1RO0A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m semet remote
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
210
structure length
210
Chain Sequence
b'SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 61
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro0A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro0A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro0A02
3M1MA 1RNIA 1RO0A 1RO2A
chains in the Genus database with same CATH superfamily
2R6MA 4IZ6A 3CE7A 1ZH1A 3GTQI 3I561 2JQ4A 1NUIA 2JMOA 2JYLA 3B5IA 2JIMA 5CZDB 2WAQA 1AA6A 2VPXA 2LIUA 4BXXI 3LMOA 1JWHC 3CCMP 3I07A 3GZLA 2GU2A 3HKZA 3NH4A 2LF4A 3G6E1 3KIHA 2OTLZ 1KD11 3FKII 4NBHA 1DV5A 3VMHA 3J81f 3J81b 4A3MI 1QVGY 2V3VA 2LEXA 1NJI1 1W2BY 1L1OC 2RPRA 4A93I 4A3II 1YIT1 3CCU1 1QVFZ 2JA6I 5BS2A 4M0IA 1M1K1 1IMQA 1E0HA 2VLNA 4U0CA 3CME1 4A3FI 5C3EI 2M5RA 2OTJ1 3GTGI 2KG8A 2O53A 2QREB 1Q812 2VLOA 3NTEA 1NQ4A 1VQNP 2KOQA 2QA4P 2PEMA 1M901 3HZQA 2CQ8A 2KODA 2K5RA 1I6HI 4XROA 1RQFA 3H3VJ 2QLVB 4E30A 2OTL1 2GYKA 2ONTA 3EEDA 1VQ8Z 1M6NA 2YU9I 2JAZA 3GTOI 2FQ2A 1K8AQ 1QXFA 1VQ9P 3IFUA 1Y8CA 1VQMZ 1M1KQ 2K3RA 2QRDB 2JIQA 1K732 1SFOI 4A3EI 1EOQA 1ZMBA 1VQ5Z 5HGNA 3P05A 1RNIA 2RIQA 2V8JA 3CXCO 1K30A 2JBGA 1TWCI 5T64A 2ZAEB 1AUMA 4NB9A 1YITP 5F2OA 1VQ7Z 2V8IA 1M90Q 4HGZA 1KC81 2K92A 2KWLA 5A2Qf 3CMEP 5A2Qb 3HOZI 2N98A 4PH0A 1EIAA 3H0DA 4QTTA 3CPWY 2F4OA 3DS1A 5KP6B 1D1DA 1FDOA 2KR5A 1YUAA 1VQ81 5C4XI 3DS2A 4Y52I 1AF8A 1WZNA 3CMAP 2PY8A 4QTUA 1VQM1 3NDIA 2PEJA 1YJ9Z 4UHPB 4BPHA 3EJBA 4XFYA 2LPKA 2OTLP 1VQ51 2JNYA 1K731 3CC4Z 2BUOA 2W04A 1UNKA 5F2KA 2XV6A 2K0YA 3S16I 2XZ1C 1KC8Q 2L22A 5D1OA 1Q81Q 2QNWA 3CCVZ 1VQ71 2JIOA 3MONA 1VQ6Z 3K7AI 4E2YA 1QF8A 4XFXA 5AN9F 2ROQA 4CA3A 3MGEA 3G4SZ 1KD12 2DGYA 2K0XA 3GTMI 2OOXB 2KG9A 5JPAA 2EGTA 3G6EZ 2LTEA 2X2BA 2Z44A 1NJI2 3VMGA 5FLXf 1GXHA 5FLXb 2PEOA 4HGYA 2R92I 1VQ4Z 3J80b 2MVUA 4A3GI 1M1K2 5I4TG 1K73Q 2PEQA 1HY8A 2EHTA 1PFTA 3NDJA 3TE5B 1YJ91 3M3YI 1KQSY 1VQ8P 2JYGA 3CC41 3G26A 4E31A 1VQKP 3G28A 4XFZA 2QKDA 2WB1A 2LKIA 3GJNA 1VQMP 4QKOA 4U0EA 1YJNZ 1Q16A 3CCV1 2Y0SA 1M902 1JJ2O 3RZOI 3WBHA 1CEIA 3FQQA 1VQ61 1BXIA 2PEKA 2L0QA 1E6JP 1UJZA 1A8OA 5EW5E 2IZ3A 5IP7I 3OW2O 3CCSZ 1R9TI 5D1OB 3G4S1 1VQ7P 3VMIA 1L0IA 2K94A 1YHQP 3G29A 2VPWA 2L9FA 2O4HA 4NH1C 3CCRP 3PO2I 1VQ41 1NP6A 2DNWA 2NVTI 3I55P 4A3CI 3GTJI 3VTNA 2CG5B 1VLAA 2E2JI 2P28A 4NBBA 4DGLA 3DPHA 4MRTC 2GDWA 2CGQA 2P3YA 1Q821 1KC82 2JS4A 1N8R1 1X3ZA 1YJN1 3OW2Z 2K0DX 2PM9A 3LUSA 3U43A 1VHNA 1ZNVA 3GKLC 4MXUA 3CC4P 2FADA 3D2LA 2P9XA 3Q20A 4MONA 3RG2A 4E2WA 2QEXZ 3CCS1 4H2WC 2F4MA 3CCVP 1KD1Q 3FQMA 2VUMI 4AYBA 3I56P 4RVDA 2JB0A 2LOLA 1VQ6P 1YIJZ 2FAEA 1NJIQ 3GKQA 1YI2Z 4E32A 1RO2A 3CCLZ 1I3QI 1VQLZ 3S1MI 3S1QI 4NBAA 4NBFA 3G6EP 5LL6f 2IV2X 1Q82Q 4HKGA 1X0TA 2VLPA 1N2FA 2AFEA 1N8RQ 4BBRI 1VQ4P 4NFRA 3Q87A 1QVGO 1KLPA 2VSQA 3G1IA 1Z02A 2GTIA 3CCUP 2QR1B 4NBEA 2Z46A 3CC7Z 2ERHA 1W2BO 2FQ1A 4RS4A 