1RO0A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m semet remote
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords ORF904
total genus 61
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro0A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro0A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro0A02
3M1MA 1RNIA 1RO0A 1RO2A
chains in the Genus database with same CATH superfamily
2NVYI 2DE5A 2RPRA 3H3VJ 1PFTA 2W03A 3PO3S 2FQ1A 3U50C 4A93I 1VQNZ 1NJI1 4EWCA 1VQ4Z 3NDIA 5IT9b 2FQ2A 1Q16A 1Q821 2QEXZ 4NB9A 1DV5A 4CL1A 1AUMA 2MVVA 1VQ8P 1QXFA 1KC81 5AN9F 2QA4P 2YADA 2GZFA 2AFEA 1L0HA 3RG6C 4MXUA 1YITZ 3GTPI 1K732 2OOYB 1GXHA 1VQOZ 2LIWA 2JO0A 1KLPA 1KC8Q 3S2DI 3CCS1 1TWCI 3DS1A 2IZ3A 5D1OA 2JUBA 3IF8A 1N8R2 2MR8A 2QEX1 2K5RA 2KGAA 3GTJI 3HYBA 2GZGA 1N8RQ 4NBEA 2Y0SA 4NB8A 3TE5B 2DNWA 2JYGA 7CEIA 3S16I 1RNIA 1A8OA 2N6ZA 4A3EI 1NJIQ 3EJDA 5JPAA 3CPWZ 3CCMP 2L4BA 2DGYA 3IX0A 2E2II 4BPGA 1QF8A 1VQ51 4BBRI 3HZQA 2E1MA 5FLMI 3I56Z 3CCLP 2GDXA 2ROQA 2JU1A 2KGCA 1VHNA 4GR2A 1NQ4A 2KGDA 5HVCA 2VPWA 2N5IA 3FQMA 1JJ2Y 3G28A 2OTJZ 3OW2O 2LKIA 2FVAA 3CE7A 3LRYA 1M74A 1X0TA 3TDHB 2OZKA 5HV8A 2I3CA 4A3FI 5I4TG 1VQ5Z 3CCQZ 1YJNP 4A3JI 1NUIA 2Z44A 3I561 1EIAA 1HQBA 3BG0B 2CGQA 3GCFA 4AYBA 2FADA 5BS2A 3CCRP 1Q7Y2 4WYMA 1VQ6P 3D6WA 1WIIA 2NO8A 2E2HI 3I07A 2GTHA 2VPYA 3G6E1 1QVFY 1Y1WI 2BHVA 3MZLB 4A3KI 4PH0A 1W2BZ 3I55Z 1DNYA 3EJBA 3CCQ1 3M4OI 1WJ2A 3HOYI 4NOZA 3OW2Z 2R92I 2JBGA 4XFYA 1I6HI 4BPHA 4GR6A 2GU2A 2PEIA 4IPYA 1BXIA 4A3CI 3DS5A 1YIJ1 3S17I 2KPIA 2LL8A 1W2BY 3VMIA 1FR2A 3CMEP 1VQPP 1TWHI 3G6EZ 3CCSP 3EEDA 3LUSA 1M6EX 4TNUA 1Q7YQ 3GTMS 4NEOA 1WZNA 2HF1A 5IP7I 1VQ6Z 3G26A 4E2XA 4MD9A 1R9TI 1VLAA 3OW2Y 4BY1I 2K0DX 1M6NA 5C4XI 5F2KA 2F4OA 1YJNZ 3M1MA 4H2WC 1VQ5P 2JMOA 2PEMA 3VMGA 2AVAA 2GDWA 3S14I 2QREB 1UNKA 3CMAZ 1LQLA 5DCKA 4NBCA 2R6MA 2B63I 3S2HI 2OTJP 3CC4Z 3ESWA 2V3VA 2JIPA 1UJZA 4DK1A 4NH1C 4QTUA 3RG2A 1VQLZ 3I56P 3T4NB 5KP7B 3GTQI 1Z6MA 2FVEA 3H4EA 3GTKI 2O4HA 3KIHA 3CME1 3Q20A 2KODA 1USPB 4E31A 4A3MI 3MGEA 1VKUA 1MZ8A 3CC41 2XV6A 2XXMA 4MD8A 4A3GI 1L0IA 2AFDA 2PM9A 2XZ1C 2LF4A 4NBGA 3EJEA 3VMHA 1VQL1 2PEQA 3DS3A 1Q822 3GTOI 1YI2P 3CCEP 2EFJA 2QLVB 1RO2A 5T64A 3CXCZ 1YJW1 1YHQP 2BUOA 1Q82Q 1VQ41 1NJI2 2R7ZI 3G71Z 3GKLC 1USPA 2PEKA 2KWLA 2V8JA 4E30A 3Q87A 1VQMP 2RIQA 1VQ8Z 1FDOA 1P9NA 1WW9A 2OOXB 5A2Qb 1VQ91 1JJ2Z 3F3PC 1S72Z 2MVUA 2WAQA 2OTL1 4NBDA 3H47A 4RV9A 1X3WA 3DTJA 4H2XC 4U0FA 3VRLC 3G1GA 1K83I 5C44I 5C3EI 1Q811 4MONA 3G21A 2L6EA 2EG5A 4RVGA 2PEJA 2VSQA 3CC7Z 1RO4A 2QR1B 1M1K2 1N2FA 3MZKB 1TWAI 2XZ0D 4RVFA 4E32A 3B4QA 2JA5I 2JA7I 1VQ9Z 1VQ7P 3GTGI 1W2BO 4A3BI 5F2OA 1Q861 1E6JP 2KOSA 4DG9A 2OTLZ 4XFXA 3I4NI 2JB0A 1QRJA 4QTTA 2N50A 2RHBA 1VQKP 3D2LA 2JNYA 3J81b 2GZJA 3CC71 1K9MQ 5HGLA 5IP9I 4BBSI 2FAEA 1K73Q 2EGTA 2ZAEB 1TWFI 3H0DA 3GKQA 2M8PA 1JJ2O 1A43A 5FLXf 3CD6Z 2V45A 2KI7B 1K9M1 3J80f 3HOWI 4F37A 2G2KA 3NH8A 2E9HA 2JAZA 3NTEA 