2PEKA

Crystal structure of rbcx point mutant q29a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQALSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pekA00
3Q20A 2PY8A 2PEOA 2Z46A 2PENA 3RG6C 3HYBA 4GR6A 5BS2A 2PEIA 2PEQA 2Z45A 4GR2A 5BS1A 2Z44A 2PEKA 2PEMA 2PEJA
chains in the Genus database with same CATH superfamily
1NJIQ 3GKLC 3RG2A 3I55P 1M6NA 1RO0A 4BPGA 1YJ9P 1YITP 2GYKA 1VQ9P 2FAEA 3I56P 1RO2A 4M0IA 1L0HA 1HQBA 2ERHA 2L4BA 5HGNA 1UJZA 1ZNVA 4QKOA 1AF8A 4PWVB 3OW2O 4PXHB 1EMVA 4GR6A 2KWLA 3HZQA 1BXIA 5HGLA 1VQLP 4COCA 2FQ1A 2FQ0A 5BS2A 4XROA 2XV6A 3G21A 1M90Q 2LTEA 5EW5E 4XFXA 2EHTA 1YJNP 2FVAA 1Z6MA 3G26A 1K8AQ 1VHNA 5BS1A 4F37A 2MVUA 2FVEA 3VRLC 1K30A 5KP6B 2LF4A 3Q20A 2LOLA 5F2OA 2MR8A 2JO0A 3CE7A 2XXMA 2FVFA 1F80D 3GJNA 2L6EA 4U0BA 2E1MA 3MGEA 4PH1A 2K0XA 1YIJP 3GZMA 2LPKA 3G1IA 5KP8B 2BUOA 2OTJP 2VLPA 2N50A 1Q86Q 5I4TG 2KGDA 3G6EP 2L22A 5F2KA 4NEOA 2LIUA 4IZ6A 2KGAA 2CGQA 2JYLA 1N8RQ 5KP7B 1EOQA 1T8KA 3G0VA 1VQKP 2EHSA 1VQ4P 4UHPB 2EFJA 2GZFA 2LMLA 2K5XA 4DG9A 4BPFA 2M8PA 1KD1Q 1Q81Q 2PEQA 3CXCO 2GDYA 2X2BA 5JPAA 2CQ8A 2M8NA 4U0CA 2KG6A 2KODA 2KGCA 1UNKA 7CEIA 1Q82Q 2KR5A 4XFYA 1YHQP 5F2NA 4COPA 2PEJA 2KW2A 2PEOA 2DNWA 3NY7B 1IUQA 3NTEA 3G29A 5EJDA 2KOSA 2WPTA 4BPHA 3CPWO 3M1MA 2GZEA 1X3OA 4GR2A 3P05A 3G28A 1K73Q 3CD6P 3CCVP 4H2XC 2AF8A 2XZ1C 4XFZA 1GXGA 4HKGA 2OTLP 3GZLA 2JAZA 1E0HA 4QNBA 2K92A 2OARA 2N6ZA 1KLPA 1BAJA 1CEIA 4CA3A 2ROQA 3CMAP 1VQ5P 2K94A 3DS4A 2DGYA 1ACPA 3CMEP 1MZ8A 1VQ6P 2LL8A 1W2BO 2N5IA 3EJEA 2KORA 4MRTC 3H0DA 1M1KQ 1QVFO 3CC7P 1VQMP 2VLOA 3CCUP 2JB0A 1RNIA 1VKUA 2LIWA 2MF4A 3HYBA 1D1DA 1VQPP 1JJ2O 2EIAA 4PH0A 1VQNP 3CCEP 2K93A 1NQ4A 2GDWA 2GDXA 3DS5A 1GPJA 2CNRA 2K2QA 3CCSP 3LMOA 3CC4P 5HV8A 2KG9A 1YI2P 2JQ4A 2LKIA 2N6YA 1AYIA 3CCJP 4U0DA 2PEMA 4U0FA 3CC2P 1QVGO 3H47A 1K9MQ 2XT1A 1A43A 2JU1A 2VLNA 2VLQA 2JGPA 4XRQA 2MR7A 2FADA 1VQ7P 2Z44A 3G1GA 2M8LA 4R0MA 2MY5A 1M74A 1YJWP 2N98A 2PY8A 1Q7YQ 2QEXP 2PEIA 1KC8Q 2JU2A 1VQOP 1FR2A 1M6EX 3CCLP 4U0EA 1EIAA 1DNYA 2EG5A 2BHVA 3EJBA 2JYGA 2XZ0D 3U43A 2QNWA 1AUMA 3WBHA 3DS0A 5HGMA 3B5IA 3G4SP 2N5HA 3H4EA 1VQ8P 4H2WC 3CCRP 3DS2A 3DS1A 4H2YC 2KOOA 2KOPA 1DV5A 3CCMP 2FACA 2KGEA 2L0QA 2AVAA 3DTJA 1IMQA 4IPYA 3B4QA 2GZGA 2K0YA 2AFDA 2VSQA 2K0DX 2PEKA 1HY8A 2PENA 3EJDA 1S72P 2QA4P 1L0IA 2Z45A 3LRYA 2MD9A 4WYMA 2PNGA 3RG6C 2L9FA 2GZIA 2FHSC 1IMPA 4U0AA 2MVVA 3DPHA 2KOQA 2KG8A 5HGOA 1GXHA 1A8OA 2NO8A 2Z46A 3DS3A 1OR5A 2FQ2A 1QRJA 2GZJA 2JBGA 5HVCA 1E6JP 5CZDB 2CWOA 2P9XA 2AFEA 1ZMBA 3E2DA 2CG5B 1KQSO 2M5RA 2ONTA 5DCKA 3G71P 3CCQP
