4H2WC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
b'HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Ligase
total genus 20
structure length 78
sequence length 78
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2wC00
1VKUA 2MD9A 2K92A 4MRTC 2L9FA 2MVVA 4R0MA 1HY8A 5KP6B 2FVAA 1NQ4A 2KG9A 2KORA 4NEOA 2LTEA 2K0XA 1ACPA 2FQ1A 2JU1A 2EHSA 2AFEA 2GDYA 2KR5A 4H2YC 3EJDA 4BPGA 2K0YA 1T8KA 2FACA 2XZ1C 2N6YA 4BPHA 2KW2A 1KLPA 2VSQA 4IZ6A 4HKGA 3CE7A 1OR5A 2GDXA 3EJEA 1L0IA 2JQ4A 2FVEA 2LKIA 2K2QA 2K94A 2ROQA 1L0HA 5CZDB 2FHSC 4H2XC 2CNRA 4BPFA 2CQ8A 2CG5B 1HQBA 2KGEA 2CGQA 1DV5A 2LIWA 2KOPA 2LOLA 3LMOA 2JU2A 2N50A 1F80D 2AVAA 2KOQA 2LL8A 2KGCA 2KWLA 2GDWA 2LIUA 2MY5A 2AFDA 2KG6A 2KGAA 5KP7B 2LMLA 2L4BA 2N5HA 2AF8A 2KOSA 1AF8A 2FADA 2K93A 2KOOA 2DNWA 2X2BA 2KG8A 2PNGA 2FQ2A 1X3OA 2EHTA 2L22A 3EJBA 3GZLA 2LPKA 2FAEA 2L0QA 4PWVB 2MF4A 2MVUA 2JGPA 3NY7B 4PXHB 2MR8A 2MR7A 4H2WC 5HVCA 2FVFA 2QNWA 3GZMA 5EJDA 4CA3A 2KGDA 2FQ0A 1DNYA 3RG2A 5KP8B 2N6ZA 5HV8A 2M5RA 2N5IA 4DG9A 2XZ0D 2N98A
chains in the Genus database with same CATH superfamily
1QVGO 2K92A 1K8AQ 1ZMBA 2VLOA 4R0MA 1IMQA 3CMAP 3G6EP 1RNIA 4XFZA 1VQPP 3DS0A 3M1MA 2FQ1A 2KR5A 2EHSA 4COPA 1KLPA 4IZ6A 5I4TG 3CE7A 1OR5A 2GDXA 2KODA 3G0VA 2M8LA 1ZNVA 2XT1A 3HZQA 1D1DA 4U0CA 1K73Q 1Q81Q 3GJNA 4U0BA 2CGQA 1VQ8P 2PEJA 3CCRP 1VQMP 1E0HA 3G21A 2KGCA 2LIUA 2XXMA 1BAJA 3G1IA 2M8PA 2LMLA 2KOSA 1VQ4P 2OARA 1EMVA 2FADA 1M6EX 2BUOA 2DNWA 2KG8A 1E6JP 3GZLA 3I56P 5F2NA 4XROA 1GXGA 4U0FA 5HVCA 3GZMA 3I55P 5JPAA 2DGYA 2P9XA 3RG2A 3RG6C 5KP8B 1RO0A 2EIAA 2M5RA 3G29A 1VQOP 4DG9A 4COCA 5BS2A 1VQ5P 3GKLC 2GZEA 1S72P 3G71P 1NQ4A 4U0EA 1VQ7P 3CCUP 2KORA 1ACPA 4PH1A 2GDYA 2AFEA 3CCSP 4WYMA 3B5IA 1T8KA 1M1KQ 3CC4P 4IPYA 2FACA 1KD1Q 2N6YA 4BPHA 1YHQP 2Z46A 1JJ2O 3CCMP 3EJEA 3CCQP 1L0IA 4PH0A 3OW2O 3CCJP 3MGEA 4BPFA 2CQ8A 1HQBA 2CG5B 2LIWA 3DS4A 2LOLA 2EG5A 4XFYA 3DS1A 1MZ8A 1F80D 1KC8Q 2EFJA 2LL8A 5EW5E 1EIAA 2KWLA 2GDWA 3U43A 2MY5A 1NJIQ 2KGAA 1RO2A 1VQ6P 2GZGA 3CCVP 