1RO0A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m semet remote
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 61
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro0A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro0A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro0A02
3M1MA 1RNIA 1RO0A 1RO2A
chains in the Genus database with same CATH superfamily
4QKOA 1YUKA 4PH1A 2PNGA 2RBLA 3H3VJ 1Y1VI 3I4NI 2JR6A 2FHSC 4UHPB 2ZAEB 5CM2M 1VQ5P 2GZFA 5T6BA 1K732 2FQ1A 5IT9f 2GZJA 3FQMA 1M74A 3CMAP 2KOQA 4S1TA 2OTJ1 2KORA 3MZLB 3HOYI 2L0QA 3GZMA 1YJWP 2XV6A 2O53A 1NJI1 2NVXI 1K8A1 4GR2A 2GZGA 2QA4P 1QVGY 4E30A 2PM9A 3HOZI 3RG2A 1E0HA 1YHQP 1M6NA 2PEQA 2E7ZA 3NDIA 1ZB9A 4NH1C 2EHSA 5I4TG 2GDXA 3LUSA 1HQBA 3GKQA 2JNYA 1YIJZ 1RO4A 5D1OA 1ZNVA 2KG9A 1Y1VS 5FLMI 5T64A 2KR5A 1KRLA 5C3EI 5IT9b 1Q7YQ 1VQOZ 1RNIA 2EFJA 2PY8A 5IP9I 4A3II 1Q811 3NFZA 2LIYA 3OW2O 2YU9I 1F80D 1S72Z 2F4OA 2VPWA 3CXCZ 2KG6A 2RHBA 1RO2A 3H0DA 5LL6f 5F2NA 3CCEZ 4A3CI 1EOQA 2MR7A 1Y1WI 1WZNA 1VQ7Z 4MONA 3CCM1 1W2BY 4U0FA 4TNUA 3G29A 3CCUZ 2WB1A 2B63I 2MY5A 3EEDA 1JWHC 2JQ4A 5F2OA 1Q86Q 1K731 1JJ2Z 3CCJ1 4BBRI 1LQLA 2R7ZI 1RO0A 1VQ91 3DS5A 4EWCA 2M5RA 1S7MA 3CCVZ 2NAPA 3NH4A 3S17I 3HZQA 1M90Q 2W04A 3J81f 3J7A4 4A3EI 4HGYA 1T8KA 3CPWO 3CC2Z 2E1MA 3CC71 2AF8A 2M8PA 1Y8CA 2N6YA 1GXHA 2LMLA 4HH4A 4E2ZA 3QWUA 4NBCA 1KD12 4DGLA 1CEIA 4H2YC 2GZEA 2JB0A 3ESWA 3G0VA 2QRDB 3CCS1 3P5JB 4DK1A 1KQSY 5D1PA 2OTJZ 2VPYA 3G1IA 3CD61 1VQOP 3U43A 1N8RQ 1JJ2Y 1IMQA 2WPTA 3J81b 1S72P 1VQK1 1VQ61 2VUMI 2EIAA 3CCQZ 3GTLI 2JU1A 1ACPA 2FVAA 1I50I 3CCEP 2KWLA 2PENA 1AYIA 3H4EA 1VQLZ 1K9M2 2JMOA 2Q4ZA 1VQ81 2JUBA 2E2JI 1KC8Q 1RLYA 3CCUP 3M1MA 2MR8A 3KIFA 2E2HI 4XFZA 5EJDA 2DE6A 1Z03A 5C44I 4DQYB 2AFDA 3S1NI 2IZ4A 2M6NA 3CCVP 2E2II 2MVVA 4QTUA 2QREB 2K93A 3G6E1 3CCL1 1DNYA 1QVFY 2K94A 2ROQA 2KOOA 5CZDB 2E9HA 4CA3A 3MZKB 4NBFA 3VMGA 2CGQA 3I561 3CE7A 1USPB 4NBGA 3GJNA 3EJBA 3CCMZ 3CC2P 4RV9A 4XFYA 1YJN1 3WBHA 2Z46A 1KD11 4BPFA 2PEOA 4U0CA 2MVUA 2OARA 3DS3A 2V3VA 4RS4A 1ML8A 4H2WC 3GTKI 2CQ8A 3CCJZ 4CL1A 2I3CA 2LTEA 2PK7A 2XXMA 3JAMf 3GTGI 2L9FA 2FVFA 1SIWA 2OTJP 2M48A 1YI2Z 2JIOA 2PEIA 4NB9A 3CC41 3BG0B 3OW2Z 3G711 2DGYA 2LEXA 1X0TA 1VQM1 3VMHA 1NP6A 1K9M1 3CCQP 1Q81Q 4HKGA 1Q7Y2 1SFOI 1Z01A 1E6JP 2P3YA 1OR5A 3GTJI 1VQLP 3PO3I 1VLAA 1QVGO 3EJDA 3I55Z 3S2HI 2NVTI 1K83I 2K5XA 1TFIA 1VQ4Z 3CMA1 2OOXB 3CCSZ 1D1DA 1YJW1 2PEJA 4RVDA 3JAMb 3S14I 3CD6Z 1L0HA 1BXIA 2QA41 3LRYA 3HYBA 4A3DI 3S16I 1VQKZ 2CNRA 2KGEA 1M1KQ 1YHQ1 2P28A 3HOUI 1QXFA 2K0YA 1Q862 2R92I 4A3GI 3HOWI 1ZB8A 2LIUA 3GTMI 3Q87A 3MGEA 5A2Qf 2JIMA 1AA6A 3CPWZ 2K0DX 3CCMP 4RVGA 3VTNA 3GTQI 2FAEA 4BY1I 2VF1A 2N6ZA 3PO3S 2BHVA 4IZ6A 1Z02A 3S1MI 4MXUA 4AYBA 2JO0A 1M902 1NQ4A 5HVCA 2LIWA 4XX2A 2QKDA 3CCJP 3GTPI 1W2BO 4Y7NI 2K92A 1TWFI 1VQ9P 1X3OA 2Z44A 1R9TI 2YADA 4COCA 1A43A 3RZOI 1TWHI 2IV2X 1YI2P 1YIT1 4A3BI 2JA6I 3LMOA 4NBDA 2LFUA 1K30A 