2N6ZA

Solution structure of the salicylate-loaded arcp from yersiniabactin synthetase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
80
structure length
79
Chain Sequence
b'DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMWP2 nonribosomal peptide synthetase
publication title Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 30
structure length 79
sequence length 80
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n6zA00
2JU2A 2N98A 3GZMA 2JGPA 2KOOA 4DG9A 1AF8A 4HKGA 2MVUA 2CGQA 2KOPA 2FACA 2MR7A 2JU1A 5KP8B 2XZ1C 2FVAA 2L4BA 4H2WC 2FVFA 2L0QA 2CQ8A 2K0YA 5HV8A 4PWVB 5HVCA 1F80D 2AVAA 2KR5A 2N5IA 2EHSA 2KOSA 5EJDA 1DV5A 2XZ0D 2FHSC 4MRTC 2GDYA 2MVVA 1X3OA 2K2QA 2GDWA 1T8KA 5KP7B 1HY8A 1L0IA 4H2XC 2VSQA 2KG8A 3EJBA 2KG6A 1VKUA 2MR8A 2AFEA 2EHTA 2FVEA 2L9FA 2QNWA 2ROQA 2KGDA 3NY7B 3EJDA 2LTEA 1NQ4A 3RG2A 4R0MA 2N6YA 2LOLA 4IZ6A 2LL8A 2CNRA 2PNGA 2LIUA 2M5RA 2N6ZA 2KG9A 2FADA 1OR5A 2K0XA 2KWLA 4H2YC 2GDXA 2KGCA 2L22A 1HQBA 2MD9A 3LMOA 2LIWA 2JQ4A 2K93A 2X2BA 3CE7A 5KP6B 1ACPA 2CG5B 2AFDA 2DNWA 1KLPA 2FQ1A 2LMLA 3GZLA 2FQ2A 2KW2A 2MY5A 1L0HA 4BPGA 4NEOA 2KGAA 2K92A 4BPHA 2KGEA 2FQ0A 2MF4A 2N5HA 4PXHB 2FAEA 2K94A 2LPKA 2AF8A 2KORA 4BPFA 4CA3A 2LKIA 5CZDB 1DNYA 2KOQA 2N50A 3EJEA
chains in the Genus database with same CATH superfamily
2KODA 2VLQA 2M8LA 3G0VA 1GXHA 3DS3A 1VQKP 3RG6C 2CGQA 5I4TG 2JU1A 2GZIA 4IPYA 4WYMA 1E6JP 4QNBA 4H2WC 2FVFA 2CQ8A 2P9XA 3GKLC 3I55P 2PENA 1Q82Q 4MRTC 2XT1A 1X3OA 5HGNA 1IUQA 2BUOA 2K2QA 1HY8A 2VSQA 4U0AA 2MR8A 1EOQA 3OW2O 2EHTA 2OARA 2WPTA 2K5XA 2M8NA 2QA4P 3NY7B 3EJDA 2GYKA 2N6YA 4IZ6A 3DS4A 4XRQA 1RO0A 3I56P 2KG9A 2K0XA 2KWLA 4H2YC 2GDXA 2L22A 3B4QA 2MD9A 3LMOA 2LIWA 3G1GA 1Q86Q 3LRYA 3G4SP 3VRLC 1VQ8P 3DS5A 3CCVP 3G26A 1YHQP 1KLPA 2CWOA 2LMLA 3GZLA 1S72P 2FQ2A 2OTLP 1L0HA 3H4EA 2KGAA 1KD1Q 2K92A 4BPHA 1GXGA 2Z46A 2FAEA 5F2NA 2LPKA 4QKOA 4CA3A 1AYIA 3CCJP 2GZJA 3CCUP 5CZDB 1VQPP 1GPJA 3CC4P 2JGPA 4DG9A 3GJNA 2MVUA 3CCEP 2QEXP 2FACA 1VQ4P 1RO2A 3CPWO 2FVAA 2L4BA 5HV8A 4PWVB 5HVCA 4F37A 1A43A 1EIAA 3DS1A 