1RO0A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m semet remote
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords ORF904
total genus 61
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro0A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro0A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro0A02
3M1MA 1RNIA 1RO0A 1RO2A
chains in the Genus database with same CATH superfamily
3G21A 1YJ9P 1A8OA 1RO4A 2QEXZ 3EJBA 3CC2P 4A3II 5F2NA 5JPAA 3GKQA 1L1OC 2Z44A 2JMOA 1NP6A 1VQ7P 4CA3A 4MD8A 1JWHC 5IP7I 3I56Z 1VQ51 1VQ6Z 5HGMA 1VQMZ 4MXUA 1QYPA 5HV8A 4BY1I 3Q20A 3S1RI 4MD9A 3CPWZ 3RG6C 4BPHA 1ZB9A 2RBLA 3VB9A 3CXCZ 1VKUA 2EHSA 2OTLP 3G6EZ 2FQ0A 1S72P 4IPYA 3TDHB 2V45A 2MVVA 1KC82 3J81f 3MZLB 1VQ4Z 1I3QI 2I3CA 3FQQA 5I4TG 4XROA 3CCQP 3S15I 2DE7A 2X2BA 3S2HI 1HQBA 2VUMI 4U0EA 4E2XA 1GXGA 2VSQA 2QA4P 1VQNP 2JIOA 1VQOP 1I6HI 2CWOA 5HGNA 1YITP 2WPTA 5BS1A 5T6BA 2M8PA 2M6NA 2OTL1 2DE5A 1KLPA 3GTPI 4NBHA 1ZMBA 1Q822 3G1IA 3HOVI 4HH4A 2OTJZ 2FHSC 4QNBA 4NBBA 2LL8A 1X3ZA 1Z6MA 2GZJA 3MONA 3CCR1 3K7AI 3QWUA 4RS4A 3H0GI 3VTNA 1W2BO 1Q7YQ 5KP8B 1VQPP 1RO0A 3GCFA 1VQ4P 5IT9f 1E0HA 3J81b 2E2II 3CPWY 3H0DA 2Y0SA 3EJDA 5HGOA 2DE6A 2RHBA 3CXCO 4RVGA 1K83I 3CCMZ 4S1TA 4A93I 2Z45A 2FADA 2N5IA 4WYMA 1QVGZ 2XT1A 1X3OA 1K8A2 2FVAA 1R9TI 2CQ8A 2MD9A 1FDOA 4DQYB 2RT9A 2JNYA 1KQSZ 3I07A 4BXXI 2L22A 1VQKP 2LIUA 1YITZ 2L0QA 2GTHA 2NAPA 4BBRI 3G4S1 2LFUA 2EHTA 4NBGA 1M6NA 2H85A 3CCQ1 3HOWI 3G71P 3GJNA 3OW2O 2E7ZA 2V8JA 2FVFA 1YJW1 5DCKA 3S1QI 2LTEA 4NB8A 3CCVZ 3LMOA 3JAMf 2K93A 5CM2M 2PEMA 3CCSP 4A3KI 3D9XA 2KODA 1K30A 3CCVP 1WCMI 2L9FA 2BHVA 3DS0A 1WJ2A 4XX2A 4QTUA 3CC2Z 1N8R2 4DG9A 2KI7B 5C4XI 4MRIA 2W03A 1USPA 4E32A 1Y1WI 2PEQA 3CE7A 2AYDA 3KIHA 4BY7I 4U0AA 4NH1C 3S1MI 5IP9I 2PEKA 1RLYA 5A2Qb 1KD11 1L0HA 4DGLA 4E2YA 5FLMI 1S721 4GR2A 4NBFA 3GTGI 2KR5A 2V8IA 3CC7P 1VQ8P 4U0FA 2JB0A 2NO8A 2M5RA 1M1K2 1YI21 2EG5A 5FLXf 1AUMA 1VQ8Z 1E6JP 2MY5A 1YHQZ 1WW9A 3E2DA 3LRYA 3G26A 5D1OB 2PMZA 4HGYA 3FQMA 1USPB 4COCA 7CEIA 1YIT1 2PM9A 1ACPA 2QA4Z 1K9M2 3CD6Z 2VPYA 1DL6A 3B5IA 2AFEA 3G1GA 1N2FA 1Q811 1M6EX 2KWLA 3HOUI 1W2BZ 4F37A 1YI2Z 2RIQA 2LF4A 1SIWA 4NBCA 3CCS1 1Q81Q 3M1MA 1KRLA 1VQO1 3DS2A 2BJOA 4COPA 1M1K1 1VQ7Z 5C3EI 2MVUA 4Y7NI 3HKZA 2IZ4A 4NFRA 1RQFA 4XRQA 4RVHA 2JA7I 1IMQA 5HVCA 1M1KQ 1VQL1 2OTJP 1VQ91 3D2LA 2E9HA 2K0XA 2QREB 2VF1A 2P3YA 3CCRP 1VHNA 2FQ1A 3RG2A 3S14I 2NVYI 1EIAA 1VQLZ 2N5HA 1UJZA 2LIWA 3G6EP 3MZKB 1N8R1 4QTTA 1K9MQ 2J6AA 3CCV1 3B4QA 5HGLA 3GTKI 2GZFA 2G2KA 3PO3S 2LEXA 1M901 4A3GI 3RZOI 1YJWZ 3CCLP 3CMAZ 3CCEP 2JAZA 1NJIQ 1RNIA 2HF1A 1KQSY 1PFTA 4A3CI 3CMAP 3CCLZ 3M4OI 2YU9I 3GZLA 1YIJP 2B63I 5KP6B 2XXMA 2JYGA 4XFZA 4PWVB 1F80D 2K92A 3G6E1 1NJI1 4U0BA 1TWFI 5D1PA 2R6MA 3CPWO 1QF8A 3CQZI 4A3FI 3NH8A 3CMEP 3Q87A 3DS3A 1I50I 2P28A 3BG0B 1Y1VS 2GYKA 4HKGA 4RVFA 3GKLC 3CCJP 2RPRA 3CCMP 2E1MA 2L4BA 2QEXP 2KGCA 4TNUA 1Q861 2W04A 3CCJZ 5F2KA 2O53A 1FR2A 