1RO0A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m semet remote
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
total genus 61
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro0A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro0A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro0A02
1RO2A 3M1MA 1RO0A 1RNIA
chains in the Genus database with same CATH superfamily
2MR7A 2JIQA 1QRJA 7CEIA 5D1OA 4A3FI 3U43A 1Y1VI 3CCR1 1E6JP 1VQ61 1I3QI 2Z44A 2JU1A 3J81b 1QYPA 4NOZA 1YJ9P 2PEJA 2KI7B 2VF1A 4A3JI 2FVFA 4MXUA 2JYGA 3NH5A 1Q861 2V8JA 1NUIA 3S1NI 2FVEA 4A3CI 3VTNA 1ZMBA 2HU9A 4RVHA 1YJNP 3HYBA 2JIPA 4A3LI 2JA8I 2R93I 2WPTA 1DL6A 3VRLC 1I50I 4QTUA 1F80D 3EJDA 4XROA 4HH4A 2V8KA 5IT9b 2CNRA 1A8OA 2XZ0D 4BPHA 5IT9f 4A3BI 3CCSP 2JIRA 2K0DX 4H2WC 2ZAEB 1JJ2Z 2VPXA 3CCL1 2LEXA 1JJ2Y 3JAMf 1VQN1 2L22A 3HKZA 3I56Z 1YHQZ 1TWGI 3LUSA 2BUOA 4GR2A 5KP7B 2DGYA 2OOYB 2AVAA 4MH4A 1YHQP 3RZDI 2Q51A 4BY1I 3GTLI 5EW5E 1R9TI 1QXFA 1Z02A 2KG6A 2CWOA 2I3CA 1T8KA 2O4HA 1A43A 5C44I 2QA4Z 2VUMI 2BHVA 2RIQA 1VQ71 1Q82Q 2NVTI 5FLXb 4CA3A 5HGLA 1QVFY 3DS5A 3H3VJ 2BJOA 1KD12 1RO0A 2IZ3A 1D1DA 5FLXf 3GTMS 1VQ51 3NFZA 4NB9A 3G6EZ 4U0EA 2K93A 2VLPA 4MRIA 4NB8A 1WZNA 2G2KA 3GZLA 2PNGA 3G6EP 1QVGO 1YJ91 3BG0B 1L1OC 1N8R1 1KC82 1ML8A 2XV6A 2PM9A 1M1K2 4CL1A 1VQK1 4E33A 2R92I 3RZOI 4U0DA 5A2Qb 3GZMA 4MONA 4NFRA 2IV2X 2K94A 2K5RA 2P28A 5A2Qf 2NO8A 3CPWZ 2KR5A 1K732 3CPWY 3CD6Z 2ERHA 2K0XA 3NDIA 1Z03A 4Y7NI 2PEQA 1NJIQ 1M6NA 3CD6P 2CG5B 1FDIA 1VQMP 2AFEA 5DCKA 3LRYA 4XX2A 1M90Q 2QREB 4BBRI 2XZ1C 3DS3A 2KOOA 2EG5A 1YIJ1 1FR2A 3I55P 2YADA 1TWFI 2NVYI 3CXCY 3CCJP 3GKQA 1KQSZ 3NTEA 4A3KI 5F2OA 1VKUA 5T67A 1VQ91 5HGMA 1SIWA 1VQLZ 3TDHB 3CME1 1BAJA 2KOQA 2Z46A 2GTHA 2V8IA 2GDXA 3ESWA 1YI2P 2PEKA 5F2NA 2GTIA 1VQLP 2M48A 3DS2A 2E7ZA 2Q4ZA 3GCFA 5HV8A 3VMIA 1Q7YQ 1VQOP 4IZ6A 1OR5A 2VSQA 2FADA 1TFIA 4F37A 4IPYA 1Y8CA 1RQFA 4MD9A 3J80f 2FQ0A 4NBEA 3MZKB 1WIIA 1K9M2 3GJNA 1DV5A 2PK7A 3K7AI 4EWCA 1Q16A 4NBAA 1RO4A 1VQ4Z 1AUMA 2AFDA 2MF4A 3CCQZ 3CCLZ 1VQNZ 3CCVP 2HF1A 3OW2O 1W2BO 3CCU1 2X2BA 4COCA 3CC71 3CC4Z 1YITZ 2P9XA 1HQBA 1AF8A 2K92A 2RBLA 2QR1B 2DE7A 1W2BZ 2M8PA 1YITP 2LIUA 2JIMA 1VQM1 3HOVI 3G711 4PWVB 2JIOA 1YJW1 1I6HI 2M6NA 3WBHA 1VQ7Z 3GTPI 3Q87A 1USPB 1K30A 3CC21 1AYIA 3J81f 3I551 1YUAA 3G1GA 3CCJ1 3B5IA 2F4OA 1P9NA 1BXIA 3NDJA 4E31A 2ONTA 4NBHA 3GTQI 2KOSA 3P05A 2QRDB 2W04A 3CMAZ 2QLVB 2GYKA 3G0VA 2N5HA 3S2DI 4E2WA 1FDOA 2QEXZ 1Q812 3Q20A 1TWCI 4A3MI 3PO3I 1GXGA 2E9HA 4XFZA 2OTL1 2JUBA 2KGDA 4UHPB 3I4NI 2B63I 3M4OI 1Q821 1M74A 4HGZA 1RLYA 3DS1A 2F4MA 2W03A 2CQ8A 2XT1A 1VQ81 3G4SZ 3TE5B 1KRLA 2VPWA 3M3YI 1Y1VS 3I4MI 3J7A4 5D1OB 2AKLA 2V3VA 3I56P 1RNIA 3G29A 2V45A 3G4SP 1KD1Q 1S721 3CCEZ 1X0TA 2NAPA 3GTMI 2PEIA 1X3ZA 2M5RA 2JNYA 4NBGA 2QKDA 3VMHA 4NBFA 2Y0SA 1VQP1 2VLOA 1YIJZ 2VUGA 3HOZI 3E2DA 2KODA 4XRQA 2YU9I 1VQ9Z 2IZ4A 2QA4P 2AYDA 4BY7I 2GZIA 1KC8Q 3IF8A 1UJZA 1M1KQ 