3I56P

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3i56P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3i56P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3i56P02
1VQ5P 1QVGO 1VQ7P 3G6EP 1K9MQ 1M1KQ 1M90Q 3CXCO 1VQNP 3CD6P 1YITP 1VQ9P 3CCMP 3CC4P 1YI2P 3G71P 1VQ8P 1YHQP 3CPWO 1VQOP 1YJ9P 1KC8Q 3I55P 3CCUP 1NJIQ 1VQLP 3CCRP 3CCSP 1KQSO 3CCJP 3CMEP 3CCVP 3I56P 3OW2O 1Q7YQ 1KD1Q 1Q82Q 3CC2P 1VQ4P 1YIJP 2QA4P 1YJNP 1JJ2O 3CCEP 1YJWP 3CCLP 3CMAP 1S72P 1N8RQ 1VQ6P 1VQPP 2OTJP 1K8AQ 1VQKP 2QEXP 1VQMP 1Q86Q 2OTLP 1W2BO 1QVFO 3CCQP 1Q81Q 3CC7P 3G4SP 1K73Q
chains in the Genus database with same CATH superfamily
2GUSA 3C1LA 2Q1KA 3F5HA 3FWNA 2XZRA 3IFMA 1EZVI 1KQFB 1PZQA 2KLVA 2QJYC 2ZJSE 4XE5B 1SP4A 3NMDA 3TNUA 2O01N 1DV5A 4EDFA 4I2LC 2ZFCA 4U0BA 2FADA 1G2CB 1SQPD 3L75J 1J1DC 4DCKA 5KLIB 2GZIA 1OIPA 3S4RA 3GF3A 5AVVB 3SWYA 4HYTB 2QG4A 5CZDB 2OYOA 3B5NC 1ZW0A 1KZUB 3SWFA 1NKZB 1VPCA 2ZYAA 1JY3P 1QGKB 4MN4C 1FZGA 2L5GB 1MV8A 4XRQA 4DOJA 1Z56A 4UB8H 3L74J 1RE4C 1IMQA 2Q7CA 1H8AA 2E5YA 1NJIQ 1P84I 3RGUA 5APYA 4DZOA 2VSQA 2W90A 2LIUA 1GL2A 1A02F 3B4SA 1SQXD 1GW3A 3L73D 2BCCG 1HGVA 1GL2D 2YKPA 4YTPC 3U1AA 2FYNB 3TGUE 2WT7B 3A2AA 2K9JA 3KXDA 4M0IA 2PNGA 3HD7D 4BRYB 1GPJA 1A02J 1GMJA 2MY5A 1Q82Q 4C7RA 4HKZH 3M1MA 5AW6B 4NPDA 2FYUJ 1YQ4C 2OTLP 2WSEJ 1RO2A 1GW4A 1PGQA 3FX0A 3CC7P 1BE3G 2A45G 1URQA 1KYOE 1VKUA 4JYBA 4C7NB 1YI2P 1YHQP 5HGNA 1DEEG 3H1JJ 1URQD 2CQ8A 1PEOA 1E6JP 3NY7B 2NO8A 3RL0g 3G0VA 2R3CA 2O1JA 3H1LG 2MD9A 2RMZA 4IOIH 1R8EA 3VMAA 4R4MA 4YPCA 1FZCC 3G9RA 3FXDA 2KR5A 4GOFA 3NFQA 3CX5I 2VLQA 1SS1A 2Z45A 4QKOA 1LNQA 3M0AA 2XKMA 2Y0CA 4BPGA 4PWVB 1VQMP 5CJ4A 2JBGA 2I1KA 1QLED 1EZVD 3NXSA 1FE6A 1TU3F 3K5BA 5EJDA 1GU5A 1NU1J 1SQQE 3HE5A 2ZT9C 1EOQA 1MZ8A 1S9KE 3L75G 3HUSA 5B66E 5KP7B 4D6TJ 4U0FA 1LP1B 2ZXEB 1N7SC 2FXMA 2WTYA 1U7JA 2XV6A 1OW7A 2KZIA 1IFJA 2OARA 2WPQA 1EIAA 1PP9J 2H8PD 3RK3B 2XZ0D 1IFDA 2PGDA 1KQSO 1BSNA 1WMKA 2HLOA 1NAFA 1LWUB 2KODA 1BCCE 2YO3A 1OX3A 3H1HJ 3U1CA 2M0BA 2PY8A 3RBXA 1QL2A 1P84D 3ITKA 1RF1B 3L72J 3CXCO 2CPSA 4H44D 2P67A 1GZLA 2K88A 1EDJA 1N73C 1T8KA 3B5IA 1JY3N 2LMLA 2M8RA 4OGQD 3CWBE 3TGUG 2KYVA 2AEJA 2KSJA 3NTEA 3O6QB 2IBZG 4AYCA 1KILB 2KG9A 2Q5UA 3AE2C 1WT6A 2XNDH 2POHA 4GDOA 2YMKA 3FWLA 2PFXA 3EFFK 3C9IA 5TISE 3AEFC 1SLQA 1NTMD 4QMAA 3BVHA 2WITA 3Q5RA 2QJKC 2GYKA 1NTKJ 4PH1A 1G2CA 1SQBJ 5CCGA 1BE3D 2PAJA 5CCGD 5BS1A 1M1JA 4BPHA 2L0QA 2C0XA 3VN0A 1L0NJ 1L0LJ 2H43A 5AW5B 5APWA 1M74A 2IFNA 2JKVA 4PV1D 2ZVNB 4I7ZC 4NPEA 2N9BA 1D7MA 3CCSP 2KS1A 1HH0A 2WSSH 2KOSA 1AQ5A 3GKLC 2FXPA 1Z6MA 4UB6E 2JR8A 1SQQG 3E7KA 2JU2A 4D6TG 2KOPA 5HGMA 3Q5SA 5B5EE 2AVAA 2H89C 4U3FJ 4WWIA 4I7ZB 2YKOA 3RG2A 1BSHA 4BRYA 5KLVK 1FR2A 3DS1A 3CXHH 3TNUB 1PFIA 1PEUA 3L73E 1JUNA 5BU8B 2B89A 2D2CD 2QSIA 2UWJE 1RO0A 4RESB 5KJ7A 1VF5D 3MUDC 1USDA 1KLPA 1KV4A 1OZHA 1VDFA 5KJ7D 3CE7A 3M91A 3WU2H 1LGHB 2YNYA 5APUA 2LOLA 3KDPB 3II6A 3L74D 2LPKA 3IR9A 2NPSC 2WQYC 2YKQA 4UHPB 2KUBA 1HUCA 1IUQA 4W80A 5AW2B 1X8YA 4MRTC 2K1AA 2LXBA 2BHVA 3CD6P 1IMPA 3DTJA 1FOSE 3G71P 1YJ9P 4GOEA 1OVUA 2NZ2A 5AVTB 1GL2B 2A45H 4PD4E 2IDBA 2M3BA 2KLUA 1NTZE 2QJPB 2Z5IA 3HD7B 3G4SP 2K9JB 3LMOA 5H2FE 2AFDA 2IBZD 1BGYE 2LIWA 3P32A 3N7NA 1DNYA 2FYUD 2FQ0A 4HJGH 2Z44A 2FACA 1NTKG 1S5LE 1FAVA 1SQPK 1ZMEC 2GDWA 1SQBG 1NHLA 1HVVA 4N78D 3BCCJ 2E42A 4L76A 1Y9BA 3H1JD 1EZVE 3GHGA 4N6JA 1KMIZ 1URQB 1L0NG 3V2QA 2E74D 2KGDA 1L0IA 1RQVA 3EQ2A 2O1KA 3P8CD 2RKLA 1GU4A 2E76C 3H1KE 4U0AA 2M8PA 2EHTA 1L4AA 1UIIA 1LWUA 4H13C 2IX7C 3V2NA 1MFTA 1RHZB 3L70D 1L4AD 1SQXK 2JB0A 3L71J 1SQVJ 4DJGA 2IYPA 3BRTB 5M1BA 1JY2O 4Y99C 1AYIA 4OVNF 4U3FG 3WUTA 3H4EA 3RK2C 1IC2A 1NU1D 1YQ3C 2QEXP 4IFMA 2W6JH 1P84E 2K0DX 1HWTC 4BPFA 3QH9A 1KILA 