2PEKA

Crystal structure of rbcx point mutant q29a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
b'EFKKVAKETAITLQSYLTYQAVRLISQALSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pekA00
2PEJA 4GR2A 2PEQA 2PY8A 5BS2A 2Z44A 2PEMA 2PEOA 2Z46A 5BS1A 3RG6C 2Z45A 4GR6A 2PEIA 3HYBA 2PENA 2PEKA 3Q20A
chains in the Genus database with same CATH superfamily
1BXIA 4U0FA 2KWLA 2K93A 4BPFA 2M8NA 1AYIA 2PEOA 1W2BO 3VRLC 4M0IA 3GZMA 2EIAA 1M74A 2K2QA 2KODA 2MR8A 2K0DX 1BAJA 1AUMA 1D1DA 2LTEA 2JYLA 3P05A 3G1IA 2QA4P 1UNKA 1GXHA 2FAEA 2GZFA 2KGEA 1FR2A 2K94A 4PH0A 2FACA 2GZEA 2LKIA 1M1KQ 4COPA 2KOOA 1GXGA 1E0HA 2KGAA 3MGEA 2ROQA 2OTJP 5F2NA 1NJIQ 2AFDA 1KLPA 5EW5E 2AF8A 5F2KA 1VQ9P 2GZJA 2KR5A 1Q86Q 2LPKA 3CMAP 4R0MA 2LF4A 3EJEA 2Z44A 4XFXA 2JU1A 3OW2O 2N98A 2FQ0A 4DG9A 5CZDB 2M5RA 1VQ6P 2AVAA 4WYMA 1A43A 1RO0A 2PY8A 4QKOA 3WBHA 1KQSO 1RO2A 3E2DA 2Z45A 3GKLC 2JGPA 1YI2P 2CGQA 4GR6A 4BPGA 2KOSA 3GJNA 1YHQP 3CCEP 1VQKP 3Q20A 4U0CA 2CQ8A 5BS2A 2XZ0D 3I56P 2L4BA 1IMPA 2LL8A 2N50A 2EHTA 2KOQA 2PEJA 4U0BA 4UHPB 5KP8B 2KW2A 3HYBA 1S72P 1HY8A 2X2BA 1ACPA 4XRQA 3EJBA 2DNWA 2K92A 3CCRP 3LRYA 1YIJP 4U0EA 1EOQA 2M8LA 1VHNA 2BHVA 4GR2A 5BS1A 2N6ZA 3B4QA 1T8KA 4COCA 3G4SP 4H2WC 2WPTA 2K0XA 2AFEA 3DS4A 4MRTC 3CXCO 1JJ2O 2L9FA 2GDYA 3GZLA 2MR7A 4H2XC 4PXHB 2GDWA 2P9XA 1IUQA 2PEQA 3G1GA 1QVGO 1NQ4A 2ONTA 3CD6P 2PENA 3DS3A 2XT1A 4CA3A 4U0AA 2LMLA 2XV6A 3CCUP 4BPHA 2FQ2A 3CMEP 1EIAA 3CCJP 3LMOA 2GYKA 5KP7B 2ERHA 2FQ1A 1VQOP 2EG5A 3G29A 1VQLP 3G21A 2VLOA 2E1MA 2VSQA 5HGLA 1M90Q 2NO8A 2VLNA 4PH1A 1K8AQ 4F37A 1KC8Q 4IZ6A 3H4EA 2FVEA 1M6NA 5I4TG 5HV8A 2EFJA 1K9MQ 1VQ7P 2N6YA 4HKGA 1CEIA 1YJNP 2JAZA 4IPYA 2L22A 2JU2A 2QNWA 2KGDA 2XZ1C 3HZQA 2VLQA 1YITP 2OARA 1K73Q 1Q82Q 1KD1Q 1Q81Q 1QRJA 1Q7YQ 2KG6A 2OTLP 3U43A 2N5HA 5KP6B 3CPWO 3CC2P 2PNGA 7CEIA 1Z6MA 2KG9A 1VQPP 3H47A 4QNBA 2VLPA 5EJDA 5F2OA 3B5IA 2CWOA 3G6EP 3CC7P 3CCMP 1L0HA 3CCLP 1EMVA 2FADA 2PEKA 4H2YC 3DS5A 5HGMA 1MZ8A 2JBGA 2MF4A 3G28A 2Z46A 2GZGA 2JO0A 1RNIA 1VKUA 2CG5B 2GZIA 2LIUA 3G0VA 3RG6C 2QEXP 2K0YA 1DV5A 1UJZA 2PEMA 1VQ5P 1ZNVA 1GPJA 3CC4P 1K30A 3DS0A 2K5XA 2XXMA 1N8RQ 1VQ8P 1AF8A 2JB0A 2GDXA 2KG8A 3DTJA 3DPHA 3DS2A 4NEOA 3RG2A 1ZMBA 3H0DA 5DCKA 1YJ9P 3NY7B 1VQ4P 2BUOA 2MVVA 1X3OA 2LIWA 1OR5A 3CE7A 2N5IA 5HGNA 5JPAA 1IMQA 3CCQP 4XROA 1L0IA 3EJDA 3G26A 1YJWP 2KORA 2MD9A 3M1MA 1VQNP 2JQ4A 2FHSC 1F80D 1A8OA 3NTEA 1HQBA 2EHSA 2MY5A 2LOLA 1VQMP 2CNRA 2KOPA 1DNYA 2KGCA 3DS1A 4PWVB 5HVCA 3CCSP 1QVFO 4XFYA 2FVFA 2FVAA 2L6EA 4XFZA 2JYGA 5HGOA 3I55P 1M6EX 2M8PA 4U0DA 2L0QA 3G71P 1E6JP 2DGYA 2PEIA 2MVUA 3CCVP
