2N6ZA

Solution structure of the salicylate-loaded arcp from yersiniabactin synthetase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
80
structure length
79
Chain Sequence
DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords HMWP2 nonribosomal peptide synthetase
total genus 30
structure length 79
sequence length 80
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n6zA00
2GDWA 2AVAA 2K0XA 2N5IA 1ACPA 3CE7A 1X3OA 2KGAA 1L0HA 2XZ0D 2VSQA 3EJEA 4DG9A 4BPFA 1OR5A 2FHSC 4BPHA 2MD9A 2L0QA 2N98A 2JGPA 1HY8A 2LMLA 2FADA 3NY7B 2KG8A 4H2WC 5HV8A 1KLPA 2FAEA 5KP7B 2KOPA 2CG5B 2X2BA 2N6ZA 2CNRA 2LPKA 1VKUA 2KOSA 2K93A 2KG9A 4NEOA 2AFEA 2KW2A 2AF8A 2FVFA 2DNWA 2QNWA 2FQ1A 2CGQA 2LOLA 1AF8A 2LL8A 2JQ4A 4MRTC 4PWVB 2JU1A 2KGEA 2ROQA 2N6YA 4R0MA 5EJDA 2GDYA 2K2QA 2KGDA 2XZ1C 2PNGA 2L4BA 3LMOA 3EJDA 5CZDB 3EJBA 2FQ2A 2M5RA 2MR8A 1L0IA 2K92A 4IZ6A 1DV5A 5HVCA 2K94A 2KORA 3RG2A 1NQ4A 2FVAA 2KR5A 2L9FA 2KOQA 2LIWA 2FACA 2L22A 2EHTA 5KP8B 2CQ8A 2MR7A 2EHSA 2KOOA 4BPGA 2KG6A 4CA3A 2GDXA 1DNYA 2KGCA 2LKIA 2K0YA 4PXHB 2N5HA 2N50A 4H2XC 4HKGA 2AFDA 2LIUA 2MF4A 2MVVA 1HQBA 2FQ0A 2LTEA 2MVUA 5KP6B 3GZMA 2JU2A 1T8KA 2FVEA 2MY5A 1F80D 3GZLA 2KWLA 4H2YC
chains in the Genus database with same CATH superfamily
1VQNP 2AVAA 2N5IA 3CE7A 4U0EA 1VQLP 2KGAA 1L0HA 2XZ0D 1BXIA 4BPHA 1K9MQ 1VQ7P 2JGPA 1HY8A 3CCJP 2EIAA 5HGOA 3CCMP 1KLPA 1FR2A 5F2OA 2KOPA 2X2BA 2N6ZA 2ERHA 3M1MA 2LPKA 4COPA 2K93A 2KG9A 2AFEA 1YJ9P 1MZ8A 2GYKA 3H0DA 2QNWA 2PENA 1M90Q 2LL8A 4PWVB 2JU1A 2GZEA 4R0MA 1M6NA 2GDYA 2EFJA 3DPHA 3EJDA 3EJBA 4XRQA 2QEXP 2FQ2A 1UNKA 2M5RA 1VQ6P 1NQ4A 2FVAA 2KR5A 2L9FA 3DS1A 3H47A 3E2DA 1NJIQ 1RO2A 4PH1A 2JBGA 2LKIA 3HZQA 1Q7YQ 2N50A 2MF4A 2XT1A 5HGNA 2MVUA 2VLNA 5KP6B 3GZMA 3G21A 3G71P 2FVEA 3MGEA 5JPAA 2Z46A 4XFXA 1ACPA 2VLPA 2JO0A 1X3OA 2PEQA 1VQ4P 2JYLA 1VQOP 2L6EA 2ONTA 3NY7B 3CCEP 3DS2A 1Q86Q 1M6EX 3I56P 2KOSA 2Z44A 2AF8A 4U0FA 2M8LA 1QRJA 2FQ1A 2E1MA 1W2BO 1AF8A 1GXHA 2JQ4A 2WPTA 2KGEA 4U0AA 2PY8A 1EOQA 2KGDA 2BHVA 1GXGA 5CZDB 2PNGA 2L4BA 3G0VA 2DGYA 