3HE5B 2M8NA 2K94A 3HUSB 2CG5B 1T3UA 2OYHC 1E5WA 3DS4A 3LIDA 3G3ZA 3MHVA 1PP9D 2E75D 3M06A 2N9YB 1UJZA 1KFMA 5KLVD 1USEA 2LF4A 3H1HD 3F89A 1KB9E 2WSEH 1ZLLA 2M3EA 3L72D 1BXIA 4H44B 2Y0EA 5GTIE 1JEKA 3G6EP 1UNKA 2KOGA 4WVZA 4ASVA 3D6ZA 5GTHE 4OGQB 1AF8A 1NTZG 1NAYA 1XTGB 3MD0A 5F2OA 2LTEA 2WZ7A 3CMAP 2JQ4A 1GXGA 2WWWA 1LTIC 3AE5C 3BCCG 3E2DA 1CSBA 3CX5E 2JWAA 4Z1MH 5KLIC 4N3YB 1ZXGA 2BQ1E 3CCUP 2A06G 2LKIA 1Q7YQ 3AECC 1S3JA 5CCHA 2MVVA 4IFFA 4IL6E 2CK3H 2Q9IA 2YO2A 1HGZA 4QNBA 2IFMA 3HE4A 1SQBD 5CCHD 2LXCB 1T2KD 2FQ1A 1QVGO 3MZWB 1FDMA 3B4QA 1MKMA 3CCMP 2CNRA 2K92A 2FVFA 1KC8Q 3M0DA 3G21A 5DJUB 4IPYA 1L0LD 1L2PA 3L71G 2N6YA 1SQVG 2VLPA 1M1JB 1IK7A 3H1ID 2GDYA 1PL5A 4PV1B 2FYNC 5AVQB 4IZ6A 2JEEA 2G8YA 1GK4A 2K0XA 3M9BA 5KP6B 5CHXA 1A8OA 1QX8A 4EIJA 1M6NA 3A0HE 3CLQA 1AA0A 1NWQA 2KS1B 3KZIE 3SWKA 2BUOA 3AEEC 3E1IA 1YJWP 3CXHI 1VQKP 1W2EA 1VF5C 2FQ2A 3HD7A 3P05A 3MIWA 3GG2A 2Y9YA 2WMMA 2FBWC 1NTMK 5L8RJ 1EDLA 2VRSA 4KT0J 3TGUJ 3CCRP 3AE8C 3RL0D 1NKNA 3G29A 2D2CB 3LIEA 1IZNB 2AEFA 1ZRTE 5KAIE 5AVXB 2OYIA 3GF7A 1VF5B 1JB0J 4U0EA 3H32A 1YTZT 2K3RA 5JPAA 2IYOA 1RF0A 2GDXA 2A45I 1OR5A 5TISH 2I1JA 4LGDE 2XDJA 4PJ0E 2ZAEB 2EHSA 3V4WA 1EDKA 2N6ZA 3P8CE 2E1MA 3H6PA 2LL8A 1H89A 1KD1Q 3RK3E 1GD2E 4H0LD 3L70E 2N1TA 1Y8AA 4GR2A 5E79E 3ABVC 1R5LA 2J58A 3CCLP 2N1TD 3V2PA 1ZN5A 3RK3C 3AE1C 2JWDA 3MGEA 3D71A 2KIKA 1S1CX 1EXIA 2H88C 1L4AC 3AEDC 1LWUC 2G3AA 2M8LA 1SQQJ 2WSCH 3A0BH 2FYZA 1H88A 2E74B 3PP5A 2EFJA 3GHGB 1OXZA 4UB6H 2AXTH 1GXHA 2YIUB 1RF1C 1PPJE 2AEMA 3RBZA 4GKGA 2YXQB 3I55P 1KILE 1AFOA 1AQTA 3PHLA 1L4AB 5APVA 1LT9A 2P7JA 3OAKA 2K5XA 2V7QH 3GW6A 3L71D 4UB8E 1SQVD 1PEQA 2Z5HA 1M6EX 1FDIA 1JOCA 1KILC 1BCCJ 1VQ7P 1PGJA 5KLVE 1DH3A 2C9NY 2KXPB 3JCUE 2KSEA 2QIWA 4YXWH 1JNMA 1M7LA 1SFCA 3V6IA 3CXHD 1GDTA 3A5TA 3ZDMA 1SFCD 1CEIA 2MR7A 3GZMA 2FYUK 3W68A 3CWBJ 2BCCD 3Q2YA 2GA1A 2N50A 3DS2A 1PIXA 2E75B 4WY4A 2IBZI 2KGCA 1JCDA 4WY4D 3WBHA 1Q86Q 1G1IA 1PGOA 5AW8B 5AW0B 1R5SA 3V5BA 5H2FH 4CA3A 1HJBA 5CBOA 1DX7A 1OVVA 2KORA 1S5LH 2KG6A 5AW7B 3EFGA 2N5HA 1N8RQ 2W27A 3A7OA 2R32A 3B8EB 4B86A 2R5BA 1GTWA 1SQPE 1LTBC 3H1LD 1NU1K 3TDKA 4L74A 2W8ZA 2B88A 3USSA 1ZNVA 3M9HA 4JYCA 1IFMA 2J5UA 3AE7C 1SQQK 3L36A 2ERHA 3H1IE 2KG8A 2E43A 2KGEA 1XTCC 2OGUA 1K8AQ 2WSCJ 2E5TA 4C46A 1RY3A 3SFEC 1IFPA 3EWKA 3W67A 1NH4A 1BDCA 2CGQA 4H2WC 3NTNA 1KORA 3AEBC 2Y0DA 3CCJP 2BASA 3B5NA 5APSA 1SQXE 3QWOC 3HE4B 2XXMA 3L75D 2VLOA 2QRXA 1BAJA 2H7HA 3H0DA 3B5ND 1J2JB 5KTBA 2ZYDA 4OWFA 1BDDA 4U7JA 2V7QJ 3L73J 1LTJB 2OTKE 4DG9A 2MVUA 3L35A 1BCCG 3I5CA 2XU6A 3U59A 3MGNA 1EDIA 4W7ZA 3PTZA 1GL2C 2JJLA 2FFDA 2QJPC 4WYMA 1X79B 5BVZA 2HODA 3VMXA 1NQ4A 3HD7C 2O01H 2J59M 5KAFE 1G1JA 5F2NA 1Q90D 5K5GB 1U57A 3CWBG 3VMZA 5HGLA 4OH8B 2MJZA 2KK7A 1AV1A 1X0TA 1KB9H 2M5AA 2IZ1A 1X9VA 1YIJP 1JY3O 3TSIA 2OYIC 4ZKPA 1VHNA 5KKZC 2PEJA 3TGUD 5GTIH 1URQC 3RL0B 1NTZJ 3C8VA 1NTKK 1JM0A 1T6AA 3HZQA 2AFEA 2PRRA 1SQBK 1M57D 2FVAA 3KPEA 3M9QA 3IAOA 1BGYJ 1J1EC 1JCCA 1RF0C 4EOTA 2JP3A 2ROQA 1L0NK 2OYIB 3HYBA 1L0LK 1QRJA 4BWNA 5KKZB 4U0CA 3VTPC 1HTLC 4XFJA 3H32B 1LTTC 3P7KA 3FGAD 1FZCA 1KQLA 1KFNA 3GLMA 5AW1B 4GT1A 1J1EB 1W5CE 2JAZA 2WPTA 2AXCA 4H2YC 3PH0A 2VLNA 3H1KJ 1JTHA 5AVZB 1K05A 2JYGA 2C9LY 3PJSK 1LJ2A 1N7LA 4H0LB 2GZJA 2XNXA 1JMBA 1HF9A 3HUSC 2ZT9D 2JYLA 2QA4P 2N1TB 2HR3A 1ACPA 1LTAC 1FC2C 5I4TG 3T97A 1NVOA 1K9MQ 1D1DA 2KZJA 4XFXA 1N7SD 2BEZF 1SQQD 3CI9A 4WBAA 1RE3A 4D6TD 1SQXG 3DPHA 3L73G 1S9KD 1X3OA 4TLFA 1NGMB 3UIAA 4H44C 3EJEA 4RJTA 2WSFJ 4L75A 3LRYA 2BCCE 4OGQC 2O01J 3WU2E 3GMAA 2QVAA 2HG5D 1N73A 2LKMA 1LT9B 2P1JA 3CC2P 3R4YA 4GR6A 2JO1A 1NTME 2P2UA 3AE3C 2KGAA 5CJ0A 1OVRA 2I8DA 1SFCB 1PEMA 1NYHA 1KYOH 4WY4C 1BE3E 2P10A 1MZ9A 1PGPA 3P8MC 3AE4C 2GUVA 1BGYG 