1RO0A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m semet remote
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 61
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro0A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro0A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro0A02
1RO2A 3M1MA 1RNIA 1RO0A
chains in the Genus database with same CATH superfamily
2GYKA 3T4NB 5IP9I 1Y1VI 1W2BY 2NVQI 1I3QI 2P3YA 3EERA 4NEOA 3MZLB 1DNYA 2GDYA 2EFJA 1VQLZ 3I55P 3JAMb 3G711 5A2Qb 4BY1I 4XFYA 1VQ51 3CMEZ 2BUOA 3HOUI 4BBRI 2FQ0A 4X6AI 3HOYI 1VQLP 5D1OA 3U43A 1GPJA 5HGMA 2E2JI 1WCMI 2JGPA 1WIIA 2V8IA 4U0FA 2V8KA 4NBGA 2Z45A 2MY5A 1TWHI 4MH4A 2DE5A 4H2WC 1YI2Z 2L6EA 1Z03A 3RG6C 3G6E1 3CCL1 3OW2Z 5BS2A 4NFRA 2E7ZA 5KP6B 1M6NA 1Y1WI 1UJZA 3K7AI 3GTJI 1AYIA 3LUSA 1VQO1 2J6AA 2XZ1C 4HGZA 4A3GI 4DG9A 4NBFA 2AFDA 4PH0A 4H2XC 2KW2A 1M1KQ 5F2KA 3CPWO 2NVXI 1EOQA 2JIQA 2DGYA 2R6MA 2AF8A 3CCQ1 3RZOI 3G0VA 4E2YA 1M901 2FAEA 2K0DX 3GKLC 3CC21 2N6ZA 1M902 2PEJA 1W2BZ 1MZ8A 1ML8A 2MVVA 1QVFO 3D6WA 1L0IA 1NQ4A 4COPA 4F37A 4A3DI 3CC4Z 4COCA 2JA6I 2GZFA 4QTUA 4MD8A 1M6EX 2L0QA 1RLYA 1GXHA 3NH5A 2JMOA 1K30A 2KGEA 3CC4P 3VRLC 1TWFI 1T8KA 2MF4A 2RIQA 2JIMA 5C44I 3MONA 3J80f 2FACA 1D1DA 2GTIA 3KIFA 3EJEA 1YHQZ 3CCUP 3GTMI 3S14I 5I4TG 3GTGI 4PH1A 3HZQA 1JJ2Y 3GTLI 3I551 3G1IA 2G2KA 1KQSY 1YHQP 1TFIA 1Q7Y1 1K73Q 1VQ4Z 1L0HA 1DL6A 2LF4A 1K9M1 2JU2A 2K0XA 3GTPI 1VQNP 2RPRA 2GU2A 1Q7Y2 3CMA1 3M4OI 1K9M2 4HH4A 4BY7I 2HF1A 1VQ4P 3CC71 4A3MI 1ZMBA 2QKDA 1SIWA 2Q51A 4A3JI 2MR7A 2VSQA 4GR6A 1M1K1 4A3CI 1AF8A 2FQ1A 2KG8A 2QR1B 3CCR1 2OTJ1 2PEIA 3ESWA 3MGEA 1YJWP 4NOZA 3G71Z 1WJ2A 1X3ZA 3JAMf 1RO0A 5A2Qf 4CA3A 3DPHA 2PEKA 1TWAI 3CCEP 3BG0B 5EJDA 4NBHA 2VLOA 2E2II 1IMQA 3CXCO 2KGDA 3QWUA 3GZLA 2GDXA 2NVYI 4BXXI 1YJNP 1IUQA 4MRTC 3G6EZ 3CCLZ 2L4BA 2OTLZ 1TWCI 2PEMA 1TWGI 2CWOA 3NFZA 4TNUA 1QYPA 1EMVA 4NBCA 5CZDB 4NBDA 4PWVB 2VLQA 2QLVB 3G4SP 2OTLP 2PMZA 2JBGA 3J81f 3NH8A 1X3WA 1HY8A 2K5XA 1I50I 3GTOI 2EG5A 3U50C 1AA6A 2V8JA 3J7A4 5F2OA 3FKII 1KQSZ 1Q861 3WBHA 3CD6Z 1VQKP 5FLMI 1Q862 1QVFY 2PEQA 3HYBA 1PFTA 4HGYA 3GTQI 3CD6P 2KOSA 2GZEA 1YUKA 5HGOA 2VLPA 2M5RA 3I07A 1VQ91 1M90Q 3PO3S 1RO2A 4GR2A 2K5RA 2GZIA 3G29A 3Q87A 5T64A 2K2QA 1R9TI 2LIYA 3RZDI 1VQ8Z 5IP7I 4E31A 1GXGA 2E2HI 4E2XA 1YJ91 1VQ8P 5CM2M 1AUMA 1YIJZ 3S16I 2N98A 2KI7B 2NAPA 2JA8I 1Q16A 1NJIQ 2RHBA 3CMEP 3DS2A 1FDOA 2KG9A 1JJ2O 1VQ6Z 1KQSO 3RG2A 5HV8A 4CL1A 1VQ6P 2XT1A 1ZB9A 3IR7A 2CGQA 1VQM1 2JQ4A 1YI2P 2LFUA 2P28A 1HQBA 3I56Z 5IT9f 3CMAZ 1Q7YQ 3CCS1 4EWCA 2QA41 2LMLA 1K9MQ 4MXUA 3G28A 4A3BI 2V3VA 3CCV1 3I56P 3CCJ1 2QEXZ 4RVFA 3HOVI 1RO4A 2M6NA 1N8R2 1YITZ 1KD1Q 1QVGY 5C4JI 3CCMZ 2F4OA 2PEOA 2OTJZ 2QEXP 1Q812 3P05A 2AKLA 3P5JB 3LMOA 1ZB8A 3D9XA 3NDIA 3CCMP 2YU9I 3G4S1 2JUBA 1NUIA 1QXFA 3FQMA 2PK7A 2Z46A 5AN9F 2CQ8A 2M8LA 2LKIA 1Y1VS 4QNBA 3H47A 1A43A 1M74A 2BJOA 3OW2O 2KODA 2MD9A 1QRJA 3DS1A 3S2HI 2DNWA 3NDJA 