2K5XA 3ESWA 1LQLA 3T4NB 2E1MA 1M6EX 3NH8A 2OTJP 4NBGA 4IPYA 2QEX1 3S2HI 2G2KA 3P5JB 1OR5A 2L6EA 1YUKA 2JR6A 2KI7B 2DE6A 2XT1A 1YIJ1 2OZKA 1BAJA 1RO0A 2PMZA 3MZLB 1MZ8A 1YI21 2LIWA 4MH4A 3CCSP 1RO4A 1DL6A 1GPJA 4NBDA 2JA8I 2FVFA 4U0AA 2NO8A 3CXCZ 3CCL1 3CCMZ 2JGPA 1S7MA 1VQL1 1HQBA 2KOSA 3M4OI 2JA7I 3U50C 4A3JI 1KRLA 1W2BZ 3RZDI 4WYMA 2VF1A 2Q4ZA 2CWOA 1EMVA 3GTPI 2PENA 1X3WA 3HOVI 2EIAA 1QRJA 2GDYA 3H47A 2JO0A 4MD7A 3CC71 3H0GI 4X6AI 5HGLA 2M8PA 2J6AA 2JIRA 2OOYB 2XZ0D 1QVFY 1S72Z 2V8KA 4MD8A 2E2HI 3CCEZ 2KORA 1YJWZ 1Q861 4XX2A 2AVAA 2KW2A 1QYPA 1WJ2A 2LL8A 3IR7A 1VQNZ 1RLYA 4DQYB 2QA4Z 4RVFA 3S2DI 4S1TA 3J80f 2H85A 4BPFA 1Z01A 2L4BA 3CCM1 3CPWO 5BS1A 2HU9A 2NVXI 2RT9A 1Q822 1AYIA 1YIJP 1VQPZ 2NVQI 1Z03A 3EERA 2GZJA 1N8R2 2EHSA 2V45A 1YI2P 3S1NI 1GXGA 3EJDA 1F80D 2BHVA 2NAPA 3PO3I 3IF8A 3EJEA 3D6WA 2Z45A 2EG5A 1VQ9Z 1VQLP 1Q7Y1 4EWCA 2FVEA 2KGEA 4E2XA 2JIPA 1TWHI 1VQ5P 2GZIA 3CQZI 2AYDA 2M6NA 4XRQA 4E33A 1S721 3CCE1 3PO3S 1ML8A 1M74A 1YJW1 2GDXA 4GR6A 1IUQA 3CC7P 1TFIA 2XXMA 3BG0B 3GTKI 1VQN1 4RV9A 3CPWZ 3CCQZ 2QA41 3CC2Z 4HH4A 1VQOZ 2LIYA 3KIFA 4A3BI 1T8KA 5C4JI 2JU2A 1IMPA 3M1MA 3HOYI 1VQP1 2PK7A 2JA5I 2N5HA 2FVAA 3G21A 1JJ2Z 1Q7YQ 3F3FC 3HOUI 3HYBA 2M8NA 4U0FA 4TNUA 3CMAZ 1VQ91 4A3LI 2FHSC 3LRYA 2N6YA 5EJDA 2K2QA 2KGDA 2N6ZA 1YJ9P 1K9M1 2B63I 2GZEA 3CXCY 3CCJZ 3D9XA 2PEIA 2FQ0A 2GZFA 3NFZA 5HVCA 1KQSO 4H2YC 5KP7B 4NEOA 4MD9A 2JUBA 3G1GA 4R0MA 3DTJA 1K8A1 1I50I 3TDHB 2LMLA 2RHBA 2RBLA 2W03A 7CEIA 1S72P 5D1PA 5C44I 3CC21 3CCQ1 3CCEP 4DG9A 2BJOA 1VQO1 4BBSI 1YJWP 3G4SP 2VLQA 2WPTA 3VRLC 2KGCA 2DE5A 5IP9I 4Y7NI 3GZMA 1WIIA 2EFJA 4COPA 2KGAA 3S17I 1K9MQ 3VB9A 2MR8A 2M48A 4BPGA 2OARA 1KQSZ 3CMA1 3CD6Z 2FACA 3G71Z 1VQPP 2E9HA 3JAMf 2MR7A 1ACPA 3JAMb 1VKUA 3CCJ1 1Q862 2E2II 2CNRA 2GTHA 2KG6A 4F37A 1SIWA 1VQKZ 5F2NA 1FR2A 1YJNP 2M8LA 4BY1I 1USPA 1P9NA 2LFUA 2N5IA 5DCKA 5HGOA 2GZGA 5HV8A 2VPYA 5FLMI 3GTLI 5T67A 1TWFI 3DS0A 1FDIA 3MZKB 1QVGZ 1YHQZ 3CCQP 2MF4A 3I4MI 3CC2P 1Q811 2PNGA 3IX0A 1Q7Y2 1Y1VI 2KOOA 1VQOP 4H2XC 3CCRZ 3QWUA 2MD9A 2K93A 3CD61 4QNBA 3I55Z 5T6BA 1ZB9A 3G711 3B4QA 1WCMI 2MY5A 4A3KI 2HF1A 1Y1VS 2VPZA 3GCFA 3RG6C 4U0BA 1VQK1 1Y1WI 1JJ2Y 4RVHA 2JU1A 3CCJP 3H4EA 2AF8A 1DNYA 2R7ZI 3G0VA 4PXHB 3OW2Y 1A43A 4BY7I 2QEXP 4NBCA 2KOPA 1USPB 4NOZA 4PWVB 1K83I 4MRIA 4PH1A 1ZB8A 3S15I 3I56Z 4RVGA 2YADA 2NVYI 2MVVA 1YHQ1 2Q51A 3DS3A 4CL1A 1K9M2 3F3PC 2I3CA 3CCR1 5IT9f 3CCLP 5IT9b 4GR2A 1X3OA 1TWGI 3E2DA 5CM2M 2AFDA 3I551 1L0HA 3BG1B 2IZ4A 2E7ZA 3S1RI 1Q86Q 2KPIA 3HOWI 4E2ZA 3J7A4 2R93I 3DS4A 3NY7B 5HGMA 2VUGA 1K8A2 3CD6P 2QRCB 3I4NI 1TWAI 1YITZ 1WW9A 3CCUZ 3GTMS 3G71P 3HOXI 5KP8B 4COCA 3CMEZ 3DS5A 4DK1A 1Z6MA 4A3DI 3NH5A 1QVFO 2AKLA 2OTJZ 4NB8A 2N50A 4U0DA 3S14I 2DE7A
chains in the Genus database with same CATH topology
