2PEKA

Crystal structure of rbcx point mutant q29a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQALSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pekA00
3HYBA 2PEMA 5BS1A 2PEKA 5BS2A 2PEJA 4GR6A 2Z44A 4GR2A 2PEQA 3Q20A 3RG6C 2Z46A 2PEIA 2Z45A 2PEOA 2PENA 2PY8A
chains in the Genus database with same CATH superfamily
2N6YA 3VRLC 1VQ6P 1F80D 2M8NA 1QRJA 2P9XA 2Z46A 1VQLP 3DS2A 4COPA 2LMLA 2MR7A 4BPFA 2PEKA 3CC4P 3CC7P 1A43A 2XZ1C 1Z6MA 1VKUA 1EOQA 2DNWA 1ZMBA 3B5IA 5HGOA 2EFJA 2GDYA 1S72P 1KLPA 1ZNVA 3DPHA 3WBHA 3HZQA 2JU2A 3CC2P 2FQ2A 1GPJA 1Q82Q 3LMOA 5KP6B 4NEOA 2LF4A 2CQ8A 2VLOA 2AFEA 2PEOA 1A8OA 5HV8A 3DS5A 2JU1A 1Q7YQ 3G0VA 4R0MA 2KOQA 2LOLA 2AF8A 2GDXA 4XFZA 5BS1A 4GR6A 1MZ8A 3NY7B 1M74A 2K93A 1D1DA 2FAEA 2OTLP 2PEQA 1VQ8P 1K30A 4M0IA 2FADA 2JQ4A 2N50A 3DS4A 2FVAA 3GZMA 1L0HA 3G1GA 1YHQP 1YJ9P 1BXIA 5HGMA 2K92A 2PENA 2KODA 2GZJA 4XFXA 3G29A 2XT1A 2JB0A 2PEIA 1QVGO 2OARA 2MY5A 1YITP 3CCRP 3GJNA 2PEMA 4H2XC 3EJDA 2XV6A 1GXGA 1VQPP 2MF4A 5CZDB 4H2WC 2KOSA 2K94A 2LTEA 4GR2A 2KR5A 1YI2P 1UNKA 2CWOA 4QNBA 5JPAA 1BAJA 2JBGA 3G1IA 1VQMP 1T8KA 2KG9A 3CPWO 2N5IA 3H0DA 2CG5B 2ERHA 3CCMP 3NTEA 5HGNA 2L0QA 3CCLP 2BUOA 2KWLA 1HY8A 3MGEA 1DNYA 2JYGA 4U0BA 2N5HA 4U0CA 1Q81Q 3DS3A 1YJWP 4BPGA 1VQKP 2AFDA 3OW2O 2MR8A 2FHSC 3CCQP 2LPKA 4PXHB 2JGPA 2VLQA 4CA3A 7CEIA 2OTJP 2VSQA 2N6ZA 2LIUA 2L9FA 2GYKA 1RO0A 2KOOA 2EG5A 3CCJP 3DS0A 1W2BO 2E1MA 1M90Q 2FVFA 3H4EA 4XROA 5EW5E 2EHSA 2M5RA 3DS1A 2L6EA 1FR2A 2L22A 1L0IA 1HQBA 4F37A 3B4QA 1K73Q 2QA4P 1VQ9P 2KORA 3CCSP 1VQNP 2GZEA 5HGLA 1EMVA 2K0XA 4PH1A 4XFYA 2NO8A 5DCKA 4IZ6A 1VQ5P 3G6EP 3GZLA 2K0YA 3G71P 4BPHA 1NQ4A 1VHNA 5F2OA 2LKIA 1E0HA 1M6NA 2N98A 3RG6C 2FVEA 4MRTC 1Q86Q 2KW2A 1CEIA 2K2QA 3U43A 4U0DA 2BHVA 2DGYA 4PWVB 4U0EA 2L4BA 5EJDA 1YJNP 3CCEP 1IMQA 2MVVA 5I4TG 4COCA 2XZ0D 2XXMA 1RO2A 2X2BA 1M6EX 4HKGA 2KGAA 3H47A 4UHPB 1AYIA 3M1MA 3EJBA 2CNRA 4WYMA 1IMPA 1M1KQ 2ROQA 3Q20A 4U0FA 1KD1Q 1K8AQ 5HVCA 1AF8A 1DV5A 3RG2A 2GZFA 3E2DA 2EHTA 2QNWA 2M8LA 1OR5A 1EIAA 2MVUA 3CD6P 3CMAP 2JO0A 3HYBA 3CXCO 2KG8A 2LIWA 2GDWA 4DG9A 3I56P 5KP8B 2KGDA 1IUQA 4PH0A 1VQ7P 1NJIQ 2KGEA 1AUMA 2CGQA 5KP7B 2GZIA 5BS2A 2KGCA 2PEJA 4U0AA 4XRQA 1E6JP 1K9MQ 3G4SP 3DTJA 1ACPA 3P05A 1YIJP 1VQOP 3CCVP 2FACA 5F2NA 4IPYA 2GZGA 2PNGA 2Z44A 3LRYA 2LL8A 1KQSO 3G21A 1N8RQ 2VLPA 2EIAA 2K5XA 1QVFO 2AVAA 3I55P 2KOPA 2JAZA 3CE7A 2FQ1A 1JJ2O 3CCUP 1RNIA 1KC8Q 1X3OA 1UJZA 2VLNA 2QEXP 1GXHA 2ONTA 2KG6A 5F2KA 4H2YC 3G28A 4QKOA 2K0DX 2Z45A 2FQ0A 3GKLC 3EJEA 2JYLA 2PY8A 2M8PA 3CMEP 2WPTA 2MD9A 1VQ4P 3G26A
