4H2WC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Ligase
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
total genus 20
structure length 78
sequence length 78
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2wC00
2EHSA 5HV8A 2JU2A 4R0MA 1NQ4A 4HKGA 2GDXA 1VKUA 2L9FA 5HVCA 2DNWA 4PWVB 2MR7A 2KOSA 4CA3A 1X3OA 2LTEA 2KW2A 2K2QA 4PXHB 2KG8A 2FACA 1L0HA 2KGDA 3EJEA 2KGAA 3CE7A 3EJDA 2LMLA 1HY8A 2CGQA 5EJDA 1F80D 2MY5A 2AF8A 2N98A 2AFEA 1ACPA 2FVEA 2FHSC 5KP6B 2KR5A 2CG5B 4H2XC 1L0IA 2FVFA 2FQ0A 2KG6A 2FADA 2N5IA 1DNYA 2N6ZA 2XZ1C 1AF8A 2AFDA 2N50A 2KOOA 2JU1A 2ROQA 4BPHA 1T8KA 5KP8B 4NEOA 2QNWA 1HQBA 2KG9A 4DG9A 3GZLA 2KWLA 2MR8A 2N6YA 2LOLA 4BPFA 5KP7B 2CQ8A 2KGCA 2MD9A 2LKIA 3LMOA 2GDYA 2KORA 4H2WC 2L4BA 2MVUA 3GZMA 3EJBA 2FVAA 2K94A 2JQ4A 2L0QA 2GDWA 2FAEA 2FQ1A 2CNRA 2N5HA 4H2YC 2JGPA 2MVVA 2MF4A 2L22A 3RG2A 1DV5A 4BPGA 1OR5A 2KOQA 2AVAA 2VSQA 5CZDB 2LIWA 4IZ6A 2LIUA 2LPKA 2KGEA 3NY7B 2KOPA 1KLPA 2PNGA 2K93A 2XZ0D 2EHTA 2K0XA 2M5RA 2FQ2A 4MRTC 2X2BA 2LL8A 2K0YA 2K92A
chains in the Genus database with same CATH superfamily
5I4TG 3U43A 1VQ9P 4QNBA 2EHSA 2JU2A 4HKGA 2BHVA 1YJ9P 1UJZA 5JPAA 3CC7P 2LTEA 1VQ7P 2EG5A 4PXHB 2KODA 2L6EA 2GZIA 2LMLA 1HY8A 1EMVA 1F80D 2MY5A 1L0IA 2KG6A 1DNYA 3CCSP 3G26A 2N6ZA 1EIAA 2XZ1C 4XROA 5HGLA 1BXIA 3GJNA 2M8LA 4BPHA 2LF4A 3H4EA 2DGYA 2MR8A 2N6YA 5KP7B 3DS1A 2XV6A 2CQ8A 1ZMBA 1YIJP 2KGCA 2MD9A 4XRQA 2LKIA 2PEOA 1IUQA 3CD6P 4H2WC 3E2DA 2L0QA 2GDWA 3CCLP 3M1MA 2N5HA 1YITP 1NJIQ 3G4SP 3CCQP 1VHNA 3LRYA 1VQ8P 2MF4A 2L22A 5EW5E 2PY8A 1BAJA 1W2BO 2LIWA 3VRLC 3HYBA 2JO0A 1KLPA 2PNGA 3DPHA 3G6EP 2XZ0D 2BUOA 2FQ2A 5F2KA 2OTJP 2XXMA 5HV8A 4WYMA 1GPJA 3Q20A 1VKUA 2L9FA 1YJWP 4PWVB 3B4QA 1ZNVA 1X3OA 1AUMA 2K2QA 2PEIA 2FACA 1L0HA 3OW2O 1E0HA 1IMPA 2XT1A 5EJDA 3G1GA 1YJNP 2N98A 2FVEA 4U0EA 1D1DA 1K30A 3MGEA 4COCA 3DS0A 3CXCO 1K9MQ 3NTEA 4UHPB 4XFYA 2PEMA 1Z6MA 2JAZA 2N50A 4IPYA 3CC2P 3H0DA 2M8NA 2E1MA 2VLPA 4DG9A 3GZLA 4GR6A 2GZFA 1YHQP 2K0DX 1M90Q 2ERHA 2GYKA 4GR2A 1KC8Q 