2PEKA

Crystal structure of rbcx point mutant q29a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQALSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pekA00
2PEQA 4GR2A 3Q20A 2PENA 3HYBA 2Z45A 2PEIA 2PEMA 2PY8A 2PEOA 2Z46A 5BS2A 5BS1A 2PEJA 2Z44A 2PEKA 4GR6A 3RG6C
chains in the Genus database with same CATH superfamily
1L0IA 2JU1A 2N5IA 1VQOP 1QRJA 1KC8Q 2Z45A 2PEOA 2ROQA 1YJ9P 2E1MA 2JBGA 1S72P 1ZMBA 2VLPA 1GXGA 3CCRP 1VQMP 5EJDA 2L0QA 2FQ2A 1AYIA 1EMVA 2LMLA 2EFJA 2KGAA 3CCLP 2KOQA 2PEKA 5KP6B 2N6ZA 2KOOA 3NY7B 2M8PA 3CXCO 3H4EA 4MRTC 3DS0A 2MF4A 4U0CA 1CEIA 3MGEA 2FQ1A 5HV8A 1AUMA 2XZ0D 3CC4P 2MVVA 4CA3A 4QNBA 1RNIA 1AF8A 2KW2A 2OTJP 4U0AA 2FADA 1YITP 3GZMA 2L4BA 2KG8A 4GR6A 2XT1A 2OTLP 1QVFO 3LMOA 1EOQA 1IUQA 2FVEA 2GZJA 2LKIA 4H2XC 1M6NA 2JU2A 3EJDA 3M1MA 3CMAP 1MZ8A 4R0MA 3CD6P 4IPYA 5DCKA 3CCMP 2EIAA 1W2BO 1VQNP 3CC7P 2L6EA 3GZLA 2K2QA 5HGMA 1GXHA 1HY8A 3G0VA 2AF8A 2JQ4A 2NO8A 5KP7B 5HGOA 4H2YC 5KP8B 3B5IA 2FVAA 1K9MQ 4NEOA 1M6EX 2L22A 3CCQP 3G4SP 2JYLA 1E6JP 2LPKA 2XXMA 1YHQP 1VQ4P 2N50A 3G26A 2KOSA 2K5XA 3HZQA 2QNWA 1D1DA 2KR5A 1Q86Q 2FACA 2LOLA 1VQ9P 2GZEA 3CMEP 4BPFA 2PEJA 4DG9A 3CCSP 3CPWO 2PENA 1RO2A 1Q81Q 1Z6MA 2CWOA 1M74A 2VLOA 5I4TG 1E0HA 1BXIA 3E2DA 4XFYA 1K73Q 2K0XA 2GDYA 1VQ8P 2M5RA 2AFDA 4COCA 1Q82Q 2JYGA 3DTJA 2EHSA 2LIWA 2ERHA 2KG9A 2JGPA 2MD9A 1VKUA 1BAJA 1VQ5P 1RO0A 3I56P 4IZ6A 3CCJP 2LF4A 4QKOA 3LRYA 2GZGA 2K92A 1OR5A 1YJWP 3CCUP 2PEQA 3Q20A 2GZFA 4U0FA 3DPHA 2LL8A 2P9XA 1T8KA 2KGDA 4BPHA 2BUOA 2XZ1C 1KD1Q 2QEXP 2MR8A 1M1KQ 1NQ4A 1IMQA 2KOPA 4H2WC 3VRLC 4PH0A 2JO0A 2PY8A 3I55P 3U43A 1QVGO 1ACPA 2GDWA 3G29A 1VQPP 3CE7A 3GJNA 1IMPA 2MR7A 2AFEA 5CZDB 1Q7YQ 3CCEP 1HQBA 2K0DX 2OARA 4M0IA 1K8AQ 5BS1A 4COPA 4BPGA 2N98A 3G21A 2FAEA 3H0DA 1UNKA 2EHTA 2DGYA 1VQ6P 2KODA 2X2BA 4XRQA 3CC2P 2CGQA 2Z44A 1X3OA 2GZIA 2DNWA 2MY5A 2Z46A 2L9FA 4HKGA 4XFXA 2FQ0A 1DV5A 1ZNVA 2LIUA 2N6YA 2MVUA 3P05A 5BS2A 4U0EA 4U0BA 1VQ7P 2QA4P 3H47A 4XFZA 2KG6A 2JAZA 2CQ8A 2JB0A 2PEIA 3DS4A 3NTEA 3G1GA 4XROA 3G28A 1KQSO 2FHSC 2KGEA 1M90Q 2K93A 2CG5B 3GKLC 2ONTA 1N8RQ 2K0YA 3EJBA 2BHVA 1NJIQ 4PH1A 1VQLP 3DS5A 3RG6C 2VLNA 3WBHA 4GR2A 3G71P 2N5HA 2KWLA 1YJNP 5JPAA 4UHPB 7CEIA 1EIAA 3DS2A 1YIJP 4F37A 2K94A 1L0HA 2GDXA 1GPJA 4PXHB 3EJEA 3G6EP 1YI2P 1A8OA 5F2KA 2XV6A 5EW5E 1FR2A 2AVAA 2EG5A 3B4QA 5HVCA 3HYBA 2GYKA 1VQKP 1KLPA 2WPTA 1UJZA 1JJ2O 1F80D 2VSQA 1K30A 5HGNA 3RG2A 5HGLA 2CNRA 3DS3A 2PEMA 2FVFA 4WYMA 3G1IA 2KORA 5F2OA 3OW2O 2VLQA 4U0DA 5F2NA 1A43A 2M8LA 3CCVP 4PWVB 2PNGA 1VHNA 2KGCA 1DNYA 2M8NA 2LTEA 3DS1A
