4H2WC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 20
structure length 78
sequence length 78
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2wC00
2LOLA 2LKIA 3CE7A 5HVCA 2KWLA 5HV8A 1F80D 2X2BA 2N98A 2FAEA 3LMOA 5KP7B 2KG6A 2L9FA 1OR5A 2JGPA 2LL8A 2EHTA 2MF4A 2KGDA 1VKUA 1AF8A 5EJDA 3EJEA 2FACA 2LIWA 2FHSC 2ROQA 4BPGA 2CGQA 2LIUA 5KP6B 2QNWA 2K0XA 2K0YA 3GZLA 2JU2A 1KLPA 2FVEA 2CQ8A 2L0QA 4H2XC 4HKGA 2GDWA 2AFEA 2N6ZA 2K93A 2KGEA 2KOSA 2FQ1A 2GDYA 2L22A 4MRTC 3EJDA 2DNWA 2K92A 2VSQA 2MD9A 2N6YA 4NEOA 1X3OA 2L4BA 2AVAA 4PXHB 2KW2A 2MR8A 2LMLA 2FQ0A 2KG8A 2MVUA 1L0IA 2KGAA 4PWVB 2MVVA 2M5RA 4H2YC 2K94A 3RG2A 1DNYA 2LPKA 2JU1A 2KOQA 1HY8A 2CNRA 4H2WC 2FVFA 2N5HA 2XZ1C 2JQ4A 2PNGA 4BPHA 1DV5A 4BPFA 2LTEA 1L0HA 2GDXA 1ACPA 3NY7B 2FQ2A 2N50A 3GZMA 2FVAA 2XZ0D 2KG9A 1NQ4A 1T8KA 2N5IA 2AF8A 3EJBA 2MR7A 4R0MA 1HQBA 2KGCA 2K2QA 4IZ6A 2KORA 2CG5B 2KR5A 2MY5A 2AFDA 4CA3A 2EHSA 2KOOA 4DG9A 5KP8B 5CZDB 2KOPA 2FADA
chains in the Genus database with same CATH superfamily
2LOLA 4XFYA 1KD1Q 1YJNP 2N98A 3B4QA 5F2KA 2JGPA 1CEIA 1K73Q 4UHPB 2M8NA 1VQ5P 3CXCO 1VKUA 2GZEA 5HGNA 3EJEA 4U0EA 2FACA 4BPGA 2CGQA 3CCRP 2QEXP 3M1MA 2LIUA 1RO2A 3GZLA 2EIAA 3G0VA 3HYBA 3CMAP 2FVEA 4H2XC 2L0QA 3G4SP 5F2NA 3G28A 3CCEP 2LF4A 2KODA 2L22A 3G26A 2VSQA 2N6YA 2L4BA 2L6EA 2MR8A 3CCJP 3CCSP 2FQ0A 2Z44A 3Q20A 2BUOA 1RO0A 7CEIA 1L0IA 5HGOA 2OTLP 1N8RQ 2GZFA 2MVVA 3CCQP 2XV6A 4XFXA 2CNRA 2JO0A 4H2WC 4U0DA 2FVFA 1Z6MA 4BPHA 3GZMA 3LRYA 2FVAA 3DS3A 2ERHA 5BS1A 2MR7A 4U0CA 1HQBA 2XXMA 4IZ6A 1KC8Q 4CA3A 2EHSA 4QKOA 5KP8B 1BAJA 1EMVA 1K9MQ 1Q7YQ 1UJZA 2JB0A 3CE7A 2KG6A 5I4TG 1OR5A 2JBGA 2LL8A 2KGDA 2PEJA 4F37A 5EJDA 5F2OA 1D1DA 2LIWA 4U0AA 1QVFO 3GKLC 1VQPP 1M6EX 1VQ8P 2BHVA 1A8OA 2QNWA 1AYIA 1ZNVA 1M90Q 2K0YA 2K0DX 5BS2A 3DTJA 1KLPA 2PEQA 1M6NA 1YHQP 4HKGA 3H4EA 1EOQA 2AFEA 1FR2A 2KOSA 2PEIA 3MGEA 3OW2O 4MRTC 3G71P 2EG5A 3CCMP 4NEOA 2AVAA 2VLOA 2NO8A 2GZJA 4XROA 2MVUA 3CD6P 4H2YC 2VLNA 2K94A 3RG2A 1DNYA 2LPKA 1HY8A 3CC4P 