5BS1A 1L0IA 4IZ6A 7CEIA 5HVCA 2M8NA 3P05A 3RG2A 5BS2A 4F37A 2KOQA 4XROA 3DTJA 5DCKA 4XFYA 2JB0A 2EHSA 4BPGA 4GR2A 4CA3A 1K73Q 1DNYA 2KGCA 3DS5A 3GKLC 4HKGA 3CCLP 2LIUA 5HGMA 1D1DA 3Q20A 3VRLC 1Z6MA 2MY5A 1AUMA 1EIAA 3DS4A 3CCVP 1CEIA 3G1GA 2QA4P 2PEJA 4GR6A 3CXCO 5HGLA 1VQPP 2VSQA 5EW5E 3CMAP 2EG5A 2OTJP 2L0QA 3H4EA 5F2KA 4XFZA 1QVGO 2KG8A 2OTLP 1QVFO 1EMVA 5HV8A 1N8RQ 2KODA 2FAEA 2OARA 1E0HA 1IMQA 2KW2A 4COCA 2FVFA 2DNWA 2PEIA 2CGQA 2LOLA 4MRTC 2ROQA 2PEMA 1YJWP 1RO0A 2XZ1C 3G6EP 3CMEP 2LF4A 3DS3A 2Z45A 1A43A 1YHQP 4QNBA 1A8OA 2K0DX 1DV5A 3G26A 4WYMA 1YIJP 3CD6P 1KQSO 1IUQA 4U0DA 1JJ2O 2LIWA 2L22A 5KP8B 1M74A 2MR7A 3U43A 3G4SP 3I55P 2XV6A 1GPJA 3G29A 2GDXA 1KD1Q 1ZMBA 2N5HA 4H2XC 3G28A 3B4QA 3CCSP 2VLQA 2JU2A 2VLOA 1RNIA 4U0BA 1AYIA 4IPYA 3CC7P 3GZLA 2JYGA 4H2YC 2GDWA 2K0XA 3CPWO 3B5IA 3GJNA 4UHPB 3LRYA 3OW2O 3WBHA 2JAZA 3CCUP 2GZGA 3CC4P 3RG6C 4QKOA 3EJEA 4DG9A 4BPFA 1OR5A 2FHSC 1YI2P 2MD9A 2GZIA 2N98A 2M8PA 1K8AQ 2LMLA 2FADA 5I4TG 4H2WC 3HYBA 5KP7B 2GZJA 1VQ9P 2CG5B 4PH0A 2CNRA 3CC2P 1VKUA 1VHNA 4M0IA 4NEOA 1Q82Q 1UJZA 1KC8Q 5F2NA 1K30A 2NO8A 1ZNVA 1S72P 1VQ8P 3G1IA 1BAJA 3CCRP 2N6YA 5EJDA 2K2QA 4U0CA 2P9XA 3LMOA 1VQ5P 2MR8A 2PEKA 2K92A 2K94A 1M1KQ 1YJNP 2KORA 2FACA 2K5XA 1VQMP 2EHTA 3DS0A 2GZFA 2CQ8A 2KOOA 2KG6A 2PEOA 2BUOA 2K0YA 4PXHB 1IMPA 2AFDA 3CCQP 2MVVA 1HQBA 3NTEA 2FQ0A 2LTEA 1Q81Q 1E6JP 1T8KA 1VQKP 1F80D 2XXMA 2KWLA 2CWOA 1YITP
chains in the Genus database with same CATH topology
2GDWA 2AVAA 2K0XA 2N5IA 1ACPA 3CE7A 1X3OA 2KGAA 1L0HA 2XZ0D 2VSQA 3EJEA 4DG9A 4BPFA 1OR5A 2FHSC 4BPHA 2MD9A 2L0QA 2N98A 2JGPA 1HY8A 2LMLA 2FADA 3NY7B 2KG8A 4H2WC 5HV8A 1KLPA 2FAEA 5KP7B 2KOPA 2CG5B 2X2BA 2N6ZA 2CNRA 2LPKA 1VKUA 2KOSA 2K93A 2KG9A 4NEOA 2AFEA 2KW2A 2AF8A 2FVFA 2DNWA 2QNWA 2FQ1A 2CGQA 2LOLA 1AF8A 2LL8A 2JQ4A 4MRTC 4PWVB 2JU1A 2KGEA 2ROQA 2N6YA 4R0MA 5EJDA 2GDYA 2K2QA 2KGDA 2XZ1C 2PNGA 2L4BA 3LMOA 3EJDA 5CZDB 3EJBA 2FQ2A 2M5RA 2MR8A 1L0IA 2K92A 4IZ6A 1DV5A 5HVCA 2K94A 2KORA 3RG2A 1NQ4A 2FVAA 2KR5A 2L9FA 2KOQA 2LIWA 2FACA 2L22A 2EHTA 