chains in the Genus database with same CATH topology
3CC7P 2L6EA 1VQOP 1QRJA 5HGMA 1M90Q 2BUOA 3G0VA 1KD1Q 1KC8Q 2QEXP 2Z45A 1M1KQ 2PEOA 5HGOA 2ONTA 1YJ9P 1N8RQ 2BHVA 2E1MA 3B5IA 1NJIQ 1K9MQ 4PH1A 1M6EX 3DS5A 3CCQP 3RG6C 1VQLP 3G4SP 3VRLC 2JYLA 4GR2A 3WBHA 4PH0A 1E6JP 2XXMA 3G71P 1S72P 2JO0A 2PY8A 1YHQP 3I55P 1ZMBA 1YJNP 1VQ4P 1QVGO 3G26A 5JPAA 3CCRP 1VQMP 3G29A 1EIAA 3DS2A 1VQPP 3HZQA 1YIJP 2EFJA 1D1DA 3CCLP 2PEKA 1Q86Q 1Q7YQ 3CCEP 2OARA 1VQ9P 3CMEP 4M0IA 2PEJA 1K8AQ 3CCSP 5BS1A 3G6EP 2M8PA 1YI2P 4COPA 3CPWO 1A8OA 5F2KA 2PENA 2XV6A 1RO2A 3CXCO 3H4EA 3G21A 3DS0A 1Q81Q 4U0CA 3H0DA 2CWOA 2EG5A 2DGYA 3HYBA 1M74A 3MGEA 1VQ6P 2KODA 5I4TG 4XRQA 3CC2P 1AUMA 3CC4P 3E2DA 4QNBA 1RNIA 1VQKP 4XFYA 1K73Q 2Z44A 2OTJP 4U0AA 1JJ2O 1VQ8P 1YITP 2Z46A 4COCA 1K30A 1Q82Q 2JYGA 3DTJA 5HGNA 4XFXA 5HGLA 3DS3A 2PEMA 4WYMA 4GR6A 3G1IA 2XT1A 5F2OA 2OTLP 3OW2O 3P05A 1QVFO 1BAJA 4U0DA 5F2NA 1VQ5P 5BS2A 4U0EA 4U0BA 1VQ7P 1RO0A 2QA4P 1EOQA 1A43A 1IUQA 3H47A 3I56P 4XFZA 2M8LA 3CCVP 3CCJP 2LF4A 3LRYA 1M6NA 3M1MA 2PEIA 3CMAP 3DS4A 1YJWP 3NTEA 3CCUP 3CD6P 2PEQA 3Q20A 4IPYA 3G1GA 5DCKA 4U0FA 2M8NA 2EIAA 4XROA 3CCMP 3DPHA 3G28A 1W2BO 1KQSO 1VQNP 2P9XA 3DS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEQ A;  4GR2 A;  3Q20 A;  2PEN A;  3HYB A;  2Z45 A;  2PEI A;  2PEM A;  2PY8 A;  2PEO A;  2Z46 A;  5BS2 A;  5BS1 A;  2PEJ A;  2Z44 A;  2PEK A;  4GR6 A;  3RG6 C; 
#chains in the Genus database with same CATH topology
 1L0I A;  2JU1 A;  2N5I A;  1VQO P;  1QRJ A;  1KC8 Q;  2Z45 A;  2PEO A;  2ROQ A;  1YJ9 P;  2E1M A;  2JBG A;  1S72 P;  1ZMB A;  2VLP A;  1GXG A;  3CCR P;  1VQM P;  5EJD A;  2L0Q A;  2FQ2 A;  1AYI A;  1EMV A;  2LML A;  2EFJ A;  2KGA A;  3CCL P;  2KOQ A;  2PEK A;  5KP6 B;  2N6Z A;  2KOO A;  3NY7 B;  2M8P A;  3CXC O;  3H4E A;  4MRT C;  3DS0 A;  2MF4 A;  4U0C A;  1CEI A;  3MGE A;  2FQ1 A;  5HV8 A;  1AUM A;  2XZ0 D;  3CC4 P;  2MVV A;  4CA3 A;  4QNB A;  1RNI A;  1AF8 A;  2KW2 A;  2OTJ P;  4U0A A;  2FAD A;  1YIT P;  3GZM A;  2L4B