2R6MA 1ZH1A 3GTQI 3I561 1NUIA 2JMOA 2JYLA 3B5IA 2WAQA 4BXXI 1JWHC 3CCMP 3I07A 2GU2A 3HKZA 3NH4A 2LF4A 3G6E1 3KIHA 2OTLZ 1KD11 3FKII 4NBHA 3J81f 3VMHA 4A3MI 3J81b 1QVGY 1NJI1 1W2BY 1L1OC 2RPRA 4A93I 4A3II 1YIT1 3CCU1 1QVFZ 2JA6I 5BS2A 4M0IA 1M1K1 4U0CA 3CME1 4A3FI 5C3EI 2OTJ1 3GTGI 2O53A 2QREB 1Q812 3NTEA 1VQNP 2QA4P 2PEMA 1M901 3HZQA 2KODA 2K5RA 1I6HI 4XROA 1RQFA 3H3VJ 2QLVB 4E30A 2OTL1 2ONTA 1VQ8Z 3EEDA 1M6NA 2YU9I 3GTOI 1K8AQ 1VQ9P 3IFUA 1VQMZ 1M1KQ 2K3RA 2QRDB 1K732 1SFOI 4A3EI 1EOQA 1ZMBA 1VQ5Z 5HGNA 3P05A 1RNIA 2RIQA 2V8JA 3CXCO 1K30A 1TWCI 5T64A 2ZAEB 1AUMA 4NB9A 1YITP 5F2OA 1VQ7Z 2V8IA 1M90Q 4HGZA 1KC81 5A2Qf 3CMEP 5A2Qb 3HOZI 4PH0A 1EIAA 3H0DA 4QTTA 3CPWY 2F4OA 3DS1A 1D1DA 1YUAA 1VQ81 5C4XI 3DS2A 4Y52I 3CMAP 2PY8A 4QTUA 1VQM1 3NDIA 2PEJA 1YJ9Z 4XFYA 2OTLP 1VQ51 2JNYA 1K731 3CC4Z 2BUOA 2W04A 5F2KA 2XV6A 3S16I 1KC8Q 5D1OA 1Q81Q 3CCVZ 1VQ71 3MONA 1VQ6Z 3K7AI 4E2YA 1QF8A 4XFXA 5AN9F 3MGEA 3G4SZ 1KD12 2DGYA 3GTMI 2OOXB 2EGTA 5JPAA 3G6EZ 2Z44A 1NJI2 3VMGA 5FLXf 5FLXb 2PEOA 4HGYA 2R92I 1VQ4Z 3J80b 4A3GI 1M1K2 5I4TG 1K73Q 2PEQA 1PFTA 3TE5B 3NDJA 1YJ91 3M3YI 1KQSY 1VQ8P 2JYGA 3CC41 3G26A 4E31A 1VQKP 3G28A 4XFZA 2QKDA 2WB1A 1VQMP 4U0EA 1YJNZ 3CCV1 2Y0SA 1M902 1JJ2O 3RZOI 3WBHA 3FQQA 1VQ61 2PEKA 1E6JP 1A8OA 2IZ3A 5IP7I 1R9TI 3OW2O 3CCSZ 5D1OB 3G4S1 1VQ7P 3VMIA 1YHQP 3G29A 2O4HA 4NH1C 3CCRP 3PO2I 1VQ41 1NP6A 2NVTI 3I55P 4A3CI 3GTJI 3VTNA 1VLAA 2E2JI 2P28A 4NBBA 4DGLA 3DPHA 2P3YA 1Q821 1KC82 2JS4A 1N8R1 1X3ZA 1YJN1 3OW2Z 2PM9A 3LUSA 4MXUA 3CC4P 4MONA 2P9XA 3Q20A 2QEXZ 3CCS1 4E2WA 3FQMA 2F4MA 3CCVP 1KD1Q 2VUMI 4AYBA 3I56P 4RVDA 1VQ6P 1YIJZ 3GKQA 1NJIQ 1YI2Z 4E32A 1RO2A 3CCLZ 1I3QI 1VQLZ 3S1MI 3S1QI 4NBAA 4NBFA 3G6EP 5LL6f 1Q82Q 1X0TA 1N2FA 1N8RQ 4BBRI 1VQ4P 4NFRA 3Q87A 1QVGO 3G1IA 1Z02A 2GTIA 3CCUP 2QR1B 4NBEA 2Z46A 3CC7Z 1W2BO 4RS4A 3ESWA 1LQLA 3T4NB 2E1MA 1M6EX 3NH8A 2OTJP 4NBGA 4IPYA 2QEX1 3S2HI 2G2KA 3P5JB 2L6EA 1YUKA 2JR6A 2KI7B 2DE6A 2XT1A 1YIJ1 2OZKA 1RO0A 1BAJA 2PMZA 3MZLB 1YI21 4MH4A 3CCSP 1RO4A 1DL6A 4NBDA 2JA8I 4U0AA 3CXCZ 3CCL1 3CCMZ 1S7MA 1VQL1 3M4OI 2JA7I 3U50C 4A3JI 1KRLA 1W2BZ 3RZDI 4WYMA 2VF1A 2Q4ZA 2CWOA 3GTPI 2PENA 1X3WA 3HOVI 2EIAA 1QRJA 3H47A 2JO0A 4MD7A 3CC71 3H0GI 4X6AI 5HGLA 2M8PA 2J6AA 2OOYB 1QVFY 1S72Z 2V8KA 4MD8A 2E2HI 3CCEZ 1YJWZ 1Q861 4XX2A 1QYPA 1VQNZ 1RLYA 4DQYB 2QA4Z 4RVFA 3S2DI 4S1TA 3J80f 2H85A 1Z01A 3CCM1 3CPWO 5BS1A 2HU9A 2NVXI 2RT9A 1Q822 1VQPZ 1YIJP 2NVQI 1Z03A 3EERA 1N8R2 1YI2P 3S1NI 2BHVA 3PO3I 3IF8A 1VQ9Z 3D6WA 2Z45A 2EG5A 1Q7Y1 1VQLP 4EWCA 4E2XA 1TWHI 1VQ5P 3CQZI 2M6NA 4XRQA 4E33A 1S721 3CCE1 3PO3S 1ML8A 1M74A 1YJW1 4GR6A 1IUQA 3CC7P 1TFIA 2XXMA 3BG0B 3GTKI 1VQN1 4RV9A 3CPWZ 3CCQZ 2QA41 3CC2Z 4HH4A 1VQOZ 2LIYA 3KIFA 4A3BI 5C4JI 3M1MA 3HOYI 1VQP1 2PK7A 2JA5I 3G21A 1JJ2Z 1Q7YQ 3F3FC 3HOUI 3HYBA 2M8NA 4U0FA 4TNUA 3CMAZ 1VQ91 4A3LI 3LRYA 1YJ9P 1K9M1 2B63I 3CXCY 3CCJZ 3D9XA 2PEIA 3NFZA 1KQSO 4MD9A 2JUBA 3G1GA 3DTJA 1K8A1 1I50I 3TDHB 2RHBA 2RBLA 2W03A 1S72P 5D1PA 5C44I 3CC21 3CCQ1 3CCEP 2BJOA 1VQO1 4BBSI 1YJWP 3G4SP 3VRLC 2DE5A 5IP9I 4Y7NI 1WIIA 2EFJA 4COPA 3S17I 1K9MQ 3VB9A 