4NB8A 1S721 1NJI1 5D1PA 3CE7A 3IFUA 2LEXA 1NJI2 5HGLA 4RS4A 1VQPZ 2LIUA 3HOZI 3TE5B 2YADA 1RNIA 4NBEA 1VQPP 1S7MA 2R92I 2M8PA 3D2LA 2PNGA 1VQ7Z 4XRQA 4WYMA 1KLPA 3DS3A 4IZ6A 1K8AQ 2X2BA 2JYGA 3S2DI 2EIAA 1VQL1 1VQ7P 1Q86Q 2JR6A 3GJNA 2FQ2A 1W2BO 2Q4ZA 2EGTA 3GTKI 3HOWI 2JB0A 1KD11 4QKOA 2PENA 2IZ4A 2WAQA 3H0GI 1KD12 2XXMA 2W03A 2R93I 1Q82Q 2R7ZI 1QVGZ 4E2ZA 2VUMI 2QREB 3BG1B 2ONTA 1VQ5Z 3DS5A 2HU9A 2ZAEB 2RBLA 3H3VJ 3G71P 2JA7I 1VQ5P 1ACPA 3LRYA 2GDWA 1EIAA 2DE6A 1LQLA 1P9NA 3MZKB 2JIOA 2VF1A 5KP7B 1YUAA 3B5IA 1VQMZ 2MR8A 3HKZA 1QF8A 2N5IA 2GTHA 3VB9A 3G6EP 3CCLP 4BPHA 2XZ0D 2VLNA 2QA4Z 3CPWY 4U0BA 2OZKA 1VQOZ 4NB9A 1K8A1 3VMGA 1K8A2 2V45A 4MD7A 3GTMS 2EHTA 2N6YA 1VQOP 1N8RQ 3CC41 2E9HA 5HGNA 2KOQA 4R0MA 2BHVA 2JAZA 1RQFA 1Q81Q 1USPB 2F4MA 5EW5E 2Y0SA 3CCQZ 2AFEA 2P9XA 4IPYA 2KGCA 4A3LI 3CC2Z 3CCU1 5FLXb 4RVDA 3S1QI 1Q821 3CCQP 3VTNA 4XFXA 2NO8A 3KIHA 1Q822 3S1RI 1YHQ1 3CC2P 2JIPA 2K94A 4A3KI 2CG5B 2PY8A 3H0DA 3S1NI 1BAJA 2LL8A 2QRCB 3B4QA 1VQN1 3GKQA 4RVHA 4A3EI 1S72Z 2KOOA 3VMIA 4XFZA 1VQ41 2EHSA 2QRDB 2JYLA 2B63I 3E2DA 1YIJP 4E30A 1E0HA 5BS1A 2LOLA 4BPFA 4Y7NI 1FDIA 4NH1C 5HVCA 1YJW1 3I55Z 3EEDA 2I3CA 2K93A 4MD9A 3TDHB 2FVAA 1FR2A 3CCE1 3G1GA 2KPIA 4QTTA 4A93I 3S15I 5T6BA 3CC7Z 3CPWZ 3CMAP 4BBSI 1N8R1 1F80D 2K3RA 1YJN1 3DTJA 4S1TA 3CC7P 5D1OB 1Q811 1WW9A 3CCRZ 2M48A 1Z01A 2CNRA 2O4HA 2IV2X 5DCKA 3CXCY 1QVFZ 1YITP 4U0AA 2NVTI 3CCRP 3S1MI 2WPTA 2OTJP 2OTL1 2ROQA 4BPGA 4NBAA 1VHNA 2ERHA 4DK1A 3J81b 3Q20A 2JA5I 2WB1A 2KGAA 2IZ3A 1VQK1 2JIRA 2L9FA 4E33A 2N50A 2OARA 1KC81 3FQQA 1CEIA 2MVUA 3EJDA 1KC82 3CD61 1L1OC 3NY7B 5C3EI 3EJBA 1WZNA 1I6HI 3I4NI 4XX2A 2JS4A 3H4EA 2RT9A 4A3II 5JPAA 1N2FA 3M1MA 2H85A 2L22A 4RVGA 3GZMA 3S17I 1E6JP 4DQYB 2K92A 4U0CA 4MONA 3HOXI 3IX0A 4M0IA 4AYBA 4RV9A 1VQ81 2N5HA 2JNYA 3F3FC 2PM9A 3CME1 1UNKA 2GZJA 1DV5A 1YIJ1 3CCUZ 2KOPA 3NH4A 2KR5A 1Z6MA 1ZH1A 3IF8A 5FLXf 1VQ9Z 1X3OA 1VQ61 2LTEA 1SFOI 2AVAA 2LPKA 1VQ9P 2QNWA 1YI21 2W04A 1VQNZ 1Z02A 3CXCZ 2FADA 2FHSC 3G26A 1KRLA 1YJ9Z 3I4MI 1BXIA 4XROA 5IT9b 4DGLA 2FVEA 3I561 5KP8B 2OOYB 3VMHA 4PXHB 3PO3I 1YJ9P 2VPWA 1ZNVA 4U0EA 3NTEA 2OOXB 2QEX1 2GZGA 1NP6A 1YJWZ 4HKGA 1JWHC 2Z44A 1YIT1 3CCM1 1M1K2 2AYDA 2KG6A 3CQZI 3GCFA 1Y8CA 2O53A 2VPYA 1K83I 3CCEZ 7CEIA 3CCSZ 5F2NA 1VQMP 2KORA 3F3PC 4UHPB 2VPXA 3CCVZ 1QVGO 2JU1A 4NBBA 2LIWA 3CCJZ 4A3FI 3CCSP 2QA4P 1USPA 1YJNZ 5C4XI 1OR5A 2KWLA 3CCVP 2VUGA 3CCJP 4U0DA 5T67A 2JO0A 3OW2Y 2DE7A 3DS0A 3J80b 3G4SZ 4H2YC 1VQP1 1X0TA 1VKUA 1VLAA 4E2WA 2K0YA 1A8OA 2FVFA 1VQKZ 5LL6f 4E32A 1VQ71 2VPZA 1K731 1JJ2Z 2XV6A 3PO2I 2E1MA 1K732 3M3YI 4MRIA 1KC8Q 4Y52I 2M8NA 3DS4A 1IMPA 3G21A 1S72P
chains in the Genus database with same CATH topology
