3CCRP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccrP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccrP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccrP02
3CCJP 3CC4P 3I55P 1VQKP 1VQPP 1M90Q 1KQSO 2OTJP 1VQ9P 1VQ7P 3CCUP 1Q7YQ 3CMEP 1VQNP 1W2BO 1VQ4P 3CCMP 3CCQP 3CC2P 1YJ9P 1YIJP 1QVGO 1JJ2O 2OTLP 3OW2O 2QEXP 1Q81Q 1VQLP 3G71P 1N8RQ 1YJWP 3CD6P 1K9MQ 2QA4P 1YHQP 3CCEP 1YI2P 3CPWO 1YITP 1Q86Q 1K8AQ 1VQ8P 3CCLP 1NJIQ 3CMAP 1VQ5P 3CCSP 1KC8Q 1VQ6P 3CC7P 1KD1Q 3G4SP 1S72P 1K73Q 1YJNP 1QVFO 1VQOP 3CCRP 1VQMP 1Q82Q 3CXCO 3G6EP 1M1KQ 3CCVP 3I56P
chains in the Genus database with same CATH superfamily
3AECC 3II6A 5F2OA 4F37A 1EXIA 1EMVA 1NO4A 1VDFA 2YO2A 2OYIB 3GZMA 3G0VA 1KILC 3CD6P 1M8OB 2XV5A 1QGKB 3L72G 2M8NA 2ZXEB 3RK2D 1NGMB 2WSCH 2AXTE 3TGUD 3FWNA 1SQXD 3NMDA 5KLIC 3HRNA 2AEFA 4H44C 2MR7A 1DD4A 3CCJP 2IZ0A 1IZNB 3TGUG 1PP9J 3U43A 4BPGA 1SQXG 2FYNB 1JY3P 3B71A 1ZNVA 2K9JA 3H1IJ 3H1HJ 1KQLA 4KT0J 2AFDA 1NTKG 2YKPA 3G9RA 1RY3A 2L0QA 2CWOA 3OJAB 2BUOA 4N78E 1MFZA 4N3YB 2Q1KA 2OQQA 3RK3C 2V7QH 1GW3A 3LMOA 3GF7A 3WU2E 2QVAA 5CBNA 1KN7A 5KAIH 4A7PA 1L4AB 4PD4E 2E76D 3L75G 2M8LA 4U0FA 5F2KA 4OGQD 1VQOP 1SQPG 3GHGA 1EDKA 4XROA 2NPSD 4ASWA 1X9VA 1PZQA 2FYNC 2A06D 3M0DC 1JUNA 3N4XA 1YJ9P 2KZIA 3MHVA 4U0DA 2OGUA 2KOOA 2P1JA 1OR5A 1KFNA 1G1IA 1RE3C 2P67A 1N7LA 3TYYA 3CX5E 4XFJA 2QE7H 2PEKA 2D2CD 3RBZA 2H43A 3NFQA 1K04A 2PEJA 1HTLC 1S2EA 1PFIA 1DNYA 2WWWA 1OX3A 2JYLA 4HJGH 4TT3H 1PPJE 2QA4P 1S5LX 3I5CA 2HODA 4H0LC 2IBZD 3RL0B 4H13D 4ZMDA 2KLVA 3HE5A 2OYOA 1ZLLA 2PEQA 2IBZG 4GOFA 1LP1B 4DZOA 3AEBC 2Z46A 4U0EA 3MGEA 5TJHA 2EFJA 2E74D 3AEAC 1J1EB 1KYOE 4BPHA 3CMAP 2JU2A 1QL1A 1E5WA 2N6YA 1JTHB 2Q7CA 2KOGA 4D6TG 2JJLA 2XDJA 5KAIE 1BDCA 2Q5UA 5KP6B 1BCCD 1P84H 1FZGA 2FXMA 4B86A 5APWA 2M5AB 1NKNA 3L4FA 3NY7B 5HGLA 2E5TA 1KC8Q 2E75C 3RL0C 1BCCG 2LXCB 2OYIA 2DNWA 1FOSE 2YKQA 1RQVA 1L0LJ 5KP8B 2FYUE 2JBGA 3CCQP 5GTHE 1NTMK 1JNMA 4QNBA 4DJGA 3P8MC 1WRGA 1F80D 1J1EC 2KS1B 2BEQD 2HFED 5AVZB 1VHNA 3L73E 5CHXA 1S3JA 4WWIA 4U0BA 2A45G 2DGYA 4IL6X 3V2QA 1ZMEC 1PP9D 1PGPA 5L8RJ 3D6ZA 3CI9A 1BDDA 5CCHD 1IK7A 2WSCJ 3H1ID 1KB9H 1PEUA 1URQC 3HTKB 1KILE 4HB1A 3V2PA 1PP9G 3L74G 2FADA 2NO8A 3H1IG 2JGPA 1AFOA 3H1HG 4CPGA 1L4AA 4H2XC 2O3JA 1FS0E 3A0BE 2N1TD 2K3RA 3KDPB 4LGDE 1FOSF 3H0DA 4HH2A 2QJYC 3CWBE 3CL3D 4M3LA 1SQVE 2VSQA 1E0HA 2Y0CA 2EG5A 2GZGA 2V7QJ 1DD3A 1U7JA 3HYBA 1Y9BA 3L72E 5BVZA 1GK6A 1IFMA 3RK3E 1GXGA 4MRTC 3TSIA 4RO0A 1S5LH 1GL2D 3HUSB 1SQXE 3DS0A 1BXIA 3V2NA 2HR3A 5EW5E 3S9OA 4UB6H 3G1IA 2QSIA 5AVUB 1NTKE 1RE4A 2FYUJ 1LWUB 1NHLA 4WBAA 3HE4B 2Y0DA 1XTGB 2W8ZA 3BCCG 1ZR4A 1GK4A 2LMLA 1N86A 1LP1A 3LRYA 1M1KQ 2HLOA 3RG6C 1EQ7A 2KOSA 1LT1A 3H32B 3A0HE 3C8VA 3EJEA 3L75E 1CEIA 1N7SB 3HD7D 2VLPA 3C1LA 2ZT9C 3DS3A 1AUMA 1HQBA 2AF8A 1SQPE 5KJ7C 2I8DA 2E1MA 3TF5A 2R3SA 4JQ0D 1M74A 1U57A 1LWUC 2MD9A 2YKOA 5KKZB 3PHLA 1YIJP 1AQTA 1X0TA 1YHQP 1SQVJ 1NJIQ 3CXCO 1X8YA 1A8OA 3G6EP 2EIAA 1E6JP 2W6JH 5E79E 2J58A 2C0WA 1FZCC 3L72J 3MUDC 3DS4A 2Q9IA 2KS1A 1N7SC 1MUUA 2BASA 1NQ4A 5AW9B 2KGEA 1S5LE 4TLFA 1NWQA 3EFGA 2UWJE 3PJSK 1L0LG 4COCA 1AV1A 1RO0A 2FYUK 2IBZE 2L9FA 1P84I 4XFXA 2GUSA 2QJPB 3A7OA 3L35A 2PENA 1ZMBA 1GPJA 4YXWH 5BU8B 1AYIA 2WQYC 2R44A 4Y99B 3CCMP 2C9NY 4GR6A 2L22A 1VF5D 5H2FE 5B5EH 4RJTA 1RF1B 4ZNCA 3BASA 4D6TE 1R5LA 5CBOA 2IPPA 4PV1B 5CCHA 3CCRP 1VQMP 1CSBA 3JCUH 2PEOA 3L75J 2JO0A 5AW0B 3CE7A 1QVGO 1IMQA 2BCCJ 1BCCE 2YMYA 2B9BA 1Q86Q 1SQPJ 2KXPB 2JP3A 1SFCD 3M91A 1A43A 3AEGC 5AVRB 4H2WC 2KW2A 2JKVA 2P2UA 4Z1MH 3H1KG 1TU3F 2AEMA 1SQVK 1H88A 3CC2P 4YXDC 3M1MA 2WSSH 3HUSA 2Y0EA 5DCKA 4K35A 2GDWA 1RF1C 1JO5A 1M6EX 4UHPB 2KODA 2YIUB 4PV1C 1QVFO 4IL6E 2FQ1A 2O1KA 1KQSO 5C39A 1LNQA 2FYUD 1PP9E 