4JPZB 2P58A 1ZP0C 2GZFA 3VOPA 2C0WA 4PJ0H 2KNCA 2XV5A 5AW3B 5CCGC 2JO0A 4XFYA 4WY4B 2KWLA 4COPA 3N4XA 2RN0A 5EW5E 2KP8A 2PEOA 1M1JC 3FXEA 1EZVG 3TK1A 1VQPP 1NTKD 4PV1C 4R4LA 5E79H 1ZOYC 2DNWA 1IFIA 4PXHB 3H1KG 3VP8A 1LTJA 1SQVK 2B87B 2MR8A 1L0ND 1CW5A 1KN7A 1U7MA 5KP8B 1LTSC 5B66H 5F2KA 1GK6A 3L75E 3KHUA 4AUWA 3HTKA 4RKUJ 5APTA 3WMM0 3OJAB 1WRGA 2WVRA 2QJYB 2N5IA 2D2CC 3L74E 4U3FD 2DW3A 5APXA 2K2QA 5KJ7C 1VQNP 1J1DB 3JCUH 4KJMA 3MUDA 5AW4B 3BATA 3D6YA 5HV8A 1PV3A 3B5NB 2FFDC 1EMVA 4H2XC 1S5LX 2KOQA 2NPSA 4I1LA 3JC22 2ZVOB 3A3YB 2NPSD 2JGPA 2IBZE 1K04A 1VQ8P 1HBWA 2FYUE 1NTMG 2FFDB 2L91A 4N78E 2PP6A 1S2EA 2OTJP 1KB9I 2HODB 3RG6C 3H1JE 2B9BA 1RQUA 4COCA 1NOHA 3HRNA 4KHXA 1M1KQ 1E0HA 1SVFA 4JQ0D 2GM4A 3WUUA 2M5AB 4JBZA 2KB7P 3U43A 1FDOA 4PD4D 3V2RA 1JY2P 1NTZD 2PEIA 2E74C 4GIFA 1IFNA 2IZ0A 3GHGC 2YIUC 2QM8A 3L70J 1M90Q 1EC5A 1YITP 1BGYD 3H25A 4EI2A 3VP9A 3BCCD 2YMYA 2M5RA 1RNIA 3CMEP 2SPZA 3KQGA 4R0MA 4I6MC 1IK9A 3DS5A 1CI6A 2A06D 2E76D 1NU1E 4Y28J 1HY8A 1W2BO 2Z4EA 2X2BA 5EFWB 3TYYA 4H13D 1N86A 1L0HA 4D6TE 1FZCB 5B5EH 3H1KD 4LLHA 3MTUE 4TT3H 1DD4A 2Q3EA 4W7YA 5AVWB 3Q3DA 2HYNA 1AUMA 1JTHB 1PP9E 1FZBA 1QL1A 1IO4A 1YTZI 4XROA 3RK2D 1H0TA 4O9BA 1RE3C 1M56D 2ZT9B 1FJKA 3L74G 3Q5PA 2L9FA 3H1HE 4LC1A 2YXRB 2E75C 5KLVJ 3L72E 4F37A 2PENA 2OYHA 2HPCA 2L22A 1N7SB 1YBKA 2GZGA 5BS2A 3T97B 2IPPA 1UIXA 5DJTB 2XT1A 3LW5H 2QNWA 5KAFH 1K30A 2GZEA 4K3AA 4ZMDA 3DS0A 1EXJA 3IN6A 3CCEP 2FY8A 3KYQA 4PD4H 4DT0A 2EIAA 1DD3A 1K73Q 1ZMBA 4IL6X 2FYUG 2OQQA 2DGYA 2PEQA 4ASWA 1IJDB 5HGOA 1N73B 4RO0A 3IF4A 1KB9D 2B87A 4XFZA 3H1JG 1KYOI 2FHSC 2O3JA 4ZNCA 3O8ZA 1NTKE 2Z46A 2JDIH 1FBMA 3CL3D 1LTGC 1SQBE 2AF8A 4HB1A 4A7PA 1DIPA 4NPFX 4PH0A 3L70G 1L0NE 2R44A 1L0LE 3G28A 2K93A 1OW8A 1EQ7A 1SQPJ 7CEIA 5CCHC 1OW6A 3SSUA 1T2KC 1OMIA 3AE9C 1S72P 1VQ6P 5C39A 2L6EA 3Q20A 2QJKB 3H1IJ 1KQGB 2KNCB 3CX5D 1LTJC 2LR2A 3AE6C 5AVSB 2Q6QA 3M0DC 1VQOP 1AVOA 3V4QA 1ZR2A 1JY2N 3A0BE 1NU1G 5DCKA 3CCVP 3BASA 1VQ4P 3AEGC 3L37A 1PPJG 2AXTE 2ITAA 4U3FE 2RH0A 5HVCA 2WT7A 2FKWB 1SQXJ 1P84H 1VQ9P 2W6BA 1RE4A 3L4FA 4K35A 1FU1A 1PP9G 1M8OB 3OW2O 1DEBA 2EG5A 1YJNP 1FJPA 2WSFH 3PRJA 5KLVG 3EJDA 3S9OA 1FOSF 3HTKB 3VYIA 2WPSA 1CZQA 3H1HG 3RL0C 2V4HA 3DS3A 4C7NA 3L72G 1ZV8A 3LW5J 1F80D 1T8ZA 1KTMA 2JU1A 1QVFO 1VQ5P 2WPVB 2KI7B 1MFZA 5TJHA 4NEOA 2NRGA 1MUUA 5GTHH 1YYCA 1AJYA 2PEMA 2P9XA 4CPGA 2NPSB 4IFDK 3AEAC 2K9YA 1ZRTD 2W6AA 1VL2A 2K0YA 3D70A 1HQBA 1KYOD 1RH5B 3CX5H 5BU5A 2R3SA 3CPWO 4H0LC 3BCCE 5CBNA 3WUVA 4L73A 1N2DC 5APQA 4ZKUA 2N1TC 2A06E 1Y47A 2PEKA 3JSVC 3GJNA 1LP1A 1SQPG 1FZFA 4IL6H 4M3LA 4WB4A 2K37A 1L0LG 3PLNA 2KOOA 3EJBA 1FS0E 3H1IG 4AQRD 1OFCX 3Q1MA 3RK3D 2QE7H 4XA4A 5AVUB 4U0DA 1S4XA 2MF4A 2BEQD 3L71E 1SQVE 1N7SA 3CCQP 2Q3IA 1A43A 2FVEA 1RF1A 2Y9ZA 3CC4P 1LT1A 3B71A 5AVYB 3MP7B 2XZ1C 2E76B 3CXHE 1LT9C 3A0HH 1ZR4A 1CI6B 1JJ2O 4H13B 2FXOA 3KZIH 4YXDC 3O6QA 3E1RA 4HH2A 2R5DA 2FAEA 1X22A 1PPJD 1FZAA 3G1IA 1SFCC 1VQLP 1KILD 1Q2NA 3G26A 3VMYA 2L4BA 2BCCJ 4Y99B 1JO5A 3RK2B 2ZYGA 1AVYA 4EYYQ 3S1KA 1BCCD 2N98A 2QM7A 1H0TB 1NO4A 5KAIH 3R2PA 3VRLC 1NTZK 2CWOA 4BXLA 1OWAA 1NTMJ 1T3JA 2HFED 1E79H 2ZXXA 3BRVB 5AVRB 2OYHB 3CWBD 3SFDC 2HPCB 2CPBA 2W83C 2KW2A 1BE3J 3G1GA 3GZLA 2ONTA 2MKVA 2WPRA 4PD4I 3H1LE 1JMMA 3OA7A 4GODA 1HJ0A 4HKGA 3I56P 3H1LJ 5AW9B 1FZEA 5CMZA 4JF7A 1QEXA 3TF5A 3H47A 1Q81Q
chains in the Genus database with same CATH topology