2CWOA 2VLQA 1QVFO 2KOOA 2Z45A 3DS5A 3G26A 2QEXP 2EHTA 2L22A 3WBHA 1IMPA 2L0QA 2MF4A 2MVUA 2JGPA 4PXHB 2OTLP 3CPWO 2MR7A 1UJZA 7CEIA 3B4QA 4CA3A 3E2DA 1BXIA 1W2BO 1KQSO 5HV8A 2N5IA 5F2OA 1VKUA 2PEQA 5DCKA 4MRTC 2JBGA 1HY8A 4QNBA 2FVAA 5KP6B 2GYKA 5HGOA 4NEOA 2LTEA 2M8NA 2ERHA 3CXCO 4H2YC 3EJDA 4BPGA 2PEOA 4XFXA 3VRLC 4HKGA 5HGMA 1GPJA 2PY8A 1YJNP 2K94A 3CD6P 1L0HA 5CZDB 2FHSC 1Q82Q 4H2XC 2XV6A 2CNRA 1DV5A 2ONTA 3P05A 2KOPA 2JAZA 2PENA 2VLNA 1VHNA 2WPTA 3G1GA 2KOQA 3CCLP 1EOQA 2KG6A 5KP7B 2L4BA 2N5HA 2AF8A 1AF8A 3H0DA 2K93A 2X2BA 4XRQA 2FQ2A 1QRJA 1AUMA 2JO0A 3LRYA 1AYIA 2FAEA 4PWVB 3NY7B 1YI2P 4H2WC 3HYBA 3DS3A 2QNWA 3DPHA 5EJDA 1CEIA 1VQLP 3DS2A 2XZ0D 2MD9A 2JYGA 1K9MQ 1N8RQ 1YJWP 2VLPA 2L9FA 2MVVA 1YIJP 2OTJP 2GZFA 2KG9A 1Z6MA 2BHVA 2K0XA 4M0IA 3G4SP 2JU1A 1FR2A 2K0YA 2K5XA 1M74A 2L6EA 2XZ1C 1VQ9P 2JB0A 1YJ9P 2KW2A 2VSQA 1GXHA 5BS1A 2PEKA 2JQ4A 2FVEA 3CCEP 1VQKP 3CMEP 2LKIA 2K2QA 2PEMA 2ROQA 1M90Q 2Z44A 1A8OA 5F2KA 2KGEA 1K30A 3LMOA 2JU2A 2N50A 4F37A 1VQNP 2K0DX 4QKOA 5HGLA 5HGNA 1Q86Q 2E1MA 4U0DA 2AVAA 2QA4P 3G28A 4U0AA 2AFDA 3H4EA 1Q7YQ 3DTJA 2NO8A 4GR6A 2LF4A 4GR2A 2PNGA 1A43A 1X3OA 3CC2P 2GZJA 3H47A 3EJBA 3CC7P 1YITP 2JYLA 1UNKA 3NTEA 2LPKA 3Q20A 2MR8A 2FVFA 4UHPB 2KGDA 1M6NA 2FQ0A 1DNYA 2N6ZA 2PEIA 2GZIA 2N98A 1IUQA
chains in the Genus database with same CATH topology
1VKUA 2MD9A 2K92A 4MRTC 2L9FA 2MVVA 4R0MA 1HY8A 5KP6B 2FVAA 1NQ4A 2KG9A 2KORA 4NEOA 2LTEA 2K0XA 1ACPA 2FQ1A 2JU1A 2EHSA 2AFEA 2GDYA 2KR5A 4H2YC 3EJDA 4BPGA 2K0YA 1T8KA 2FACA 2XZ1C 2N6YA 4BPHA 2KW2A 1KLPA 2VSQA 4IZ6A 4HKGA 3CE7A 1OR5A 2GDXA 3EJEA 1L0IA 2JQ4A 2FVEA 2LKIA 2K2QA 2K94A 2ROQA 1L0HA 5CZDB 2FHSC 4H2XC 2CNRA 4BPFA 2CQ8A 2CG5B 1HQBA 2KGEA 2CGQA 1DV5A 2LIWA 2KOPA 2LOLA 3LMOA 2JU2A 2N50A 1F80D 2AVAA 2KOQA 2LL8A 2KGCA 2KWLA 2GDWA 2LIUA 2MY5A 2AFDA 2KG6A 2KGAA 5KP7B 2LMLA 2L4BA 2N5HA 2AF8A 2KOSA 1AF8A 2FADA 2K93A 2KOOA 2DNWA 2X2BA 2KG8A 2PNGA 2FQ2A 1X3OA 2EHTA 2L22A 3EJBA 3GZLA 2LPKA 2FAEA 2L0QA 4PWVB 2MF4A 2MVUA 2JGPA 3NY7B 4PXHB 2MR8A 