3CCRP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccrP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccrP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccrP02
1VQMP 3CMEP 3CPWO 1VQOP 3OW2O 1VQPP 3I56P 1K73Q 1YJ9P 1VQNP 1YI2P 2QEXP 1JJ2O 1VQLP 1QVGO 1M1KQ 1QVFO 3CD6P 3CCMP 2QA4P 1Q86Q 1N8RQ 3CC2P 1VQ8P 1Q7YQ 3CCEP 1VQ4P 3G4SP 1VQ6P 1VQ7P 1S72P 1YJNP 1YHQP 1YITP 1VQKP 2OTJP 3CCVP 1KC8Q 3G6EP 1KD1Q 1KQSO 3CCSP 1Q82Q 1VQ9P 3CMAP 1YJWP 1K8AQ 3CC4P 1K9MQ 3CCLP 3CCQP 3CC7P 3CXCO 3CCJP 3CCRP 2OTLP 1YIJP 3I55P 1W2BO 1VQ5P 3CCUP 3G71P 1NJIQ 1Q81Q 1M90Q
chains in the Genus database with same CATH superfamily
1H8AA 1GDTA 3TF5A 4F37A 3G3ZA 1BCCE 4ASWA 2VLOA 1N7SD 1PV3A 1ZR4A 2GUSA 3U43A 2W6JH 1FC2C 3AE4C 4RO0A 3CCQP 1RF1A 2K93A 3H1HD 1NJIQ 4YTPC 1VPCA 4W80A 3HD7A 3H4EA 4RJTA 2NPSD 1NU1G 3L70E 4WB4A 2YNYA 5APWA 2LPKA 4HJGH 2NRGA 3FX0A 1M57D 3BRVB 1BDDA 3BATA 2K0DX 4WY4D 5EFWB 3CXCO 5TISH 1PPJG 1SQQD 2JJLA 1LT9B 2LL8A 1L4AA 1YTZT 1CI6B 2O01N 1JCCA 1FZAA 1HJ0A 2Y0DA 2FAEA 3LRYA 1RHZB 2E43A 1NHLA 2K0XA 1VQ7P 5AW8B 1NOHA 2C0XA 2GDXA 1IUQA 1K04A 1BCCJ 2WSFJ 2MR8A 2KG9A 1OR5A 3HUSA 5DJUB 1GMJA 5F2OA 3L71D 1HBWA 1T8KA 1LT9A 2JP3A 3KYQA 4PJ0H 4PD4E 4K35A 1YITP 5B5EH 1M1JA 3H1HJ 3NY7B 1KQFB 4KHXA 3L70J 1H0TB 2FFDA 1KYOH 1T2KD 2QSIA 3AEEC 4NPFX 3G29A 3W67A 5KJ7C 1J1DC 2NPSC 1SFCD 1ZW0A 1PPJD 2QVAA 1DD3A 2I8DA 2WSSH 3D6YA 3EJBA 3QWOC 1EZVE 1P84H 1N73B 1EDJA 3S1KA 2E74B 2H88C 1EOQA 1VQMP 5APTA 3A0BH 3BCCG 3AE5C 3DS5A 1JJ2O 4Y28J 1H0TA 2NZ2A 1NTZG 2VRSA 1KFNA 3LW5J 3V2PA 1JTHB 3PP5A 2IX7C 4NPDA 1S5LX 3L71J 1FJPA 1ZNVA 1HQBA 1ZMBA 3A7OA 1NTKE 1LNQA 2AVAA 2AXTE 1S1CX 3TYYA 2XV6A 3DS4A 1LTSC 1E6JP 2EFJA 3WMM0 2E42A 3KZIE 1EXJA 3L75E 2I1KA 3R2PA 3KHUA 1R8EA 2QA4P 1R5SA 2ZYGA 2Q3IA 1BXIA 2WT7B 4OH8B 5DCKA 2QE7H 2CNRA 3BCCD 1NYHA 3PHLA 3Q2YA 1NTZD 3AE9C 4ZNCA 3G26A 1SQBK 2W90A 3MP7B 