3T4NB 5IP9I 1Y1VI 1W2BY 2NVQI 1I3QI 2P3YA 3EERA 3MZLB 2EFJA 1VQLZ 3I55P 3JAMb 3G711 5A2Qb 4BY1I 4XFYA 1VQ51 3CMEZ 2BUOA 3HOUI 4BBRI 4X6AI 3HOYI 1VQLP 5D1OA 5HGMA 2E2JI 1WCMI 1WIIA 2V8IA 4U0FA 2V8KA 4NBGA 2Z45A 1TWHI 4MH4A 2DE5A 1YI2Z 2L6EA 1Z03A 3RG6C 3G6E1 3CCL1 3OW2Z 5BS2A 4NFRA 1M6NA 1Y1WI 3K7AI 3GTJI 3LUSA 1VQO1 2J6AA 4HGZA 4A3GI 4NBFA 4PH0A 1M1KQ 5F2KA 3CPWO 2NVXI 1EOQA 2DGYA 2R6MA 3RZOI 3CCQ1 3G0VA 4E2YA 1M901 3CC21 1M902 2PEJA 1W2BZ 1ML8A 1QVFO 3D6WA 4COPA 4A3DI 3CC4Z 4COCA 2JA6I 4QTUA 4MD8A 1M6EX 1RLYA 3NH5A 2JMOA 1K30A 3CC4P 3VRLC 1TWFI 2RIQA 5C44I 3MONA 3J80f 1D1DA 2GTIA 3KIFA 1YHQZ 3CCUP 3GTMI 3S14I 5I4TG 3GTGI 4PH1A 3HZQA 1JJ2Y 3GTLI 3I551 3G1IA 2G2KA 1KQSY 1YHQP 1TFIA 1Q7Y1 1K73Q 1VQ4Z 1DL6A 2LF4A 1K9M1 3GTPI 3M4OI 1VQNP 2RPRA 2GU2A 1Q7Y2 3CMA1 1K9M2 4HH4A 4BY7I 2HF1A 1VQ4P 3CC71 4A3MI 1ZMBA 2QKDA 2Q51A 4A3JI 4GR6A 1M1K1 4A3CI 2QR1B 3CCR1 2OTJ1 2PEIA 3ESWA 3MGEA 1YJWP 4NOZA 3G71Z 1X3ZA 3JAMf 1RO0A 5A2Qf 3DPHA 2PEKA 1TWAI 3CCEP 3BG0B 4NBHA 2E2II 3CXCO 3QWUA 2NVYI 4BXXI 1YJNP 1IUQA 3G6EZ 3CCLZ 2OTLZ 1TWCI 2PEMA 1TWGI 2CWOA 3NFZA 4TNUA 1QYPA 4NBCA 4NBDA 2QLVB 3G4SP 2OTLP 2PMZA 3J81f 3NH8A 1X3WA 1I50I 3GTOI 2EG5A 3U50C 2V8JA 3J7A4 3FKII 5F2OA 1KQSZ 1Q861 3WBHA 3CD6Z 1VQKP 5FLMI 1Q862 2PEQA 3HYBA 1PFTA 4HGYA 3GTQI 3CD6P 1YUKA 5HGOA 3I07A 1VQ91 1M90Q 3PO3S 1RO2A 4GR2A 2K5RA 3G29A 3Q87A 5T64A 1R9TI 2LIYA 3RZDI 1VQ8Z 5IP7I 4E31A 2E2HI 4E2XA 1YJ91 1VQ8P 5CM2M 1AUMA 1YIJZ 3S16I 2KI7B 2JA8I 1NJIQ 2RHBA 3CMEP 3DS2A 1JJ2O 1VQ6Z 1KQSO 4CL1A 1VQ6P 2XT1A 1ZB9A 1VQM1 1YI2P 2LFUA 2P28A 3I56Z 5IT9f 3CMAZ 1Q7YQ 3CCS1 4EWCA 2QA41 1K9MQ 4MXUA 3G28A 4A3BI 3CCV1 3I56P 3CCJ1 2QEXZ 4RVFA 3HOVI 1RO4A 2M6NA 1N8R2 1YITZ 1KD1Q 1QVGY 5C4JI 3CCMZ 2F4OA 2PEOA 2OTJZ 2QEXP 1Q812 3P05A 2AKLA 3P5JB 1ZB8A 3D9XA 3NDIA 3CCMP 2YU9I 3G4S1 2JUBA 1NUIA 3FQMA 2PK7A 2Z46A 5AN9F 2M8LA 1Y1VS 4QNBA 3H47A 1A43A 1M74A 2BJOA 3OW2O 2KODA 1QRJA 3DS1A 3S2HI 3NDJA 1S721 4NB8A 1NJI1 5D1PA 3IFUA 1NJI2 5HGLA 4RS4A 1VQPZ 3HOZI 3TE5B 2YADA 1RNIA 4NBEA 1VQPP 1S7MA 2R92I 2M8PA 1VQ7Z 4XRQA 4WYMA 3DS3A 1K8AQ 2JYGA 3S2DI 2EIAA 1VQL1 1VQ7P 1Q86Q 2JR6A 1W2BO 2Q4ZA 2EGTA 3GTKI 3HOWI 1KD11 2PENA 2IZ4A 2WAQA 3H0GI 1KD12 2XXMA 2W03A 2R93I 1Q82Q 2R7ZI 1QVGZ 4E2ZA 2VUMI 2QREB 3BG1B 2ONTA 1VQ5Z 3DS5A 2HU9A 2ZAEB 2RBLA 3H3VJ 3G71P 2JA7I 1VQ5P 3LRYA 1EIAA 2DE6A 1LQLA 1P9NA 3MZKB 2VF1A 1YUAA 3B5IA 1VQMZ 3HKZA 1QF8A 2GTHA 3VB9A 3G6EP 3CCLP 2QA4Z 3CPWY 4U0BA 2OZKA 1VQOZ 4NB9A 1K8A1 3VMGA 1K8A2 4MD7A 3GTMS 1VQOP 1N8RQ 3CC41 2E9HA 5HGNA 1RQFA 1USPB 2BHVA 2F4MA 2Y0SA 1Q81Q 1QVFY 3CCQZ 2P9XA 4IPYA 4A3LI 3CC2Z 3CCU1 5FLXb 4RVDA 3S1QI 1Q821 3CCQP 3VTNA 4XFXA 3KIHA 1Q822 3S1RI 1YHQ1 3CC2P 4A3KI 3S1NI 2PY8A 3H0DA 1BAJA 2QRCB 1VQN1 3GKQA 4RVHA 4A3EI 1S72Z 3VMIA 4XFZA 1VQ41 2QRDB 2JYLA 2B63I 3E2DA 1YIJP 4E30A 5BS1A 4Y7NI 4NH1C 1YJW1 3I55Z 3EEDA 2I3CA 4MD9A 3TDHB 3CCE1 3G1GA 2KPIA 4QTTA 4A93I 3S15I 5T6BA 3CC7Z 3CPWZ 3CMAP 4BBSI 1N8R1 2K3RA 1YJN1 3DTJA 4S1TA 3CC7P 5D1OB 1Q811 1WW9A 3CCRZ 2M48A 1Z01A 2O4HA 5DCKA 3CXCY 1QVFZ 1YITP 4U0AA 2NVTI 3CCRP 3S1MI 2OTJP 2OTL1 4NBAA 4DK1A 3J81b 3Q20A 2JA5I 2WB1A 2IZ3A 1VQK1 4E33A 2OARA 1KC81 3FQQA 1KC82 3CD61 