3CC4Z 2AKLA 3HOXI 2NVQI 4BBSI 1ZNVA 3HYBA 2QEX1 2KG9A 2OOXB 3CC4P 3H4EA 2K2QA 3T4NB 2R92I 2OTLZ 2ERHA 1YHQP 3P05A 3WBHA 2PK7A 3H3VJ 3DS1A 2Q4ZA 2JIRA 3CC41 2OOYB 1RO2A 2LPKA 3IR7A 1DV5A 1JJ2Z 1DNYA 1VLAA 2JUBA 2KG8A 2NVTI 3CMEZ 1K731 1HY8A 2CGQA 2EGTA 2FVEA 1AF8A 3GTMI 3ESWA 3CCQZ 2WB1A 2PY8A 2YADA 5LL6f 2QRDB 2WAQA 3OW2Z 2PEOA 2R7ZI 4A3BI 1Z02A 3CD6P 2KOPA 3G4SZ 4NBDA 1KC81 5BS2A 3GTQI 1T8KA 1LQLA 1K8A1 2JGPA 2JQ4A 1YJNP 1VQM1 1YJ9Z 2VPZA 2DGYA 2KPIA 5T64A 5C4JI 2VLOA 2K3RA 2PENA 3S1NI 1YJNZ 1AYIA 2KGDA 1VQ81 1X0TA 1SFOI 1KQSO 4NBEA 2HU9A 1CEIA 1KC8Q 3CCM1 1QVGY 1P9NA 2EFJA 1K732 1VQN1 3CMA1 3GTMS 3I551 1GPJA 4U0CA 4R0MA 2JIQA 1QVFO 3M3YI 4M0IA 3I56P 1VQ6P 1VQLP 4DK1A 4NBAA 4MD7A 2AFDA 2FACA 1Q16A 2JR6A 3U50C 1VQPZ 3CCRZ 3HZQA 1MZ8A 1ML8A 2AF8A 2JU2A 3HOYI 2JA5I 1D1DA 2KORA 2LKIA 1M74A 1EMVA 3CCU1 1VQP1 1QVFZ 2LMLA 1YIJZ 3KIFA 2N98A 3NFZA 3P5JB 2GZIA 2M8NA 2MR7A 1KD1Q 1VQ5P 2VPXA 1OR5A 5EJDA 4A3EI 1VQNZ 2KG6A 1AA6A 1M90Q 3OW2Y 1VQ9P 1NQ4A 1Q82Q 3NH4A 2JO0A 2XZ1C 4MRTC 1QVGO 2OZKA 1TWGI 3MGEA 4U0DA 1YJN1 3S17I 4IZ6A 4BPFA 1NJI2 4EWCA 1YJ91 2P9XA 4XFXA 4RVDA 1BAJA 3NTEA 3NDIA 3H47A 3GTOI 2QLVB 1JJ2Y 2ONTA 1WIIA 1QXFA 5EW5E 5FLXb 2JS4A 2XV6A 2QKDA 3CXCY 2KGEA 5D1OA 2FQ2A 4A3LI 2KOQA 2ROQA 3DPHA 3CCUZ 2K0DX 1K73Q 1IMPA 1S72Z 4A3DI 4E2WA 3EERA 3S16I 1L0IA 4PH1A 4PH0A 2K94A 1VQ9Z 4NB9A 3FKII 2Z46A 2JBGA 1K8AQ 2GU2A 2E2HI 2GZGA 2VLNA 2F4MA 4H2WC 4XFYA 1Q862 4E31A 1VQ71 3CCJ1 3I55Z 1VQOZ 3G4SP 3GTLI 2OARA 1FDIA 3PO2I 3DS5A 2N50A 4HGZA 1Q7Y2 2DNWA 2VLPA 3F3PC 4CL1A 1VQ41 2GDYA 3CD61 2QA41 5AN9F 5T67A 2N6ZA 3D6WA 3CCUP 4E2ZA 1Q86Q 1BXIA 4GR6A 2O4HA 2K0YA 2FAEA 1YUAA 3JAMb 1Y1VI 5F2OA 2CG5B 2QRCB 2VUGA 2CNRA 3HOZI 1IUQA 3CCL1 1A43A 3VMGA 1VQMP 1NUIA 4NEOA 3CC7Z 1M902 1UNKA 2PEIA 2PEJA 2Q51A 2R93I 3G28A 2GZEA 1GXHA 2IZ3A 3IF8A 4RV9A 2VLQA 2K5XA 5KP7B 3IX0A 4UHPB 1EOQA 2LIYA 3S2DI 2XZ0D 3G0VA 3VMHA 2EIAA 3F3FC 3TE5B 1N8RQ 4NOZA 2OTJ1 3G711 3CCEZ 1S7MA 1VQKZ 2JU1A 3CC21 1Y8CA 2ZAEB 1W2BY 2NVXI 2BUOA 2JIPA 2QR1B 1YI2P 2JA8I 1TWAI 3J80b 3GZMA 4PXHB 4E33A 2IV2X 1QRJA 2M48A 1ZH1A 2N6YA 4Y52I 3CCSZ 3CC71 3EEDA 3RZDI 2F4OA 2KGAA 1Q812 3GTJI 3I4MI 3NY7B 2AVAA 1K9M1 2K5RA 4H2XC 1TFIA 2KOOA 5CZDB 1Z03A 4MH4A 2MF4A 3DTJA 4A3JI 3I4NI 2L6EA 3EJEA 3U43A 2JA6I 3NH5A 1Z01A 2M8LA 1YUKA 2MR8A 3BG1B 3PO3I 1Q7Y1 4E30A 3G29A 3DS4A 3I561 1VQ5Z 1VQ61 1YHQ1 2QNWA 4H2YC 2VPWA 2V3VA 3CME1 1TWHI 4A3MI 1YJWP 1QVFY 4X6AI 4QKOA 1YIJ1 2KOSA 4BPGA 1ZB8A 3J7A4 4MONA 1TWCI 2GTIA 4AYBA 1KD12 2KW2A 2V8KA 1JJ2O 2JYLA 1VQK1 2GDWA 3NDJA 3I55P 1WZNA 2PNGA 5C44I 2GDXA 3J80f 3G71Z 3CCE1 5A2Qf 3VMIA 2JIMA 3LUSA 2LOLA 3VRLC 1X3WA 2E2JI 5IT9b 1Q821 3IFUA
chains in the Genus database with same CATH topology
