4H2WC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Ligase
total genus 20
structure length 78
sequence length 78
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2wC00
2KG8A 2K93A 2XZ1C 2FVAA 4MRTC 2L4BA 2LIWA 2KGCA 2QNWA 4PWVB 2N98A 2LIUA 5HVCA 2KOQA 5CZDB 4HKGA 2K94A 4PXHB 1L0HA 2EHTA 5KP6B 4BPFA 2FQ2A 2KOSA 2FVFA 2FAEA 2FQ1A 2MVVA 2KWLA 3EJDA 1DV5A 2AFEA 2L9FA 4BPHA 1NQ4A 2K92A 2EHSA 2JQ4A 2FQ0A 2FACA 2GDYA 2LKIA 2N6ZA 5HV8A 2X2BA 5KP7B 2N6YA 2K2QA 2KGEA 2MR8A 3RG2A 2LMLA 1HQBA 3GZLA 2XZ0D 2GDWA 4DG9A 1F80D 2DNWA 2AVAA 2LL8A 2CGQA 2CG5B 2LTEA 4IZ6A 2JU2A 4BPGA 2KG9A 2KG6A 2MD9A 1ACPA 3LMOA 2L0QA 2FHSC 3EJEA 2AF8A 1X3OA 2KW2A 2LOLA 2N5IA 4H2YC 2KGDA 2FADA 2MY5A 3CE7A 5KP8B 2PNGA 2M5RA 3NY7B 1KLPA 2ROQA 2N5HA 2CNRA 1AF8A 3EJBA 1DNYA 2KORA 2AFDA 2N50A 1VKUA 1T8KA 2K0XA 4CA3A 2L22A 2JU1A 2CQ8A 2MR7A 1L0IA 4R0MA 2GDXA 4H2XC 2KOPA 2FVEA 2KGAA 2MVUA 4NEOA 1OR5A 2JGPA 2K0YA 2LPKA 1HY8A 3GZMA 2VSQA 5EJDA 2MF4A 4H2WC 2KOOA 2KR5A
chains in the Genus database with same CATH superfamily
2OTLP 2XZ1C 1K8AQ 2NO8A 2JAZA 2FVAA 2ERHA 3DS4A 3CD6P 3CCMP 3G29A 1RNIA 5F2OA 3CCRP 1K9MQ 2JB0A 2FVFA 1QVFO 4IPYA 2FQ1A 3EJDA 1Q7YQ 1KC8Q 1DV5A 2K92A 3CCJP 3I56P 2ONTA 2JYLA 2LKIA 2K0DX 3MGEA 2K2QA 3RG2A 1VQ4P 3GZLA 1W2BO 3U43A 3G71P 2GZFA 2JU2A 4BPGA 2PENA 2KG6A 1ACPA 1IUQA 1M6EX 1VQLP 1GPJA 1VQ8P 5KP8B 2M5RA 3CCUP 1M6NA 1YHQP 3CMAP 3CMEP 3NY7B 1UNKA 3B4QA 2ROQA 2KORA 3DS3A 3CCEP 3CC2P 3E2DA 2K5XA 2L6EA 2VLOA 4XFZA 5EW5E 3LRYA 2CQ8A 1YI2P 1L0IA 1YITP 2GDXA 4H2XC 2KGAA 4NEOA 4COCA 3WBHA 5EJDA 3CCSP 4H2WC 2K93A 1UJZA 3G1GA 1YJ9P 4MRTC 2L4BA 4XFXA 2QNWA 2N98A 4U0EA 3CPWO 4HKGA 3CCQP 1VQNP 2P9XA 1L0HA 2EHTA 5KP6B 4BPFA 3CCVP 1GXGA 2FQ2A 3Q20A 2FAEA 2AFEA 2BUOA 2L9FA 4XROA 4U0DA 2EHSA 5BS1A 1Q82Q 3M1MA 2GDYA 5KP7B 1M90Q 2VLPA 2MR8A 1N8RQ 1HQBA 2CWOA 3H4EA 2GZJA 1F80D 3H47A 3CCLP 2LTEA 2CG5B 4U0FA 2KG9A 2MD9A 1YJNP 2FHSC 3EJEA 5HGMA 1NJIQ 2AF8A 1X3OA 3GKLC 3G21A 2MY5A 1E6JP 2XXMA 3CE7A 2PNGA 1EOQA 3G28A 1QRJA 5HGNA 