1L1OC 5C3EI 1I6HI 3I4NI 4XX2A 2JS4A 3H4EA 2RT9A 4A3II 5JPAA 1N2FA 3M1MA 2H85A 4RVGA 3S17I 1E6JP 4DQYB 4U0CA 4MONA 3HOXI 3IX0A 4M0IA 4AYBA 4RV9A 1VQ81 2JNYA 3F3FC 2PM9A 3CME1 1YIJ1 3CCUZ 3NH4A 3IF8A 1ZH1A 5FLXf 1VQ9Z 1VQ61 1SFOI 1VQ9P 1YI21 2W04A 1VQNZ 1Z02A 3CXCZ 3G26A 1KRLA 1YJ9Z 3I4MI 4XROA 5IT9b 4DGLA 3I561 3VMHA 3PO3I 1YJ9P 4U0EA 3NTEA 2OOXB 2QEX1 1NP6A 1YJWZ 1JWHC 2Z44A 1YIT1 3CCM1 1M1K2 3CQZI 3GCFA 2O53A 1K83I 3CCEZ 3CCSZ 5F2NA 1VQMP 3F3PC 3CCVZ 4A3FI 1QVGO 4NBBA 3CCJZ 3CCSP 2QA4P 1USPA 1YJNZ 5C4XI 3CCVP 2VUGA 3CCJP 4U0DA 5T67A 2JO0A 3OW2Y 2DE7A 3DS0A 3J80b 3G4SZ 1VQP1 1X0TA 1VLAA 4E2WA 1A8OA 1VQKZ 5LL6f 4E32A 1VQ71 1K731 1JJ2Z 2XV6A 3PO2I 2E1MA 1K732 3M3YI 4MRIA 1KC8Q 4Y52I 2M8NA 3DS4A 2OOYB 3G21A 1S72P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO2 A;  3M1M A;  1RNI A;  1RO0 A; 
#chains in the Genus database with same CATH topology
 2GYK A;  3T4N B;  5IP9 I;  1Y1V I;  1W2B Y;  2NVQ I;  1I3Q I;  2P3Y A;  3EER A;  4NEO A;  3MZL B;  1DNY A;  2GDY A;  2EFJ A;  1VQL Z;  3I55 P;  3JAM b;  3G71 1;  5A2Q b;  4BY1 I;  4XFY A;  1VQ5 1;  3CME Z;  2BUO A;  3HOU I;  4BBR I;  2FQ0 A;  4X6A I;  3HOY I;  1VQL P;  5D1O A;  3U43 A;  1GPJ A;  5HGM A;  2E2J I;  1WCM I;  2JGP A;  1WII A;  2V8I A;  4U0F A;  2V8K A;  4NBG A;  2Z45 A;  2MY5 A;  1TWH I;  4MH4 A;  2DE5 A;  4H2W C;  1YI2 Z;  2L6E A;  1Z03 A;  3RG6 C;  3G6E 1;  3CCL 1;  3OW2 Z;  5BS2 A;  4NFR A;  2E7Z A;  5KP6 B;  1M6N A;  1Y1W I;  1UJZ A;  3K7A I;  3GTJ I;  1AYI A;  3LUS A;  1VQO 1;  2J6A A;  2XZ1 C;  4HGZ A;  4A3G I;  4DG9 A;  4NBF A;  2AFD A;  4PH0 A;  4H2X C;  2KW2 A;  1M1K Q;  5F2K A;  3CPW O;  2NVX I;  1EOQ A;  2JIQ A;  2DGY A;  2R6M A;  2AF8 A;  3CCQ 1;  3RZO I;  3G0V A;  4E2Y A;  1M90 1;  2FAE A;  2K0D X;  3GKL C;  3CC2 1;  2N6Z A;  1M90 2;  2PEJ A;  1W2B Z;  1MZ8 A;  1ML8 A;  2MVV A;  1QVF O;  3D6W A;  1L0I A;  1NQ4 A;  4COP A;  4F37 A;  4A3D I;  3CC4 Z;  4COC A;  2JA6 I;  2GZF A;  4QTU A;  4MD8 A;  1M6E X;  2L0Q A;  1RLY A;  1GXH A;  3NH5 A;  2JMO A;  1K30 A;  2KGE A;  3CC4 P;  3VRL C;  1TWF I;  1T8K A;  2MF4 A;  2RIQ A;  2JIM A;  5C44 I;  3MON A;  3J80 f;  2FAC A;  1D1D A;  2GTI A;  3KIF A;  3EJE A;  1YHQ Z;  3CCU P;  3GTM I;  3S14 I;  5I4T G;  3GTG I;  4PH1 A;  3HZQ A;  1JJ2 Y;  3GTL I;  3I55 1;  3G1I A;  2G2K A;  1KQS Y;  1YHQ P;  1TFI A;  1Q7Y 1;  1K73 Q;  1VQ4 Z;  1L0H A;  1DL6 A;  2LF4 A;  1K9M 1;  2JU2 A;  2K0X A;  3GTP I;  1VQN P;  2RPR A;  2GU2 A;  1Q7Y 2;  3CMA 1;  3M4O I;  1K9M 2;  4HH4 A;  4BY7 I;  2HF1 A;  1VQ4 P;  3CC7 1;  4A3M I;  1ZMB A;  2QKD A;  1SIW A;  2Q51 A;  4A3J I;  2MR7 A;  2VSQ A;  4GR6 A;  1M1K 1;  4A3C I;  1AF8 A;  2FQ1 A;  2KG8 A;  2QR1 B;  3CCR 1;  2OTJ 1;  2PEI A;  3ESW A;  3MGE A;  1YJW P;  4NOZ A;  3G71 Z;  1WJ2 A;  1X3Z A;  3JAM f;  1RO0 A;  5A2Q f;  4CA3 A;  3DPH A;  2PEK A;  1TWA I;  3CCE P;  3BG0 B;  5EJD A;  4NBH A;  2VLO A;  2E2I I;  1IMQ A;  