4H2WC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Ligase
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
total genus 20
structure length 78
sequence length 78
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2wC00
1T8KA 5KP7B 2ROQA 2LIUA 2LKIA 1HQBA 4H2WC 4PXHB 2KR5A 3LMOA 3CE7A 3EJEA 2KGCA 2EHTA 4H2XC 2L22A 1OR5A 1AF8A 2KG6A 2KOPA 2KOQA 2CNRA 1NQ4A 2N50A 2MVVA 2JU1A 2KORA 2N5HA 2CGQA 4HKGA 1DV5A 2KGAA 2N6YA 2KOOA 2L0QA 2MY5A 2XZ1C 4BPGA 2K0XA 2KW2A 5CZDB 1X3OA 2KGEA 2AF8A 3EJDA 1ACPA 1L0HA 2CG5B 1L0IA 2FACA 1DNYA 2EHSA 4IZ6A 2K92A 2LL8A 2K94A 2FHSC 3RG2A 2MF4A 4PWVB 2AFDA 5HV8A 2KG8A 2M5RA 2L9FA 2JGPA 5KP6B 2N6ZA 2N5IA 2LTEA 2AVAA 4H2YC 2X2BA 1VKUA 2JU2A 3EJBA 2FVAA 2AFEA 4NEOA 1HY8A 5HVCA 2L4BA 2KOSA 2QNWA 3NY7B 2FQ1A 2FVEA 2K2QA 5EJDA 2K0YA 2FADA 3GZMA 4BPFA 2VSQA 5KP8B 2XZ0D 2FVFA 2FAEA 2KGDA 2MR8A 2CQ8A 4R0MA 2MD9A 2N98A 2KWLA 1F80D 2LIWA 2DNWA 4DG9A 2LPKA 2GDWA 2LMLA 2LOLA 3GZLA 2PNGA 1KLPA 4MRTC 2GDYA 2MVUA 4CA3A 2MR7A 2KG9A 2GDXA 2FQ0A 2FQ2A 2K93A 4BPHA 2JQ4A
chains in the Genus database with same CATH superfamily
2BHVA 5KP7B 2ROQA 5HGOA 3G4SP 3CXCO 1K9MQ 3CPWO 2KGCA 3GKLC 1AF8A 1EIAA 1VQ6P 2KG6A 1YJNP 2KOQA 2MVVA 2KORA 2CGQA 2L0QA 3G71P 2MY5A 2XZ1C 2KGEA 4IPYA 3CCUP 1VQOP 2AF8A 3CCSP 2FACA 4COCA 3CCRP 2K94A 3I56P 5F2KA 2QA4P 2M5RA 2JGPA 2VLNA 1Q7YQ 2LTEA 3LRYA 4H2YC 2ERHA 2JU2A 3CCMP 2PEQA 2FVAA 3HYBA 2Z46A 1VQ9P 2K5XA 2KOSA 4QKOA 3CCJP 5HGLA 1VQ4P 2FADA 1VQPP 2XZ0D 2FAEA 3CC7P 3Q20A 1K30A 2MD9A 4XROA 2KWLA 1M90Q 2GZGA 1Q86Q 1S72P 1M1KQ 1FR2A 1VQKP 4U0AA 3CC4P 2K0DX 1M74A 2MR7A 3DS0A 5I4TG 3P05A 1YJWP 1T8KA 2LIUA 2JAZA 2KR5A 3H0DA 3EJEA 3CCVP 1QRJA 2EHTA 2JB0A 4U0CA 3DS4A 3GJNA 2CNRA 2PEJA 2JYGA 1DV5A 2GZIA 2KOOA 3G0VA 1ZNVA 4U0BA 2K0XA 2M8LA 5CZDB 1KD1Q 1DNYA 1L0IA 5EW5E 2EHSA 4IZ6A 2K92A 2LL8A 5JPAA 2FHSC 2E1MA 1RO2A 4XFYA 1N8RQ 1ZMBA 2PEIA 5KP6B 3H47A 2AVAA 2PY8A 2JO0A 1E6JP 1IUQA 4NEOA 1HY8A 5HVCA 2L4BA 2VLOA 1M6NA 3B5IA 2VSQA 2NO8A 1IMQA 2DGYA 1JJ2O 2KGDA 2N98A 1F80D 3G6EP 