3L74E 3G28A 1M7LA 1SQXK 4NPDA 2QIWA 2MVVA 3H1IE 1K9MQ 3H1HE 3DS2A 3WMM0 2R32A 3AE7C 1NTKK 5EJDA 4IFMA 4XFYA 3O6QB 1VQPP 2HODB 4AYCA 1PEOA 3VTPC 3GG2A 1RF0A 3AEFC 1MFTA 3OW2O 3G1GA 2QEXP 1JOCA 2O01N 1NH4A 3GHGC 3V2RA 1T2KC 3HE5B 3G26A 1KILD 5AW5B 1H89A 3JCUE 1NYHA 4H44D 4AQRD 4WY4B 2JO1A 2K0DX 2JU1A 3U1AA 1K30A 1R5SA 1SLQA 1SQPK 1X79B 1GDTA 1T6AA 3CWBD 1LJ2A 1W2EA 2GZFA 1DIPA 3MGNA 2VRSA 1SQVD 2XT1A 2QM7A 2W83C 2FQ0A 1T8KA 3FGAD 1ZRTE 3UIAA 3GF3A 4U3FG 1SQVG 3L72D 3SWFA 3RK3D 1P84D 5KAFH 3JC22 3RBXA 3BCCE 1Y8AA 1YJWP 2ZYGA 5BU5A 5CMZA 1USEA 3FXEA 3FXDA 4Y28J 5AVXB 1RF1A 2PEIA 2WITA 5TISH 1NTKD 3H4EA 5DJTB 3L74J 2A45I 4C7NB 1OW6A 3TK1A 3LIDA 3KZIH 3WBHA 2MF4A 3CLQA 1CW5A 1K8AQ 1HH0A 1YTZT 4I7ZC 2K0XA 2CQ8A 1NOHA 1VL2A 2WSEH 2I1JA 4I6MC 1NAYA 2WPRA 4U7JA 1FZFA 3SFEC 3L75D 2XNXA 2C0XA 2OYIC 1KB9D 4CA3A 1Q90D 2BCCD 2JQ4A 4AUWA 3A5TA 2JWDA 2JEEA 3MZWB 1SQPD 1Y47A 4H0LD 2BCCG 4RKUJ 2WMMA 4JYCA 3NTNA 1M57D 1VQ9P 3VRLC 2KG8A 1L0LE 1M6NA 2YNYA 2E76B 3KXDA 2EHSA 2H88C 1QL2A 2XXMA 4RESB 2VLOA 4OGQB 1ZP0C 4OWFA 3VP9A 1FZBA 1LT9A 2NPSB 3GKLC 1SQBE 1VQNP 2FHSC 3BCCJ 5HGMA 2ITAA 1L4AC 2ONTA 2N9YB 2YXQB 2R3CA 3H1JJ 4U0CA 3O6QA 1AVOA 2LXBA 5K5GB 3G4SP 1S72P 5CJ4A 2QNWA 1MKMA 2E75D 2D2CB 4MN4C 2E42A 4WYMA 4EOTA 1ZXGA 1PEQA 2Q3IA 3RGUA 2ERHA 3P8CD 1YQ4C 2KNCA 2IFNA 2G3AA 2CPSA 4WY4A 3H1KE 4OGQC 1WT6A 4D6TD 1GZLA 4H13B 1ZV8A 1BAJA 1WMKA 1H8AA 2W90A 4DT0A 3OAKA 2E74B 1N73B 2FACA 1RE4C 1JY2O 2KSEA 1URQD 4COPA 1UJZA 3AEEC 1FDIA 3K5BA 2L91A 1IUQA 2WTYA 2K5XA 3PH0A 1A02J 1K05A 1KZUB 4GOEA 1LGHB 1NU1G 5B66H 4C7NA 2RMZA 4QKOA 1HY8A 4M0IA 1SQBJ 1QEXA 4WB4A 1D7MA 1VQ7P 3DS1A 3L74D 2KLUA 1LTAC 1LTGC 1UIIA 1X22A 1EZVD 4UB8H 5AVVB 1QLED 1FZAA 3AE3C 5CZDB 2N50A 2FQ2A 1EC5A 3H1HD 1EZVG 2ROQA 4DCKA 1EDJA 2IDBA 1M90Q 1JY3O 2KYVA 1XTCC 4U3FE 1FR2A 2N5HA 3H1KJ 3V5BA 2JR8A 3EQ2A 5APVA 2WSEJ 5GTIH 3P7KA 3CCVP 1HGZA 2N1TB 2BEZF 3TDKA 1IJDB 1J1DB 1P84E 1NTZE 3VMXA 1N2DC 5AW8B 4JPZB 1G2CB 2ZT9D 2NPSA 1SS1A 4JYBA 5APTA 4R4MA 3B5ND 2IX7C 2JWAA 3SWKA 1L0LK 1PEMA 3BRVB 1ZRTD 2LTEA 2JDIH 5KLVJ 3AE2C 2N9BA 5AW4B 2L4BA 1BSHA 1LTJA 1Q7YQ 3BCCD 5CCHC 4DG9A 3WUVA 1GL2B 4W7ZA 3Q20A 1LTIC 4HKZH 3VP8A 3B4QA 1FBMA 3T97B 1FC2C 3KYQA 5BS2A 2K37A 4PH0A 1JCCA 3H1JG 2GA1A 3DTJA 1MZ9A 3O8ZA 4GT1A 3TNUB 1N7SD 1KB9E 1JJ2O 2BCCE 1BGYE 1RO2A 3R2PA 3ITKA 4KHXA 3R4YA 1R8EA 1PGJA 3HUSC 1KV4A 5AW1B 4PH1A 2K92A 1N73A 1OW8A 3HD7B 1U7MA 2H89C 4L74A 2N5IA 4U3FJ 2Z44A 4PWVB 1EXJA 4K3AA 3W67A 1X3OA 4U0AA 2XZ1C 4QMAA 3AE4C 2FYZA 3QWOC 3Q5SA 2B89A 1YBKA 1L0LD 3NTEA 2FXOA 1NTZJ 1M1JB 2XNDH 5CCGD 1KMIZ 5AW6B 2LIUA 3D6YA 2MJZA 2KB7P 2OYHA 1L0NG 1RF0C 3CC7P 2NRGA 1EIAA 1SQQG 2O01H 4UB6E 4GKGA 3CC4P 4L73A 1SQBD 2LIWA 2B87A 2PEMA 3MTUE 2L5GB 4L76A 3P8CE 5KKZC 3VOPA 3MIWA 4OVNF 1D1DA 1SQBG 1JM0A 3NXSA 4IPYA 5AW7B 3QH9A 3SSUA 3L37A 2WPVB 1DEBA 2WPQA 1HWTC 4NPFX 1OZHA 1VF5B 1M1JC 1T8ZA 3IAOA 3AE8C 3AE5C 1BGYJ 3M9BA 1RH5B 2K0YA 2LKIA 2J59M 2N1TA 3H1KD 3H1LG 5BS1A 1NAFA 1AVYA 2QJPC 2K2QA 1G2CA 1OFCX 1KB9I 3GMAA 4Y99C 2YXRB 3L71J 3P05A 3SWYA 1NU1E 3D71A 2QRXA 1Q81Q 1PGQA 4BRYB 1EDLA 3OA7A 1T2KD 1PL5A 1SFCB 2WT7A 2GDYA 2JAZA 4HYTB 1PIXA 5KLVD 3GJNA 1GL2A 1OWAA 3M9QA 3B5NA 1W2BO 2M8RA 1LT9B 3T97A 3ABVC 1EZVE 2KI7B 5KLVG 1N8RQ 2I1KA 1DV5A 2Z4EA 4GR2A 5DJUB 1QX8A 1JCDA 1KQGB 2AXTH 2QJKB 3TNUA 2FVFA 5AVQB 4BWNA 3IN6A 1VQ4P 5F2NA 5B5EE 1L0IA 2GDXA 2GZEA 2KK7A 2Y9ZA 2H8PD 1E79H 4ZKUA 1BE3J 4I1LA 5HGNA 2YIUC 3HD7A 4OH8B 1IO4A 2FVEA 2KNCB 1EOQA 2KUBA 2P7JA 3S1KA 1CI6B 1LT9C 1ZOYC 2Y9YA 4IOIH 3WU2H 3VN0A 1KILB 3M0AA 2VLNA 4U3FD 3L36A 3CPWO 4PD4H 1JY2P 2Z5IA 3CCSP 4YPCA 2ZVOB 4IFDK 1M1JA 2LR2A 1HVVA 1NU1J 1NTZD 3RG2A 2WZ7A 2KZJA 3E2DA 3H1JE 1KORA 1IK9A 4KJMA 2AFEA 4BXLA 1NTZG 3S4RA 