1Q81Q 4RVHA 2KOPA 2WPTA 3QWUA 1YIT1 3HKZA 4IZ6A 1VQO1 2NVXI 2YU9I 3KIFA 4UHPB 4NBBA 5D1PA 1VQ71 3HOXI 1NP6A 2PK7A 5EJDA 2LIYA 3K7AI 1QYPA 2K5XA 2AYDA 3CCVZ 3CCL1 3GZMA 1YUAA 3G4SZ 4U0EA 1VQKZ 2KR5A 2KGEA 1AF8A 1K9M2 3S1MI 2JIOA 3CCJ1 2GZIA 2OTLP 3CCM1 3HOUI 2MY5A 3MONA 3S1QI 2N6YA 4NBHA 2JGPA 2OARA 3CCUP 1Y1VS 1VQ7Z 3EERA 2MR7A 4PWVB 1KQSY 4Y52I 4QKOA 2F4MA 2FHSC 1YJ9P 3NH5A 3G4S1 2VUGA 1Q862 1T8KA 2OTJ1 2K92A 3CCV1 3NFZA 3CCJZ 1F80D 3CCE1 1YI21 3RZDI 2GYKA 1AA6A 2LMLA 2MF4A 2NVQI 3LMOA 4DGLA 3G1IA 5CZDB 4RS4A 5IT9f 1S72P 5LL6f 2AF8A 4PH1A 3D9XA 1Z01A 1Q812 1M1K1 1VQN1 2GZEA 4MD7A 2R93I 4X6AI 1VQMZ 1ZNVA 1KRLA 3G71P 1ACPA 1RQFA 2FVFA 1BAJA 2QKDA 1YHQZ 1M1KQ 2GDYA 3CCEZ 4U0DA 1YI2Z 4COCA 3I551 2JIMA 2LPKA 4U0BA 2EIAA 1ML8A 2QRDB 5FLXb 2IV2X 2KG9A 2Q51A 3H0GI 2MD9A 4CA3A 1JWHC 3GZLA 2M6NA 1WCMI 3CC2Z 4XROA 2LTEA 3J81f 5EW5E 2QRCB 4BXXI 4U0AA 1YIJZ 1YUKA 3M3YI 4BY7I 3B5IA 3NY7B 3S1RI 5A2Qf 2VPZA 4QNBA 3BG1B 2N5HA 2IZ4A 3NDJA 1VQLP 4MH4A 2P9XA 2VLPA 4E2WA 2K0YA 3E2DA 3CC4P 2W04A 3CC21 2CQ8A 1Y8CA 3CMAP 2PY8A 1EMVA 2VLOA 2KG6A 1YJWZ 1GXGA 2NVTI 2Z46A 4A3DI 3FQQA 2KW2A 1L1OC 1S7MA 1VQP1 3S1NI 2M8NA 2M5RA 3VB9A 4XRQA 1VQ81 4HGZA 3HOVI 2CG5B 4MRTC 1S721 5T6BA 2VUMI 1X3OA 1FDIA 2BJOA 2GTIA 2XT1A 2K93A 2KOOA 3DPHA 2J6AA 1QVGY 3GTLI 3G0VA 1YJWP 4H2YC 4XFZA 2JIRA 2ERHA 3CCSZ 3G6EP 1VQPZ 3CMEZ 2AKLA 2N98A 2FQ0A 5D1OB 3JAMb 2WB1A 3IFUA 1Q86Q 1IMPA 1X3ZA 5T67A 3CXCY 2L0QA 3GTMI 1HY8A 1SFOI 1D1DA 2V8IA 4Y7NI 1TFIA 3FKII 3DS2A 2DE6A 3I55P 1YIJP 4NBFA 1K731 2E7ZA 4HKGA 2Q4ZA 3CC2P 5C4JI 1IMQA 2K94A 3G711 5KP8B 2M48A 3CCRZ 3I4MI 4A3LI 4S1TA 2LEXA 1I3QI 1CEIA 3PO2I 3G29A 2DE7A 3CCQP 2O53A 1Z03A 2K2QA 1VQ61 2JIQA 5KP6B 3CCU1 4MRIA 1Z02A 1QVFZ 2VLNA 1ZB9A 3J80b 2PENA 1ZB8A 1K30A 1KQSO 1SIWA 3VTNA 2CNRA 2RT9A 4NFRA 1YJN1 1IUQA 2PEOA 4R0MA 3CCJP 3CCLZ 1Y1VI 3CCR1 1M90Q 3CMA1 1VQK1 3JAMf 4M0IA 1YJ9Z 4A3II 2NAPA 2JA6I 3CPWO 3CCMZ 2L9FA 4PXHB 2M8LA 4E2YA 1I50I 2KOQA 3CCUZ 1KD11 1TWGI 4COPA 3HOZI 1K8AQ 2LOLA 5HGOA 5BS1A 3CXCO 2LFUA 3CQZI 3U43A 1K8A2 3P05A 5F2NA 5HGMA 3CD61 3RZOI 1KD1Q 2KORA 2FACA 1KQSZ 3G4SP 2VLQA 1VQOP 2JU2A 1YJ91 1YITP 2VPXA 2CWOA 3CCVP 1QVFO 2JS4A 2K3RA 2ONTA 5CM2M 4RVDA 2QA4Z 3NH4A 2P28A 2Z45A 1Q7Y1 4U0CA 4HH4A 2PNGA 3DS4A 1E0HA 4DQYB 4E33A 1M902 1QVGO 2JR6A 1M901 1GPJA 2X2BA 2QEXP 1VQM1 3GJNA 2JA8I 1AYIA 1VQ4P 1OR5A 4NBAA 1YHQ1 1EOQA 1VQNP 2HU9A 1RO0A 2QA41 1KC82 3CD6P 1K8A1 1ZH1A 3WBHA 2RBLA 2EHSA 4HGYA 3DS0A 1KD12 2V8KA 4E2ZA 5HGNA 2KG8A 3CPWY 2H85A 3F3FC 4BPFA 2QNWA 2E2JI 2L22A 3J7A4 2LIUA 2JYLA 2P3YA 3IR7A 2EHTA 1RLYA 3PO3I 3P5JB 2K0XA 4XX2A 1QVGZ 1DL6A 1VQ9P 2PMZA 2VF1A 2JQ4A 3S15I 1N8R1 1ZMBA 3CC7P
chains in the Genus database with same CATH topology