2XZ0D 7CEIA 1N8RQ 4COPA 3G71P 3WBHA 2GDYA 2GDWA 1M6EX 1UJZA 1VQ7P 3DS0A 2EG5A 3G28A 2AFEA 2PEQA 2QNWA 2ROQA 2KGDA 1NQ4A 5BS1A 1Q81Q 3RG2A 4R0MA 2LOLA 4U0BA 2CNRA 2PEJA 2K0DX 1KC8Q 2BHVA 2GZFA 2FADA 3G21A 1A8OA 2L6EA 1M6NA 1M74A 2PEIA 2EFJA 1ACPA 2CG5B 2AFDA 4UHPB 2FQ1A 1K8AQ 2KW2A 2XV6A 3M1MA 2MF4A 1QRJA 4PXHB 2AF8A 3HZQA 4BPFA 2LF4A 3CMAP 1AUMA 4M0IA 2N50A 3EJEA 2JU2A 3CXCO 3GZMA 3CCQP 1AF8A 4XFZA 2KOPA 2GZEA 3CC2P 1D1DA 1YJWP 2PY8A 1F80D 5DCKA 2N5IA 4XFYA 2KOSA 5EJDA 2JBGA 1DV5A 4U0DA 1VQ9P 2FHSC 2JB0A 1VQNP 5HGLA 1K30A 5KP7B 1L0IA 1VQMP 1VKUA 1VQOP 2L9FA 2Z45A 4U0CA 1UNKA 1RNIA 4GR2A 1ZNVA 1MZ8A 2DGYA 1NJIQ 4XROA 1IMPA 2PNGA 2LIUA 3H0DA 1IMQA 1OR5A 2KGCA 1M90Q 3G1IA 1HQBA 5JPAA 5HGOA 1YI2P 4XFXA 3CC7P 2X2BA 3B5IA 1ZMBA 3MGEA 2VLPA 3CCLP 2MY5A 1QVFO 2JO0A 4BPGA 4NEOA 3DPHA 3DS2A 4PH1A 3G6EP 2K94A 2KORA 1QVGO 2NO8A 2Z44A 3NTEA 1K73Q 3CD6P 2OTJP 2JYGA 2N98A 4U0FA 2PEMA 2KOOA 4HKGA 2PEKA 2MR7A 2E1MA 2XXMA 1KQSO 1JJ2O 1VQ5P 1VHNA 5KP8B 2XZ1C 4COCA 1EMVA 2L0QA 2K0YA 2GZGA 2AVAA 2KR5A 2EHSA 2ONTA 1E0HA 1FR2A 2PEOA 5EW5E 1Z6MA 2MVVA 3G29A 1YJ9P 3CCSP 1T8KA 4H2XC 2KG8A 3EJBA 2KG6A 1YIJP 4U0EA 3P05A 2FVEA 5HGMA 3CCRP 1VQ6P 2JAZA 2LTEA 4PH0A 1M1KQ 2ERHA 1CEIA 2LL8A 3HYBA 2EIAA 2M5RA 2N6ZA 3CMEP 5F2OA 1BAJA 2JYLA 2JQ4A 2K93A 1BXIA 3CE7A 5KP6B 2VLNA 1YITP 3Q20A 2DNWA 1W2BO 2M8PA 1Q7YQ 3CCMP 2VLOA 4GR6A 2KGEA 2FQ0A 2N5HA 3H47A 5BS2A 1VQLP 3DTJA 1YJNP 1K9MQ 3U43A 2LKIA 3E2DA 5F2KA 1DNYA 2KOQA
chains in the Genus database with same CATH topology
2JU2A 2N98A 3GZMA 2JGPA 2KOOA 4DG9A 1AF8A 4HKGA 2MVUA 2CGQA 2KOPA 2FACA 2MR7A 2JU1A 5KP8B 2XZ1C 2FVAA 2L4BA 4H2WC 2FVFA 2L0QA 2CQ8A 2K0YA 5HV8A 4PWVB 5HVCA 1F80D 2AVAA 2KR5A 2N5IA 2EHSA 2KOSA 5EJDA 1DV5A 2XZ0D 2FHSC 4MRTC 2GDYA 2MVVA 1X3OA 2K2QA 2GDWA 1T8KA 5KP7B 1HY8A 1L0IA 4H2XC 2VSQA 2KG8A 3EJBA 2KG6A 1VKUA 2MR8A 2AFEA 2EHTA 2FVEA 2L9FA 2QNWA 2ROQA 2KGDA 3NY7B 3EJDA 2LTEA 1NQ4A 3RG2A 4R0MA 2N6YA 2LOLA 4IZ6A 2LL8A 2CNRA 2PNGA 2LIUA 2M5RA 2N6ZA 2KG9A 2FADA 1OR5A 2K0XA 2KWLA 4H2YC 2GDXA 2KGCA 2L22A 1HQBA 2MD9A 3LMOA 