5KP8B 2CQ8A 2MR7A 2EHSA 2KOOA 4BPGA 2KG6A 4CA3A 2GDXA 1DNYA 2KGCA 2LKIA 2K0YA 4PXHB 2N5HA 2N50A 4H2XC 4HKGA 2AFDA 2LIUA 2MF4A 2MVVA 1HQBA 2FQ0A 2LTEA 2MVUA 5KP6B 3GZMA 2JU2A 1T8KA 2FVEA 2MY5A 1F80D 3GZLA 2KWLA 4H2YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDW A;  2AVA A;  2K0X A;  2N5I A;  1ACP A;  3CE7 A;  1X3O A;  2KGA A;  1L0H A;  2XZ0 D;  2VSQ A;  3EJE A;  4DG9 A;  4BPF A;  1OR5 A;  2FHS C;  4BPH A;  2MD9 A;  2L0Q A;  2N98 A;  2JGP A;  1HY8 A;  2LML A;  2FAD A;  3NY7 B;  2KG8 A;  4H2W C;  5HV8 A;  1KLP A;  2FAE A;  5KP7 B;  2KOP A;  2CG5 B;  2X2B A;  2N6Z A;  2CNR A;  2LPK A;  1VKU A;  2KOS A;  2K93 A;  2KG9 A;  4NEO A;  2AFE A;  2KW2 A;  2AF8 A;  2FVF A;  2DNW A;  2QNW A;  2FQ1 A;  2CGQ A;  2LOL A;  1AF8 A;  2LL8 A;  2JQ4 A;  4MRT C;  4PWV B;  2JU1 A;  2KGE A;  2ROQ A;  2N6Y A;  4R0M A;  5EJD A;  2GDY A;  2K2Q A;  2KGD A;  2XZ1 C;  2PNG A;  2L4B A;  3LMO A;  3EJD A;  5CZD B;  3EJB A;  2FQ2 A;  2M5R A;  2MR8 A;  1L0I A;  2K92 A;  4IZ6 A;  1DV5 A;  5HVC A;  2K94 A;  2KOR A;  3RG2 A;  1NQ4 A;  2FVA A;  2KR5 A;  2L9F A;  2KOQ A;  2LIW A;  2FAC A;  2L22 A;  2EHT A;  5KP8 B;  2CQ8 A;  2MR7 A;  2EHS A;  2KOO A;  4BPG A;  2KG6 A;  4CA3 A;  2GDX A;  1DNY A;  2KGC A;  2LKI A;  2K0Y A;  4PXH B;  2N5H A;  2N50 A;  4H2X C;  4HKG A;  2AFD A;  2LIU A;  2MF4 A;  2MVV A;  1HQB A;  2FQ0 A;  2LTE A;  2MVU A;  5KP6 B;  3GZM A;  2JU2 A;  1T8K A;  2FVE A;  2MY5 A;  1F80 D;  3GZL A;  2KWL A;  4H2Y C; 
#chains in the Genus database with same CATH topology
 1VQN P;  2AVA A;  2N5I A;  3CE7 A;  4U0E A;  1VQL P;  2KGA A;  1L0H A;  2XZ0 D;  1BXI A;  4BPH A;  1K9M Q;  1VQ7 P;  2JGP A;  1HY8 A;  3CCJ P;  2EIA A;  5HGO A;  3CCM P;  1KLP A;  1FR2 A;  5F2O A;  2KOP A;  2X2B A;  2N6Z A;  2ERH A;  3M1M A;  2LPK A;  4COP A;  2K93 A;  2KG9 A;  2AFE A;  1YJ9 P;  1MZ8 A;  2GYK A;  3H0D A;  2QNW A;  2PEN A;  1M90 Q;  2LL8 A;  4PWV B;  2JU1 A;  2GZE A;  4R0M A;  1M6N A;  2GDY A;  2EFJ A;  3DPH A;  3EJD A;  3EJB A;  4XRQ A;  2QEX P;  2FQ2 A;  1UNK A;  2M5R A;  