3CXC O;  2KGD A;  3QWU A;  3GZL A;  2GDX A;  2NVY I;  4BXX I;  1YJN P;  1IUQ A;  4MRT C;  3G6E Z;  3CCL Z;  2L4B A;  2OTL Z;  1TWC I;  2PEM A;  1TWG I;  2CWO A;  3NFZ A;  4TNU A;  1QYP A;  1EMV A;  4NBC A;  5CZD B;  4NBD A;  4PWV B;  2VLQ A;  2QLV B;  3G4S P;  2OTL P;  2PMZ A;  2JBG A;  3J81 f;  3NH8 A;  1X3W A;  1HY8 A;  2K5X A;  1I50 I;  3GTO I;  2EG5 A;  3U50 C;  1AA6 A;  2V8J A;  3J7A 4;  5F2O A;  3FKI I;  1KQS Z;  1Q86 1;  3WBH A;  3CD6 Z;  1VQK P;  5FLM I;  1Q86 2;  1QVF Y;  2PEQ A;  3HYB A;  1PFT A;  4HGY A;  3GTQ I;  3CD6 P;  2KOS A;  2GZE A;  1YUK A;  5HGO A;  2VLP A;  2M5R A;  3I07 A;  1VQ9 1;  1M90 Q;  3PO3 S;  1RO2 A;  4GR2 A;  2K5R A;  2GZI A;  3G29 A;  3Q87 A;  5T64 A;  2K2Q A;  1R9T I;  2LIY A;  3RZD I;  1VQ8 Z;  5IP7 I;  4E31 A;  1GXG A;  2E2H I;  4E2X A;  1YJ9 1;  1VQ8 P;  5CM2 M;  1AUM A;  1YIJ Z;  3S16 I;  2N98 A;  2KI7 B;  2NAP A;  2JA8 I;  1Q16 A;  1NJI Q;  2RHB A;  3CME P;  3DS2 A;  1FDO A;  2KG9 A;  1JJ2 O;  1VQ6 Z;  1KQS O;  3RG2 A;  5HV8 A;  4CL1 A;  1VQ6 P;  2XT1 A;  1ZB9 A;  3IR7 A;  2CGQ A;  1VQM 1;  2JQ4 A;  1YI2 P;  2LFU A;  2P28 A;  1HQB A;  3I56 Z;  5IT9 f;  3CMA Z;  1Q7Y Q;  3CCS 1;  4EWC A;  2QA4 1;  2LML A;  1K9M Q;  4MXU A;  3G28 A;  4A3B I;  2V3V A;  3CCV 1;  3I56 P;  3CCJ 1;  2QEX Z;  4RVF A;  3HOV I;  1RO4 A;  2M6N A;  1N8R 2;  1YIT Z;  1KD1 Q;  1QVG Y;  5C4J I;  3CCM Z;  2F4O A;  2PEO A;  2OTJ Z;  2QEX P;  1Q81 2;  3P05 A;  2AKL A;  3P5J B;  3LMO A;  1ZB8 A;  3D9X A;  3NDI A;  3CCM P;  2YU9 I;  3G4S 1;  2JUB A;  1NUI A;  1QXF A;  3FQM A;  2PK7 A;  2Z46 A;  5AN9 F;  2CQ8 A;  2M8L A;  2LKI A;  1Y1V S;  4QNB A;  3H47 A;  1A43 A;  1M74 A;  2BJO A;  3OW2 O;  2KOD A;  2MD9 A;  1QRJ A;  3DS1 A;  3S2H I;  2DNW A;  3NDJ A;  4NB8 A;  1S72 1;  1NJI 1;  5D1P A;  3CE7 A;  3IFU A;  2LEX A;  1NJI 2;  5HGL A;  4RS4 A;  1VQP Z;  2LIU A;  3HOZ I;  3TE5 B;  2YAD A;  1RNI A;  4NBE A;  1VQP P;  1S7M A;  2R92 I;  2M8P A;  3D2L A;  2PNG A;  1VQ7 Z;  4XRQ A;  4WYM A;  1KLP A;  3DS3 A;  4IZ6 A;  1K8A Q;  2X2B A;  2JYG A;  3S2D I;  2EIA A;  1VQL 1;  1VQ7 P;  1Q86 Q;  2JR6 A;  3GJN A;  2FQ2 A;  1W2B O;  2Q4Z A;  2EGT A;  3GTK I;  3HOW I;  2JB0 A;  1KD1 1;  4QKO A;  2PEN A;  2IZ4 A;  2WAQ A;  3H0G I;  1KD1 2;  2XXM A;  2W03 A;  2R93 I;  1Q82 Q;  2R7Z I;  1QVG Z;  4E2Z A;  2VUM I;  2QRE B;  3BG1 B;  2ONT A;  1VQ5 Z;  3DS5 A;  2HU9 A;  2ZAE B;  2RBL A;  3H3V J;  3G71 P;  2JA7 I;  1VQ5 P;  1ACP A;  3LRY A;  2GDW A;  1EIA A;  2DE6 A;  1LQL A;  1P9N A;  3MZK B;  2JIO A;  2VF1 A;  5KP7 B;  1YUA A;  3B5I A;  1VQM Z;  2MR8 A;  3HKZ A;  1QF8 A;  2N5I A;  2GTH A;  3VB9 A;  3G6E P;  3CCL P;  4BPH A;  2XZ0 D;  2VLN A;  2QA4 Z;  3CPW Y;  4U0B A;  2OZK A;  1VQO Z;  4NB9 A;  1K8A 1;  3VMG A;  1K8A 2;  2V45 A;  4MD7 A;  3GTM S;  2EHT A;  2N6Y A;  1VQO P;  1N8R Q;  3CC4 1;  2E9H A;  5HGN A;  2KOQ A;  4R0M A;  2BHV A;  2JAZ A;  1RQF A;  1Q81 Q;  1USP B;  