2N6ZA

Solution structure of the salicylate-loaded arcp from yersiniabactin synthetase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
80
structure length
79
Chain Sequence
DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords HMWP2 nonribosomal peptide synthetase
publication title Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts.
pubmed doi rcsb
source organism Yersinia pestis
total genus 30
structure length 79
sequence length 80
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n6zA00
5KP8B 2FADA 2VSQA 2MF4A 2N98A 2XZ0D 4H2WC 4BPHA 2EHTA 2LL8A 2N6YA 2LMLA 2CG5B 4PWVB 5CZDB 1F80D 2FQ0A 1L0IA 4HKGA 1VKUA 2CQ8A 2L0QA 2AF8A 2KG9A 2KW2A 1HQBA 2K93A 2LPKA 4CA3A 2PNGA 4MRTC 2FQ2A 4H2YC 2LTEA 5EJDA 2KG6A 2K0XA 2MVVA 2KGDA 4PXHB 5KP6B 2K0YA 4BPGA 2N6ZA 2KGEA 2X2BA 2JGPA 2KOOA 1DNYA 2L22A 3CE7A 5HVCA 2AFDA 2GDWA 2FVEA 4H2XC 4DG9A 1HY8A 2LIWA 2MVUA 4BPFA 2K94A 1L0HA 3NY7B 2KWLA 2L9FA 2DNWA 1AF8A 2KOQA 2LOLA 1ACPA 3GZMA 2AVAA 2K2QA 2MY5A 3EJDA 2MR7A 2KR5A 2KGCA 2AFEA 2KOSA 1NQ4A 2FQ1A 2FVAA 2N5IA 2MR8A 1DV5A 2JU1A 1KLPA 2KG8A 2L4BA 2FVFA 5HV8A 3RG2A 2M5RA 1T8KA 2GDYA 4IZ6A 2GDXA 3LMOA 2EHSA 1X3OA 1OR5A 2N5HA 5KP7B 2QNWA 3EJEA 2K92A 2CNRA 2KOPA 2ROQA 2JU2A 2JQ4A 2N50A 2KORA 2LIUA 3GZLA 4NEOA 2KGAA 2XZ1C 2FHSC 3EJBA 4R0MA 2LKIA 2MD9A 2CGQA 2FAEA 2FACA
chains in the Genus database with same CATH superfamily
2WPTA 1RNIA 5DCKA 3CCEP 3CXCO 2XZ0D 3DS0A 2XXMA 1YI2P 2LMLA 2K5XA 3DS3A 1M6EX 2VLNA 4HKGA 1VKUA 2AF8A 4CA3A 1A43A 2PNGA 1EIAA 3G71P 1Z6MA 2P9XA 2Z45A 2OTJP 1EMVA 2LTEA 5HGLA 3CMAP 2K0XA 4PXHB 3U43A 2PEIA 3G1GA 4BPGA 2KGEA 1DNYA 1QVGO 3CCLP 3RG6C 2NO8A 4DG9A 5HGNA 3G28A 3H0DA 1L0HA 2VLQA 2KWLA 2L9FA 3DTJA 2KOQA 4PH1A 2QA4P 4UHPB 1ACPA 3GZMA 2PEJA 2MY5A 3CC7P 3NTEA 2CWOA 1VQ4P 2KOSA 1DV5A 3GKLC 2KODA 1M6NA 5HGOA 2L4BA 2FVFA 2K0DX 1T8KA 4IZ6A 2GZIA 2VLOA 5F2KA 1X3OA 1OR5A 2QNWA 2EFJA 2ROQA 5F2OA 2JQ4A 1M90Q 1K8AQ 2PEKA 2E1MA 2FHSC 2FAEA 3CPWO 1YJNP 5KP8B 2VSQA 4XRQA 4BPHA 3GJNA 2JYGA 2GYKA 3CCMP 4PWVB 3G21A 1VQ8P 4F37A 1F80D 1VQOP 1L0IA 2OTLP 2M8NA 1HQBA 