1VQ6 P;  1NQ4 A;  2FVA A;  2KR5 A;  2L9F A;  3DS1 A;  3H47 A;  3E2D A;  1NJI Q;  1RO2 A;  4PH1 A;  2JBG A;  2LKI A;  3HZQ A;  1Q7Y Q;  2N50 A;  2MF4 A;  2XT1 A;  5HGN A;  2MVU A;  2VLN A;  5KP6 B;  3GZM A;  3G21 A;  3G71 P;  2FVE A;  3MGE A;  5JPA A;  2Z46 A;  4XFX A;  1ACP A;  2VLP A;  2JO0 A;  1X3O A;  2PEQ A;  1VQ4 P;  2JYL A;  1VQO P;  2L6E A;  2ONT A;  3NY7 B;  3CCE P;  3DS2 A;  1Q86 Q;  1M6E X;  3I56 P;  2KOS A;  2Z44 A;  2AF8 A;  4U0F A;  2M8L A;  1QRJ A;  2FQ1 A;  2E1M A;  1W2B O;  1AF8 A;  1GXH A;  2JQ4 A;  2WPT A;  2KGE A;  4U0A A;  2PY8 A;  1EOQ A;  2KGD A;  2BHV A;  1GXG A;  5CZD B;  2PNG A;  2L4B A;  3G0V A;  2DGY A;  5BS1 A;  1L0I A;  4IZ6 A;  7CEI A;  5HVC A;  2M8N A;  3P05 A;  3RG2 A;  5BS2 A;  4F37 A;  2KOQ A;  4XRO A;  3DTJ A;  5DCK A;  4XFY A;  2JB0 A;  2EHS A;  4BPG A;  4GR2 A;  4CA3 A;  1K73 Q;  1DNY A;  2KGC A;  3DS5 A;  3GKL C;  4HKG A;  3CCL P;  2LIU A;  5HGM A;  1D1D A;  3Q20 A;  3VRL C;  1Z6M A;  2MY5 A;  1AUM A;  1EIA A;  3DS4 A;  3CCV P;  1CEI A;  3G1G A;  2QA4 P;  2PEJ A;  4GR6 A;  3CXC O;  5HGL A;  1VQP P;  2VSQ A;  5EW5 E;  3CMA P;  2EG5 A;  2OTJ P;  2L0Q A;  3H4E A;  5F2K A;  4XFZ A;  1QVG O;  2KG8 A;  2OTL P;  1QVF O;  1EMV A;  5HV8 A;  1N8R Q;  2KOD A;  2FAE A;  2OAR A;  1E0H A;  1IMQ A;  2KW2 A;  4COC A;  2FVF A;  2DNW A;  2PEI A;  2CGQ A;  2LOL A;  4MRT C;  2ROQ A;  2PEM A;  1YJW P;  1RO0 A;  2XZ1 C;  3G6E P;  3CME P;  2LF4 A;  3DS3 A;  2Z45 A;  1A43 A;  1YHQ P;  4QNB A;  1A8O A;  2K0D X;  1DV5 A;  3G26 A;  4WYM A;  1YIJ P;  3CD6 P;  1KQS O;  1IUQ A;  4U0D A;  1JJ2 O;  2LIW A;  2L22 A;  5KP8 B;  1M74 A;  2MR7 A;  3U43 A;  3G4S P;  3I55 P;  2XV6 A;  1GPJ A;  3G29 A;  2GDX A;  1KD1 Q;  1ZMB A;  2N5H A;  4H2X C;  3G28 A;  3B4Q A;  3CCS P;  2VLQ A;  2JU2 A;  2VLO A;  1RNI A;  4U0B A;  1AYI A;  4IPY A;  3CC7 P;  3GZL A;  2JYG A;  4H2Y C;  2GDW A;  2K0X A;  3CPW O;  3B5I A;  3GJN A;  4UHP B;  3LRY A;  3OW2 O;  3WBH A;  2JAZ A;  3CCU P;  2GZG A;  3CC4 P;  3RG6 C;  4QKO A;  3EJE A;  4DG9 A;  4BPF A;  1OR5 A;  