2NVYI 2DE5A 2RPRA 3H3VJ 1PFTA 2W03A 3PO3S 4A93I 3U50C 1VQNZ 1NJI1 4EWCA 1VQ4Z 3NDIA 5IT9b 1Q821 2QEXZ 4NB9A 4CL1A 1AUMA 1VQ8P 1KC81 5AN9F 2QA4P 2YADA 3RG6C 4MXUA 1YITZ 3GTPI 1K732 2OOYB 1VQOZ 2JO0A 1KC8Q 3S2DI 3CCS1 1TWCI 3DS1A 2IZ3A 5D1OA 2JUBA 3IF8A 1N8R2 2QEX1 2K5RA 3GTJI 3HYBA 1N8RQ 4NBEA 2Y0SA 4NB8A 3TE5B 2JYGA 3S16I 1RNIA 1A8OA 4A3EI 1NJIQ 5JPAA 3CPWZ 3CCMP 2DGYA 3IX0A 2E2II 1QF8A 1VQ51 4BBRI 3HZQA 2E1MA 5FLMI 3I56Z 3CCLP 4GR2A 3FQMA 1JJ2Y 3G28A 2OTJZ 3OW2O 3LRYA 1M74A 1X0TA 3TDHB 2OZKA 2I3CA 4A3FI 5I4TG 1VQ5Z 3CCQZ 1YJNP 4A3JI 1NUIA 2Z44A 3I561 1EIAA 3BG0B 3GCFA 4AYBA 5BS2A 3CCRP 1Q7Y2 4WYMA 1VQ6P 3D6WA 1WIIA 2E2HI 3I07A 2GTHA 3G6E1 1QVFY 1Y1WI 2BHVA 3MZLB 4A3KI 4PH0A 1W2BZ 3I55Z 3CCQ1 3M4OI 3HOYI 4NOZA 3OW2Z 2R92I 4XFYA 1I6HI 4GR6A 2GU2A 2PEIA 4IPYA 4A3CI 3DS5A 1YIJ1 3S17I 2KPIA 1W2BY 3VMIA 3CMEP 1VQPP 1TWHI 3G6EZ 3CCSP 3EEDA 3LUSA 1M6EX 4TNUA 1Q7YQ 3GTMS 2HF1A 5IP7I 1VQ6Z 3G26A 4E2XA 4MD9A 1R9TI 1VLAA 3OW2Y 4BY1I 1M6NA 5C4XI 5F2KA 2F4OA 1YJNZ 3M1MA 1VQ5P 2JMOA 2PEMA 3VMGA 3S14I 2QREB 3CMAZ 1LQLA 5DCKA 4NBCA 2R6MA 2B63I 3S2HI 2OTJP 3CC4Z 3ESWA 4DK1A 4NH1C 4QTUA 1VQLZ 3I56P 3T4NB 3GTQI 3GTKI 3H4EA 2O4HA 3KIHA 3CME1 3Q20A 2KODA 1USPB 4E31A 4A3MI 3MGEA 3CC41 2XV6A 2XXMA 4MD8A 4A3GI 2PM9A 2LF4A 4NBGA 3VMHA 1VQL1 2PEQA 3DS3A 1Q822 3GTOI 1YI2P 3CCEP 2EFJA 2QLVB 1RO2A 5T64A 3CXCZ 1YJW1 1YHQP 2BUOA 1Q82Q 1VQ41 1NJI2 2R7ZI 3G71Z 1USPA 2PEKA 2V8JA 4E30A 3Q87A 1VQMP 2RIQA 1VQ8Z 1P9NA 1WW9A 2OOXB 5A2Qb 1VQ91 1JJ2Z 3F3PC 1S72Z 2WAQA 2OTL1 4NBDA 3H47A 4RV9A 1X3WA 3DTJA 4U0FA 3VRLC 3G1GA 1K83I 5C44I 5C3EI 1Q811 4MONA 3G21A 2L6EA 2EG5A 4RVGA 2PEJA 3CC7Z 1RO4A 2QR1B 1M1K2 1N2FA 3MZKB 1TWAI 4RVFA 4E32A 2JA5I 2JA7I 1VQ9Z 1VQ7P 3GTGI 1W2BO 4A3BI 5F2OA 1Q861 1E6JP 2OTLZ 4XFXA 3I4NI 1QRJA 4QTTA 2RHBA 1VQKP 2JNYA 3J81b 3CC71 1K9MQ 5HGLA 5IP9I 4BBSI 1K73Q 2EGTA 2ZAEB 1TWFI 3H0DA 3GKQA 2M8PA 1JJ2O 1A43A 5FLXf 3CD6Z 2KI7B 1K9M1 3J80f 3HOWI 2G2KA 3NH8A 2E9HA 3NTEA 1Q81Q 4RVHA 3QWUA 1YIT1 3HKZA 2NVXI 1VQO1 2YU9I 3KIFA 4NBBA 5D1PA 1VQ71 3HOXI 3K7AI 2PK7A 1NP6A 2LIYA 1QYPA 3CCVZ 3CCL1 1YUAA 3G4SZ 4U0EA 1VQKZ 3S1MI 1K9M2 3CCJ1 2OTLP 3CCM1 3HOUI 3MONA 3S1QI 4NBHA 2OARA 3CCUP 1Y1VS 1VQ7Z 3EERA 1KQSY 4Y52I 2F4MA 1YJ9P 3NH5A 3G4S1 2VUGA 1Q862 2OTJ1 3CCV1 3NFZA 3CCJZ 3CCE1 1YI21 3RZDI 2NVQI 4DGLA 3G1IA 4RS4A 5IT9f 1S72P 5LL6f 4PH1A 3D9XA 1Z01A 1Q812 1M1K1 1VQN1 4MD7A 2R93I 4X6AI 1VQMZ 1KRLA 3G71P 1RQFA 1BAJA 2QKDA 1YHQZ 1M1KQ 3CCEZ 4U0DA 1YI2Z 4COCA 3I551 4U0BA 2EIAA 1ML8A 2QRDB 5FLXb 2Q51A 3H0GI 1JWHC 2M6NA 1WCMI 3CC2Z 4XROA 3J81f 2QRCB 4BXXI 4U0AA 1YIJZ 1YUKA 3M3YI 4BY7I 3B5IA 3S1RI 5A2Qf 4QNBA 3BG1B 2IZ4A 3NDJA 4MH4A 1VQLP 2P9XA 4E2WA 3E2DA 3CC4P 2W04A 3CC21 3CMAP 2PY8A 1YJWZ 2NVTI 2Z46A 4A3DI 3FQQA 1L1OC 1S7MA 1VQP1 3S1NI 2M8NA 3VB9A 4XRQA 1VQ81 4HGZA 3HOVI 1S721 5T6BA 2VUMI 2BJOA 2GTIA 2XT1A 3DPHA 2J6AA 1QVGY 3GTLI 3G0VA 1YJWP 4XFZA 3CCSZ 3G6EP 1VQPZ 3CMEZ 2AKLA 5D1OB 3JAMb 2WB1A 3IFUA 1Q86Q 1X3ZA 5T67A 3CXCY 3GTMI 1SFOI 1D1DA 2V8IA 4Y7NI 1TFIA 3FKII 3DS2A 2DE6A 3I55P 1YIJP 4NBFA 1K731 2Q4ZA 3CC2P 5C4JI 3G711 2M48A 3CCRZ 3I4MI 4A3LI 4S1TA 1I3QI 3PO2I 3G29A 2DE7A 3CCQP 2O53A 