2VPXA 2JIPA 3RZDI 1GXGA 1Q7Y1 3I56Z 1VQP1 3HKZA 3HOXI 1BAJA 1YJNZ 2XT1A 5A2Qb 3CXCY 3GTMS 2LKIA 2JU2A 3IF8A 1N8R2 3S2DI 4MRIA 4U0EA 3CCR1 1N2FA 2KOSA 4A3LI 3I55P 1VQ4P 5IP7I 3E2DA 1X3ZA 5T67A 2R93I 4BPGA 4A3MI 4XROA 1I3QI 3CCSP 2OTL1 1NUIA 1YUAA 2V8JA 4PWVB 3GCFA 3CD6P 2NVQI 2KOPA 1IUQA 1Q82Q 3CC4Z 2CWOA 5HV8A 1Q861 1KC82 2L4BA 5F2KA 3G71Z 1KQSO 1VQKP 4XFXA 2JBGA 2K2QA 2GTHA 3NH5A 1YJ91 2NVYI 1JJ2O 1VQN1 2WAQA 1YIJ1 2HF1A 2PMZA 4E33A 1M901 4U0DA 1UJZA 2FQ0A 2QR1B 4QNBA 1VQO1 3DS0A 2ONTA 3CQZI 1TWCI 3F3FC 4X6AI 3G4S1 3D9XA 2DNWA 2JA5I 4H2XC 2F4MA 1DL6A 4R0MA 1QF8A 1M6EX 2DE5A 3TE5B 4XRQA 5KP6B 1MZ8A 3G6EP 2M8LA 4PH0A 1TWGI 1VQ71 4IPYA 3T4NB 2JIRA 3VRLC 3I56P 4U0AA 5C4JI 2GDWA 3D2LA 1NJIQ 1YJNP 1QVFO 1K8AQ 4QTTA 2GU2A 2L6EA 2VPZA 3B4QA 1UNKA 3CME1 3DS2A 4E2WA 2GZIA 1VQ9Z 3G1GA 1Q812 2VLOA 2GYKA 3S15I 2LOLA 1ZH1A 3DTJA 2KGDA 2QEX1 1A8OA 3CC4P 3EERA 2JYGA 4MD7A 2M8NA 3G71P 2VLQA 3H0GI 4NBBA 1VQPZ 4Y52I 2OOYB 3CC7Z 1X3WA 2LL8A 4NOZA 3J80f 2VLPA 2VUGA 2AVAA 2BJOA 1TWAI 1VQ51 1I6HI 3GTOI 3CCRZ 4PXHB 2JA7I 4WYMA 1FDIA 1VKUA 1M1K2 1P9NA 1QYPA 4MD9A 1FR2A 2MF4A 2N98A 4NEOA 5DCKA 3VMIA 2V8IA 4NBHA 2OTLZ 1Q16A 4HGZA 1AUMA 1WW9A 3NDJA 1W2BZ 2PEKA 3FKII 1GPJA 2LF4A 1EIAA 2KGCA 3P05A 1VQ6Z 1K73Q 3CCQ1 3IX0A 1PFTA 2LPKA 1VHNA 3DS4A 1YJ9Z 1VQL1 3J80b 1VQNZ 1WCMI 2RPRA 1VQ8Z 3OW2Y 1WJ2A 5HGMA 2GDYA 5KP8B 3S1QI 4A3FI 2K5RA 2FADA 2ERHA 2VLNA 2O4HA 2MD9A 5KP7B 3HOVI 4A3JI 3PO2I 4A93I 1L0IA 4BPHA 3G4SZ 5D1OB 3IFUA 2W03A 4NBEA 1FDOA 4BY7I 3G28A 2VSQA 2IZ3A 4RVFA 3G6EZ 5C4XI 3CCLZ 1YITP 2N5IA 5AN9F 3BG1B 2PEMA 2QNWA 4E2YA 5BS1A 2V45A 1KQSZ 3G26A 1VQPP 3CC7P 3FQQA 3RG6C 4DG9A 5BS2A 2XZ0D 2RT9A 3IR7A 2GTIA 1M1K1 3NY7B 2N50A 1Q822 3GZLA 3I07A 3CCRP 3U50C 1WIIA 3CMEZ 1EMVA 3CXCO 2FQ2A 3CPWY 3B5IA 2Q51A 3NTEA 1YI21 5HGOA 2OTLP 4E2XA 3GKLC 3F3PC 4BBSI 2JYLA 2QEXZ 4GR6A 2EGTA 3M4OI 1VQ6P 3TDHB 2JIQA 1VQMZ 3Q20A 1YJ9P 2KGAA 1AF8A 2XZ1C 3G21A 1VQNP 1VQ5Z 4MRTC 3I551 2HU9A 1YIJP 2G2KA 1VQ41 2FACA 1VQ8P 3CMAZ 2OZKA 2RIQA 2AFEA 1QVFZ 4MD8A 2JAZA 4NFRA 2FVEA 3KIHA 1YJWZ 3MONA 3NH8A 2H85A 2N5HA 2KODA 4COPA 1KLPA 1S721 2AYDA 3EJEA 1KD1Q 5FLXf 3G4SP 2QA4Z 1USPA 4F37A 4NBAA 1NJI2 2JA8I 3M3YI 1QRJA 1K8A2 3H47A 3CCE1 4M0IA 2JS4A 1YHQZ 1ZMBA 3DS1A 2JGPA 2K0XA 3CCLP 1DV5A 4A3KI 3VB9A 1VQ7P 2DE7A 4MH4A 3I4MI 1RQFA 3K7AI 4NB8A 1N8R1 2K3RA 2Y0SA 3CCU1 5HGNA 1Q821 1IMPA 2X2BA 2KW2A 3DPHA 4E31A 2J6AA 2P9XA 5EW5E 1QVGZ 3S1RI 1K9MQ 3D6WA 3CMEP 3CCV1 4U0BA 2BUOA 1HY8A 1L1OC 5JPAA 5FLXb 2L22A 1KC81 2KPIA 1Z6MA 2EG5A 2V8KA 2QRCB 2AKLA 2QLVB 2NO8A 1YITZ 2Z45A 2KG8A 2KI7B 2CG5B 2EHTA 2QEXP 7CEIA 3CC21 4E32A 5HGLA 4RVHA 4BXXI 1VQMP 2R6MA
chains in the Genus database with same CATH topology