2M48A 1KQSZ 2OARA 3CD6Z 3CMA1 3G71Z 1VQPP 2E9HA 3JAMf 3JAMb 3CCJ1 2E2II 1Q862 2GTHA 1VQKZ 5F2NA 1YJNP 2M8LA 4BY1I 1USPA 1P9NA 2LFUA 5DCKA 5HGOA 5FLMI 3GTLI 5T67A 1TWFI 3DS0A 3MZKB 1QVGZ 1YHQZ 3CCQP 3I4MI 3CC2P 1Q811 3IX0A 1Q7Y2 1Y1VI 1VQOP 3CCRZ 3QWUA 3CD61 4QNBA 3I55Z 5T6BA 1ZB9A 3G711 1WCMI 4A3KI 2HF1A 1Y1VS 3GCFA 3RG6C 4U0BA 1VQK1 1Y1WI 1JJ2Y 4RVHA 3CCJP 3H4EA 2R7ZI 3G0VA 3OW2Y 1A43A 4BY7I 2QEXP 4NBCA 1USPB 4NOZA 1K83I 4MRIA 4PH1A 1ZB8A 3S15I 3I56Z 4RVGA 2YADA 2NVYI 1YHQ1 2Q51A 3DS3A 4CL1A 1K9M2 3F3PC 2I3CA 3CCR1 5IT9f 3CCLP 5IT9b 4GR2A 1TWGI 3E2DA 5CM2M 3I551 3BG1B 2IZ4A 3S1RI 1Q86Q 2KPIA 3HOWI 4E2ZA 3J7A4 2R93I 3DS4A 1K8A2 5HGMA 2VUGA 3CD6P 2QRCB 3I4NI 1TWAI 1YITZ 1WW9A 3CCUZ 3GTMS 3G71P 3HOXI 4COCA 3CMEZ 3DS5A 4DK1A 4A3DI 3NH5A 1QVFO 2AKLA 2OTJZ 4NB8A 4U0DA 3S14I 2DE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RNI A;  1RO0 A;  1RO2 A; 
#chains in the Genus database with same CATH topology
 2R6M A;  4IZ6 A;  3CE7 A;  1ZH1 A;  3GTQ I;  3I56 1;  2JQ4 A;  1NUI A;  2JMO A;  2JYL A;  3B5I A;  2JIM A;  5CZD B;  2WAQ A;  1AA6 A;  2VPX A;  2LIU A;  4BXX I;  3LMO A;  1JWH C;  3CCM P;  3I07 A;  3GZL A;  2GU2 A;  3HKZ A;  3NH4 A;  2LF4 A;  3G6E 1;  3KIH A;  2OTL Z;  1KD1 1;  3FKI I;  4NBH A;  1DV5 A;  3VMH A;  3J81 f;  3J81 b;  4A3M I;  1QVG Y;  2V3V A;  2LEX A;  1NJI 1;  1W2B Y;  1L1O C;  2RPR A;  4A93 I;  4A3I I;  1YIT 1;  3CCU 1;  1QVF Z;  2JA6 I;  5BS2 A;  4M0I A;  1M1K 1;  1IMQ A;  1E0H A;  2VLN A;  4U0C A;  3CME 1;  4A3F I;  5C3E I;  2M5R A;  2OTJ 1;  3GTG I;  2KG8 A;  2O53 A;  2QRE B;  1Q81 2;  2VLO A;  3NTE A;  1NQ4 A;  1VQN P;  2KOQ A;  2QA4 P;  2PEM A;  1M90 1;  3HZQ A;  2CQ8 A;  2KOD A;  2K5R A;  1I6H I;  4XRO A;  1RQF A;  3H3V J;  2QLV B;  4E30 A;  2OTL 1;  2GYK A;  2ONT A;  3EED A;  1VQ8 Z;  1M6N A;  2YU9 I;  2JAZ A;  3GTO I;  2FQ2 A;  1K8A Q;  1QXF A;  1VQ9 P;  3IFU A;  1Y8C A;  1VQM Z;  1M1K Q;  2K3R A;  2QRD B;  2JIQ A;  1K73 2;  1SFO I;  4A3E I;  1EOQ A;  1ZMB A;  1VQ5 Z;  5HGN A;  3P05 A;  1RNI A;  2RIQ A;  2V8J A;  3CXC O;  1K30 A;  2JBG A;  1TWC I;  5T64 A;  2ZAE B;  1AUM A;  4NB9 A;  1YIT P;  5F2O A;  1VQ7 Z;  2V8I A;  1M90 Q;  4HGZ A;  1KC8 1;  2K92 A;  2KWL A;  5A2Q f;  3CME P;  5A2Q b;  3HOZ I;  2N98 A;  4PH0 A;  1EIA A;  3H0D A;  4QTT A;  3CPW Y;  2F4O A;  3DS1 A;  5KP6 B;  1D1D A;  1FDO A;  2KR5 A;  1YUA A;  1VQ8 1;  5C4X I;  3DS2 A;  4Y52 I;  1AF8 A;  1WZN A;  3CMA P;  2PY8 A;  4QTU A;  1VQM 1;  3NDI A;  2PEJ A;  1YJ9 Z;  4UHP B;  4BPH A;  3EJB A;  4XFY A;  2LPK A;  2OTL P;  1VQ5 1;  2JNY A;  1K73 1;  3CC4 Z;  2BUO A;  2W04 A;  1UNK A;  5F2K A;  2XV6 A;  2K0Y A;  3S16 I;  2XZ1 C;  1KC8 Q;  2L22 A;  5D1O A;  1Q81 Q;  2QNW A;  3CCV Z;  1VQ7 1;  2JIO A;  3MON A;  1VQ6 Z;  3K7A I;  4E2Y A;  1QF8 A;  4XFX A;  5AN9 F;  2ROQ A;  4CA3 A;  3MGE A;  3G4S Z;  1KD1 2;  2DGY A;  2K0X A;  3GTM I;  2OOX B;  2KG9 A;  5JPA A;  2EGT A;  3G6E Z;  