2K9JB 3WUUA 3RG2A 2E5TA 2N9YB 1BE3E 1FDOA 3GHGA 1SQVK 4BPHA 2PEOA 2O3JA 3B5NC 3RK3D 5AVYB 5CCGA 2E76C 2KGDA 2IBZD 3H1IG 5I4TG 2JEEA 5CCHD 2J58A 4OWFA 2WTYA 1BGYG 1L0LD 2PEKA 2Y0CA 3E1IA 2WMMA 3LIDA 2A45H 4H0LD 3HD7D 4EOTA 2YIUC 3CC7P 5HGOA 2WSEJ 1URQC 2GYKA 3A0HH 3CXHH 1LTBC 4UB6H 3GMAA 1NKNA 3P7KA 4COCA 1Q86Q 1N2DC 3DS2A 2O01J 3BCCJ 3FXEA 4R4LA 1L4AD 3Q5SA 1FZFA 1MKMA 5EW5E 2KS1B 2YXQB 3TGUE 2PFXA 4GT1A 1K30A 2AXCA 1A02J 2VSQA 3JCUE 5AVVB 2R3CA 5CJ4A 2ZT9D 2BEQD 5KTBA 5AW5B 1S5LH 1MV8A 1RE4C 4PD4H 3TNUA 2N5HA 5APXA 2FQ0A 3S9OA 2M8PA 1L0LJ 1VF5C 2PGDA 1BSHA 2HG5D 2Q1KA 3H0DA 5CCHC 2LMLA 2LXCB 2DGYA 5GTIH 1UIXA 1NQ4A 3NFQA 1X79B 1A8OA 4U3FG 1VL2A 2W83C 2C9LY 1KILC 2AF8A 1AJYA 5APVA 2CPSA 2JWDA 1IFNA 1PIXA 4GKGA 3HZQA 2B88A 3CMEP 3HE5B 1J1DB 3H1JG 5AVUB 2K94A 3M91A 3FWLA 3M0DA 5CJ0A 4N6JA 1OFCX 3CWBG 2WITA 3RL0g 2FYNC 5AW2B 4Y99C 2AEFA 2D2CD 3M9QA 7CEIA 1FJKA 1ZRTD 1JUNA 4H2YC 2Z46A 3H32B 1S4XA 1R5LA 1Q81Q 1J1EB 2IYOA 2WVRA 1GU4A 3II6A 2FXMA 1JMBA 3RG6C 3CCEP 1FDIA 1RE3A 2ZT9C 5AW9B 5TISE 2YMKA 2Q5UA 3B71A 1EDLA 1NKZB 1ZP0C 4KJMA 4C7NB 2CQ8A 2G3AA 3SWFA 2KOSA 3RL0D 2LF4A 4U3FD 3KZIH 2V7QJ 2WSCH 1SQVG 2FQ1A 1E0HA 1TU3F 1W2EA 2N5IA 2X2BA 3VP9A 2QJYC 2HPCB 3RK2D 2HODB 4WBAA 2H8PD 3CPWO 1L0ND 3I56P 2JKVA 4PJ0E 3TDKA 1VQLP 5E79H 1LTGC 1IMQA 1GL2B 1ZN5A 5HV8A 5B5EE 4C7NA 3NTNA 1YHQP 3IFMA 3SFEC 1IC2A 2FXOA 1K8AQ 1KYOE 2QJKC 2D2CC 4PWVB 3KXDA 2XNXA 4D6TE 1ZXGA 1CZQA 2GDWA 2RKLA 1VQPP 2HODA 4LGDE 3CE7A 3R4YA 1SQBD 3IR9A 5CCGD 2OYHC 3H47A 1BDCA 3B5NB 1P84E 2E76B 4LC1A 1NTKK 1GL2A 2K1AA 4U0FA 3CX5H 4N78D 3A0BE 2IBZI 1SQVD 2XXMA 2K3RA 2I1JA 2FBWC 3L74D 1NH4A 1NWQA 1PZQA 1YYCA 3MUDC 4MN4C 2LIUA 1EIAA 1BCCG 2YIUB 2RN0A 1ZV8A 2P58A 1IFIA 1M74A 1L0NJ 1URQB 3LIEA 2QJPC 1UIIA 2HLOA 2GZEA 2ZYAA 2R3SA 2C9NY 1IJDB 3E2DA 1Q7YQ 3H1HG 3L70G 5CHXA 2Z5HA 5H2FE 1WT6A 3L72E 2KGEA 2CPBA 5CBOA 2XU6A 4EDFA 