1YUKA 4PH1A 2RBLA 3H3VJ 1Y1VI 3I4NI 2JR6A 2ZAEB 5CM2M 1VQ5P 5T6BA 1K732 5IT9f 3FQMA 1M74A 3CMAP 4S1TA 2OTJ1 3MZLB 3HOYI 2NVXI 1YJWP 2O53A 2XV6A 1NJI1 1K8A1 4GR2A 2QA4P 1QVGY 4E30A 2PM9A 3HOZI 1YHQP 1M6NA 2PEQA 3NDIA 1ZB9A 4NH1C 5I4TG 3LUSA 3GKQA 2JNYA 1YIJZ 1RO4A 5D1OA 1Y1VS 5FLMI 5T64A 1KRLA 5C3EI 5IT9b 1Q7YQ 1VQOZ 1RNIA 2EFJA 2PY8A 5IP9I 4A3II 1Q811 3NFZA 2LIYA 3OW2O 2YU9I 1S72Z 2F4OA 3CXCZ 2RHBA 1RO2A 3H0DA 5LL6f 5F2NA 3CCEZ 4A3CI 1EOQA 1Y1WI 1VQ7Z 4MONA 3CCM1 1W2BY 4U0FA 4TNUA 3G29A 3CCUZ 2WB1A 2B63I 3EEDA 1JWHC 5F2OA 1Q86Q 1K731 1JJ2Z 3CCJ1 4BBRI 1LQLA 2R7ZI 1RO0A 1VQ91 3DS5A 4EWCA 1S7MA 3CCVZ 3NH4A 3S17I 3HZQA 1M90Q 2W04A 3J81f 3J7A4 4A3EI 4HGYA 3CPWO 3CC2Z 2E1MA 3CC71 2M8PA 4HH4A 4E2ZA 3QWUA 4NBCA 1KD12 4DGLA 3ESWA 3G0VA 2QRDB 3CCS1 3P5JB 4DK1A 1KQSY 5D1PA 2OTJZ 3G1IA 3CD61 1VQOP 1N8RQ 1JJ2Y 3J81b 1S72P 1VQK1 1VQ61 2VUMI 2EIAA 3CCQZ 3GTLI 1I50I 3CCEP 2PENA 3H4EA 1VQLZ 1K9M2 2JMOA 2Q4ZA 1VQ81 2JUBA 2E2JI 1KC8Q 1RLYA 3CCUP 3M1MA 3KIFA 2E2HI 4XFZA 2DE6A 1Z03A 5C44I 4DQYB 3S1NI 2IZ4A 2M6NA 3CCVP 2E2II 4QTUA 2QREB 3G6E1 3CCL1 1QVFY 2E9HA 3VMGA 3MZKB 4NBFA 3I561 1USPB 4NBGA 3CCMZ 3CC2P 4RV9A 4XFYA 1YJN1 3WBHA 2Z46A 1KD11 2PEOA 4U0CA 2OARA 3DS3A 4RS4A 1ML8A 3GTKI 3CCJZ 4CL1A 2I3CA 2PK7A 2XXMA 3JAMf 3GTGI 2OTJP 2M48A 1YI2Z 2PEIA 4NB9A 3CC41 3BG0B 3OW2Z 3G711 2DGYA 1X0TA 1VQM1 3VMHA 1NP6A 1K9M1 3CCQP 1Q81Q 1Q7Y2 1SFOI 1Z01A 1E6JP 2P3YA 3GTJI 1VQLP 3PO3I 1VLAA 1QVGO 3I55Z 3S2HI 2NVTI 1K83I 1TFIA 1VQ4Z 3CMA1 2OOXB 3CCSZ 1D1DA 1YJW1 2PEJA 4RVDA 3JAMb 3S14I 3CD6Z 2QA41 3LRYA 3HYBA 4A3DI 3S16I 1VQKZ 1M1KQ 1YHQ1 2P28A 3HOUI 1Q862 4A3GI 2R92I 3HOWI 1ZB8A 3GTMI 3Q87A 3MGEA 5A2Qf 3CPWZ 3VTNA 3CCMP 4RVGA 3GTQI 4BY1I 2VF1A 3PO3S 2BHVA 1Z02A 3S1MI 4MXUA 4AYBA 2JO0A 1M902 4XX2A 2QKDA 3CCJP 3GTPI 1W2BO 4Y7NI 1TWFI 1VQ9P 2Z44A 1R9TI 2YADA 4COCA 1A43A 3RZOI 1TWHI 1YIT1 1YI2P 4A3BI 2JA6I 4NBDA 2LFUA 1K30A 3RZDI 1Q7Y1 3I56Z 1VQP1 3HKZA 3HOXI 1BAJA 1YJNZ 2XT1A 5A2Qb 3CXCY 3GTMS 3IF8A 1N8R2 3S2DI 4MRIA 4U0EA 3CCR1 1N2FA 4A3LI 3I55P 1VQ4P 5IP7I 3E2DA 1X3ZA 5T67A 2R93I 4A3MI 4XROA 1I3QI 3CCSP 2OTL1 1NUIA 1YUAA 2V8JA 3GCFA 3CD6P 2NVQI 1Q82Q 1IUQA 3CC4Z 2CWOA 1Q861 1KC82 5F2KA 3G71Z 1KQSO 1VQKP 4XFXA 2GTHA 3NH5A 1YJ91 2NVYI 1JJ2O 1VQN1 2WAQA 1YIJ1 2HF1A 2PMZA 4E33A 1M901 4U0DA 2QR1B 4QNBA 1VQO1 3DS0A 2ONTA 3CQZI 1TWCI 3F3FC 4X6AI 3G4S1 3D9XA 2JA5I 2F4MA 1DL6A 1QF8A 1M6EX 2DE5A 3TE5B 4XRQA 3G6EP 2M8LA 4PH0A 1TWGI 1VQ71 4IPYA 3T4NB 3VRLC 3I56P 4U0AA 5C4JI 1NJIQ 1YJNP 1QVFO 1K8AQ 4QTTA 2GU2A 2L6EA 3CME1 3DS2A 4E2WA 1VQ9Z 3G1GA 1Q812 3S15I 1ZH1A 3DTJA 2QEX1 1A8OA 3CC4P 3EERA 2JYGA 4MD7A 2M8NA 3G71P 3H0GI 4NBBA 1VQPZ 4Y52I 2OOYB 3CC7Z 1X3WA 4NOZA 3J80f 2VUGA 2BJOA 1TWAI 1VQ51 1I6HI 3GTOI 3CCRZ 2JA7I 4WYMA 1M1K2 1P9NA 1QYPA 4MD9A 5DCKA 3VMIA 2V8IA 4NBHA 2OTLZ 4HGZA 1AUMA 1WW9A 3NDJA 1W2BZ 2PEKA 3FKII 2LF4A 1EIAA 3P05A 1VQ6Z 1K73Q 3CCQ1 3IX0A 1PFTA 3DS4A 1YJ9Z 1VQL1 3J80b 1VQNZ 1WCMI 2RPRA 1VQ8Z 3OW2Y 5HGMA 3S1QI 4A3FI 2K5RA 2O4HA 3HOVI 4A3JI 3PO2I 4A93I 3G4SZ 5D1OB 3IFUA 2W03A 4NBEA 4BY7I 3G28A 2IZ3A 4RVFA 3G6EZ 5C4XI 3CCLZ 1YITP 5AN9F 3BG1B 2PEMA 4E2YA 5BS1A 1KQSZ 3G26A 1VQPP 3CC7P 3FQQA 3RG6C 