3G21A 1YJ9P 1A8OA 1RO4A 2QEXZ 3CC2P 4A3II 5F2NA 5JPAA 3GKQA 1L1OC 2Z44A 2JMOA 1NP6A 1VQ7P 4MD8A 1JWHC 5IP7I 3I56Z 1VQ51 1VQ6Z 5HGMA 1VQMZ 4MXUA 1QYPA 4BY1I 3Q20A 3S1RI 4MD9A 3CPWZ 3RG6C 1ZB9A 3CXCZ 2RBLA 3VB9A 3G6EZ 2OTLP 1S72P 4IPYA 3TDHB 1KC82 3J81f 3MZLB 1VQ4Z 1I3QI 2I3CA 3FQQA 5I4TG 4XROA 3CCQP 3S15I 2DE7A 3S2HI 2VUMI 4U0EA 4E2XA 2QA4P 1VQNP 1VQOP 1I6HI 2CWOA 5HGNA 1YITP 5BS1A 5T6BA 2M8PA 2M6NA 2OTL1 2DE5A 3GTPI 4NBHA 1ZMBA 1Q822 3G1IA 3HOVI 4HH4A 2OTJZ 4QNBA 4NBBA 1X3ZA 3MONA 3CCR1 3K7AI 3QWUA 4RS4A 3H0GI 3VTNA 1W2BO 1Q7YQ 1VQPP 1RO0A 3GCFA 1VQ4P 5IT9f 3J81b 2E2II 3CPWY 3H0DA 2Y0SA 5HGOA 2DE6A 2RHBA 3CXCO 4RVGA 1K83I 3CCMZ 4S1TA 4A93I 2Z45A 4WYMA 1QVGZ 2XT1A 1K8A2 1R9TI 4DQYB 2RT9A 2JNYA 1KQSZ 3I07A 4BXXI 1VQKP 1YITZ 2GTHA 4BBRI 3G4S1 2LFUA 4NBGA 1M6NA 2H85A 3CCQ1 3HOWI 3G71P 2V8JA 3OW2O 1YJW1 5DCKA 3S1QI 4NB8A 3CCVZ 3JAMf 5CM2M 2PEMA 3CCSP 4A3KI 3D9XA 2KODA 1K30A 3CCVP 1WCMI 4XX2A 2BHVA 3DS0A 4QTUA 3CC2Z 1N8R2 2KI7B 5C4XI 4MRIA 2W03A 1USPA 4E32A 1Y1WI 2PEQA 3KIHA 4BY7I 4U0AA 4NH1C 3S1MI 5IP9I 2PEKA 1RLYA 5A2Qb 1KD11 4DGLA 4E2YA 5FLMI 1S721 4GR2A 4NBFA 3GTGI 2V8IA 3CC7P 1VQ8P 4U0FA 1M1K2 1YI21 2EG5A 5FLXf 1AUMA 1VQ8Z 1E6JP 1YHQZ 1WW9A 3E2DA 3LRYA 3G26A 5D1OB 2PMZA 4HGYA 3FQMA 1USPB 4COCA 1YIT1 2PM9A 1K9M2 2QA4Z 3CD6Z 1DL6A 3B5IA 1N2FA 3G1GA 1Q811 1M6EX 3HOUI 1W2BZ 1YI2Z 2RIQA 2LF4A 4NBCA 3CCS1 1Q81Q 3M1MA 1KRLA 1VQO1 3DS2A 2BJOA 4COPA 1M1K1 1VQ7Z 5C3EI 4Y7NI 3HKZA 2IZ4A 4NFRA 1RQFA 4XRQA 4RVHA 2JA7I 1M1KQ 1VQL1 2OTJP 1VQ91 2E9HA 2QREB 2VF1A 2P3YA 3CCRP 3S14I 2NVYI 1EIAA 1VQLZ 3G6EP 3MZKB 1N8R1 4QTTA 1K9MQ 2J6AA 3CCV1 5HGLA 3GTKI 2G2KA 3PO3S 1M901 4A3GI 3RZOI 1YJWZ 3CCLP 3CMAZ 3CCEP 1NJIQ 1RNIA 2HF1A 1KQSY 1PFTA 4A3CI 3CMAP 3CCLZ 3M4OI 2YU9I 1YIJP 2B63I 2XXMA 2JYGA 4XFZA 3G6E1 1NJI1 4U0BA 1TWFI 5D1PA 2R6MA 3CPWO 1QF8A 3CQZI 4A3FI 3NH8A 3Q87A 3CMEP 3DS3A 1I50I 2P28A 3BG0B 1Y1VS 4RVFA 3CCJP 2RPRA 3CCMP 2E1MA 1Q861 2QEXP 4TNUA 2W04A 3CCJZ 5F2KA 2O53A 3CC4Z 2AKLA 3HOXI 2NVQI 4BBSI 3HYBA 2QEX1 2OOXB 3CC4P 3H4EA 3T4NB 2R92I 2OTLZ 1YHQP 3P05A 3WBHA 2PK7A 3H3VJ 3DS1A 2Q4ZA 3CC41 2OOYB 1RO2A 1JJ2Z 1VLAA 2JUBA 2NVTI 3CMEZ 1K731 2EGTA 3GTMI 3ESWA 3CCQZ 2WB1A 2PY8A 2YADA 5LL6f 2QRDB 2WAQA 3OW2Z 2PEOA 2R7ZI 4A3BI 1Z02A 3CD6P 1KC81 3G4SZ 4NBDA 3GTQI 5BS2A 1LQLA 1K8A1 1YJNP 1VQM1 1YJ9Z 2DGYA 2KPIA 5T64A 5C4JI 2K3RA 2PENA 3S1NI 1YJNZ 1VQ81 1X0TA 1SFOI 1KQSO 4NBEA 2HU9A 1KC8Q 3CCM1 1QVGY 1P9NA 2EFJA 1K732 1VQN1 3CMA1 3GTMS 3I551 4U0CA 1QVFO 3M3YI 4M0IA 3I56P 1VQ6P 1VQLP 4DK1A 4NBAA 4MD7A 2JR6A 3U50C 1VQPZ 3CCRZ 3HZQA 1ML8A 3HOYI 2JA5I 1D1DA 1M74A 1VQP1 3CCU1 1QVFZ 1YIJZ 3KIFA 3NFZA 3P5JB 2M8NA 1KD1Q 1VQ5P 4A3EI 1VQNZ 1M90Q 3OW2Y 1VQ9P 1Q82Q 3NH4A 2JO0A 2OZKA 1QVGO 1TWGI 3MGEA 4U0DA 1YJN1 3S17I 1NJI2 4EWCA 1YJ91 2P9XA 4XFXA 4RVDA 1BAJA 3NTEA 3NDIA 3H47A 3GTOI 2QLVB 1JJ2Y 2ONTA 1WIIA 5FLXb 2JS4A 2XV6A 2QKDA 3CXCY 5D1OA 4A3LI 3DPHA 3CCUZ 1K73Q 1S72Z 4A3DI 4E2WA 3EERA 3S16I 4PH1A 4PH0A 1VQ9Z 4NB9A 3FKII 2Z46A 1K8AQ 2GU2A 2E2HI 2F4MA 4XFYA 1Q862 4E31A 1VQ71 3CCJ1 3I55Z 1VQOZ 3G4SP 3GTLI 2OARA 3PO2I 3DS5A 4HGZA 1Q7Y2 3F3PC 4CL1A 1VQ41 3CD61 2QA41 5AN9F 5T67A 3D6WA 