2IDBA 1U57A 3Q20A 3Q5PA 2E75D 1SQBJ 4PH1A 4PV1B 1VQNP 1LJ2A 4U0AA 2N1TC 1RF0A 2BCCE 2KB7P 5CCGC 2UWJE 1VQKP 5KLIC 3VOPA 1SQVJ 3HTKA 3GZMA 2R5DA 1LWUC 4OGQD 4BRYB 1VF5B 2ZAEB 1LTTC 3L74J 1L0LK 2ZFCA 3NXSA 1DV5A 1BCCD 2A06E 2WPVB 3PTZA 4GOFA 1N8RQ 1HGZA 2POHA 4XFJA 1S72P 1SQXE 3L71G 3HRNA 1KORA 2GZJA 2KOQA 2OGUA 3H1LE 2M5AB 1L0HA 2FYUE 3VMYA 1FZCC 4A7PA 1VQOP 2KIKA 3L70D 1K73Q 1OVVA 1BAJA 2PEMA 1IK7A 1H88A 2FYNB 4Y99B 1PL5A 2R5BA 5AVXB 2KGCA 4Z1MH 5HVCA 1K9MQ 2BASA 3A0HE 1FR2A 1JY3P 3CXHE 2CWOA 1YBKA 4UB6E 3F89A 3H1KE 2FHSC 3CC2P 1QRJA 1N86A 3L36A 5KLVE 1RQUA 5KKZC 4NEOA 3EFGA 2J59M 5C39A 2OYOA 4DOJA 1SLQA 2KOGA 1RO0A 2WPQA 5BS2A 1WMKA 1KB9H 1NO4A 1OWAA 1VQ8P 4PD4D 1CI6A 1S5LE 1N7SC 2QJYB 2XZ0D 2M0BA 3CMAP 2V4HA 3CCJP 1PGQA 4WVZA 1QL1A 1IFMA 1N7LA 2XT1A 2Q6QA 1H89A 4I7ZC 4GR2A 5KAFH 5GTIE 2KUBA 1GK6A 1EZVD 4R4MA 5HGLA 2YXRB 2KI7B 4H13D 3CCRP 1NU1E 2M8RA 4WY4C 4JPZB 3PLNA 1AV1A 2M3BA 4OVNF 3G0VA 1L2PA 1NVOA 2KW2A 2WWWA 2N9BA 3E1RA 3G21A 2PP6A 2Y9ZA 1WRGA 5CZDB 1P84I 2OTJP 1VQ9P 1Q82Q 1YJWP 2JYLA 2VLPA 1LTAC 4IOIH 1AF8A 3SSUA 2K88A 2K2QA 1NTKD 2MKVA 3LMOA 4AYCA 1N73A 2IBZG 1FS0E 2OYIB 1VDFA 3AE3C 2GM4A 2QJPB 2LKIA 1JY3N 1L0LG 3FXDA 1L0NK 3DTJA 4IL6E 2JB0A 2ONTA 5H2FH 3IF4A 1JTHA 3VRLC 3L73E 2BHVA 3L75D 2IYPA 4JQ0D 5JPAA 2MF4A 2AEMA 1T2KC 1NGMB 1XTGB 3USSA 3AEAC 3IAOA 1USEA 2XDJA 3WUTA 4DG9A 1SFCC 1KQSO 2JU2A 2FQ2A 2OYIA 2W8ZA 4XRQA 1ACPA 2KYVA 4I6MC 5E79E 4AQRD 2KSEA 2N1TB 1IFDA 2P67A 3B8EB 1Y47A 1BE3D 5KLIB 4C46A 1X3OA 4RESB 4RKUJ 1HF9A 1NTKJ 5GTHH 2BQ1E 1JY3O 1NTZE 2WT7A 1HY8A 5AVSB 4IL6X 1FZEA 1HUCA 2WSFH 4H44D 1IFPA 1NAYA 1X9VA 3CX5E 1FZBA 2PEQA 2K9JA 3M0AA 3MTUE 1AVOA 2ITAA 2IPPA 3L75J 2M5RA 1FZCB 1SS1A 4XFXA 2KGAA 3VTPC 3GKLC 2K92A 3T97B 5DJTB 1FDMA 2CGQA 2Z45A 1LTJC 5AW7B 5HGMA 2IFMA 2WPTA 3I5CA 3GF3A 1KILE 2KOPA 2KNCB 2E5YA 1FU1A 3TGUD 4JF7A 3Q5RA 1CSBA 1BE3J 2L22A 