5BS2A 2RT9A 2GTIA 1M1K1 1Q822 3I07A 3CCRP 3U50C 1WIIA 3CMEZ 3CXCO 3CPWY 3B5IA 2Q51A 3NTEA 1YI21 5HGOA 2OTLP 4E2XA 3F3PC 4BBSI 2JYLA 2QEXZ 4GR6A 2EGTA 3M4OI 1VQ6P 3TDHB 1VQMZ 3Q20A 1YJ9P 3G21A 1VQNP 1VQ5Z 3I551 2HU9A 1YIJP 2G2KA 1VQ41 1VQ8P 3CMAZ 2OZKA 2RIQA 1QVFZ 4MD8A 4NFRA 3KIHA 1YJWZ 3MONA 3NH8A 2H85A 4COPA 2KODA 1S721 1KD1Q 5FLXf 2QA4Z 3G4SP 1USPA 4NBAA 1NJI2 2JA8I 3M3YI 1QRJA 1K8A2 3H47A 3CCE1 4M0IA 2JS4A 1YHQZ 1ZMBA 3DS1A 3CCLP 4A3KI 3VB9A 1VQ7P 2DE7A 4MH4A 3I4MI 1RQFA 3K7AI 4NB8A 1N8R1 2K3RA 2Y0SA 3CCU1 5HGNA 1Q821 3DPHA 4E31A 2J6AA 2P9XA 1QVGZ 3S1RI 1K9MQ 3D6WA 3CMEP 3CCV1 4U0BA 2BUOA 1L1OC 5JPAA 5FLXb 1KC81 2KPIA 2EG5A 2V8KA 2QRCB 2AKLA 2QLVB 1YITZ 2Z45A 2KI7B 2QEXP 3CC21 4E32A 5HGLA 4RVHA 4BXXI 1VQMP 2R6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RNI A;  1RO0 A;  1RO2 A; 
#chains in the Genus database with same CATH topology
 4QKO A;  1YUK A;  4PH1 A;  2PNG A;  2RBL A;  3H3V J;  1Y1V I;  3I4N I;  2JR6 A;  2FHS C;  4UHP B;  2ZAE B;  5CM2 M;  1VQ5 P;  2GZF A;  5T6B A;  1K73 2;  2FQ1 A;  5IT9 f;  2GZJ A;  3FQM A;  1M74 A;  3CMA P;  2KOQ A;  4S1T A;  2OTJ 1;  2KOR A;  3MZL B;  3HOY I;  2L0Q A;  3GZM A;  1YJW P;  2XV6 A;  2O53 A;  1NJI 1;  2NVX I;  1K8A 1;  4GR2 A;  2GZG A;  2QA4 P;  1QVG Y;  4E30 A;  2PM9 A;  3HOZ I;  3RG2 A;  1E0H A;  1YHQ P;  1M6N A;  2PEQ A;  2E7Z A;  3NDI A;  1ZB9 A;  4NH1 C;  2EHS A;  5I4T G;  2GDX A;  3LUS A;  1HQB A;  3GKQ A;  2JNY A;  1YIJ Z;  1RO4 A;  5D1O A;  1ZNV A;  2KG9 A;  1Y1V S;  5FLM I;  5T64 A;  2KR5 A;  1KRL A;  5C3E I;  5IT9 b;  1Q7Y Q;  1VQO Z;  1RNI A;  2EFJ A;  2PY8 A;  5IP9 I;  4A3I I;  1Q81 1;  3NFZ A;  2LIY A;  3OW2 O;  2YU9 I;  1F80 D;  1S72 Z;  2F4O A;  2VPW A;  3CXC Z;  2KG6 A;  2RHB A;  1RO2 A;  3H0D A;  5LL6 f;  5F2N A;  3CCE Z;  4A3C I;  1EOQ A;  2MR7 A;  1Y1W I;  1WZN A;  1VQ7 Z;  4MON A;  3CCM 1;  1W2B Y;  4U0F A;  4TNU A;  3G29 A;  3CCU Z;  2WB1 A;  2B63 I;  2MY5 A;  3EED A;  1JWH C;  2JQ4 A;  5F2O A;  1Q86 Q;  1K73 1;  1JJ2 Z;  3CCJ 1;  4BBR I;  1LQL A;  2R7Z I;  1RO0 A;  1VQ9 1;  3DS5 A;  4EWC A;  2M5R A;  1S7M A;  3CCV Z;  2NAP A;  3NH4 A;  3S17 I;  3HZQ A;  1M90 Q;  2W04 A;  3J81 f;  3J7A 4;  4A3E I;  4HGY A;  1T8K A;  3CPW O;  3CC2 Z;  2E1M A;  3CC7 1;  2AF8 A;  2M8P A;  1Y8C A;  2N6Y A;  1GXH A;  2LML A;  4HH4 A;  4E2Z A;  3QWU A;  4NBC A;  1KD1 2;  4DGL A;  1CEI A;  4H2Y C;  2GZE A;  2JB0 A;  3ESW A;  3G0V A;  2QRD B;  3CCS 1;  3P5J B;  4DK1 A;  1KQS Y;  5D1P A;  2OTJ Z;  2VPY A;  3G1I A;  3CD6 1;  1VQO P;  3U43 A;  1N8R Q;  1JJ2 Y;  1IMQ A;  2WPT A;  3J81 b;  1S72 P;  1VQK 1;  1VQ6 1;  2VUM I;  2EIA A;  3CCQ Z;  3GTL I;  2JU1 A;  1ACP A;  2FVA A;  1I50 I;  3CCE P;  2KWL A;  2PEN A;  1AYI A;  3H4E A;  1VQL Z;  1K9M 2;  2JMO A;  2Q4Z A;  1VQ8 1;  2JUB A;  2E2J I;  1KC8 Q;  1RLY A;  3CCU P;  3M1M A;  2MR8 A;  3KIF A;  2E2H I;  4XFZ A;  5EJD A;  2DE6 A;  1Z03 A;  5C44 I;  4DQY