1FR2A 1DNYA 3B5IA 3DS1A 2K0XA 1A43A 1VQ6P 3G0VA 2L22A 2OTJP 1GXHA 4COPA 1VQKP 3VRLC 2FVEA 2MVUA 1OR5A 4PH0A 2K0YA 1HY8A 4PH1A 3GZMA 1M74A 2GZIA 3G26A 4F37A 2PEOA 2QA4P 1ZNVA 1E0HA 1BXIA 2LIWA 4PWVB 2GZEA 2LIUA 5CZDB 1BAJA 1ZMBA 2K94A 4PXHB 2PEKA 3DPHA 1EIAA 5F2NA 3G6EP 2KWLA 2M8NA 2PEJA 3I55P 1NQ4A 3CC7P 2JQ4A 2FACA 2Z46A 5HV8A 2KODA 2X2BA 3HYBA 2LMLA 2XZ0D 1EMVA 2GDWA 2AVAA 2DNWA 4XRQA 2LL8A 2M8LA 2PY8A 2L0QA 2JO0A 1VQOP 5HGLA 2KW2A 4H2YC 5I4TG 2KGDA 1M1KQ 3CXCO 2PEIA 2JBGA 5F2KA 2Z44A 1VQ5P 5DCKA 2N5HA 1Q86Q 3EJBA 3DS2A 1K73Q 1VKUA 1RO0A 4CA3A 1YJWP 2Z45A 1D1DA 2JU1A 4QKOA 1QVGO 4R0MA 2KOPA 1AUMA 1JJ2O 1KD1Q 1Q81Q 3DS0A 2VSQA 4M0IA 3CC4P 1MZ8A 2KR5A 2JYGA 2EFJA 2KG8A 2VLQA 2VLNA 3P05A 1VQPP 2PEQA 2LF4A 2KGCA 3H0DA 1RO2A 5HVCA 3G4SP 2KOQA 3OW2O 1VQ9P 4U0CA 2M8PA 4WYMA 5BS2A 2KOSA 1CEIA 1S72P 2GYKA 2MVVA 4BPHA 5JPAA 2GZGA 1VQ7P 2FQ0A 2QEXP 5HGOA 2N6ZA 3NTEA 2N6YA 2OARA 2KGEA 3GJNA 1IMPA 1K30A 4XFYA 4DG9A 1YIJP 2CGQA 4IZ6A 2WPTA 1VHNA 7CEIA 3LMOA 2LOLA 2N5IA 3G1IA 3HZQA 2FADA 4QNBA 2XV6A 1KLPA 1AYIA 2CNRA 1AF8A 2AFDA 2N50A 2DGYA 3RG6C 1T8KA 4U0BA 1IMQA 1VQMP 2XT1A 2BHVA 2EIAA 1Z6MA 2MR7A 4U0AA 1KQSO 4GR2A 4UHPB 2JGPA 2LPKA 4GR6A 2PEMA 1A8OA 2E1MA 2EG5A 3DTJA 2MF4A 2KOOA 3DS5A
chains in the Genus database with same CATH topology
2KG8A 2K93A 2XZ1C 2FVAA 4MRTC 2L4BA 2LIWA 2KGCA 2QNWA 4PWVB 2N98A 2LIUA 5HVCA 2KOQA 5CZDB 4HKGA 2K94A 4PXHB 1L0HA 2EHTA 5KP6B 4BPFA 2FQ2A 2KOSA 2FVFA 2FAEA 2FQ1A 2MVVA 2KWLA 3EJDA 1DV5A 2AFEA 2L9FA 4BPHA 1NQ4A 2K92A 2EHSA 2JQ4A 2FQ0A 2FACA 2GDYA 2LKIA 2N6ZA 5HV8A 2X2BA 5KP7B 2N6YA 2K2QA 2KGEA 2MR8A 3RG2A 2LMLA 1HQBA 3GZLA 2XZ0D 2GDWA 4DG9A 1F80D 2DNWA 2AVAA 2LL8A 2CGQA 2CG5B 2LTEA 4IZ6A 2JU2A 4BPGA 2KG9A 2KG6A 2MD9A 1ACPA 3LMOA 2L0QA 2FHSC 3EJEA 2AF8A 1X3OA 2KW2A 2LOLA 2N5IA 4H2YC 2KGDA 2FADA 2MY5A 3CE7A 5KP8B 2PNGA 2M5RA 3NY7B 1KLPA 2ROQA 2N5HA 2CNRA 1AF8A 3EJBA 1DNYA 2KORA 2AFDA 2N50A 1VKUA 1T8KA 2K0XA 4CA3A 2L22A 2JU1A 2CQ8A 2MR7A 1L0IA 4R0MA 2GDXA 4H2XC 2KOPA 2FVEA 