chains in the Genus database with same CATH topology
1A43A 1RO0A 3CCUP 2PY8A 3WBHA 3CCLP 4U0FA 1KQSO 3CMEP 1RO2A 3E2DA 2Z45A 1EIAA 2M8NA 2PEKA 3DS5A 5HGMA 3CCJP 1YI2P 2PEOA 1W2BO 4GR6A 3VRLC 4M0IA 1YHQP 1VQKP 3Q20A 3CCEP 4U0CA 3G28A 5BS2A 3I56P 2Z46A 2JO0A 1VQOP 1RNIA 2EG5A 2EIAA 3G29A 1VQLP 3G21A 1M74A 2KODA 2PEJA 4U0BA 2E1MA 5HGLA 1M90Q 3G0VA 3RG6C 2QEXP 3HYBA 1S72P 4PH1A 1K8AQ 1VQ5P 2PEMA 4XRQA 1BAJA 1AUMA 1KC8Q 1D1DA 3CC4P 3H4EA 2JYLA 1K30A 1M6NA 3P05A 3G1IA 3DS0A 5I4TG 3CCRP 2XXMA 3LRYA 1N8RQ 1YIJP 2QA4P 1VQ8P 2EFJA 1K9MQ 3DTJA 3DS2A 3DPHA 1VQ7P 4U0EA 1ZMBA 3H0DA 5DCKA 1EOQA 1YJ9P 4PH0A 1YJNP 2M8LA 4IPYA 1VQ4P 2BUOA 2BHVA 1M1KQ 4GR2A 4COPA 5BS1A 5HGNA 4COCA 3G4SP 5JPAA 3CCQP 4XROA 3G26A 3HZQA 3MGEA 1YJWP 2OTJP 3M1MA 1VQNP 1YITP 5F2NA 2OARA 3DS4A 1K73Q 1NJIQ 1Q82Q 1KD1Q 3CXCO 1JJ2O 1Q81Q 1QRJA 1Q7YQ 1A8OA 3NTEA 2OTLP 5F2KA 1VQMP 1VQ9P 3CPWO 3CC2P 2P9XA 1IUQA 3DS1A 1Q86Q 3CMAP 1VQPP 3H47A 2PEQA 3G1GA 3CCSP 1QVFO 4QNBA 1QVGO 4XFYA 2LF4A 2L6EA 2ONTA 5F2OA 2Z44A 4XFZA 2JYGA 5HGOA 3I55P 1M6EX 3B5IA 4XFXA 3CD6P 2M8PA 2CWOA 3G6EP 3OW2O 2PENA 4U0DA 3DS3A 3CC7P 4WYMA 2XT1A 3G71P 3CCMP 1E6JP 1VQ6P 2DGYA 4U0AA 2PEIA 3CCVP 2XV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEJ A;  4GR2 A;  2PEQ A;  2PY8 A;  5BS2 A;  2Z44 A;  2PEM A;  2PEO A;  2Z46 A;  5BS1 A;  3RG6 C;  2Z45 A;  4GR6 A;  2PEI A;  3HYB A;  2PEN A;  2PEK A;  3Q20 A; 
#chains in the Genus database with same CATH topology
 1BXI A;  4U0F A;  2KWL A;  2K93 A;  4BPF A;  2M8N A;  1AYI A;  2PEO A;  1W2B O;  3VRL C;  4M0I A;  3GZM A;  2EIA A;  1M74 A;  2K2Q A;  2KOD A;  2MR8 A;  2K0D X;  1BAJ A;  1AUM A;  1D1D A;  2LTE A;  2JYL A;  3P05 A;  3G1I A;  2QA4 P;  1UNK A;  1GXH A;  2FAE A;  2GZF A;  2KGE A;  1FR2 A;  2K94 A;  4PH0 A;  2FAC A;  2GZE A;  2LKI A;  1M1K Q;  4COP A;  2KOO A;  1GXG A;  1E0H A;  2KGA A;  3MGE A;  2ROQ A;  2OTJ P;  5F2N A;  1NJI Q;  2AFD A;  1KLP A;  5EW5 E;  2AF8 A;  5F2K A;  1VQ9 P;  2GZJ A;  2KR5 A;  1Q86 Q;  