2FHS C;  1YI2 P;  2MD9 A;  2GZI A;  2N98 A;  2M8P A;  1K8A Q;  2LML A;  2FAD A;  5I4T G;  4H2W C;  3HYB A;  5KP7 B;  2GZJ A;  1VQ9 P;  2CG5 B;  4PH0 A;  2CNR A;  3CC2 P;  1VKU A;  1VHN A;  4M0I A;  4NEO A;  1Q82 Q;  1UJZ A;  1KC8 Q;  5F2N A;  1K30 A;  2NO8 A;  1ZNV A;  1S72 P;  1VQ8 P;  3G1I A;  1BAJ A;  3CCR P;  2N6Y A;  5EJD A;  2K2Q A;  4U0C A;  2P9X A;  3LMO A;  1VQ5 P;  2MR8 A;  2PEK A;  2K92 A;  2K94 A;  1M1K Q;  1YJN P;  2KOR A;  2FAC A;  2K5X A;  1VQM P;  2EHT A;  3DS0 A;  2GZF A;  2CQ8 A;  2KOO A;  2KG6 A;  2PEO A;  2BUO A;  2K0Y A;  4PXH B;  1IMP A;  2AFD A;  3CCQ P;  2MVV A;  1HQB A;  3NTE A;  2FQ0 A;  2LTE A;  1Q81 Q;  1E6J P;  1T8K A;  1VQK P;  1F80 D;  2XXM A;  2KWL A;  2CWO A;  1YIT P; 
#chains in the Genus database with same CATH homology
 2GDW A;  2AVA A;  2K0X A;  2N5I A;  1ACP A;  3CE7 A;  1X3O A;  2KGA A;  1L0H A;  2XZ0 D;  2VSQ A;  3EJE A;  4DG9 A;  4BPF A;  1OR5 A;  2FHS C;  4BPH A;  2MD9 A;  2L0Q A;  2N98 A;  2JGP A;  1HY8 A;  2LML A;  2FAD A;  3NY7 B;  2KG8 A;  4H2W C;  5HV8 A;  1KLP A;  2FAE A;  5KP7 B;  2KOP A;  2CG5 B;  2X2B A;  2N6Z A;  2CNR A;  2LPK A;  1VKU A;  2KOS A;  2K93 A;  2KG9 A;  4NEO A;  2AFE A;  2KW2 A;  2AF8 A;  2FVF A;  2DNW A;  2QNW A;  2FQ1 A;  2CGQ A;  2LOL A;  1AF8 A;  2LL8 A;  2JQ4 A;  4MRT C;  4PWV B;  2JU1 A;  2KGE A;  2ROQ A;  2N6Y A;  4R0M A;  5EJD A;  2GDY A;  2K2Q A;  2KGD A;  2XZ1 C;  2PNG A;  2L4B A;  3LMO A;  3EJD A;  5CZD B;  3EJB A;  2FQ2 A;  2M5R A;  2MR8 A;  1L0I A;  2K92 A;  4IZ6 A;  1DV5 A;  5HVC A;  2K94 A;  2KOR A;  3RG2 A;  1NQ4 A;  2FVA A;  2KR5 A;  2L9F A;  2KOQ A;  2LIW A;  2FAC A;  2L22 A;  2EHT A;  5KP8 B;  2CQ8 A;  2MR7 A;  2EHS A;  2KOO A;  4BPG A;  2KG6 A;  4CA3 A;  2GDX A;  1DNY A;  2KGC A;  2LKI A;  2K0Y A;  4PXH B;  2N5H A;  2N50 A;  4H2X C;  4HKG A;  2AFD A;  2LIU A;  2MF4 A;  2MVV A;  1HQB A;  2FQ0 A;  2LTE A;  2MVU A;  5KP6 B;  3GZM A;  2JU2 A;  1T8K A;  2FVE A;  2MY5 A;  1F80 D;  3GZL A;  2KWL A;  4H2Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...