B;  2AFD A;  3S1N I;  2IZ4 A;  2M6N A;  3CCV P;  2E2I I;  2MVV A;  4QTU A;  2QRE B;  2K93 A;  3G6E 1;  3CCL 1;  1DNY A;  1QVF Y;  2K94 A;  2ROQ A;  2KOO A;  5CZD B;  2E9H A;  4CA3 A;  3MZK B;  4NBF A;  3VMG A;  2CGQ A;  3I56 1;  3CE7 A;  1USP B;  4NBG A;  3GJN A;  3EJB A;  3CCM Z;  3CC2 P;  4RV9 A;  4XFY A;  1YJN 1;  3WBH A;  2Z46 A;  1KD1 1;  4BPF A;  2PEO A;  4U0C A;  2MVU A;  2OAR A;  3DS3 A;  2V3V A;  4RS4 A;  1ML8 A;  4H2W C;  3GTK I;  2CQ8 A;  3CCJ Z;  4CL1 A;  2I3C A;  2LTE A;  2PK7 A;  2XXM A;  3JAM f;  3GTG I;  2L9F A;  2FVF A;  1SIW A;  2OTJ P;  2M48 A;  1YI2 Z;  2JIO A;  2PEI A;  4NB9 A;  3CC4 1;  3BG0 B;  3OW2 Z;  3G71 1;  2DGY A;  2LEX A;  1X0T A;  1VQM 1;  3VMH A;  1NP6 A;  1K9M 1;  3CCQ P;  1Q81 Q;  4HKG A;  1Q7Y 2;  1SFO I;  1Z01 A;  1E6J P;  2P3Y A;  1OR5 A;  3GTJ I;  1VQL P;  3PO3 I;  1VLA A;  1QVG O;  3EJD A;  3I55 Z;  3S2H I;  2NVT I;  1K83 I;  2K5X A;  1TFI A;  1VQ4 Z;  3CMA 1;  2OOX B;  3CCS Z;  1D1D A;  1YJW 1;  2PEJ A;  4RVD A;  3JAM b;  3S14 I;  3CD6 Z;  1L0H A;  1BXI A;  2QA4 1;  3LRY A;  3HYB A;  4A3D I;  3S16 I;  1VQK Z;  2CNR A;  2KGE A;  1M1K Q;  1YHQ 1;  2P28 A;  3HOU I;  1QXF A;  2K0Y A;  1Q86 2;  2R92 I;  4A3G I;  3HOW I;  1ZB8 A;  2LIU A;  3GTM I;  3Q87 A;  3MGE A;  5A2Q f;  2JIM A;  1AA6 A;  3CPW Z;  2K0D X;  3CCM P;  4RVG A;  3VTN A;  3GTQ I;  2FAE A;  4BY1 I;  2VF1 A;  2N6Z A;  3PO3 S;  2BHV A;  4IZ6 A;  1Z02 A;  3S1M I;  4MXU A;  4AYB A;  2JO0 A;  1M90 2;  1NQ4 A;  5HVC A;  2LIW A;  4XX2 A;  2QKD A;  3CCJ P;  3GTP I;  1W2B O;  4Y7N I;  2K92 A;  1TWF I;  1VQ9 P;  1X3O A;  2Z44 A;  1R9T I;  2YAD A;  4COC A;  1A43 A;  3RZO I;  1TWH I;  2IV2 X;  1YI2 P;  1YIT 1;  4A3B I;  2JA6 I;  3LMO A;  4NBD A;  2LFU A;  1K30 A;  2VPX A;  2JIP A;  3RZD I;  1GXG A;  1Q7Y 1;  3I56 Z;  1VQP 1;  3HKZ A;  3HOX I;  1BAJ A;  1YJN Z;  2XT1 A;  5A2Q b;  3CXC Y;  3GTM S;  2LKI A;  2JU2 A;  3IF8 A;  1N8R 2;  3S2D I;  4MRI A;  4U0E A;  3CCR 1;  1N2F A;  2KOS A;  4A3L I;  3I55 P;  1VQ4 P;  5IP7 I;  3E2D A;  1X3Z A;  5T67 A;  2R93 I;  4BPG A;  4A3M I;  4XRO A;  1I3Q I;  3CCS P;  2OTL 1;  1NUI A;  1YUA A;  2V8J A;  4PWV B;  3GCF A;  3CD6 P;  2NVQ I;  2KOP A;  1IUQ A;  1Q82 Q;  3CC4 Z;  2CWO A;  5HV8 A;  1Q86 1;  1KC8 2;  2L4B A;  5F2K A;  3G71 Z;  1KQS O;  1VQK P;  4XFX A;  2JBG A;  2K2Q A;  2GTH A;  3NH5 A;  1YJ9 1;  2NVY I;  1JJ2 O;  1VQN 1;  2WAQ A;  1YIJ 1;  2HF1 A;  2PMZ A;  4E33 A;  1M90 1;  4U0D A;  1UJZ A;  2FQ0 A;  2QR1 B;  4QNB A;  1VQO 1;  3DS0 A;  2ONT A;  3CQZ I;  1TWC I;  3F3F C;  4X6A I;  3G4S 1;  3D9X A;  2DNW A;  2JA5 I;  4H2X C;  2F4M A;  1DL6 A;  4R0M A;  1QF8 A;  1M6E X;  2DE5 A;  3TE5 B;  4XRQ A;  5KP6 B;  1MZ8 A;  3G6E P;  2M8L A;  4PH0 A;  1TWG I;  1VQ7 1;  4IPY A;  3T4N B;  2JIR A;  3VRL C;  3I56 P;  4U0A A;  5C4J I;  2GDW A;  3D2L A;  1NJI Q;  1YJN P;  1QVF O;  1K8A Q;  4QTT A;  2GU2 A;  2L6E A;  2VPZ A;  3B4Q A;  