4PH1A 4GR2A 2LPKA 1VQ5P 2LOLA 1KLPA 2OTJP 1VQNP 1UNKA 4CA3A 3U43A 4U0EA 1RO0A 2GDXA 2FQ0A 1W2BO 2QEXP 2FQ2A 4BPHA 1A8OA 3DS1A 4F37A 3M1MA 2LKIA 2GZEA 2JBGA 2Z44A 4H2WC 1GXGA 1YITP 3LMOA 2CWOA 2XV6A 3G1IA 5BS2A 4H2XC 2L22A 1AYIA 5HGNA 2ONTA 2WPTA 2OTLP 1CEIA 5BS1A 2KGAA 2N6YA 2VLQA 7CEIA 3G1GA 2M8PA 4BPGA 1X3OA 3DS5A 3DTJA 3WBHA 1L0HA 1QVFO 1YJ9P 2MF4A 2AFDA 5HV8A 1YHQP 2LF4A 5DCKA 1E0HA 3G26A 4XRQA 1KC8Q 2Z45A 3B4QA 2P9XA 3I55P 5F2NA 1YIJP 2PEOA 3NY7B 1VQLP 3CMEP 2K0YA 3GZMA 4BPFA 1KQSO 5KP8B 1EMVA 2KODA 2CQ8A 4R0MA 3G29A 1QVGO 2LIWA 2GDWA 2LMLA 2PENA 4MRTC 3CCQP 2PEMA 1VQ7P 2EG5A 1Q81Q 3H4EA 1GPJA 2BUOA 2K93A 4M0IA 1EOQA 3G28A 3RG6C 1HQBA 4PXHB 1VQ8P 3CE7A 2JYLA 4XFZA 1OR5A 4GR6A 1M6EX 2EFJA 2KOPA 1NQ4A 4WYMA 2N50A 1IMPA 2JU1A 2N5HA 4U0DA 4HKGA 1D1DA 5HGMA 1AUMA 2GZJA 1UJZA 3CMAP 3VRLC 4UHPB 1VHNA 2XT1A 2KW2A 4PH0A 3EJDA 1ACPA 2EIAA 2CG5B 3MGEA 4XFXA 3G21A 3E2DA 2XXMA 2GZFA 1YI2P 3RG2A 4COPA 4PWVB 2KG8A 2L9FA 2N6ZA 1BXIA 1BAJA 2N5IA 1MZ8A 2X2BA 1A43A 1VKUA 3EJBA 2AFEA 1GXHA 2M8NA 1RNIA 2OARA 3DS2A 2QNWA 4U0FA 2FQ1A 2FVEA 3OW2O 3CCEP 2K2QA 5EJDA 3NTEA 3DPHA 4QNBA 5F2OA 2FVFA 1VQMP 1NJIQ 2L6EA 2PEKA 2VLPA 2MR8A 3HZQA 2DNWA 4DG9A 3CC2P 1Z6MA 3CCLP 3DS3A 3GZLA 2PNGA 2GDYA 2GYKA 2MVUA 2KG9A 1K8AQ 1Q82Q 1K73Q 2JQ4A 3CD6P
chains in the Genus database with same CATH topology
1T8KA 5KP7B 2ROQA 2LIUA 2LKIA 1HQBA 4H2WC 4PXHB 2KR5A 3LMOA 3CE7A 3EJEA 2KGCA 2EHTA 4H2XC 2L22A 1OR5A 1AF8A 2KG6A 2KOPA 2KOQA 2CNRA 1NQ4A 2N50A 2MVVA 2JU1A 2KORA 2N5HA 2CGQA 4HKGA 1DV5A 2KGAA 2N6YA 2KOOA 2L0QA 2MY5A 2XZ1C 4BPGA 2K0XA 2KW2A 5CZDB 1X3OA 2KGEA 2AF8A 3EJDA 1ACPA 1L0HA 2CG5B 1L0IA 2FACA 1DNYA 2EHSA 4IZ6A 2K92A 2LL8A 2K94A 2FHSC 3RG2A 2MF4A 4PWVB 2AFDA 5HV8A 2KG8A 2M5RA 2L9FA 2JGPA 5KP6B 2N6ZA 2N5IA 2LTEA 2AVAA 4H2YC 2X2BA 1VKUA 2JU2A 3EJBA 2FVAA 2AFEA 4NEOA 1HY8A 5HVCA 2L4BA 2KOSA 2QNWA 3NY7B 2FQ1A 2FVEA 2K2QA 5EJDA 2K0YA 2FADA 3GZMA 4BPFA 2VSQA 5KP8B 2XZ0D 2FVFA 2FAEA 2KGDA 2MR8A 2CQ8A 4R0MA 2MD9A 2N98A 2KWLA 1F80D 2LIWA 2DNWA 