3PTZA 5CCGA 3CX5H 4WY4C 2JB0A 3ZDMA 1GMJA 3RK3B 1J2JB 1CZQA 3M06A 5HGOA 1S9KE 2LPKA 4PXHB 2AVAA 5HVCA 2KORA 2K9YA 3PP5A 2FKWB 3RK2B 2GZIA 1YI2P 2XV6A 1OVRA 2O01J 2MY5A 1EDIA 1EZVI 2PP6A 2HPCB 4YTPC 2AXCA 3RL0g 3L70J 1T3JA 2M3EA 1BGYD 1L4AD 2KOPA 2CK3H 2Q3EA 2XKMA 1KYOH 1K73Q 1Q82Q 2ZFCA 1BGYG 4I2LC 1VQKP 2PGDA 4BRYA 4LLHA 1SFCA 1HBWA 2L6EA 3L71D 4DOJA 1L0NE 3LIEA 2FXPA 2KSJA 1SQQE 3RK2C 2YMKA 4H0LB 3W68A 1FJKA 3L71G 1KQFB 3HZQA 1KD1Q 1FZEA 1NU1K 1KLPA 1OXZA 5KAFE 4C7RA 2Z45A 2K88A 2KG6A 3DS5A 2GM4A 5GTHH 4WVZA 4IZ6A 2FBWC 1FE6A 4H2YC 1LTJB 1VQ8P 1IFNA 2A06G 1NTMJ 3CXHH 3GLMA 2P10A 3AE1C 2M0BA 3RL0D 5TISE 3I55P 1RQUA 2K94A 3KZIE 2VLQA 5I4TG 3H1LE 4EYYQ 2FFDA 2E76C 1HUCA 1VPCA 3PLNA 3P32A 3MP7B 1A02F 1BE3D 2ZJSE 3BVHA 4LC1A 4L75A 4XE5B 2E75B 1CI6A 1YJNP 2IZ1A 4BPFA 2NPSC 2X2BA 4EI2A 3LW5H 3F5HA 2GYKA 1KILA 5AVTB 2AEJA 1BE3G 1YYCA 3A0BH 2HG5D 2MKVA 5AVYB 1GW4A 1GU4A 2WPSA 2KP8A 3GZLA 1SVFA 1LTJC 1AJYA 1YITP 2D2CC 1FDOA 5KLVE 2ZYAA 4EIJA 2FY8A 3Q1MA 4C46A 2H7HA 2R5DA 1L0NJ 1GXHA 1NU1D 2FAEA 1SQQJ 4XA4A 5HV8A 1URQB 1HJ0A 3JSVC 2O1JA 3IF4A 1VQ6P 4GODA 4H13C 2CNRA 2KOQA 2WSFH 2JYGA 5M1BA 2OTJP 1H0TB 2KWLA 5AW3B 2N98A 2OYHB 3BATA 2KGCA 1NVOA 4PD4I 1L0HA 1DEEG 1FJPA 1ACPA 2QJYB 2Q6QA 4JF7A 5AVWB 2E74C 1N73C 3CXHE 3C9IA 5KP7B 2B87B 5APSA 2HPCA 1OMIA 2M3BA 3M0DA 1IMPA 2CGQA 3MD0A 3VMZA 1FDMA 3V4WA 3DPHA 3Q3DA 1JMMA 2EHTA 3FWLA 3A0HH 1AF8A 3N7NA 3B4SA 1GD2E 3H1LJ 3L70D 1RE3A 1KTMA 1ZN5A 3E1IA 3CX5I 3Q5RA 1PGOA 2N6ZA 3L70G 1FU1A 2OARA 1Q2NA 1QRJA 2OYHC 1VKUA 1HJBA 2XZ0D 2CPBA 3EFFK 1W5CE 5APXA 4ASVA 2W6AA 1UIXA 2B88A 2RH0A 5AW2B 3EJDA 1IFDA 5KJ7D 3H25A 1L0NK 1SQQK 2LOLA 2OTKE 5E79H 3CCUP 3B8EB 2WT7B 4ZKPA 1KFMA 4GIFA 1KYOI 2ZT9B 1JY2N 2POHA 3H1JD 3AE6C 3U1CA 1JMBA 3B5NB 3TGUE 2XU6A 1NTMD 3H6PA 5B66E 1SQBK 4JBZA 5APUA 2BQ1E 2N1TC 2WVRA 1S4XA 2QG4A 3SFDC 1NTMG 1J1DC 4PJ0H 4UB8E 1S9KD 1HF9A 1JB0J 5H2FH 3B5IA 1ZW0A 2V4HA 2IFMA 1IC2A 3L73J 1L2PA 3GW6A 1OVVA 2BHVA 1FZCB 3KPEA 1IFJA 3EWKA 3KHUA 1M56D 3CXHI 3L71E 1JTHA 2SPZA 3E1RA 4NEOA 1GL2C 1DH3A 3B5NC 5GTIE 2ZYDA 3FX0A 1HGVA 4N78D 3LW5J 3IFMA 2M5AA 1JY3N 1URQA 2J5UA 2A06E 2P9XA 3CWBJ 5CJ0A 1L0ND 1LTTC 4PD4D 1SQQD 3V4QA 5KLVK 2A45H 1H0TA 2PFXA 4EDFA 4IL6H 3USSA 4NPEA 3HD7C 2PY8A 2Z5HA 3AE9C 3KQGA 4W7YA 3G29A 2KGAA 1LTSC 3H47A 3BRTB 4R0MA 1SP4A 2KIKA 3TGUJ 2HYNA 1SQXJ 4R4LA 1BE3E 3IR9A 2PAJA 2WSFJ 3CX5D 2W6BA 2PRRA 4PV1D 3AEDC 3VMAA 3V6IA 4PJ0E 1AQ5A 4HKGA 2RKLA 3HTKA 1NTKJ 3VYIA 1GU5A 2G8YA 1NKZB 1S1CX 3H1LD 1Z56A 1LTBC 2K1AA 1VQLP 2GZJA 1DX7A 1PPJD 1AA0A 3EJBA 2IYOA 2M8PA 2K9JB 1OIPA 5KTBA 1PPJG 1RNIA 1IFPA 1JEKA 3WUUA 1MV8A 5APQA 1UNKA 3CMEP 1USDA 5CCGC 3PRJA 2ZXXA 3CCEP 3G21A 1KYOD 1FAVA 1ZR2A 3U59A 3A2AA 1VQ5P 5JPAA 1NTZK 4W80A 1BSNA 2LL8A 1VF5C 5KJ7A 5APYA 3G71P 3GHGB 3CCLP 2KGDA 1LWUA 7CEIA 1IFIA 3Q2YA 2KR5A 3HE4A 1T3UA 1OW7A 1YQ3C 2KG9A 2M5RA 5EFWB 3E7KA 3L70E 3A3YB 1G1JA 3CXHD 3H32A 4XFZA 2DW3A 2FYUG 1SFCC 1FZCA 2E43A 1RHZB 3MUDA 1OVUA 3VMYA 3L73D 2FFDB 1N7SA 3G3ZA 2MR8A 3WUTA 2LKMA 3I56P 4WY4D 2QM8A 3Q5PA 2IYPA 3L73G 4IFFA 1PV3A 2ZVNB 2YO3A 4N6JA 2C9LY 2NZ2A 2RN0A 2IBZI 1MZ8A 2PNGA 4D6TJ 2E5YA 1Z6MA 5AVSB 2P58A 2QJKC 5KLIB 2FVAA 4H44B 3D70A 1GTWA 2XZRA 4GDOA 2K93A 2WPTA 2LF4A 1YTZI 1BCCJ 2W27A 2OTLP 4XRQA 2MVUA 2CG5B 2ZAEB 3F89A 2R5BA 1NTME 2FFDC 3CWBG 4I7ZB 4O9BA 2GUVA 3M9HA
chains in the Genus database with same CATH topology