2MR7A 4H2WC 5HVCA 2FVFA 2QNWA 3GZMA 5EJDA 4CA3A 2KGDA 2FQ0A 1DNYA 3RG2A 5KP8B 2N6ZA 5HV8A 2M5RA 2N5IA 4DG9A 2XZ0D 2N98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKU A;  2MD9 A;  2K92 A;  4MRT C;  2L9F A;  2MVV A;  4R0M A;  1HY8 A;  5KP6 B;  2FVA A;  1NQ4 A;  2KG9 A;  2KOR A;  4NEO A;  2LTE A;  2K0X A;  1ACP A;  2FQ1 A;  2JU1 A;  2EHS A;  2AFE A;  2GDY A;  2KR5 A;  4H2Y C;  3EJD A;  4BPG A;  2K0Y A;  1T8K A;  2FAC A;  2XZ1 C;  2N6Y A;  4BPH A;  2KW2 A;  1KLP A;  2VSQ A;  4IZ6 A;  4HKG A;  3CE7 A;  1OR5 A;  2GDX A;  3EJE A;  1L0I A;  2JQ4 A;  2FVE A;  2LKI A;  2K2Q A;  2K94 A;  2ROQ A;  1L0H A;  5CZD B;  2FHS C;  4H2X C;  2CNR A;  4BPF A;  2CQ8 A;  2CG5 B;  1HQB A;  2KGE A;  2CGQ A;  1DV5 A;  2LIW A;  2KOP A;  2LOL A;  3LMO A;  2JU2 A;  2N50 A;  1F80 D;  2AVA A;  2KOQ A;  2LL8 A;  2KGC A;  2KWL A;  2GDW A;  2LIU A;  2MY5 A;  2AFD A;  2KG6 A;  2KGA A;  5KP7 B;  2LML A;  2L4B A;  2N5H A;  2AF8 A;  2KOS A;  1AF8 A;  2FAD A;  2K93 A;  2KOO A;  2DNW A;  2X2B A;  2KG8 A;  2PNG A;  2FQ2 A;  1X3O A;  2EHT A;  2L22 A;  3EJB A;  3GZL A;  2LPK A;  2FAE A;  2L0Q A;  4PWV B;  2MF4 A;  2MVU A;  2JGP A;  3NY7 B;  4PXH B;  2MR8 A;  2MR7 A;  4H2W C;  5HVC A;  2FVF A;  2QNW A;  3GZM A;  5EJD A;  4CA3 A;  2KGD A;  2FQ0 A;  1DNY A;  3RG2 A;  5KP8 B;  2N6Z A;  5HV8 A;  2M5R A;  2N5I A;  4DG9 A;  2XZ0 D;  2N98 A; 
#chains in the Genus database with same CATH topology
 1QVG O;  2K92 A;  1K8A Q;  1ZMB A;  2VLO A;  4R0M A;  1IMQ A;  3CMA P;  3G6E P;  1RNI A;  4XFZ A;  1VQP P;  3DS0 A;  3M1M A;  2FQ1 A;  2KR5 A;  2EHS A;  4COP A;  1KLP A;  4IZ6 A;  5I4T G;  3CE7 A;  1OR5 A;  2GDX A;  2KOD A;  3G0V A;  2M8L A;  1ZNV A;  2XT1 A;  3HZQ A;  1D1D A;  4U0C A;  1K73 Q;  1Q81 Q;  3GJN A;  4U0B A;  2CGQ A;  1VQ8 P;  2PEJ A;  3CCR P;  1VQM P;  1E0H A;  3G21 A;  2KGC A;  2LIU A;  2XXM A;  1BAJ A;  3G1I A;  2M8P A;  2LML A;  2KOS A;  1VQ4 P;  2OAR A;  1EMV A;  2FAD A;  1M6E X;  2BUO A;  2DNW A;  2KG8 A;  1E6J P;  3GZL A;  3I56 P;  