1Z03A 1VQ61 3CCU1 4MRIA 1Z02A 1QVFZ 1ZB9A 3J80b 2PENA 1ZB8A 1K30A 1KQSO 3VTNA 2RT9A 4NFRA 1YJN1 1IUQA 2PEOA 3CCJP 3CCLZ 1Y1VI 3CCR1 1M90Q 3CMA1 1VQK1 3JAMf 4M0IA 1YJ9Z 4A3II 2JA6I 3CPWO 3CCMZ 2M8LA 4E2YA 1I50I 3CCUZ 1KD11 1TWGI 4COPA 3HOZI 1K8AQ 2LFUA 5HGOA 5BS1A 3CXCO 3CQZI 1K8A2 3P05A 5F2NA 5HGMA 3CD61 3RZOI 1KD1Q 1KQSZ 3G4SP 1VQOP 1YJ91 1YITP 2CWOA 3CCVP 1QVFO 2JS4A 2K3RA 2ONTA 5CM2M 4RVDA 2QA4Z 3NH4A 2P28A 2Z45A 1Q7Y1 4U0CA 4HH4A 3DS4A 4DQYB 4E33A 1M902 1QVGO 2JR6A 1M901 2QEXP 1VQM1 2JA8I 1VQ4P 1YHQ1 4NBAA 1EOQA 1VQNP 2HU9A 1RO0A 2QA41 1KC82 3CD6P 1K8A1 1ZH1A 3WBHA 2RBLA 4HGYA 3DS0A 1KD12 2V8KA 4E2ZA 5HGNA 3CPWY 2H85A 3F3FC 2E2JI 3J7A4 2JYLA 2P3YA 1RLYA 3PO3I 3P5JB 4XX2A 1QVGZ 1DL6A 1VQ9P 2PMZA 2VF1A 3S15I 1N8R1 1ZMBA 3CC7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RNI A;  1RO0 A;  1RO2 A; 
#chains in the Genus database with same CATH topology
 2NVY I;  2DE5 A;  2RPR A;  3H3V J;  1PFT A;  2W03 A;  3PO3 S;  2FQ1 A;  3U50 C;  4A93 I;  1VQN Z;  1NJI 1;  4EWC A;  1VQ4 Z;  3NDI A;  5IT9 b;  2FQ2 A;  1Q16 A;  1Q82 1;  2QEX Z;  4NB9 A;  1DV5 A;  4CL1 A;  1AUM A;  2MVV A;  1VQ8 P;  1QXF A;  1KC8 1;  5AN9 F;  2QA4 P;  2YAD A;  2GZF A;  2AFE A;  1L0H A;  3RG6 C;  4MXU A;  1YIT Z;  3GTP I;  1K73 2;  2OOY B;  1GXH A;  1VQO Z;  2LIW A;  2JO0 A;  1KLP A;  1KC8 Q;  3S2D I;  3CCS 1;  1TWC I;  3DS1 A;  2IZ3 A;  5D1O A;  2JUB A;  3IF8 A;  1N8R 2;  2MR8 A;  2QEX 1;  2K5R A;  2KGA A;  3GTJ I;  3HYB A;  2GZG A;  1N8R Q;  4NBE A;  2Y0S A;  4NB8 A;  3TE5 B;  2DNW A;  2JYG A;  7CEI A;  3S16 I;  1RNI A;  1A8O A;  2N6Z A;  4A3E I;  1NJI Q;  3EJD A;  5JPA A;  3CPW Z;  3CCM P;  2L4B A;  2DGY A;  3IX0 A;  2E2I I;  4BPG A;  1QF8 A;  1VQ5 1;  4BBR I;  3HZQ A;  2E1M A;  5FLM I;  3I56 Z;  3CCL P;  2GDX A;  2ROQ A;  2JU1 A;  2KGC A;  1VHN A;  4GR2 A;  1NQ4 A;  2KGD A;  5HVC A;  2VPW A;  2N5I A;  3FQM A;  1JJ2 Y;  3G28 A;  2OTJ Z;  3OW2 O;  2LKI A;  2FVA A;  3CE7 A;  3LRY A;  1M74 A;  1X0T A;  3TDH B;  2OZK A;  5HV8 A;  2I3C A;  4A3F I;  5I4T G;  1VQ5 Z;  3CCQ Z;  1YJN P;  4A3J I;  1NUI A;  2Z44 A;  3I56 1;  1EIA A;  1HQB A;  3BG0 B;  2CGQ A;  3GCF A;  4AYB A;  2FAD A;  5BS2 A;  3CCR P;  1Q7Y 2;  4WYM A;  1VQ6 P;  3D6W A;  1WII A;  2NO8 A;  2E2H I;  3I07 A;  2GTH A;  2VPY A;  3G6E 1;  1QVF Y;  1Y1W I;  2BHV A;  3MZL B;  4A3K I;  4PH0 A;  1W2B Z;  3I55 Z;  1DNY A;  3EJB A;  3CCQ 1;  3M4O I;  1WJ2 A;  3HOY I;  4NOZ A;  3OW2 Z;  2R92 I;  2JBG A;  4XFY A;  1I6H I;  4BPH A;  4GR6 A;  2GU2 A;  2PEI A;  4IPY A;  1BXI A;  4A3C I;  3DS5 A;  1YIJ 1;  3S17 I;  2KPI A;  2LL8 A;  1W2B Y;  3VMI A;  1FR2 A;  3CME P;  1VQP P;  1TWH I;  3G6E Z;  3CCS P;  3EED A;  3LUS A;  1M6E X;  4TNU A;  1Q7Y Q;  3GTM S;  4NEO A;  1WZN A;  2HF1 A;  5IP7 I;  1VQ6 Z;  3G26 A;  4E2X A;  4MD9 A;  1R9T I;  1VLA A;  3OW2 Y;  4BY1 I;  2K0D X;  1M6N A;  5C4X I;  5F2K A;  2F4O A;  1YJN Z;  3M1M A;  4H2W C;  