2KGAA 2MVUA 4NEOA 1OR5A 2JGPA 2K0YA 2LPKA 1HY8A 3GZMA 2VSQA 5EJDA 2MF4A 4H2WC 2KOOA 2KR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG8 A;  2K93 A;  2XZ1 C;  2FVA A;  4MRT C;  2L4B A;  2LIW A;  2KGC A;  2QNW A;  4PWV B;  2N98 A;  2LIU A;  5HVC A;  2KOQ A;  5CZD B;  4HKG A;  2K94 A;  4PXH B;  1L0H A;  2EHT A;  5KP6 B;  4BPF A;  2FQ2 A;  2KOS A;  2FVF A;  2FAE A;  2FQ1 A;  2MVV A;  2KWL A;  3EJD A;  1DV5 A;  2AFE A;  2L9F A;  4BPH A;  1NQ4 A;  2K92 A;  2EHS A;  2JQ4 A;  2FQ0 A;  2FAC A;  2GDY A;  2LKI A;  2N6Z A;  5HV8 A;  2X2B A;  5KP7 B;  2N6Y A;  2K2Q A;  2KGE A;  2MR8 A;  3RG2 A;  2LML A;  1HQB A;  3GZL A;  2XZ0 D;  2GDW A;  4DG9 A;  1F80 D;  2DNW A;  2AVA A;  2LL8 A;  2CGQ A;  2CG5 B;  2LTE A;  4IZ6 A;  2JU2 A;  4BPG A;  2KG9 A;  2KG6 A;  2MD9 A;  1ACP A;  3LMO A;  2L0Q A;  2FHS C;  3EJE A;  2AF8 A;  1X3O A;  2KW2 A;  2LOL A;  2N5I A;  4H2Y C;  2KGD A;  2FAD A;  2MY5 A;  3CE7 A;  5KP8 B;  2PNG A;  2M5R A;  3NY7 B;  1KLP A;  2ROQ A;  2N5H A;  2CNR A;  1AF8 A;  3EJB A;  1DNY A;  2KOR A;  2AFD A;  2N50 A;  1VKU A;  1T8K A;  2K0X A;  4CA3 A;  2L22 A;  2JU1 A;  2CQ8 A;  2MR7 A;  1L0I A;  4R0M A;  2GDX A;  4H2X C;  2KOP A;  2FVE A;  2KGA A;  2MVU A;  4NEO A;  1OR5 A;  2JGP A;  2K0Y A;  2LPK A;  1HY8 A;  3GZM A;  2VSQ A;  5EJD A;  2MF4 A;  4H2W C;  2KOO A;  2KR5 A; 
#chains in the Genus database with same CATH topology
 2OTL P;  2XZ1 C;  1K8A Q;  2NO8 A;  2JAZ A;  2FVA A;  2ERH A;  3DS4 A;  3CD6 P;  3CCM P;  3G29 A;  1RNI A;  5F2O A;  3CCR P;  1K9M Q;  2JB0 A;  2FVF A;  1QVF O;  4IPY A;  2FQ1 A;  3EJD A;  1Q7Y Q;  1KC8 Q;  1DV5 A;  2K92 A;  3CCJ P;  3I56 P;  2ONT A;  2JYL A;  2LKI A;  2K0D X;  3MGE A;  2K2Q A;  3RG2 A;  1VQ4 P;  3GZL A;  1W2B O;  3U43 A;  3G71 P;  2GZF A;  2JU2 A;  4BPG A;  2PEN A;  2KG6 A;  1ACP A;  1IUQ A;  1M6E X;  1VQL P;  1GPJ A;  1VQ8 P;  5KP8 B;  2M5R A;  3CCU P;  1M6N A;  1YHQ P;  3CMA P;  3CME P;  3NY7 B;  1UNK A;  3B4Q A;  2ROQ A;  2KOR A;  3DS3 A;  3CCE P;  3CC2 