4PH0A 1AUMA 2XZ1C 3H47A 2PNGA 2QA4P 1DV5A 2LTEA 1L0HA 2GDXA 4M0IA 1ACPA 2FQ2A 2N50A 1NQ4A 3CC7P 3DS2A 3EJBA 3CCUP 2KORA 2GZGA 2PEMA 1YI2P 4PH1A 3GJNA 1S72P 4U0FA 1EIAA 2PY8A 2KWLA 5HV8A 1F80D 2DGYA 2X2BA 1Q81Q 2EHTA 1K30A 3G21A 4XRQA 1QVGO 1AF8A 3DPHA 1VQ7P 1VHNA 2ROQA 1E0HA 1A43A 1K8AQ 1Q86Q 4XFZA 1IUQA 1MZ8A 2JYGA 1IMPA 3G6EP 3VRLC 1VQKP 2VLQA 2CQ8A 2EFJA 1Q82Q 1UNKA 2FQ1A 3EJDA 2MD9A 1M1KQ 1VQMP 2M8PA 4COPA 3DS1A 3DS5A 4GR2A 3P05A 2LMLA 2WPTA 2KGAA 1GXGA 1VQ6P 1W2BO 2JU1A 3CC2P 3HZQA 3H0DA 2N5HA 1QRJA 5EW5E 1M74A 2OARA 2PEKA 4IPYA 3NY7B 3CMEP 2KG9A 3G1IA 1VQLP 1YIJP 3I55P 3CCLP 4R0MA 2K2QA 2AFDA 3DS0A 3E2DA 3CCVP 5JPAA 3DS4A 1YJWP 2KOPA 2FADA 5HGMA 2LKIA 5HGLA 5HVCA 2FAEA 3LMOA 5KP7B 1NJIQ 3I56P 2PEOA 2L9FA 1GXHA 2MF4A 1GPJA 2FHSC 3NTEA 5KP6B 2K0XA 2JU2A 3B5IA 1VQNP 1KQSO 2JAZA 4GR6A 2GDWA 3CPWO 2N6ZA 4WYMA 2K93A 4QNBA 2KGEA 1VQ9P 2GDYA 2Z46A 2DNWA 2K92A 3G1GA 4U0BA 1BXIA 1YJ9P 1X3OA 2GZIA 2PENA 4PXHB 2KW2A 2M8LA 3WBHA 4COCA 2KG8A 2E1MA 4PWVB 2ONTA 2M5RA 2XT1A 1ZMBA 2KOQA 1IMQA 1JJ2O 3RG6C 2P9XA 2Z45A 1RNIA 2JQ4A 2JYLA 3G29A 4BPFA 3U43A 2XZ0D 2GYKA 2CWOA 1T8KA 2OTJP 2N5IA 1VQOP 2AF8A 1VQ4P 1YITP 2K5XA 5DCKA 2KGCA 2KR5A 2CG5B 2MY5A 2VLPA 2KOOA 1E6JP 4DG9A 5CZDB
chains in the Genus database with same CATH topology
2LOLA 2LKIA 3CE7A 5HVCA 2KWLA 5HV8A 1F80D 2X2BA 2N98A 2FAEA 3LMOA 5KP7B 2KG6A 2L9FA 1OR5A 2JGPA 2LL8A 2EHTA 2MF4A 2KGDA 1VKUA 1AF8A 5EJDA 3EJEA 2FACA 2LIWA 2FHSC 2ROQA 4BPGA 2CGQA 2LIUA 5KP6B 2QNWA 2K0XA 2K0YA 3GZLA 2JU2A 1KLPA 2FVEA 2CQ8A 2L0QA 4H2XC 4HKGA 2GDWA 2AFEA 2N6ZA 2K93A 2KGEA 2KOSA 2FQ1A 2GDYA 2L22A 4MRTC 3EJDA 2DNWA 2K92A 2VSQA 2MD9A 2N6YA 4NEOA 1X3OA 2L4BA 2AVAA 4PXHB 2KW2A 2MR8A 2LMLA 2FQ0A 2KG8A 2MVUA 1L0IA 2KGAA 4PWVB 2MVVA 2M5RA 4H2YC 2K94A 3RG2A 1DNYA 2LPKA 2JU1A 2KOQA 1HY8A 2CNRA 4H2WC 2FVFA 2N5HA 2XZ1C 2JQ4A 2PNGA 4BPHA 1DV5A 4BPFA 2LTEA 1L0HA 2GDXA 1ACPA 3NY7B 2FQ2A 2N50A 3GZMA 2FVAA 2XZ0D 2KG9A 1NQ4A 1T8KA 2N5IA 2AF8A 3EJBA 2MR7A 4R0MA 1HQBA 2KGCA 2K2QA 4IZ6A 