1VQ5 P;  2JMO A;  2PEM A;  3VMG A;  2AVA A;  2GDW A;  3S14 I;  2QRE B;  1UNK A;  3CMA Z;  1LQL A;  5DCK A;  4NBC A;  2R6M A;  2B63 I;  3S2H I;  2OTJ P;  3CC4 Z;  3ESW A;  2V3V A;  2JIP A;  1UJZ A;  4DK1 A;  4NH1 C;  4QTU A;  3RG2 A;  1VQL Z;  3I56 P;  3T4N B;  5KP7 B;  3GTQ I;  1Z6M A;  2FVE A;  3H4E A;  3GTK I;  2O4H A;  3KIH A;  3CME 1;  3Q20 A;  2KOD A;  1USP B;  4E31 A;  4A3M I;  3MGE A;  1VKU A;  1MZ8 A;  3CC4 1;  2XV6 A;  2XXM A;  4MD8 A;  4A3G I;  1L0I A;  2AFD A;  2PM9 A;  2XZ1 C;  2LF4 A;  4NBG A;  3EJE A;  3VMH A;  1VQL 1;  2PEQ A;  3DS3 A;  1Q82 2;  3GTO I;  1YI2 P;  3CCE P;  2EFJ A;  2QLV B;  1RO2 A;  5T64 A;  3CXC Z;  1YJW 1;  1YHQ P;  2BUO A;  1Q82 Q;  1VQ4 1;  1NJI 2;  2R7Z I;  3G71 Z;  3GKL C;  1USP A;  2PEK A;  2KWL A;  2V8J A;  4E30 A;  3Q87 A;  1VQM P;  2RIQ A;  1VQ8 Z;  1FDO A;  1P9N A;  1WW9 A;  2OOX B;  5A2Q b;  1VQ9 1;  1JJ2 Z;  3F3P C;  1S72 Z;  2MVU A;  2WAQ A;  2OTL 1;  4NBD A;  3H47 A;  4RV9 A;  1X3W A;  3DTJ A;  4H2X C;  4U0F A;  3VRL C;  3G1G A;  1K83 I;  5C44 I;  5C3E I;  1Q81 1;  4MON A;  3G21 A;  2L6E A;  2EG5 A;  4RVG A;  2PEJ A;  2VSQ A;  3CC7 Z;  1RO4 A;  2QR1 B;  1M1K 2;  1N2F A;  3MZK B;  1TWA I;  2XZ0 D;  4RVF A;  4E32 A;  3B4Q A;  2JA5 I;  2JA7 I;  1VQ9 Z;  1VQ7 P;  3GTG I;  1W2B O;  4A3B I;  5F2O A;  1Q86 1;  1E6J P;  2KOS A;  4DG9 A;  2OTL Z;  4XFX A;  3I4N I;  2JB0 A;  1QRJ A;  4QTT A;  2N50 A;  2RHB A;  1VQK P;  3D2L A;  2JNY A;  3J81 b;  2GZJ A;  3CC7 1;  1K9M Q;  5HGL A;  5IP9 I;  4BBS I;  2FAE A;  1K73 Q;  2EGT A;  2ZAE B;  1TWF I;  3H0D A;  3GKQ A;  2M8P A;  1JJ2 O;  1A43 A;  5FLX f;  3CD6 Z;  2V45 A;  2KI7 B;  1K9M 1;  3J80 f;  3HOW I;  4F37 A;  2G2K A;  3NH8 A;  2E9H A;  2JAZ A;  3NTE A;  1Q81 Q;  4RVH A;  2KOP A;  2WPT A;  3QWU A;  1YIT 1;  3HKZ A;  4IZ6 A;  1VQO 1;  2NVX I;  2YU9 I;  3KIF A;  4UHP B;  4NBB A;  5D1P A;  1VQ7 1;  3HOX I;  1NP6 A;  2PK7 A;  5EJD A;  2LIY A;  3K7A I;  1QYP A;  2K5X A;  2AYD A;  3CCV Z;  3CCL 1;  3GZM A;  1YUA A;  3G4S Z;  4U0E A;  1VQK Z;  2KR5 A;  2KGE A;  1AF8 A;  1K9M 2;  3S1M I;  2JIO A;  3CCJ 1;  2GZI A;  2OTL P;  3CCM 1;  3HOU I;  2MY5 A;  3MON A;  3S1Q I;  2N6Y A;  4NBH A;  2JGP A;  2OAR A;  3CCU P;  1Y1V S;  1VQ7 Z;  3EER A;  2MR7 A;  4PWV B;  1KQS Y;  4Y52 I;  4QKO A;  2F4M A;  2FHS C;  1YJ9 P;  3NH5 A;  3G4S 1;  2VUG A;  1Q86 2;  1T8K A;  2OTJ 1;  2K92 A;  3CCV 1;  3NFZ A;  3CCJ Z;  1F80 D;  3CCE 1;  1YI2 1;  3RZD I;  2GYK A;  1AA6 A;  2LML A;  2MF4 A;  2NVQ I;  3LMO A;  4DGL A;  3G1I A;  5CZD B;  4RS4 A;  5IT9 f;  1S72 P;  5LL6 f;  2AF8 A;  4PH1 A;  3D9X A;  1Z01 A;  1Q81 2;  1M1K 1;  1VQN 1;  2GZE A;  4MD7 A;  2R93 I;  4X6A I;  1VQM Z;  1ZNV A;  1KRL A;  3G71 P;  1ACP A;  1RQF A;  2FVF A;  1BAJ A;  2QKD A;  1YHQ Z;  1M1K Q;  2GDY A;  3CCE Z;  4U0D A;  1YI2 Z;  4COC A;  3I55 1;  2JIM A;  2LPK A;  4U0B A;  2EIA A;  1ML8 A;  2QRD B;  5FLX b;  2IV2 X;  2KG9 A;  2Q51 