3F3PC 5C4XI 3NY7B 1NJI1 5F2KA 2K5XA 2DE5A 5JPAA 2ROQA 1QVFO 2R7ZI 1K73Q 2LIYA 2OTJZ 1M901 2EHTA 1Q862 3FQMA 4E2ZA 2OZKA 3FQQA 4RVGA 1WCMI 4RV9A 3CCMZ 2MVVA 1YJN1 1VLAA 1QVGZ 5BS2A 3RG6C 5KP8B 4NBCA 2KOPA 4MD8A 3CCS1 1EOQA 3CCUZ 1QF8A 3GTJI 3CC7Z 1KQSY 3G21A 1Y1WI 5I4TG 2GZJA 4PXHB 1GPJA 1EMVA 1YHQ1 2L9FA 3S1QI 3CCRZ 1VQ6Z 4S1TA 1DNYA 1YJWZ 2MVUA 3CXCO 2H85A 2FACA 4E30A 5FLMI 3S2HI 3P5JB 1K9MQ 1VHNA 4RVDA 3GTOI 1UNKA 2KG8A 1VQ6P 1L0HA 2KPIA 3D6WA 2QA41 3GTGI 2M8LA 1KLPA 1IMPA 2PY8A 4RVFA 2KG9A 3LMOA 3D2LA 4DGLA 5CZDB 2O53A 2GZGA 1K8AQ 3F3FC 2JO0A 3G6E1 2KWLA 5HVCA 2RPRA 3HOYI 2LPKA 1N8R2 2LKIA 3CE7A 1ZB9A 3S16I 2FQ1A 3M1MA 2JA5I 4NBBA 1VQ8Z 1VQ4P 2JYLA 3D9XA 4HKGA 5BS1A 3CCQP 4NBDA 3CCLP 1VQNP 3G26A 2J6AA 3HOUI 2LTEA 1S72Z 3OW2Z 3CC4P 1W2BY 3CD61 4E32A 5IP7I 2JBGA 1ZB8A 2WB1A 3EERA 4DG9A 2JA6I 4RS4A 1VQPZ 1NP6A 1AA6A 3CQZI 2NVQI 2LOLA 1Q81Q 1ACPA 1VQ7P 3G1IA 1VQ5Z 3GTKI 3HOWI 1WW9A 3U50C 4BPFA 2EFJA 1X3OA 1VQ5P 1KD11 2QRCB 1YI21 1VQL1 3GKLC 1MZ8A 1GXHA 1LQLA 3CMAP 2KGAA 2VPYA 3VB9A 3H0GI 1YJ9Z 2E2JI 4PH1A 4MRTC 1VQO1 1VQKZ 5EJDA 2LMLA 2QEXP 2KW2A 1IMQA 3H47A 3I07A 2E2II 1EIAA 1YJNZ 2EHSA 1VQKP 3QWUA 4XFXA 4A3EI 1KC81 2LF4A 1NQ4A 1M1K1 4H2YC 2OARA 2CGQA 2Z45A 2GZFA 1SFOI 4U0CA 3KIFA 3S14I 1JJ2O 1K731 4DQYB 3DTJA 3CCSZ 3S1RI 4QTTA 2DE6A 2K0YA 3CCV1 3CCEP 2N98A 2DNWA 2GDWA 2KGCA 1VQ41 4R0MA 3JAMb 3EEDA 2VLNA 3MGEA 4U0AA 3CCQ1 2R6MA 5AN9F 1Q86Q 3T4NB 1YIJP 2PEMA 3FKII 3CMEZ 3PO3S 2JU2A 3VMGA 2K3RA 3CC41 1VQ9P 3MONA 4U0FA 1YUKA 1YIT1 2FQ2A 2MY5A 3CMEP 4BBSI 2QNWA 1WJ2A 4NH1C 5C3EI 3IR7A 3KIHA 4Y52I 3IFUA 4A3GI 2OTJP 2L6EA 2M8NA 4XFYA 5C4JI 1QVFZ 4BPGA 1TWAI 1QVGY 4E2YA 3DS4A 3CCMP 2L4BA 4TNUA 3G28A 2OOXB 1JWHC 1N2FA 3CMA1 1IUQA 4DK1A 2JQ4A 3MZLB 1Q822 1K9M1 4AYBA 3HOXI 1Q7Y1 2QEX1 2E2HI 3B4QA 4HGYA 3HZQA 3CPWO 2P3YA 5KP6B 5HGNA 3DS0A 2N50A 1Z01A 3H4EA 4NEOA 2JMOA 2GDYA 3CCUP 5D1PA 4E2XA 2PMZA 4A3II 3I561 3S15I 3RG2A 3CC7P 4MD7A 5CM2M 3G4S1 1K8A1 2AF8A 1PFTA 1VQMZ 2WAQA 3G71Z 5HGOA 4COPA 1RO2A 1CEIA 5IP9I 2JGPA 1KQSO 2JS4A 2FAEA 2N6ZA 3EJBA 1TWHI 3CC2Z 3CCE1 2JB0A 4A3DI 3CCRP 3G71P 3I55Z 2N5IA 1YJWP 3CCJZ 3BG1B 2MR8A 1N8RQ 3CC2P 4X6AI 3NH4A 2JA7I 2FHSC 3CXCZ 4PH0A 2JR6A 2K2QA 1NJI2 1Z6MA 1YI2Z 2RT9A 3NH8A 2PEOA 3DPHA 2LFUA 3IX0A 4WYMA 1M902 3H0DA 2PENA 2OTLZ 2GZEA 1VQOZ 2EGTA 3PO2I 2OTJ1 2XXMA 1Q811 2LL8A 2OTLP 5LL6f 4QNBA 4M0IA 1X3WA 4H2XC 2EIAA 1HY8A 3J80b 2E1MA 1USPA 1E0HA 4BXXI 2VPZA 3EJEA 3CCM1 2FVAA 4A93I 1VQ8P 5T6BA 5T64A 2GU2A 3OW2Y 2KGEA 2LIWA 1Q7Y2 4QKOA 1K83I 1S72P 3CCVZ 2JAZA 2N6YA 3S17I 4GR6A 1ZH1A 2MD9A 2NVXI 3S1MI 1ZNVA 1VQPP 1M6EX 2RHBA 1K8A2 1L0IA 2L0QA 2VLQA 1S7MA 4U0BA 2KORA
chains in the Genus database with same CATH topology