3CCUP 4E2ZA 1Q86Q 4GR6A 2O4HA 1YUAA 3JAMb 1Y1VI 5F2OA 2QRCB 2VUGA 3HOZI 1IUQA 3CCL1 1A43A 3VMGA 1VQMP 1NUIA 3CC7Z 1M902 2PEIA 2PEJA 2Q51A 2R93I 3G28A 2IZ3A 3IF8A 4RV9A 3IX0A 1EOQA 2LIYA 3S2DI 3G0VA 3VMHA 2EIAA 3F3FC 3TE5B 1N8RQ 4NOZA 2OTJ1 3G711 3CCEZ 1S7MA 1VQKZ 3CC21 2ZAEB 1W2BY 2NVXI 2BUOA 2QR1B 1YI2P 2JA8I 1TWAI 3J80b 4E33A 1QRJA 2M48A 1ZH1A 4Y52I 3CCSZ 3CC71 3EEDA 3RZDI 2F4OA 1Q812 3GTJI 3I4MI 1K9M1 2K5RA 1TFIA 4MH4A 1Z03A 4A3JI 3DTJA 3I4NI 2L6EA 2JA6I 3NH5A 1Z01A 2M8LA 1YUKA 3BG1B 3PO3I 1Q7Y1 4E30A 3G29A 3DS4A 3I561 1VQ5Z 1VQ61 1YHQ1 3CME1 4A3MI 1TWHI 1QVFY 1YJWP 4X6AI 1YIJ1 1ZB8A 3J7A4 4MONA 1TWCI 2GTIA 4AYBA 1KD12 2V8KA 1JJ2O 2JYLA 1VQK1 3NDJA 3I55P 5C44I 3J80f 3G71Z 3CCE1 5A2Qf 3VMIA 3LUSA 3VRLC 1X3WA 2E2JI 5IT9b 1Q821 3IFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RNI A;  1RO0 A;  1RO2 A; 
#chains in the Genus database with same CATH topology
 3G21 A;  1YJ9 P;  1A8O A;  1RO4 A;  2QEX Z;  3EJB A;  3CC2 P;  4A3I I;  5F2N A;  5JPA A;  3GKQ A;  1L1O C;  2Z44 A;  2JMO A;  1NP6 A;  1VQ7 P;  4CA3 A;  4MD8 A;  1JWH C;  5IP7 I;  3I56 Z;  1VQ5 1;  1VQ6 Z;  5HGM A;  1VQM Z;  4MXU A;  1QYP A;  5HV8 A;  4BY1 I;  3Q20 A;  3S1R I;  4MD9 A;  3CPW Z;  3RG6 C;  4BPH A;  1ZB9 A;  2RBL A;  3VB9 A;  3CXC Z;  1VKU A;  2EHS A;  2OTL P;  3G6E Z;  2FQ0 A;  1S72 P;  4IPY A;  3TDH B;  2V45 A;  2MVV A;  1KC8 2;  3J81 f;  3MZL B;  1VQ4 Z;  1I3Q I;  2I3C A;  3FQQ A;  5I4T G;  4XRO A;  3CCQ P;  3S15 I;  2DE7 A;  2X2B A;  3S2H I;  1HQB A;  2VUM I;  4U0E A;  4E2X A;  1GXG A;  2VSQ A;  2QA4 P;  1VQN P;  2JIO A;  1VQO P;  1I6H I;  2CWO A;  5HGN A;  1YIT P;  2WPT A;  5BS1 A;  5T6B A;  2M8P A;  2M6N A;  2OTL 1;  2DE5 A;  1KLP A;  3GTP I;  4NBH A;  1ZMB A;  1Q82 2;  3G1I A;  3HOV I;  4HH4 A;  2OTJ Z;  2FHS C;  4QNB A;  4NBB A;  2LL8 A;  1X3Z A;  1Z6M A;  2GZJ A;  3MON A;  3CCR 1;  3K7A I;  3QWU A;  4RS4 A;  3H0G I;  3VTN A;  1W2B O;  1Q7Y Q;  5KP8 B;  1VQP P;  1RO0 A;  3GCF A;  1VQ4 P;  5IT9 f;  1E0H A;  3J81 b;  2E2I I;  3CPW Y;  3H0D A;  2Y0S A;  3EJD A;  5HGO A;  2DE6 A;  2RHB A;  3CXC O;  4RVG A;  1K83 I;  3CCM Z;  4S1T A;  4A93 I;  2Z45 A;  2FAD A;  2N5I A;  4WYM A;  1QVG Z;  2XT1 A;  1X3O A;  1K8A 2;  2FVA A;  1R9T I;  2CQ8 A;  2MD9 A;  1FDO A;  4DQY B;  2RT9 A;  2JNY A;  1KQS Z;  3I07 A;  4BXX I;  2L22 A;  1VQK P;  2LIU A;  1YIT Z;  2L0Q A;  2GTH A;  2NAP A;  4BBR I;  3G4S 1;  2LFU A;  2EHT A;  4NBG A;  1M6N A;  2H85 A;  3CCQ 1;  3HOW I;  3G71 P;  3GJN A;  3OW2 O;  2E7Z A;  2V8J A;  2FVF A;  1YJW 1;  5DCK A;  3S1Q I;  2LTE A;  4NB8 A;  3CCV Z;  3LMO A;  3JAM f;  2K93 A;  5CM2 M;  2PEM A;  3CCS P;  4A3K I;  3D9X A;  2KOD A;  1K30 A;  3CCV P;  1WCM I;  2L9F A;  2BHV A;  3DS0 A;  1WJ2 A;  4XX2 A;  4QTU A;  3CC2 Z;  1N8R 2;  4DG9 A;  2KI7 B;  5C4X I;  4MRI A;  2W03 A;  1USP A;  4E32 A;  1Y1W I;  2PEQ A;  3CE7 A;  2AYD A;  3KIH A;  4BY7 I;  4U0A A;  4NH1 C;  3S1M I;  