2N6ZA

Solution structure of the salicylate-loaded arcp from yersiniabactin synthetase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
80
structure length
79
Chain Sequence
DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMWP2 nonribosomal peptide synthetase
publication title Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 30
structure length 79
sequence length 80
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n6zA00
4H2YC 4IZ6A 2K0XA 5EJDA 4BPHA 2AVAA 2LIWA 2MVUA 2XZ1C 4PWVB 3CE7A 2CGQA 1OR5A 2L22A 2FQ1A 4DG9A 4R0MA 4HKGA 2XZ0D 2FACA 2FVFA 2FADA 2CQ8A 2AFEA 2KG9A 5HVCA 4NEOA 2KWLA 2GDXA 1HY8A 2FVEA 1DV5A 2LKIA 2AF8A 2K92A 2FVAA 4MRTC 4BPGA 2KGEA 2L9FA 2KR5A 2ROQA 2KG6A 2MY5A 2KGDA 3EJBA 2K0YA 2N6ZA 2K93A 2VSQA 2MR7A 2CNRA 2N5HA 4BPFA 2KGAA 2N50A 3GZMA 4H2WC 1T8KA 5KP8B 2EHTA 3NY7B 3LMOA 3RG2A 2LOLA 2N98A 2MD9A 1NQ4A 2MF4A 2MVVA 2K94A 2KOQA 1VKUA 2CG5B 1ACPA 1AF8A 1L0HA 2DNWA 4CA3A 2JU1A 2FAEA 1KLPA 3EJDA 2AFDA 3EJEA 2L0QA 2KGCA 2KOOA 5HV8A 2M5RA 2MR8A 2KOSA 2LL8A 2LIUA 4H2XC 2GDWA 5CZDB 1HQBA 5KP6B 2JQ4A 2FHSC 2KORA 1DNYA 2X2BA 2FQ2A 1X3OA 2LPKA 2LMLA 2JU2A 2LTEA 2GDYA 3GZLA 2PNGA 2L4BA 5KP7B 1L0IA 2N6YA 1F80D 2KW2A 2K2QA 2QNWA 2EHSA 2KG8A 4PXHB 2JGPA 2KOPA 2FQ0A 2N5IA
chains in the Genus database with same CATH superfamily
4H2YC 2PENA 1VQMP 5JPAA 1VQ6P 4U0FA 2CGQA 2XZ0D 2E1MA 2FVFA 1NJIQ 2CQ8A 3DS4A 3E2DA 1N8RQ 2BHVA 2KWLA 3CMEP 1IMQA 3CC7P 1EOQA 2LF4A 1DV5A 2LKIA 2AF8A 4XFXA 4U0BA 3CC2P 2QA4P 1M74A 3CCQP 2ROQA 1VQPP 3G4SP 2N6ZA 2GYKA 2GZIA 3DS1A 5BS1A 3G6EP 1FR2A 3OW2O 2CNRA 2N5HA 4BPFA 1RNIA 2KGAA 2N50A 2M8NA 5KP8B 1VQ8P 2N98A 3CXCO 2MD9A 1NQ4A 2GZGA 3RG6C 1VKUA 1K8AQ 2DNWA 2JU1A 5BS2A 2FAEA 1KLPA 2WPTA 2AFDA 2JYGA 2LL8A 1M6NA 3MGEA 2GDWA 5CZDB 1AUMA 2X2BA 1AYIA 1X3OA 2LMLA 4U0CA 2JU2A 2EFJA 1UJZA 5KP7B 2KW2A 3H4EA 2EIAA 2EHSA 2KG8A 4PXHB 2JGPA 1M6EX 4IZ6A 1JJ2O 4BPHA 2AVAA 2LIWA 2MVUA 2OARA 3CMAP 3HYBA 5EW5E 1K30A 3G1GA 4DG9A 4HKGA 2KG9A 4NEOA 1IUQA 1K73Q 1HY8A 2ONTA 1YITP 3G28A 2FVEA 1QVFO 1Z6MA 4MRTC 3P05A 2BUOA 2Z45A 