1QRJA 5D1OA 4A3FI 1Y1VI 3CCR1 1E6JP 1VQ61 1I3QI 2Z44A 3J81b 1QYPA 4NOZA 1YJ9P 2PEJA 2KI7B 2VF1A 4A3JI 4MXUA 2JYGA 3NH5A 1Q861 2V8JA 1NUIA 3S1NI 4A3CI 3VTNA 1ZMBA 2HU9A 4RVHA 1YJNP 3HYBA 4A3LI 2JA8I 2R93I 1DL6A 3VRLC 1I50I 4QTUA 4XROA 4HH4A 2V8KA 5IT9b 1A8OA 5IT9f 4A3BI 3CCSP 2ZAEB 1JJ2Z 3CCL1 1JJ2Y 1VQN1 3JAMf 3HKZA 3I56Z 1YHQZ 1TWGI 3LUSA 2BUOA 4GR2A 2DGYA 2OOYB 4MH4A 1YHQP 3RZDI 2Q51A 4BY1I 3GTLI 1R9TI 1Z02A 2CWOA 2I3CA 2O4HA 1A43A 5C44I 2QA4Z 2VUMI 2BHVA 2RIQA 1VQ71 1Q82Q 2NVTI 5FLXb 5HGLA 1QVFY 3DS5A 3H3VJ 2BJOA 1KD12 1RO0A 2IZ3A 1D1DA 5FLXf 3GTMS 1VQ51 3NFZA 4NB9A 3G6EZ 4U0EA 4MRIA 4NB8A 2G2KA 3G6EP 1QVGO 1YJ91 3BG0B 1L1OC 1N8R1 1KC82 1ML8A 2PM9A 2XV6A 1M1K2 4CL1A 1VQK1 4E33A 2R92I 3RZOI 4U0DA 5A2Qb 4MONA 4NFRA 2K5RA 2P28A 5A2Qf 3CPWZ 1K732 3CPWY 3CD6Z 3NDIA 1Z03A 4Y7NI 2PEQA 1NJIQ 1M6NA 3CD6P 1VQMP 5DCKA 3LRYA 4XX2A 1M90Q 2QREB 4BBRI 3DS3A 2EG5A 1YIJ1 3I55P 2YADA 1TWFI 2NVYI 3CXCY 3CCJP 3GKQA 1KQSZ 3NTEA 4A3KI 5F2OA 5T67A 1VQ91 5HGMA 1VQLZ 3TDHB 3CME1 1BAJA 2Z46A 2GTHA 2V8IA 3ESWA 1YI2P 2PEKA 5F2NA 2GTIA 1VQLP 2M48A 3DS2A 2Q4ZA 3GCFA 3VMIA 1Q7YQ 1VQOP 1TFIA 4MD9A 4IPYA 1RQFA 3J80f 4NBEA 3MZKB 1WIIA 1K9M2 2PK7A 3K7AI 4EWCA 4NBAA 1RO4A 1VQ4Z 1AUMA 3CCQZ 3CCLZ 1VQNZ 3CCVP 2HF1A 3OW2O 1W2BO 3CCU1 4COCA 3CC71 3CC4Z 1YITZ 2P9XA 2RBLA 2QR1B 2DE7A 1W2BZ 2M8PA 1YITP 1VQM1 3HOVI 3G711 1YJW1 1I6HI 2M6NA 3WBHA 1VQ7Z 3GTPI 3Q87A 1USPB 1K30A 3CC21 3J81f 3I551 1YUAA 3G1GA 3CCJ1 3B5IA 2F4OA 1P9NA 3NDJA 4E31A 2ONTA 4NBHA 3GTQI 2QRDB 3P05A 3CMAZ 2W04A 2QLVB 3G0VA 3S2DI 4E2WA 2QEXZ 1Q812 3Q20A 1TWCI 4A3MI 3PO3I 2E9HA 4XFZA 2OTL1 2JUBA 3I4NI 2B63I 3M4OI 1Q821 1M74A 4HGZA 1RLYA 3DS1A 2F4MA 2W03A 2XT1A 1VQ81 3G4SZ 3TE5B 1KRLA 3M3YI 1Y1VS 3I4MI 3J7A4 5D1OB 2AKLA 3I56P 1RNIA 3G29A 3G4SP 1KD1Q 1S721 3CCEZ 1X0TA 3GTMI 2PEIA 1X3ZA 2JNYA 4NBGA 2QKDA 3VMHA 4NBFA 2Y0SA 1VQP1 1YIJZ 3HOZI 2VUGA 3E2DA 2KODA 4XRQA 2YU9I 1VQ9Z 2IZ4A 2QA4P 4BY7I 1KC8Q 3IF8A 1M1KQ 3F3PC 5C4XI 1NJI1 5F2KA 2DE5A 5JPAA 1QVFO 2R7ZI 1K73Q 2LIYA 2OTJZ 1M901 1Q862 3FQMA 4E2ZA 2OZKA 3FQQA 4RVGA 1WCMI 4RV9A 3CCMZ 1YJN1 1VLAA 1QVGZ 5BS2A 3RG6C 4NBCA 4MD8A 3CCS1 1EOQA 3CCUZ 1QF8A 3GTJI 3CC7Z 1KQSY 3G21A 1Y1WI 5I4TG 1YHQ1 3S1QI 3CCRZ 1VQ6Z 4S1TA 1YJWZ 3CXCO 2H85A 4E30A 5FLMI 3S2HI 3P5JB 1K9MQ 4RVDA 3GTOI 1VQ6P 2KPIA 3D6WA 2QA41 3GTGI 2M8LA 2PY8A 4RVFA 4DGLA 2O53A 1K8AQ 3F3FC 2JO0A 3G6E1 2RPRA 3HOYI 1N8R2 1ZB9A 3S16I 3M1MA 2JA5I 4NBBA 1VQ8Z 1VQ4P 2JYLA 3D9XA 5BS1A 3CCQP 4NBDA 3CCLP 1VQNP 3G26A 2J6AA 3HOUI 1S72Z 3OW2Z 3CC4P 1W2BY 3CD61 4E32A 5IP7I 1ZB8A 2WB1A 3EERA 2JA6I 4RS4A 1VQPZ 1NP6A 3CQZI 2NVQI 1Q81Q 1VQ7P 3G1IA 1VQ5Z 3GTKI 3HOWI 1WW9A 3U50C 2EFJA 1VQ5P 1KD11 2QRCB 1YI21 1VQL1 1LQLA 3CMAP 3VB9A 3H0GI 1YJ9Z 2E2JI 4PH1A 1VQO1 1VQKZ 2QEXP 3H47A 3I07A 2E2II 1EIAA 1YJNZ 1VQKP 3QWUA 4XFXA 4A3EI 1KC81 2LF4A 1M1K1 2OARA 2Z45A 1SFOI 4U0CA 3KIFA 3S14I 1JJ2O 1K731 4DQYB 3DTJA 3CCSZ 3S1RI 4QTTA 2DE6A 3CCV1 3CCEP 1VQ41 3JAMb 3EEDA 3MGEA 4U0AA 3CCQ1 2R6MA 5AN9F 1Q86Q 3T4NB 1YIJP 2PEMA 3FKII 3CMEZ 3PO3S 3VMGA 2K3RA 3CC41 1VQ9P 3MONA 4U0FA 1YUKA 1YIT1 3CMEP 4BBSI 4NH1C 5C3EI 3KIHA 4Y52I 3IFUA 4A3GI 2OTJP 2L6EA 2M8NA 4XFYA 5C4JI 