2LPK A;  3CMA P;  4R0M A;  2LF4 A;  3EJE A;  2Z44 A;  4XFX A;  2JU1 A;  3OW2 O;  2N98 A;  2FQ0 A;  4DG9 A;  5CZD B;  2M5R A;  1VQ6 P;  2AVA A;  4WYM A;  1A43 A;  1RO0 A;  2PY8 A;  4QKO A;  3WBH A;  1KQS O;  1RO2 A;  3E2D A;  2Z45 A;  3GKL C;  2JGP A;  1YI2 P;  2CGQ A;  4GR6 A;  4BPG A;  2KOS A;  3GJN A;  1YHQ P;  3CCE P;  1VQK P;  3Q20 A;  4U0C A;  2CQ8 A;  5BS2 A;  2XZ0 D;  3I56 P;  2L4B A;  1IMP A;  2LL8 A;  2N50 A;  2EHT A;  2KOQ A;  2PEJ A;  4U0B A;  4UHP B;  5KP8 B;  2KW2 A;  3HYB A;  1S72 P;  1HY8 A;  2X2B A;  1ACP A;  4XRQ A;  3EJB A;  2DNW A;  2K92 A;  3CCR P;  3LRY A;  1YIJ P;  4U0E A;  1EOQ A;  2M8L A;  1VHN A;  2BHV A;  4GR2 A;  5BS1 A;  2N6Z A;  3B4Q A;  1T8K A;  4COC A;  3G4S P;  4H2W C;  2WPT A;  2K0X A;  2AFE A;  3DS4 A;  4MRT C;  3CXC O;  1JJ2 O;  2L9F A;  2GDY A;  3GZL A;  2MR7 A;  4H2X C;  4PXH B;  2GDW A;  2P9X A;  1IUQ A;  2PEQ A;  3G1G A;  1QVG O;  1NQ4 A;  2ONT A;  3CD6 P;  2PEN A;  3DS3 A;  2XT1 A;  4CA3 A;  4U0A A;  2LML A;  2XV6 A;  3CCU P;  4BPH A;  2FQ2 A;  3CME P;  1EIA A;  3CCJ P;  3LMO A;  2GYK A;  5KP7 B;  2ERH A;  2FQ1 A;  1VQO P;  2EG5 A;  3G29 A;  1VQL P;  3G21 A;  2VLO A;  2E1M A;  2VSQ A;  5HGL A;  1M90 Q;  2NO8 A;  2VLN A;  4PH1 A;  1K8A Q;  4F37 A;  1KC8 Q;  4IZ6 A;  3H4E A;  2FVE A;  1M6N A;  5I4T G;  5HV8 A;  2EFJ A;  1K9M Q;  1VQ7 P;  2N6Y A;  4HKG A;  1CEI A;  1YJN P;  2JAZ A;  4IPY A;  2L22 A;  2JU2 A;  2QNW A;  2KGD A;  2XZ1 C;  3HZQ A;  2VLQ A;  1YIT P;  2OAR A;  1K73 Q;  1Q82 Q;  1KD1 Q;  1Q81 Q;  1QRJ A;  1Q7Y Q;  2KG6 A;  2OTL P;  3U43 A;  2N5H A;  5KP6 B;  3CPW O;  3CC2 P;  2PNG A;  7CEI A;  1Z6M A;  2KG9 A;  1VQP P;  3H47 A;  4QNB A;  2VLP A;  5EJD A;  5F2O A;  3B5I A;  2CWO A;  3G6E P;  3CC7 P;  3CCM P;  1L0H A;  3CCL P;  1EMV A;  2FAD A;  2PEK A;  4H2Y C;  3DS5 A;  5HGM A;  1MZ8 A;  2JBG A;  2MF4 A;  3G28 A;  2Z46 A;  2GZG A;  2JO0 A;  1RNI A;  1VKU A;  2CG5 B;  2GZI A;  2LIU A;  3G0V A;  3RG6 C;  2QEX P;  2K0Y A;  1DV5 A;  1UJZ A;  2PEM A;  1VQ5 P;  1ZNV A;  1GPJ A;  3CC4 P;  1K30 A;  3DS0 A;  2K5X A;  2XXM A;  1N8R Q;  1VQ8 P;  1AF8 A;  2JB0 A;  2GDX A;  2KG8 A;  3DTJ A;  3DPH A;  3DS2 A;  4NEO A;  3RG2 A;  1ZMB A;  3H0D A;  5DCK A;  1YJ9 P;  3NY7 B;  1VQ4 P;  2BUO A;  2MVV A;  1X3O A;  2LIW A;  1OR5 A;  3CE7 