1RO0A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m semet remote
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords ORF904
total genus 61
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro0A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro0A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro0A02
3M1MA 1RO2A 1RO0A 1RNIA
chains in the Genus database with same CATH superfamily
3VRLC 2FQ0A 4E31A 2E9HA 4AYBA 2LKIA 2M5RA 4XROA 1YJWZ 3RG2A 4HGYA 2GZGA 1FDOA 1YUAA 3P5JB 4A93I 2M8LA 2QA41 3BG0B 4A3II 1Q16A 4MD7A 4H2YC 3GTOI 4CL1A 2F4MA 3T4NB 1VQ51 2K5RA 2KG9A 2KWLA 4BPHA 3CC21 4A3BI 1SFOI 4A3GI 2MVVA 3CCM1 4NEOA 3CCEP 1K8A1 2LF4A 3G21A 4H2WC 2E7ZA 1K8AQ 5D1OA 3I4MI 1X3WA 3G71Z 2EHSA 5HGMA 2ONTA 4A3LI 2XV6A 3G4SZ 2PEKA 1ACPA 1YIJZ 1X3ZA 1TWFI 2W03A 1YITP 1IUQA 1K9M2 2VSQA 2QREB 3CCRP 2RT9A 4BY1I 1I3QI 4XFZA 4MONA 2KGCA 1S7MA 1VQ9Z 1X3OA 1VQK1 1Y1VI 1VQ91 3PO3I 2FADA 1Q822 1DNYA 3GTLI 3H3VJ 2PEMA 3DTJA 2MR8A 2O4HA 2PK7A 2KOOA 1S72P 3FKII 2O53A 3HZQA 2DE7A 2JBGA 1KQSY 2FQ2A 1N8RQ 4A3JI 2V8KA 1YIT1 1QVGO 2BJOA 4NBHA 5EW5E 2KOQA 1VQL1 2R7ZI 2KGAA 1MZ8A 3I55P 1JWHC 4E2ZA 2L4BA 2PY8A 4X6AI 3CCQP 2AF8A 2MD9A 2EGTA 4E2WA 1ZMBA 2KPIA 5KP7B 3NH4A 1VQKZ 2LMLA 4NFRA 2OTLP 3CCL1 5HGNA 3CCJP 1I50I 3D6WA 5HGOA 4E2YA 1EMVA 4NH1C 1NUIA 5BS2A 4U0BA 2WB1A 2VLNA 3KIHA 2VPYA 4NBEA 1Y1VS 2OTJZ 4XFYA 5FLXb 1Q811 2I3CA 2VLQA 5D1PA 1YHQ1 3G1GA 4DG9A 1YHQZ 4DQYB 2K5XA 3OW2O 1WW9A 4NB9A 5T6BA 1OR5A 1TWCI 2VPWA 2V45A 3D2LA 3CD6Z 2Q51A 1M1K1 1N8R1 3QWUA 3GTQI 2J6AA 4Y7NI 4QTTA 4PWVB 2QR1B 1EIAA 2K0DX 1P9NA 2AYDA 3CCV1 1VQN1 1VQNP 3EJDA 1LQLA 1K8A2 2V8IA 3J80b 4A3FI 3IFUA 1RQFA 4RVDA 2JIPA 1QVGY 1T8KA 4WYMA 2R92I 5IP7I 3HKZA 4R0MA 1VQMZ 4NBFA 2MY5A 3CMEP 2GU2A 1VQ7P 1YJ9Z 1VQ71 3S17I 5A2Qf 3JAMb 4COPA 2QKDA 2IZ3A 4MD9A 2JA7I 1VQ8Z 4A3EI 2FVEA 3M3YI 2KODA 2H85A 3B4QA 2PENA 2L6EA 2M8PA 3GZMA 2JYLA 4E2XA 4F37A 1NJI2 3HOYI 4H2XC 1VQO1 2PMZA 3JAMf 2GYKA 3CCMZ 1Z01A 3RZDI 2JR6A 2N98A 5EJDA 1USPA 1EOQA 2VUGA 1Q7Y1 3CCS1 3F3FC 3VTNA 4U0CA 3H4EA 1WCMI 5FLMI 3RG6C 5T67A 1YJNZ 1N8R2 1YJW1 2OOXB 2N6ZA 1ML8A 5KP8B 4NBGA 2EFJA 2VLPA 2JA8I 2LFUA 2KOPA 3DS1A 3P05A 1NJI1 4QKOA 1A43A 3S1NI 4DK1A 1QVFY 2P3YA 1VQ4Z 1ZB8A 2JA6I 3CC7P 1AUMA 1NQ4A 1YUKA 1Q7Y2 3CMAZ 4QNBA 1KC8Q 3OW2Y 3G29A 1RNIA 2QEXZ 2EG5A 4M0IA 5C4JI 3CCLZ 1YITZ 3LUSA 2GZFA 1VQ61 2K93A 4RVHA 2PEJA 2E2HI 3S16I 2NO8A 3CCMP 2R6MA 5CM2M 3G1IA 3CC71 2KORA 4U0EA 1KRLA 4EWCA 1VQMP 3HOXI 2JB0A 2FVAA 2KGDA 1K9M1 2M48A 2P28A 1GXGA 3CCE1 5F2NA 3G4SP 4NBCA 4A3KI 2VLOA 2KGEA 2QRCB 4U0AA 1NP6A 4RVGA 1R9TI 1WZNA 1L0IA 1VQ81 2PEIA 3NH8A 1QVGZ 2LL8A 3CMEZ 3I56P 4BY7I 2EHTA 3WBHA 2JAZA 4MRIA 3G6EZ 3CME1 1W2BO 1VQ5Z 1VQOZ 5CZDB 2GTIA 1KLPA 1KQSO 1BAJA 5IT9b 3VMHA 4NB8A 2JUBA 5IP9I 1Y8CA 2Z44A 4A3CI 1KC81 4BXXI 4A3MI 2JQ4A 1KC82 3S1MI 4RS4A 1QXFA 1K732 3G4S1 3S14I 4IPYA 1JJ2Y 2N6YA 5HV8A 1VQ5P 2CNRA 2JNYA 5BS1A 1K9MQ 1IMQA 2FHSC 2QA4P 