2KORA 2CG5B 2KR5A 2MY5A 2AFDA 4CA3A 2EHSA 2KOOA 4DG9A 5KP8B 5CZDB 2KOPA 2FADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOL A;  2LKI A;  3CE7 A;  5HVC A;  2KWL A;  5HV8 A;  1F80 D;  2X2B A;  2N98 A;  2FAE A;  3LMO A;  5KP7 B;  2KG6 A;  2L9F A;  1OR5 A;  2JGP A;  2LL8 A;  2EHT A;  2MF4 A;  2KGD A;  1VKU A;  1AF8 A;  5EJD A;  3EJE A;  2FAC A;  2LIW A;  2FHS C;  2ROQ A;  4BPG A;  2CGQ A;  2LIU A;  5KP6 B;  2QNW A;  2K0X A;  2K0Y A;  3GZL A;  2JU2 A;  1KLP A;  2FVE A;  2CQ8 A;  2L0Q A;  4H2X C;  4HKG A;  2GDW A;  2AFE A;  2N6Z A;  2K93 A;  2KGE A;  2KOS A;  2FQ1 A;  2GDY A;  2L22 A;  4MRT C;  3EJD A;  2DNW A;  2K92 A;  2VSQ A;  2MD9 A;  2N6Y A;  4NEO A;  1X3O A;  2L4B A;  2AVA A;  4PXH B;  2KW2 A;  2MR8 A;  2LML A;  2FQ0 A;  2KG8 A;  2MVU A;  1L0I A;  2KGA A;  4PWV B;  2MVV A;  2M5R A;  4H2Y C;  2K94 A;  3RG2 A;  1DNY A;  2LPK A;  2JU1 A;  2KOQ A;  1HY8 A;  2CNR A;  4H2W C;  2FVF A;  2N5H A;  2XZ1 C;  2JQ4 A;  2PNG A;  4BPH A;  1DV5 A;  4BPF A;  2LTE A;  1L0H A;  2GDX A;  1ACP A;  3NY7 B;  2FQ2 A;  2N50 A;  3GZM A;  2FVA A;  2XZ0 D;  2KG9 A;  1NQ4 A;  1T8K A;  2N5I A;  2AF8 A;  3EJB A;  2MR7 A;  4R0M A;  1HQB A;  2KGC A;  2K2Q A;  4IZ6 A;  2KOR A;  2CG5 B;  2KR5 A;  2MY5 A;  2AFD A;  4CA3 A;  2EHS A;  2KOO A;  4DG9 A;  5KP8 B;  5CZD B;  2KOP A;  2FAD A; 
#chains in the Genus database with same CATH topology
 2LOL A;  4XFY A;  1KD1 Q;  1YJN P;  2N98 A;  3B4Q A;  5F2K A;  2JGP A;  1CEI A;  1K73 Q;  4UHP B;  2M8N A;  1VQ5 P;  3CXC O;  1VKU A;  2GZE A;  5HGN A;  3EJE A;  4U0E A;  2FAC A;  4BPG A;  2CGQ A;  3CCR P;  2QEX P;  3M1M A;  2LIU A;  1RO2 A;  3GZL A;  2EIA A;  3G0V A;  3HYB A;  3CMA P;  2FVE A;  4H2X C;  2L0Q A;  3G4S P;  5F2N A;  3G28 A;  3CCE P;  2LF4 A;  2KOD A;  2L22 A;  3G26 A;  2VSQ A;  2N6Y A;  2L4B A;  2L6E A;  2MR8 A;  3CCJ P;  3CCS P;  2FQ0 A;  2Z44 A;  3Q20 A;  2BUO A;  1RO0 A;  7CEI A;  1L0I A;  5HGO A;  2OTL P;  1N8R Q;  2GZF A;  2MVV A;  3CCQ P;  2XV6 A;  4XFX A;  2CNR