4DG9A 2LPKA 2GDWA 2LMLA 2LOLA 3GZLA 2PNGA 1KLPA 4MRTC 2GDYA 2MVUA 4CA3A 2MR7A 2KG9A 2GDXA 2FQ0A 2FQ2A 2K93A 4BPHA 2JQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8K A;  5KP7 B;  2ROQ A;  2LIU A;  2LKI A;  1HQB A;  4H2W C;  4PXH B;  2KR5 A;  3LMO A;  3CE7 A;  3EJE A;  2KGC A;  2EHT A;  4H2X C;  2L22 A;  1OR5 A;  1AF8 A;  2KG6 A;  2KOP A;  2KOQ A;  2CNR A;  1NQ4 A;  2N50 A;  2MVV A;  2JU1 A;  2KOR A;  2N5H A;  2CGQ A;  4HKG A;  1DV5 A;  2KGA A;  2N6Y A;  2KOO A;  2L0Q A;  2MY5 A;  2XZ1 C;  4BPG A;  2K0X A;  2KW2 A;  5CZD B;  1X3O A;  2KGE A;  2AF8 A;  3EJD A;  1ACP A;  1L0H A;  2CG5 B;  1L0I A;  2FAC A;  1DNY A;  2EHS A;  4IZ6 A;  2K92 A;  2LL8 A;  2K94 A;  2FHS C;  3RG2 A;  2MF4 A;  4PWV B;  2AFD A;  5HV8 A;  2KG8 A;  2M5R A;  2L9F A;  2JGP A;  5KP6 B;  2N6Z A;  2N5I A;  2LTE A;  2AVA A;  4H2Y C;  2X2B A;  1VKU A;  2JU2 A;  3EJB A;  2FVA A;  2AFE A;  4NEO A;  1HY8 A;  5HVC A;  2L4B A;  2KOS A;  2QNW A;  3NY7 B;  2FQ1 A;  2FVE A;  2K2Q A;  5EJD A;  2K0Y A;  2FAD A;  3GZM A;  4BPF A;  2VSQ A;  5KP8 B;  2XZ0 D;  2FVF A;  2FAE A;  2KGD A;  2MR8 A;  2CQ8 A;  4R0M A;  2MD9 A;  2N98 A;  2KWL A;  1F80 D;  2LIW A;  2DNW A;  4DG9 A;  2LPK A;  2GDW A;  2LML A;  2LOL A;  3GZL A;  2PNG A;  1KLP A;  4MRT C;  2GDY A;  2MVU A;  4CA3 A;  2MR7 A;  2KG9 A;  2GDX A;  2FQ0 A;  2FQ2 A;  2K93 A;  4BPH A;  2JQ4 A; 
#chains in the Genus database with same CATH topology
 2BHV A;  5KP7 B;  2ROQ A;  5HGO A;  3G4S P;  3CXC O;  1K9M Q;  3CPW O;  2KGC A;  3GKL C;  1AF8 A;  1EIA A;  1VQ6 P;  2KG6 A;  1YJN P;  2KOQ A;  2MVV A;  2KOR A;  2CGQ A;  2L0Q A;  3G71 P;  2MY5 A;  2XZ1 C;  2KGE A;  4IPY A;  3CCU P;  1VQO P;  2AF8 A;  3CCS P;  2FAC A;  4COC A;  3CCR P;  2K94 A;  3I56 P;  5F2K A;  2QA4 P;  2M5R A;  2JGP A;  2VLN A;  1Q7Y Q;  2LTE A;  3LRY A;  4H2Y C;  2ERH A;  2JU2 A;  3CCM P;  2PEQ A;  2FVA A;  3HYB A;  2Z46 A;  1VQ9 P;  2K5X A;  2KOS A;  4QKO A;  3CCJ P;  5HGL A;  1VQ4 P;  2FAD A;  1VQP P;  2XZ0 D;  2FAE A;  3CC7 P;  