5IT9f 1N2FA 3EJEA 2PEQA 2LEXA 3NDJA 4NBBA 3ESWA 2MVUA 3S2HI 1F80D 4BPGA 1D1DA 5KP6B 3I56Z 3J81f 1VQ6Z 5HGLA 2FQ1A 4NBDA 3VB9A 2CWOA 2Y0SA 1Q821 3IF8A 3GTGI 2X2BA 1YJN1 2Z45A 1VQ8P 3PO2I 2V8JA 3HOUI 5D1OB 2OTL1 2F4OA 2XZ0D 2L22A 3NTEA 3NDIA 2L9FA 1VQLP 1USPB 3CCSZ 2VPXA 1Q861 1KD12 3G71P 4PXHB 2R93I 3IX0A 4MH4A 1Z02A 2M8NA 2JMOA 1VQM1 3VMIA 1VHNA 2MR7A 3NFZA 3CPWO 2N5HA 1TWGI 1PFTA 2JIOA 3HOZI 1AYIA 1WJ2A 2HF1A 1Q812 3M1MA 3CC2P 3KIFA 4A3DI 4HH4A 1AA6A 1Z6MA 2GZIA 4E32A 3CQZI 2LIWA 3DS0A 1VQ9P 1M74A 1SIWA 1VQLZ 3U50C 2QRDB 2EIAA 1JJ2O 1UNKA 2MF4A 3I551 3CCR1 3CCJ1 1K73Q 1RO4A 4S1TA 3I55Z 1I6HI 1M1K2 5F2KA 2K2QA 2NVQI 1M902 3S1RI 5I4TG 1Q82Q 4QTUA 2FVFA 1DL6A 3FQMA 1YI21 1KQSZ 2DNWA 4PH0A 3CCUZ 2AKLA 3K7AI 1FR2A 1S721 1W2BZ 1QVFZ 2E2II 2NVYI 3CXCO 3F3PC 1W2BY 4BPFA 4IZ6A 1AF8A 2RPRA 3HOWI 2PEOA 2OTJ1 3GTMS 2OZKA 3GTMI 2JA5I 4U0FA 2GDWA 2LIUA 2ZAEB 2RBLA 3VMGA 2B63I 1QRJA 1QF8A 4E30A 3TE5B 4MD8A 4PH1A 5JPAA 3G6EP 2DE5A 4U0DA 1X0TA 1A8OA 2XXMA 3H0DA 3I4NI 2BHVA 1Z03A 2FACA 2NAPA 2L0QA 3BG1B 2JIMA 1K30A 7CEIA 1RO2A 2QLVB 3CCSP 2LTEA 3CCVZ 2E2JI 1TWAI 3HOVI 1TWHI 2KG6A 1VLAA 2NVTI 3GJNA 1VQOP 3CCVP 3CCUP 2DGYA 3GTPI 2JYGA 1GXHA 3G28A 1QVFO 1Y1WI 1YJ91 2Z46A 5LL6f 2KW2A 1VQPZ 3GKLC 2AVAA 3GZLA 1GPJA 1S72Z 1Q86Q 2ROQA 2GTHA 3G6E1 4Y52I 3EEDA 2JS4A 2N50A 5F2OA 2DE6A 2KOSA 2OOYB 1YHQP 3CXCY 4GR2A 4NOZA 1YJ9P 3CPWZ 2CQ8A 2KG8A 1VQ7Z 1VQNZ 3M4OI 3I561 1IMPA 3D9XA 3CCRZ 2JIRA 3CMA1 2AFDA 2ERHA 2FAEA 1VQKP 1YIJ1 1M901 3TDHB 3EERA 3MZKB 3GKQA 2JIQA 5T64A 3CCLP 1JJ2Z 2K0YA 2E1MA 2GDYA 2W04A 3GCFA 3J81b 2K3RA 2QNWA 2LIYA 3NY7B 4NBAA 3CCQ1 2CGQA 3Q20A 2YU9I 1VQ6P 1VQ4P 2WAQA 1Q7YQ 3CE7A 3U43A 4BBSI 1VQP1 3FQQA 1HQBA 1K731 2KI7B 2HU9A 4MRTC 2QEXP 1VQPP 4MXUA 3CXCZ 5DCKA 2GDXA 5C4XI 3Q87A 1QYPA 1VQ41 1L0HA 3CC2Z 1L1OC 3CC7Z 2N5IA 3NH5A 1E0HA 3J7A4 3E2DA 1E6JP 3GTKI 1K83I 2QEX1 1RLYA 5HVCA 4HKGA 3CC4P 1Q81Q 3G0VA 1WIIA 3G26A 2RIQA 1TFIA 2IV2X 2XT1A 2VUMI 3S2DI 2WPTA 2K0XA 3DS4A 1ZH1A 2YADA 4BBRI 3PO3S 2M6NA 3H47A 2LPKA 2BUOA 4CA3A 2OARA 1YJWP 2JU2A 2P9XA 4UHPB 2VF1A 3OW2Z 1M6NA 3B5IA 1YI2P 3GTJI 3LMOA 3CCJZ 1KD1Q 5FLXf 1YJNP 3DS5A 2KR5A 3CC4Z 3G711 3DS3A 3DPHA 3LRYA 3RZOI 1ZNVA 3DS2A 5A2Qb 3HYBA 1M6EX 2XZ1C 3CCU1 1DV5A 1RO0A 3MZLB 2JGPA 5AN9F 1NJIQ 1BXIA 2JU1A 5C3EI 2G2KA 4E33A 3S1QI 5C44I 2PM9A 1UJZA 4HGZA 4XX2A 3CCEZ 4RVFA 3IR7A 2GZJA 2K92A 1M90Q 3H0GI 4DGLA 2LOLA 2PNGA 2QA4Z 1VKUA 2NVXI 3EJBA 4RV9A 2IZ4A 3MONA 2K94A 3I07A 1ZB9A 2AFEA 1HY8A 4XFXA 2Q4ZA 1M1KQ 1CEIA 1YIJP 4TNUA 3MGEA 1Q862 1KD11 3CD61 3CD6P 2OTLZ 3S15I 2JO0A 3CPWY 3CMAP 2RHBA 2GZEA 4GR6A 4COCA 2V3VA 1FDIA 2VPZA 3J80f 2CG5B 3CC41 1YI2Z 2OTJP 3CCQZ 4XRQA
chains in the Genus database with same CATH topology