2KGEA 1VQ7P 1Q7YQ 3U43A 2KR5A 1VQKP 2KG6A 2VLOA 2M8LA 2MY5A 3DTJA 3EJBA 1GXHA 2K93A 5HGMA 4COPA 1MZ8A 2GZFA 2XXMA 1RO2A 1QVGO 3B5IA 4XRQA 1GXGA 2L6EA 1D1DA 2LOLA 1EMVA 2MVVA 2PEKA 4U0DA 3CCLP 2OTJP 1ACPA 1L0HA 1YJWP 5HGNA 4U0EA 1KQSO 3EJDA 3CCRP 2KGCA 2KOOA 5HGLA 2M5RA 2JO0A 2MR8A 1W2BO 1Q82Q 3CCMP 1VQ5P 4H2XC 1IMPA 2KORA 2FHSC 2PEMA 3NTEA 4XFZA 1CEIA 3G0VA 1E6JP 2LTEA 1S72P 2QNWA 1BXIA 4IPYA 2CWOA 1RO0A 2K0XA 1GPJA 4PH0A 4UHPB 2XZ1C 5HGOA 3CCEP 2P9XA 4PWVB 2K5XA 2L22A 2FQ1A 2FACA 2QEXP 3DS2A 2FADA 2VLNA 4QNBA 4PH1A 1K9MQ 1EIAA 7CEIA 2K92A 3DS0A 3G29A 1Q81Q 3Q20A 2GZJA 3CCUP 4WYMA 3VRLC 2K0YA 3DS3A 4XFYA 4M0IA 2VSQA 2MR7A 3GZMA 4H2WC 2JBGA 3NY7B 3LMOA 3DS5A 1VQOP 3RG2A 1VQNP 2GZEA 3CCSP 2K94A 2KOQA 1YJNP 1M1KQ 2OTLP 1YI2P 3GKLC 2CG5B 1AF8A 5DCKA 3G21A 4F37A 2L0QA 3LRYA 5HV8A 3CCVP 2XT1A 1HQBA 5KP6B 1YJ9P 2JQ4A 2PEQA 1DNYA 2PY8A 3DPHA 2NO8A 2M8PA 5F2KA 3H47A 3GZLA 2L4BA 2N6YA 1F80D 2K2QA 2VLQA 2KOPA 2N5IA 2KODA 5F2OA 5EJDA 3G1IA 2PEOA 4U0AA 1YIJP 3M1MA 3CE7A 1OR5A 3WBHA 4R0MA 2JB0A 2Z46A 3CC4P 2AFEA 5F2NA 2ERHA 5HVCA 2PEIA 2GDXA 2K0DX 4QKOA 1ZMBA 2PEJA 3GJNA 2FVAA 1A43A 4BPGA 3G71P 2VLPA 1E0HA 2L9FA 4XROA 1VQ9P 4GR6A 2KGDA 1A8OA 3G26A 3I56P 1VQ4P 1T8KA 2EHTA 1ZNVA 3B4QA 2MF4A 1KD1Q 1VHNA 4CA3A 1M90Q 2JAZA 1KC8Q 3CPWO 3EJEA 1BAJA 5I4TG 2KOSA 2LIUA 3H0DA 1YHQP 1VQLP 2EG5A 2XV6A 2FQ2A 3CD6P 2LPKA 3CCJP 3I55P 4GR2A 2JYLA 4COCA 3HZQA 2GDYA 2PNGA 1L0IA 1QRJA 1Q86Q 2DGYA 1UNKA 2Z44A 2FQ0A
chains in the Genus database with same CATH topology
4H2YC 4IZ6A 2K0XA 5EJDA 4BPHA 2AVAA 2LIWA 2MVUA 2XZ1C 4PWVB 3CE7A 2CGQA 1OR5A 2L22A 2FQ1A 4DG9A 4R0MA 4HKGA 2XZ0D 2FACA 2FVFA 2FADA 2CQ8A 2AFEA 2KG9A 5HVCA 4NEOA 2KWLA 2GDXA 1HY8A 2FVEA 1DV5A 2LKIA 2AF8A 2K92A 2FVAA 4MRTC 4BPGA 2KGEA 2L9FA 2KR5A 2ROQA 2KG6A 2MY5A 2KGDA 3EJBA 2K0YA 2N6ZA 2K93A 2VSQA 2MR7A 2CNRA 2N5HA 4BPFA 2KGAA 2N50A 3GZMA 4H2WC 1T8KA 5KP8B 2EHTA 3NY7B 3LMOA 3RG2A 2LOLA 2N98A 2MD9A 1NQ4A 2MF4A 2MVVA 2K94A 2KOQA 1VKUA 2CG5B 1ACPA 1AF8A 1L0HA 2DNWA 4CA3A 2JU1A 2FAEA 1KLPA 3EJDA 2AFDA 3EJEA 2L0QA 2KGCA 