5F2N A;  4XRO A;  1GXG A;  4U0F A;  5HVC A;  3GZM A;  3I55 P;  5JPA A;  2DGY A;  2P9X A;  3RG2 A;  3RG6 C;  5KP8 B;  1RO0 A;  2EIA A;  2M5R A;  3G29 A;  1VQO P;  4DG9 A;  4COC A;  5BS2 A;  1VQ5 P;  3GKL C;  2GZE A;  1S72 P;  3G71 P;  1NQ4 A;  4U0E A;  1VQ7 P;  3CCU P;  2KOR A;  1ACP A;  4PH1 A;  2GDY A;  2AFE A;  3CCS P;  4WYM A;  3B5I A;  1T8K A;  1M1K Q;  3CC4 P;  4IPY A;  2FAC A;  1KD1 Q;  2N6Y A;  4BPH A;  1YHQ P;  2Z46 A;  1JJ2 O;  3CCM P;  3EJE A;  3CCQ P;  1L0I A;  4PH0 A;  3OW2 O;  3CCJ P;  3MGE A;  4BPF A;  2CQ8 A;  1HQB A;  2CG5 B;  2LIW A;  3DS4 A;  2LOL A;  2EG5 A;  4XFY A;  3DS1 A;  1MZ8 A;  1F80 D;  1KC8 Q;  2EFJ A;  2LL8 A;  5EW5 E;  1EIA A;  2KWL A;  2GDW A;  3U43 A;  2MY5 A;  1NJI Q;  2KGA A;  1RO2 A;  1VQ6 P;  2GZG A;  3CCV P;  2CWO A;  2VLQ A;  1QVF O;  2KOO A;  2Z45 A;  3DS5 A;  3G26 A;  2QEX P;  2EHT A;  2L22 A;  3WBH A;  1IMP A;  2L0Q A;  2MF4 A;  2MVU A;  2JGP A;  4PXH B;  2OTL P;  3CPW O;  2MR7 A;  1UJZ A;  7CEI A;  3B4Q A;  4CA3 A;  3E2D A;  1BXI A;  1W2B O;  1KQS O;  5HV8 A;  2N5I A;  5F2O A;  1VKU A;  2PEQ A;  5DCK A;  4MRT C;  2JBG A;  1HY8 A;  4QNB A;  2FVA A;  5KP6 B;  2GYK A;  5HGO A;  4NEO A;  2LTE A;  2M8N A;  2ERH A;  3CXC O;  4H2Y C;  3EJD A;  4BPG A;  2PEO A;  4XFX A;  3VRL C;  4HKG A;  5HGM A;  1GPJ A;  2PY8 A;  1YJN P;  2K94 A;  3CD6 P;  1L0H A;  5CZD B;  2FHS C;  1Q82 Q;  4H2X C;  2XV6 A;  2CNR A;  1DV5 A;  2ONT A;  3P05 A;  2KOP A;  2JAZ A;  2PEN A;  2VLN A;  1VHN A;  2WPT A;  3G1G A;  2KOQ A;  3CCL P;  1EOQ A;  2KG6 A;  5KP7 B;  2L4B A;  2N5H A;  2AF8 A;  1AF8 A;  3H0D A;  2K93 A;  2X2B A;  4XRQ A;  2FQ2 A;  1QRJ A;  1AUM A;  2JO0 A;  3LRY A;  1AYI A;  2FAE A;  4PWV B;  3NY7 B;  1YI2 P;  4H2W C;  3HYB A;  3DS3 A;  2QNW A;  3DPH A;  5EJD A;  1CEI A;  1VQL P;  3DS2 A;  2XZ0 D;  2MD9 A;  2JYG A;  1K9M Q;  1N8R Q;  1YJW P;  2VLP A;  2L9F A;  2MVV A;  1YIJ P;  2OTJ P;  2GZF A;  2KG9 A;  1Z6M A;  2BHV A;  2K0X A;  4M0I A;  3G4S P;  2JU1 A;  1FR2 A;  2K0Y A;  2K5X A;  1M74 