2K93A 4H2YC 3WBHA 1YJ9P 3CMEP 2BUOA 5EJDA 2KGDA 1VQMP 1E0HA 2L22A 1VQ9P 2GZFA 1GXHA 5HVCA 1Q82Q 1VQNP 4IPYA 2GDWA 3CCQP 1QRJA 1Q86Q 1ZMBA 1QVFO 2QEXP 4BPFA 2K94A 5BS1A 2PEQA 2MR7A 2M8PA 2ONTA 2FQ1A 5BS2A 2DGYA 1AYIA 3OW2O 5HGMA 2GZGA 1UJZA 3CCVP 1RO0A 5EW5E 2EG5A 1VQ5P 2EHSA 4M0IA 3Q20A 3G29A 4U0CA 1BAJA 2K92A 1YHQP 2KOPA 1VQLP 3GZLA 3DS4A 2XZ1C 3VRLC 1K9MQ 4R0MA 1K73Q 2LKIA 2JO0A 3B4QA 3G0VA 2OARA 3CCJP 4GR2A 2FADA 4H2WC 2EHTA 4U0BA 2CQ8A 2L0QA 2L6EA 3G6EP 2GZEA 3HZQA 3CC4P 1YITP 3M1MA 2KG6A 2MVVA 5KP6B 2K0YA 2M8LA 2N6ZA 2PENA 2X2BA 1CEIA 4QNBA 2JGPA 1IMPA 1K30A 2KOOA 3HYBA 2PEOA 2AFDA 2BHVA 1MZ8A 2LIWA 5I4TG 4COPA 2JB0A 1KD1Q 3H47A 3CC2P 1AF8A 2XT1A 2LOLA 5JPAA 3G1IA 2AVAA 2K2QA 1UNKA 3I56P 2LF4A 2KR5A 2KGCA 2AFEA 1NQ4A 2PY8A 3E2DA 2JU1A 1KLPA 4QKOA 1JJ2O 2VLPA 1M74A 1FR2A 5HV8A 1Q81Q 7CEIA 2JAZA 2GDYA 3LMOA 2GZJA 1IMQA 2N5HA 2JBGA 1KC8Q 4WYMA 5F2NA 2JU2A 2N50A 2EIAA 4NEOA 3LRYA 1Q7YQ 3EJBA 1D1DA 2ERHA 2MD9A 4GR6A 3G26A 2FACA 2MF4A 2N98A 4XFXA 2LL8A 2N6YA 1YIJP 2CG5B 3DS1A 5CZDB 1EOQA 2FQ0A 1NJIQ 3DPHA 1RO2A 2KG9A 2KW2A 2LPKA 4MRTC 2FQ2A 2XV6A 3DS5A 1N8RQ 4XFYA 2Z46A 3CD6P 1GPJA 3G4SP 3CCRP 1S72P 3MGEA 3CE7A 4H2XC 2FVEA 3CCUP 1VQKP 1HY8A 1IUQA 4PH0A 2MVUA 3NY7B 1KQSO 2DNWA 2PEMA 1VQ6P 3CCSP 1ZNVA 4U0FA 1GXGA 4U0DA 1M1KQ 3EJDA 2FVAA 2N5IA 2MR8A 2JYLA 4XROA 4XFZA 2KG8A 3RG2A 1AUMA 2M5RA 3H4EA 2GDXA 1BXIA 1VHNA 1VQPP 1VQ7P 1E6JP 5KP7B 2Z44A 3I55P 3EJEA 2CNRA 1A8OA 2KORA 3P05A 2LIUA 1W2BO 4U0EA 1YJWP 3DS2A 3B5IA 2KGAA 4U0AA 4COCA 2CGQA
chains in the Genus database with same CATH topology
5KP8B 2FADA 2VSQA 2MF4A 2N98A 2XZ0D 4H2WC 4BPHA 2EHTA 2LL8A 2N6YA 2LMLA 2CG5B 4PWVB 5CZDB 1F80D 2FQ0A 1L0IA 4HKGA 1VKUA 2CQ8A 2L0QA 2AF8A 2KG9A 2KW2A 1HQBA 2K93A 2LPKA 4CA3A 2PNGA 4MRTC 2FQ2A 4H2YC 2LTEA 5EJDA 2KG6A 2K0XA 2MVVA 2KGDA 4PXHB 5KP6B 2K0YA 4BPGA 2N6ZA 2KGEA 2X2BA 2JGPA 2KOOA 1DNYA 2L22A 3CE7A 5HVCA 2AFDA 2GDWA 2FVEA 4H2XC 4DG9A 1HY8A 2LIWA 2MVUA 4BPFA 2K94A 1L0HA 3NY7B 2KWLA 2L9FA 2DNWA 1AF8A 2KOQA 2LOLA 1ACPA 3GZMA 2AVAA 2K2QA 2MY5A 3EJDA 2MR7A 2KR5A 2KGCA 2AFEA 