3VRLC 4E31A 2E9HA 4AYBA 4XROA 1YJWZ 4HGYA 1YUAA 3P5JB 4A93I 2M8LA 2QA41 3BG0B 4A3II 4MD7A 3GTOI 4CL1A 2F4MA 3T4NB 1VQ51 2K5RA 3CC21 4A3BI 1SFOI 4A3GI 3CCM1 3CCEP 1K8A1 2LF4A 3G21A 1K8AQ 5D1OA 3I4MI 1X3WA 3G71Z 5HGMA 2ONTA 4A3LI 2XV6A 3G4SZ 2PEKA 1YIJZ 1X3ZA 1TWFI 2W03A 1YITP 1IUQA 1K9M2 2QREB 3CCRP 2RT9A 4BY1I 1I3QI 4XFZA 4MONA 1VQ9Z 1S7MA 1VQK1 1Y1VI 1VQ91 3PO3I 1Q822 3GTLI 3H3VJ 2PEMA 3DTJA 2O4HA 2PK7A 1S72P 3FKII 2O53A 3HZQA 2DE7A 1KQSY 1N8RQ 4A3JI 2V8KA 1YIT1 1QVGO 2BJOA 4NBHA 1VQL1 2R7ZI 3I55P 1JWHC 4E2ZA 2PY8A 4X6AI 3CCQP 2EGTA 4E2WA 1ZMBA 2KPIA 3NH4A 1VQKZ 4NFRA 2OTLP 3CCL1 5HGNA 1I50I 3CCJP 3D6WA 5HGOA 4E2YA 4NH1C 1NUIA 5BS2A 4U0BA 2WB1A 3KIHA 4NBEA 1Y1VS 2OTJZ 4XFYA 5FLXb 1Q811 2I3CA 5D1PA 1YHQ1 3G1GA 1YHQZ 4DQYB 3OW2O 1WW9A 4NB9A 5T6BA 1TWCI 3CD6Z 2Q51A 1M1K1 1N8R1 3QWUA 3GTQI 2J6AA 4Y7NI 4QTTA 2QR1B 1EIAA 1P9NA 3CCV1 1VQN1 1VQNP 1LQLA 1K8A2 2V8IA 3J80b 4A3FI 3IFUA 1RQFA 4RVDA 1QVGY 2R92I 4WYMA 5IP7I 3HKZA 1VQMZ 4NBFA 2GU2A 3CMEP 1VQ7P 1YJ9Z 1VQ71 3S17I 5A2Qf 3JAMb 4COPA 2QKDA 2IZ3A 4MD9A 2JA7I 1VQ8Z 4A3EI 3M3YI 2KODA 2H85A 2PENA 2L6EA 2M8PA 2JYLA 4E2XA 1NJI2 3HOYI 1VQO1 2PMZA 3JAMf 3CCMZ 1Z01A 3RZDI 2JR6A 1USPA 1EOQA 2VUGA 1Q7Y1 3CCS1 3F3FC 3VTNA 4U0CA 3H4EA 1WCMI 5FLMI 3RG6C 5T67A 1YJNZ 1N8R2 1YJW1 2OOXB 1ML8A 4NBGA 2EFJA 2JA8I 2LFUA 3DS1A 3P05A 1NJI1 1A43A 3S1NI 4DK1A 1QVFY 2P3YA 1VQ4Z 1ZB8A 2JA6I 3CC7P 1AUMA 1YUKA 1Q7Y2 3CMAZ 4QNBA 1KC8Q 3OW2Y 3G29A 1RNIA 2QEXZ 2EG5A 4M0IA 5C4JI 3CCLZ 1YITZ 3LUSA 1VQ61 4RVHA 2PEJA 2E2HI 3S16I 3CCMP 2R6MA 5CM2M 3G1IA 3CC71 4U0EA 1KRLA 4EWCA 1VQMP 3HOXI 1K9M1 2M48A 2P28A 3CCE1 5F2NA 3G4SP 4NBCA 4A3KI 2QRCB 4U0AA 1NP6A 4RVGA 1R9TI 1VQ81 2PEIA 3NH8A 1QVGZ 3CMEZ 3I56P 4BY7I 3WBHA 4MRIA 3CME1 3G6EZ 1W2BO 1VQ5Z 1VQOZ 2GTIA 1KQSO 1BAJA 5IT9b 3VMHA 4NB8A 2JUBA 5IP9I 2Z44A 4A3CI 1KC81 4BXXI 4A3MI 1KC82 3S1MI 4RS4A 1K732 3G4S1 3S14I 4IPYA 1JJ2Y 1VQ5P 2JNYA 5BS1A 2QA4P 1K9MQ 5IT9f 1N2FA 2PEQA 3NDJA 4NBBA 3ESWA 3S2HI 1D1DA 3I56Z 3J81f 1VQ6Z 5HGLA 4NBDA 3VB9A 2CWOA 2Y0SA 1Q821 3IF8A 3GTGI 1YJN1 2Z45A 1VQ8P 3PO2I 2V8JA 3HOUI 5D1OB 2OTL1 2F4OA 3NTEA 3NDIA 3CCSZ 1VQLP 1USPB 1Q861 1KD12 3G71P 2R93I 3IX0A 4MH4A 1Z02A 2M8NA 2JMOA 1VQM1 3VMIA 3NFZA 3CPWO 1TWGI 1PFTA 3HOZI 2HF1A 1Q812 3M1MA 3CC2P 3KIFA 4A3DI 4HH4A 4E32A 3CQZI 3DS0A 1VQ9P 1M74A 1VQLZ 3U50C 2QRDB 2EIAA 1JJ2O 3I551 3CCR1 3CCJ1 1K73Q 1RO4A 4S1TA 3I55Z 1I6HI 1M1K2 5F2KA 2NVQI 1M902 3S1RI 5I4TG 1Q82Q 4QTUA 1DL6A 3FQMA 1YI21 1KQSZ 3CCUZ 4PH0A 2AKLA 3K7AI 1S721 1W2BZ 1QVFZ 2E2II 2NVYI 3CXCO 3F3PC 1W2BY 2RPRA 3HOWI 2OTJ1 2PEOA 3GTMS 2OZKA 3GTMI 2JA5I 4U0FA 2ZAEB 2RBLA 3VMGA 2B63I 1QRJA 1QF8A 4E30A 3TE5B 4MD8A 4PH1A 5JPAA 3G6EP 2DE5A 4U0DA 1X0TA 1A8OA 2XXMA 3H0DA 3I4NI 2BHVA 1Z03A 3BG1B 2QLVB 1K30A 1RO2A 3CCSP 3CCVZ 2E2JI 1TWAI 3HOVI 1TWHI 1VLAA 2NVTI 1VQOP 3CCVP 3CCUP 2DGYA 3GTPI 2JYGA 3G28A 1QVFO 1Y1WI 1YJ91 2Z46A 5LL6f 1VQPZ 1S72Z 1Q86Q 2GTHA 3G6E1 4Y52I 3EEDA 2JS4A 5F2OA 2DE6A 2OOYB 1YHQP 3CXCY 4GR2A 4NOZA 1YJ9P 3CPWZ 1VQ7Z 1VQNZ 3M4OI 3I561 3CCRZ 3D9XA 3CMA1 1VQKP 1YIJ1 1M901 3TDHB 3EERA 3MZKB 3GKQA 5T64A 3CCLP 1JJ2Z 2E1MA 2W04A 3GCFA 3J81b 2K3RA 2LIYA 4NBAA 