1ZMBA 2DGYA 2PEQA 3LRYA 5HGMA 3P05A 3G6EP 1A43A 1M90Q 3CXCO 1YITP 3CC4P 3HZQA 1YI2P 3DS3A 5HGNA 1YHQP 5HGOA 3I55P 3CCRP 4U0AA 3B5IA 4XFZA 1RNIA 3CMEP 1E6JP 1PEOA 2M8PA 3DS1A 3G29A 5F2OA 3CC2P 1PEUA 3DS5A 1JJ2O 4GR6A 3CMAP 3G0VA 3NTEA 2Z46A 1K8AQ 3HYBA 1W2BO 1QVFO 1PEQA 1QRJA 4U0CA 1M6EX 4U0BA 1VQ5P 4U0EA 1VQ7P 3E2DA 1VQNP 1RO0A 3G1IA 1PEMA 4PH0A 3CCUP 1VQLP 2BQ1E 3G26A 2PEMA 3G28A 3CCJP 2P9XA 1Q7YQ 5JPAA 2Z45A 3H4EA 1S72P 4QNBA 1VQ6P 1AUMA 2XXMA 2QEXP 1IUQA 1VQMP 2L6EA 1BAJA 3H0DA 4XROA 4XRQA 3Q20A 2JYGA 1QVGO 3VRLC 2BHVA 3CD6P 2CWOA 3DTJA 4PH1A 3CCMP 3G71P 1VQ8P 1EOQA 3DS2A 2M8NA 2E1MA 3CPWO 2JO0A 1VQOP 1YJ9P 1KC8Q 4XFYA 3G21A 1NJIQ 4IPYA 5DCKA 3CCVP 4COPA 1KD1Q 2PEOA 2JYLA 1VQ4P 2QA4P 4U0FA 5BS1A 2PEKA 2PENA 3DS4A 4WYMA 1VQPP 2OTJP 3G1GA 3WBHA 4GR2A 1Q86Q 3RG6C 5BS2A 2XV6A 4COCA 3CCLP 2ONTA 3G4SP 5I4TG 1M74A 1K9MQ 2OARA 1D1DA 1M1KQ 2XT1A 4M0IA 4XFXA 1VQ9P 1EIAA 5F2NA 1A8OA 1K30A 1M6NA 2LF4A 3DPHA 3MGEA 5HGLA 3CCSP 1KQSO 2Z44A 3DS0A 3I56P 3OW2O 2KODA 2M8LA 1Q82Q 2BUOA 2EG5A 1YIJP 1YJNP 3M1MA 3CCQP 1YJWP 4U0DA 3CCEP 2PEIA 1N8RQ 5F2KA 1VQKP 2OTLP 2EIAA 1RO2A 2EFJA 2PY8A 2PEJA 3H47A 1Q81Q 3CC7P 1K73Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 P;  1QVG O;  1VQ7 P;  3G6E P;  1K9M Q;  1M1K Q;  1M90 Q;  3CXC O;  1VQN P;  3CD6 P;  1YIT P;  1VQ9 P;  3CCM P;  3CC4 P;  1YI2 P;  3G71 P;  1VQ8 P;  1YHQ P;  3CPW O;  1VQO P;  1YJ9 P;  1KC8 Q;  3I55 P;  3CCU P;  1NJI Q;  1VQL P;  3CCR P;  3CCS P;  1KQS O;  3CCJ P;  3CME P;  3CCV P;  3I56 P;  3OW2 O;  1Q7Y Q;  1KD1 Q;  1Q82 Q;  3CC2 P;  1VQ4 P;  1YIJ P;  2QA4 P;  1YJN P;  1JJ2 O;  3CCE P;  1YJW P;  3CCL P;  3CMA P;  1S72 P;  1N8R Q;  1VQ6 P;  1VQP P;  2OTJ P;  1K8A Q;  1VQK P;  2QEX P;  1VQM P;  1Q86 Q;  2OTL P;  1W2B O;  1QVF O;  3CCQ P;  1Q81 Q;  3CC7 P;  3G4S P;  1K73 Q; 
#chains in the Genus database with same CATH topology
 2GUS A;  3C1L A;  2Q1K A;  3F5H A;  3FWN A;  2XZR A;  3IFM A;  1EZV I;  1KQF B;  1PZQ A;  2KLV A;  2QJY C;  2ZJS E;  4XE5 B;  1SP4 A;  3NMD A;  3TNU A;  2O01 N;  1DV5 A;  4EDF A;  4I2L C;  2ZFC A;  4U0B A;  2FAD A;  1G2C B;  1SQP D;  3L75 J;  1J1D C;  4DCK A;  5KLI B;  2GZI A;  1OIP A;  3S4R A;  3GF3 A;  5AVV B;  3SWY A;  4HYT B;  2QG4 A;  5CZD B;  2OYO A;  3B5N C;  1ZW0 A;  1KZU B;  3SWF A;  1NKZ B;  1VPC A;  2ZYA A;  1JY3 P;  1QGK B;  4MN4 C;  1FZG A;  2L5G B;  1MV8 A;  4XRQ A;  4DOJ A;  1Z56 A;  4UB8 H;  3L74 J;  1RE4 C;  1IMQ A;  2Q7C A;  1H8A A;  2E5Y A;  1NJI Q;  1P84 I;  3RGU A;  5APY A;  4DZO A;  2VSQ A;  2W90 A;  2LIU A;  1GL2 A;  1A02 F;  3B4S A;  1SQX D;  1GW3 A;  3L73 D;  2BCC G;  1HGV A;  1GL2 D;  2YKP A;  4YTP C;  3U1A A;  2FYN B;  3TGU E;  2WT7 B;  3A2A A;  2K9J A;  3KXD A;  4M0I A;  2PNG A;  3HD7 D;  4BRY B;  1GPJ A;  1A02 J;  1GMJ A;  2MY5 A;  1Q82 Q;  4C7R A;  4HKZ H;  3M1M A;  5AW6 B;  4NPD A;  2FYU J;  1YQ4 C;  2OTL P;  2WSE J;  1RO2 A;  1GW4 A;  1PGQ A;  3FX0 A;  3CC7 P;  1BE3 G;  2A45 G;  1URQ A;  1KYO E;  1VKU A;  4JYB A;  4C7N B;  1YI2 P;  1YHQ P;  5HGN A;  1DEE G;  3H1J J;  1URQ D;  2CQ8 A;  1PEO A;  1E6J P;  3NY7 B;  2NO8 A;  3RL0 g;  3G0V A;  2R3C A;  2O1J A;  3H1L G;  2MD9 A;  2RMZ A;  4IOI H;  1R8E A;  3VMA A;  4R4M A;  4YPC A;  1FZC C;  3G9R A;  3FXD A;  2KR5 A;  4GOF A;  3NFQ A;  3CX5 I;  2VLQ A;  1SS1 A;  2Z45 A;  4QKO A;  1LNQ A;  3M0A A;  2XKM A;  2Y0C A;  4BPG A;  4PWV B;  1VQM P;  5CJ4 A;  2JBG A;  2I1K A;  1QLE D;  1EZV D;  3NXS A;  1FE6 A;  1TU3 F;  3K5B A;  5EJD A;  1GU5 A;  1NU1 J;  1SQQ E;  3HE5 A;  2ZT9 C;  1EOQ A;  1MZ8 A;  1S9K E;  3L75 G;  3HUS A;  5B66 E;  5KP7 B;  4D6T J;  4U0F A;  1LP1 B;  2ZXE B;  1N7S C;  2FXM A;  2WTY A;  1U7J A;  2XV6 A;  1OW7 A;  2KZI A;  1IFJ A;  2OAR A;  2WPQ A;  1EIA A;  1PP9 J;  2H8P D;  3RK3 B;  2XZ0 D;  1IFD A;  2PGD A;  1KQS O;  1BSN A;  1WMK A;  2HLO A;  1NAF A;  1LWU B;  2KOD A;  1BCC E;  2YO3 A;  1OX3 A;  3H1H J;  3U1C A;  2M0B A;  2PY8 A;  3RBX A;  1QL2 A;  1P84 D;  3ITK A;  1RF1 B;  3L72 J;  3CXC O;  2CPS A;  4H44 D;  2P67 A;  1GZL A;  2K88 