2KOSA 1NQ4A 2FQ1A 2FVAA 2N5IA 2MR8A 1DV5A 2JU1A 1KLPA 2KG8A 2L4BA 2FVFA 5HV8A 3RG2A 2M5RA 1T8KA 2GDYA 4IZ6A 2GDXA 3LMOA 2EHSA 1X3OA 1OR5A 2N5HA 5KP7B 2QNWA 3EJEA 2K92A 2CNRA 2KOPA 2ROQA 2JU2A 2JQ4A 2N50A 2KORA 2LIUA 3GZLA 4NEOA 2KGAA 2XZ1C 2FHSC 3EJBA 4R0MA 2LKIA 2MD9A 2CGQA 2FAEA 2FACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP8 B;  2FAD A;  2VSQ A;  2MF4 A;  2N98 A;  2XZ0 D;  4H2W C;  4BPH A;  2EHT A;  2LL8 A;  2N6Y A;  2LML A;  2CG5 B;  4PWV B;  5CZD B;  1F80 D;  2FQ0 A;  1L0I A;  4HKG A;  1VKU A;  2CQ8 A;  2L0Q A;  2AF8 A;  2KG9 A;  2KW2 A;  1HQB A;  2K93 A;  2LPK A;  4CA3 A;  2PNG A;  4MRT C;  2FQ2 A;  4H2Y C;  2LTE A;  5EJD A;  2KG6 A;  2K0X A;  2MVV A;  2KGD A;  4PXH B;  5KP6 B;  2K0Y A;  4BPG A;  2N6Z A;  2KGE A;  2X2B A;  2JGP A;  2KOO A;  1DNY A;  2L22 A;  3CE7 A;  5HVC A;  2AFD A;  2GDW A;  2FVE A;  4H2X C;  4DG9 A;  1HY8 A;  2LIW A;  2MVU A;  4BPF A;  2K94 A;  1L0H A;  3NY7 B;  2KWL A;  2L9F A;  2DNW A;  1AF8 A;  2KOQ A;  2LOL A;  1ACP A;  3GZM A;  2AVA A;  2K2Q A;  2MY5 A;  3EJD A;  2MR7 A;  2KR5 A;  2KGC A;  2AFE A;  2KOS A;  1NQ4 A;  2FQ1 A;  2FVA A;  2N5I A;  2MR8 A;  1DV5 A;  2JU1 A;  1KLP A;  2KG8 A;  2L4B A;  2FVF A;  5HV8 A;  3RG2 A;  2M5R A;  1T8K A;  2GDY A;  4IZ6 A;  2GDX A;  3LMO A;  2EHS A;  1X3O A;  1OR5 A;  2N5H A;  5KP7 B;  2QNW A;  3EJE A;  2K92 A;  2CNR A;  2KOP A;  2ROQ A;  2JU2 A;  2JQ4 A;  2N50 A;  2KOR A;  2LIU A;  3GZL A;  4NEO A;  2KGA A;  2XZ1 C;  2FHS C;  3EJB A;  4R0M A;  2LKI A;  2MD9 A;  2CGQ A;  2FAE A;  2FAC A; 
#chains in the Genus database with same CATH topology
 2WPT A;  1RNI A;  5DCK A;  3CCE P;  3CXC O;  2XZ0 D;  3DS0 A;  2XXM A;  1YI2 P;  2LML A;  2K5X A;  3DS3 A;  1M6E X;  2VLN A;  4HKG A;  1VKU A;  2AF8 A;  4CA3 A;  1A43 A;  2PNG A;  1EIA A;  3G71 P;  1Z6M A;  2P9X A;  2Z45 A;  2OTJ P;  1EMV A;  2LTE A;  5HGL A;  3CMA P;  2K0X A;  4PXH B;  3U43 A;  2PEI A;  3G1G A;  4BPG A;  2KGE A;  1DNY A;  1QVG O;  3CCL P;  3RG6 C;  2NO8 A;  4DG9 A;  5HGN A;  3G28 A;  3H0D A;  1L0H A;  2VLQ A;  2KWL A;  2L9F A;  