A;  2N5I A;  5HGN A;  5JPA A;  1IMQ A;  3CCQ P;  4XRO A;  1L0I A;  3EJD A;  3G26 A;  1YJW P;  2KOR A;  2MD9 A;  3M1M A;  1VQN P;  2JQ4 A;  2FHS C;  1F80 D;  1A8O A;  3NTE A;  1HQB A;  2EHS A;  2MY5 A;  2LOL A;  1VQM P;  2CNR A;  2KOP A;  1DNY A;  2KGC A;  3DS1 A;  4PWV B;  5HVC A;  3CCS P;  1QVF O;  4XFY A;  2FVF A;  2FVA A;  2L6E A;  4XFZ A;  2JYG A;  5HGO A;  3I55 P;  1M6E X;  2M8P A;  4U0D A;  2L0Q A;  3G71 P;  1E6J P;  2DGY A;  2PEI A;  2MVU A;  3CCV P; 
#chains in the Genus database with same CATH homology
 1A43 A;  1RO0 A;  3CCU P;  2PY8 A;  3WBH A;  3CCL P;  4U0F A;  1KQS O;  3CME P;  1RO2 A;  3E2D A;  2Z45 A;  1EIA A;  2M8N A;  2PEK A;  3DS5 A;  5HGM A;  3CCJ P;  1YI2 P;  2PEO A;  1W2B O;  4GR6 A;  3VRL C;  4M0I A;  1YHQ P;  1VQK P;  3Q20 A;  3CCE P;  4U0C A;  3G28 A;  5BS2 A;  3I56 P;  2Z46 A;  2JO0 A;  1VQO P;  1RNI A;  2EG5 A;  2EIA A;  3G29 A;  1VQL P;  3G21 A;  1M74 A;  2KOD A;  2PEJ A;  4U0B A;  2E1M A;  5HGL A;  1M90 Q;  3G0V A;  3RG6 C;  2QEX P;  3HYB A;  1S72 P;  4PH1 A;  1K8A Q;  1VQ5 P;  2PEM A;  4XRQ A;  1BAJ A;  1AUM A;  1KC8 Q;  1D1D A;  3CC4 P;  3H4E A;  2JYL A;  1K30 A;  1M6N A;  3P05 A;  3G1I A;  3DS0 A;  5I4T G;  3CCR P;  2XXM A;  3LRY A;  1N8R Q;  1YIJ P;  2QA4 P;  1VQ8 P;  2EFJ A;  1K9M Q;  3DTJ A;  3DS2 A;  3DPH A;  1VQ7 P;  4U0E A;  1ZMB A;  3H0D A;  5DCK A;  1EOQ A;  1YJ9 P;  4PH0 A;  1YJN P;  2M8L A;  4IPY A;  1VQ4 P;  2BUO A;  2BHV A;  1M1K Q;  4GR2 A;  4COP A;  5BS1 A;  5HGN A;  4COC A;  3G4S P;  5JPA A;  3CCQ P;  4XRO A;  3G26 A;  3HZQ A;  3MGE A;  1YJW P;  2OTJ P;  3M1M A;  1VQN P;  1YIT P;  5F2N A;  2OAR A;  3DS4 A;  1K73 Q;  1NJI Q;  1Q82 Q;  1KD1 Q;  3CXC O;  1JJ2 O;  1Q81 Q;  1QRJ A;  1Q7Y Q;  1A8O A;  3NTE A;  2OTL P;  5F2K A;  1VQM P;  1VQ9 P;  3CPW O;  3CC2 P;  2P9X A;  1IUQ A;  3DS1 A;  1Q86 Q;  3CMA P;  1VQP P;  3H47 A;  2PEQ A;  3G1G A;  3CCS P;  1QVF O;  4QNB A;  1QVG O;  4XFY A;  2LF4 A;  2L6E A;  2ONT A;  5F2O A;  2Z44 A;  4XFZ A;  2JYG A;  5HGO A;  3I55 P;  1M6E X;  3B5I A;  4XFX A;  3CD6 P;  2M8P A;  2CWO A;  3G6E P;  3OW2 O;  2PEN A;  4U0D A;  3DS3 A;  3CC7 P;  4WYM A;  2XT1 A;  3G71 P;  3CCM P;  1E6J P;  1VQ6 P;  2DGY A;  4U0A A;  2PEI A;  3CCV P;  2XV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...