5IP9 I;  2PEK A;  1RLY A;  5A2Q b;  1KD1 1;  1L0H A;  4DGL A;  4E2Y A;  5FLM I;  1S72 1;  4GR2 A;  4NBF A;  3GTG I;  2KR5 A;  2V8I A;  3CC7 P;  1VQ8 P;  4U0F A;  2JB0 A;  2NO8 A;  2M5R A;  1M1K 2;  1YI2 1;  2EG5 A;  5FLX f;  1AUM A;  1VQ8 Z;  1E6J P;  2MY5 A;  1YHQ Z;  1WW9 A;  3E2D A;  3LRY A;  3G26 A;  5D1O B;  2PMZ A;  4HGY A;  3FQM A;  1USP B;  4COC A;  7CEI A;  1YIT 1;  2PM9 A;  1ACP A;  2QA4 Z;  1K9M 2;  3CD6 Z;  2VPY A;  1DL6 A;  3B5I A;  2AFE A;  3G1G A;  1N2F A;  1Q81 1;  1M6E X;  2KWL A;  3HOU I;  1W2B Z;  4F37 A;  1YI2 Z;  2RIQ A;  2LF4 A;  1SIW A;  4NBC A;  3CCS 1;  1Q81 Q;  3M1M A;  1KRL A;  1VQO 1;  3DS2 A;  2BJO A;  4COP A;  1M1K 1;  1VQ7 Z;  5C3E I;  2MVU A;  4Y7N I;  3HKZ A;  2IZ4 A;  4NFR A;  1RQF A;  4XRQ A;  4RVH A;  2JA7 I;  1IMQ A;  5HVC A;  1M1K Q;  1VQL 1;  2OTJ P;  1VQ9 1;  3D2L A;  2E9H A;  2K0X A;  2QRE B;  2VF1 A;  2P3Y A;  3CCR P;  1VHN A;  2FQ1 A;  3RG2 A;  3S14 I;  2NVY I;  1EIA A;  1VQL Z;  2N5H A;  1UJZ A;  2LIW A;  3G6E P;  3MZK B;  1N8R 1;  4QTT A;  1K9M Q;  2J6A A;  3CCV 1;  3B4Q A;  5HGL A;  3GTK I;  2GZF A;  2G2K A;  3PO3 S;  2LEX A;  1M90 1;  4A3G I;  3RZO I;  1YJW Z;  3CCL P;  3CMA Z;  3CCE P;  2JAZ A;  1NJI Q;  1RNI A;  2HF1 A;  1KQS Y;  1PFT A;  4A3C I;  3CMA P;  3CCL Z;  3M4O I;  2YU9 I;  3GZL A;  1YIJ P;  2B63 I;  5KP6 B;  2XXM A;  2JYG A;  4XFZ A;  4PWV B;  1F80 D;  2K92 A;  3G6E 1;  1NJI 1;  4U0B A;  1TWF I;  5D1P A;  2R6M A;  3CPW O;  1QF8 A;  3CQZ I;  4A3F I;  3NH8 A;  3CME P;  3Q87 A;  3DS3 A;  1I50 I;  2P28 A;  3BG0 B;  1Y1V S;  2GYK A;  4HKG A;  4RVF A;  3GKL C;  3CCJ P;  2RPR A;  3CCM P;  2E1M A;  2L4B A;  2QEX P;  2KGC A;  4TNU A;  1Q86 1;  2W04 A;  3CCJ Z;  5F2K A;  2O53 A;  1FR2 A;  3CC4 Z;  2AKL A;  3HOX I;  2NVQ I;  4BBS I;  1ZNV A;  3HYB A;  2QEX 1;  2KG9 A;  2OOX B;  3CC4 P;  3H4E A;  2K2Q A;  3T4N B;  2R92 I;  2OTL Z;  2ERH A;  1YHQ P;  3P05 A;  3WBH A;  2PK7 A;  3H3V J;  3DS1 A;  2Q4Z A;  2JIR A;  3CC4 1;  2OOY B;  1RO2 A;  2LPK A;  3IR7 A;  1DV5 A;  1JJ2 Z;  1DNY A;  1VLA A;  2JUB A;  2KG8 A;  2NVT I;  3CME Z;  1K73 1;  1HY8 A;  2CGQ A;  2EGT A;  2FVE A;  1AF8 A;  3GTM I;  3ESW A;  3CCQ Z;  2WB1 A;  2PY8 A;  2YAD A;  5LL6 f;  2QRD B;  2WAQ A;  3OW2 Z;  2PEO A;  2R7Z I;  4A3B I;  1Z02 A;  3CD6 P;  2KOP A;  3G4S Z;  4NBD A;  1KC8 1;  5BS2 A;  3GTQ I;  1T8K A;  1LQL A;  1K8A 1;  2JGP A;  2JQ4 A;  1YJN P;  1VQM 1;  1YJ9 Z;  2VPZ A;  2DGY A;  2KPI A;  5T64 A;  5C4J I;  2VLO A;  2K3R A;  2PEN A;  3S1N I;  1YJN Z;  1AYI A;  2KGD A;  1VQ8 1;  1X0T A;  1SFO I;  1KQS O;  4NBE A;  2HU9 A;  1CEI A;  1KC8 Q;  3CCM 1;  1QVG Y;  1P9N A;  2EFJ A;  1K73 2;  1VQN 1;  3CMA 1;  3GTM S;  3I55 1;  1GPJ A;  4U0C A;  4R0M A;  2JIQ A;  1QVF O;  3M3Y I;  4M0I A;  3I56 P;  1VQ6 P;  1VQL P;  4DK1 A;  4NBA A;  4MD7 A;  2AFD A;  2FAC A;  1Q16 A;  2JR6 A;  3U50 C;  1VQP Z;  3CCR Z;  3HZQ A;  1MZ8 A;  1ML8 A;  2AF8 A;  2JU2 