3DTJ A;  2KOQ A;  4PH1 A;  2QA4 P;  4UHP B;  1ACP A;  3GZM A;  2PEJ A;  2MY5 A;  3CC7 P;  3NTE A;  2CWO A;  1VQ4 P;  2KOS A;  1DV5 A;  3GKL C;  2KOD A;  1M6N A;  5HGO A;  2L4B A;  2FVF A;  2K0D X;  1T8K A;  4IZ6 A;  2GZI A;  2VLO A;  5F2K A;  1X3O A;  1OR5 A;  2QNW A;  2EFJ A;  2ROQ A;  5F2O A;  2JQ4 A;  1M90 Q;  1K8A Q;  2PEK A;  2E1M A;  2FHS C;  2FAE A;  3CPW O;  1YJN P;  5KP8 B;  2VSQ A;  4XRQ A;  4BPH A;  3GJN A;  2JYG A;  2GYK A;  3CCM P;  4PWV B;  3G21 A;  1VQ8 P;  4F37 A;  1F80 D;  1VQO P;  1L0I A;  2OTL P;  2M8N A;  1HQB A;  2K93 A;  4H2Y C;  3WBH A;  1YJ9 P;  3CME P;  2BUO A;  5EJD A;  2KGD A;  1VQM P;  1E0H A;  2L22 A;  1VQ9 P;  2GZF A;  1GXH A;  5HVC A;  1Q82 Q;  1VQN P;  4IPY A;  2GDW A;  3CCQ P;  1QRJ A;  1Q86 Q;  1ZMB A;  1QVF O;  2QEX P;  4BPF A;  2K94 A;  5BS1 A;  2PEQ A;  2MR7 A;  2M8P A;  2ONT A;  2FQ1 A;  5BS2 A;  2DGY A;  1AYI A;  3OW2 O;  5HGM A;  2GZG A;  1UJZ A;  3CCV P;  1RO0 A;  5EW5 E;  2EG5 A;  1VQ5 P;  2EHS A;  4M0I A;  3Q20 A;  3G29 A;  4U0C A;  1BAJ A;  2K92 A;  1YHQ P;  2KOP A;  1VQL P;  3GZL A;  3DS4 A;  2XZ1 C;  3VRL C;  1K9M Q;  4R0M A;  1K73 Q;  2LKI A;  2JO0 A;  3B4Q A;  3G0V A;  2OAR A;  3CCJ P;  4GR2 A;  2FAD A;  4H2W C;  2EHT A;  4U0B A;  2CQ8 A;  2L0Q A;  2L6E A;  3G6E P;  2GZE A;  3HZQ A;  3CC4 P;  1YIT P;  3M1M A;  2KG6 A;  2MVV A;  5KP6 B;  2K0Y A;  2M8L A;  2N6Z A;  2PEN A;  2X2B A;  1CEI A;  4QNB A;  2JGP A;  1IMP A;  1K30 A;  2KOO A;  3HYB A;  2PEO A;  2AFD A;  2BHV A;  1MZ8 A;  2LIW A;  5I4T G;  4COP A;  2JB0 A;  1KD1 Q;  3H47 A;  3CC2 P;  1AF8 A;  2XT1 A;  2LOL A;  5JPA A;  3G1I A;  2AVA A;  2K2Q A;  1UNK A;  3I56 P;  2LF4 A;  2KR5 A;  2KGC A;  2AFE A;  1NQ4 A;  2PY8 A;  3E2D A;  2JU1 A;  1KLP A;  4QKO A;  1JJ2 O;  2VLP A;  1M74 A;  1FR2 A;  5HV8 A;  1Q81 Q;  7CEI A;  2JAZ A;  2GDY A;  3LMO A;  2GZJ A;  1IMQ A;  2N5H A;  2JBG A;  1KC8 Q;  4WYM A;  5F2N A;  2JU2 A;  2N50 A;  2EIA A;  4NEO A;  3LRY A;  1Q7Y Q;  3EJB A;  1D1D A;  2ERH A;  2MD9 A;  4GR6 A;  3G26 A;  2FAC A;  2MF4 A;  2N98 A;  4XFX A;  2LL8 A;  