5JPAA 1QRJA 3CC4P 1M1KQ 1K30A 5F2OA 3RG6C 2PEOA 2PEMA 1VQ9P 3VRLC 1Q7YQ 2JO0A 1VQ4P 5F2NA 2P9XA 2PEJA 1QVGO 1M6NA 3G0VA 2JYLA 3G71P 1D1DA 3CD6P 1PEUA 3DS3A 1AUMA 2QA4P 2M8NA 2XXMA 3Q20A 1YITP 1Q86Q 3CCLP 2XT1A 5HGNA 4IPYA 1K73Q 1A43A 2E1MA 1Q82Q 5BS2A 4PH0A 1M74A 3CCJP 4M0IA 1EOQA 1VQKP 3DTJA 1VQ7P 3CCUP 2PEQA 1VQNP 3CC2P 2L6EA 3DS1A 5HGMA 3H0DA 3M1MA 2Z46A 1YIJP 5DCKA 2PY8A 4U0EA 1JJ2O 3G29A 2ONTA 3MGEA 1RO2A 3H47A 1YJWP 1YHQP 4U0CA 2EFJA 4XFZA 1M6EX 3CPWO 1NJIQ 2KODA 3CMAP 1VQ5P 2CWOA 3CCSP 1VQ6P 3HZQA 2BUOA 2EG5A 1KD1Q 3G4SP 1S72P 1QVFO 5BS1A 4PH1A 3CXCO 1A8OA 3G6EP 2EIAA 1E6JP 3I56P 2JYGA 4WYMA 3HYBA 2BQ1E 2PEIA 1M90Q 1KQSO 2OTJP 3DS4A 2Z45A 1PEQA 3H4EA 3P05A 3G28A 3DS5A 3WBHA 1Q81Q 1VQLP 3B5IA 3E2DA 1K9MQ 2Z44A 3DS2A 2M8LA 1K8AQ 1VQ8P 4U0FA 4COCA 5HGLA 1IUQA 1KC8Q 1RO0A 2M8PA 1BAJA 5F2KA 3DS0A 1VQOP 4XFXA 4XFYA 2PENA 1RNIA 3CCVP 1ZMBA 4U0AA 2BHVA 3G1IA 3I55P 3DPHA 1VQPP 4XROA 3CMEP 1W2BO 2LF4A 1PEOA 3CCMP 5HGOA 3CCQP 3NTEA 4GR6A 1YJ9P 5I4TG 4QNBA 2OTLP 3OW2O 3G1GA 4XRQA 2QEXP 4U0DA 1N8RQ 3G26A 3CCEP 3G21A 1YI2P 2XV6A 4GR2A 4COPA 3CC7P 1YJNP 1EIAA 1PEMA 3CCRP 1VQMP 3LRYA 2PEKA 2OARA 4U0BA 2DGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ P;  3CC4 P;  3I55 P;  1VQK P;  1VQP P;  1M90 Q;  1KQS O;  2OTJ P;  1VQ9 P;  1VQ7 P;  3CCU P;  1Q7Y Q;  3CME P;  1VQN P;  1W2B O;  1VQ4 P;  3CCM P;  3CCQ P;  3CC2 P;  1YJ9 P;  1YIJ P;  1QVG O;  1JJ2 O;  2OTL P;  3OW2 O;  2QEX P;  1Q81 Q;  1VQL P;  3G71 P;  1N8R Q;  1YJW P;  3CD6 P;  1K9M Q;  2QA4 P;  1YHQ P;  3CCE P;  1YI2 P;  3CPW O;  1YIT P;  1Q86 Q;  1K8A Q;  1VQ8 P;  3CCL P;  1NJI Q;  3CMA P;  1VQ5 P;  3CCS P;  1KC8 Q;  1VQ6 P;  3CC7 P;  1KD1 Q;  3G4S P;  1S72 P;  1K73 Q;  1YJN P;  1QVF O;  1VQO P;  3CCR P;  1VQM P;  1Q82 Q;  3CXC O;  3G6E P;  1M1K Q;  3CCV P;  3I56 P; 
#chains in the Genus database with same CATH topology
 3AEC C;  3II6 A;  5F2O A;  4F37 A;  1EXI A;  1EMV A;  1NO4 A;  1VDF A;  2YO2 A;  2OYI B;  3GZM A;  3G0V A;  1KIL C;  3CD6 P;  1M8O B;  2XV5 A;  1QGK B;  3L72 G;  2M8N A;  2ZXE B;  3RK2 D;  1NGM B;  2WSC H;  2AXT E;  3TGU D;  3FWN A;  1SQX D;  3NMD A;  5KLI C;  3HRN A;  2AEF A;  4H44 C;  2MR7 A;  1DD4 A;  3CCJ P;  2IZ0 A;  1IZN B;  3TGU G;  1PP9 J;  3U43 A;  4BPG A;  1SQX G;  2FYN B;  1JY3 P;  3B71 A;  1ZNV A;  2K9J A;  3H1I J;  3H1H J;  1KQL A;  4KT0 J;  2AFD A;  1NTK G;  2YKP A;  3G9R A;  1RY3 A;  2L0Q A;  2CWO A;  3OJA B;  2BUO A;  4N78 E;  1MFZ A;  4N3Y B;  2Q1K A;  2OQQ A;  3RK3 C;  2V7Q H;  1GW3 A;  3LMO A;  3GF7 A;  3WU2 E;  2QVA A;  5CBN A;  1KN7 A;  5KAI H;  4A7P A;  1L4A B;  4PD4 E;  2E76 D;  3L75 G;  2M8L A;  4U0F A;  5F2K A;  4OGQ D;  1VQO P;  1SQP G;  3GHG A;  1EDK A;  4XRO A;  2NPS D;  4ASW A;  1X9V A;  1PZQ A;  2FYN C;  2A06 D;  3M0D C;  1JUN A;  3N4X A;  1YJ9 P;  2KZI A;  3MHV A;  4U0D A;  2OGU A;  2KOO A;  2P1J A;  1OR5 A;  1KFN A;  1G1I A;  1RE3 C;  2P67 A;  1N7L A;  3TYY A;  3CX5 E;  4XFJ A;  2QE7 H;  2PEK A;  2D2C D;  3RBZ A;  2H43 A;  3NFQ A;  1K04 A;  2PEJ A;  1HTL C;  1S2E A;  1PFI A;  1DNY A;  2WWW A;  1OX3 A;  2JYL A;  4HJG H;  4TT3 H;  1PPJ E;  2QA4 P;  1S5L X;  3I5C A;  2HOD A;  4H0L C;  2IBZ D;  3RL0 B;  4H13 D;  4ZMD A;  2KLV A;  3HE5 A;  2OYO A;  1ZLL A;  2PEQ A;  2IBZ G;  4GOF A;  1LP1 B;  4DZO A;  3AEB C;  2Z46 A;  4U0E A;  3MGE A;  5TJH A;  2EFJ A;  2E74 D;  3AEA C;  1J1E B;  1KYO E;  4BPH A;  3CMA P;  2JU2 A;  1QL1 A;  1E5W A;  2N6Y A;  1JTH B;  2Q7C A;  2KOG A;  4D6T G;  2JJL A;  2XDJ A;  5KAI E;  1BDC A;  2Q5U A;  5KP6 B;  1BCC D;  1P84 H;  1FZG A;  2FXM A;  4B86 A;  5APW A;  2M5A B;  1NKN A;  3L4F A;  3NY7 B;  5HGL A;  2E5T A;  1KC8 Q;  2E75 C;  3RL0 C;  1BCC G;  2LXC B;  2OYI A;  2DNW A;  1FOS E;  2YKQ A;  1RQV A;  1L0L J;  5KP8 B;  2FYU E;  2JBG A;  3CCQ P;  5GTH E;  1NTM K;  1JNM A;  4QNB A;  4DJG A;  3P8M C;  1WRG A;  1F80 D;  1J1E C;  2KS1 B;  2BEQ D;  2HFE D;  5AVZ B;  1VHN A;  3L73 E;  5CHX A;  1S3J A;  4WWI A;  4U0B A;  2A45 G;  2DGY A;  4IL6 X;  3V2Q A;  1ZME C;  1PP9 D;  1PGP A;  