3CCQ1 3Q20A 2YU9I 1VQ6P 1VQ4P 2WAQA 1Q7YQ 4BBSI 1VQP1 3FQQA 1K731 2KI7B 2HU9A 2QEXP 1VQPP 4MXUA 3CXCZ 5DCKA 5C4XI 3Q87A 1QYPA 1VQ41 3CC2Z 1L1OC 3CC7Z 3NH5A 3J7A4 3E2DA 1E6JP 3GTKI 1K83I 2QEX1 1RLYA 3CC4P 1Q81Q 3G0VA 1WIIA 3G26A 2RIQA 1TFIA 2XT1A 2VUMI 3S2DI 3DS4A 2YADA 1ZH1A 4BBRI 3PO3S 2M6NA 3H47A 2BUOA 2OARA 1YJWP 2P9XA 2VF1A 3OW2Z 1M6NA 3B5IA 1YI2P 3GTJI 3CCJZ 1KD1Q 5FLXf 1YJNP 3DS5A 3CC4Z 3G711 3DS3A 3DPHA 3LRYA 3RZOI 3DS2A 5A2Qb 3HYBA 1M6EX 3CCU1 1RO0A 3MZLB 5AN9F 1NJIQ 5C3EI 2G2KA 4E33A 3S1QI 5C44I 2PM9A 4HGZA 4XX2A 3CCEZ 4RVFA 1M90Q 3H0GI 4DGLA 2QA4Z 2NVXI 4RV9A 2IZ4A 3MONA 3I07A 1ZB9A 4XFXA 2Q4ZA 1M1KQ 4TNUA 1YIJP 1Q862 3MGEA 1KD11 3CD61 3CD6P 2OTLZ 3S15I 2JO0A 3CPWY 3CMAP 2RHBA 3J80f 4GR6A 4COCA 3CC41 1YI2Z 2OTJP 3CCQZ 4XRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RO2 A;  1RO0 A;  1RNI A; 
#chains in the Genus database with same CATH topology
 3VRL C;  2FQ0 A;  4E31 A;  2E9H A;  4AYB A;  2LKI A;  2M5R A;  4XRO A;  1YJW Z;  3RG2 A;  4HGY A;  2GZG A;  1FDO A;  1YUA A;  3P5J B;  4A93 I;  2M8L A;  2QA4 1;  3BG0 B;  4A3I I;  1Q16 A;  4MD7 A;  4H2Y C;  3GTO I;  4CL1 A;  2F4M A;  3T4N B;  1VQ5 1;  2K5R A;  2KG9 A;  2KWL A;  4BPH A;  3CC2 1;  4A3B I;  1SFO I;  4A3G I;  2MVV A;  3CCM 1;  4NEO A;  3CCE P;  1K8A 1;  2LF4 A;  3G21 A;  4H2W C;  2E7Z A;  1K8A Q;  5D1O A;  3I4M I;  1X3W A;  3G71 Z;  2EHS A;  5HGM A;  2ONT A;  4A3L I;  2XV6 A;  3G4S Z;  2PEK A;  1ACP A;  1YIJ Z;  1X3Z A;  1TWF I;  2W03 A;  1YIT P;  1IUQ A;  1K9M 2;  2VSQ A;  2QRE B;  3CCR P;  2RT9 A;  4BY1 I;  1I3Q I;  4XFZ A;  4MON A;  2KGC A;  1S7M A;  1VQ9 Z;  1X3O A;  1VQK 1;  1Y1V I;  1VQ9 1;  3PO3 I;  2FAD A;  1Q82 2;  1DNY A;  3GTL I;  3H3V J;  2PEM A;  3DTJ A;  2MR8 A;  2O4H A;  2PK7 A;  2KOO A;  1S72 P;  3FKI I;  2O53 A;  3HZQ A;  2DE7 A;  2JBG A;  1KQS Y;  2FQ2 A;  1N8R Q;  4A3J I;  2V8K A;  1YIT 1;  1QVG O;  2BJO A;  4NBH A;  5EW5 E;  2KOQ A;  1VQL 1;  2R7Z I;  2KGA A;  1MZ8 A;  3I55 P;  1JWH C;  4E2Z A;  2L4B A;  2PY8 A;  4X6A I;  3CCQ P;  2AF8 A;  2MD9 A;  2EGT A;  4E2W A;  1ZMB A;  2KPI A;  5KP7 B;  3NH4 A;  1VQK Z;  2LML A;  4NFR A;  2OTL P;  3CCL 1;  5HGN A;  3CCJ P;  1I50 I;  3D6W A;  5HGO A;  4E2Y A;  1EMV A;  4NH1 C;  1NUI A;  5BS2 A;  4U0B A;  2WB1 A;  2VLN A;  3KIH A;  2VPY A;  4NBE A;  1Y1V S;  2OTJ Z;  4XFY A;  5FLX b;  1Q81 1;  2I3C A;  2VLQ A;  5D1P A;  1YHQ 1;  3G1G A;  4DG9 A;  1YHQ Z;  4DQY B;  2K5X A;  3OW2 O;  1WW9 A;  4NB9 A;  5T6B A;  1OR5 A;  1TWC I;  2VPW A;  2V45 A;  3D2L A;  3CD6 Z;  2Q51 A;  1M1K 1;  1N8R 1;  3QWU A;  3GTQ I;  2J6A A;  4Y7N I;  4QTT A;  4PWV B;  2QR1 B;  1EIA A;  2K0D X;  1P9N A;  2AYD A;  3CCV 1;  1VQN 1;  1VQN P;  3EJD A;  1LQL A;  1K8A 2;  2V8I A;  3J80 b;  4A3F I;  3IFU A;  1RQF A;  4RVD A;  2JIP A;  1QVG Y;  1T8K A;  4WYM A;  2R92 I;  5IP7 I;  3HKZ A;  4R0M A;  1VQM Z;  4NBF A;  2MY5 A;  3CME P;  2GU2 A;  1VQ7 P;  1YJ9 Z;  