chains in the Genus database with same CATH topology
1NJIQ 2EG5A 3I55P 1YIJP 2BHVA 1M6NA 3G1IA 2OTLP 2JYGA 1RO0A 4QNBA 2BUOA 2OARA 2OTJP 1YJ9P 1BAJA 1YITP 1VQ9P 1AUMA 3WBHA 3CMAP 1VQ5P 3I56P 1Q86Q 3DS0A 3DS4A 1RO2A 5HGMA 2DGYA 5I4TG 3G6EP 3CMEP 4M0IA 1VQ6P 5F2KA 1W2BO 3H0DA 1M1KQ 3B5IA 3G4SP 1QVFO 2JYLA 3H4EA 5HGNA 1N8RQ 3CC7P 1VQ8P 1VQMP 1EOQA 3CCRP 3CCUP 3DS2A 3DS1A 3G0VA 3CCMP 1VQKP 1RNIA 3HYBA 1D1DA 1VQPP 3OW2O 1JJ2O 2EIAA 3DTJA 4IPYA 4PH0A 1VQ4P 4GR6A 1VQNP 2EFJA 3CCEP 3HZQA 2M8PA 3DS5A 1KD1Q 1Q81Q 2PEQA 5HGLA 1VQLP 2PEKA 4COCA 3CXCO 3CCSP 3CC4P 5BS2A 2PENA 2M8NA 5JPAA 4XROA 1S72P 3CCQP 1YI2P 4U0CA 2QA4P 2XV6A 3CCJP 3G21A 2KODA 4U0DA 2Z45A 3LRYA 1M90Q 4WYMA 2PEMA 4U0FA 3CC2P 1QVGO 3H47A 1Q82Q 3RG6C 4XFYA 1K9MQ 2XT1A 4XFXA 1YHQP 1YJNP 5F2NA 1A43A 4U0AA 4COPA 2PEJA 2PEOA 3DPHA 1IUQA 3NTEA 5HGOA 3G29A 4XRQA 1VQ7P 3G26A 1K8AQ 1A8OA 2Z46A 5BS1A 3DS3A 3CPWO 2Z44A 3G1GA 1QRJA 3M1MA 2M8LA 3VRLC 1K30A 1M74A 4GR2A 1YJWP 3P05A 1E6JP 3G28A 2CWOA 2LF4A 2P9XA 3Q20A 5F2OA 2PY8A 1K73Q 2JO0A 1Q7YQ 2QEXP 3CCVP 2PEIA 3CD6P 2XXMA 1ZMBA 1KC8Q 3E2DA 4XFZA 2L6EA 4U0BA 1VQOP 1KQSO 2ONTA 1M6EX 2E1MA 5DCKA 3MGEA 3G71P 3CCLP 4PH1A 4U0EA 1EIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q20 A;  2PY8 A;  2PEO A;  2Z46 A;  2PEN A;  3RG6 C;  3HYB A;  4GR6 A;  5BS2 A;  2PEI A;  2PEQ A;  2Z45 A;  4GR2 A;  5BS1 A;  2Z44 A;  2PEK A;  2PEM A;  2PEJ A; 
#chains in the Genus database with same CATH topology
 1NJI Q;  3GKL C;  3RG2 A;  3I55 P;  1M6N A;  1RO0 A;  4BPG A;  1YJ9 P;  1YIT P;  2GYK A;  1VQ9 P;  2FAE A;  3I56 P;  1RO2 A;  4M0I A;  1L0H A;  1HQB A;  2ERH A;  2L4B A;  5HGN A;  1UJZ A;  1ZNV A;  4QKO A;  1AF8 A;  4PWV B;  3OW2 O;  4PXH B;  1EMV A;  4GR6 A;  2KWL A;  3HZQ A;  1BXI A;  5HGL A;  1VQL P;  4COC A;  2FQ1 A;  2FQ0 A;  5BS2 A;  4XRO A;  2XV6 A;  3G21 A;  1M90 Q;  2LTE A;  5EW5 E;  4XFX A;  2EHT A;  1YJN P;  2FVA A;  1Z6M A;  3G26 A;  1K8A Q;  1VHN A;  5BS1 A;  4F37 A;  2MVU A;  2FVE A;  3VRL C;  1K30 A;  5KP6 