A;  1EDJ A;  1N73 C;  1T8K A;  3B5I A;  1JY3 N;  2LML A;  2M8R A;  4OGQ D;  3CWB E;  3TGU G;  2KYV A;  2AEJ A;  2KSJ A;  3NTE A;  3O6Q B;  2IBZ G;  4AYC A;  1KIL B;  2KG9 A;  2Q5U A;  3AE2 C;  1WT6 A;  2XND H;  2POH A;  4GDO A;  2YMK A;  3FWL A;  2PFX A;  3EFF K;  3C9I A;  5TIS E;  3AEF C;  1SLQ A;  1NTM D;  4QMA A;  3BVH A;  2WIT A;  3Q5R A;  2QJK C;  2GYK A;  1NTK J;  4PH1 A;  1G2C A;  1SQB J;  5CCG A;  1BE3 D;  2PAJ A;  5CCG D;  5BS1 A;  1M1J A;  4BPH A;  2L0Q A;  2C0X A;  3VN0 A;  1L0N J;  1L0L J;  2H43 A;  5AW5 B;  5APW A;  1M74 A;  2IFN A;  2JKV A;  4PV1 D;  2ZVN B;  4I7Z C;  4NPE A;  2N9B A;  1D7M A;  3CCS P;  2KS1 A;  1HH0 A;  2WSS H;  2KOS A;  1AQ5 A;  3GKL C;  2FXP A;  1Z6M A;  4UB6 E;  2JR8 A;  1SQQ G;  3E7K A;  2JU2 A;  4D6T G;  2KOP A;  5HGM A;  3Q5S A;  5B5E E;  2AVA A;  2H89 C;  4U3F J;  4WWI A;  4I7Z B;  2YKO A;  3RG2 A;  1BSH A;  4BRY A;  5KLV K;  1FR2 A;  3DS1 A;  3CXH H;  3TNU B;  1PFI A;  1PEU A;  3L73 E;  1JUN A;  5BU8 B;  2B89 A;  2D2C D;  2QSI A;  2UWJ E;  1RO0 A;  4RES B;  5KJ7 A;  1VF5 D;  3MUD C;  1USD A;  1KLP A;  1KV4 A;  1OZH A;  1VDF A;  5KJ7 D;  3CE7 A;  3M91 A;  3WU2 H;  1LGH B;  2YNY A;  5APU A;  2LOL A;  3KDP B;  3II6 A;  3L74 D;  2LPK A;  3IR9 A;  2NPS C;  2WQY C;  2YKQ A;  4UHP B;  2KUB A;  1HUC A;  1IUQ A;  4W80 A;  5AW2 B;  1X8Y A;  4MRT C;  2K1A A;  2LXB A;  2BHV A;  3CD6 P;  1IMP A;  3DTJ A;  1FOS E;  3G71 P;  1YJ9 P;  4GOE A;  1OVU A;  2NZ2 A;  5AVT B;  1GL2 B;  2A45 H;  4PD4 E;  2IDB A;  2M3B A;  2KLU A;  1NTZ E;  2QJP B;  2Z5I A;  3HD7 B;  3G4S P;  2K9J B;  3LMO A;  5H2F E;  2AFD A;  2IBZ D;  1BGY E;  2LIW A;  3P32 A;  3N7N A;  1DNY A;  2FYU D;  2FQ0 A;  4HJG H;  2Z44 A;  2FAC A;  1NTK G;  1S5L E;  1FAV A;  1SQP K;  1ZME C;  2GDW A;  1SQB G;  1NHL A;  1HVV A;  4N78 D;  3BCC J;  2E42 A;  4L76 A;  1Y9B A;  3H1J D;  1EZV E;  3GHG A;  4N6J A;  1KMI Z;  1URQ B;  1L0N G;  3V2Q A;  2E74 D;  2KGD A;  1L0I A;  1RQV A;  3EQ2 A;  2O1K A;  3P8C D;  2RKL A;  1GU4 A;  2E76 C;  3H1K E;  4U0A A;  2M8P A;  2EHT A;  1L4A A;  1UII A;  1LWU A;  4H13 C;  2IX7 C;  3V2N A;  1MFT A;  1RHZ B;  3L70 D;  1L4A D;  1SQX K;  2JB0 A;  3L71 J;  1SQV J;  4DJG A;  2IYP A;  3BRT B;  5M1B A;  1JY2 O;  4Y99 C;  1AYI A;  4OVN F;  4U3F G;  3WUT A;  3H4E A;  3RK2 C;  1IC2 A;  1NU1 D;  1YQ3 C;  2QEX P;  4IFM A;  2W6J H;  1P84 E;  2K0D X;  1HWT C;  4BPF A;  3QH9 A;  1KIL A;  3HE5 B;  2M8N A;  2K94 A;  3HUS B;  2CG5 B;  1T3U A;  2OYH C;  1E5W A;  3DS4 A;  3LID A;  3G3Z A;  3MHV A;  1PP9 D;  2E75 D;  3M06 A;  2N9Y B;  1UJZ A;  1KFM A;  5KLV D;  1USE A;  2LF4 A;  3H1H D;  3F89 A;  1KB9 E;  2WSE H;  1ZLL A;  2M3E A;  3L72 D;  1BXI A;  4H44 B;  2Y0E A;  5GTI E;  1JEK A;  3G6E P;  1UNK A;  2KOG A;  4WVZ A;  4ASV A;  3D6Z A;  5GTH E;  4OGQ B;  1AF8 A;  1NTZ G;  1NAY A;  1XTG B;  3MD0 A;  5F2O A;  2LTE A;  2WZ7 A;  3CMA P;  2JQ4 A;  1GXG A;  2WWW A;  1LTI C;  3AE5 C;  3BCC G;  3E2D A;  1CSB A;  3CX5 E;  2JWA A;  4Z1M H;  5KLI C;  4N3Y B;  1ZXG A;  2BQ1 E;  3CCU P;  2A06 G;  2LKI A;  1Q7Y Q;  3AEC C;  1S3J A;  5CCH A;  2MVV A;  4IFF A;  4IL6 E;  2CK3 H;  2Q9I A;  2YO2 A;  1HGZ A;  4QNB A;  2IFM A;  3HE4 A;  1SQB D;  5CCH D;  2LXC B;  1T2K D;  2FQ1 A;  1QVG O;  3MZW B;  1FDM A;  3B4Q A;  1MKM A;  3CCM P;  2CNR A;  2K92 A;  2FVF A;  1KC8 Q;  3M0D A;  3G21 A;  5DJU B;  4IPY A;  1L0L D;  1L2P A;  3L71 G;  2N6Y A;  1SQV G;  2VLP A;  1M1J B;  1IK7 A;  3H1I D;  2GDY A;  1PL5 A;  4PV1 B;  2FYN C;  5AVQ B;  4IZ6 A;  2JEE A;  2G8Y A;  1GK4 A;  2K0X A;  3M9B A;  5KP6 B;  5CHX A;  1A8O A;  1QX8 A;  4EIJ A;  1M6N A;  3A0H E;  3CLQ A;  1AA0 A;  1NWQ A;  2KS1 B;  3KZI E;  3SWK A;  2BUO A;  3AEE C;  3E1I