1QVFZ 1TWAI 1QVGY 4E2YA 3DS4A 3CCMP 4TNUA 3G28A 2OOXB 1JWHC 1N2FA 3CMA1 1IUQA 4DK1A 3MZLB 1Q822 1K9M1 4AYBA 3HOXI 1Q7Y1 2QEX1 2E2HI 4HGYA 3HZQA 3CPWO 2P3YA 5HGNA 3DS0A 1Z01A 3H4EA 2JMOA 5D1PA 3CCUP 4E2XA 4A3II 2PMZA 3I561 3S15I 3CC7P 5CM2M 4MD7A 3G4S1 1K8A1 1VQMZ 1PFTA 2WAQA 3G71Z 5HGOA 4COPA 1RO2A 5IP9I 2JS4A 1KQSO 1TWHI 3CC2Z 3CCE1 4A3DI 3CCRP 3G71P 3I55Z 1YJWP 3CCJZ 3BG1B 1N8RQ 3CC2P 4X6AI 3NH4A 2JA7I 3CXCZ 4PH0A 2JR6A 1NJI2 1YI2Z 2RT9A 3NH8A 2PEOA 3DPHA 2LFUA 3IX0A 4WYMA 1M902 3H0DA 2PENA 2OTLZ 1VQOZ 2EGTA 3PO2I 2OTJ1 2XXMA 1Q811 2OTLP 5LL6f 4QNBA 4M0IA 1X3WA 3J80b 2EIAA 2E1MA 1USPA 4BXXI 3CCM1 4A93I 1VQ8P 5T6BA 5T64A 2GU2A 3OW2Y 1Q7Y2 1K83I 1S72P 3CCVZ 3S17I 4GR6A 1ZH1A 2NVXI 3S1MI 1VQPP 1M6EX 2RHBA 1K8A2 1S7MA 4U0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO2 A;  3M1M A;  1RO0 A;  1RNI A; 
#chains in the Genus database with same CATH topology
 2MR7 A;  2JIQ A;  1QRJ A;  7CEI A;  5D1O A;  4A3F I;  3U43 A;  1Y1V I;  3CCR 1;  1E6J P;  1VQ6 1;  1I3Q I;  2Z44 A;  2JU1 A;  3J81 b;  1QYP A;  4NOZ A;  1YJ9 P;  2PEJ A;  2KI7 B;  2VF1 A;  4A3J I;  2FVF A;  4MXU A;  2JYG A;  3NH5 A;  1Q86 1;  2V8J A;  1NUI A;  3S1N I;  2FVE A;  4A3C I;  3VTN A;  1ZMB A;  2HU9 A;  4RVH A;  1YJN P;  3HYB A;  2JIP A;  4A3L I;  2JA8 I;  2R93 I;  2WPT A;  1DL6 A;  3VRL C;  1I50 I;  4QTU A;  1F80 D;  3EJD A;  4XRO A;  4HH4 A;  2V8K A;  5IT9 b;  2CNR A;  1A8O A;  2XZ0 D;  4BPH A;  5IT9 f;  4A3B I;  3CCS P;  2JIR A;  2K0D X;  4H2W C;  2ZAE B;  1JJ2 Z;  2VPX A;  3CCL 1;  2LEX A;  1JJ2 Y;  3JAM f;  1VQN 1;  2L22 A;  3HKZ A;  3I56 Z;  1YHQ Z;  1TWG I;  3LUS A;  2BUO A;  4GR2 A;  5KP7 B;  2DGY A;  2OOY B;  2AVA A;  4MH4 A;  1YHQ P;  3RZD I;  2Q51 A;  4BY1 I;  3GTL I;  5EW5 E;  1R9T I;  1QXF A;  1Z02 A;  2KG6 A;  2CWO A;  2I3C A;  1T8K A;  2O4H A;  1A43 A;  5C44 I;  2QA4 Z;  2VUM I;  2BHV A;  2RIQ A;  1VQ7 1;  1Q82 Q;  2NVT I;  5FLX b;  4CA3 A;  5HGL A;  1QVF Y;  3DS5 A;  3H3V J;  2BJO A;  1KD1 2;  1RO0 A;  2IZ3 A;  1D1D A;  5FLX f;  3GTM S;  1VQ5 1;  3NFZ A;  4NB9 A;  3G6E Z;  4U0E A;  2K93 A;  2VLP A;  4MRI A;  4NB8 A;  1WZN A;  2G2K A;  3GZL A;  2PNG A;  3G6E P;  1QVG O;  1YJ9 1;  3BG0 B;  1L1O C;  1N8R 1;  1KC8 2;  1ML8 A;  2XV6 A;  2PM9 A;  1M1K 2;  4CL1 A;  1VQK 1;  4E33 A;  2R92 I;  3RZO I;  4U0D A;  5A2Q b;  3GZM A;  4MON A;  4NFR A;  2IV2 X;  2K94 A;  2K5R A;  2P28 A;  5A2Q f;  2NO8 A;  3CPW Z;  2KR5 A;  1K73 2;  3CPW Y;  3CD6 Z;  2ERH A;  2K0X A;  3NDI A;  1Z03 A;  4Y7N I;  2PEQ A;  1NJI Q;  1M6N A;  3CD6 P;  2CG5 B;  1FDI A;  1VQM P;  2AFE A;  5DCK A;  3LRY A;  4XX2 A;  1M90 Q;  2QRE B;  4BBR I;  2XZ1 C;  3DS3 A;  2KOO A;  2EG5 A;  1YIJ 1;  1FR2 A;  3I55 P;  2YAD A;  1TWF I;  2NVY I;  3CXC Y;  3CCJ P;  3GKQ A;  1KQS Z;  3NTE A;  4A3K I;  5F2O A;  1VKU A;  5T67 A;  1VQ9 1;  5HGM A;  1SIW A;  1VQL Z;  3TDH B;  3CME 1;  1BAJ A;  2KOQ A;  2Z46 A;  2GTH A;  2V8I A;  2GDX