P;  3E2D A;  2K5X A;  2L6E A;  2VLO A;  4XFZ A;  5EW5 E;  3LRY A;  2CQ8 A;  1YI2 P;  1L0I A;  1YIT P;  2GDX A;  4H2X C;  2KGA A;  4NEO A;  4COC A;  3WBH A;  5EJD A;  3CCS P;  4H2W C;  2K93 A;  1UJZ A;  3G1G A;  1YJ9 P;  4MRT C;  2L4B A;  4XFX A;  2QNW A;  2N98 A;  4U0E A;  3CPW O;  4HKG A;  3CCQ P;  1VQN P;  2P9X A;  1L0H A;  2EHT A;  5KP6 B;  4BPF A;  3CCV P;  1GXG A;  2FQ2 A;  3Q20 A;  2FAE A;  2AFE A;  2BUO A;  2L9F A;  4XRO A;  4U0D A;  2EHS A;  5BS1 A;  1Q82 Q;  3M1M A;  2GDY A;  5KP7 B;  1M90 Q;  2VLP A;  2MR8 A;  1N8R Q;  1HQB A;  2CWO A;  3H4E A;  2GZJ A;  1F80 D;  3H47 A;  3CCL P;  2LTE A;  2CG5 B;  4U0F A;  2KG9 A;  2MD9 A;  1YJN P;  2FHS C;  3EJE A;  5HGM A;  1NJI Q;  2AF8 A;  1X3O A;  3GKL C;  3G21 A;  2MY5 A;  1E6J P;  2XXM A;  3CE7 A;  2PNG A;  1EOQ A;  3G28 A;  1QRJ A;  5HGN A;  1FR2 A;  1DNY A;  3B5I A;  3DS1 A;  2K0X A;  1A43 A;  1VQ6 P;  3G0V A;  2L22 A;  2OTJ P;  1GXH A;  4COP A;  1VQK P;  3VRL C;  2FVE A;  2MVU A;  1OR5 A;  4PH0 A;  2K0Y A;  1HY8 A;  4PH1 A;  3GZM A;  1M74 A;  2GZI A;  3G26 A;  4F37 A;  2PEO A;  2QA4 P;  1ZNV A;  1E0H A;  1BXI A;  2LIW A;  4PWV B;  2GZE A;  2LIU A;  5CZD B;  1BAJ A;  1ZMB A;  2K94 A;  4PXH B;  2PEK A;  3DPH A;  1EIA A;  5F2N A;  3G6E P;  2KWL A;  2M8N A;  2PEJ A;  3I55 P;  1NQ4 A;  3CC7 P;  2JQ4 A;  2FAC A;  2Z46 A;  5HV8 A;  2KOD A;  2X2B A;  3HYB A;  2LML A;  2XZ0 D;  1EMV A;  2GDW A;  2AVA A;  2DNW A;  4XRQ A;  2LL8 A;  2M8L A;  2PY8 A;  2L0Q A;  2JO0 A;  1VQO P;  5HGL A;  2KW2 A;  4H2Y C;  5I4T G;  2KGD A;  1M1K Q;  3CXC O;  2PEI A;  2JBG A;  5F2K A;  2Z44 A;  1VQ5 P;  5DCK A;  2N5H A;  1Q86 Q;  3EJB A;  3DS2 A;  1K73 Q;  1VKU A;  1RO0 A;  4CA3 A;  1YJW P;  2Z45 A;  1D1D A;  2JU1 A;  4QKO A;  1QVG O;  4R0M A;  2KOP A;  1AUM A;  1JJ2 O;  1KD1 Q;  1Q81 Q;  3DS0 A;  2VSQ A;  4M0I A;  3CC4 P;  1MZ8 A;  2KR5 A;  2JYG A;  2EFJ A;  2KG8 A;  2VLQ A;  2VLN A;  3P05 A;  1VQP P;  2PEQ A;  2LF4 A;  2KGC A;  3H0D A;  1RO2 A;  5HVC A;  3G4S P;  2KOQ A;  3OW2 O;  1VQ9 P;  4U0C A;  2M8P A;  4WYM A;  5BS2 A;  2KOS A;  1CEI A;  1S72 P;  2GYK A;  2MVV A;  4BPH A;  5JPA A;  2GZG A;  1VQ7 P;  2FQ0 A;  2QEX P;  5HGO A;  2N6Z A;  3NTE A;  2N6Y A;  2OAR A;  2KGE A;  3GJN A;  1IMP A;  1K30 A;  4XFY A;  4DG9 A;  1YIJ P;  2CGQ A;  4IZ6 A;  2WPT A;  1VHN A;  7CEI A;  3LMO A;  2LOL A;  2N5I A;  3G1I A;  3HZQ A;  2FAD A;  4QNB A;  2XV6 A;  1KLP A;  1AYI A;  2CNR A;  1AF8 A;  2AFD A;  2N50 A;  2DGY A;  3RG6 C;  1T8K A;  4U0B A;  1IMQ A;  1VQM P;  2XT1 A;  2BHV A;  2EIA A;  1Z6M A;  2MR7 A;  4U0A A;  1KQS O;  4GR2 A;  4UHP B;  2JGP A;  2LPK A;  4GR6 A;  2PEM A;  1A8O A;  2E1M A;  2EG5 A;  3DTJ A;  2MF4 A;  2KOO A;  3DS5 A; 
#chains in the Genus database with same CATH homology
 2KG8 A;  2K93 A;  2XZ1 C;  2FVA A;  4MRT C;  2L4B A;  2LIW A;  2KGC A;  2QNW A;  4PWV B;  2N98 A;  2LIU A;  5HVC A;  2KOQ A;  5CZD B;  4HKG A;  2K94 A;  4PXH B;  1L0H A;  2EHT A;  5KP6 B;  4BPF A;  2FQ2 A;  2KOS A;  2FVF A;  2FAE A;  2FQ1 A;  2MVV A;  2KWL A;  3EJD A;  1DV5 A;  2AFE A;  2L9F A;  4BPH A;  1NQ4 A;  2K92 A;  2EHS A;  2JQ4 A;  2FQ0 A;  2FAC A;  2GDY A;  2LKI A;  2N6Z A;  5HV8 A;  2X2B A;  5KP7 B;  2N6Y A;  2K2Q A;  2KGE A;  2MR8 A;  3RG2 A;  2LML A;  1HQB A;  3GZL A;  2XZ0 D;  2GDW A;  4DG9 A;  1F80 D;  2DNW A;  2AVA A;  2LL8 A;  2CGQ A;  2CG5 B;  2LTE A;  4IZ6 A;  2JU2 A;  4BPG A;  2KG9 A;  2KG6 A;  2MD9 A;  1ACP A;  3LMO A;  2L0Q A;  2FHS C;  3EJE A;  2AF8 A;  1X3O A;  2KW2 A;  2LOL A;  2N5I A;  4H2Y C;  2KGD A;  2FAD A;  2MY5 A;  3CE7 A;  5KP8 B;  2PNG A;  2M5R A;  3NY7 B;  1KLP A;  2ROQ A;  2N5H A;  2CNR A;  1AF8 A;  3EJB A;  1DNY A;  2KOR A;  2AFD A;  2N50 A;  1VKU A;  1T8K A;  2K0X A;  4CA3 A;  2L22 A;  2JU1 A;  2CQ8 A;  2MR7 A;  1L0I A;  4R0M A;  2GDX A;  4H2X C;  2KOP A;  2FVE A;  2KGA A;  2MVU A;  4NEO A;  1OR5 A;  2JGP A;  2K0Y A;  2LPK A;  1HY8 A;  3GZM A;  2VSQ A;  5EJD A;  2MF4 A;  4H2W C;  2KOO A;  2KR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...