3P05A 1YJ9P 4IZ6A 2Z44A 3CCMP 1HH0A 3V5BA 2VLQA 5KKZB 1M7LA 3T97A 4EI2A 4M3LA 3CC4P 2QM7A 3Q1MA 2FVEA 1YIJP 4ZKPA 3O8ZA 3LW5H 1G2CB 3RK3C 2PEIA 2KS1A 3BRTB 1YTZI 1FZGA 2JBGA 1X8YA 1N7SB 1RY3A 2PRRA 4PD4I 2KZJA 3RBZA 2NO8A 3H1IE 1RQVA 2B87B 1RF1C 2XZRA 2N6YA 1BGYE 1OMIA 4H0LC 1JMMA 2RMZA 3HD7C 4I7ZB 3L37A 2C0WA 3OW2O 2NPSB 2QEXP 5AW6B 1OW8A 4WYMA 2N98A 1SP4A 3TGUJ 1L0NG 3AE1C 1KQGB 3CCSP 2GDYA 1EZVI 4WY4B 3HYBA 4PH0A 1L4AC 5TJHA 2OQQA 3V2QA 4L76A 1MUUA 2QM8A 2W6AA 1QEXA 3D6ZA 3P8MC 3HE5A 1QX8A 5KJ7A 2NPSA 1SQBG 3HUSC 2LXBA 3G71P 2E74D 1NAFA 3C1LA 1LT9C 4IL6H 2YKQA 4IFDK 2ZXEB 1CW5A 4L73A 2FYZA 1QVGO 3O6QB 2P7JA 2K5XA 3P8CE 3MIWA 3H32A 2ZVOB 2KLUA 3GJNA 1M1JC 1DNYA 2GA1A 2AFEA 1ZLLA 2FFDC 3L74G 4K3AA 2B89A 1RO2A 1KB9E 5AVWB 1OVRA 2AEJA 2GUVA 2GZGA 2L0QA 3MHVA 1PP9E 2P9XA 1NU1K 1SFCB 3S4RA 1NTME 1IK9A 2WSEH 2BUOA 3JC22 3WUVA 3U1CA 1PEOA 1KYOD 3H1JE 1SVFA 4D6TD 3CWBE 1G1JA 1SQPE 5KAFE 3VN0A 3D71A 1OX3A 2HPCA 1JOCA 3MGEA 1PEMA 1IMPA 3G9RA 3AE8C 2W6BA 4B86A 1P84D 3QH9A 1LTIC 4GOEA 3G6EP 1OZHA 3DS1A 2PY8A 3H25A 4EYYQ 1JEKA 1GU5A 2JGPA 4HKGA 2EIAA 1KTMA 2KOOA 2H7HA 1E5WA 4O9BA 3VYIA 3RL0C 3MGNA 4KT0J 3SWKA 2ZXXA 3CX5I 2A06G 4XFZA 1IFJA 4WWIA 4ZMDA 2LKMA 1Y9BA 1DEBA 2Z5IA 2MD9A 5HGNA 1D1DA 2JWAA 2WPSA 3B5NA 1NTMJ 3RK2C 1LP1B 3CI9A 5APQA 3Q3DA 1LTJB 3D70A 2CG5B 2JYGA 1DIPA 3PRJA 4DZOA 4YPCA 1AYIA 4XFYA 2B9BA 4XROA 4D6TJ 3L72D 3PH0A 1GXHA 5KP6B 3HE4B 3AE7C 3VP8A 1AA0A 3BASA 3WU2H 1EXIA 5AVZB 3VMZA 2XZ1C 5L8RJ 1MFTA 1URQA 3V4QA 2KZIA 3GHGC 2BCCD 2HR3A 1LGHB 2KK7A 1S9KE 3F5HA 3N4XA 4TT3H 3AEGC 2JO0A 2KODA 4L75A 2A06D 1JM0A 1DX7A 3GZLA 4W7YA 1DH3A 1SQXD 2FACA 1KILB 4XE5B 5GTHE 4H0LB 3HD7B 3H1LD 2MVVA 2O1KA 2FYUD 1RE4A 4JYBA 4BRYA 5APYA 2HFED 3JSVC 5AVTB 5AW0B 3ABVC 1FBMA 3L72J 5CCHA 2MJZA 1L4AB 3GG2A 3CXHD 1KILA 5AW4B 1F80D 4U0BA 3H1HE 5KJ7D 4R0MA 2BCCJ 1EZVG 2E75C 1EQ7A 4YXDC 3H1KD 