A;  3ESW A;  1YI2 P;  2PEK A;  5F2N A;  2GTI A;  1VQL P;  2M48 A;  3DS2 A;  2E7Z A;  2Q4Z A;  3GCF A;  5HV8 A;  3VMI A;  1Q7Y Q;  1VQO P;  4IZ6 A;  1OR5 A;  2VSQ A;  2FAD A;  1TFI A;  4F37 A;  4IPY A;  1Y8C A;  1RQF A;  4MD9 A;  3J80 f;  2FQ0 A;  4NBE A;  3MZK B;  1WII A;  1K9M 2;  3GJN A;  1DV5 A;  2PK7 A;  3K7A I;  4EWC A;  1Q16 A;  4NBA A;  1RO4 A;  1VQ4 Z;  1AUM A;  2AFD A;  2MF4 A;  3CCQ Z;  3CCL Z;  1VQN Z;  3CCV P;  2HF1 A;  3OW2 O;  1W2B O;  3CCU 1;  2X2B A;  4COC A;  3CC7 1;  3CC4 Z;  1YIT Z;  2P9X A;  1HQB A;  1AF8 A;  2K92 A;  2RBL A;  2QR1 B;  2DE7 A;  1W2B Z;  2M8P A;  1YIT P;  2LIU A;  2JIM A;  1VQM 1;  3HOV I;  3G71 1;  4PWV B;  2JIO A;  1YJW 1;  1I6H I;  2M6N A;  3WBH A;  1VQ7 Z;  3GTP I;  3Q87 A;  1USP B;  1K30 A;  3CC2 1;  1AYI A;  3J81 f;  3I55 1;  1YUA A;  3G1G A;  3CCJ 1;  3B5I A;  2F4O A;  1P9N A;  1BXI A;  3NDJ A;  4E31 A;  2ONT A;  4NBH A;  3GTQ I;  2KOS A;  3P05 A;  2QRD B;  2W04 A;  3CMA Z;  2QLV B;  2GYK A;  3G0V A;  2N5H A;  3S2D I;  4E2W A;  1FDO A;  2QEX Z;  1Q81 2;  3Q20 A;  1TWC I;  4A3M I;  3PO3 I;  1GXG A;  2E9H A;  4XFZ A;  2OTL 1;  2JUB A;  2KGD A;  4UHP B;  3I4N I;  2B63 I;  3M4O I;  1Q82 1;  1M74 A;  4HGZ A;  1RLY A;  3DS1 A;  2F4M A;  2W03 A;  2CQ8 A;  2XT1 A;  1VQ8 1;  3G4S Z;  3TE5 B;  1KRL A;  2VPW A;  3M3Y I;  1Y1V S;  3I4M I;  3J7A 4;  5D1O B;  2AKL A;  2V3V A;  3I56 P;  1RNI A;  3G29 A;  2V45 A;  3G4S P;  1KD1 Q;  1S72 1;  3CCE Z;  1X0T A;  2NAP A;  3GTM I;  2PEI A;  1X3Z A;  2M5R A;  2JNY A;  4NBG A;  2QKD A;  3VMH A;  4NBF A;  2Y0S A;  1VQP 1;  2VLO A;  1YIJ Z;  2VUG A;  3HOZ I;  3E2D A;  2KOD A;  4XRQ A;  2YU9 I;  1VQ9 Z;  2IZ4 A;  2QA4 P;  2AYD A;  4BY7 I;  2GZI A;  1KC8 Q;  3IF8 A;  1UJZ A;  1M1K Q;  3F3P C;  5C4X I;  3NY7 B;  1NJI 1;  5F2K A;  2K5X A;  2DE5 A;  5JPA A;  2ROQ A;  1QVF O;  2R7Z I;  1K73 Q;  2LIY A;  2OTJ Z;  1M90 1;  2EHT A;  1Q86 2;  3FQM A;  4E2Z A;  2OZK A;  3FQQ A;  4RVG A;  1WCM I;  4RV9 A;  3CCM Z;  2MVV A;  1YJN 1;  1VLA A;  1QVG Z;  5BS2 A;  3RG6 C;  5KP8 B;  4NBC A;  2KOP A;  4MD8 A;  3CCS 1;  1EOQ A;  3CCU Z;  1QF8 A;  3GTJ I;  3CC7 Z;  1KQS Y;  3G21 A;  1Y1W I;  5I4T G;  2GZJ A;  4PXH B;  1GPJ A;  1EMV A;  1YHQ 1;  2L9F A;  3S1Q I;  3CCR Z;  1VQ6 Z;  4S1T A;  1DNY A;  1YJW Z;  2MVU A;  3CXC O;  2H85 A;  2FAC A;  4E30 A;  5FLM I;  3S2H I;  3P5J B;  1K9M Q;  1VHN A;  4RVD A;  3GTO I;  1UNK A;  2KG8 A;  1VQ6 P;  1L0H A;  2KPI A;  3D6W A;  2QA4 1;  3GTG I;  2M8L A;  1KLP A;  1IMP A;  2PY8 A;  4RVF A;  2KG9 A;  3LMO A;  3D2L A;  4DGL A;  5CZD B;  2O53 A;  2GZG A;  1K8A Q;  3F3F C;  2JO0 A;  3G6E 1;  2KWL A;  5HVC A;  2RPR A;  3HOY I;  2LPK A;  1N8R 2;  2LKI A;  3CE7 A;  1ZB9 A;  3S16 I;  2FQ1 A;  3M1M A;  2JA5 I;  4NBB A;  1VQ8 Z;  1VQ4 P;  2JYL A;  3D9X A;  4HKG A;  5BS1 A;  3CCQ P;  4NBD A;  3CCL P;  1VQN P;  3G26 A;  2J6A A;  3HOU I;  2LTE A;  1S72 Z;  3OW2 Z;  3CC4 P;  1W2B