5L8R J;  3D6Z A;  3CI9 A;  1BDD A;  5CCH D;  1IK7 A;  2WSC J;  3H1I D;  1KB9 H;  1PEU A;  1URQ C;  3HTK B;  1KIL E;  4HB1 A;  3V2P A;  1PP9 G;  3L74 G;  2FAD A;  2NO8 A;  3H1I G;  2JGP A;  1AFO A;  3H1H G;  4CPG A;  1L4A A;  4H2X C;  2O3J A;  1FS0 E;  3A0B E;  2N1T D;  2K3R A;  3KDP B;  4LGD E;  1FOS F;  3H0D A;  4HH2 A;  2QJY C;  3CWB E;  3CL3 D;  4M3L A;  1SQV E;  2VSQ A;  1E0H A;  2Y0C A;  2EG5 A;  2GZG A;  2V7Q J;  1DD3 A;  1U7J A;  3HYB A;  1Y9B A;  3L72 E;  5BVZ A;  1GK6 A;  1IFM A;  3RK3 E;  1GXG A;  4MRT C;  3TSI A;  4RO0 A;  1S5L H;  1GL2 D;  3HUS B;  1SQX E;  3DS0 A;  1BXI A;  3V2N A;  2HR3 A;  5EW5 E;  3S9O A;  4UB6 H;  3G1I A;  2QSI A;  5AVU B;  1NTK E;  1RE4 A;  2FYU J;  1LWU B;  1NHL A;  4WBA A;  3HE4 B;  2Y0D A;  1XTG B;  2W8Z A;  3BCC G;  1ZR4 A;  1GK4 A;  2LML A;  1N86 A;  1LP1 A;  3LRY A;  1M1K Q;  2HLO A;  3RG6 C;  1EQ7 A;  2KOS A;  1LT1 A;  3H32 B;  3A0H E;  3C8V A;  3EJE A;  3L75 E;  1CEI A;  1N7S B;  3HD7 D;  2VLP A;  3C1L A;  2ZT9 C;  3DS3 A;  1AUM A;  1HQB A;  2AF8 A;  1SQP E;  5KJ7 C;  2I8D A;  2E1M A;  3TF5 A;  2R3S A;  4JQ0 D;  1M74 A;  1U57 A;  1LWU C;  2MD9 A;  2YKO A;  5KKZ B;  3PHL A;  1YIJ P;  1AQT A;  1X0T A;  1YHQ P;  1SQV J;  1NJI Q;  3CXC O;  1X8Y A;  1A8O A;  3G6E P;  2EIA A;  1E6J P;  2W6J H;  5E79 E;  2J58 A;  2C0W A;  1FZC C;  3L72 J;  3MUD C;  3DS4 A;  2Q9I A;  2KS1 A;  1N7S C;  1MUU A;  2BAS A;  1NQ4 A;  5AW9 B;  2KGE A;  1S5L E;  4TLF A;  1NWQ A;  3EFG A;  2UWJ E;  3PJS K;  1L0L G;  4COC A;  1AV1 A;  1RO0 A;  2FYU K;  2IBZ E;  2L9F A;  1P84 I;  4XFX A;  2GUS A;  2QJP B;  3A7O A;  3L35 A;  2PEN A;  1ZMB A;  1GPJ A;  4YXW H;  5BU8 B;  1AYI A;  2WQY C;  2R44 A;  4Y99 B;  3CCM P;  2C9N Y;  4GR6 A;  2L22 A;  1VF5 D;  5H2F E;  5B5E H;  4RJT A;  1RF1 B;  4ZNC A;  3BAS A;  4D6T E;  1R5L A;  5CBO A;  2IPP A;  4PV1 B;  5CCH A;  3CCR P;  1VQM P;  1CSB A;  3JCU H;  2PEO A;  3L75 J;  2JO0 A;  5AW0 B;  3CE7 A;  1QVG O;  1IMQ A;  2BCC J;  1BCC E;  2YMY A;  2B9B A;  1Q86 Q;  1SQP J;  2KXP B;  2JP3 A;  1SFC D;  3M91 A;  1A43 A;  3AEG C;  5AVR B;  4H2W C;  2KW2 A;  2JKV A;  2P2U A;  4Z1M H;  3H1K G;  1TU3 F;  2AEM A;  1SQV K;  1H88 A;  3CC2 P;  4YXD C;  3M1M A;  2WSS H;  3HUS A;  2Y0E A;  5DCK A;  4K35 A;  2GDW A;  1RF1 C;  1JO5 A;  1M6E X;  4UHP B;  2KOD A;  2YIU B;  4PV1 C;  1QVF O;  4IL6 E;  2FQ1 A;  2O1K A;  1KQS O;  5C39 A;  1LNQ A;  2FYU D;  1PP9 E;  3L74 E;  3G28 A;  1M7L A;  1SQX K;  4NPD A;  2QIW A;  2MVV A;  3H1I E;  1K9M Q;  3H1H E;  3DS2 A;  3WMM 0;  2R32 A;  3AE7 C;  1NTK K;  5EJD A;  4IFM A;  4XFY A;  3O6Q B;  1VQP P;  2HOD B;  4AYC A;  1PEO A;  3VTP C;  3GG2 A;  1RF0 A;  3AEF C;  1MFT A;  3OW2 O;  3G1G A;  2QEX P;  1JOC A;  2O01 N;  1NH4 A;  3GHG C;  3V2R A;  1T2K C;  3HE5 B;  3G26 A;  1KIL D;  5AW5 B;  1H89 A;  3JCU E;  1NYH A;  4H44 D;  4AQR D;  4WY4 B;  2JO1 A;  2K0D X;  2JU1 A;  3U1A A;  1K30 A;  1R5S A;  1SLQ A;  1SQP K;  1X79 B;  1GDT A;  1T6A A;  3CWB D;  1LJ2 A;  1W2E A;  2GZF A;  1DIP A;  3MGN A;  2VRS A;  1SQV D;  2XT1 A;  2QM7 A;  2W83 C;  2FQ0 A;  1T8K A;  3FGA D;  1ZRT E;  3UIA A;  3GF3 A;  4U3F G;  1SQV G;  3L72 D;  3SWF A;  3RK3 D;  1P84 D;  5KAF H;  3JC2 2;  3RBX A;  3BCC E;  1Y8A A;  1YJW P;  2ZYG A;  5BU5 A;  5CMZ A;  1USE A;  3FXE A;  3FXD A;  4Y28 J;  5AVX B;  1RF1 A;  2PEI A;  2WIT A;  5TIS H;  1NTK D;  3H4E A;  5DJT B;  3L74 J;  2A45 I;  4C7N B;  1OW6 A;  3TK1 A;  3LID A;  3KZI H;  3WBH A;  2MF4 A;  3CLQ A;  1CW5 A;  1K8A Q;  1HH0 A;  1YTZ T;  4I7Z C;  2K0X A;  2CQ8 A;  1NOH A;  1VL2 A;  2WSE H;  2I1J A;  4I6M C;  1NAY A;  2WPR A;  4U7J A;  1FZF A;  3SFE C;  3L75 D;  2XNX A;  2C0X A;  2OYI C;  1KB9 D;  4CA3 A;  1Q90 D;  