2LIWA 2JQ4A 2K93A 2X2BA 3CE7A 5KP6B 1ACPA 2CG5B 2AFDA 2DNWA 1KLPA 2FQ1A 2LMLA 3GZLA 2FQ2A 2KW2A 2MY5A 1L0HA 4BPGA 4NEOA 2KGAA 2K92A 4BPHA 2KGEA 2FQ0A 2MF4A 2N5HA 4PXHB 2FAEA 2K94A 2LPKA 2AF8A 2KORA 4BPFA 4CA3A 2LKIA 5CZDB 1DNYA 2KOQA 2N50A 3EJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU2 A;  2N98 A;  3GZM A;  2JGP A;  2KOO A;  4DG9 A;  1AF8 A;  4HKG A;  2MVU A;  2CGQ A;  2KOP A;  2FAC A;  2MR7 A;  2JU1 A;  5KP8 B;  2XZ1 C;  2FVA A;  2L4B A;  4H2W C;  2FVF A;  2L0Q A;  2CQ8 A;  2K0Y A;  5HV8 A;  4PWV B;  5HVC A;  1F80 D;  2AVA A;  2KR5 A;  2N5I A;  2EHS A;  2KOS A;  5EJD A;  1DV5 A;  2XZ0 D;  2FHS C;  4MRT C;  2GDY A;  2MVV A;  1X3O A;  2K2Q A;  2GDW A;  1T8K A;  5KP7 B;  1HY8 A;  1L0I A;  4H2X C;  2VSQ A;  2KG8 A;  3EJB A;  2KG6 A;  1VKU A;  2MR8 A;  2AFE A;  2EHT A;  2FVE A;  2L9F A;  2QNW A;  2ROQ A;  2KGD A;  3NY7 B;  3EJD A;  2LTE A;  1NQ4 A;  3RG2 A;  4R0M A;  2N6Y A;  2LOL A;  4IZ6 A;  2LL8 A;  2CNR A;  2PNG A;  2LIU A;  2M5R A;  2N6Z A;  2KG9 A;  2FAD A;  1OR5 A;  2K0X A;  2KWL A;  4H2Y C;  2GDX A;  2KGC A;  2L22 A;  1HQB A;  2MD9 A;  3LMO A;  2LIW A;  2JQ4 A;  2K93 A;  2X2B A;  3CE7 A;  5KP6 B;  1ACP A;  2CG5 B;  2AFD A;  2DNW A;  1KLP A;  2FQ1 A;  2LML A;  3GZL A;  2FQ2 A;  2KW2 A;  2MY5 A;  1L0H A;  4BPG A;  4NEO A;  2KGA A;  2K92 A;  4BPH A;  2KGE A;  2FQ0 A;  2MF4 A;  2N5H A;  4PXH B;  2FAE A;  2K94 A;  2LPK A;  2AF8 A;  2KOR A;  4BPF A;  4CA3 A;  2LKI A;  5CZD B;  1DNY A;  2KOQ A;  2N50 A;  3EJE A; 
#chains in the Genus database with same CATH topology
 2KOD A;  2VLQ A;  2M8L A;  3G0V A;  1GXH A;  3DS3 A;  1VQK P;  3RG6 C;  2CGQ A;  5I4T G;  2JU1 A;  2GZI A;  4IPY A;  4WYM A;  1E6J P;  4QNB A;  4H2W C;  2FVF A;  2CQ8 A;  2P9X A;  3GKL C;  3I55 P;  2PEN A;  1Q82 Q;  4MRT C;  2XT1 A;  1X3O A;  5HGN A;  1IUQ A;  2BUO A;  2K2Q A;  1HY8 A;  2VSQ A;  4U0A A;  2MR8 A;  1EOQ A;  3OW2 O;  2EHT A;  2OAR A;  2WPT A;  2K5X A;  2M8N A;  2QA4 P;  3NY7 B;  3EJD A;  2GYK A;  2N6Y A;  4IZ6 A;  3DS4 A;  4XRQ A;  1RO0 A;  3I56 P;  2KG9 A;  