Y;  3CD6 1;  4E32 A;  5IP7 I;  2JBG A;  1ZB8 A;  2WB1 A;  3EER A;  4DG9 A;  2JA6 I;  4RS4 A;  1VQP Z;  1NP6 A;  1AA6 A;  3CQZ I;  2NVQ I;  2LOL A;  1Q81 Q;  1ACP A;  1VQ7 P;  3G1I A;  1VQ5 Z;  3GTK I;  3HOW I;  1WW9 A;  3U50 C;  4BPF A;  2EFJ A;  1X3O A;  1VQ5 P;  1KD1 1;  2QRC B;  1YI2 1;  1VQL 1;  3GKL C;  1MZ8 A;  1GXH A;  1LQL A;  3CMA P;  2KGA A;  2VPY A;  3VB9 A;  3H0G I;  1YJ9 Z;  2E2J I;  4PH1 A;  4MRT C;  1VQO 1;  1VQK Z;  5EJD A;  2LML A;  2QEX P;  2KW2 A;  1IMQ A;  3H47 A;  3I07 A;  2E2I I;  1EIA A;  1YJN Z;  2EHS A;  1VQK P;  3QWU A;  4XFX A;  4A3E I;  1KC8 1;  2LF4 A;  1NQ4 A;  1M1K 1;  4H2Y C;  2OAR A;  2CGQ A;  2Z45 A;  2GZF A;  1SFO I;  4U0C A;  3KIF A;  3S14 I;  1JJ2 O;  1K73 1;  4DQY B;  3DTJ A;  3CCS Z;  3S1R I;  4QTT A;  2DE6 A;  2K0Y A;  3CCV 1;  3CCE P;  2N98 A;  2DNW A;  2GDW A;  2KGC A;  1VQ4 1;  4R0M A;  3JAM b;  3EED A;  2VLN A;  3MGE A;  4U0A A;  3CCQ 1;  2R6M A;  5AN9 F;  1Q86 Q;  3T4N B;  1YIJ P;  2PEM A;  3FKI I;  3CME Z;  3PO3 S;  2JU2 A;  3VMG A;  2K3R A;  3CC4 1;  1VQ9 P;  3MON A;  4U0F A;  1YUK A;  1YIT 1;  2FQ2 A;  2MY5 A;  3CME P;  4BBS I;  2QNW A;  1WJ2 A;  4NH1 C;  5C3E I;  3IR7 A;  3KIH A;  4Y52 I;  3IFU A;  4A3G I;  2OTJ P;  2L6E A;  2M8N A;  4XFY A;  5C4J I;  1QVF Z;  4BPG A;  1TWA I;  1QVG Y;  4E2Y A;  3DS4 A;  3CCM P;  2L4B A;  4TNU A;  3G28 A;  2OOX B;  1JWH C;  1N2F A;  3CMA 1;  1IUQ A;  4DK1 A;  2JQ4 A;  3MZL B;  1Q82 2;  1K9M 1;  4AYB A;  3HOX I;  1Q7Y 1;  2QEX 1;  2E2H I;  3B4Q A;  4HGY A;  3HZQ A;  3CPW O;  2P3Y A;  5KP6 B;  5HGN A;  3DS0 A;  2N50 A;  1Z01 A;  3H4E A;  4NEO A;  2JMO A;  2GDY A;  3CCU P;  5D1P A;  4E2X A;  2PMZ A;  4A3I I;  3I56 1;  3S15 I;  3RG2 A;  3CC7 P;  4MD7 A;  5CM2 M;  3G4S 1;  1K8A 1;  2AF8 A;  1PFT A;  1VQM Z;  2WAQ A;  3G71 Z;  5HGO A;  4COP A;  1RO2 A;  1CEI A;  5IP9 I;  2JGP A;  1KQS O;  2JS4 A;  2FAE A;  2N6Z A;  3EJB A;  1TWH I;  3CC2 Z;  3CCE 1;  2JB0 A;  4A3D I;  3CCR P;  3G71 P;  3I55 Z;  2N5I A;  1YJW P;  3CCJ Z;  3BG1 B;  2MR8 A;  1N8R Q;  3CC2 P;  4X6A I;  3NH4 A;  2JA7 I;  2FHS C;  3CXC Z;  4PH0 A;  2JR6 A;  2K2Q A;  1NJI 2;  1Z6M A;  1YI2 Z;  2RT9 A;  3NH8 A;  2PEO A;  3DPH A;  2LFU A;  3IX0 A;  4WYM A;  1M90 2;  3H0D A;  2PEN A;  2OTL Z;  2GZE A;  1VQO Z;  2EGT A;  3PO2 I;  2OTJ 1;  2XXM A;  1Q81 1;  2LL8 A;  2OTL P;  5LL6 f;  4QNB A;  4M0I A;  1X3W A;  4H2X C;  2EIA A;  1HY8 A;  3J80 b;  2E1M A;  1USP A;  1E0H A;  4BXX I;  2VPZ A;  3EJE A;  3CCM 1;  2FVA A;  4A93 I;  1VQ8 P;  5T6B A;  5T64 A;  2GU2 A;  3OW2 Y;  2KGE A;  2LIW A;  1Q7Y 2;  4QKO A;  1K83 I;  1S72 P;  3CCV Z;  2JAZ A;  2N6Y A;  3S17 I;  4GR6 A;  1ZH1 A;  2MD9 A;  2NVX I;  3S1M I;  1ZNV A;  1VQP P;  1M6E X;  2RHB A;  1K8A 2;  1L0I A;  2L0Q A;  2VLQ A;  1S7M A;  4U0B A;  2KOR A; 
#chains in the Genus database with same CATH homology