1VQ7 1;  3S17 I;  5A2Q f;  3JAM b;  4COP A;  2QKD A;  2IZ3 A;  4MD9 A;  2JA7 I;  1VQ8 Z;  4A3E I;  2FVE A;  3M3Y I;  2KOD A;  2H85 A;  3B4Q A;  2PEN A;  2L6E A;  2M8P A;  3GZM A;  2JYL A;  4E2X A;  4F37 A;  1NJI 2;  3HOY I;  4H2X C;  1VQO 1;  2PMZ A;  3JAM f;  2GYK A;  3CCM Z;  1Z01 A;  3RZD I;  2JR6 A;  2N98 A;  5EJD A;  1USP A;  1EOQ A;  2VUG A;  1Q7Y 1;  3CCS 1;  3F3F C;  3VTN A;  4U0C A;  3H4E A;  1WCM I;  5FLM I;  3RG6 C;  5T67 A;  1YJN Z;  1N8R 2;  1YJW 1;  2OOX B;  2N6Z A;  1ML8 A;  5KP8 B;  4NBG A;  2EFJ A;  2VLP A;  2JA8 I;  2LFU A;  2KOP A;  3DS1 A;  3P05 A;  1NJI 1;  4QKO A;  1A43 A;  3S1N I;  4DK1 A;  1QVF Y;  2P3Y A;  1VQ4 Z;  1ZB8 A;  2JA6 I;  3CC7 P;  1AUM A;  1NQ4 A;  1YUK A;  1Q7Y 2;  3CMA Z;  4QNB A;  1KC8 Q;  3OW2 Y;  3G29 A;  1RNI A;  2QEX Z;  2EG5 A;  4M0I A;  5C4J I;  3CCL Z;  1YIT Z;  3LUS A;  2GZF A;  1VQ6 1;  2K93 A;  4RVH A;  2PEJ A;  2E2H I;  3S16 I;  2NO8 A;  3CCM P;  2R6M A;  5CM2 M;  3G1I A;  3CC7 1;  2KOR A;  4U0E A;  1KRL A;  4EWC A;  1VQM P;  3HOX I;  2JB0 A;  2FVA A;  2KGD A;  1K9M 1;  2M48 A;  2P28 A;  1GXG A;  3CCE 1;  5F2N A;  3G4S P;  4NBC A;  4A3K I;  2VLO A;  2KGE A;  2QRC B;  4U0A A;  1NP6 A;  4RVG A;  1R9T I;  1WZN A;  1L0I A;  1VQ8 1;  2PEI A;  3NH8 A;  1QVG Z;  2LL8 A;  3CME Z;  3I56 P;  4BY7 I;  2EHT A;  3WBH A;  2JAZ A;  4MRI A;  3G6E Z;  3CME 1;  1W2B O;  1VQ5 Z;  1VQO Z;  5CZD B;  2GTI A;  1KLP A;  1KQS O;  1BAJ A;  5IT9 b;  3VMH A;  4NB8 A;  2JUB A;  5IP9 I;  1Y8C A;  2Z44 A;  4A3C I;  1KC8 1;  4BXX I;  4A3M I;  2JQ4 A;  1KC8 2;  3S1M I;  4RS4 A;  1QXF A;  1K73 2;  3G4S 1;  3S14 I;  4IPY A;  1JJ2 Y;  2N6Y A;  5HV8 A;  1VQ5 P;  2CNR A;  2JNY A;  5BS1 A;  1K9M Q;  1IMQ A;  2FHS C;  2QA4 P;  5IT9 f;  1N2F A;  3EJE A;  2PEQ A;  2LEX A;  3NDJ A;  4NBB A;  3ESW A;  2MVU A;  3S2H I;  1F80 D;  4BPG A;  1D1D A;  5KP6 B;  3I56 Z;  3J81 f;  1VQ6 Z;  5HGL A;  2FQ1 A;  4NBD A;  3VB9 A;  2CWO A;  2Y0S A;  1Q82 1;  3IF8 A;  3GTG I;  2X2B A;  1YJN 1;  2Z45 A;  1VQ8 P;  3PO2 I;  2V8J A;  3HOU I;  5D1O B;  2OTL 1;  2F4O A;  2XZ0 D;  2L22 A;  3NTE A;  3NDI A;  2L9F A;  1VQL P;  1USP B;  3CCS Z;  2VPX A;  1Q86 1;  1KD1 2;  3G71 P;  4PXH B;  2R93 I;  3IX0 A;  4MH4 A;  1Z02 A;  2M8N A;  2JMO A;  1VQM 1;  3VMI A;  1VHN A;  2MR7 A;  3NFZ A;  3CPW O;  2N5H A;  1TWG I;  1PFT A;  2JIO A;  3HOZ I;  1AYI A;  1WJ2 A;  2HF1 A;  1Q81 2;  3M1M A;  3CC2 P;  3KIF A;  4A3D I;  4HH4 A;  1AA6 A;  1Z6M A;  2GZI A;  4E32 A;  3CQZ I;  2LIW A;  3DS0 A;  1VQ9 P;  1M74 A;  1SIW A;  1VQL Z;  3U50 C;  2QRD B;  2EIA A;  1JJ2 O;  1UNK A;  2MF4 A;  3I55 1;  3CCR 1;  3CCJ 1;  1K73 Q;  1RO4 A;  4S1T A;  3I55 Z;  1I6H I;  1M1K 2;  5F2K A;  2K2Q A;  2NVQ I;  1M90 2;  3S1R I;  5I4T G;  1Q82 Q;  4QTU A;  2FVF A;  1DL6 A;  3FQM A;  1YI2 1;  1KQS Z;  2DNW A;  4PH0 A;  3CCU Z;  2AKL A;  3K7A I;  1FR2 A;  1S72 1;  1W2B Z;  1QVF Z;  2E2I I;  2NVY I;  3CXC O;  3F3P C;  1W2B Y;  4BPF A;  4IZ6 A;  1AF8 A;  2RPR A;  3HOW I;  2PEO A;  2OTJ 1;  3GTM S;  2OZK A;  3GTM I;  2JA5 I;  4U0F A;  2GDW A;  2LIU A;  2ZAE B;  2RBL A;  3VMG A;  2B63 I;  1QRJ A;  1QF8 A;  4E30 A;  3TE5 B;  4MD8 A;  4PH1 A;  5JPA A;  3G6E P;  2DE5 A;  4U0D A;  1X0T A;  1A8O A;  2XXM A;  3H0D A;  3I4N I;  2BHV A;  1Z03 A;  2FAC A;  2NAP A;  2L0Q A;  3BG1 B;  2JIM A;  1K30 A;  7CEI A;  1RO2 A;  2QLV B;  3CCS P;  2LTE A;  3CCV Z;  2E2J I;  1TWA I;  3HOV I;  1TWH I;  2KG6 A;  1VLA A;  2NVT I;  3GJN A;  1VQO P;  3CCV P;  3CCU P;  2DGY A;  3GTP I;  2JYG A;  1GXH A;  3G28 A;  1QVF O;  1Y1W I;  1YJ9 1;  2Z46 A;  5LL6 f;  2KW2 A;  1VQP Z;  3GKL C;  2AVA A;  3GZL A;  1GPJ A;  1S72 Z;  1Q86 Q;  2ROQ A;  2GTH A;  3G6E 1;  4Y52 I;  3EED A;  2JS4 A;  2N50 A;  5F2O A;  2DE6 A;  2KOS A;  2OOY B;  1YHQ P;  3CXC Y;  4GR2 A;  4NOZ A;  1YJ9 P;  3CPW Z;  2CQ8 A;  2KG8 A;  1VQ7 Z;  1VQN Z;  3M4O I;  3I56 1;  1IMP A;  3D9X A;  3CCR Z;  2JIR A;  3CMA 1;  2AFD A;  2ERH A;  2FAE A;  1VQK P;  1YIJ 1;  1M90 1;  3TDH B;  3EER A;  3MZK B;  3GKQ A;  2JIQ A;  5T64 A;  3CCL P;  1JJ2 Z;  2K0Y A;  2E1M A;  2GDY A;  2W04 A;  3GCF A;  3J81 b;  2K3R A;  2QNW A;  2LIY A;  3NY7 B;  4NBA A;  3CCQ 1;  2CGQ A;  3Q20 A;  2YU9 I;  1VQ6 P;  1VQ4 P;  2WAQ A;  1Q7Y Q;  3CE7 A;  3U43 A;  4BBS I;  1VQP 1;  3FQQ A;  1HQB A;  1K73 1;  2KI7 B;  2HU9 A;  4MRT C;  2QEX P;  1VQP P;  4MXU A;  3CXC Z;  5DCK A;  2GDX A;  5C4X I;  3Q87 A;  1QYP A;  1VQ4 1;  1L0H A;  3CC2 Z;  1L1O C;  3CC7 Z;  2N5I A;  3NH5 A;  1E0H A;  3J7A 4;  3E2D A;  1E6J P;  3GTK I;  1K83 I;  2QEX 1;  1RLY A;  5HVC A;  4HKG A;  3CC4 P;  1Q81 Q;  3G0V A;  1WII A;  3G26 A;  2RIQ A;  1TFI A;  2IV2 X;  2XT1 A;  2VUM I;  3S2D I;  2WPT A;  2K0X A;  3DS4 A;  1ZH1 A;  2YAD A;  4BBR I;  3PO3 S;  2M6N A;  3H47 A;  2LPK A;  2BUO A;  4CA3 A;  2OAR A;  1YJW P;  2JU2 A;  2P9X A;  4UHP B;  2VF1 A;  3OW2 Z;  1M6N A;  3B5I A;  1YI2 P;  3GTJ I;  3LMO A;  3CCJ Z;  1KD1 Q;  5FLX f;  1YJN P;  3DS5 A;  2KR5 A;  3CC4 Z;  3G71 1;  3DS3 A;  3DPH A;  3LRY A;  3RZO I;  1ZNV A;  3DS2 A;  5A2Q b;  3HYB A;  1M6E X;  2XZ1 C;  3CCU 1;  1DV5 A;  1RO0 A;  3MZL B;  2JGP A;  5AN9 F;  1NJI Q;  1BXI A;  2JU1 A;  5C3E I;  2G2K A;  4E33 A;  3S1Q I;  5C44 I;  2PM9 A;  1UJZ A;  4HGZ A;  4XX2 A;  3CCE Z;  4RVF A;  3IR7 A;  2GZJ A;  2K92 A;  1M90 Q;  3H0G I;  4DGL A;  2LOL A;  2PNG A;  2QA4 Z;  1VKU A;  2NVX I;  3EJB A;  4RV9 A;  2IZ4 A;  3MON A;  2K94 A;  3I07 A;  1ZB9 A;  2AFE A;  1HY8 A;  4XFX A;  2Q4Z A;  1M1K Q;  1CEI A;  1YIJ P;  4TNU A;  3MGE A;  1Q86 2;  1KD1 1;  3CD6 1;  3CD6 P;  2OTL Z;  3S15 I;  2JO0 A;  3CPW Y;  3CMA P;  2RHB A;  2GZE A;  4GR6 A;  4COC A;  2V3V A;  1FDI A;  2VPZ A;  3J80 f;  2CG5 B;  3CC4 1;  1YI2 Z;  2OTJ P;  3CCQ Z;  4XRQ A; 
#chains in the Genus database with same CATH homology