chains in the Genus database with same CATH topology
2JO0A 3HYBA 3CXCO 3CCRP 3VRLC 2PEMA 1K73Q 1VQ6P 2QA4P 2M8NA 1VQ9P 1QRJA 2P9XA 2Z46A 2XV6A 1VQLP 3DS2A 3CCSP 1VQPP 1VQNP 3I56P 1IUQA 5HGLA 4PH0A 1VQ7P 1NJIQ 1AUMA 4COPA 4GR2A 1YI2P 4QNBA 2CWOA 5JPAA 4PH1A 2PEKA 4XFYA 4U0AA 4XRQA 2PEJA 5DCKA 5BS2A 1BAJA 1E6JP 1VQ5P 3G6EP 3CC4P 3G1IA 1VQMP 1K9MQ 3CC7P 1A43A 3G4SP 3DTJA 3G71P 3P05A 1YIJP 1VQOP 3CPWO 5F2OA 3CCVP 5F2NA 1EOQA 1ZMBA 1M6NA 3B5IA 4IPYA 5HGOA 3RG6C 2EFJA 3H0DA 1S72P 3WBHA 3DPHA 1Q86Q 3HZQA 2Z44A 3CC2P 3LRYA 1KQSO 3CCMP 3NTEA 4U0DA 3G21A 2BHVA 2DGYA 1N8RQ 5HGNA 4U0EA 1Q82Q 3CCLP 2BUOA 2EIAA 1QVFO 1YJNP 2LF4A 3MGEA 3CCEP 3I55P 2JYGA 2PEOA 4U0BA 1JJ2O 5I4TG 3CCUP 4U0CA 1A8OA 4COCA 1Q81Q 3DS5A 2XXMA 3DS3A 1RNIA 1RO2A 1YJWP 1KC8Q 1M6EX 1VQKP 1Q7YQ 3H47A 3OW2O 3G0VA 3M1MA 3CCQP 4WYMA 2QEXP 1M1KQ 4XFZA 5BS1A 2OTJP 2ONTA 4GR6A 3Q20A 5F2KA 4U0FA 1KD1Q 1M74A 1K8AQ 1D1DA 3G28A 2OTLP 1RO0A 2PEQA 1VQ8P 1K30A 2Z45A 4M0IA 3DS4A 2EG5A 3CCJP 3DS0A 2JYLA 1W2BO 2E1MA 2PY8A 1M90Q 4XROA 3H4EA 3G1GA 3E2DA 1YHQP 2M8PA 1YJ9P 5HGMA 3CMEP 2PENA 2M8LA 2KODA 4XFXA 3DS1A 1VQ4P 1EIAA 3G29A 2L6EA 2XT1A 2PEIA 1QVGO 2OARA 3CD6P 1YITP 3G26A 3CMAP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYB A;  2PEM A;  5BS1 A;  2PEK A;  5BS2 A;  2PEJ A;  4GR6 A;  2Z44 A;  4GR2 A;  2PEQ A;  3Q20 A;  3RG6 C;  2Z46 A;  2PEI A;  2Z45 A;  2PEO A;  2PEN A;  2PY8 A; 
#chains in the Genus database with same CATH topology
 2N6Y A;  3VRL C;  1VQ6 P;  1F80 D;  2M8N A;  1QRJ A;  2P9X A;  2Z46 A;  1VQL P;  3DS2 A;  4COP A;  2LML A;  2MR7 A;  4BPF A;  2PEK A;  3CC4 P;  3CC7 P;  1A43 A;  2XZ1 C;  1Z6M A;  1VKU A;  1EOQ A;  2DNW A;  1ZMB A;  3B5I A;  5HGO A;  2EFJ A;  2GDY A;  1S72 P;  1KLP A;  1ZNV A;  3DPH A;  3WBH A;  3HZQ A;  2JU2 A;  3CC2 P;  2FQ2 A;  1GPJ A;  1Q82 Q;  3LMO A;  5KP6 B;  4NEO A;  2LF4 A;  2CQ8 A;  2VLO A;  2AFE A;  2PEO A;  1A8O A;  5HV8 A;  3DS5 A;  2JU1 A;  1Q7Y Q;  3G0V A;  4R0M A;  2KOQ A;  2LOL A;  2AF8 A;  2GDX A;  4XFZ A;  