A;  2L6E A;  2XZ1 C;  1VQ9 P;  2JB0 A;  1YJ9 P;  2KW2 A;  2VSQ A;  1GXH A;  5BS1 A;  2PEK A;  2JQ4 A;  2FVE A;  3CCE P;  1VQK P;  3CME P;  2LKI A;  2K2Q A;  2PEM A;  2ROQ A;  1M90 Q;  2Z44 A;  1A8O A;  5F2K A;  2KGE A;  1K30 A;  3LMO A;  2JU2 A;  2N50 A;  4F37 A;  1VQN P;  2K0D X;  4QKO A;  5HGL A;  5HGN A;  1Q86 Q;  2E1M A;  4U0D A;  2AVA A;  2QA4 P;  3G28 A;  4U0A A;  2AFD A;  3H4E A;  1Q7Y Q;  3DTJ A;  2NO8 A;  4GR6 A;  2LF4 A;  4GR2 A;  2PNG A;  1A43 A;  1X3O A;  3CC2 P;  2GZJ A;  3H47 A;  3EJB A;  3CC7 P;  1YIT P;  2JYL A;  1UNK A;  3NTE A;  2LPK A;  3Q20 A;  2MR8 A;  2FVF A;  4UHP B;  2KGD A;  1M6N A;  2FQ0 A;  1DNY A;  2N6Z A;  2PEI A;  2GZI A;  2N98 A;  1IUQ A; 
#chains in the Genus database with same CATH homology
 1VKU A;  2MD9 A;  2K92 A;  4MRT C;  2L9F A;  2MVV A;  4R0M A;  1HY8 A;  5KP6 B;  2FVA A;  1NQ4 A;  2KG9 A;  2KOR A;  4NEO A;  2LTE A;  2K0X A;  1ACP A;  2FQ1 A;  2JU1 A;  2EHS A;  2AFE A;  2GDY A;  2KR5 A;  4H2Y C;  3EJD A;  4BPG A;  2K0Y A;  1T8K A;  2FAC A;  2XZ1 C;  2N6Y A;  4BPH A;  2KW2 A;  1KLP A;  2VSQ A;  4IZ6 A;  4HKG A;  3CE7 A;  1OR5 A;  2GDX A;  3EJE A;  1L0I A;  2JQ4 A;  2FVE A;  2LKI A;  2K2Q A;  2K94 A;  2ROQ A;  1L0H A;  5CZD B;  2FHS C;  4H2X C;  2CNR A;  4BPF A;  2CQ8 A;  2CG5 B;  1HQB A;  2KGE A;  2CGQ A;  1DV5 A;  2LIW A;  2KOP A;  2LOL A;  3LMO A;  2JU2 A;  2N50 A;  1F80 D;  2AVA A;  2KOQ A;  2LL8 A;  2KGC A;  2KWL A;  2GDW A;  2LIU A;  2MY5 A;  2AFD A;  2KG6 A;  2KGA A;  5KP7 B;  2LML A;  2L4B A;  2N5H A;  2AF8 A;  2KOS A;  1AF8 A;  2FAD A;  2K93 A;  2KOO A;  2DNW A;  2X2B A;  2KG8 A;  2PNG A;  2FQ2 A;  1X3O A;  2EHT A;  2L22 A;  3EJB A;  3GZL A;  2LPK A;  2FAE A;  2L0Q A;  4PWV B;  2MF4 A;  2MVU A;  2JGP A;  3NY7 B;  4PXH B;  2MR8 A;  2MR7 A;  4H2W C;  5HVC A;  2FVF A;  2QNW A;  3GZM A;  5EJD A;  4CA3 A;  2KGD A;  2FQ0 A;  1DNY A;  3RG2 A;  5KP8 B;  2N6Z A;  5HV8 A;  2M5R A;  2N5I A;  4DG9 A;  2XZ0 D;  2N98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...