 3VRL C;  4E31 A;  2E9H A;  4AYB A;  4XRO A;  1YJW Z;  4HGY A;  1YUA A;  3P5J B;  4A93 I;  2M8L A;  2QA4 1;  3BG0 B;  4A3I I;  4MD7 A;  3GTO I;  4CL1 A;  2F4M A;  3T4N B;  1VQ5 1;  2K5R A;  3CC2 1;  4A3B I;  1SFO I;  4A3G I;  3CCM 1;  3CCE P;  1K8A 1;  2LF4 A;  3G21 A;  1K8A Q;  5D1O A;  3I4M I;  1X3W A;  3G71 Z;  5HGM A;  2ONT A;  4A3L I;  2XV6 A;  3G4S Z;  2PEK A;  1YIJ Z;  1X3Z A;  1TWF I;  2W03 A;  1YIT P;  1IUQ A;  1K9M 2;  2QRE B;  3CCR P;  2RT9 A;  4BY1 I;  1I3Q I;  4XFZ A;  4MON A;  1VQ9 Z;  1S7M A;  1VQK 1;  1Y1V I;  1VQ9 1;  3PO3 I;  1Q82 2;  3GTL I;  3H3V J;  2PEM A;  3DTJ A;  2O4H A;  2PK7 A;  1S72 P;  3FKI I;  2O53 A;  3HZQ A;  2DE7 A;  1KQS Y;  1N8R Q;  4A3J I;  2V8K A;  1YIT 1;  1QVG O;  2BJO A;  4NBH A;  1VQL 1;  2R7Z I;  3I55 P;  1JWH C;  4E2Z A;  2PY8 A;  4X6A I;  3CCQ P;  2EGT A;  4E2W A;  1ZMB A;  2KPI A;  3NH4 A;  1VQK Z;  4NFR A;  2OTL P;  3CCL 1;  5HGN A;  1I50 I;  3CCJ P;  3D6W A;  5HGO A;  4E2Y A;  4NH1 C;  1NUI A;  5BS2 A;  4U0B A;  2WB1 A;  3KIH A;  4NBE A;  1Y1V S;  2OTJ Z;  4XFY A;  5FLX b;  1Q81 1;  2I3C A;  5D1P A;  1YHQ 1;  3G1G A;  1YHQ Z;  4DQY B;  3OW2 O;  1WW9 A;  4NB9 A;  5T6B A;  1TWC I;  3CD6 Z;  2Q51 A;  1M1K 1;  1N8R 1;  3QWU A;  3GTQ I;  2J6A A;  4Y7N I;  4QTT A;  2QR1 B;  1EIA A;  1P9N A;  3CCV 1;  1VQN 1;  1VQN P;  1LQL A;  1K8A 2;  2V8I A;  3J80 b;  4A3F I;  3IFU A;  1RQF A;  4RVD A;  1QVG Y;  2R92 I;  4WYM A;  5IP7 I;  3HKZ A;  1VQM Z;  4NBF A;  2GU2 A;  3CME P;  1VQ7 P;  1YJ9 Z;  1VQ7 1;  3S17 I;  5A2Q f;  3JAM b;  4COP A;  2QKD A;  2IZ3 A;  4MD9 A;  2JA7 I;  1VQ8 Z;  4A3E I;  3M3Y I;  2KOD A;  2H85 A;  2PEN A;  2L6E A;  2M8P A;  2JYL A;  4E2X A;  1NJI 2;  3HOY I;  1VQO 1;  2PMZ A;  3JAM f;  3CCM Z;  1Z01 A;  3RZD I;  2JR6 A;  1USP A;  1EOQ A;  2VUG A;  1Q7Y 1;  3CCS 1;  3F3F C;  3VTN A;  4U0C A;  3H4E A;  1WCM I;  5FLM I;  3RG6 C;  5T67 A;  1YJN Z;  1N8R 2;  1YJW 1;  2OOX B;  1ML8 A;  4NBG A;  2EFJ A;  2JA8 I;  2LFU A;  3DS1 A;  3P05 A;  1NJI 1;  1A43 A;  3S1N I;  4DK1 A;  1QVF Y;  2P3Y A;  1VQ4 Z;  1ZB8 A;  2JA6 I;  3CC7 P;  1AUM A;  1YUK A;  1Q7Y 2;  3CMA Z;  4QNB A;  1KC8 Q;  3OW2 Y;  3G29 A;  1RNI A;  2QEX Z;  2EG5 A;  4M0I A;  5C4J I;  3CCL Z;  1YIT Z;  3LUS A;  1VQ6 1;  4RVH A;  2PEJ A;  2E2H I;  3S16 I;  3CCM P;  2R6M A;  5CM2 M;  3G1I A;  3CC7 1;  4U0E A;  1KRL A;  4EWC A;  1VQM P;  3HOX I;  1K9M 1;  2M48 A;  2P28 A;  3CCE 1;  5F2N A;  3G4S P;  4NBC A;  4A3K I;  2QRC B;  4U0A A;  1NP6 A;  4RVG A;  1R9T I;  1VQ8 1;  2PEI A;  3NH8 A;  1QVG Z;  3CME Z;  3I56 P;  4BY7 I;  3WBH A;  4MRI A;  3CME 1;  3G6E Z;  1W2B O;  1VQ5 Z;  1VQO Z;  2GTI A;  1KQS O;  1BAJ A;  5IT9 b;  3VMH A;  4NB8 A;  2JUB A;  5IP9 I;  2Z44 A;  4A3C I;  1KC8 1;  4BXX I;  4A3M I;  1KC8 2;  3S1M I;  4RS4 A;  1K73 2;  3G4S 1;  3S14 I;  4IPY A;  1JJ2 Y;  1VQ5 P;  2JNY A;  5BS1 A;  2QA4 P;  1K9M Q;  5IT9 f;  1N2F A;  2PEQ A;  3NDJ A;  4NBB A;  3ESW A;  3S2H I;  1D1D A;  3I56 Z;  3J81 f;  1VQ6 Z;  5HGL