2F4M A;  5EW5 E;  2Y0S A;  3CCQ Z;  2AFE A;  2P9X A;  4IPY A;  2KGC A;  4A3L I;  3CC2 Z;  3CCU 1;  5FLX b;  4RVD A;  3S1Q I;  1Q82 1;  3CCQ P;  3VTN A;  4XFX A;  2NO8 A;  3KIH A;  1Q82 2;  3S1R I;  1YHQ 1;  3CC2 P;  2JIP A;  2K94 A;  4A3K I;  2CG5 B;  2PY8 A;  3H0D A;  3S1N I;  1BAJ A;  2LL8 A;  2QRC B;  3B4Q A;  1VQN 1;  3GKQ A;  4RVH A;  4A3E I;  1S72 Z;  2KOO A;  3VMI A;  4XFZ A;  1VQ4 1;  2EHS A;  2QRD B;  2JYL A;  2B63 I;  3E2D A;  1YIJ P;  4E30 A;  1E0H A;  5BS1 A;  2LOL A;  4BPF A;  4Y7N I;  1FDI A;  4NH1 C;  5HVC A;  1YJW 1;  3I55 Z;  3EED A;  2I3C A;  2K93 A;  4MD9 A;  3TDH B;  2FVA A;  1FR2 A;  3CCE 1;  3G1G A;  2KPI A;  4QTT A;  4A93 I;  3S15 I;  5T6B A;  3CC7 Z;  3CPW Z;  3CMA P;  4BBS I;  1N8R 1;  1F80 D;  2K3R A;  1YJN 1;  3DTJ A;  4S1T A;  3CC7 P;  5D1O B;  1Q81 1;  1WW9 A;  3CCR Z;  2M48 A;  1Z01 A;  2CNR A;  2O4H A;  2IV2 X;  5DCK A;  3CXC Y;  1QVF Z;  1YIT P;  4U0A A;  2NVT I;  3CCR P;  3S1M I;  2WPT A;  2OTJ P;  2OTL 1;  2ROQ A;  4BPG A;  4NBA A;  1VHN A;  2ERH A;  4DK1 A;  3J81 b;  3Q20 A;  2JA5 I;  2WB1 A;  2KGA A;  2IZ3 A;  1VQK 1;  2JIR A;  2L9F A;  4E33 A;  2N50 A;  2OAR A;  1KC8 1;  3FQQ A;  1CEI A;  2MVU A;  3EJD A;  1KC8 2;  3CD6 1;  1L1O C;  3NY7 B;  5C3E I;  3EJB A;  1WZN A;  1I6H I;  3I4N I;  4XX2 A;  2JS4 A;  3H4E A;  2RT9 A;  4A3I I;  5JPA A;  1N2F A;  3M1M A;  2H85 A;  2L22 A;  4RVG A;  3GZM A;  3S17 I;  1E6J P;  4DQY B;  2K92 A;  4U0C A;  4MON A;  3HOX I;  3IX0 A;  4M0I A;  4AYB A;  4RV9 A;  1VQ8 1;  2N5H A;  2JNY A;  3F3F C;  2PM9 A;  3CME 1;  1UNK A;  2GZJ A;  1DV5 A;  1YIJ 1;  3CCU Z;  2KOP A;  3NH4 A;  2KR5 A;  1Z6M A;  1ZH1 A;  3IF8 A;  5FLX f;  1VQ9 Z;  1X3O A;  1VQ6 1;  2LTE A;  1SFO I;  2AVA A;  2LPK A;  1VQ9 P;  2QNW A;  1YI2 1;  2W04 A;  1VQN Z;  1Z02 A;  3CXC Z;  2FAD A;  2FHS C;  3G26 A;  1KRL A;  1YJ9 Z;  3I4M I;  1BXI A;  4XRO A;  5IT9 b;  4DGL A;  2FVE A;  3I56 1;  5KP8 B;  2OOY B;  3VMH A;  4PXH B;  3PO3 I;  1YJ9 P;  2VPW A;  1ZNV A;  4U0E A;  3NTE A;  2OOX B;  2QEX 1;  2GZG A;  1NP6 A;  1YJW Z;  4HKG A;  1JWH C;  2Z44 A;  1YIT 1;  3CCM 1;  1M1K 2;  2AYD A;  2KG6 A;  3CQZ I;  3GCF A;  1Y8C A;  2O53 A;  2VPY A;  1K83 I;  3CCE Z;  7CEI A;  3CCS Z;  5F2N A;  1VQM P;  2KOR A;  3F3P C;  4UHP B;  2VPX A;  3CCV Z;  1QVG O;  2JU1 A;  4NBB A;  2LIW A;  3CCJ Z;  4A3F I;  3CCS P;  2QA4 P;  1USP A;  1YJN Z;  5C4X I;  1OR5 A;  2KWL A;  3CCV P;  2VUG A;  3CCJ P;  4U0D A;  5T67 A;  2JO0 A;  3OW2 Y;  2DE7 A;  3DS0 A;  3J80 b;  3G4S Z;  4H2Y C;  1VQP 1;  1X0T A;  1VKU A;  1VLA A;  4E2W A;  2K0Y A;  1A8O A;  2FVF A;  1VQK Z;  5LL6 f;  4E32 A;  1VQ7 1;  2VPZ A;  1K73 1;  1JJ2 Z;  2XV6 A;  3PO2 I;  2E1M A;  1K73 2;  3M3Y I;  4MRI A;  1KC8 Q;  4Y52 I;  2M8N A;  3DS4 A;  1IMP A;  3G21 A;  1S72 P; 
#chains in the Genus database with same CATH homology