2K0X A;  2KWL A;  4H2Y C;  2GDX A;  2L22 A;  3B4Q A;  2MD9 A;  3LMO A;  2LIW A;  3G1G A;  1Q86 Q;  3LRY A;  3G4S P;  3VRL C;  1VQ8 P;  3DS5 A;  3CCV P;  3G26 A;  1YHQ P;  1KLP A;  2CWO A;  2LML A;  3GZL A;  1S72 P;  2FQ2 A;  2OTL P;  1L0H A;  3H4E A;  2KGA A;  1KD1 Q;  2K92 A;  4BPH A;  1GXG A;  2Z46 A;  2FAE A;  5F2N A;  2LPK A;  4QKO A;  4CA3 A;  1AYI A;  3CCJ P;  2GZJ A;  3CCU P;  5CZD B;  1VQP P;  1GPJ A;  3CC4 P;  2JGP A;  4DG9 A;  3GJN A;  2MVU A;  3CCE P;  2QEX P;  2FAC A;  1VQ4 P;  1RO2 A;  3CPW O;  2FVA A;  2L4B A;  5HV8 A;  4PWV B;  5HVC A;  4F37 A;  1A43 A;  1EIA A;  3DS1 A;  2XZ0 D;  7CEI A;  1N8R Q;  4COP A;  3G71 P;  3WBH A;  2GDY A;  2GDW A;  1M6E X;  1UJZ A;  1VQ7 P;  3DS0 A;  2EG5 A;  3G28 A;  2AFE A;  2PEQ A;  2QNW A;  2ROQ A;  2KGD A;  1NQ4 A;  5BS1 A;  1Q81 Q;  3RG2 A;  4R0M A;  2LOL A;  4U0B A;  2CNR A;  2PEJ A;  2K0D X;  1KC8 Q;  2BHV A;  2GZF A;  2FAD A;  3G21 A;  1A8O A;  2L6E A;  1M6N A;  1M74 A;  2PEI A;  2EFJ A;  1ACP A;  2CG5 B;  2AFD A;  4UHP B;  2FQ1 A;  1K8A Q;  2KW2 A;  2XV6 A;  3M1M A;  2MF4 A;  1QRJ A;  4PXH B;  2AF8 A;  3HZQ A;  4BPF A;  2LF4 A;  3CMA P;  1AUM A;  4M0I A;  2N50 A;  3EJE A;  2JU2 A;  3CXC O;  3GZM A;  3CCQ P;  1AF8 A;  4XFZ A;  2KOP A;  2GZE A;  3CC2 P;  1D1D A;  1YJW P;  2PY8 A;  1F80 D;  5DCK A;  2N5I A;  4XFY A;  2KOS A;  5EJD A;  2JBG A;  1DV5 A;  4U0D A;  1VQ9 P;  2FHS C;  2JB0 A;  1VQN P;  5HGL A;  1K30 A;  5KP7 B;  1L0I A;  1VQM P;  1VKU A;  1VQO P;  2L9F A;  2Z45 A;  4U0C A;  1UNK A;  1RNI A;  4GR2 A;  1ZNV A;  1MZ8 A;  2DGY A;  1NJI Q;  4XRO A;  1IMP A;  2PNG A;  2LIU A;  3H0D A;  1IMQ A;  1OR5 A;  2KGC A;  1M90 Q;  3G1I A;  1HQB A;  5JPA A;  5HGO A;  1YI2 P;  4XFX A;  3CC7 P;  2X2B A;  3B5I A;  1ZMB A;  3MGE A;  2VLP A;  3CCL P;  2MY5 A;  1QVF O;  2JO0 A;  4BPG A;  4NEO A;  3DPH A;  3DS2 A;  4PH1 A;  3G6E P;  2K94 A;  2KOR A;  1QVG O;  2NO8 A;  2Z44 A;  3NTE A;  1K73 Q;  3CD6 P;  2OTJ P;  2JYG A;  2N98 A;  4U0F A;  2PEM A;  2KOO A;  4HKG A;  2PEK A;  2MR7 A;  2E1M A;  2XXM A;  1KQS