;  1M6N A;  3DS5 A;  3WBH A;  1M6E X;  4COP A;  3H0D A;  3CCE P;  3OW2 O;  4XRO A;  1KD1 Q;  3P05 A;  3G71 P;  3CME P;  1QVG O;  3RG6 C;  3HYB A;  2JO0 A;  3M1M A;  3VRL C;  3DS2 A;  4WYM A;  1VQN P;  2EG5 A;  1KQS O;  1RO0 A;  1N8R Q;  1VQK P;  2XT1 A;  1M90 Q;  2P9X A;  3G6E P;  4QNB A;  5F2N A;  2LF4 A;  1YIJ P;  2M8N A;  1IUQ A;  2BQ1 E;  1EOQ A;  2L6E A;  1BAJ A;  1YHQ P;  1Q7Y Q;  2PEK A;  1VQ9 P;  1YJN P;  1K73 Q;  3DPH A;  4XRQ A;  3Q20 A;  1KC8 Q;  4GR6 A;  2OAR A;  1PEM A;  1AUM A;  1A43 A;  1YI2 P;  1K9M Q;  3CC7 P;  3CC2 P;  4PH0 A;  3B5I A;  1VQ7 P;  2QEX P;  4U0A A;  5F2O A;  2Z46 A;  1PEO A;  2E1M A;  3G1G A;  1K30 A;  2EIA A;  1W2B O;  2DGY A;  2XXM A;  1QRJ A;  3NTE A;  1K8A Q;  1NJI Q;  2EFJ A;  3CCJ P;  3CCS P;  1A8O A;  2BUO A;  2PEO A;  3G21 A;  1EIA A;  2ONT A;  4U0B A;  5BS1 A;  3DTJ A;  3I56 P;  3CXC O;  4XFY A;  2Z44 A;  4GR2 A;  1YJW P;  3CD6 P;  3G1I A;  1YJ9 P;  5HGO A;  2M8P A;  1E6J P;  3H47 A;  5HGM A;  3G28 A;  1Q81 Q;  1Q82 Q;  2PEM A;  4U0E A;  3G29 A;  1QVF O;  4PH1 A;  4XFZ A;  3DS3 A;  1VQP P;  3DS1 A;  2QA4 P;  1D1D A;  5DCK A;  2M8L A;  4XFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...