A;  3HOY I;  2JA5 I;  1D1D A;  2KOR A;  2LKI A;  1M74 A;  1EMV A;  3CCU 1;  1VQP 1;  1QVF Z;  2LML A;  1YIJ Z;  3KIF A;  2N98 A;  3NFZ A;  3P5J B;  2GZI A;  2M8N A;  2MR7 A;  1KD1 Q;  1VQ5 P;  2VPX A;  1OR5 A;  5EJD A;  4A3E I;  1VQN Z;  2KG6 A;  1AA6 A;  1M90 Q;  3OW2 Y;  1VQ9 P;  1NQ4 A;  1Q82 Q;  3NH4 A;  2JO0 A;  2XZ1 C;  4MRT C;  1QVG O;  2OZK A;  1TWG I;  3MGE A;  4U0D A;  1YJN 1;  3S17 I;  4IZ6 A;  4BPF A;  1NJI 2;  4EWC A;  1YJ9 1;  2P9X A;  4XFX A;  4RVD A;  1BAJ A;  3NTE A;  3NDI A;  3H47 A;  3GTO I;  2QLV B;  1JJ2 Y;  2ONT A;  1WII A;  1QXF A;  5EW5 E;  5FLX b;  2JS4 A;  2XV6 A;  2QKD A;  3CXC Y;  2KGE A;  5D1O A;  2FQ2 A;  4A3L I;  2KOQ A;  2ROQ A;  3DPH A;  3CCU Z;  2K0D X;  1K73 Q;  1IMP A;  1S72 Z;  4A3D I;  4E2W A;  3EER A;  3S16 I;  1L0I A;  4PH1 A;  4PH0 A;  2K94 A;  1VQ9 Z;  4NB9 A;  3FKI I;  2Z46 A;  2JBG A;  1K8A Q;  2GU2 A;  2E2H I;  2GZG A;  2VLN A;  2F4M A;  4H2W C;  4XFY A;  1Q86 2;  4E31 A;  1VQ7 1;  3CCJ 1;  3I55 Z;  1VQO Z;  3G4S P;  3GTL I;  2OAR A;  1FDI A;  3PO2 I;  3DS5 A;  2N50 A;  4HGZ A;  1Q7Y 2;  2DNW A;  2VLP A;  3F3P C;  4CL1 A;  1VQ4 1;  2GDY A;  3CD6 1;  2QA4 1;  5AN9 F;  5T67 A;  2N6Z A;  3D6W A;  3CCU P;  4E2Z A;  1Q86 Q;  1BXI A;  4GR6 A;  2O4H A;  2K0Y A;  2FAE A;  1YUA A;  3JAM b;  1Y1V I;  5F2O A;  2CG5 B;  2QRC B;  2VUG A;  2CNR A;  3HOZ I;  1IUQ A;  3CCL 1;  1A43 A;  3VMG A;  1VQM P;  1NUI A;  4NEO A;  3CC7 Z;  1M90 2;  1UNK A;  2PEI A;  2PEJ A;  2Q51 A;  2R93 I;  3G28 A;  2GZE A;  1GXH A;  2IZ3 A;  3IF8 A;  4RV9 A;  2VLQ A;  2K5X A;  5KP7 B;  3IX0 A;  4UHP B;  1EOQ A;  2LIY A;  3S2D I;  2XZ0 D;  3G0V A;  3VMH A;  2EIA A;  3F3F C;  3TE5 B;  1N8R Q;  4NOZ A;  2OTJ 1;  3G71 1;  3CCE Z;  1S7M A;  1VQK Z;  2JU1 A;  3CC2 1;  1Y8C A;  2ZAE B;  1W2B Y;  2NVX I;  2BUO A;  2JIP A;  2QR1 B;  1YI2 P;  2JA8 I;  1TWA I;  3J80 b;  3GZM A;  4PXH B;  4E33 A;  2IV2 X;  1QRJ A;  2M48 A;  1ZH1 A;  2N6Y A;  4Y52 I;  3CCS Z;  3CC7 1;  3EED A;  3RZD I;  2F4O A;  2KGA A;  1Q81 2;  3GTJ I;  3I4M I;  3NY7 B;  2AVA A;  1K9M 1;  2K5R A;  4H2X C;  1TFI A;  2KOO A;  5CZD B;  1Z03 A;  4MH4 A;  2MF4 A;  3DTJ A;  4A3J I;  3I4N I;  2L6E A;  3EJE A;  3U43 A;  2JA6 I;  3NH5 A;  1Z01 A;  2M8L A;  1YUK A;  2MR8 A;  3BG1 B;  3PO3 I;  1Q7Y 1;  4E30 A;  3G29 A;  3DS4 A;  3I56 1;  1VQ5 Z;  1VQ6 1;  1YHQ 1;  2QNW A;  4H2Y C;  2VPW A;  2V3V A;  3CME 1;  1TWH I;  4A3M I;  1YJW P;  1QVF Y;  4X6A I;  4QKO A;  1YIJ 1;  2KOS A;  4BPG A;  1ZB8 A;  3J7A 4;  4MON A;  1TWC I;  2GTI A;  4AYB A;  1KD1 2;  2KW2 A;  2V8K A;  1JJ2 O;  2JYL A;  1VQK 1;  2GDW A;  3NDJ A;  3I55 P;  1WZN A;  2PNG A;  5C44 I;  2GDX A;  3J80 f;  3G71 Z;  3CCE 1;  5A2Q f;  3VMI A;  2JIM A;  3LUS A;  2LOL A;  3VRL C;  1X3W A;  2E2J I;  5IT9 b;  1Q82 1;  3IFU A; 
#chains in the Genus database with same CATH homology