A;  4NBD A;  3VB9 A;  2CWO A;  2Y0S A;  1Q82 1;  3IF8 A;  3GTG I;  1YJN 1;  2Z45 A;  1VQ8 P;  3PO2 I;  2V8J A;  3HOU I;  5D1O B;  2OTL 1;  2F4O A;  3NTE A;  3NDI A;  3CCS Z;  1VQL P;  1USP B;  1Q86 1;  1KD1 2;  3G71 P;  2R93 I;  3IX0 A;  4MH4 A;  1Z02 A;  2M8N A;  2JMO A;  1VQM 1;  3VMI A;  3NFZ A;  3CPW O;  1TWG I;  1PFT A;  3HOZ I;  2HF1 A;  1Q81 2;  3M1M A;  3CC2 P;  3KIF A;  4A3D I;  4HH4 A;  4E32 A;  3CQZ I;  3DS0 A;  1VQ9 P;  1M74 A;  1VQL Z;  3U50 C;  2QRD B;  2EIA A;  1JJ2 O;  3I55 1;  3CCR 1;  3CCJ 1;  1K73 Q;  1RO4 A;  4S1T A;  3I55 Z;  1I6H I;  1M1K 2;  5F2K A;  2NVQ I;  1M90 2;  3S1R I;  5I4T G;  1Q82 Q;  4QTU A;  1DL6 A;  3FQM A;  1YI2 1;  1KQS Z;  3CCU Z;  4PH0 A;  2AKL A;  3K7A I;  1S72 1;  1W2B Z;  1QVF Z;  2E2I I;  2NVY I;  3CXC O;  3F3P C;  1W2B Y;  2RPR A;  3HOW I;  2OTJ 1;  2PEO A;  3GTM S;  2OZK A;  3GTM I;  2JA5 I;  4U0F A;  2ZAE B;  2RBL A;  3VMG A;  2B63 I;  1QRJ A;  1QF8 A;  4E30 A;  3TE5 B;  4MD8 A;  4PH1 A;  5JPA A;  3G6E P;  2DE5 A;  4U0D A;  1X0T A;  1A8O A;  2XXM A;  3H0D A;  3I4N I;  2BHV A;  1Z03 A;  3BG1 B;  2QLV B;  1K30 A;  1RO2 A;  3CCS P;  3CCV Z;  2E2J I;  1TWA I;  3HOV I;  1TWH I;  1VLA A;  2NVT I;  1VQO P;  3CCV P;  3CCU P;  2DGY A;  3GTP I;  2JYG A;  3G28 A;  1QVF O;  1Y1W I;  1YJ9 1;  2Z46 A;  5LL6 f;  1VQP Z;  1S72 Z;  1Q86 Q;  2GTH A;  3G6E 1;  4Y52 I;  3EED A;  2JS4 A;  5F2O A;  2DE6 A;  2OOY B;  1YHQ P;  3CXC Y;  4GR2 A;  4NOZ A;  1YJ9 P;  3CPW Z;  1VQ7 Z;  1VQN Z;  3M4O I;  3I56 1;  3CCR Z;  3D9X A;  3CMA 1;  1VQK P;  1YIJ 1;  1M90 1;  3TDH B;  3EER A;  3MZK B;  3GKQ A;  5T64 A;  3CCL P;  1JJ2 Z;  2E1M A;  2W04 A;  3GCF A;  3J81 b;  2K3R A;  2LIY A;  4NBA A;  3CCQ 1;  3Q20 A;  2YU9 I;  1VQ6 P;  1VQ4 P;  2WAQ A;  1Q7Y Q;  4BBS I;  1VQP 1;  3FQQ A;  1K73 1;  2KI7 B;  2HU9 A;  2QEX P;  1VQP P;  4MXU A;  3CXC Z;  5DCK A;  5C4X I;  3Q87 A;  1QYP A;  1VQ4 1;  3CC2 Z;  1L1O C;  3CC7 Z;  3NH5 A;  3J7A 4;  3E2D A;  1E6J P;  3GTK I;  1K83 I;  2QEX 1;  1RLY A;  3CC4 P;  1Q81 Q;  3G0V A;  1WII A;  3G26 A;  2RIQ A;  1TFI A;  2XT1 A;  2VUM I;  3S2D I;  3DS4 A;  2YAD A;  1ZH1 A;  4BBR I;  3PO3 S;  2M6N A;  3H47 A;  2BUO A;  2OAR A;  1YJW P;  2P9X A;  2VF1 A;  3OW2 Z;  1M6N A;  3B5I A;  1YI2 P;  3GTJ I;  3CCJ Z;  1KD1 Q;  5FLX f;  1YJN P;  3DS5 A;  3CC4 Z;  3G71 1;  3DS3 A;  3DPH A;  3LRY A;  3RZO I;  3DS2 A;  5A2Q b;  3HYB A;  1M6E X;  3CCU 1;  1RO0 A;  3MZL B;  5AN9 F;  1NJI Q;  5C3E I;  2G2K A;  4E33 A;  3S1Q I;  5C44 I;  2PM9 A;  4HGZ A;  4XX2 A;  3CCE Z;  4RVF A;  1M90 Q;  3H0G I;  4DGL A;  2QA4 Z;  2NVX I;  4RV9 A;  2IZ4 A;  3MON A;  3I07 A;  1ZB9 A;  4XFX A;  2Q4Z A;  1M1K Q;  4TNU A;  1YIJ P;  1Q86 2;  3MGE A;  1KD1 1;  3CD6 1;  3CD6 P;  2OTL Z;  3S15 I;  2JO0 A;  3CPW Y;  3CMA P;  2RHB A;  3J80 f;  4GR6 A;  4COC A;  3CC4 1;  1YI2 Z;  2OTJ P;  3CCQ Z;  4XRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...