2BCC D;  2JQ4 A;  4AUW A;  3A5T A;  2JWD A;  2JEE A;  3MZW B;  1SQP D;  1Y47 A;  4H0L D;  2BCC G;  4RKU J;  2WMM A;  4JYC A;  3NTN A;  1M57 D;  1VQ9 P;  3VRL C;  2KG8 A;  1L0L E;  1M6N A;  2YNY A;  2E76 B;  3KXD A;  2EHS A;  2H88 C;  1QL2 A;  2XXM A;  4RES B;  2VLO A;  4OGQ B;  1ZP0 C;  4OWF A;  3VP9 A;  1FZB A;  1LT9 A;  2NPS B;  3GKL C;  1SQB E;  1VQN P;  2FHS C;  3BCC J;  5HGM A;  2ITA A;  1L4A C;  2ONT A;  2N9Y B;  2YXQ B;  2R3C A;  3H1J J;  4U0C A;  3O6Q A;  1AVO A;  2LXB A;  5K5G B;  3G4S P;  1S72 P;  5CJ4 A;  2QNW A;  1MKM A;  2E75 D;  2D2C B;  4MN4 C;  2E42 A;  4WYM A;  4EOT A;  1ZXG A;  1PEQ A;  2Q3I A;  3RGU A;  2ERH A;  3P8C D;  1YQ4 C;  2KNC A;  2IFN A;  2G3A A;  2CPS A;  4WY4 A;  3H1K E;  4OGQ C;  1WT6 A;  4D6T D;  1GZL A;  4H13 B;  1ZV8 A;  1BAJ A;  1WMK A;  1H8A A;  2W90 A;  4DT0 A;  3OAK A;  2E74 B;  1N73 B;  2FAC A;  1RE4 C;  1JY2 O;  2KSE A;  1URQ D;  4COP A;  1UJZ A;  3AEE C;  1FDI A;  3K5B A;  2L91 A;  1IUQ A;  2WTY A;  2K5X A;  3PH0 A;  1A02 J;  1K05 A;  1KZU B;  4GOE A;  1LGH B;  1NU1 G;  5B66 H;  4C7N A;  2RMZ A;  4QKO A;  1HY8 A;  4M0I A;  1SQB J;  1QEX A;  4WB4 A;  1D7M A;  1VQ7 P;  3DS1 A;  3L74 D;  2KLU A;  1LTA C;  1LTG C;  1UII A;  1X22 A;  1EZV D;  4UB8 H;  5AVV B;  1QLE D;  1FZA A;  3AE3 C;  5CZD B;  2N50 A;  2FQ2 A;  1EC5 A;  3H1H D;  1EZV G;  2ROQ A;  4DCK A;  1EDJ A;  2IDB A;  1M90 Q;  1JY3 O;  2KYV A;  1XTC C;  4U3F E;  1FR2 A;  2N5H A;  3H1K J;  3V5B A;  2JR8 A;  3EQ2 A;  5APV A;  2WSE J;  5GTI H;  3P7K A;  3CCV P;  1HGZ A;  2N1T B;  2BEZ F;  3TDK A;  1IJD B;  1J1D B;  1P84 E;  1NTZ E;  3VMX A;  1N2D C;  5AW8 B;  4JPZ B;  1G2C B;  2ZT9 D;  2NPS A;  1SS1 A;  4JYB A;  5APT A;  4R4M A;  3B5N D;  2IX7 C;  2JWA A;  3SWK A;  1L0L K;  1PEM A;  3BRV B;  1ZRT D;  2LTE A;  2JDI H;  5KLV J;  3AE2 C;  2N9B A;  5AW4 B;  2L4B A;  1BSH A;  1LTJ A;  1Q7Y Q;  3BCC D;  5CCH C;  4DG9 A;  3WUV A;  1GL2 B;  4W7Z A;  3Q20 A;  1LTI C;  4HKZ H;  3VP8 A;  3B4Q A;  1FBM A;  3T97 B;  1FC2 C;  3KYQ A;  5BS2 A;  2K37 A;  4PH0 A;  1JCC A;  3H1J G;  2GA1 A;  3DTJ A;  1MZ9 A;  3O8Z A;  4GT1 A;  3TNU B;  1N7S D;  1KB9 E;  1JJ2 O;  2BCC E;  1BGY E;  1RO2 A;  3R2P A;  3ITK A;  4KHX A;  3R4Y A;  1R8E A;  1PGJ A;  3HUS C;  1KV4 A;  5AW1 B;  4PH1 A;  2K92 A;  1N73 A;  1OW8 A;  3HD7 B;  1U7M A;  2H89 C;  4L74 A;  2N5I A;  4U3F J;  2Z44 A;  4PWV B;  1EXJ A;  4K3A A;  3W67 A;  1X3O A;  4U0A A;  2XZ1 C;  4QMA A;  3AE4 C;  2FYZ A;  3QWO C;  3Q5S A;  2B89 A;  1YBK A;  1L0L D;  3NTE A;  2FXO A;  1NTZ J;  1M1J B;  2XND H;  5CCG D;  1KMI Z;  5AW6 B;  2LIU A;  3D6Y A;  2MJZ A;  2KB7 P;  2OYH A;  1L0N G;  1RF0 C;  3CC7 P;  2NRG A;  1EIA A;  1SQQ G;  2O01 H;  4UB6 E;  4GKG A;  3CC4 P;  4L73 A;  1SQB D;  2LIW A;  2B87 A;  2PEM A;  3MTU E;  2L5G B;  4L76 A;  3P8C E;  5KKZ C;  3VOP A;  3MIW A;  4OVN F;  1D1D A;  1SQB G;  1JM0 A;  3NXS A;  4IPY A;  5AW7 B;  3QH9 A;  3SSU A;  3L37 A;  2WPV B;  1DEB A;  2WPQ A;  1HWT C;  4NPF X;  1OZH A;  1VF5 B;  1M1J C;  1T8Z A;  3IAO A;  3AE8 C;  3AE5 C;  1BGY J;  3M9B A;  1RH5 B;  2K0Y A;  2LKI A;  2J59 M;  2N1T A;  3H1K D;  3H1L G;  5BS1 A;  1NAF A;  1AVY A;  2QJP C;  2K2Q A;  1G2C A;  1OFC X;  1KB9 I;  3GMA A;  4Y99 C;  2YXR B;  3L71 J;  3P05 A;  3SWY A;  1NU1 E;  3D71 A;  2QRX A;  1Q81 Q;  1PGQ A;  4BRY B;  1EDL A;  3OA7 A;  1T2K D;  1PL5 A;  1SFC B;  2WT7 A;  2GDY A;  2JAZ A;  4HYT B;  1PIX A;  5KLV D;  3GJN A;  1GL2 A;  1OWA A;  3M9Q A;  3B5N A;  1W2B O;  2M8R A;  1LT9 B;  3T97 A;  3ABV C;  1EZV E;  2KI7 B;  5KLV G;  1N8R Q;  2I1K A;  1DV5 A;  2Z4E A;  4GR2 A;  5DJU B;  1QX8 A;  1JCD A;  1KQG B;  2AXT H;  2QJK B;  3TNU A;  2FVF A;  5AVQ B;  4BWN A;  3IN6 