A;  3H0G I;  2MD9 A;  4CA3 A;  1JWH C;  3GZL A;  2M6N A;  1WCM I;  3CC2 Z;  4XRO A;  2LTE A;  3J81 f;  5EW5 E;  2QRC B;  4BXX I;  4U0A A;  1YIJ Z;  1YUK A;  3M3Y I;  4BY7 I;  3B5I A;  3NY7 B;  3S1R I;  5A2Q f;  2VPZ A;  4QNB A;  3BG1 B;  2N5H A;  2IZ4 A;  3NDJ A;  1VQL P;  4MH4 A;  2P9X A;  2VLP A;  4E2W A;  2K0Y A;  3E2D A;  3CC4 P;  2W04 A;  3CC2 1;  2CQ8 A;  1Y8C A;  3CMA P;  2PY8 A;  1EMV A;  2VLO A;  2KG6 A;  1YJW Z;  1GXG A;  2NVT I;  2Z46 A;  4A3D I;  3FQQ A;  2KW2 A;  1L1O C;  1S7M A;  1VQP 1;  3S1N I;  2M8N A;  2M5R A;  3VB9 A;  4XRQ A;  1VQ8 1;  4HGZ A;  3HOV I;  2CG5 B;  4MRT C;  1S72 1;  5T6B A;  2VUM I;  1X3O A;  1FDI A;  2BJO A;  2GTI A;  2XT1 A;  2K93 A;  2KOO A;  3DPH A;  2J6A A;  1QVG Y;  3GTL I;  3G0V A;  1YJW P;  4H2Y C;  4XFZ A;  2JIR A;  2ERH A;  3CCS Z;  3G6E P;  1VQP Z;  3CME Z;  2AKL A;  2N98 A;  2FQ0 A;  5D1O B;  3JAM b;  2WB1 A;  3IFU A;  1Q86 Q;  1IMP A;  1X3Z A;  5T67 A;  3CXC Y;  2L0Q A;  3GTM I;  1HY8 A;  1SFO I;  1D1D A;  2V8I A;  4Y7N I;  1TFI A;  3FKI I;  3DS2 A;  2DE6 A;  3I55 P;  1YIJ P;  4NBF A;  1K73 1;  2E7Z A;  4HKG A;  2Q4Z A;  3CC2 P;  5C4J I;  1IMQ A;  2K94 A;  3G71 1;  5KP8 B;  2M48 A;  3CCR Z;  3I4M I;  4A3L I;  4S1T A;  2LEX A;  1I3Q I;  1CEI A;  3PO2 I;  3G29 A;  2DE7 A;  3CCQ P;  2O53 A;  1Z03 A;  2K2Q A;  1VQ6 1;  2JIQ A;  5KP6 B;  3CCU 1;  4MRI A;  1Z02 A;  1QVF Z;  2VLN A;  1ZB9 A;  3J80 b;  2PEN A;  1ZB8 A;  1K30 A;  1KQS O;  1SIW A;  3VTN A;  2CNR A;  2RT9 A;  4NFR A;  1YJN 1;  1IUQ A;  2PEO A;  4R0M A;  3CCJ P;  3CCL Z;  1Y1V I;  3CCR 1;  1M90 Q;  3CMA 1;  1VQK 1;  3JAM f;  4M0I A;  1YJ9 Z;  4A3I I;  2NAP A;  2JA6 I;  3CPW O;  3CCM Z;  2L9F A;  4PXH B;  2M8L A;  4E2Y A;  1I50 I;  2KOQ A;  3CCU Z;  1KD1 1;  1TWG I;  4COP A;  3HOZ I;  1K8A Q;  2LOL A;  5HGO A;  5BS1 A;  3CXC O;  2LFU A;  3CQZ I;  3U43 A;  1K8A 2;  3P05 A;  5F2N A;  5HGM A;  3CD6 1;  3RZO I;  1KD1 Q;  2KOR A;  2FAC A;  1KQS Z;  3G4S P;  2VLQ A;  1VQO P;  2JU2 A;  1YJ9 1;  1YIT P;  2VPX A;  2CWO A;  3CCV P;  1QVF O;  2JS4 A;  2K3R A;  2ONT A;  5CM2 M;  4RVD A;  2QA4 Z;  3NH4 A;  2P28 A;  2Z45 A;  1Q7Y 1;  4U0C A;  4HH4 A;  2PNG A;  3DS4 A;  1E0H A;  4DQY B;  4E33 A;  1M90 2;  1QVG O;  2JR6 A;  1M90 1;  1GPJ A;  2X2B A;  2QEX P;  1VQM 1;  3GJN A;  2JA8 I;  1AYI A;  1VQ4 P;  1OR5 A;  4NBA A;  1YHQ 1;  1EOQ A;  1VQN P;  2HU9 A;  1RO0 A;  2QA4 1;  1KC8 2;  3CD6 P;  1K8A 1;  1ZH1 A;  3WBH A;  2RBL A;  2EHS A;  4HGY A;  3DS0 A;  1KD1 2;  2V8K A;  4E2Z A;  5HGN A;  2KG8 A;  3CPW Y;  2H85 A;  3F3F C;  4BPF A;  2QNW A;  2E2J I;  2L22 A;  3J7A 4;  2LIU A;  2JYL A;  2P3Y A;  3IR7 A;  2EHT A;  1RLY A;  3PO3 I;  3P5J B;  2K0X A;  4XX2 A;  1QVG Z;  1DL6 A;  1VQ9 P;  2PMZ A;  2VF1 A;  2JQ4 A;  3S15 I;  1N8R 1;  1ZMB A;  3CC7 P; 
#chains in the Genus database with same CATH homology