2LTE A;  2X2B A;  2Z44 A;  1NJI 2;  3VMG A;  5FLX f;  1GXH A;  5FLX b;  2PEO A;  4HGY A;  2R92 I;  1VQ4 Z;  3J80 b;  2MVU A;  4A3G I;  1M1K 2;  5I4T G;  1K73 Q;  2PEQ A;  1HY8 A;  2EHT A;  1PFT A;  3NDJ A;  3TE5 B;  1YJ9 1;  3M3Y I;  1KQS Y;  1VQ8 P;  2JYG A;  3CC4 1;  3G26 A;  4E31 A;  1VQK P;  3G28 A;  4XFZ A;  2QKD A;  2WB1 A;  2LKI A;  3GJN A;  1VQM P;  4QKO A;  4U0E A;  1YJN Z;  1Q16 A;  3CCV 1;  2Y0S A;  1M90 2;  1JJ2 O;  3RZO I;  3WBH A;  1CEI A;  3FQQ A;  1VQ6 1;  1BXI A;  2PEK A;  2L0Q A;  1E6J P;  1UJZ A;  1A8O A;  5EW5 E;  2IZ3 A;  5IP7 I;  3OW2 O;  3CCS Z;  1R9T I;  5D1O B;  3G4S 1;  1VQ7 P;  3VMI A;  1L0I A;  2K94 A;  1YHQ P;  3G29 A;  2VPW A;  2L9F A;  2O4H A;  4NH1 C;  3CCR P;  3PO2 I;  1VQ4 1;  1NP6 A;  2DNW A;  2NVT I;  3I55 P;  4A3C I;  3GTJ I;  3VTN A;  2CG5 B;  1VLA A;  2E2J I;  2P28 A;  4NBB A;  4DGL A;  3DPH A;  4MRT C;  2GDW A;  2CGQ A;  2P3Y A;  1Q82 1;  1KC8 2;  2JS4 A;  1N8R 1;  1X3Z A;  1YJN 1;  3OW2 Z;  2K0D X;  2PM9 A;  3LUS A;  3U43 A;  1VHN A;  1ZNV A;  3GKL C;  4MXU A;  3CC4 P;  2FAD A;  3D2L A;  2P9X A;  3Q20 A;  4MON A;  3RG2 A;  4E2W A;  2QEX Z;  3CCS 1;  4H2W C;  2F4M A;  3CCV P;  1KD1 Q;  3FQM A;  2VUM I;  4AYB A;  3I56 P;  4RVD A;  2JB0 A;  2LOL A;  1VQ6 P;  1YIJ Z;  2FAE A;  1NJI Q;  3GKQ A;  1YI2 Z;  4E32 A;  1RO2 A;  3CCL Z;  1I3Q I;  1VQL Z;  3S1M I;  3S1Q I;  4NBA A;  4NBF A;  3G6E P;  5LL6 f;  2IV2 X;  1Q82 Q;  4HKG A;  1X0T A;  2VLP A;  1N2F A;  2AFE A;  1N8R Q;  4BBR I;  1VQ4 P;  4NFR A;  3Q87 A;  1QVG O;  1KLP A;  2VSQ A;  3G1I A;  1Z02 A;  2GTI A;  3CCU P;  2QR1 B;  4NBE A;  2Z46 A;  3CC7 Z;  2ERH A;  1W2B O;  2FQ1 A;  4RS4 A;  2K5X A;  3ESW A;  1LQL A;  3T4N B;  2E1M A;  1M6E X;  3NH8 A;  2OTJ P;  4NBG A;  4IPY A;  2QEX 1;  3S2H I;  2G2K A;  3P5J B;  1OR5 A;  2L6E A;  1YUK A;  2JR6 A;  2KI7 B;  2DE6 A;  2XT1 A;  1YIJ 1;  2OZK A;  1BAJ A;  1RO0 A;  2PMZ A;  3MZL B;  1MZ8 A;  1YI2 1;  2LIW A;  4MH4 A;  3CCS P;  1RO4 A;  1DL6 A;  1GPJ A;  4NBD A;  2JA8 I;  2FVF A;  4U0A A;  2NO8 A;  3CXC Z;  3CCL 1;  3CCM Z;  2JGP A;  1S7M A;  1VQL 1;  1HQB A;  2KOS A;  3M4O I;  2JA7 I;  3U50 C;  4A3J I;  1KRL A;  1W2B Z;  3RZD I;  4WYM A;  2VF1 A;  2Q4Z A;  2CWO A;  1EMV A;  3GTP I;  2PEN A;  1X3W A;  3HOV I;  2EIA A;  1QRJ A;  2GDY A;  3H47 A;  2JO0 A;  4MD7 A;  3CC7 1;  3H0G I;  4X6A I;  5HGL A;  2M8P A;  2J6A A;  2JIR A;  2OOY B;  2XZ0 D;  1QVF Y;  1S72 Z;  2V8K A;  4MD8 A;  2E2H I;  3CCE Z;  2KOR A;  1YJW Z;  1Q86 1;  4XX2 A;  2AVA A;  2KW2 A;  1QYP A;  1WJ2 A;  2LL8 A;  3IR7 A;  1VQN Z;  1RLY A;  4DQY B;  2QA4 Z;  4RVF A;  3S2D I;  4S1T A;  3J80 f;  2H85 A;  4BPF A;  1Z01 A;  2L4B A;  3CCM 1;  3CPW O;  5BS1 A;  2HU9 A;  2NVX I;  2RT9 A;  1Q82 2;  1AYI A;  1YIJ P;  1VQP Z;  2NVQ I;  1Z03 A;  3EER A;  2GZJ A;  1N8R 2;  2EHS A;  2V45 A;  1YI2 P;  3S1N I;  1GXG A;  3EJD A;  1F80 D;  2BHV A;  2NAP A;  3PO3 I;  3IF8 A;  3EJE A;  