3LMOA 2L4BA 3GZMA 2JB0A 3DTJA 2PENA 1JJ2O 2FQ1A 2CNRA 1VQMP 3CPWO 3CMEP 1M6NA 3B5IA 1GXHA 1DV5A 2Z46A 2KOQA 2AVAA 2VSQA 4F37A 3GKLC 2LIUA 1M6EX 1YI2P 2NO8A 2EHTA 1RO0A 2JBGA 2K0YA 2VLQA 2K92A 4U0FA 1Q82Q 2CWOA 1NQ4A 2KOSA 4CA3A 2Z45A 3CMAP 2KG8A 1VQ5P 2KGDA 2PEQA 3EJEA 5BS2A 3CE7A 1UNKA 3DS2A 2QEXP 2GZJA 1RNIA 1GXGA 3G1IA 3P05A 2KR5A 2CG5B 3HZQA 4H2XC 5DCKA 2N5IA 4XFZA 1KD1Q 1M1KQ 1AF8A 3G29A 2KOOA 5BS1A 2ROQA 1EOQA 2VLOA 4NEOA 2QNWA 1HQBA 2KG9A 1N8RQ 1Q81Q 3CCJP 2LOLA 2OARA 5F2NA 3DS5A 4PH0A 1M74A 2PEJA 1VQ6P 2JYLA 1VQOP 2GDYA 2FVAA 1Q86Q 1AYIA 1IMQA 1K73Q 2M8PA 1KQSO 1RO2A 3I55P 1Q7YQ 3RG2A 4BPGA 4U0CA 5CZDB 4IZ6A 3I56P 2LPKA 2KGEA 3WBHA 2KOPA 2WPTA 2K93A 7CEIA 2K0XA 4MRTC 2QA4P 2X2BA 2LL8A 4COPA 1QVGO 4R0MA 1VQKP 2GDXA 5HVCA 2DNWA 2MR7A 2VLNA 1A8OA 4U0BA 5HGMA 2EFJA 3CCUP 2KW2A 1A43A 2KGAA 3EJDA 3G28A 1VQ4P 2CGQA 3CCRP 2AF8A 1ACPA 2AFEA 2FHSC 2K5XA 5KP6B 2Z44A 2FVFA 1QVFO 2FQ0A 3G21A 3CCMP 2FADA 2OTLP 3CCEP 5F2OA 2PEKA 2ONTA 3H47A 3G71P 2AFDA 2JU1A 1CEIA 2GZEA 1T8KA 5KP8B 1K8AQ 5HGNA 4M0IA 4XFXA 2KWLA 4QKOA 3CCVP 1QRJA 4BPFA 1VQPP 3G0VA 1FR2A 4PH1A 2KORA 2MVUA 1VQLP 3EJBA 3DS4A 2GZGA 2JYGA 2K94A 2JQ4A 2FAEA 3CC4P 5HGOA 4H2YC 1E6JP 2JGPA 2MVVA 1OR5A 2P9XA 3RG6C 4U0DA 1MZ8A 1S72P 4U0AA 1VQNP 3NY7B 3DS3A 2M5RA 2EIAA
chains in the Genus database with same CATH topology
2EHSA 5HV8A 2JU2A 4R0MA 1NQ4A 4HKGA 2GDXA 1VKUA 2L9FA 5HVCA 2DNWA 4PWVB 2MR7A 2KOSA 4CA3A 1X3OA 2LTEA 2KW2A 2K2QA 4PXHB 2KG8A 2FACA 1L0HA 2KGDA 3EJEA 2KGAA 3CE7A 3EJDA 2LMLA 1HY8A 2CGQA 5EJDA 1F80D 2MY5A 2AF8A 2N98A 2AFEA 1ACPA 2FVEA 2FHSC 5KP6B 2KR5A 2CG5B 4H2XC 1L0IA 2FVFA 2FQ0A 2KG6A 2FADA 2N5IA 1DNYA 2N6ZA 2XZ1C 1AF8A 2AFDA 2N50A 2KOOA 2JU1A 2ROQA 4BPHA 1T8KA 5KP8B 4NEOA 2QNWA 1HQBA 2KG9A 4DG9A 3GZLA 2KWLA 2MR8A 2N6YA 2LOLA 4BPFA 5KP7B 2CQ8A 2KGCA 2MD9A 2LKIA 3LMOA 2GDYA 2KORA 4H2WC 2L4BA 2MVUA 3GZMA 3EJBA 2FVAA 2K94A 2JQ4A 2L0QA 2GDWA 2FAEA 2FQ1A 2CNRA 2N5HA 4H2YC 2JGPA 2MVVA 2MF4A 2L22A 3RG2A 1DV5A 4BPGA 1OR5A 2KOQA 2AVAA 2VSQA 5CZDB 