A;  1YJW P;  3CXH I;  1VQK P;  1W2E A;  1VF5 C;  2FQ2 A;  3HD7 A;  3P05 A;  3MIW A;  3GG2 A;  2Y9Y A;  2WMM A;  2FBW C;  1NTM K;  5L8R J;  1EDL A;  2VRS A;  4KT0 J;  3TGU J;  3CCR P;  3AE8 C;  3RL0 D;  1NKN A;  3G29 A;  2D2C B;  3LIE A;  1IZN B;  2AEF A;  1ZRT E;  5KAI E;  5AVX B;  2OYI A;  3GF7 A;  1VF5 B;  1JB0 J;  4U0E A;  3H32 A;  1YTZ T;  2K3R A;  5JPA A;  2IYO A;  1RF0 A;  2GDX A;  2A45 I;  1OR5 A;  5TIS H;  2I1J A;  4LGD E;  2XDJ A;  4PJ0 E;  2ZAE B;  2EHS A;  3V4W A;  1EDK A;  2N6Z A;  3P8C E;  2E1M A;  3H6P A;  2LL8 A;  1H89 A;  1KD1 Q;  3RK3 E;  1GD2 E;  4H0L D;  3L70 E;  2N1T A;  1Y8A A;  4GR2 A;  5E79 E;  3ABV C;  1R5L A;  2J58 A;  3CCL P;  2N1T D;  3V2P A;  1ZN5 A;  3RK3 C;  3AE1 C;  2JWD A;  3MGE A;  3D71 A;  2KIK A;  1S1C X;  1EXI A;  2H88 C;  1L4A C;  3AED C;  1LWU C;  2G3A A;  2M8L A;  1SQQ J;  2WSC H;  3A0B H;  2FYZ A;  1H88 A;  2E74 B;  3PP5 A;  2EFJ A;  3GHG B;  1OXZ A;  4UB6 H;  2AXT H;  1GXH A;  2YIU B;  1RF1 C;  1PPJ E;  2AEM A;  3RBZ A;  4GKG A;  2YXQ B;  3I55 P;  1KIL E;  1AFO A;  1AQT A;  3PHL A;  1L4A B;  5APV A;  1LT9 A;  2P7J A;  3OAK A;  2K5X A;  2V7Q H;  3GW6 A;  3L71 D;  4UB8 E;  1SQV D;  1PEQ A;  2Z5H A;  1M6E X;  1FDI A;  1JOC A;  1KIL C;  1BCC J;  1VQ7 P;  1PGJ A;  5KLV E;  1DH3 A;  2C9N Y;  2KXP B;  3JCU E;  2KSE A;  2QIW A;  4YXW H;  1JNM A;  1M7L A;  1SFC A;  3V6I A;  3CXH D;  1GDT A;  3A5T A;  3ZDM A;  1SFC D;  1CEI A;  2MR7 A;  3GZM A;  2FYU K;  3W68 A;  3CWB J;  2BCC D;  3Q2Y A;  2GA1 A;  2N50 A;  3DS2 A;  1PIX A;  2E75 B;  4WY4 A;  2IBZ I;  2KGC A;  1JCD A;  4WY4 D;  3WBH A;  1Q86 Q;  1G1I A;  1PGO A;  5AW8 B;  5AW0 B;  1R5S A;  3V5B A;  5H2F H;  4CA3 A;  1HJB A;  5CBO A;  1DX7 A;  1OVV A;  2KOR A;  1S5L H;  2KG6 A;  5AW7 B;  3EFG A;  2N5H A;  1N8R Q;  2W27 A;  3A7O A;  2R32 A;  3B8E B;  4B86 A;  2R5B A;  1GTW A;  1SQP E;  1LTB C;  3H1L D;  1NU1 K;  3TDK A;  4L74 A;  2W8Z A;  2B88 A;  3USS A;  1ZNV A;  3M9H A;  4JYC A;  1IFM A;  2J5U A;  3AE7 C;  1SQQ K;  3L36 A;  2ERH A;  3H1I E;  2KG8 A;  2E43 A;  2KGE A;  1XTC C;  2OGU A;  1K8A Q;  2WSC J;  2E5T A;  4C46 A;  1RY3 A;  3SFE C;  1IFP A;  3EWK A;  3W67 A;  1NH4 A;  1BDC A;  2CGQ A;  4H2W C;  3NTN A;  1KOR A;  3AEB C;  2Y0D A;  3CCJ P;  2BAS A;  3B5N A;  5APS A;  1SQX E;  3QWO C;  3HE4 B;  2XXM A;  3L75 D;  2VLO A;  2QRX A;  1BAJ A;  2H7H A;  3H0D A;  3B5N D;  1J2J B;  5KTB A;  2ZYD A;  4OWF A;  1BDD A;  4U7J A;  2V7Q J;  3L73 J;  1LTJ B;  2OTK E;  4DG9 A;  2MVU A;  3L35 A;  1BCC G;  3I5C A;  2XU6 A;  3U59 A;  3MGN A;  1EDI A;  4W7Z A;  3PTZ A;  1GL2 C;  2JJL A;  2FFD A;  2QJP C;  4WYM A;  1X79 B;  5BVZ A;  2HOD A;  3VMX A;  1NQ4 A;  3HD7 C;  2O01 H;  2J59 M;  5KAF E;  1G1J A;  5F2N A;  1Q90 D;  5K5G B;  1U57 A;  3CWB G;  3VMZ A;  5HGL A;  4OH8 B;  2MJZ A;  2KK7 A;  1AV1 A;  1X0T A;  1KB9 H;  2M5A A;  2IZ1 A;  1X9V A;  1YIJ P;  1JY3 O;  3TSI A;  2OYI C;  4ZKP A;  1VHN A;  5KKZ C;  2PEJ A;  3TGU D;  5GTI H;  1URQ C;  3RL0 B;  1NTZ J;  3C8V A;  1NTK K;  1JM0 A;  1T6A A;  3HZQ A;  2AFE A;  2PRR A;  1SQB K;  1M57 D;  2FVA A;  3KPE A;  3M9Q A;  3IAO A;  1BGY J;  1J1E C;  1JCC A;  1RF0 C;  4EOT A;  2JP3 A;  2ROQ A;  1L0N K;  2OYI B;  3HYB A;  1L0L K;  1QRJ A;  4BWN A;  5KKZ B;  4U0C A;  3VTP C;  1HTL C;  4XFJ A;  3H32 B;  1LTT C;  3P7K A;  3FGA D;  1FZC A;  1KQL A;  1KFN A;  3GLM A;  5AW1 B;  4GT1 A;  1J1E B;  1W5C E;  2JAZ A;  2WPT A;  2AXC A;  4H2Y C;  3PH0 A;  2VLN A;  3H1K J;  1JTH A;  5AVZ B;  1K05 A;  2JYG A;  2C9L Y;  3PJS K;  1LJ2 A;  1N7L A;  4H0L B;  2GZJ A;  2XNX A;  1JMB A;  1HF9 A;  3HUS C;  2ZT9 D;  2JYL A;  2QA4 P;  2N1T B;  2HR3 A;  1ACP A;  1LTA C;  1FC2 C;  5I4T G;  3T97 A;  1NVO