3D6W A;  2Z45 A;  2EG5 A;  1VQ9 Z;  1VQL P;  1Q7Y 1;  4EWC A;  2FVE A;  2KGE A;  4E2X A;  2JIP A;  1TWH I;  1VQ5 P;  2GZI A;  3CQZ I;  2AYD A;  2M6N A;  4XRQ A;  4E33 A;  1S72 1;  3CCE 1;  3PO3 S;  1ML8 A;  1M74 A;  1YJW 1;  2GDX A;  4GR6 A;  1IUQ A;  3CC7 P;  1TFI A;  2XXM A;  3BG0 B;  3GTK I;  1VQN 1;  4RV9 A;  3CPW Z;  3CCQ Z;  2QA4 1;  3CC2 Z;  4HH4 A;  1VQO Z;  2LIY A;  3KIF A;  4A3B I;  1T8K A;  5C4J I;  2JU2 A;  1IMP A;  3M1M A;  3HOY I;  1VQP 1;  2PK7 A;  2JA5 I;  2N5H A;  2FVA A;  3G21 A;  1JJ2 Z;  1Q7Y Q;  3F3F C;  3HOU I;  3HYB A;  2M8N A;  4U0F A;  4TNU A;  3CMA Z;  1VQ9 1;  4A3L I;  2FHS C;  3LRY A;  2N6Y A;  5EJD A;  2K2Q A;  2KGD A;  2N6Z A;  1YJ9 P;  1K9M 1;  2B63 I;  2GZE A;  3CXC Y;  3CCJ Z;  3D9X A;  2PEI A;  2FQ0 A;  2GZF A;  3NFZ A;  5HVC A;  1KQS O;  4H2Y C;  5KP7 B;  4NEO A;  4MD9 A;  2JUB A;  3G1G A;  4R0M A;  3DTJ A;  1K8A 1;  1I50 I;  3TDH B;  2LML A;  2RHB A;  2RBL A;  2W03 A;  7CEI A;  1S72 P;  5D1P A;  5C44 I;  3CC2 1;  3CCQ 1;  3CCE P;  4DG9 A;  2BJO A;  1VQO 1;  4BBS I;  1YJW P;  3G4S P;  2VLQ A;  2WPT A;  3VRL C;  2KGC A;  2DE5 A;  5IP9 I;  4Y7N I;  3GZM A;  1WII A;  2EFJ A;  4COP A;  2KGA A;  3S17 I;  1K9M Q;  3VB9 A;  2MR8 A;  2M48 A;  4BPG A;  2OAR A;  1KQS Z;  3CMA 1;  3CD6 Z;  2FAC A;  3G71 Z;  1VQP P;  2E9H A;  3JAM f;  2MR7 A;  1ACP A;  3JAM b;  1VKU A;  3CCJ 1;  1Q86 2;  2E2I I;  2CNR A;  2GTH A;  2KG6 A;  4F37 A;  1SIW A;  1VQK Z;  5F2N A;  1FR2 A;  1YJN P;  2M8L A;  4BY1 I;  1USP A;  1P9N A;  2LFU A;  2N5I A;  5DCK A;  5HGO A;  2GZG A;  5HV8 A;  2VPY A;  5FLM I;  3GTL I;  5T67 A;  1TWF I;  3DS0 A;  1FDI A;  3MZK B;  1QVG Z;  1YHQ Z;  3CCQ P;  2MF4 A;  3I4M I;  3CC2 P;  1Q81 1;  2PNG A;  3IX0 A;  1Q7Y 2;  1Y1V I;  2KOO A;  1VQO P;  4H2X C;  3CCR Z;  3QWU A;  2MD9 A;  2K93 A;  3CD6 1;  4QNB A;  3I55 Z;  5T6B A;  1ZB9 A;  3G71 1;  3B4Q A;  1WCM I;  2MY5 A;  4A3K I;  2HF1 A;  1Y1V S;  2VPZ A;  3GCF A;  3RG6 C;  4U0B A;  1VQK 1;  1Y1W I;  1JJ2 Y;  4RVH A;  2JU1 A;  3CCJ P;  3H4E A;  2AF8 A;  1DNY A;  2R7Z I;  3G0V A;  4PXH B;  3OW2 Y;  1A43 A;  4BY7 I;  2QEX P;  4NBC A;  2KOP A;  1USP B;  4NOZ A;  4PWV B;  1K83 I;  4MRI A;  4PH1 A;  1ZB8 A;  3S15 I;  3I56 Z;  4RVG A;  2YAD A;  2NVY I;  2MVV A;  1YHQ 1;  2Q51 A;  3DS3 A;  4CL1 A;  1K9M 2;  3F3P C;  2I3C A;  3CCR 1;  5IT9 f;  3CCL P;  5IT9 b;  4GR2 A;  1X3O A;  1TWG I;  3E2D A;  5CM2 M;  2AFD A;  3I55 1;  1L0H A;  3BG1 B;  2IZ4 A;  2E7Z A;  3S1R I;  1Q86 Q;  2KPI A;  3HOW I;  4E2Z A;  3J7A 4;  2R93 I;  3DS4 A;  3NY7 B;  5HGM A;  2VUG A;  1K8A 2;  3CD6 P;  2QRC B;  3I4N I;  1TWA I;  1YIT Z;  1WW9 A;  3CCU Z;  3GTM S;  3G71 P;  3HOX I;  5KP8 B;  4COC A;  3CME Z;  3DS5 A;  4DK1 A;  1Z6M A;  4A3D I;  3NH5 A;  1QVF O;  2AKL A;  2OTJ Z;  4NB8 A;  2N50 A;  4U0D A;  3S14 I;  2DE7 A; 
#chains in the Genus database with same CATH homology