2LIWA 4IZ6A 2LIUA 2LPKA 2KGEA 3NY7B 2KOPA 1KLPA 2PNGA 2K93A 2XZ0D 2EHTA 2K0XA 2M5RA 2FQ2A 4MRTC 2X2BA 2LL8A 2K0YA 2K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHS A;  5HV8 A;  2JU2 A;  4R0M A;  1NQ4 A;  4HKG A;  2GDX A;  1VKU A;  2L9F A;  5HVC A;  2DNW A;  4PWV B;  2MR7 A;  2KOS A;  4CA3 A;  1X3O A;  2LTE A;  2KW2 A;  2K2Q A;  4PXH B;  2KG8 A;  2FAC A;  1L0H A;  2KGD A;  3EJE A;  2KGA A;  3CE7 A;  3EJD A;  2LML A;  1HY8 A;  2CGQ A;  5EJD A;  1F80 D;  2MY5 A;  2AF8 A;  2N98 A;  2AFE A;  1ACP A;  2FVE A;  2FHS C;  5KP6 B;  2KR5 A;  2CG5 B;  4H2X C;  1L0I A;  2FVF A;  2FQ0 A;  2KG6 A;  2FAD A;  2N5I A;  1DNY A;  2N6Z A;  2XZ1 C;  1AF8 A;  2AFD A;  2N50 A;  2KOO A;  2JU1 A;  2ROQ A;  4BPH A;  1T8K A;  5KP8 B;  4NEO A;  2QNW A;  1HQB A;  2KG9 A;  4DG9 A;  3GZL A;  2KWL A;  2MR8 A;  2N6Y A;  2LOL A;  4BPF A;  5KP7 B;  2CQ8 A;  2KGC A;  2MD9 A;  2LKI A;  3LMO A;  2GDY A;  2KOR A;  4H2W C;  2L4B A;  2MVU A;  3GZM A;  3EJB A;  2FVA A;  2K94 A;  2JQ4 A;  2L0Q A;  2GDW A;  2FAE A;  2FQ1 A;  2CNR A;  2N5H A;  4H2Y C;  2JGP A;  2MVV A;  2MF4 A;  2L22 A;  3RG2 A;  1DV5 A;  4BPG A;  1OR5 A;  2KOQ A;  2AVA A;  2VSQ A;  5CZD B;  2LIW A;  4IZ6 A;  2LIU A;  2LPK A;  2KGE A;  3NY7 B;  2KOP A;  1KLP A;  2PNG A;  2K93 A;  2XZ0 D;  2EHT A;  2K0X A;  2M5R A;  2FQ2 A;  4MRT C;  2X2B A;  2LL8 A;  2K0Y A;  2K92 A; 
#chains in the Genus database with same CATH topology
 5I4T G;  3U43 A;  1VQ9 P;  4QNB A;  2EHS A;  2JU2 A;  4HKG A;  2BHV A;  1YJ9 P;  1UJZ A;  5JPA A;  3CC7 P;  2LTE A;  1VQ7 P;  2EG5 A;  4PXH B;  2KOD A;  2L6E A;  2GZI A;  2LML A;  1HY8 A;  1EMV A;  1F80 D;  2MY5 A;  1L0I A;  2KG6 A;  1DNY A;  3CCS P;  3G26 A;  2N6Z A;  1EIA A;  2XZ1 C;  4XRO A;  5HGL A;  1BXI A;  3GJN A;  2M8L A;  4BPH A;  2LF4 A;  3H4E A;  2DGY A;  2MR8 A;  2N6Y A;  5KP7 B;  3DS1 A;  2XV6 A;  2CQ8 A;  1ZMB A;  1YIJ P;  2KGC A;  2MD9 A;  4XRQ A;  2LKI A;  2PEO A;  1IUQ A;  3CD6 P;  4H2W C;  3E2D A;  2L0Q A;  2GDW A;  3CCL P;  3M1M A;  