A;  1VQ4 P;  5F2N A;  5B5E E;  1L0I A;  2GDX A;  2GZE A;  2KK7 A;  2Y9Z A;  2H8P D;  1E79 H;  4ZKU A;  1BE3 J;  4I1L A;  5HGN A;  2YIU C;  3HD7 A;  4OH8 B;  1IO4 A;  2FVE A;  2KNC B;  1EOQ A;  2KUB A;  2P7J A;  3S1K A;  1CI6 B;  1LT9 C;  1ZOY C;  2Y9Y A;  4IOI H;  3WU2 H;  3VN0 A;  1KIL B;  3M0A A;  2VLN A;  4U3F D;  3L36 A;  3CPW O;  4PD4 H;  1JY2 P;  2Z5I A;  3CCS P;  4YPC A;  2ZVO B;  4IFD K;  1M1J A;  2LR2 A;  1HVV A;  1NU1 J;  1NTZ D;  3RG2 A;  2WZ7 A;  2KZJ A;  3E2D A;  3H1J E;  1KOR A;  1IK9 A;  4KJM A;  2AFE A;  4BXL A;  1NTZ G;  3S4R A;  3PTZ A;  5CCG A;  3CX5 H;  4WY4 C;  2JB0 A;  3ZDM A;  1GMJ A;  3RK3 B;  1J2J B;  1CZQ A;  3M06 A;  5HGO A;  1S9K E;  2LPK A;  4PXH B;  2AVA A;  5HVC A;  2KOR A;  2K9Y A;  3PP5 A;  2FKW B;  3RK2 B;  2GZI A;  1YI2 P;  2XV6 A;  1OVR A;  2O01 J;  2MY5 A;  1EDI A;  1EZV I;  2PP6 A;  2HPC B;  4YTP C;  2AXC A;  3RL0 g;  3L70 J;  1T3J A;  2M3E A;  1BGY D;  1L4A D;  2KOP A;  2CK3 H;  2Q3E A;  2XKM A;  1KYO H;  1K73 Q;  1Q82 Q;  2ZFC A;  1BGY G;  4I2L C;  1VQK P;  2PGD A;  4BRY A;  4LLH A;  1SFC A;  1HBW A;  2L6E A;  3L71 D;  4DOJ A;  1L0N E;  3LIE A;  2FXP A;  2KSJ A;  1SQQ E;  3RK2 C;  2YMK A;  4H0L B;  3W68 A;  1FJK A;  3L71 G;  1KQF B;  3HZQ A;  1KD1 Q;  1FZE A;  1NU1 K;  1KLP A;  1OXZ A;  5KAF E;  4C7R A;  2Z45 A;  2K88 A;  2KG6 A;  3DS5 A;  2GM4 A;  5GTH H;  4WVZ A;  4IZ6 A;  2FBW C;  1FE6 A;  4H2Y C;  1LTJ B;  1VQ8 P;  1IFN A;  2A06 G;  1NTM J;  3CXH H;  3GLM A;  2P10 A;  3AE1 C;  2M0B A;  3RL0 D;  5TIS E;  3I55 P;  1RQU A;  2K94 A;  3KZI E;  2VLQ A;  5I4T G;  3H1L E;  4EYY Q;  2FFD A;  2E76 C;  1HUC A;  1VPC A;  3PLN A;  3P32 A;  3MP7 B;  1A02 F;  1BE3 D;  2ZJS E;  3BVH A;  4LC1 A;  4L75 A;  4XE5 B;  2E75 B;  1CI6 A;  1YJN P;  2IZ1 A;  4BPF A;  2NPS C;  2X2B A;  4EI2 A;  3LW5 H;  3F5H A;  2GYK A;  1KIL A;  5AVT B;  2AEJ A;  1BE3 G;  1YYC A;  3A0B H;  2HG5 D;  2MKV A;  5AVY B;  1GW4 A;  1GU4 A;  2WPS A;  2KP8 A;  3GZL A;  1SVF A;  1LTJ C;  1AJY A;  1YIT P;  2D2C C;  1FDO A;  5KLV E;  2ZYA A;  4EIJ A;  2FY8 A;  3Q1M A;  4C46 A;  2H7H A;  2R5D A;  1L0N J;  1GXH A;  1NU1 D;  2FAE A;  1SQQ J;  4XA4 A;  5HV8 A;  1URQ B;  1HJ0 A;  3JSV C;  2O1J A;  3IF4 A;  1VQ6 P;  4GOD A;  4H13 C;  2CNR A;  2KOQ A;  2WSF H;  2JYG A;  5M1B A;  2OTJ P;  1H0T B;  2KWL A;  5AW3 B;  2N98 A;  2OYH B;  3BAT A;  2KGC A;  1NVO A;  4PD4 I;  1L0H A;  1DEE G;  1FJP A;  1ACP A;  2QJY B;  2Q6Q A;  4JF7 A;  5AVW B;  2E74 C;  1N73 C;  3CXH E;  3C9I A;  5KP7 B;  2B87 B;  5APS A;  2HPC A;  1OMI A;  2M3B A;  3M0D A;  1IMP A;  2CGQ A;  3MD0 A;  3VMZ A;  1FDM A;  3V4W A;  3DPH A;  3Q3D A;  1JMM A;  2EHT A;  3FWL A;  3A0H H;  1AF8 A;  3N7N A;  3B4S A;  1GD2 E;  3H1L J;  3L70 D;  1RE3 A;  1KTM A;  1ZN5 A;  3E1I A;  3CX5 I;  3Q5R A;  1PGO A;  2N6Z A;  3L70 G;  1FU1 A;  2OAR A;  1Q2N A;  1QRJ A;  2OYH C;  1VKU A;  1HJB A;  2XZ0 D;  2CPB A;  3EFF K;  1W5C E;  5APX A;  4ASV A;  2W6A A;  1UIX A;  2B88 A;  2RH0 A;  5AW2 B;  3EJD A;  1IFD A;  5KJ7 D;  3H25 A;  1L0N K;  1SQQ K;  2LOL A;  2OTK E;  5E79 H;  3CCU P;  3B8E B;  2WT7 B;  4ZKP A;  1KFM A;  4GIF A;  1KYO I;  2ZT9 B;  1JY2 N;  2POH A;  3H1J D;  3AE6 C;  3U1C A;  1JMB A;  3B5N B;  3TGU E;  2XU6 A;  1NTM D;  3H6P A;  5B66 E;  1SQB K;  4JBZ A;  5APU A;  2BQ1 E;  2N1T C;  2WVR A;  1S4X A;  2QG4 A;  3SFD C;  1NTM G;  1J1D C;  4PJ0 H;  4UB8 E;  1S9K D;  1HF9 A;  1JB0 J;  5H2F H;  3B5I A;  1ZW0 A;  2V4H A;  2IFM A;  1IC2 A;  3L73 J;  1L2P A;  3GW6 A;  1OVV A;  2BHV A;  1FZC B;  3KPE A;  1IFJ A;  3EWK A;  3KHU A;  1M56 D;  3CXH I;  3L71 E;  1JTH A;  2SPZ A;  3E1R A;  4NEO A;  1GL2 C;  1DH3 A;  3B5N C;  5GTI E;  2ZYD A;  3FX0 A;  1HGV A;  4N78 