 3T4N B;  5IP9 I;  1Y1V I;  1W2B Y;  2NVQ I;  1I3Q I;  2P3Y A;  3EER A;  3MZL B;  2EFJ A;  1VQL Z;  3I55 P;  3JAM b;  3G71 1;  5A2Q b;  4BY1 I;  4XFY A;  1VQ5 1;  3CME Z;  2BUO A;  3HOU I;  4BBR I;  4X6A I;  3HOY I;  1VQL P;  5D1O A;  5HGM A;  2E2J I;  1WCM I;  1WII A;  2V8I A;  4U0F A;  2V8K A;  4NBG A;  2Z45 A;  1TWH I;  4MH4 A;  2DE5 A;  1YI2 Z;  2L6E A;  1Z03 A;  3RG6 C;  3G6E 1;  3CCL 1;  3OW2 Z;  5BS2 A;  4NFR A;  1M6N A;  1Y1W I;  3K7A I;  3GTJ I;  3LUS A;  1VQO 1;  2J6A A;  4HGZ A;  4A3G I;  4NBF A;  4PH0 A;  1M1K Q;  5F2K A;  3CPW O;  2NVX I;  1EOQ A;  2DGY A;  2R6M A;  3RZO I;  3CCQ 1;  3G0V A;  4E2Y A;  1M90 1;  3CC2 1;  1M90 2;  2PEJ A;  1W2B Z;  1ML8 A;  1QVF O;  3D6W A;  4COP A;  4A3D I;  3CC4 Z;  4COC A;  2JA6 I;  4QTU A;  4MD8 A;  1M6E X;  1RLY A;  3NH5 A;  2JMO A;  1K30 A;  3CC4 P;  3VRL C;  1TWF I;  2RIQ A;  5C44 I;  3MON A;  3J80 f;  1D1D A;  2GTI A;  3KIF A;  1YHQ Z;  3CCU P;  3GTM I;  3S14 I;  5I4T G;  3GTG I;  4PH1 A;  3HZQ A;  1JJ2 Y;  3GTL I;  3I55 1;  3G1I A;  2G2K A;  1KQS Y;  1YHQ P;  1TFI A;  1Q7Y 1;  1K73 Q;  1VQ4 Z;  1DL6 A;  2LF4 A;  1K9M 1;  3GTP I;  3M4O I;  1VQN P;  2RPR A;  2GU2 A;  1Q7Y 2;  3CMA 1;  1K9M 2;  4HH4 A;  4BY7 I;  2HF1 A;  1VQ4 P;  3CC7 1;  4A3M I;  1ZMB A;  2QKD A;  2Q51 A;  4A3J I;  4GR6 A;  1M1K 1;  4A3C I;  2QR1 B;  3CCR 1;  2OTJ 1;  2PEI A;  3ESW A;  3MGE A;  1YJW P;  4NOZ A;  3G71 Z;  1X3Z A;  3JAM f;  1RO0 A;  5A2Q f;  3DPH A;  2PEK A;  1TWA I;  3CCE P;  3BG0 B;  4NBH A;  2E2I I;  3CXC O;  3QWU A;  2NVY I;  4BXX I;  1YJN P;  1IUQ A;  3G6E Z;  3CCL Z;  2OTL Z;  1TWC I;  2PEM A;  1TWG I;  2CWO A;  3NFZ A;  4TNU A;  1QYP A;  4NBC A;  4NBD A;  2QLV B;  3G4S P;  2OTL P;  2PMZ A;  3J81 f;  3NH8 A;  1X3W A;  1I50 I;  3GTO I;  2EG5 A;  3U50 C;  2V8J A;  3J7A 4;  3FKI I;  5F2O A;  1KQS Z;  1Q86 1;  3WBH A;  3CD6 Z;  1VQK P;  5FLM I;  1Q86 2;  2PEQ A;  3HYB A;  1PFT A;  4HGY A;  3GTQ I;  3CD6 P;  1YUK A;  5HGO A;  3I07 A;  1VQ9 1;  1M90 Q;  3PO3 S;  1RO2 A;  4GR2 A;  2K5R A;  3G29 A;  3Q87 A;  5T64 A;  1R9T I;  2LIY A;  3RZD I;  1VQ8 Z;  5IP7 I;  4E31 A;  2E2H I;  4E2X A;  1YJ9 1;  1VQ8 P;  5CM2 M;  1AUM A;  1YIJ Z;  3S16 I;  2KI7 B;  2JA8 I;  1NJI Q;  2RHB A;  3CME P;  3DS2 A;  1JJ2 O;  1VQ6 Z;  1KQS O;  4CL1 A;  1VQ6 P;  2XT1 A;  1ZB9 A;  1VQM 1;  1YI2 P;  2LFU A;  2P28 A;  3I56 Z;  5IT9 f;  3CMA Z;  1Q7Y Q;  3CCS 1;  4EWC A;  2QA4 1;  1K9M Q;  4MXU A;  3G28 A;  4A3B I;  3CCV 1;  3I56 P;  3CCJ 1;  2QEX Z;  4RVF A;  3HOV I;  1RO4 A;  2M6N A;  1N8R 2;  1YIT Z;  1KD1 Q;  1QVG Y;  5C4J I;  3CCM Z;  2F4O A;  2PEO A;  2OTJ Z;  2QEX P;  1Q81 2;  3P05 A;  2AKL A;  3P5J B;  1ZB8 A;  3D9X A;  3NDI A;  3CCM P;  2YU9 I;  3G4S 1;  2JUB A;  1NUI A;  3FQM A;  2PK7 A;  2Z46 A;  5AN9 F;  2M8L A;  1Y1V S;  4QNB A;  3H47 A;  1A43 A;  1M74 A;  2BJO A;  3OW2 O;  2KOD A;  1QRJ A;  3DS1 A;  3S2H I;  3NDJ A;  1S72 1;  4NB8 A;  1NJI 1;  5D1P A;  3IFU A;  1NJI 2;  5HGL A;  4RS4 A;  1VQP Z;  3HOZ I;  