1UNK A;  3CME 1;  3DS2 A;  4E2W A;  2GZI A;  1VQ9 Z;  3G1G A;  1Q81 2;  2VLO A;  2GYK A;  3S15 I;  2LOL A;  1ZH1 A;  3DTJ A;  2KGD A;  2QEX 1;  1A8O A;  3CC4 P;  3EER A;  2JYG A;  4MD7 A;  2M8N A;  3G71 P;  2VLQ A;  3H0G I;  4NBB A;  1VQP Z;  4Y52 I;  2OOY B;  3CC7 Z;  1X3W A;  2LL8 A;  4NOZ A;  3J80 f;  2VLP A;  2VUG A;  2AVA A;  2BJO A;  1TWA I;  1VQ5 1;  1I6H I;  3GTO I;  3CCR Z;  4PXH B;  2JA7 I;  4WYM A;  1FDI A;  1VKU A;  1M1K 2;  1P9N A;  1QYP A;  4MD9 A;  1FR2 A;  2MF4 A;  2N98 A;  4NEO A;  5DCK A;  3VMI A;  2V8I A;  4NBH A;  2OTL Z;  1Q16 A;  4HGZ A;  1AUM A;  1WW9 A;  3NDJ A;  1W2B Z;  2PEK A;  3FKI I;  1GPJ A;  2LF4 A;  1EIA A;  2KGC A;  3P05 A;  1VQ6 Z;  1K73 Q;  3CCQ 1;  3IX0 A;  1PFT A;  2LPK A;  1VHN A;  3DS4 A;  1YJ9 Z;  1VQL 1;  3J80 b;  1VQN Z;  1WCM I;  2RPR A;  1VQ8 Z;  3OW2 Y;  1WJ2 A;  5HGM A;  2GDY A;  5KP8 B;  3S1Q I;  4A3F I;  2K5R A;  2FAD A;  2ERH A;  2VLN A;  2O4H A;  2MD9 A;  5KP7 B;  3HOV I;  4A3J I;  3PO2 I;  4A93 I;  1L0I A;  4BPH A;  3G4S Z;  5D1O B;  3IFU A;  2W03 A;  4NBE A;  1FDO A;  4BY7 I;  3G28 A;  2VSQ A;  2IZ3 A;  4RVF A;  3G6E Z;  5C4X I;  3CCL Z;  1YIT P;  2N5I A;  5AN9 F;  3BG1 B;  2PEM A;  2QNW A;  4E2Y A;  5BS1 A;  2V45 A;  1KQS Z;  3G26 A;  1VQP P;  3CC7 P;  3FQQ A;  3RG6 C;  4DG9 A;  5BS2 A;  2XZ0 D;  2RT9 A;  3IR7 A;  2GTI A;  1M1K 1;  3NY7 B;  2N50 A;  1Q82 2;  3GZL A;  3I07 A;  3CCR P;  3U50 C;  1WII A;  3CME Z;  1EMV A;  3CXC O;  2FQ2 A;  3CPW Y;  3B5I A;  2Q51 A;  3NTE A;  1YI2 1;  5HGO A;  2OTL P;  4E2X A;  3GKL C;  3F3P C;  4BBS I;  2JYL A;  2QEX Z;  4GR6 A;  2EGT A;  3M4O I;  1VQ6 P;  3TDH B;  2JIQ A;  1VQM Z;  3Q20 A;  1YJ9 P;  2KGA A;  1AF8 A;  2XZ1 C;  3G21 A;  1VQN P;  1VQ5 Z;  4MRT C;  3I55 1;  2HU9 A;  1YIJ P;  2G2K A;  1VQ4 1;  2FAC A;  1VQ8 P;  3CMA Z;  2OZK A;  2RIQ A;  2AFE A;  1QVF Z;  4MD8 A;  2JAZ A;  4NFR A;  2FVE A;  3KIH A;  1YJW Z;  3MON A;  3NH8 A;  2H85 A;  2N5H A;  2KOD A;  4COP A;  1KLP A;  1S72 1;  2AYD A;  3EJE A;  1KD1 Q;  5FLX f;  3G4S P;  2QA4 Z;  1USP A;  4F37 A;  4NBA A;  1NJI 2;  2JA8 I;  3M3Y I;  1QRJ A;  1K8A 2;  3H47 A;  3CCE 1;  4M0I A;  2JS4 A;  1YHQ Z;  1ZMB A;  3DS1 A;  2JGP A;  2K0X A;  3CCL P;  1DV5 A;  4A3K I;  3VB9 A;  1VQ7 P;  2DE7 A;  4MH4 A;  3I4M I;  1RQF A;  3K7A I;  4NB8 A;  1N8R 1;  2K3R A;  2Y0S A;  3CCU 1;  5HGN A;  1Q82 1;  1IMP A;  2X2B A;  2KW2 A;  3DPH A;  4E31 A;  2J6A A;  2P9X A;  5EW5 E;  1QVG Z;  3S1R I;  1K9M Q;  3D6W A;  3CME P;  3CCV 1;  4U0B A;  2BUO A;  1HY8 A;  1L1O C;  5JPA A;  5FLX b;  2L22 A;  1KC8 1;  2KPI A;  1Z6M A;  2EG5 A;  2V8K A;  2QRC B;  2AKL A;  2QLV B;  2NO8 A;  1YIT Z;  2Z45 A;  2KG8 A;  2KI7 B;  2CG5 B;  2EHT A;  2QEX P;  7CEI A;  3CC2 1;  4E32 A;  5HGL A;  4RVH A;  4BXX I;  1VQM P;  2R6M A; 
#chains in the Genus database with same CATH homology