 3G21 A;  1YJ9 P;  1A8O A;  1RO4 A;  2QEX Z;  3CC2 P;  4A3I I;  5F2N A;  5JPA A;  3GKQ A;  1L1O C;  2Z44 A;  2JMO A;  1NP6 A;  1VQ7 P;  4MD8 A;  1JWH C;  5IP7 I;  3I56 Z;  1VQ5 1;  1VQ6 Z;  5HGM A;  1VQM Z;  4MXU A;  1QYP A;  4BY1 I;  3Q20 A;  3S1R I;  4MD9 A;  3CPW Z;  3RG6 C;  1ZB9 A;  3CXC Z;  2RBL A;  3VB9 A;  3G6E Z;  2OTL P;  1S72 P;  4IPY A;  3TDH B;  1KC8 2;  3J81 f;  3MZL B;  1VQ4 Z;  1I3Q I;  2I3C A;  3FQQ A;  5I4T G;  4XRO A;  3CCQ P;  3S15 I;  2DE7 A;  3S2H I;  2VUM I;  4U0E A;  4E2X A;  2QA4 P;  1VQN P;  1VQO P;  1I6H I;  2CWO A;  5HGN A;  1YIT P;  5BS1 A;  5T6B A;  2M8P A;  2M6N A;  2OTL 1;  2DE5 A;  3GTP I;  4NBH A;  1ZMB A;  1Q82 2;  3G1I A;  3HOV I;  4HH4 A;  2OTJ Z;  4QNB A;  4NBB A;  1X3Z A;  3MON A;  3CCR 1;  3K7A I;  3QWU A;  4RS4 A;  3H0G I;  3VTN A;  1W2B O;  1Q7Y Q;  1VQP P;  1RO0 A;  3GCF A;  1VQ4 P;  5IT9 f;  3J81 b;  2E2I I;  3CPW Y;  3H0D A;  2Y0S A;  5HGO A;  2DE6 A;  2RHB A;  3CXC O;  4RVG A;  1K83 I;  3CCM Z;  4S1T A;  4A93 I;  2Z45 A;  4WYM A;  1QVG Z;  2XT1 A;  1K8A 2;  1R9T I;  4DQY B;  2RT9 A;  2JNY A;  1KQS Z;  3I07 A;  4BXX I;  1VQK P;  1YIT Z;  2GTH A;  4BBR I;  3G4S 1;  2LFU A;  4NBG A;  1M6N A;  2H85 A;  3CCQ 1;  3HOW I;  3G71 P;  2V8J A;  3OW2 O;  1YJW 1;  5DCK A;  3S1Q I;  4NB8 A;  3CCV Z;  3JAM f;  5CM2 M;  2PEM A;  3CCS P;  4A3K I;  3D9X A;  2KOD A;  1K30 A;  3CCV P;  1WCM I;  4XX2 A;  2BHV A;  3DS0 A;  4QTU A;  3CC2 Z;  1N8R 2;  2KI7 B;  5C4X I;  4MRI A;  2W03 A;  1USP A;  4E32 A;  1Y1W I;  2PEQ A;  3KIH A;  4BY7 I;  4U0A A;  4NH1 C;  3S1M I;  5IP9 I;  2PEK A;  1RLY A;  5A2Q b;  1KD1 1;  4DGL A;  4E2Y A;  5FLM I;  1S72 1;  4GR2 A;  4NBF A;  3GTG I;  2V8I A;  3CC7 P;  1VQ8 P;  4U0F A;  1M1K 2;  1YI2 1;  2EG5 A;  5FLX f;  1AUM A;  1VQ8 Z;  1E6J P;  1YHQ Z;  1WW9 A;  3E2D A;  3LRY A;  3G26 A;  5D1O B;  2PMZ A;  4HGY A;  3FQM A;  1USP B;  4COC A;  1YIT 1;  2PM9 A;  1K9M 2;  2QA4 Z;  3CD6 Z;  1DL6 A;  3B5I A;  1N2F A;  3G1G A;  1Q81 1;  1M6E X;  3HOU I;  1W2B Z;  1YI2 Z;  2RIQ A;  2LF4 A;  4NBC A;  3CCS 1;  1Q81 Q;  3M1M A;  1KRL A;  1VQO 1;  3DS2 A;  2BJO A;  4COP A;  1M1K 1;  1VQ7 Z;  5C3E I;  4Y7N I;  3HKZ A;  2IZ4 A;  4NFR A;  1RQF A;  4XRQ A;  4RVH A;  2JA7 I;  1M1K Q;  1VQL 1;  2OTJ P;  1VQ9 1;  2E9H A;  2QRE B;  2VF1 A;  2P3Y A;  3CCR P;  3S14 I;  2NVY I;  1EIA A;  1VQL Z;  3G6E P;  3MZK B;  1N8R 1;  4QTT A;  1K9M Q;  2J6A A;  3CCV 1;  5HGL A;  3GTK I;  2G2K A;  3PO3 S;  1M90 1;  4A3G I;  3RZO I;  1YJW Z;  3CCL P;  3CMA Z;  3CCE P;  1NJI Q;  1RNI A;  2HF1 A;  1KQS Y;  1PFT A;  4A3C I;  3CMA P;  3CCL Z;  3M4O I;  2YU9 I;  1YIJ P;  2B63 I;  2XXM A;  2JYG A;  4XFZ A;  3G6E 1;  1NJI 1;  4U0B A;  1TWF I;  5D1P A;  2R6M A;  3CPW O;  1QF8 A;  3CQZ I;  4A3F I;  3NH8 A;  3Q87 A;  3CME P;  3DS3 A;  1I50 I;  2P28 A;  3BG0 B;  1Y1V S;  4RVF A;  3CCJ P;  2RPR A;  3CCM P;  2E1M A;  1Q86 1;  2QEX P;  4TNU A;  2W04 A;  3CCJ Z;  5F2K A;  2O53 A;  3CC4 Z;  2AKL A;  3HOX I;  2NVQ I;  4BBS