A;  2JO0 A;  4H2W C;  4U0D A;  2FVF A;  1Z6M A;  4BPH A;  3GZM A;  3LRY A;  2FVA A;  3DS3 A;  2ERH A;  5BS1 A;  2MR7 A;  4U0C A;  1HQB A;  2XXM A;  4IZ6 A;  1KC8 Q;  4CA3 A;  2EHS A;  4QKO A;  5KP8 B;  1BAJ A;  1EMV A;  1K9M Q;  1Q7Y Q;  1UJZ A;  2JB0 A;  3CE7 A;  2KG6 A;  5I4T G;  1OR5 A;  2JBG A;  2LL8 A;  2KGD A;  2PEJ A;  4F37 A;  5EJD A;  5F2O A;  1D1D A;  2LIW A;  4U0A A;  1QVF O;  3GKL C;  1VQP P;  1M6E X;  1VQ8 P;  2BHV A;  1A8O A;  2QNW A;  1AYI A;  1ZNV A;  1M90 Q;  2K0Y A;  2K0D X;  5BS2 A;  3DTJ A;  1KLP A;  2PEQ A;  1M6N A;  1YHQ P;  4HKG A;  3H4E A;  1EOQ A;  2AFE A;  1FR2 A;  2KOS A;  2PEI A;  3MGE A;  3OW2 O;  4MRT C;  3G71 P;  2EG5 A;  3CCM P;  4NEO A;  2AVA A;  2VLO A;  2NO8 A;  2GZJ A;  4XRO A;  2MVU A;  3CD6 P;  4H2Y C;  2VLN A;  2K94 A;  3RG2 A;  1DNY A;  2LPK A;  1HY8 A;  3CC4 P;  4PH0 A;  1AUM A;  2XZ1 C;  3H47 A;  2PNG A;  2QA4 P;  1DV5 A;  2LTE A;  1L0H A;  2GDX A;  4M0I A;  1ACP A;  2FQ2 A;  2N50 A;  1NQ4 A;  3CC7 P;  3DS2 A;  3EJB A;  3CCU P;  2KOR A;  2GZG A;  2PEM A;  1YI2 P;  4PH1 A;  3GJN A;  1S72 P;  4U0F A;  1EIA A;  2PY8 A;  2KWL A;  5HV8 A;  1F80 D;  2DGY A;  2X2B A;  1Q81 Q;  2EHT A;  1K30 A;  3G21 A;  4XRQ A;  1QVG O;  1AF8 A;  3DPH A;  1VQ7 P;  1VHN A;  2ROQ A;  1E0H A;  1A43 A;  1K8A Q;  1Q86 Q;  4XFZ A;  1IUQ A;  1MZ8 A;  2JYG A;  1IMP A;  3G6E P;  3VRL C;  1VQK P;  2VLQ A;  2CQ8 A;  2EFJ A;  1Q82 Q;  1UNK A;  2FQ1 A;  3EJD A;  2MD9 A;  1M1K Q;  1VQM P;  2M8P A;  4COP A;  3DS1 A;  3DS5 A;  4GR2 A;  3P05 A;  2LML A;  2WPT A;  2KGA A;  1GXG A;  1VQ6 P;  1W2B O;  2JU1 A;  3CC2 P;  3HZQ A;  3H0D A;  2N5H A;  1QRJ A;  5EW5 E;  1M74 A;  2OAR A;  2PEK A;  4IPY A;  3NY7 B;  3CME P;  2KG9 A;  3G1I A;  1VQL P;  1YIJ P;  3I55 P;  3CCL P;  4R0M A;  2K2Q A;  2AFD A;  3DS0 A;  3E2D A;  3CCV P;  5JPA A;  3DS4 A;  1YJW P;  2KOP A;  2FAD A;  5HGM A;  2LKI A;  5HGL A;  5HVC A;  2FAE A;  3LMO A;  5KP7 B;  1NJI Q;  3I56 P;  2PEO A;  2L9F A;  1GXH A;  2MF4 A;  1GPJ A;  