B;  2LF4 A;  3Q20 A;  2LOL A;  5F2O A;  2MR8 A;  2JO0 A;  3CE7 A;  2XXM A;  2FVF A;  1F80 D;  3GJN A;  2L6E A;  4U0B A;  2E1M A;  3MGE A;  4PH1 A;  2K0X A;  1YIJ P;  3GZM A;  2LPK A;  3G1I A;  5KP8 B;  2BUO A;  2OTJ P;  2VLP A;  2N50 A;  1Q86 Q;  5I4T G;  2KGD A;  3G6E P;  2L22 A;  5F2K A;  4NEO A;  2LIU A;  4IZ6 A;  2KGA A;  2CGQ A;  2JYL A;  1N8R Q;  5KP7 B;  1EOQ A;  1T8K A;  3G0V A;  1VQK P;  2EHS A;  1VQ4 P;  4UHP B;  2EFJ A;  2GZF A;  2LML A;  2K5X A;  4DG9 A;  4BPF A;  2M8P A;  1KD1 Q;  1Q81 Q;  2PEQ A;  3CXC O;  2GDY A;  2X2B A;  5JPA A;  2CQ8 A;  2M8N A;  4U0C A;  2KG6 A;  2KOD A;  2KGC A;  1UNK A;  7CEI A;  1Q82 Q;  2KR5 A;  4XFY A;  1YHQ P;  5F2N A;  4COP A;  2PEJ A;  2KW2 A;  2PEO A;  2DNW A;  3NY7 B;  1IUQ A;  3NTE A;  3G29 A;  5EJD A;  2KOS A;  2WPT A;  4BPH A;  3CPW O;  3M1M A;  2GZE A;  1X3O A;  4GR2 A;  3P05 A;  3G28 A;  1K73 Q;  3CD6 P;  3CCV P;  4H2X C;  2AF8 A;  2XZ1 C;  4XFZ A;  1GXG A;  4HKG A;  2OTL P;  3GZL A;  2JAZ A;  1E0H A;  4QNB A;  2K92 A;  2OAR A;  2N6Z A;  1KLP A;  1BAJ A;  1CEI A;  4CA3 A;  2ROQ A;  3CMA P;  1VQ5 P;  2K94 A;  3DS4 A;  2DGY A;  1ACP A;  3CME P;  1MZ8 A;  1VQ6 P;  2LL8 A;  1W2B O;  2N5I A;  3EJE A;  2KOR A;  4MRT C;  3H0D A;  1M1K Q;  1QVF O;  3CC7 P;  1VQM P;  2VLO A;  3CCU P;  2JB0 A;  1RNI A;  1VKU A;  2LIW A;  2MF4 A;  3HYB A;  1D1D A;  1VQP P;  1JJ2 O;  2EIA A;  4PH0 A;  1VQN P;  3CCE P;  2K93 A;  1NQ4 A;  2GDW A;  2GDX A;  3DS5 A;  1GPJ A;  2CNR A;  2K2Q A;  3CCS P;  3LMO A;  3CC4 P;  5HV8 A;  2KG9 A;  1YI2 P;  2JQ4 A;  2LKI A;  2N6Y A;  1AYI A;  3CCJ P;  4U0D A;  2PEM A;  4U0F A;  3CC2 P;  1QVG O;  3H47 A;  1K9M Q;  2XT1 A;  1A43 A;  2JU1 A;  2VLN A;  2VLQ A;  2JGP A;  4XRQ A;  2MR7 A;  2FAD A;  1VQ7 P;  2Z44 A;  3G1G A;  2M8L A;  4R0M A;  2MY5 A;  1M74 A;  1YJW P;  2N98 A;  2PY8 A;  1Q7Y Q;  2QEX P;  2PEI A;  1KC8 Q;  2JU2 A;  1VQO P;  1FR2 A;  1M6E X;  3CCL P;  4U0E A;  1EIA A;  1DNY A;  2EG5 A;  2BHV A;  3EJB A;  2JYG A;  2XZ0 D;  3U43 A;  2QNW A;  1AUM A;  3WBH A;  3DS0 A;  5HGM A;  3B5I A;  3G4S P;  2N5H A;  3H4E A;  1VQ8 P;  4H2W C;  3CCR P;  3DS2 A;  3DS1 A;  4H2Y C;  2KOO A;  2KOP A;  1DV5 A;  3CCM P;  2FAC A;  2KGE A;  2L0Q A;  2AVA A;  3DTJ A;  1IMQ A;  4IPY A;  3B4Q A;  2GZG A;  2K0Y A;  