 2NVY I;  2DE5 A;  2RPR A;  3H3V J;  1PFT A;  2W03 A;  3PO3 S;  4A93 I;  3U50 C;  1VQN Z;  1NJI 1;  4EWC A;  1VQ4 Z;  3NDI A;  5IT9 b;  1Q82 1;  2QEX Z;  4NB9 A;  4CL1 A;  1AUM A;  1VQ8 P;  1KC8 1;  5AN9 F;  2QA4 P;  2YAD A;  3RG6 C;  4MXU A;  1YIT Z;  3GTP I;  1K73 2;  2OOY B;  1VQO Z;  2JO0 A;  1KC8 Q;  3S2D I;  3CCS 1;  1TWC I;  3DS1 A;  2IZ3 A;  5D1O A;  2JUB A;  3IF8 A;  1N8R 2;  2QEX 1;  2K5R A;  3GTJ I;  3HYB A;  1N8R Q;  4NBE A;  2Y0S A;  4NB8 A;  3TE5 B;  2JYG A;  3S16 I;  1RNI A;  1A8O A;  4A3E I;  1NJI Q;  5JPA A;  3CPW Z;  3CCM P;  2DGY A;  3IX0 A;  2E2I I;  1QF8 A;  1VQ5 1;  4BBR I;  3HZQ A;  2E1M A;  5FLM I;  3I56 Z;  3CCL P;  4GR2 A;  3FQM A;  1JJ2 Y;  3G28 A;  2OTJ Z;  3OW2 O;  3LRY A;  1M74 A;  1X0T A;  3TDH B;  2OZK A;  2I3C A;  4A3F I;  5I4T G;  1VQ5 Z;  3CCQ Z;  1YJN P;  4A3J I;  1NUI A;  2Z44 A;  3I56 1;  1EIA A;  3BG0 B;  3GCF A;  4AYB A;  5BS2 A;  3CCR P;  1Q7Y 2;  4WYM A;  1VQ6 P;  3D6W A;  1WII A;  2E2H I;  3I07 A;  2GTH A;  3G6E 1;  1QVF Y;  1Y1W I;  2BHV A;  3MZL B;  4A3K I;  4PH0 A;  1W2B Z;  3I55 Z;  3CCQ 1;  3M4O I;  3HOY I;  4NOZ A;  3OW2 Z;  2R92 I;  4XFY A;  1I6H I;  4GR6 A;  2GU2 A;  2PEI A;  4IPY A;  4A3C I;  3DS5 A;  1YIJ 1;  3S17 I;  2KPI A;  1W2B Y;  3VMI A;  3CME P;  1VQP P;  1TWH I;  3G6E Z;  3CCS P;  3EED A;  3LUS A;  1M6E X;  4TNU A;  1Q7Y Q;  3GTM S;  2HF1 A;  5IP7 I;  1VQ6 Z;  3G26 A;  4E2X A;  4MD9 A;  1R9T I;  1VLA A;  3OW2 Y;  4BY1 I;  1M6N A;  5C4X I;  5F2K A;  2F4O A;  1YJN Z;  3M1M A;  1VQ5 P;  2JMO A;  2PEM A;  3VMG A;  3S14 I;  2QRE B;  3CMA Z;  1LQL A;  5DCK A;  4NBC A;  2R6M A;  2B63 I;  3S2H I;  2OTJ P;  3CC4 Z;  3ESW A;  4DK1 A;  4NH1 C;  4QTU A;  1VQL Z;  3I56 P;  3T4N B;  3GTQ I;  3GTK I;  3H4E A;  2O4H A;  3KIH A;  3CME 1;  3Q20 A;  2KOD A;  1USP B;  4E31 A;  4A3M I;  3MGE A;  3CC4 1;  2XV6 A;  2XXM A;  4MD8 A;  4A3G I;  2PM9 A;  2LF4 A;  4NBG A;  3VMH A;  1VQL 1;  2PEQ A;  3DS3 A;  1Q82 2;  3GTO I;  1YI2 P;  3CCE P;  2EFJ A;  2QLV B;  1RO2 A;  5T64 A;  3CXC Z;  1YJW 1;  1YHQ P;  2BUO A;  1Q82 Q;  1VQ4 1;  1NJI 2;  2R7Z I;  3G71 Z;  1USP A;  2PEK A;  2V8J A;  4E30 A;  3Q87 A;  1VQM P;  2RIQ A;  1VQ8 Z;  1P9N A;  1WW9 A;  2OOX B;  5A2Q b;  1VQ9 1;  1JJ2 Z;  3F3P C;  1S72 Z;  2WAQ A;  2OTL 1;  4NBD A;  3H47 A;  4RV9 A;  1X3W A;  3DTJ A;  4U0F A;  3VRL C;  3G1G A;  1K83 I;  5C44 I;  5C3E I;  1Q81 1;  4MON A;  3G21 A;  2L6E A;  2EG5 A;  4RVG A;  2PEJ A;  3CC7 Z;  1RO4 A;  2QR1 B;  1M1K 2;  1N2F A;  3MZK B;  1TWA I;  4RVF A;  4E32 A;  2JA5 I;  2JA7 I;  1VQ9 Z;  1VQ7 P;  3GTG I;  1W2B O;  4A3B I;  5F2O A;  1Q86 1;  1E6J P;  2OTL Z;  4XFX A;  3I4N I;  1QRJ A;  4QTT A;  2RHB A;  1VQK P;  2JNY A;  3J81 b;  3CC7 1;  1K9M Q;  5HGL A;  5IP9 I;  4BBS I;  1K73 Q;  2EGT A;  2ZAE B;  1TWF I;  3H0D A;  3GKQ A;  2M8P A;  1JJ2 O;  1A43 A;  5FLX f;  3CD6 Z;  2KI7 B;  1K9M 1;  3J80 f;  3HOW I;  2G2K A;  3NH8 A;  2E9H A;  3NTE A;  1Q81 Q;  4RVH A;  3QWU A;  1YIT 1;  3HKZ A;  2NVX