2KOOA 5HV8A 2M5RA 2MR8A 2KOSA 2LL8A 2LIUA 4H2XC 2GDWA 5CZDB 1HQBA 5KP6B 2JQ4A 2FHSC 2KORA 1DNYA 2X2BA 2FQ2A 1X3OA 2LPKA 2LMLA 2JU2A 2LTEA 2GDYA 3GZLA 2PNGA 2L4BA 5KP7B 1L0IA 2N6YA 1F80D 2KW2A 2K2QA 2QNWA 2EHSA 2KG8A 4PXHB 2JGPA 2KOPA 2FQ0A 2N5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2Y C;  4IZ6 A;  2K0X A;  5EJD A;  4BPH A;  2AVA A;  2LIW A;  2MVU A;  2XZ1 C;  4PWV B;  3CE7 A;  2CGQ A;  1OR5 A;  2L22 A;  2FQ1 A;  4DG9 A;  4R0M A;  4HKG A;  2XZ0 D;  2FAC A;  2FVF A;  2FAD A;  2CQ8 A;  2AFE A;  2KG9 A;  5HVC A;  4NEO A;  2KWL A;  2GDX A;  1HY8 A;  2FVE A;  1DV5 A;  2LKI A;  2AF8 A;  2K92 A;  2FVA A;  4MRT C;  4BPG A;  2KGE A;  2L9F A;  2KR5 A;  2ROQ A;  2KG6 A;  2MY5 A;  2KGD A;  3EJB A;  2K0Y A;  2N6Z A;  2K93 A;  2VSQ A;  2MR7 A;  2CNR A;  2N5H A;  4BPF A;  2KGA A;  2N50 A;  3GZM A;  4H2W C;  1T8K A;  5KP8 B;  2EHT A;  3NY7 B;  3LMO A;  3RG2 A;  2LOL A;  2N98 A;  2MD9 A;  1NQ4 A;  2MF4 A;  2MVV A;  2K94 A;  2KOQ A;  1VKU A;  2CG5 B;  1ACP A;  1AF8 A;  1L0H A;  2DNW A;  4CA3 A;  2JU1 A;  2FAE A;  1KLP A;  3EJD A;  2AFD A;  3EJE A;  2L0Q A;  2KGC A;  2KOO A;  5HV8 A;  2M5R A;  2MR8 A;  2KOS A;  2LL8 A;  2LIU A;  4H2X C;  2GDW A;  5CZD B;  1HQB A;  5KP6 B;  2JQ4 A;  2FHS C;  2KOR A;  1DNY A;  2X2B A;  2FQ2 A;  1X3O A;  2LPK A;  2LML A;  2JU2 A;  2LTE A;  2GDY A;  3GZL A;  2PNG A;  2L4B A;  5KP7 B;  1L0I A;  2N6Y A;  1F80 D;  2KW2 A;  2K2Q A;  2QNW A;  2EHS A;  2KG8 A;  4PXH B;  2JGP A;  2KOP A;  2FQ0 A;  2N5I A; 
#chains in the Genus database with same CATH topology
 4H2Y C;  2PEN A;  1VQM P;  5JPA A;  1VQ6 P;  4U0F A;  2CGQ A;  2XZ0 D;  2E1M A;  2FVF A;  1NJI Q;  2CQ8 A;  3DS4 A;  3E2D A;  1N8R Q;  2BHV A;  2KWL A;  3CME P;  1IMQ A;  3CC7 P;  1EOQ A;  2LF4 A;  1DV5 A;  2LKI A;  2AF8 A;  4XFX A;  4U0B A;  3CC2 P;  2QA4 P;  1M74 A;  3CCQ P;  2ROQ A;  1VQP P;  3G4S P;  2N6Z A;  2GYK A;  2GZI A;  3DS1 A;  5BS1 A;  3G6E P;  1FR2 A;  3OW2 O;  2CNR A;  2N5H A;  4BPF A;  1RNI A;  2KGA A;  2N50 A;  2M8N A;  5KP8 B;  1VQ8 P;  2N98 A;  3CXC O;  