2AFD A;  2VSQ A;  2K0D X;  2PEK A;  1HY8 A;  2PEN A;  3EJD A;  1S72 P;  2QA4 P;  1L0I A;  2Z45 A;  3LRY A;  2MD9 A;  4WYM A;  2PNG A;  3RG6 C;  2L9F A;  2GZI A;  2FHS C;  1IMP A;  4U0A A;  2MVV A;  3DPH A;  2KOQ A;  2KG8 A;  5HGO A;  1GXH A;  1A8O A;  2NO8 A;  2Z46 A;  3DS3 A;  1OR5 A;  2FQ2 A;  1QRJ A;  2GZJ A;  2JBG A;  5HVC A;  1E6J P;  5CZD B;  2CWO A;  2P9X A;  2AFE A;  1ZMB A;  3E2D A;  2CG5 B;  1KQS O;  2M5R A;  2ONT A;  5DCK A;  3G71 P;  3CCQ P; 
#chains in the Genus database with same CATH homology
 1NJI Q;  2EG5 A;  3I55 P;  1YIJ P;  2BHV A;  1M6N A;  3G1I A;  2OTL P;  2JYG A;  1RO0 A;  4QNB A;  2BUO A;  2OAR A;  2OTJ P;  1YJ9 P;  1BAJ A;  1YIT P;  1VQ9 P;  1AUM A;  3WBH A;  3CMA P;  1VQ5 P;  3I56 P;  1Q86 Q;  3DS0 A;  3DS4 A;  1RO2 A;  5HGM A;  2DGY A;  5I4T G;  3G6E P;  3CME P;  4M0I A;  1VQ6 P;  5F2K A;  1W2B O;  3H0D A;  1M1K Q;  3B5I A;  3G4S P;  1QVF O;  2JYL A;  3H4E A;  5HGN A;  1N8R Q;  3CC7 P;  1VQ8 P;  1VQM P;  1EOQ A;  3CCR P;  3CCU P;  3DS2 A;  3DS1 A;  3G0V A;  3CCM P;  1VQK P;  1RNI A;  3HYB A;  1D1D A;  1VQP P;  3OW2 O;  1JJ2 O;  2EIA A;  3DTJ A;  4IPY A;  4PH0 A;  1VQ4 P;  4GR6 A;  1VQN P;  2EFJ A;  3CCE P;  3HZQ A;  2M8P A;  3DS5 A;  1KD1 Q;  1Q81 Q;  2PEQ A;  5HGL A;  1VQL P;  2PEK A;  4COC A;  3CXC O;  3CCS P;  3CC4 P;  5BS2 A;  2PEN A;  2M8N A;  5JPA A;  4XRO A;  1S72 P;  3CCQ P;  1YI2 P;  4U0C A;  2QA4 P;  2XV6 A;  3CCJ P;  3G21 A;  2KOD A;  4U0D A;  2Z45 A;  3LRY A;  1M90 Q;  4WYM A;  2PEM A;  4U0F A;  3CC2 P;  1QVG O;  3H47 A;  1Q82 Q;  3RG6 C;  4XFY A;  1K9M Q;  2XT1 A;  4XFX A;  1YHQ P;  1YJN P;  5F2N A;  1A43 A;  4U0A A;  4COP A;  2PEJ A;  2PEO A;  3DPH A;  1IUQ A;  3NTE A;  5HGO A;  3G29 A;  4XRQ A;  1VQ7 P;  3G26 A;  1K8A Q;  1A8O A;  2Z46 A;  5BS1 A;  3DS3 A;  3CPW O;  2Z44 A;  3G1G A;  1QRJ A;  3M1M A;  2M8L A;  3VRL C;  1K30 A;  1M74 A;  4GR2 A;  1YJW P;  3P05 A;  1E6J P;  3G28 A;  2CWO A;  2LF4 A;  2P9X A;  3Q20 A;  5F2O A;  2PY8 A;  1K73 Q;  2JO0 A;  1Q7Y Q;  2QEX P;  3CCV P;  2PEI A;  3CD6 P;  2XXM A;  1ZMB A;  1KC8 Q;  3E2D A;  4XFZ A;  2L6E A;  4U0B A;  1VQO P;  1KQS O;  2ONT A;  1M6E X;  2E1M A;  5DCK A;  3MGE A;  3G71 P;  3CCL P;  4PH1 A;  4U0E A;  1EIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...