5BS1 A;  4GR6 A;  1MZ8 A;  3NY7 B;  1M74 A;  2K93 A;  1D1D A;  2FAE A;  2OTL P;  2PEQ A;  1VQ8 P;  1K30 A;  4M0I A;  2FAD A;  2JQ4 A;  2N50 A;  3DS4 A;  2FVA A;  3GZM A;  1L0H A;  3G1G A;  1YHQ P;  1YJ9 P;  1BXI A;  5HGM A;  2K92 A;  2PEN A;  2KOD A;  2GZJ A;  4XFX A;  3G29 A;  2XT1 A;  2JB0 A;  2PEI A;  1QVG O;  2OAR A;  2MY5 A;  1YIT P;  3CCR P;  3GJN A;  2PEM A;  4H2X C;  3EJD A;  2XV6 A;  1GXG A;  1VQP P;  2MF4 A;  5CZD B;  4H2W C;  2KOS A;  2K94 A;  2LTE A;  4GR2 A;  2KR5 A;  1YI2 P;  1UNK A;  2CWO A;  4QNB A;  5JPA A;  1BAJ A;  2JBG A;  3G1I A;  1VQM P;  1T8K A;  2KG9 A;  3CPW O;  2N5I A;  3H0D A;  2CG5 B;  2ERH A;  3CCM P;  3NTE A;  5HGN A;  2L0Q A;  3CCL P;  2BUO A;  2KWL A;  1HY8 A;  3MGE A;  1DNY A;  2JYG A;  4U0B A;  2N5H A;  4U0C A;  1Q81 Q;  3DS3 A;  1YJW P;  4BPG A;  1VQK P;  2AFD A;  3OW2 O;  2MR8 A;  2FHS C;  3CCQ P;  2LPK A;  4PXH B;  2JGP A;  2VLQ A;  4CA3 A;  7CEI A;  2OTJ P;  2VSQ A;  2N6Z A;  2LIU A;  2L9F A;  2GYK A;  1RO0 A;  2KOO A;  2EG5 A;  3CCJ P;  3DS0 A;  1W2B O;  2E1M A;  1M90 Q;  2FVF A;  3H4E A;  4XRO A;  5EW5 E;  2EHS A;  2M5R A;  3DS1 A;  2L6E A;  1FR2 A;  2L22 A;  1L0I A;  1HQB A;  4F37 A;  3B4Q A;  1K73 Q;  2QA4 P;  1VQ9 P;  2KOR A;  3CCS P;  1VQN P;  2GZE A;  5HGL A;  1EMV A;  2K0X A;  4PH1 A;  4XFY A;  2NO8 A;  5DCK A;  4IZ6 A;  1VQ5 P;  3G6E P;  3GZL A;  2K0Y A;  3G71 P;  4BPH A;  1NQ4 A;  1VHN A;  5F2O A;  2LKI A;  1E0H A;  1M6N A;  2N98 A;  3RG6 C;  2FVE A;  4MRT C;  1Q86 Q;  2KW2 A;  1CEI A;  2K2Q A;  3U43 A;  4U0D A;  2BHV A;  2DGY A;  4PWV B;  4U0E A;  2L4B A;  5EJD A;  1YJN P;  3CCE P;  1IMQ A;  2MVV A;  5I4T G;  4COC A;  2XZ0 D;  2XXM A;  1RO2 A;  2X2B A;  1M6E X;  4HKG A;  2KGA A;  3H47 A;  4UHP B;  1AYI A;  3M1M A;  3EJB A;  2CNR A;  4WYM A;  1IMP A;  1M1K Q;  2ROQ A;  3Q20 A;  4U0F A;  1KD1 Q;  1K8A Q;  5HVC A;  1AF8 A;  1DV5 A;  3RG2 A;  2GZF A;  3E2D A;  2EHT A;  2QNW A;  2M8L A;  1OR5 A;  1EIA A;  2MVU A;  3CD6 P;  3CMA P;  2JO0 A;  3HYB A;  3CXC O;  2KG8 A;  2LIW A;  2GDW A;  4DG9 A;  3I56 P;  5KP8 B;  2KGD A;  1IUQ A;  4PH0 A;  1VQ7 P;  1NJI Q;  2KGE A;  1AUM A;  2CGQ A;  5KP7 B;  2GZI A;  5BS2 A;  2KGC A;  2PEJ A;  4U0A A;  4XRQ A;  1E6J P;  1K9M Q;  3G4S P;  3DTJ A;  1ACP A;  3P05 A;  1YIJ P;  1VQO