 1YUK A;  4PH1 A;  2RBL A;  3H3V J;  1Y1V I;  3I4N I;  2JR6 A;  2ZAE B;  5CM2 M;  1VQ5 P;  5T6B A;  1K73 2;  5IT9 f;  3FQM A;  1M74 A;  3CMA P;  4S1T A;  2OTJ 1;  3MZL B;  3HOY I;  2NVX I;  1YJW P;  2O53 A;  2XV6 A;  1NJI 1;  1K8A 1;  4GR2 A;  2QA4 P;  1QVG Y;  4E30 A;  2PM9 A;  3HOZ I;  1YHQ P;  1M6N A;  2PEQ A;  3NDI A;  1ZB9 A;  4NH1 C;  5I4T G;  3LUS A;  3GKQ A;  2JNY A;  1YIJ Z;  1RO4 A;  5D1O A;  1Y1V S;  5FLM I;  5T64 A;  1KRL A;  5C3E I;  5IT9 b;  1Q7Y Q;  1VQO Z;  1RNI A;  2EFJ A;  2PY8 A;  5IP9 I;  4A3I I;  1Q81 1;  3NFZ A;  2LIY A;  3OW2 O;  2YU9 I;  1S72 Z;  2F4O A;  3CXC Z;  2RHB A;  1RO2 A;  3H0D A;  5LL6 f;  5F2N A;  3CCE Z;  4A3C I;  1EOQ A;  1Y1W I;  1VQ7 Z;  4MON A;  3CCM 1;  1W2B Y;  4U0F A;  4TNU A;  3G29 A;  3CCU Z;  2WB1 A;  2B63 I;  3EED A;  1JWH C;  5F2O A;  1Q86 Q;  1K73 1;  1JJ2 Z;  3CCJ 1;  4BBR I;  1LQL A;  2R7Z I;  1RO0 A;  1VQ9 1;  3DS5 A;  4EWC A;  1S7M A;  3CCV Z;  3NH4 A;  3S17 I;  3HZQ A;  1M90 Q;  2W04 A;  3J81 f;  3J7A 4;  4A3E I;  4HGY A;  3CPW O;  3CC2 Z;  2E1M A;  3CC7 1;  2M8P A;  4HH4 A;  4E2Z A;  3QWU A;  4NBC A;  1KD1 2;  4DGL A;  3ESW A;  3G0V A;  2QRD B;  3CCS 1;  3P5J B;  4DK1 A;  1KQS Y;  5D1P A;  2OTJ Z;  3G1I A;  3CD6 1;  1VQO P;  1N8R Q;  1JJ2 Y;  3J81 b;  1S72 P;  1VQK 1;  1VQ6 1;  2VUM I;  2EIA A;  3CCQ Z;  3GTL I;  1I50 I;  3CCE P;  2PEN A;  3H4E A;  1VQL Z;  1K9M 2;  2JMO A;  2Q4Z A;  1VQ8 1;  2JUB A;  2E2J I;  1KC8 Q;  1RLY A;  3CCU P;  3M1M A;  3KIF A;  2E2H I;  4XFZ A;  2DE6 A;  1Z03 A;  5C44 I;  4DQY B;  3S1N I;  2IZ4 A;  2M6N A;  3CCV P;  2E2I I;  4QTU A;  2QRE B;  3G6E 1;  3CCL 1;  1QVF Y;  2E9H A;  3VMG A;  3MZK B;  4NBF A;  3I56 1;  1USP B;  4NBG A;  3CCM Z;  3CC2 P;  4RV9 A;  4XFY A;  1YJN 1;  3WBH A;  2Z46 A;  1KD1 1;  2PEO A;  4U0C A;  2OAR A;  3DS3 A;  4RS4 A;  1ML8 A;  3GTK I;  3CCJ Z;  4CL1 A;  2I3C A;  2PK7 A;  2XXM A;  3JAM f;  3GTG I;  2OTJ P;  2M48 A;  1YI2 Z;  2PEI A;  4NB9 A;  3CC4 1;  3BG0 B;  3OW2 Z;  3G71 1;  2DGY A;  1X0T A;  1VQM 1;  3VMH A;  1NP6 A;  1K9M 1;  3CCQ P;  1Q81 Q;  1Q7Y 2;  1SFO I;  1Z01 A;  1E6J P;  2P3Y A;  3GTJ I;  1VQL P;  3PO3 I;  1VLA A;  1QVG O;  3I55 Z;  3S2H I;  2NVT I;  1K83 I;  1TFI A;  1VQ4 Z;  3CMA 1;  2OOX B;  3CCS Z;  1D1D A;  1YJW 1;  2PEJ A;  4RVD A;  3JAM b;  3S14 I;  3CD6 Z;  2QA4 1;  3LRY A;  3HYB A;  4A3D I;  3S16 I;  1VQK Z;  1M1K Q;  1YHQ 1;  2P28 A;  3HOU I;  1Q86 2;  4A3G I;  2R92 I;  3HOW I;  1ZB8 A;  3GTM I;  3Q87 A;  3MGE A;  5A2Q f;  3CPW Z;  3VTN A;  3CCM P;  4RVG A;  3GTQ I;  4BY1 I;  2VF1 A;  3PO3 S;  2BHV A;  1Z02 A;  3S1M I;  4MXU A;  4AYB A;  2JO0 A;  1M90 2;  4XX2 A;  2QKD A;  3CCJ P;  3GTP I;  1W2B O;  4Y7N I;  1TWF I;  1VQ9 P;  2Z44 A;  1R9T I;  2YAD A;  4COC A;  1A43 A;  3RZO I;  1TWH I;  1YIT 1;  1YI2 P;  4A3B I;  2JA6 I;  4NBD A;  2LFU A;  1K30 A;  3RZD I;  1Q7Y 1;  3I56 Z;  1VQP 1;  3HKZ A;  3HOX I;  1BAJ A;  1YJN Z;  2XT1 A;  5A2Q b;  3CXC Y;  3GTM S;  3IF8 A;  1N8R 2;  3S2D I;  4MRI