A;  1K9M Q;  1D1D A;  2KZJ A;  4XFX A;  1N7S D;  2BEZ F;  1SQQ D;  3CI9 A;  4WBA A;  1RE3 A;  4D6T D;  1SQX G;  3DPH A;  3L73 G;  1S9K D;  1X3O A;  4TLF A;  1NGM B;  3UIA A;  4H44 C;  3EJE A;  4RJT A;  2WSF J;  4L75 A;  3LRY A;  2BCC E;  4OGQ C;  2O01 J;  3WU2 E;  3GMA A;  2QVA A;  2HG5 D;  1N73 A;  2LKM A;  1LT9 B;  2P1J A;  3CC2 P;  3R4Y A;  4GR6 A;  2JO1 A;  1NTM E;  2P2U A;  3AE3 C;  2KGA A;  5CJ0 A;  1OVR A;  2I8D A;  1SFC B;  1PEM A;  1NYH A;  1KYO H;  4WY4 C;  1BE3 E;  2P10 A;  1MZ9 A;  1PGP A;  3P8M C;  3AE4 C;  2GUV A;  1BGY G;  4JPZ B;  2P58 A;  1ZP0 C;  2GZF A;  3VOP A;  2C0W A;  4PJ0 H;  2KNC A;  2XV5 A;  5AW3 B;  5CCG C;  2JO0 A;  4XFY A;  4WY4 B;  2KWL A;  4COP A;  3N4X A;  2RN0 A;  5EW5 E;  2KP8 A;  2PEO A;  1M1J C;  3FXE A;  1EZV G;  3TK1 A;  1VQP P;  1NTK D;  4PV1 C;  4R4L A;  5E79 H;  1ZOY C;  2DNW A;  1IFI A;  4PXH B;  3H1K G;  3VP8 A;  1LTJ A;  1SQV K;  2B87 B;  2MR8 A;  1L0N D;  1CW5 A;  1KN7 A;  1U7M A;  5KP8 B;  1LTS C;  5B66 H;  5F2K A;  1GK6 A;  3L75 E;  3KHU A;  4AUW A;  3HTK A;  4RKU J;  5APT A;  3WMM 0;  3OJA B;  1WRG A;  2WVR A;  2QJY B;  2N5I A;  2D2C C;  3L74 E;  4U3F D;  2DW3 A;  5APX A;  2K2Q A;  5KJ7 C;  1VQN P;  1J1D B;  3JCU H;  4KJM A;  3MUD A;  5AW4 B;  3BAT A;  3D6Y A;  5HV8 A;  1PV3 A;  3B5N B;  2FFD C;  1EMV A;  4H2X C;  1S5L X;  2KOQ A;  2NPS A;  4I1L A;  3JC2 2;  2ZVO B;  3A3Y B;  2NPS D;  2JGP A;  2IBZ E;  1K04 A;  1VQ8 P;  1HBW A;  2FYU E;  1NTM G;  2FFD B;  2L91 A;  4N78 E;  2PP6 A;  1S2E A;  2OTJ P;  1KB9 I;  2HOD B;  3RG6 C;  3H1J E;  2B9B A;  1RQU A;  4COC A;  1NOH A;  3HRN A;  4KHX A;  1M1K Q;  1E0H A;  1SVF A;  4JQ0 D;  2GM4 A;  3WUU A;  2M5A B;  4JBZ A;  2KB7 P;  3U43 A;  1FDO A;  4PD4 D;  3V2R A;  1JY2 P;  1NTZ D;  2PEI A;  2E74 C;  4GIF A;  1IFN A;  2IZ0 A;  3GHG C;  2YIU C;  2QM8 A;  3L70 J;  1M90 Q;  1EC5 A;  1YIT P;  1BGY D;  3H25 A;  4EI2 A;  3VP9 A;  3BCC D;  2YMY A;  2M5R A;  1RNI A;  3CME P;  2SPZ A;  3KQG A;  4R0M A;  4I6M C;  1IK9 A;  3DS5 A;  1CI6 A;  2A06 D;  2E76 D;  1NU1 E;  4Y28 J;  1HY8 A;  1W2B O;  2Z4E A;  2X2B A;  5EFW B;  3TYY A;  4H13 D;  1N86 A;  1L0H A;  4D6T E;  1FZC B;  5B5E H;  3H1K D;  4LLH A;  3MTU E;  4TT3 H;  1DD4 A;  2Q3E A;  4W7Y A;  5AVW B;  3Q3D A;  2HYN A;  1AUM A;  1JTH B;  1PP9 E;  1FZB A;  1QL1 A;  1IO4 A;  1YTZ I;  4XRO A;  3RK2 D;  1H0T A;  4O9B A;  1RE3 C;  1M56 D;  2ZT9 B;  1FJK A;  3L74 G;  3Q5P A;  2L9F A;  3H1H E;  4LC1 A;  2YXR B;  2E75 C;  5KLV J;  3L72 E;  4F37 A;  2PEN A;  2OYH A;  2HPC A;  2L22 A;  1N7S B;  1YBK A;  2GZG A;  5BS2 A;  3T97 B;  2IPP A;  1UIX A;  5DJT B;  2XT1 A;  3LW5 H;  2QNW A;  5KAF H;  1K30 A;  2GZE A;  4K3A A;  4ZMD A;  3DS0 A;  1EXJ A;  3IN6 A;  3CCE P;  2FY8 A;  3KYQ A;  4PD4 H;  4DT0 A;  2EIA A;  1DD3 A;  1K73 Q;  1ZMB A;  4IL6 X;  2FYU G;  2OQQ A;  2DGY A;  2PEQ A;  4ASW A;  1IJD B;  5HGO A;  1N73 B;  4RO0 A;  3IF4 A;  1KB9 D;  2B87 A;  4XFZ A;  3H1J G;  1KYO I;  2FHS C;  2O3J A;  4ZNC A;  3O8Z A;  1NTK E;  2Z46 A;  2JDI H;  1FBM A;  3CL3 D;  1LTG C;  1SQB E;  2AF8 A;  4HB1 A;  4A7P A;  1DIP A;  4NPF X;  4PH0 A;  3L70 G;  1L0N E;  2R44 A;  1L0L E;  3G28 A;  2K93 A;  1OW8 A;  1EQ7 A;  1SQP J;  7CEI A;  5CCH C;  1OW6 A;  3SSU A;  1T2K C;  1OMI A;  3AE9 C;  1S72 P;  1VQ6 P;  5C39 A;  2L6E A;  3Q20 A;  2QJK B;  3H1I J;  1KQG B;  2KNC B;  3CX5 D;  1LTJ C;  2LR2 A;  3AE6 C;  5AVS B;  2Q6Q A;  3M0D C;  1VQO P;  1AVO A;  3V4Q A;  1ZR2 A;  1JY2 N;  3A0B E;  1NU1 G;  5DCK A;  3CCV P;  3BAS A;  1VQ4 P;  3AEG C;  3L37 A;  1PPJ G;  2AXT E;  2ITA A;  4U3F E;  2RH0 A;  5HVC A;  2WT7 A;  2FKW B;  1SQX J;  1P84 H;  1VQ9 P;  2W6B A;  1RE4 A;  3L4F A;  4K35 A;  1FU1 A;  1PP9 G;  