2N5H A;  1YIT P;  1NJI Q;  3G4S P;  3CCQ P;  1VHN A;  3LRY A;  1VQ8 P;  2MF4 A;  2L22 A;  5EW5 E;  2PY8 A;  1BAJ A;  1W2B O;  2LIW A;  3VRL C;  3HYB A;  2JO0 A;  1KLP A;  2PNG A;  3DPH A;  3G6E P;  2XZ0 D;  2BUO A;  2FQ2 A;  5F2K A;  2OTJ P;  2XXM A;  5HV8 A;  4WYM A;  1GPJ A;  3Q20 A;  1VKU A;  2L9F A;  1YJW P;  4PWV B;  3B4Q A;  1ZNV A;  1X3O A;  1AUM A;  2K2Q A;  2PEI A;  2FAC A;  1L0H A;  3OW2 O;  1E0H A;  1IMP A;  2XT1 A;  5EJD A;  3G1G A;  1YJN P;  2N98 A;  2FVE A;  4U0E A;  1D1D A;  1K30 A;  3MGE A;  4COC A;  3DS0 A;  3CXC O;  1K9M Q;  3NTE A;  4UHP B;  4XFY A;  2PEM A;  1Z6M A;  2JAZ A;  2N50 A;  4IPY A;  3CC2 P;  3H0D A;  2M8N A;  2E1M A;  2VLP A;  4DG9 A;  3GZL A;  4GR6 A;  2GZF A;  1YHQ P;  2K0D X;  1M90 Q;  2ERH A;  2GYK A;  4GR2 A;  1KC8 Q;  3LMO A;  2L4B A;  3GZM A;  2JB0 A;  3DTJ A;  2PEN A;  1JJ2 O;  2FQ1 A;  2CNR A;  1VQM P;  3CPW O;  3CME P;  1M6N A;  3B5I A;  1GXH A;  1DV5 A;  2Z46 A;  2KOQ A;  2AVA A;  2VSQ A;  4F37 A;  3GKL C;  2LIU A;  1M6E X;  1YI2 P;  2NO8 A;  2EHT A;  1RO0 A;  2JBG A;  2K0Y A;  2VLQ A;  2K92 A;  4U0F A;  1Q82 Q;  2CWO A;  1NQ4 A;  2KOS A;  4CA3 A;  2Z45 A;  3CMA P;  2KG8 A;  1VQ5 P;  2KGD A;  2PEQ A;  3EJE A;  5BS2 A;  3CE7 A;  1UNK A;  3DS2 A;  2QEX P;  2GZJ A;  1RNI A;  1GXG A;  3G1I A;  3P05 A;  2KR5 A;  2CG5 B;  3HZQ A;  4H2X C;  5DCK A;  2N5I A;  4XFZ A;  1KD1 Q;  1M1K Q;  1AF8 A;  3G29 A;  2KOO A;  5BS1 A;  2ROQ A;  1EOQ A;  2VLO A;  4NEO A;  2QNW A;  1HQB A;  2KG9 A;  1N8R Q;  1Q81 Q;  3CCJ P;  2LOL A;  2OAR A;  5F2N A;  3DS5 A;  4PH0 A;  1M74 A;  2PEJ A;  1VQ6 P;  2JYL A;  1VQO P;  2GDY A;  2FVA A;  1Q86 Q;  1AYI A;  1IMQ A;  1K73 Q;  2M8P A;  1KQS O;  1RO2 A;  3I55 P;  1Q7Y Q;  3RG2 A;  4BPG A;  4U0C A;  5CZD B;  4IZ6 A;  3I56 P;  2LPK A;  2KGE A;  3WBH A;  2KOP A;  2WPT A;  2K93 A;  7CEI A;  2K0X A;  4MRT C;  2QA4 P;  2X2B A;  2LL8 A;  4COP A;  1QVG O;  4R0M A;  1VQK P;  2GDX A;  5HVC A;  2DNW A;  2MR7 A;  2VLN A;  1A8O A;  4U0B A;  5HGM A;  2EFJ A;  3CCU