A;  4U0E A;  3CCR 1;  1N2F A;  4A3L I;  3I55 P;  1VQ4 P;  5IP7 I;  3E2D A;  1X3Z A;  5T67 A;  2R93 I;  4A3M I;  4XRO A;  1I3Q I;  3CCS P;  2OTL 1;  1NUI A;  1YUA A;  2V8J A;  3GCF A;  3CD6 P;  2NVQ I;  1Q82 Q;  1IUQ A;  3CC4 Z;  2CWO A;  1Q86 1;  1KC8 2;  5F2K A;  3G71 Z;  1KQS O;  1VQK P;  4XFX A;  2GTH A;  3NH5 A;  1YJ9 1;  2NVY I;  1JJ2 O;  1VQN 1;  2WAQ A;  1YIJ 1;  2HF1 A;  2PMZ A;  4E33 A;  1M90 1;  4U0D A;  2QR1 B;  4QNB A;  1VQO 1;  3DS0 A;  2ONT A;  3CQZ I;  1TWC I;  3F3F C;  4X6A I;  3G4S 1;  3D9X A;  2JA5 I;  2F4M A;  1DL6 A;  1QF8 A;  1M6E X;  2DE5 A;  3TE5 B;  4XRQ A;  3G6E P;  2M8L A;  4PH0 A;  1TWG I;  1VQ7 1;  4IPY A;  3T4N B;  3VRL C;  3I56 P;  4U0A A;  5C4J I;  1NJI Q;  1YJN P;  1QVF O;  1K8A Q;  4QTT A;  2GU2 A;  2L6E A;  3CME 1;  3DS2 A;  4E2W A;  1VQ9 Z;  3G1G A;  1Q81 2;  3S15 I;  1ZH1 A;  3DTJ A;  2QEX 1;  1A8O A;  3CC4 P;  3EER A;  2JYG A;  4MD7 A;  2M8N A;  3G71 P;  3H0G I;  4NBB A;  1VQP Z;  4Y52 I;  2OOY B;  3CC7 Z;  1X3W A;  4NOZ A;  3J80 f;  2VUG A;  2BJO A;  1TWA I;  1VQ5 1;  1I6H I;  3GTO I;  3CCR Z;  2JA7 I;  4WYM A;  1M1K 2;  1P9N A;  1QYP A;  4MD9 A;  5DCK A;  3VMI A;  2V8I A;  4NBH A;  2OTL Z;  4HGZ A;  1AUM A;  1WW9 A;  3NDJ A;  1W2B Z;  2PEK A;  3FKI I;  2LF4 A;  1EIA A;  3P05 A;  1VQ6 Z;  1K73 Q;  3CCQ 1;  3IX0 A;  1PFT A;  3DS4 A;  1YJ9 Z;  1VQL 1;  3J80 b;  1VQN Z;  1WCM I;  2RPR A;  1VQ8 Z;  3OW2 Y;  5HGM A;  3S1Q I;  4A3F I;  2K5R A;  2O4H A;  3HOV I;  4A3J I;  3PO2 I;  4A93 I;  3G4S Z;  5D1O B;  3IFU A;  2W03 A;  4NBE A;  4BY7 I;  3G28 A;  2IZ3 A;  4RVF A;  3G6E Z;  5C4X I;  3CCL Z;  1YIT P;  5AN9 F;  3BG1 B;  2PEM A;  4E2Y A;  5BS1 A;  1KQS Z;  3G26 A;  1VQP P;  3CC7 P;  3FQQ A;  3RG6 C;  5BS2 A;  2RT9 A;  2GTI A;  1M1K 1;  1Q82 2;  3I07 A;  3CCR P;  3U50 C;  1WII A;  3CME Z;  3CXC O;  3CPW Y;  3B5I A;  2Q51 A;  3NTE A;  1YI2 1;  5HGO A;  2OTL P;  4E2X A;  3F3P C;  4BBS I;  2JYL A;  2QEX Z;  4GR6 A;  2EGT A;  3M4O I;  1VQ6 P;  3TDH B;  1VQM Z;  3Q20 A;  1YJ9 P;  3G21 A;  1VQN P;  1VQ5 Z;  3I55 1;  2HU9 A;  1YIJ P;  2G2K A;  1VQ4 1;  1VQ8 P;  3CMA Z;  2OZK A;  2RIQ A;  1QVF Z;  4MD8 A;  4NFR A;  3KIH A;  1YJW Z;  3MON A;  3NH8 A;  2H85 A;  4COP A;  2KOD A;  1S72 1;  1KD1 Q;  5FLX f;  2QA4 Z;  3G4S P;  1USP A;  4NBA A;  1NJI 2;  2JA8 I;  3M3Y I;  1QRJ A;  1K8A 2;  3H47 A;  3CCE 1;  4M0I A;  2JS4 A;  1YHQ Z;  1ZMB A;  3DS1 A;  3CCL P;  4A3K I;  3VB9 A;  1VQ7 P;  2DE7 A;  4MH4 A;  3I4M I;  1RQF A;  3K7A I;  4NB8 A;  1N8R 1;  2K3R A;  2Y0S A;  3CCU 1;  5HGN A;  1Q82 1;  3DPH A;  4E31 A;  2J6A A;  2P9X A;  1QVG Z;  3S1R I;  1K9M Q;  3D6W A;  3CME P;  3CCV 1;  4U0B A;  2BUO A;  1L1O C;  5JPA A;  5FLX b;  1KC8 1;  2KPI A;  2EG5 A;  2V8K A;  2QRC B;  2AKL A;  2QLV B;  1YIT Z;  2Z45 A;  2KI7 B;  2QEX P;  3CC2 1;  4E32 A;  5HGL A;  4RVH A;  4BXX I;  1VQM P;  2R6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...