O;  1JJ2 O;  1VQ5 P;  1VHN A;  5KP8 B;  2XZ1 C;  4COC A;  1EMV A;  2L0Q A;  2K0Y A;  2GZG A;  2AVA A;  2KR5 A;  2EHS A;  2ONT A;  1E0H A;  1FR2 A;  2PEO A;  5EW5 E;  1Z6M A;  2MVV A;  3G29 A;  1YJ9 P;  3CCS P;  1T8K A;  4H2X C;  2KG8 A;  3EJB A;  2KG6 A;  1YIJ P;  4U0E A;  3P05 A;  2FVE A;  5HGM A;  3CCR P;  1VQ6 P;  2JAZ A;  2LTE A;  4PH0 A;  1M1K Q;  2ERH A;  1CEI A;  2LL8 A;  3HYB A;  2EIA A;  2M5R A;  2N6Z A;  3CME P;  5F2O A;  1BAJ A;  2JYL A;  2JQ4 A;  2K93 A;  1BXI A;  3CE7 A;  5KP6 B;  2VLN A;  1YIT P;  3Q20 A;  2DNW A;  1W2B O;  2M8P A;  1Q7Y Q;  3CCM P;  2VLO A;  4GR6 A;  2KGE A;  2FQ0 A;  2N5H A;  3H47 A;  5BS2 A;  1VQL P;  3DTJ A;  1YJN P;  1K9M Q;  3U43 A;  2LKI A;  3E2D A;  5F2K A;  1DNY A;  2KOQ A; 
#chains in the Genus database with same CATH homology
 2JU2 A;  2N98 A;  3GZM A;  2JGP A;  2KOO A;  4DG9 A;  1AF8 A;  4HKG A;  2MVU A;  2CGQ A;  2KOP A;  2FAC A;  2MR7 A;  2JU1 A;  5KP8 B;  2XZ1 C;  2FVA A;  2L4B A;  4H2W C;  2FVF A;  2L0Q A;  2CQ8 A;  2K0Y A;  5HV8 A;  4PWV B;  5HVC A;  1F80 D;  2AVA A;  2KR5 A;  2N5I A;  2EHS A;  2KOS A;  5EJD A;  1DV5 A;  2XZ0 D;  2FHS C;  4MRT C;  2GDY A;  2MVV A;  1X3O A;  2K2Q A;  2GDW A;  1T8K A;  5KP7 B;  1HY8 A;  1L0I A;  4H2X C;  2VSQ A;  2KG8 A;  3EJB A;  2KG6 A;  1VKU A;  2MR8 A;  2AFE A;  2EHT A;  2FVE A;  2L9F A;  2QNW A;  2ROQ A;  2KGD A;  3NY7 B;  3EJD A;  2LTE A;  1NQ4 A;  3RG2 A;  4R0M A;  2N6Y A;  2LOL A;  4IZ6 A;  2LL8 A;  2CNR A;  2PNG A;  2LIU A;  2M5R A;  2N6Z A;  2KG9 A;  2FAD A;  1OR5 A;  2K0X A;  2KWL A;  4H2Y C;  2GDX A;  2KGC A;  2L22 A;  1HQB A;  2MD9 A;  3LMO A;  2LIW A;  2JQ4 A;  2K93 A;  2X2B A;  3CE7 A;  5KP6 B;  1ACP A;  2CG5 B;  2AFD A;  2DNW A;  1KLP A;  2FQ1 A;  2LML A;  3GZL A;  2FQ2 A;  2KW2 A;  2MY5 A;  1L0H A;  4BPG A;  4NEO A;  2KGA A;  2K92 A;  4BPH A;  2KGE A;  2FQ0 A;  2MF4 A;  2N5H A;  4PXH B;  2FAE A;  2K94 A;  2LPK A;  2AF8 A;  2KOR A;  4BPF A;  4CA3 A;  2LKI A;  5CZD B;  1DNY A;  2KOQ A;  2N50 A;  3EJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...