2N6Y A;  1YIJ P;  2CG5 B;  3DS1 A;  5CZD B;  1EOQ A;  2FQ0 A;  1NJI Q;  3DPH A;  1RO2 A;  2KG9 A;  2KW2 A;  2LPK A;  4MRT C;  2FQ2 A;  2XV6 A;  3DS5 A;  1N8R Q;  4XFY A;  2Z46 A;  3CD6 P;  1GPJ A;  3G4S P;  3CCR P;  1S72 P;  3MGE A;  3CE7 A;  4H2X C;  2FVE A;  3CCU P;  1VQK P;  1HY8 A;  1IUQ A;  4PH0 A;  2MVU A;  3NY7 B;  1KQS O;  2DNW A;  2PEM A;  1VQ6 P;  3CCS P;  1ZNV A;  4U0F A;  1GXG A;  4U0D A;  1M1K Q;  3EJD A;  2FVA A;  2N5I A;  2MR8 A;  2JYL A;  4XRO A;  4XFZ A;  2KG8 A;  3RG2 A;  1AUM A;  2M5R A;  3H4E A;  2GDX A;  1BXI A;  1VHN A;  1VQP P;  1VQ7 P;  1E6J P;  5KP7 B;  2Z44 A;  3I55 P;  3EJE A;  2CNR A;  1A8O A;  2KOR A;  3P05 A;  2LIU A;  1W2B O;  4U0E A;  1YJW P;  3DS2 A;  3B5I A;  2KGA A;  4U0A A;  4COC A;  2CGQ A; 
#chains in the Genus database with same CATH homology
 5KP8 B;  2FAD A;  2VSQ A;  2MF4 A;  2N98 A;  2XZ0 D;  4H2W C;  4BPH A;  2EHT A;  2LL8 A;  2N6Y A;  2LML A;  2CG5 B;  4PWV B;  5CZD B;  1F80 D;  2FQ0 A;  1L0I A;  4HKG A;  1VKU A;  2CQ8 A;  2L0Q A;  2AF8 A;  2KG9 A;  2KW2 A;  1HQB A;  2K93 A;  2LPK A;  4CA3 A;  2PNG A;  4MRT C;  2FQ2 A;  4H2Y C;  2LTE A;  5EJD A;  2KG6 A;  2K0X A;  2MVV A;  2KGD A;  4PXH B;  5KP6 B;  2K0Y A;  4BPG A;  2N6Z A;  2KGE A;  2X2B A;  2JGP A;  2KOO A;  1DNY A;  2L22 A;  3CE7 A;  5HVC A;  2AFD A;  2GDW A;  2FVE A;  4H2X C;  4DG9 A;  1HY8 A;  2LIW A;  2MVU A;  4BPF A;  2K94 A;  1L0H A;  3NY7 B;  2KWL A;  2L9F A;  2DNW A;  1AF8 A;  2KOQ A;  2LOL A;  1ACP A;  3GZM A;  2AVA A;  2K2Q A;  2MY5 A;  3EJD A;  2MR7 A;  2KR5 A;  2KGC A;  2AFE A;  2KOS A;  1NQ4 A;  2FQ1 A;  2FVA A;  2N5I A;  2MR8 A;  1DV5 A;  2JU1 A;  1KLP A;  2KG8 A;  2L4B A;  2FVF A;  5HV8 A;  3RG2 A;  2M5R A;  1T8K A;  2GDY A;  4IZ6 A;  2GDX A;  3LMO A;  2EHS A;  1X3O A;  1OR5 A;  2N5H A;  5KP7 B;  2QNW A;  3EJE A;  2K92 A;  2CNR A;  2KOP A;  2ROQ A;  2JU2 A;  2JQ4 A;  2N50 A;  2KOR A;  2LIU A;  3GZL A;  4NEO A;  2KGA A;  2XZ1 C;  2FHS C;  3EJB A;  4R0M A;  2LKI A;  2MD9 A;  2CGQ A;  2FAE A;  2FAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...