2FHS C;  3NTE A;  5KP6 B;  2K0X A;  2JU2 A;  3B5I A;  1VQN P;  1KQS O;  2JAZ A;  4GR6 A;  2GDW A;  3CPW O;  2N6Z A;  4WYM A;  2K93 A;  4QNB A;  2KGE A;  1VQ9 P;  2GDY A;  2Z46 A;  2DNW A;  2K92 A;  3G1G A;  4U0B A;  1BXI A;  1YJ9 P;  1X3O A;  2GZI A;  2PEN A;  4PXH B;  2KW2 A;  2M8L A;  3WBH A;  4COC A;  2KG8 A;  2E1M A;  4PWV B;  2ONT A;  2M5R A;  2XT1 A;  1ZMB A;  2KOQ A;  1IMQ A;  1JJ2 O;  3RG6 C;  2P9X A;  2Z45 A;  1RNI A;  2JQ4 A;  2JYL A;  3G29 A;  4BPF A;  3U43 A;  2XZ0 D;  2GYK A;  2CWO A;  1T8K A;  2OTJ P;  2N5I A;  1VQO P;  2AF8 A;  1VQ4 P;  1YIT P;  2K5X A;  5DCK A;  2KGC A;  2KR5 A;  2CG5 B;  2MY5 A;  2VLP A;  2KOO A;  1E6J P;  4DG9 A;  5CZD B; 
#chains in the Genus database with same CATH homology
 2LOL A;  2LKI A;  3CE7 A;  5HVC A;  2KWL A;  5HV8 A;  1F80 D;  2X2B A;  2N98 A;  2FAE A;  3LMO A;  5KP7 B;  2KG6 A;  2L9F A;  1OR5 A;  2JGP A;  2LL8 A;  2EHT A;  2MF4 A;  2KGD A;  1VKU A;  1AF8 A;  5EJD A;  3EJE A;  2FAC A;  2LIW A;  2FHS C;  2ROQ A;  4BPG A;  2CGQ A;  2LIU A;  5KP6 B;  2QNW A;  2K0X A;  2K0Y A;  3GZL A;  2JU2 A;  1KLP A;  2FVE A;  2CQ8 A;  2L0Q A;  4H2X C;  4HKG A;  2GDW A;  2AFE A;  2N6Z A;  2K93 A;  2KGE A;  2KOS A;  2FQ1 A;  2GDY A;  2L22 A;  4MRT C;  3EJD A;  2DNW A;  2K92 A;  2VSQ A;  2MD9 A;  2N6Y A;  4NEO A;  1X3O A;  2L4B A;  2AVA A;  4PXH B;  2KW2 A;  2MR8 A;  2LML A;  2FQ0 A;  2KG8 A;  2MVU A;  1L0I A;  2KGA A;  4PWV B;  2MVV A;  2M5R A;  4H2Y C;  2K94 A;  3RG2 A;  1DNY A;  2LPK A;  2JU1 A;  2KOQ A;  1HY8 A;  2CNR A;  4H2W C;  2FVF A;  2N5H A;  2XZ1 C;  2JQ4 A;  2PNG A;  4BPH A;  1DV5 A;  4BPF A;  2LTE A;  1L0H A;  2GDX A;  1ACP A;  3NY7 B;  2FQ2 A;  2N50 A;  3GZM A;  2FVA A;  2XZ0 D;  2KG9 A;  1NQ4 A;  1T8K A;  2N5I A;  2AF8 A;  3EJB A;  2MR7 A;  4R0M A;  1HQB A;  2KGC A;  2K2Q A;  4IZ6 A;  2KOR A;  2CG5 B;  2KR5 A;  2MY5 A;  2AFD A;  4CA3 A;  2EHS A;  2KOO A;  4DG9 A;  5KP8 B;  5CZD B;  2KOP A;  2FAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...