3TE5 B;  2YAD A;  1RNI A;  4NBE A;  1VQP P;  1S7M A;  2R92 I;  2M8P A;  1VQ7 Z;  4XRQ A;  4WYM A;  3DS3 A;  1K8A Q;  2JYG A;  3S2D I;  2EIA A;  1VQL 1;  1VQ7 P;  1Q86 Q;  2JR6 A;  1W2B O;  2Q4Z A;  2EGT A;  3GTK I;  3HOW I;  1KD1 1;  2PEN A;  2IZ4 A;  2WAQ A;  3H0G I;  1KD1 2;  2XXM A;  2W03 A;  2R93 I;  1Q82 Q;  2R7Z I;  1QVG Z;  4E2Z A;  2VUM I;  2QRE B;  3BG1 B;  2ONT A;  1VQ5 Z;  3DS5 A;  2HU9 A;  2ZAE B;  2RBL A;  3H3V J;  3G71 P;  2JA7 I;  1VQ5 P;  3LRY A;  1EIA A;  2DE6 A;  1LQL A;  1P9N A;  3MZK B;  2VF1 A;  1YUA A;  3B5I A;  1VQM Z;  3HKZ A;  1QF8 A;  2GTH A;  3VB9 A;  3G6E P;  3CCL P;  2QA4 Z;  3CPW Y;  4U0B A;  2OZK A;  1VQO Z;  4NB9 A;  1K8A 1;  3VMG A;  1K8A 2;  4MD7 A;  3GTM S;  1VQO P;  1N8R Q;  3CC4 1;  2E9H A;  5HGN A;  1RQF A;  1USP B;  2BHV A;  2F4M A;  2Y0S A;  1Q81 Q;  1QVF Y;  3CCQ Z;  2P9X A;  4IPY A;  4A3L I;  3CC2 Z;  3CCU 1;  5FLX b;  4RVD A;  3S1Q I;  1Q82 1;  3CCQ P;  3VTN A;  4XFX A;  3KIH A;  1Q82 2;  3S1R I;  1YHQ 1;  3CC2 P;  4A3K I;  3S1N I;  2PY8 A;  3H0D A;  1BAJ A;  2QRC B;  1VQN 1;  3GKQ A;  4RVH A;  4A3E I;  1S72 Z;  3VMI A;  4XFZ A;  1VQ4 1;  2QRD B;  2JYL A;  2B63 I;  3E2D A;  1YIJ P;  4E30 A;  5BS1 A;  4Y7N I;  4NH1 C;  1YJW 1;  3I55 Z;  3EED A;  2I3C A;  4MD9 A;  3TDH B;  3CCE 1;  3G1G A;  2KPI A;  4QTT A;  4A93 I;  3S15 I;  5T6B A;  3CC7 Z;  3CPW Z;  3CMA P;  4BBS I;  1N8R 1;  2K3R A;  1YJN 1;  3DTJ A;  4S1T A;  3CC7 P;  5D1O B;  1Q81 1;  1WW9 A;  3CCR Z;  2M48 A;  1Z01 A;  2O4H A;  5DCK A;  3CXC Y;  1QVF Z;  1YIT P;  4U0A A;  2NVT I;  3CCR P;  3S1M I;  2OTJ P;  2OTL 1;  4NBA A;  4DK1 A;  3J81 b;  3Q20 A;  2JA5 I;  2WB1 A;  2IZ3 A;  1VQK 1;  4E33 A;  2OAR A;  1KC8 1;  3FQQ A;  1KC8 2;  3CD6 1;  1L1O C;  5C3E I;  1I6H I;  3I4N I;  4XX2 A;  2JS4 A;  3H4E A;  2RT9 A;  4A3I I;  5JPA A;  1N2F A;  3M1M A;  2H85 A;  4RVG A;  3S17 I;  1E6J P;  4DQY B;  4U0C A;  4MON A;  3HOX I;  3IX0 A;  4M0I A;  4AYB A;  4RV9 A;  1VQ8 1;  2JNY A;  3F3F C;  2PM9 A;  3CME 1;  1YIJ 1;  3CCU Z;  3NH4 A;  3IF8 A;  1ZH1 A;  5FLX f;  1VQ9 Z;  1VQ6 1;  1SFO I;  1VQ9 P;  1YI2 1;  2W04 A;  1VQN Z;  1Z02 A;  3CXC Z;  3G26 A;  1KRL A;  1YJ9 Z;  3I4M I;  4XRO A;  5IT9 b;  4DGL A;  3I56 1;  3VMH A;  3PO3 I;  1YJ9 P;  4U0E A;  3NTE A;  2OOX B;  2QEX 1;  1NP6 A;  1YJW Z;  1JWH C;  2Z44 A;  1YIT 1;  3CCM 1;  1M1K 2;  3CQZ I;  3GCF A;  2O53 A;  1K83 I;  3CCE Z;  3CCS Z;  5F2N A;  1VQM P;  3F3P C;  3CCV Z;  4A3F I;  1QVG O;  4NBB A;  3CCJ Z;  3CCS P;  2QA4 P;  1USP A;  1YJN Z;  5C4X I;  3CCV P;  2VUG A;  3CCJ P;  4U0D A;  5T67 A;  2JO0 A;  3OW2 Y;  2DE7 A;  3DS0 A;  3J80 b;  3G4S Z;  1VQP 1;  1X0T A;  1VLA A;  4E2W A;  1A8O A;  1VQK Z;  5LL6 f;  4E32 A;  1VQ7 1;  1K73 1;  1JJ2 Z;  2XV6 A;  3PO2 I;  2E1M A;  1K73 2;  3M3Y I;  4MRI A;  1KC8 Q;  4Y52 I;  2M8N A;  3DS4 A;  2OOY B;  3G21 A;  1S72 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...