3M9BA 2M5AA 2ZT9B 3K5BA 1OXZA 4BWNA 5KLVD 2YMYA 4H2WC 3DPHA 3HUSB 4ZKUA 2EHTA 1MZ8A 1QL2A 3VMXA 1UJZA 1SQQE 5BS1A 4OGQC 1AVYA 2M8NA 3V2RA 1KFMA 1JY2P 3A3YB 1IZNB 1SQXJ 1M1JB 1GD2E 2L4BA 3H1LJ 1NTKG 2FFDB 1FE6A 1VQ6P 2FYUJ 3TSIA 3EWKA 1KB9I 1HJBA 2Z4EA 3CCUP 1Q2NA 3A5TA 4CPGA 3M0DC 2PEJA 4BPFA 5F2KA 1KLPA 3L71E 4BXLA 3CD6P 2Q3EA 4HB1A 3L73G 1OW6A 2PNGA 1VQ4P 3L75G 2QJKB 1A43A 2D2CB 1CEIA 1KYOI 1NU1D 1EC5A 2OTLP 1T3UA 4EIJA 3H1KJ 2LOLA 1USDA 2M3EA 1DD4A 2XKMA 1T6AA 5KLVJ 2OYHB 1X0TA 1RE3C 4YXWH 1GL2D 2WQYC 2RH0A 1PPJE 1SQQJ 4M0IA 1L0IA 1KC8Q 3AEDC 1JNMA 1KD1Q 1ZOYC 1HWTC 4W7ZA 1BE3G 4N3YB 2QG4A 3G1IA 4U7JA 3BVHA 3EQ2A 3B5IA 1J1EC 1Z56A 2LIWA 3RL0B 1YI2P 1AQTA 2H43A 2DNWA 5KAIE 1Q90D 3C9IA 1PGPA 2GZFA 3AEFC 4GIFA 3B5ND 3TK1A 2OYHA 2E76D 2GZIA 1JCDA 4U0EA 2K37A 3RK2B 4QNBA 1W2BO 3B4SA 1QLED 2K9YA 4HKZH 1GK4A 3L73D 1NTMK 3PJSK 5B66H 5CMZA 2OTKE 5KP8B 3EFFK 1NU1J 2IZ1A 2QRXA 3OAKA 4I1LA 1SQPK 1AFOA 3MUDA 4JBZA 2PAJA 1U7MA 1URQD 4IFFA 1JY2N 2YKOA 4H13C 4BPGA 2E1MA 3H6PA 3GHGB 1IO4A 3AECC 3TGUG 2AFDA 2ROQA 2YO2A 1M6NA 1UNKA 1AQ5A 1GL2C 3CCVP 1LWUB 5APUA 2YO3A 1KN7A 3BCCE 3N7NA 5BU8B 1Y8AA 2JDIH 2Y0EA 5KP7B 4PV1D 3NMDA 2ZJSE 4I2LC 3AEBC 3CX5D 4HYTB 2N1TA 2KORA 2FVFA 3L73J 1M6EX 1Z6MA 2FKWB 1VF5D 2WSCJ 3RK3E 1LWUA 2IBZE 1JO5A 3RGUA 1JY2O 4JYCA 1OW7A 1GTWA 2JO1A 1HGVA 1XTCC 1M56D 2KWLA 1L0LE 2A45I 4PXHB 1KILD 3DS0A 1MZ9A 2HYNA 1FOSE 2L6EA 3GLMA 1DEEG 4GODA 3CXHI 4TLFA 2E75B 4U0CA 2VLNA 2WZ7A 1EDKA 1GW3A 1LT1A 1RF0C 1FZCA 1QVFO 1GZLA 1AUMA 3TNUB 2FVAA 5AW3B 2EHSA 1NTZJ 2OARA 1J2JB 1GW4A 4OGQB 3WU2E 2R32A 4DT0A 5APSA 1GXGA 2KNCA 1HVVA 1SQXK 1S2EA 4NPEA 2ERHA 2FADA 4PV1C 2W27A 1S3JA 3CLQA 3H1ID 3U59A 4UB8E 3V2NA 4H44C 2FYUK 2M8LA 3IN6A 3V6IA 2PENA 1BGYD 1VHNA 2KP8A 2MR7A 4ASVA 1M90Q 1ZMEC 1A02F 2KXPB 3FWNA 1M1KQ 2WPRA 1G2CA 4MRTC 5AVQB 3G4SP 4GR6A 2QNWA 2FXPA 1PP9G 3AE6C 2JAZA 4C7RA 2IZ0A 1N7SA 2QIWA 1NTMG 3M06A 2LR2A 1U7JA 4UHPB 1KZUB 5KLVK 2B87A 4LLHA 4D6TG 1SQPG 2JQ4A 1FOSF 1SQQK 2FY8A 3GW6A 5KAIH 1M8OB 4IFMA 4QKOA 1ZRTE 3G28A 4U0DA 5AW1B 2P1JA 4IPYA 4WY4A 1X22A 3H1IJ 2KG6A 2LTEA 3B4QA 3P8CD 3KPEA 2SPZA 2JU1A 4H2XC 1BGYJ 2KG8A 2P2UA 2AXTH 4AUWA 1W5CE 4HH2A 2KR5A 3CL3D 3CCLP 2BEZF 2KSJA 1RH5B 1KB9D 3AE2C 1PGJA 2EG5A 3C8VA 2J5UA 1RNIA 1PP9D 3SWYA 4QMAA 1KMIZ 4U3FE 3MD0A 1MFZA 1QGKB 1NTMD 1YQ4C 1VKUA 2G8YA 3DS3A 2H89C 3A2AA 3O6QA 3H1JD 4H13B 4COPA 3I55P 3CWBD 1SQPD 2O01H 3VMAA 5K5GB 3WBHA 3L72G 3UIAA 1L0NE 1JB0J 2IFNA 5F2NA 3GF7A 1T8ZA 3EJEA 2N50A 2XV5A 1SFCA 1VQ5P 2BCCG 2DW3A 4DJGA 4DCKA 1N73C 2CK3H 2N1TD 2E74C 3EJDA 2MY5A 1HTLC 1PGOA 1SQBE 2L5GB 1GPJA 2L9FA 3U1AA 3MZWB 2Q7CA 3NTEA 1PP9J 4N78E 3G1GA 4U3FJ 4CA3A 1SQXG 1SQVE 3SFDC 2JR8A 1KV4A 1T3JA 3H1LG 3P32A 2FYUG 3H1JJ 3L74E 5AVRB 5M1BA 3ZDMA 2R44A 3L4FA 3V4WA 1PFIA 1KQLA 1YQ3C 2OYIC 3CWBJ 1SQPJ 2YKPA 5BVZA 1ZR2A 2MVUA 1D7MA 2A45G 3E7KA 1EDIA 5B66E 2O1JA 2P10A 1OVUA 5CBNA 3JCUH 3HTKB 3KDPB 3W68A 3M9HA 2L91A 1EMVA 1S9KD 1LP1A 4GDOA 1NTZK 1OIPA 1LTJA 3KQGA 3H1KG 4UB8H 2KLVA 1E79H 3RK3B 5KLVG 5EJDA 1K05A 3FGAD 3OJAB 2ZVNB 3M1MA 1PEUA 3HE4A 3RBXA 1FAVA 1SQQG 3L35A 4H44B 1G1IA 3ITKA 2XNDH 5BU5A 2K0YA 2N6ZA 1BSNA 1YJNP 1RF1B 4L74A 3OA7A 2Q9IA 4XA4A 2ZYDA 2Y9YA 2V7QH 1PEQA
chains in the Genus database with same CATH topology
1RO0A 4U0BA 4PH1A 2BHVA 3VRLC 5BS2A 3CPWO 3P05A 3I56P 1YJ9P 3G29A 1VQNP 3H0DA 1YI2P 2JYGA 1VQLP 1QVGO 5JPAA 2Z44A 3CCMP 4U0AA 1VQ8P 2DGYA 4XFYA 3DPHA 4XROA 3DS0A 1YHQP 1VQKP 1A8OA 1KQSO 2PEOA 3CMAP 1K8AQ 3CC4P 3NTEA 4U0EA 3CCQP 3CCJP 2L6EA 3G1GA 3G28A 4QNBA 4U0DA 4XRQA 1YIJP 1W2BO 4IPYA 5BS1A 3HZQA 2M8NA 1RO2A 5I4TG 1EOQA 1NJIQ 1VQMP 2PEIA 3CMEP 2XT1A 4U0CA 3H4EA 1VQPP 4GR2A 3DS5A 1JJ2O 1QVFO 1AUMA 2PEKA 2P9XA 1N8RQ 3H47A 2BUOA 1VQ6P 1S72P 2OARA 1PEOA 5HGLA 4U0FA 3CCLP 3CC7P 5HGOA 3CXCO 