I;  1VQO 1;  2YU9 I;  3KIF A;  4NBB A;  5D1P A;  1VQ7 1;  3HOX I;  3K7A I;  2PK7 A;  1NP6 A;  2LIY A;  1QYP A;  3CCV Z;  3CCL 1;  1YUA A;  3G4S Z;  4U0E A;  1VQK Z;  3S1M I;  1K9M 2;  3CCJ 1;  2OTL P;  3CCM 1;  3HOU I;  3MON A;  3S1Q I;  4NBH A;  2OAR A;  3CCU P;  1Y1V S;  1VQ7 Z;  3EER A;  1KQS Y;  4Y52 I;  2F4M A;  1YJ9 P;  3NH5 A;  3G4S 1;  2VUG A;  1Q86 2;  2OTJ 1;  3CCV 1;  3NFZ A;  3CCJ Z;  3CCE 1;  1YI2 1;  3RZD I;  2NVQ I;  4DGL A;  3G1I A;  4RS4 A;  5IT9 f;  1S72 P;  5LL6 f;  4PH1 A;  3D9X A;  1Z01 A;  1Q81 2;  1M1K 1;  1VQN 1;  4MD7 A;  2R93 I;  4X6A I;  1VQM Z;  1KRL A;  3G71 P;  1RQF A;  1BAJ A;  2QKD A;  1YHQ Z;  1M1K Q;  3CCE Z;  4U0D A;  1YI2 Z;  4COC A;  3I55 1;  4U0B A;  2EIA A;  1ML8 A;  2QRD B;  5FLX b;  2Q51 A;  3H0G I;  1JWH C;  2M6N A;  1WCM I;  3CC2 Z;  4XRO A;  3J81 f;  2QRC B;  4BXX I;  4U0A A;  1YIJ Z;  1YUK A;  3M3Y I;  4BY7 I;  3B5I A;  3S1R I;  5A2Q f;  4QNB A;  3BG1 B;  2IZ4 A;  3NDJ A;  4MH4 A;  1VQL P;  2P9X A;  4E2W A;  3E2D A;  3CC4 P;  2W04 A;  3CC2 1;  3CMA P;  2PY8 A;  1YJW Z;  2NVT I;  2Z46 A;  4A3D I;  3FQQ A;  1L1O C;  1S7M A;  1VQP 1;  3S1N I;  2M8N A;  3VB9 A;  4XRQ A;  1VQ8 1;  4HGZ A;  3HOV I;  1S72 1;  5T6B A;  2VUM I;  2BJO A;  2GTI A;  2XT1 A;  3DPH A;  2J6A A;  1QVG Y;  3GTL I;  3G0V A;  1YJW P;  4XFZ A;  3CCS Z;  3G6E P;  1VQP Z;  3CME Z;  2AKL A;  5D1O B;  3JAM b;  2WB1 A;  3IFU A;  1Q86 Q;  1X3Z A;  5T67 A;  3CXC Y;  3GTM I;  1SFO I;  1D1D A;  2V8I A;  4Y7N I;  1TFI A;  3FKI I;  3DS2 A;  2DE6 A;  3I55 P;  1YIJ P;  4NBF A;  1K73 1;  2Q4Z A;  3CC2 P;  5C4J I;  3G71 1;  2M48 A;  3CCR Z;  3I4M I;  4A3L I;  4S1T A;  1I3Q I;  3PO2 I;  3G29 A;  2DE7 A;  3CCQ P;  2O53 A;  1Z03 A;  1VQ6 1;  3CCU 1;  4MRI A;  1Z02 A;  1QVF Z;  1ZB9 A;  3J80 b;  2PEN A;  1ZB8 A;  1K30 A;  1KQS O;  3VTN A;  2RT9 A;  4NFR A;  1YJN 1;  1IUQ A;  2PEO A;  3CCJ P;  3CCL Z;  1Y1V I;  3CCR 1;  1M90 Q;  3CMA 1;  1VQK 1;  3JAM f;  4M0I A;  1YJ9 Z;  4A3I I;  2JA6 I;  3CPW O;  3CCM Z;  2M8L A;  4E2Y A;  1I50 I;  3CCU Z;  1KD1 1;  1TWG I;  4COP A;  3HOZ I;  1K8A Q;  2LFU A;  5HGO A;  5BS1 A;  3CXC O;  3CQZ I;  1K8A 2;  3P05 A;  5F2N A;  5HGM A;  3CD6 1;  3RZO I;  1KD1 Q;  1KQS Z;  3G4S P;  1VQO P;  1YJ9 1;  1YIT P;  2CWO A;  3CCV P;  1QVF O;  2JS4 A;  2K3R A;  2ONT A;  5CM2 M;  4RVD A;  2QA4 Z;  3NH4 A;  2P28 A;  2Z45 A;  1Q7Y 1;  4U0C A;  4HH4 A;  3DS4 A;  4DQY B;  4E33 A;  1M90 2;  1QVG O;  2JR6 A;  1M90 1;  2QEX P;  1VQM 1;  2JA8 I;  1VQ4 P;  1YHQ 1;  4NBA A;  1EOQ A;  1VQN P;  2HU9 A;  1RO0 A;  2QA4 1;  1KC8 2;  3CD6 P;  1K8A 1;  1ZH1 A;  3WBH A;  2RBL A;  4HGY A;  3DS0 A;  1KD1 2;  2V8K A;  4E2Z A;  5HGN A;  3CPW Y;  2H85 A;  3F3F C;  2E2J I;  3J7A 4;  2JYL A;  2P3Y A;  1RLY A;  3PO3 I;  3P5J B;  4XX2 A;  1QVG Z;  1DL6 A;  1VQ9 P;  2PMZ A;  2VF1 A;  3S15 I;  1N8R 1;  1ZMB A;  3CC7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...