1M8O B;  3OW2 O;  1DEB A;  2EG5 A;  1YJN P;  1FJP A;  2WSF H;  3PRJ A;  5KLV G;  3EJD A;  3S9O A;  1FOS F;  3HTK B;  3VYI A;  2WPS A;  1CZQ A;  3H1H G;  3RL0 C;  2V4H A;  3DS3 A;  4C7N A;  3L72 G;  1ZV8 A;  3LW5 J;  1F80 D;  1T8Z A;  1KTM A;  2JU1 A;  1QVF O;  1VQ5 P;  2WPV B;  2KI7 B;  1MFZ A;  5TJH A;  4NEO A;  2NRG A;  1MUU A;  5GTH H;  1YYC A;  1AJY A;  2PEM A;  2P9X A;  4CPG A;  2NPS B;  4IFD K;  3AEA C;  2K9Y A;  1ZRT D;  2W6A A;  1VL2 A;  2K0Y A;  3D70 A;  1HQB A;  1KYO D;  1RH5 B;  3CX5 H;  5BU5 A;  2R3S A;  3CPW O;  4H0L C;  3BCC E;  5CBN A;  3WUV A;  4L73 A;  1N2D C;  5APQ A;  4ZKU A;  2N1T C;  2A06 E;  1Y47 A;  2PEK A;  3JSV C;  3GJN A;  1LP1 A;  1SQP G;  1FZF A;  4IL6 H;  4M3L A;  4WB4 A;  2K37 A;  1L0L G;  3PLN A;  2KOO A;  3EJB A;  1FS0 E;  3H1I G;  4AQR D;  1OFC X;  3Q1M A;  3RK3 D;  2QE7 H;  4XA4 A;  5AVU B;  4U0D A;  1S4X A;  2MF4 A;  2BEQ D;  3L71 E;  1SQV E;  1N7S A;  3CCQ P;  2Q3I A;  1A43 A;  2FVE A;  1RF1 A;  2Y9Z A;  3CC4 P;  1LT1 A;  3B71 A;  5AVY B;  3MP7 B;  2XZ1 C;  2E76 B;  3CXH E;  1LT9 C;  3A0H H;  1ZR4 A;  1CI6 B;  1JJ2 O;  4H13 B;  2FXO A;  3KZI H;  4YXD C;  3O6Q A;  3E1R A;  4HH2 A;  2R5D A;  2FAE A;  1X22 A;  1PPJ D;  1FZA A;  3G1I A;  1SFC C;  1VQL P;  1KIL D;  1Q2N A;  3G26 A;  3VMY A;  2L4B A;  2BCC J;  4Y99 B;  1JO5 A;  3RK2 B;  2ZYG A;  1AVY A;  4EYY Q;  3S1K A;  1BCC D;  2N98 A;  2QM7 A;  1H0T B;  1NO4 A;  5KAI H;  3R2P A;  3VRL C;  1NTZ K;  2CWO A;  4BXL A;  1OWA A;  1NTM J;  1T3J A;  2HFE D;  1E79 H;  2ZXX A;  3BRV B;  5AVR B;  2OYH B;  3CWB D;  3SFD C;  2HPC B;  2CPB A;  2W83 C;  2KW2 A;  1BE3 J;  3G1G A;  3GZL A;  2ONT A;  2MKV A;  2WPR A;  4PD4 I;  3H1L E;  1JMM A;  3OA7 A;  4GOD A;  1HJ0 A;  4HKG A;  3I56 P;  3H1L J;  5AW9 B;  1FZE A;  5CMZ A;  4JF7 A;  1QEX A;  3TF5 A;  3H47 A;  1Q81 Q; 
#chains in the Genus database with same CATH homology
 1ZMB A;  2DGY A;  2PEQ A;  3LRY A;  5HGM A;  3P05 A;  3G6E P;  1A43 A;  1M90 Q;  3CXC O;  1YIT P;  3CC4 P;  3HZQ A;  1YI2 P;  3DS3 A;  5HGN A;  1YHQ P;  5HGO A;  3I55 P;  3CCR P;  4U0A A;  3B5I A;  4XFZ A;  1RNI A;  3CME P;  1E6J P;  1PEO A;  2M8P A;  3DS1 A;  3G29 A;  5F2O A;  3CC2 P;  1PEU A;  3DS5 A;  1JJ2 O;  4GR6 A;  3CMA P;  3G0V A;  3NTE A;  2Z46 A;  1K8A Q;  3HYB A;  1W2B O;  1QVF O;  1PEQ A;  1QRJ A;  4U0C A;  1M6E X;  4U0B A;  1VQ5 P;  4U0E A;  1VQ7 P;  3E2D A;  1VQN P;  1RO0 A;  3G1I A;  1PEM A;  4PH0 A;  3CCU P;  1VQL P;  2BQ1 E;  3G26 A;  2PEM A;  3G28 A;  3CCJ P;  2P9X A;  1Q7Y Q;  5JPA A;  2Z45 A;  3H4E A;  1S72 P;  4QNB A;  1VQ6 P;  1AUM A;  2XXM A;  2QEX P;  1IUQ A;  1VQM P;  2L6E A;  1BAJ A;  3H0D A;  4XRO A;  4XRQ A;  3Q20 A;  2JYG A;  1QVG O;  3VRL C;  2BHV A;  3CD6 P;  2CWO A;  3DTJ A;  4PH1 A;  3CCM P;  3G71 P;  1VQ8 P;  1EOQ A;  3DS2 A;  2M8N A;  2E1M A;  3CPW O;  2JO0 A;  1VQO P;  1YJ9 P;  1KC8 Q;  4XFY A;  3G21 A;  1NJI Q;  4IPY A;  5DCK A;  3CCV P;  4COP A;  1KD1 Q;  2PEO A;  2JYL A;  1VQ4 P;  2QA4 P;  4U0F A;  5BS1 A;  2PEK A;  2PEN A;  3DS4 A;  4WYM A;  1VQP P;  2OTJ P;  3G1G A;  3WBH A;  4GR2 A;  1Q86 Q;  3RG6 C;  5BS2 A;  2XV6 A;  4COC A;  3CCL P;  2ONT A;  3G4S P;  5I4T G;  1M74 A;  1K9M Q;  2OAR A;  1D1D A;  1M1K Q;  2XT1 A;  4M0I A;  4XFX A;  1VQ9 P;  1EIA A;  5F2N A;  1A8O A;  1K30 A;  1M6N A;  2LF4 A;  3DPH A;  3MGE A;  5HGL A;  3CCS P;  1KQS O;  2Z44 A;  3DS0 A;  3I56 P;  3OW2 O;  2KOD A;  2M8L A;  1Q82 Q;  2BUO A;  2EG5 A;  1YIJ P;  1YJN P;  3M1M A;  3CCQ P;  1YJW P;  4U0D A;  3CCE P;  2PEI A;  1N8R Q;  5F2K A;  1VQK P;  2OTL P;  2EIA A;  1RO2 A;  2EFJ A;  2PY8 A;  2PEJ A;  3H47 A;  1Q81 Q;  3CC7 P;  1K73 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...