A;  2KG8 A;  4GR6 A;  2XT1 A;  2OTL P;  1QVF O;  3LMO A;  1EOQ A;  1IUQ A;  2FVE A;  2GZJ A;  2LKI A;  4H2X C;  1M6N A;  2JU2 A;  3EJD A;  3M1M A;  3CMA P;  1MZ8 A;  4R0M A;  3CD6 P;  4IPY A;  5DCK A;  3CCM P;  2EIA A;  1W2B O;  1VQN P;  3CC7 P;  2L6E A;  3GZL A;  2K2Q A;  5HGM A;  1GXH A;  1HY8 A;  3G0V A;  2AF8 A;  2JQ4 A;  2NO8 A;  5KP7 B;  5HGO A;  4H2Y C;  5KP8 B;  3B5I A;  2FVA A;  1K9M Q;  4NEO A;  1M6E X;  2L22 A;  3CCQ P;  3G4S P;  2JYL A;  1E6J P;  2LPK A;  2XXM A;  1YHQ P;  1VQ4 P;  2N50 A;  3G26 A;  2KOS A;  2K5X A;  3HZQ A;  2QNW A;  1D1D A;  2KR5 A;  1Q86 Q;  2FAC A;  2LOL A;  1VQ9 P;  2GZE A;  3CME P;  4BPF A;  2PEJ A;  4DG9 A;  3CCS P;  3CPW O;  2PEN A;  1RO2 A;  1Q81 Q;  1Z6M A;  2CWO A;  1M74 A;  2VLO A;  5I4T G;  1E0H A;  1BXI A;  3E2D A;  4XFY A;  1K73 Q;  2K0X A;  2GDY A;  1VQ8 P;  2M5R A;  2AFD A;  4COC A;  1Q82 Q;  2JYG A;  3DTJ A;  2EHS A;  2LIW A;  2ERH A;  2KG9 A;  2JGP A;  2MD9 A;  1VKU A;  1BAJ A;  1VQ5 P;  1RO0 A;  3I56 P;  4IZ6 A;  3CCJ P;  2LF4 A;  4QKO A;  3LRY A;  2GZG A;  2K92 A;  1OR5 A;  1YJW P;  3CCU P;  2PEQ A;  3Q20 A;  2GZF A;  4U0F A;  3DPH A;  2LL8 A;  2P9X A;  1T8K A;  2KGD A;  4BPH A;  2BUO A;  2XZ1 C;  1KD1 Q;  2QEX P;  2MR8 A;  1M1K Q;  1NQ4 A;  1IMQ A;  2KOP A;  4H2W C;  3VRL C;  4PH0 A;  2JO0 A;  2PY8 A;  3I55 P;  3U43 A;  1QVG O;  1ACP A;  2GDW A;  3G29 A;  1VQP P;  3CE7 A;  3GJN A;  1IMP A;  2MR7 A;  2AFE A;  5CZD B;  1Q7Y Q;  3CCE P;  1HQB A;  2K0D X;  2OAR A;  4M0I A;  1K8A Q;  5BS1 A;  4COP A;  4BPG A;  2N98 A;  3G21 A;  2FAE A;  3H0D A;  1UNK A;  2EHT A;  2DGY A;  1VQ6 P;  2KOD A;  2X2B A;  4XRQ A;  3CC2 P;  2CGQ A;  2Z44 A;  1X3O A;  2GZI A;  2DNW A;  2MY5 A;  2Z46 A;  2L9F A;  4HKG A;  4XFX A;  2FQ0 A;  1DV5 A;  1ZNV A;  2LIU A;  2N6Y A;  2MVU A;  3P05 A;  5BS2 A;  4U0E A;  4U0B A;  1VQ7 P;  2QA4 P;  3H47 A;  4XFZ A;  2KG6 A;  2JAZ A;  2CQ8 A;  2JB0 A;  2PEI A;  3DS4 A;  3NTE A;  3G1G A;  4XRO A;  3G28 A;  1KQS O;  2FHS C;  2KGE A;  1M90 Q;  2K93 A;  2CG5 B;  3GKL C;  2ONT A;  1N8R Q;  2K0Y A;  3EJB A;  2BHV A;  1NJI Q;  4PH1 A;  1VQL P;  3DS5 A;  3RG6 C;  2VLN A;  3WBH A;  4GR2 A;  3G71 P;  2N5H A;  2KWL A;  1YJN P;  5JPA A;  4UHP B;  7CEI A;  1EIA A;  3DS2 A;  1YIJ P;  4F37 A;  2K94 A;  1L0H A;  