 1QRJ A;  5D1O A;  4A3F I;  1Y1V I;  3CCR 1;  1E6J P;  1VQ6 1;  1I3Q I;  2Z44 A;  3J81 b;  1QYP A;  4NOZ A;  1YJ9 P;  2PEJ A;  2KI7 B;  2VF1 A;  4A3J I;  4MXU A;  2JYG A;  3NH5 A;  1Q86 1;  2V8J A;  1NUI A;  3S1N I;  4A3C I;  3VTN A;  1ZMB A;  2HU9 A;  4RVH A;  1YJN P;  3HYB A;  4A3L I;  2JA8 I;  2R93 I;  1DL6 A;  3VRL C;  1I50 I;  4QTU A;  4XRO A;  4HH4 A;  2V8K A;  5IT9 b;  1A8O A;  5IT9 f;  4A3B I;  3CCS P;  2ZAE B;  1JJ2 Z;  3CCL 1;  1JJ2 Y;  1VQN 1;  3JAM f;  3HKZ A;  3I56 Z;  1YHQ Z;  1TWG I;  3LUS A;  2BUO A;  4GR2 A;  2DGY A;  2OOY B;  4MH4 A;  1YHQ P;  3RZD I;  2Q51 A;  4BY1 I;  3GTL I;  1R9T I;  1Z02 A;  2CWO A;  2I3C A;  2O4H A;  1A43 A;  5C44 I;  2QA4 Z;  2VUM I;  2BHV A;  2RIQ A;  1VQ7 1;  1Q82 Q;  2NVT I;  5FLX b;  5HGL A;  1QVF Y;  3DS5 A;  3H3V J;  2BJO A;  1KD1 2;  1RO0 A;  2IZ3 A;  1D1D A;  5FLX f;  3GTM S;  1VQ5 1;  3NFZ A;  4NB9 A;  3G6E Z;  4U0E A;  4MRI A;  4NB8 A;  2G2K A;  3G6E P;  1QVG O;  1YJ9 1;  3BG0 B;  1L1O C;  1N8R 1;  1KC8 2;  1ML8 A;  2PM9 A;  2XV6 A;  1M1K 2;  4CL1 A;  1VQK 1;  4E33 A;  2R92 I;  3RZO I;  4U0D A;  5A2Q b;  4MON A;  4NFR A;  2K5R A;  2P28 A;  5A2Q f;  3CPW Z;  1K73 2;  3CPW Y;  3CD6 Z;  3NDI A;  1Z03 A;  4Y7N I;  2PEQ A;  1NJI Q;  1M6N A;  3CD6 P;  1VQM P;  5DCK A;  3LRY A;  4XX2 A;  1M90 Q;  2QRE B;  4BBR I;  3DS3 A;  2EG5 A;  1YIJ 1;  3I55 P;  2YAD A;  1TWF I;  2NVY I;  3CXC Y;  3CCJ P;  3GKQ A;  1KQS Z;  3NTE A;  4A3K I;  5F2O A;  5T67 A;  1VQ9 1;  5HGM A;  1VQL Z;  3TDH B;  3CME 1;  1BAJ A;  2Z46 A;  2GTH A;  2V8I A;  3ESW A;  1YI2 P;  2PEK A;  5F2N A;  2GTI A;  1VQL P;  2M48 A;  3DS2 A;  2Q4Z A;  3GCF A;  3VMI A;  1Q7Y Q;  1VQO P;  1TFI A;  4MD9 A;  4IPY A;  1RQF A;  3J80 f;  4NBE A;  3MZK B;  1WII A;  1K9M 2;  2PK7 A;  3K7A I;  4EWC A;  4NBA A;  1RO4 A;  1VQ4 Z;  1AUM A;  3CCQ Z;  3CCL Z;  1VQN Z;  3CCV P;  2HF1 A;  3OW2 O;  1W2B O;  3CCU 1;  4COC A;  3CC7 1;  3CC4 Z;  1YIT Z;  2P9X A;  2RBL A;  2QR1 B;  2DE7 A;  1W2B Z;  2M8P A;  1YIT P;  1VQM 1;  3HOV I;  3G71 1;  1YJW 1;  1I6H I;  2M6N A;  3WBH A;  1VQ7 Z;  3GTP I;  3Q87 A;  1USP B;  1K30 A;  3CC2 1;  3J81 f;  3I55 1;  1YUA A;  3G1G A;  3CCJ 1;  3B5I A;  2F4O A;  1P9N A;  3NDJ A;  4E31 A;  2ONT A;  4NBH A;  3GTQ I;  2QRD B;  3P05 A;  3CMA Z;  2W04 A;  2QLV B;  3G0V A;  3S2D I;  4E2W A;  2QEX Z;  1Q81 2;  3Q20 A;  1TWC I;  4A3M I;  3PO3 I;  2E9H A;  4XFZ A;  2OTL 1;  2JUB A;  3I4N I;  2B63 I;  3M4O I;  1Q82 1;  1M74 A;  4HGZ A;  1RLY A;  3DS1 A;  2F4M A;  2W03 A;  2XT1 A;  1VQ8 1;  3G4S Z;  3TE5 B;  1KRL A;  3M3Y I;  1Y1V S;  3I4M I;  3J7A 4;  5D1O B;  2AKL A;  3I56 P;  1RNI A;  3G29 A;  3G4S P;  1KD1 Q;  1S72 1;  3CCE Z;  1X0T A;  3GTM I;  2PEI A;  1X3Z A;  2JNY A;  4NBG A;  2QKD A;  3VMH A;  4NBF A;  2Y0S A;  1VQP 1;  1YIJ Z;  3HOZ I;  2VUG A;  3E2D A;  2KOD A;  4XRQ A;  2YU9 I;  1VQ9 Z;  2IZ4 A;  2QA4 P;  4BY7 I;  1KC8 Q;  3IF8 A;  1M1K Q;  3F3P C;  5C4X I;  1NJI 1;  5F2K A;  2DE5 A;  5JPA A;  1QVF O;  2R7Z