I;  3HYB A;  2QEX 1;  2OOX B;  3CC4 P;  3H4E A;  3T4N B;  2R92 I;  2OTL Z;  1YHQ P;  3P05 A;  3WBH A;  2PK7 A;  3H3V J;  3DS1 A;  2Q4Z A;  3CC4 1;  2OOY B;  1RO2 A;  1JJ2 Z;  1VLA A;  2JUB A;  2NVT I;  3CME Z;  1K73 1;  2EGT A;  3GTM I;  3ESW A;  3CCQ Z;  2WB1 A;  2PY8 A;  2YAD A;  5LL6 f;  2QRD B;  2WAQ A;  3OW2 Z;  2PEO A;  2R7Z I;  4A3B I;  1Z02 A;  3CD6 P;  1KC8 1;  3G4S Z;  4NBD A;  3GTQ I;  5BS2 A;  1LQL A;  1K8A 1;  1YJN P;  1VQM 1;  1YJ9 Z;  2DGY A;  2KPI A;  5T64 A;  5C4J I;  2K3R A;  2PEN A;  3S1N I;  1YJN Z;  1VQ8 1;  1X0T A;  1SFO I;  1KQS O;  4NBE A;  2HU9 A;  1KC8 Q;  3CCM 1;  1QVG Y;  1P9N A;  2EFJ A;  1K73 2;  1VQN 1;  3CMA 1;  3GTM S;  3I55 1;  4U0C A;  1QVF O;  3M3Y I;  4M0I A;  3I56 P;  1VQ6 P;  1VQL P;  4DK1 A;  4NBA A;  4MD7 A;  2JR6 A;  3U50 C;  1VQP Z;  3CCR Z;  3HZQ A;  1ML8 A;  3HOY I;  2JA5 I;  1D1D A;  1M74 A;  1VQP 1;  3CCU 1;  1QVF Z;  1YIJ Z;  3KIF A;  3NFZ A;  3P5J B;  2M8N A;  1KD1 Q;  1VQ5 P;  4A3E I;  1VQN Z;  1M90 Q;  3OW2 Y;  1VQ9 P;  1Q82 Q;  3NH4 A;  2JO0 A;  2OZK A;  1QVG O;  1TWG I;  3MGE A;  4U0D A;  1YJN 1;  3S17 I;  1NJI 2;  4EWC A;  1YJ9 1;  2P9X A;  4XFX A;  4RVD A;  1BAJ A;  3NTE A;  3NDI A;  3H47 A;  3GTO I;  2QLV B;  1JJ2 Y;  2ONT A;  1WII A;  5FLX b;  2JS4 A;  2XV6 A;  2QKD A;  3CXC Y;  5D1O A;  4A3L I;  3DPH A;  3CCU Z;  1K73 Q;  1S72 Z;  4A3D I;  4E2W A;  3EER A;  3S16 I;  4PH1 A;  4PH0 A;  1VQ9 Z;  4NB9 A;  3FKI I;  2Z46 A;  1K8A Q;  2GU2 A;  2E2H I;  2F4M A;  4XFY A;  1Q86 2;  4E31 A;  1VQ7 1;  3CCJ 1;  3I55 Z;  1VQO Z;  3G4S P;  3GTL I;  2OAR A;  3PO2 I;  3DS5 A;  4HGZ A;  1Q7Y 2;  3F3P C;  4CL1 A;  1VQ4 1;  3CD6 1;  2QA4 1;  5AN9 F;  5T67 A;  3D6W A;  3CCU P;  4E2Z A;  1Q86 Q;  4GR6 A;  2O4H A;  1YUA A;  3JAM b;  1Y1V I;  5F2O A;  2QRC B;  2VUG A;  3HOZ I;  1IUQ A;  3CCL 1;  1A43 A;  3VMG A;  1VQM P;  1NUI A;  3CC7 Z;  1M90 2;  2PEI A;  2PEJ A;  2Q51 A;  2R93 I;  3G28 A;  2IZ3 A;  3IF8 A;  4RV9 A;  3IX0 A;  1EOQ A;  2LIY A;  3S2D I;  3G0V A;  3VMH A;  2EIA A;  3F3F C;  3TE5 B;  1N8R Q;  4NOZ A;  2OTJ 1;  3G71 1;  3CCE Z;  1S7M A;  1VQK Z;  3CC2 1;  2ZAE B;  1W2B Y;  2NVX I;  2BUO A;  2QR1 B;  1YI2 P;  2JA8 I;  1TWA I;  3J80 b;  4E33 A;  1QRJ A;  2M48 A;  1ZH1 A;  4Y52 I;  3CCS Z;  3CC7 1;  3EED A;  3RZD I;  2F4O A;  1Q81 2;  3GTJ I;  3I4M I;  1K9M 1;  2K5R A;  1TFI A;  4MH4 A;  1Z03 A;  4A3J I;  3DTJ A;  3I4N I;  2L6E A;  2JA6 I;  3NH5 A;  1Z01 A;  2M8L A;  1YUK A;  3BG1 B;  3PO3 I;  1Q7Y 1;  4E30 A;  3G29 A;  3DS4 A;  3I56 1;  1VQ5 Z;  1VQ6 1;  1YHQ 1;  3CME 1;  4A3M I;  1TWH I;  1QVF Y;  1YJW P;  4X6A I;  1YIJ 1;  1ZB8 A;  3J7A 4;  4MON A;  1TWC I;  2GTI A;  4AYB A;  1KD1 2;  2V8K A;  1JJ2 O;  2JYL A;  1VQK 1;  3NDJ A;  3I55 P;  5C44 I;  3J80 f;  3G71 Z;  3CCE 1;  5A2Q f;  3VMI A;  3LUS A;  3VRL C;  1X3W A;  2E2J I;  5IT9 b;  1Q82 1;  3IFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...