2MD9 A;  1NQ4 A;  2GZG A;  3RG6 C;  1VKU A;  1K8A Q;  2DNW A;  2JU1 A;  5BS2 A;  2FAE A;  1KLP A;  2WPT A;  2AFD A;  2JYG A;  2LL8 A;  1M6N A;  3MGE A;  2GDW A;  5CZD B;  1AUM A;  2X2B A;  1AYI A;  1X3O A;  2LML A;  4U0C A;  2JU2 A;  2EFJ A;  1UJZ A;  5KP7 B;  2KW2 A;  3H4E A;  2EIA A;  2EHS A;  2KG8 A;  4PXH B;  2JGP A;  1M6E X;  4IZ6 A;  1JJ2 O;  4BPH A;  2AVA A;  2LIW A;  2MVU A;  2OAR A;  3CMA P;  3HYB A;  5EW5 E;  1K30 A;  3G1G A;  4DG9 A;  4HKG A;  2KG9 A;  4NEO A;  1IUQ A;  1K73 Q;  1HY8 A;  2ONT A;  1YIT P;  3G28 A;  2FVE A;  1QVF O;  1Z6M A;  4MRT C;  3P05 A;  2BUO A;  2Z45 A;  2KGE A;  1VQ7 P;  1Q7Y Q;  3U43 A;  2KR5 A;  1VQK P;  2KG6 A;  2VLO A;  2M8L A;  2MY5 A;  3DTJ A;  3EJB A;  1GXH A;  2K93 A;  5HGM A;  4COP A;  1MZ8 A;  2GZF A;  2XXM A;  1RO2 A;  1QVG O;  3B5I A;  4XRQ A;  1GXG A;  2L6E A;  1D1D A;  2LOL A;  1EMV A;  2MVV A;  2PEK A;  4U0D A;  3CCL P;  2OTJ P;  1ACP A;  1L0H A;  1YJW P;  5HGN A;  4U0E A;  1KQS O;  3EJD A;  3CCR P;  2KGC A;  2KOO A;  5HGL A;  2M5R A;  2JO0 A;  2MR8 A;  1W2B O;  1Q82 Q;  3CCM P;  1VQ5 P;  4H2X C;  1IMP A;  2KOR A;  2FHS C;  2PEM A;  3NTE A;  4XFZ A;  1CEI A;  3G0V A;  1E6J P;  2LTE A;  1S72 P;  2QNW A;  1BXI A;  4IPY A;  2CWO A;  1RO0 A;  2K0X A;  1GPJ A;  4PH0 A;  4UHP B;  2XZ1 C;  5HGO A;  3CCE P;  2P9X A;  4PWV B;  2K5X A;  2L22 A;  2FQ1 A;  2FAC A;  2QEX P;  3DS2 A;  2FAD A;  2VLN A;  4QNB A;  4PH1 A;  1K9M Q;  1EIA A;  7CEI A;  2K92 A;  3DS0 A;  3G29 A;  1Q81 Q;  3Q20 A;  2GZJ A;  3CCU P;  4WYM A;  3VRL C;  2K0Y A;  3DS3 A;  4XFY A;  4M0I A;  2VSQ A;  2MR7 A;  3GZM A;  4H2W C;  2JBG A;  3NY7 B;  3LMO A;  3DS5 A;  1VQO P;  3RG2 A;  1VQN P;  2GZE A;  3CCS P;  2K94 A;  2KOQ A;  1YJN P;  1M1K Q;  2OTL P;  1YI2 P;  3GKL C;  2CG5 B;  1AF8 A;  5DCK A;  3G21 A;  4F37 A;  2L0Q A;  3LRY A;  5HV8 A;  3CCV P;  2XT1 A;  1HQB A;  5KP6 B;  1YJ9 P;  2JQ4 A;  2PEQ A;  1DNY A;  2PY8 A;  3DPH A;  2NO8 A;  2M8P A;  5F2K A;  3H47 A;  3GZL A;  2L4B A;  2N6Y A;  1F80 D;  2K2Q A;  2VLQ A;  2KOP A;  2N5I A;  2KOD A;  