D;  3LW5 J;  3IFM A;  2M5A A;  1JY3 N;  1URQ A;  2J5U A;  2A06 E;  2P9X A;  3CWB J;  5CJ0 A;  1L0N D;  1LTT C;  4PD4 D;  1SQQ D;  3V4Q A;  5KLV K;  2A45 H;  1H0T A;  2PFX A;  4EDF A;  4IL6 H;  3USS A;  4NPE A;  3HD7 C;  2PY8 A;  2Z5H A;  3AE9 C;  3KQG A;  4W7Y A;  3G29 A;  2KGA A;  1LTS C;  3H47 A;  3BRT B;  4R0M A;  1SP4 A;  2KIK A;  3TGU J;  2HYN A;  1SQX J;  4R4L A;  1BE3 E;  3IR9 A;  2PAJ A;  2WSF J;  3CX5 D;  2W6B A;  2PRR A;  4PV1 D;  3AED C;  3VMA A;  3V6I A;  4PJ0 E;  1AQ5 A;  4HKG A;  2RKL A;  3HTK A;  1NTK J;  3VYI A;  1GU5 A;  2G8Y A;  1NKZ B;  1S1C X;  3H1L D;  1Z56 A;  1LTB C;  2K1A A;  1VQL P;  2GZJ A;  1DX7 A;  1PPJ D;  1AA0 A;  3EJB A;  2IYO A;  2M8P A;  2K9J B;  1OIP A;  5KTB A;  1PPJ G;  1RNI A;  1IFP A;  1JEK A;  3WUU A;  1MV8 A;  5APQ A;  1UNK A;  3CME P;  1USD A;  5CCG C;  3PRJ A;  2ZXX A;  3CCE P;  3G21 A;  1KYO D;  1FAV A;  1ZR2 A;  3U59 A;  3A2A A;  1VQ5 P;  5JPA A;  1NTZ K;  4W80 A;  1BSN A;  2LL8 A;  1VF5 C;  5KJ7 A;  5APY A;  3G71 P;  3GHG B;  3CCL P;  2KGD A;  1LWU A;  7CEI A;  1IFI A;  3Q2Y A;  2KR5 A;  3HE4 A;  1T3U A;  1OW7 A;  1YQ3 C;  2KG9 A;  2M5R A;  5EFW B;  3E7K A;  3L70 E;  3A3Y B;  1G1J A;  3CXH D;  3H32 A;  4XFZ A;  2DW3 A;  2FYU G;  1SFC C;  1FZC A;  2E43 A;  1RHZ B;  3MUD A;  1OVU A;  3VMY A;  3L73 D;  2FFD B;  1N7S A;  3G3Z A;  2MR8 A;  3WUT A;  2LKM A;  3I56 P;  4WY4 D;  2QM8 A;  3Q5P A;  2IYP A;  3L73 G;  4IFF A;  1PV3 A;  2ZVN B;  2YO3 A;  4N6J A;  2C9L Y;  2NZ2 A;  2RN0 A;  2IBZ I;  1MZ8 A;  2PNG A;  4D6T J;  2E5Y A;  1Z6M A;  5AVS B;  2P58 A;  2QJK C;  5KLI B;  2FVA A;  4H44 B;  3D70 A;  1GTW A;  2XZR A;  4GDO A;  2K93 A;  2WPT A;  2LF4 A;  1YTZ I;  1BCC J;  2W27 A;  2OTL P;  4XRQ A;  2MVU A;  2CG5 B;  2ZAE B;  3F89 A;  2R5B A;  1NTM E;  2FFD C;  3CWB G;  4I7Z B;  4O9B A;  2GUV A;  3M9H A; 
#chains in the Genus database with same CATH homology
 5JPA A;  1QRJ A;  3CC4 P;  1M1K Q;  1K30 A;  5F2O A;  3RG6 C;  2PEO A;  2PEM A;  1VQ9 P;  3VRL C;  1Q7Y Q;  2JO0 A;  1VQ4 P;  5F2N A;  2P9X A;  2PEJ A;  1QVG O;  1M6N A;  3G0V A;  2JYL A;  3G71 P;  1D1D A;  3CD6 P;  1PEU A;  3DS3 A;  1AUM A;  2QA4 P;  2M8N A;  2XXM A;  3Q20 A;  1YIT P;  1Q86 Q;  3CCL P;  2XT1 A;  5HGN A;  4IPY A;  1K73 Q;  1A43 A;  2E1M A;  1Q82 Q;  5BS2 A;  4PH0 A;  1M74 A;  3CCJ P;  4M0I A;  1EOQ A;  1VQK P;  3DTJ A;  1VQ7 P;  3CCU P;  2PEQ A;  1VQN P;  3CC2 P;  2L6E A;  3DS1 A;  5HGM A;  3H0D A;  3M1M A;  2Z46 A;  1YIJ P;  5DCK A;  2PY8 A;  4U0E A;  1JJ2 O;  3G29 A;  2ONT A;  3MGE A;  1RO2 A;  3H47 A;  1YJW P;  1YHQ P;  4U0C A;  2EFJ A;  4XFZ A;  1M6E X;  3CPW O;  1NJI Q;  2KOD A;  3CMA P;  1VQ5 P;  2CWO A;  3CCS P;  1VQ6 P;  3HZQ A;  2BUO A;  2EG5 A;  1KD1 Q;  3G4S P;  1S72 P;  1QVF O;  5BS1 A;  4PH1 A;  3CXC O;  1A8O A;  3G6E P;  2EIA A;  1E6J P;  3I56 P;  2JYG A;  4WYM A;  3HYB A;  2BQ1 E;  2PEI A;  1M90 Q;  1KQS O;  2OTJ P;  3DS4 A;  2Z45 A;  1PEQ A;  3H4E A;  3P05 A;  3G28 A;  3DS5 A;  3WBH A;  1Q81 Q;  1VQL P;  3B5I A;  3E2D A;  1K9M Q;  2Z44 A;  3DS2 A;  2M8L A;  1K8A Q;  1VQ8 P;  4U0F A;  4COC A;  5HGL A;  1IUQ A;  1KC8 Q;  1RO0 A;  2M8P A;  1BAJ A;  5F2K A;  3DS0 A;  1VQO P;  4XFX A;  4XFY A;  2PEN A;  1RNI A;  3CCV P;  1ZMB A;  4U0A A;  2BHV A;  3G1I A;  3I55 P;  3DPH A;  1VQP P;  4XRO A;  3CME P;  1W2B O;  2LF4 A;  1PEO A;  3CCM P;  5HGO A;  3CCQ P;  3NTE A;  4GR6 A;  1YJ9 P;  5I4T G;  4QNB A;  2OTL P;  3OW2 O;  3G1G A;  4XRQ A;  2QEX P;  4U0D A;  1N8R Q;  3G26 A;  3CCE P;  3G21 A;  1YI2 P;  2XV6 A;  4GR2 A;  4COP A;  3CC7 P;  1YJN P;  1EIA A;  1PEM A;  3CCR P;  1VQM P;  3LRY A;  2PEK A;  2OAR A;  4U0B A;  2DGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...