3Q20 A;  1K30 A;  2MD9 A;  4XRO A;  2KWL A;  1M90 Q;  2GZG A;  1Q86 Q;  1S72 P;  1M1K Q;  1FR2 A;  1VQK P;  4U0A A;  3CC4 P;  2K0D X;  1M74 A;  2MR7 A;  3DS0 A;  5I4T G;  3P05 A;  1YJW P;  1T8K A;  2LIU A;  2JAZ A;  2KR5 A;  3H0D A;  3EJE A;  3CCV P;  1QRJ A;  2EHT A;  2JB0 A;  4U0C A;  3DS4 A;  3GJN A;  2CNR A;  2PEJ A;  2JYG A;  1DV5 A;  2GZI A;  2KOO A;  3G0V A;  1ZNV A;  4U0B A;  2K0X A;  2M8L A;  5CZD B;  1KD1 Q;  1DNY A;  1L0I A;  5EW5 E;  2EHS A;  4IZ6 A;  2K92 A;  2LL8 A;  5JPA A;  2FHS C;  2E1M A;  1RO2 A;  4XFY A;  1N8R Q;  1ZMB A;  2PEI A;  5KP6 B;  3H47 A;  2AVA A;  2PY8 A;  2JO0 A;  1E6J P;  1IUQ A;  4NEO A;  1HY8 A;  5HVC A;  2L4B A;  2VLO A;  1M6N A;  3B5I A;  2VSQ A;  2NO8 A;  1IMQ A;  2DGY A;  1JJ2 O;  2KGD A;  2N98 A;  1F80 D;  3G6E P;  4PH1 A;  4GR2 A;  2LPK A;  1VQ5 P;  2LOL A;  1KLP A;  2OTJ P;  1VQN P;  1UNK A;  4CA3 A;  3U43 A;  4U0E A;  1RO0 A;  2GDX A;  2FQ0 A;  1W2B O;  2QEX P;  2FQ2 A;  4BPH A;  1A8O A;  3DS1 A;  4F37 A;  3M1M A;  2LKI A;  2GZE A;  2JBG A;  2Z44 A;  4H2W C;  1GXG A;  1YIT P;  3LMO A;  2CWO A;  2XV6 A;  3G1I A;  5BS2 A;  4H2X C;  2L22 A;  1AYI A;  5HGN A;  2ONT A;  2WPT A;  2OTL P;  1CEI A;  5BS1 A;  2KGA A;  2N6Y A;  2VLQ A;  7CEI A;  3G1G A;  2M8P A;  4BPG A;  1X3O A;  3DS5 A;  3DTJ A;  3WBH A;  1L0H A;  1QVF O;  1YJ9 P;  2MF4 A;  2AFD A;  5HV8 A;  1YHQ P;  2LF4 A;  5DCK A;  1E0H A;  3G26 A;  4XRQ A;  1KC8 Q;  2Z45 A;  3B4Q A;  2P9X A;  3I55 P;  5F2N A;  1YIJ P;  2PEO A;  3NY7 B;  1VQL P;  3CME P;  2K0Y A;  3GZM A;  4BPF A;  1KQS O;  5KP8 B;  1EMV A;  2KOD A;  2CQ8 A;  4R0M A;  3G29 A;  1QVG O;  2LIW A;  2GDW A;  2LML A;  2PEN A;  4MRT C;  3CCQ P;  2PEM A;  1VQ7 P;  2EG5 A;  1Q81 Q;  3H4E A;  1GPJ A;  2BUO A;  2K93 A;  4M0I A;  1EOQ A;  3G28 A;  3RG6 C;  1HQB A;  4PXH B;  1VQ8 P;  3CE7 A;  2JYL A;  4XFZ A;  1OR5 A;  4GR6 A;  1M6E X;  2EFJ A;  2KOP A;  1NQ4 A;  4WYM A;  2N50 A;  1IMP A;  2JU1 A;  2N5H A;  4U0D A;  4HKG A;  1D1D A;  5HGM A;  1AUM A;  2GZJ A;  1UJZ A;  3CMA P;  3VRL C;  4UHP B;  1VHN A;  2XT1 A;  2KW2 A;  4PH0 A;  3EJD A;  1ACP A;  2EIA A;  2CG5 B;  3MGE A;  4XFX A;  3G21 A;  3E2D A;  2XXM A;  2GZF A;  1YI2 P;  3RG2 A;  4COP A;  4PWV B;  2KG8 A;  2L9F A;  2N6Z A;  1BXI A;  1BAJ A;  2N5I A;  1MZ8 A;  2X2B A;  1A43 A;  1VKU A;  3EJB A;  2AFE A;  1GXH A;  2M8N A;  1RNI A;  2OAR A;  3DS2 A;  2QNW A;  4U0F A;  2FQ1 A;  2FVE A;  3OW2 O;  3CCE P;  2K2Q A;  5EJD A;  3NTE A;  3DPH A;  4QNB A;  5F2O A;  2FVF A;  1VQM P;  1NJI Q;  2L6E A;  2PEK A;  2VLP A;  2MR8 A;  3HZQ A;  2DNW A;  4DG9 A;  3CC2 P;  1Z6M A;  3CCL P;  3DS3 A;  3GZL A;  2PNG A;  2GDY A;  2GYK A;  2MVU A;  2KG9 A;  1K8A Q;  1Q82 Q;  1K73 Q;  2JQ4 A;  3CD6 P; 
#chains in the Genus database with same CATH homology
 1T8K A;  5KP7 B;  2ROQ A;  2LIU A;  2LKI A;  1HQB A;  4H2W C;  4PXH B;  2KR5 A;  3LMO A;  3CE7 A;  3EJE A;  2KGC A;  2EHT A;  4H2X C;  2L22 A;  1OR5 A;  1AF8 A;  2KG6 A;  2KOP A;  2KOQ A;  2CNR A;  1NQ4 A;  2N50 A;  2MVV A;  2JU1 A;  2KOR A;  2N5H A;  2CGQ A;  4HKG A;  1DV5 A;  2KGA A;  2N6Y A;  2KOO A;  2L0Q A;  2MY5 A;  2XZ1 C;  4BPG A;  2K0X A;  2KW2 A;  5CZD B;  1X3O A;  2KGE A;  2AF8 A;  3EJD A;  1ACP A;  1L0H A;  2CG5 B;  1L0I A;  2FAC A;  1DNY A;  2EHS A;  4IZ6 A;  2K92 A;  2LL8 A;  2K94 A;  2FHS C;  3RG2 A;  2MF4 A;  4PWV B;  2AFD A;  5HV8 A;  2KG8 A;  2M5R A;  2L9F A;  2JGP A;  5KP6 B;  2N6Z A;  2N5I A;  2LTE A;  2AVA A;  4H2Y C;  2X2B A;  1VKU A;  2JU2 A;  3EJB A;  2FVA A;  2AFE A;  4NEO A;  1HY8 A;  5HVC A;  2L4B A;  2KOS A;  2QNW A;  3NY7 B;  2FQ1 A;  2FVE A;  2K2Q A;  5EJD A;  2K0Y A;  2FAD A;  3GZM A;  4BPF A;  2VSQ A;  5KP8 B;  2XZ0 D;  2FVF A;  2FAE A;  2KGD A;  2MR8 A;  2CQ8 A;  4R0M A;  2MD9 A;  2N98 A;  2KWL A;  1F80 D;  2LIW A;  2DNW A;  4DG9 A;  2LPK A;  2GDW A;  2LML A;  2LOL A;  3GZL A;  2PNG A;  1KLP A;  4MRT C;  2GDY A;  2MVU A;  4CA3 A;  2MR7 A;  2KG9 A;  2GDX A;  2FQ0 A;  2FQ2 A;  2K93 A;  4BPH A;  2JQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...