5F2O A;  5EJD A;  3G1I A;  2PEO A;  4U0A A;  1YIJ P;  3M1M A;  3CE7 A;  1OR5 A;  3WBH A;  4R0M A;  2JB0 A;  2Z46 A;  3CC4 P;  2AFE A;  5F2N A;  2ERH A;  5HVC A;  2PEI A;  2GDX A;  2K0D X;  4QKO A;  1ZMB A;  2PEJ A;  3GJN A;  2FVA A;  1A43 A;  4BPG A;  3G71 P;  2VLP A;  1E0H A;  2L9F A;  4XRO A;  1VQ9 P;  4GR6 A;  2KGD A;  1A8O A;  3G26 A;  3I56 P;  1VQ4 P;  1T8K A;  2EHT A;  1ZNV A;  3B4Q A;  2MF4 A;  1KD1 Q;  1VHN A;  4CA3 A;  1M90 Q;  2JAZ A;  1KC8 Q;  3CPW O;  3EJE A;  1BAJ A;  5I4T G;  2KOS A;  2LIU A;  3H0D A;  1YHQ P;  1VQL P;  2EG5 A;  2XV6 A;  2FQ2 A;  3CD6 P;  2LPK A;  3CCJ P;  3I55 P;  4GR2 A;  2JYL A;  4COC A;  3HZQ A;  2GDY A;  2PNG A;  1L0I A;  1QRJ A;  1Q86 Q;  2DGY A;  1UNK A;  2Z44 A;  2FQ0 A; 
#chains in the Genus database with same CATH homology
 4H2Y C;  4IZ6 A;  2K0X A;  5EJD A;  4BPH A;  2AVA A;  2LIW A;  2MVU A;  2XZ1 C;  4PWV B;  3CE7 A;  2CGQ A;  1OR5 A;  2L22 A;  2FQ1 A;  4DG9 A;  4R0M A;  4HKG A;  2XZ0 D;  2FAC A;  2FVF A;  2FAD A;  2CQ8 A;  2AFE A;  2KG9 A;  5HVC A;  4NEO A;  2KWL A;  2GDX A;  1HY8 A;  2FVE A;  1DV5 A;  2LKI A;  2AF8 A;  2K92 A;  2FVA A;  4MRT C;  4BPG A;  2KGE A;  2L9F A;  2KR5 A;  2ROQ A;  2KG6 A;  2MY5 A;  2KGD A;  3EJB A;  2K0Y A;  2N6Z A;  2K93 A;  2VSQ A;  2MR7 A;  2CNR A;  2N5H A;  4BPF A;  2KGA A;  2N50 A;  3GZM A;  4H2W C;  1T8K A;  5KP8 B;  2EHT A;  3NY7 B;  3LMO A;  3RG2 A;  2LOL A;  2N98 A;  2MD9 A;  1NQ4 A;  2MF4 A;  2MVV A;  2K94 A;  2KOQ A;  1VKU A;  2CG5 B;  1ACP A;  1AF8 A;  1L0H A;  2DNW A;  4CA3 A;  2JU1 A;  2FAE A;  1KLP A;  3EJD A;  2AFD A;  3EJE A;  2L0Q A;  2KGC A;  2KOO A;  5HV8 A;  2M5R A;  2MR8 A;  2KOS A;  2LL8 A;  2LIU A;  4H2X C;  2GDW A;  5CZD B;  1HQB A;  5KP6 B;  2JQ4 A;  2FHS C;  2KOR A;  1DNY A;  2X2B A;  2FQ2 A;  1X3O A;  2LPK A;  2LML A;  2JU2 A;  2LTE A;  2GDY A;  3GZL A;  2PNG A;  2L4B A;  5KP7 B;  1L0I A;  2N6Y A;  1F80 D;  2KW2 A;  2K2Q A;  2QNW A;  2EHS A;  2KG8 A;  4PXH B;  2JGP A;  2KOP A;  2FQ0 A;  2N5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...