P;  2KW2 A;  1A43 A;  2KGA A;  3EJD A;  3G28 A;  1VQ4 P;  2CGQ A;  3CCR P;  2AF8 A;  1ACP A;  2AFE A;  2FHS C;  2K5X A;  5KP6 B;  2Z44 A;  2FVF A;  1QVF O;  2FQ0 A;  3G21 A;  3CCM P;  2FAD A;  2OTL P;  3CCE P;  5F2O A;  2PEK A;  2ONT A;  3H47 A;  3G71 P;  2AFD A;  2JU1 A;  1CEI A;  2GZE A;  1T8K A;  5KP8 B;  1K8A Q;  5HGN A;  4M0I A;  4XFX A;  2KWL A;  4QKO A;  3CCV P;  1QRJ A;  4BPF A;  1VQP P;  3G0V A;  1FR2 A;  4PH1 A;  2KOR A;  2MVU A;  1VQL P;  3EJB A;  3DS4 A;  2GZG A;  2JYG A;  2K94 A;  2JQ4 A;  2FAE A;  3CC4 P;  5HGO A;  4H2Y C;  1E6J P;  2JGP A;  2MVV A;  1OR5 A;  2P9X A;  3RG6 C;  4U0D A;  1MZ8 A;  1S72 P;  4U0A A;  1VQN P;  3NY7 B;  3DS3 A;  2M5R A;  2EIA A; 
#chains in the Genus database with same CATH homology
 2EHS A;  5HV8 A;  2JU2 A;  4R0M A;  1NQ4 A;  4HKG A;  2GDX A;  1VKU A;  2L9F A;  5HVC A;  2DNW A;  4PWV B;  2MR7 A;  2KOS A;  4CA3 A;  1X3O A;  2LTE A;  2KW2 A;  2K2Q A;  4PXH B;  2KG8 A;  2FAC A;  1L0H A;  2KGD A;  3EJE A;  2KGA A;  3CE7 A;  3EJD A;  2LML A;  1HY8 A;  2CGQ A;  5EJD A;  1F80 D;  2MY5 A;  2AF8 A;  2N98 A;  2AFE A;  1ACP A;  2FVE A;  2FHS C;  5KP6 B;  2KR5 A;  2CG5 B;  4H2X C;  1L0I A;  2FVF A;  2FQ0 A;  2KG6 A;  2FAD A;  2N5I A;  1DNY A;  2N6Z A;  2XZ1 C;  1AF8 A;  2AFD A;  2N50 A;  2KOO A;  2JU1 A;  2ROQ A;  4BPH A;  1T8K A;  5KP8 B;  4NEO A;  2QNW A;  1HQB A;  2KG9 A;  4DG9 A;  3GZL A;  2KWL A;  2MR8 A;  2N6Y A;  2LOL A;  4BPF A;  5KP7 B;  2CQ8 A;  2KGC A;  2MD9 A;  2LKI A;  3LMO A;  2GDY A;  2KOR A;  4H2W C;  2L4B A;  2MVU A;  3GZM A;  3EJB A;  2FVA A;  2K94 A;  2JQ4 A;  2L0Q A;  2GDW A;  2FAE A;  2FQ1 A;  2CNR A;  2N5H A;  4H2Y C;  2JGP A;  2MVV A;  2MF4 A;  2L22 A;  3RG2 A;  1DV5 A;  4BPG A;  1OR5 A;  2KOQ A;  2AVA A;  2VSQ A;  5CZD B;  2LIW A;  4IZ6 A;  2LIU A;  2LPK A;  2KGE A;  3NY7 B;  2KOP A;  1KLP A;  2PNG A;  2K93 A;  2XZ0 D;  2EHT A;  2K0X A;  2M5R A;  2FQ2 A;  4MRT C;  2X2B A;  2LL8 A;  2K0Y A;  2K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...