 2R6M A;  1ZH1 A;  3GTQ I;  3I56 1;  1NUI A;  2JMO A;  2JYL A;  3B5I A;  2WAQ A;  4BXX I;  1JWH C;  3CCM P;  3I07 A;  2GU2 A;  3HKZ A;  3NH4 A;  2LF4 A;  3G6E 1;  3KIH A;  2OTL Z;  1KD1 1;  3FKI I;  4NBH A;  3J81 f;  3VMH A;  4A3M I;  3J81 b;  1QVG Y;  1NJI 1;  1W2B Y;  1L1O C;  2RPR A;  4A93 I;  4A3I I;  1YIT 1;  3CCU 1;  1QVF Z;  2JA6 I;  5BS2 A;  4M0I A;  1M1K 1;  4U0C A;  3CME 1;  4A3F I;  5C3E I;  2OTJ 1;  3GTG I;  2O53 A;  2QRE B;  1Q81 2;  3NTE A;  1VQN P;  2QA4 P;  2PEM A;  1M90 1;  3HZQ A;  2KOD A;  2K5R A;  1I6H I;  4XRO A;  1RQF A;  3H3V J;  2QLV B;  4E30 A;  2OTL 1;  2ONT A;  1VQ8 Z;  3EED A;  1M6N A;  2YU9 I;  3GTO I;  1K8A Q;  1VQ9 P;  3IFU A;  1VQM Z;  1M1K Q;  2K3R A;  2QRD B;  1K73 2;  1SFO I;  4A3E I;  1EOQ A;  1ZMB A;  1VQ5 Z;  5HGN A;  3P05 A;  1RNI A;  2RIQ A;  2V8J A;  3CXC O;  1K30 A;  1TWC I;  5T64 A;  2ZAE B;  1AUM A;  4NB9 A;  1YIT P;  5F2O A;  1VQ7 Z;  2V8I A;  1M90 Q;  4HGZ A;  1KC8 1;  5A2Q f;  3CME P;  5A2Q b;  3HOZ I;  4PH0 A;  1EIA A;  3H0D A;  4QTT A;  3CPW Y;  2F4O A;  3DS1 A;  1D1D A;  1YUA A;  1VQ8 1;  5C4X I;  3DS2 A;  4Y52 I;  3CMA P;  2PY8 A;  4QTU A;  1VQM 1;  3NDI A;  2PEJ A;  1YJ9 Z;  4XFY A;  2OTL P;  1VQ5 1;  2JNY A;  1K73 1;  3CC4 Z;  2BUO A;  2W04 A;  5F2K A;  2XV6 A;  3S16 I;  1KC8 Q;  5D1O A;  1Q81 Q;  3CCV Z;  1VQ7 1;  3MON A;  1VQ6 Z;  3K7A I;  4E2Y A;  1QF8 A;  4XFX A;  5AN9 F;  3MGE A;  3G4S Z;  1KD1 2;  2DGY A;  3GTM I;  2OOX B;  2EGT A;  5JPA A;  3G6E Z;  2Z44 A;  1NJI 2;  3VMG A;  5FLX f;  5FLX b;  2PEO A;  4HGY A;  2R92 I;  1VQ4 Z;  3J80 b;  4A3G I;  1M1K 2;  5I4T G;  1K73 Q;  2PEQ A;  1PFT A;  3TE5 B;  3NDJ A;  1YJ9 1;  3M3Y I;  1KQS Y;  1VQ8 P;  2JYG A;  3CC4 1;  3G26 A;  4E31 A;  1VQK P;  3G28 A;  4XFZ A;  2QKD A;  2WB1 A;  1VQM P;  4U0E A;  1YJN Z;  3CCV 1;  2Y0S A;  1M90 2;  1JJ2 O;  3RZO I;  3WBH A;  3FQQ A;  1VQ6 1;  2PEK A;  1E6J P;  1A8O A;  2IZ3 A;  5IP7 I;  1R9T I;  3OW2 O;  3CCS Z;  5D1O B;  3G4S 1;  1VQ7 P;  3VMI A;  1YHQ P;  3G29 A;  2O4H A;  4NH1 C;  3CCR P;  3PO2 I;  1VQ4 1;  1NP6 A;  2NVT I;  3I55 P;  4A3C I;  3GTJ I;  3VTN A;  1VLA A;  2E2J I;  2P28 A;  4NBB A;  4DGL A;  3DPH A;  2P3Y A;  1Q82 1;  1KC8 2;  2JS4 A;  1N8R 1;  1X3Z A;  1YJN 1;  3OW2 Z;  2PM9 A;  3LUS A;  4MXU A;  3CC4 P;  4MON A;  2P9X A;  3Q20 A;  2QEX Z;  3CCS 1;  4E2W A;  3FQM A;  2F4M A;  3CCV P;  1KD1 Q;  2VUM I;  4AYB A;  3I56 P;  4RVD A;  1VQ6 P;  1YIJ Z;  3GKQ A;  1NJI Q;  1YI2 Z;  4E32 A;  1RO2 A;  3CCL Z;  1I3Q I;  1VQL Z;  3S1M I;  3S1Q I;  4NBA A;  4NBF A;  3G6E P;  5LL6 f;  1Q82 Q;  1X0T A;  1N2F A;  1N8R Q;  4BBR I;  1VQ4 P;  4NFR A;  3Q87 A;  1QVG O;  3G1I A;  1Z02 A;  2GTI A;  3CCU P;  2QR1 B;  4NBE A;  2Z46 A;  3CC7 Z;  1W2B O;  4RS4 A;  3ESW A;  1LQL A;  3T4N B;  2E1M A;  1M6E X;  3NH8 A;  2OTJ P;  4NBG A;  4IPY A;  2QEX 1;  3S2H I;  2G2K A;  3P5J B;  2L6E A;  1YUK A;  2JR6 A;  2KI7 B;  2DE6 A;  2XT1 A;  1YIJ 1;  2OZK A;  1RO0 A;  1BAJ A;  2PMZ A;  3MZL