2GDX A;  1GPJ A;  4PXH B;  3EJE A;  3G6E P;  1YI2 P;  1A8O A;  5F2K A;  2XV6 A;  5EW5 E;  1FR2 A;  2AVA A;  2EG5 A;  3B4Q A;  5HVC A;  3HYB A;  2GYK A;  1VQK P;  1KLP A;  2WPT A;  1UJZ A;  1JJ2 O;  1F80 D;  2VSQ A;  1K30 A;  5HGN A;  3RG2 A;  5HGL A;  2CNR A;  3DS3 A;  2PEM A;  2FVF A;  4WYM A;  3G1I A;  2KOR A;  5F2O A;  3OW2 O;  2VLQ A;  4U0D A;  5F2N A;  1A43 A;  2M8L A;  3CCV P;  4PWV B;  2PNG A;  1VHN A;  2KGC A;  1DNY A;  2M8N A;  2LTE A;  3DS1 A; 
#chains in the Genus database with same CATH homology
 3CC7 P;  2L6E A;  1VQO P;  1QRJ A;  5HGM A;  1M90 Q;  2BUO A;  3G0V A;  1KD1 Q;  1KC8 Q;  2QEX P;  2Z45 A;  1M1K Q;  2PEO A;  5HGO A;  2ONT A;  1YJ9 P;  1N8R Q;  2BHV A;  2E1M A;  3B5I A;  1NJI Q;  1K9M Q;  4PH1 A;  1M6E X;  3DS5 A;  3CCQ P;  3RG6 C;  1VQL P;  3G4S P;  3VRL C;  2JYL A;  4GR2 A;  3WBH A;  4PH0 A;  1E6J P;  2XXM A;  3G71 P;  1S72 P;  2JO0 A;  2PY8 A;  1YHQ P;  3I55 P;  1ZMB A;  1YJN P;  1VQ4 P;  1QVG O;  3G26 A;  5JPA A;  3CCR P;  1VQM P;  3G29 A;  1EIA A;  3DS2 A;  1VQP P;  3HZQ A;  1YIJ P;  2EFJ A;  1D1D A;  3CCL P;  2PEK A;  1Q86 Q;  1Q7Y Q;  3CCE P;  2OAR A;  1VQ9 P;  3CME P;  4M0I A;  2PEJ A;  1K8A Q;  3CCS P;  5BS1 A;  3G6E P;  2M8P A;  1YI2 P;  4COP A;  3CPW O;  1A8O A;  5F2K A;  2PEN A;  2XV6 A;  1RO2 A;  3CXC O;  3H4E A;  3G21 A;  3DS0 A;  1Q81 Q;  4U0C A;  3H0D A;  2CWO A;  2EG5 A;  2DGY A;  3HYB A;  1M74 A;  3MGE A;  1VQ6 P;  2KOD A;  5I4T G;  4XRQ A;  3CC2 P;  1AUM A;  3CC4 P;  3E2D A;  4QNB A;  1RNI A;  1VQK P;  4XFY A;  1K73 Q;  2Z44 A;  2OTJ P;  4U0A A;  1JJ2 O;  1VQ8 P;  1YIT P;  2Z46 A;  4COC A;  1K30 A;  1Q82 Q;  2JYG A;  3DTJ A;  5HGN A;  4XFX A;  5HGL A;  3DS3 A;  2PEM A;  4WYM A;  4GR6 A;  3G1I A;  2XT1 A;  5F2O A;  2OTL P;  3OW2 O;  3P05 A;  1QVF O;  1BAJ A;  4U0D A;  5F2N A;  1VQ5 P;  5BS2 A;  4U0E A;  4U0B A;  1VQ7 P;  1RO0 A;  2QA4 P;  1EOQ A;  1A43 A;  1IUQ A;  3H47 A;  3I56 P;  4XFZ A;  2M8L A;  3CCV P;  3CCJ P;  2LF4 A;  3LRY A;  1M6N A;  3M1M A;  2PEI A;  3CMA P;  3DS4 A;  1YJW P;  3NTE A;  3CCU P;  3CD6 P;  2PEQ A;  3Q20 A;  4IPY A;  3G1G A;  5DCK A;  4U0F A;  2M8N A;  2EIA A;  4XRO A;  3CCM P;  3DPH A;  3G28 A;  1W2B O;  1KQS O;  1VQN P;  2P9X A;  3DS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...