I;  1K73 Q;  2LIY A;  2OTJ Z;  1M90 1;  1Q86 2;  3FQM A;  4E2Z A;  2OZK A;  3FQQ A;  4RVG A;  1WCM I;  4RV9 A;  3CCM Z;  1YJN 1;  1VLA A;  1QVG Z;  5BS2 A;  3RG6 C;  4NBC A;  4MD8 A;  3CCS 1;  1EOQ A;  3CCU Z;  1QF8 A;  3GTJ I;  3CC7 Z;  1KQS Y;  3G21 A;  1Y1W I;  5I4T G;  1YHQ 1;  3S1Q I;  3CCR Z;  1VQ6 Z;  4S1T A;  1YJW Z;  3CXC O;  2H85 A;  4E30 A;  5FLM I;  3S2H I;  3P5J B;  1K9M Q;  4RVD A;  3GTO I;  1VQ6 P;  2KPI A;  3D6W A;  2QA4 1;  3GTG I;  2M8L A;  2PY8 A;  4RVF A;  4DGL A;  2O53 A;  1K8A Q;  3F3F C;  2JO0 A;  3G6E 1;  2RPR A;  3HOY I;  1N8R 2;  1ZB9 A;  3S16 I;  3M1M A;  2JA5 I;  4NBB A;  1VQ8 Z;  1VQ4 P;  2JYL A;  3D9X A;  5BS1 A;  3CCQ P;  4NBD A;  3CCL P;  1VQN P;  3G26 A;  2J6A A;  3HOU I;  1S72 Z;  3OW2 Z;  3CC4 P;  1W2B Y;  3CD6 1;  4E32 A;  5IP7 I;  1ZB8 A;  2WB1 A;  3EER A;  2JA6 I;  4RS4 A;  1VQP Z;  1NP6 A;  3CQZ I;  2NVQ I;  1Q81 Q;  1VQ7 P;  3G1I A;  1VQ5 Z;  3GTK I;  3HOW I;  1WW9 A;  3U50 C;  2EFJ A;  1VQ5 P;  1KD1 1;  2QRC B;  1YI2 1;  1VQL 1;  1LQL A;  3CMA P;  3VB9 A;  3H0G I;  1YJ9 Z;  2E2J I;  4PH1 A;  1VQO 1;  1VQK Z;  2QEX P;  3H47 A;  3I07 A;  2E2I I;  1EIA A;  1YJN Z;  1VQK P;  3QWU A;  4XFX A;  4A3E I;  1KC8 1;  2LF4 A;  1M1K 1;  2OAR A;  2Z45 A;  1SFO I;  4U0C A;  3KIF A;  3S14 I;  1JJ2 O;  1K73 1;  4DQY B;  3DTJ A;  3CCS Z;  3S1R I;  4QTT A;  2DE6 A;  3CCV 1;  3CCE P;  1VQ4 1;  3JAM b;  3EED A;  3MGE A;  4U0A A;  3CCQ 1;  2R6M A;  5AN9 F;  1Q86 Q;  3T4N B;  1YIJ P;  2PEM A;  3FKI I;  3CME Z;  3PO3 S;  3VMG A;  2K3R A;  3CC4 1;  1VQ9 P;  3MON A;  4U0F A;  1YUK A;  1YIT 1;  3CME P;  4BBS I;  4NH1 C;  5C3E I;  3KIH A;  4Y52 I;  3IFU A;  4A3G I;  2OTJ P;  2L6E A;  2M8N A;  4XFY A;  5C4J I;  1QVF Z;  1TWA I;  1QVG Y;  4E2Y A;  3DS4 A;  3CCM P;  4TNU A;  3G28 A;  2OOX B;  1JWH C;  1N2F A;  3CMA 1;  1IUQ A;  4DK1 A;  3MZL B;  1Q82 2;  1K9M 1;  4AYB A;  3HOX I;  1Q7Y 1;  2QEX 1;  2E2H I;  4HGY A;  3HZQ A;  3CPW O;  2P3Y A;  5HGN A;  3DS0 A;  1Z01 A;  3H4E A;  2JMO A;  5D1P A;  3CCU P;  4E2X A;  4A3I I;  2PMZ A;  3I56 1;  3S15 I;  3CC7 P;  5CM2 M;  4MD7 A;  3G4S 1;  1K8A 1;  1VQM Z;  1PFT A;  2WAQ A;  3G71 Z;  5HGO A;  4COP A;  1RO2 A;  5IP9 I;  2JS4 A;  1KQS O;  1TWH I;  3CC2 Z;  3CCE 1;  4A3D I;  3CCR P;  3G71 P;  3I55 Z;  1YJW P;  3CCJ Z;  3BG1 B;  1N8R Q;  3CC2 P;  4X6A I;  3NH4 A;  2JA7 I;  3CXC Z;  4PH0 A;  2JR6 A;  1NJI 2;  1YI2 Z;  2RT9 A;  3NH8 A;  2PEO A;  3DPH A;  2LFU A;  3IX0 A;  4WYM A;  1M90 2;  3H0D A;  2PEN A;  2OTL Z;  1VQO Z;  2EGT A;  3PO2 I;  2OTJ 1;  2XXM A;  1Q81 1;  2OTL P;  5LL6 f;  4QNB A;  4M0I A;  1X3W A;  3J80 b;  2EIA A;  2E1M A;  1USP A;  4BXX I;  3CCM 1;  4A93 I;  1VQ8 P;  5T6B A;  5T64 A;  2GU2 A;  3OW2 Y;  1Q7Y 2;  1K83 I;  1S72 P;  3CCV Z;  3S17 I;  4GR6 A;  1ZH1 A;  2NVX I;  3S1M I;  1VQP P;  1M6E X;  2RHB A;  1K8A 2;  1S7M A;  4U0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...