P;  3CCV P;  2FAC A;  5F2N A;  4IPY A;  2GZG A;  2PNG A;  2Z44 A;  3LRY A;  2LL8 A;  1KQS O;  3G21 A;  1N8R Q;  2VLP A;  2EIA A;  2K5X A;  1QVF O;  2AVA A;  3I55 P;  2KOP A;  2JAZ A;  3CE7 A;  2FQ1 A;  1JJ2 O;  3CCU P;  1RNI A;  1KC8 Q;  1X3O A;  1UJZ A;  2VLN A;  2QEX P;  1GXH A;  2ONT A;  2KG6 A;  5F2K A;  4H2Y C;  3G28 A;  4QKO A;  2K0D X;  2Z45 A;  2FQ0 A;  3GKL C;  3EJE A;  2JYL A;  2PY8 A;  2M8P A;  3CME P;  2WPT A;  2MD9 A;  1VQ4 P;  3G26 A; 
#chains in the Genus database with same CATH homology
 2JO0 A;  3HYB A;  3CXC O;  3CCR P;  3VRL C;  2PEM A;  1K73 Q;  1VQ6 P;  2QA4 P;  2M8N A;  1VQ9 P;  1QRJ A;  2P9X A;  2Z46 A;  2XV6 A;  1VQL P;  3DS2 A;  3CCS P;  1VQP P;  1VQN P;  3I56 P;  1IUQ A;  5HGL A;  4PH0 A;  1VQ7 P;  1NJI Q;  1AUM A;  4COP A;  4GR2 A;  1YI2 P;  4QNB A;  2CWO A;  5JPA A;  4PH1 A;  2PEK A;  4XFY A;  4U0A A;  4XRQ A;  2PEJ A;  5DCK A;  5BS2 A;  1BAJ A;  1E6J P;  1VQ5 P;  3G6E P;  3CC4 P;  3G1I A;  1VQM P;  1K9M Q;  3CC7 P;  1A43 A;  3G4S P;  3DTJ A;  3G71 P;  3P05 A;  1YIJ P;  1VQO P;  3CPW O;  5F2O A;  3CCV P;  5F2N A;  1EOQ A;  1ZMB A;  1M6N A;  3B5I A;  4IPY A;  5HGO A;  3RG6 C;  2EFJ A;  3H0D A;  1S72 P;  3WBH A;  3DPH A;  1Q86 Q;  3HZQ A;  2Z44 A;  3CC2 P;  3LRY A;  1KQS O;  3CCM P;  3NTE A;  4U0D A;  3G21 A;  2BHV A;  2DGY A;  1N8R Q;  5HGN A;  4U0E A;  1Q82 Q;  3CCL P;  2BUO A;  2EIA A;  1QVF O;  1YJN P;  2LF4 A;  3MGE A;  3CCE P;  3I55 P;  2JYG A;  2PEO A;  4U0B A;  1JJ2 O;  5I4T G;  3CCU P;  4U0C A;  1A8O A;  4COC A;  1Q81 Q;  3DS5 A;  2XXM A;  3DS3 A;  1RNI A;  1RO2 A;  1YJW P;  1KC8 Q;  1M6E X;  1VQK P;  1Q7Y Q;  3H47 A;  3OW2 O;  3G0V A;  3M1M A;  3CCQ P;  4WYM A;  2QEX P;  1M1K Q;  4XFZ A;  5BS1 A;  2OTJ P;  2ONT A;  4GR6 A;  3Q20 A;  5F2K A;  4U0F A;  1KD1 Q;  1M74 A;  1K8A Q;  1D1D A;  3G28 A;  2OTL P;  1RO0 A;  2PEQ A;  1VQ8 P;  1K30 A;  2Z45 A;  4M0I A;  3DS4 A;  2EG5 A;  3CCJ P;  3DS0 A;  2JYL A;  1W2B O;  2E1M A;  2PY8 A;  1M90 Q;  4XRO A;  3H4E A;  3G1G A;  3E2D A;  1YHQ P;  2M8P A;  1YJ9 P;  5HGM A;  3CME P;  2PEN A;  2M8L A;  2KOD A;  4XFX A;  3DS1 A;  1VQ4 P;  1EIA A;  3G29 A;  2L6E A;  2XT1 A;  2PEI A;  1QVG O;  2OAR A;  3CD6 P;  1YIT P;  3G26 A;  3CMA P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...