B;  1YI2 1;  4MH4 A;  3CCS P;  1RO4 A;  1DL6 A;  4NBD A;  2JA8 I;  4U0A A;  3CXC Z;  3CCL 1;  3CCM Z;  1S7M A;  1VQL 1;  3M4O I;  2JA7 I;  3U50 C;  4A3J I;  1KRL A;  1W2B Z;  3RZD I;  4WYM A;  2VF1 A;  2Q4Z A;  2CWO A;  3GTP I;  2PEN A;  1X3W A;  3HOV I;  2EIA A;  1QRJ A;  3H47 A;  2JO0 A;  4MD7 A;  3CC7 1;  3H0G I;  4X6A I;  5HGL A;  2M8P A;  2J6A A;  2OOY B;  1QVF Y;  1S72 Z;  2V8K A;  4MD8 A;  2E2H I;  3CCE Z;  1YJW Z;  1Q86 1;  4XX2 A;  1QYP A;  1VQN Z;  1RLY A;  4DQY B;  2QA4 Z;  4RVF A;  3S2D I;  4S1T A;  3J80 f;  2H85 A;  1Z01 A;  3CCM 1;  3CPW O;  5BS1 A;  2HU9 A;  2NVX I;  2RT9 A;  1Q82 2;  1VQP Z;  1YIJ P;  2NVQ I;  1Z03 A;  3EER A;  1N8R 2;  1YI2 P;  3S1N I;  2BHV A;  3PO3 I;  3IF8 A;  1VQ9 Z;  3D6W A;  2Z45 A;  2EG5 A;  1Q7Y 1;  1VQL P;  4EWC A;  4E2X A;  1TWH I;  1VQ5 P;  3CQZ I;  2M6N A;  4XRQ A;  4E33 A;  1S72 1;  3CCE 1;  3PO3 S;  1ML8 A;  1M74 A;  1YJW 1;  4GR6 A;  1IUQ A;  3CC7 P;  1TFI A;  2XXM A;  3BG0 B;  3GTK I;  1VQN 1;  4RV9 A;  3CPW Z;  3CCQ Z;  2QA4 1;  3CC2 Z;  4HH4 A;  1VQO Z;  2LIY A;  3KIF A;  4A3B I;  5C4J I;  3M1M A;  3HOY I;  1VQP 1;  2PK7 A;  2JA5 I;  3G21 A;  1JJ2 Z;  1Q7Y Q;  3F3F C;  3HOU I;  3HYB A;  2M8N A;  4U0F A;  4TNU A;  3CMA Z;  1VQ9 1;  4A3L I;  3LRY A;  1YJ9 P;  1K9M 1;  2B63 I;  3CXC Y;  3CCJ Z;  3D9X A;  2PEI A;  3NFZ A;  1KQS O;  4MD9 A;  2JUB A;  3G1G A;  3DTJ A;  1K8A 1;  1I50 I;  3TDH B;  2RHB A;  2RBL A;  2W03 A;  1S72 P;  5D1P A;  5C44 I;  3CC2 1;  3CCQ 1;  3CCE P;  2BJO A;  1VQO 1;  4BBS I;  1YJW P;  3G4S P;  3VRL C;  2DE5 A;  5IP9 I;  4Y7N I;  1WII A;  2EFJ A;  4COP A;  3S17 I;  1K9M Q;  3VB9 A;  2M48 A;  1KQS Z;  2OAR A;  3CD6 Z;  3CMA 1;  3G71 Z;  1VQP P;  2E9H A;  3JAM f;  3JAM b;  3CCJ 1;  2E2I I;  1Q86 2;  2GTH A;  1VQK Z;  5F2N A;  1YJN P;  2M8L A;  4BY1 I;  1USP A;  1P9N A;  2LFU A;  5DCK A;  5HGO A;  5FLM I;  3GTL I;  5T67 A;  1TWF I;  3DS0 A;  3MZK B;  1QVG Z;  1YHQ Z;  3CCQ P;  3I4M I;  3CC2 P;  1Q81 1;  3IX0 A;  1Q7Y 2;  1Y1V I;  1VQO P;  3CCR Z;  3QWU A;  3CD6 1;  4QNB A;  3I55 Z;  5T6B A;  1ZB9 A;  3G71 1;  1WCM I;  4A3K I;  2HF1 A;  1Y1V S;  3GCF A;  3RG6 C;  4U0B A;  1VQK 1;  1Y1W I;  1JJ2 Y;  4RVH A;  3CCJ P;  3H4E A;  2R7Z I;  3G0V A;  3OW2 Y;  1A43 A;  4BY7 I;  2QEX P;  4NBC A;  1USP B;  4NOZ A;  1K83 I;  4MRI A;  4PH1 A;  1ZB8 A;  3S15 I;  3I56 Z;  4RVG A;  2YAD A;  2NVY I;  1YHQ 1;  2Q51 A;  3DS3 A;  4CL1 A;  1K9M 2;  3F3P C;  2I3C A;  3CCR 1;  5IT9 f;  3CCL P;  5IT9 b;  4GR2 A;  1TWG I;  3E2D A;  5CM2 M;  3I55 1;  3BG1 B;  2IZ4 A;  3S1R I;  1Q86 Q;  2KPI A;  3HOW I;  4E2Z A;  3J7A 4;  2R93 I;  3DS4 A;  1K8A 2;  5HGM A;  2VUG A;  3CD6 P;  2QRC B;  3I4N I;  1TWA I;  1YIT Z;  1WW9 A;  3CCU Z;  3GTM S;  3G71 P;  3HOX I;  4COC A;  3CME Z;  3DS5 A;  4DK1 A;  4A3D I;  3NH5 A;  1QVF O;  2AKL A;  2OTJ Z;  4NB8 A;  4U0D A;  3S14 I;  2DE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...