3CCRP 2BQ1E 2JO0A 2Z46A 2KODA 3CCUP 2XXMA 1ZMBA 1Q81Q 2EG5A 1VQOP 1RNIA 3OW2O 2E1MA 2PEJA 1K73Q 3G0VA 1BAJA 2PEMA 5F2KA 2QEXP 3LRYA 3G21A 3MGEA 3CD6P 4COCA 1M6NA 1Q86Q 1PEMA 3DS2A 4WYMA 3RG6C 3CCEP 1VQ4P 1VQ7P 1EIAA 2PEQA 3CCVP 1A43A 3DS3A 2M8LA 3G6EP 1VQ9P 2OTJP 3CCSP 1Q82Q 3DS1A 1IUQA 2PENA 1YJWP 2PY8A 3HYBA 2JYLA 4COPA 4PH0A 1K9MQ 2XV6A 3DS4A 1M74A 2OTLP 3I55P 1E6JP 4XFXA 2EFJA 2CWOA 1M90Q 2EIAA 1K30A 3WBHA 5F2OA 3M1MA 1PEUA 2LF4A 2Z45A 1M1KQ 3E2DA 5F2NA 2QA4P 3CC2P 1QRJA 1Q7YQ 3G4SP 5HGMA 4GR6A 4M0IA 4XFZA 1YJNP 1YITP 5DCKA 1KC8Q 1KD1Q 1M6EX 5HGNA 1D1DA 3DTJA 2ONTA 1VQ5P 3G26A 3Q20A 3G1IA 1PEQA 3G71P 2M8PA 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM P;  3CME P;  3CPW O;  1VQO P;  3OW2 O;  1VQP P;  3I56 P;  1K73 Q;  1YJ9 P;  1VQN P;  1YI2 P;  2QEX P;  1JJ2 O;  1VQL P;  1QVG O;  1M1K Q;  1QVF O;  3CD6 P;  3CCM P;  2QA4 P;  1Q86 Q;  1N8R Q;  3CC2 P;  1VQ8 P;  1Q7Y Q;  3CCE P;  1VQ4 P;  3G4S P;  1VQ6 P;  1VQ7 P;  1S72 P;  1YJN P;  1YHQ P;  1YIT P;  1VQK P;  2OTJ P;  3CCV P;  1KC8 Q;  3G6E P;  1KD1 Q;  1KQS O;  3CCS P;  1Q82 Q;  1VQ9 P;  3CMA P;  1YJW P;  1K8A Q;  3CC4 P;  1K9M Q;  3CCL P;  3CCQ P;  3CC7 P;  3CXC O;  3CCJ P;  3CCR P;  2OTL P;  1YIJ P;  3I55 P;  1W2B O;  1VQ5 P;  3CCU P;  3G71 P;  1NJI Q;  1Q81 Q;  1M90 Q; 
#chains in the Genus database with same CATH topology
 1H8A A;  1GDT A;  3TF5 A;  4F37 A;  3G3Z A;  1BCC E;  4ASW A;  2VLO A;  1N7S D;  1PV3 A;  1ZR4 A;  2GUS A;  3U43 A;  2W6J H;  1FC2 C;  3AE4 C;  4RO0 A;  3CCQ P;  1RF1 A;  2K93 A;  3H1H D;  1NJI Q;  4YTP C;  1VPC A;  4W80 A;  3HD7 A;  3H4E A;  4RJT A;  2NPS D;  1NU1 G;  3L70 E;  4WB4 A;  2YNY A;  5APW A;  2LPK A;  4HJG H;  2NRG A;  3FX0 A;  1M57 D;  3BRV B;  1BDD A;  3BAT A;  2K0D X;  4WY4 D;  5EFW B;  3CXC O;  5TIS H;  1PPJ G;  1SQQ D;  2JJL A;  1LT9 B;  2LL8 A;  1L4A A;  1YTZ T;  1CI6 B;  2O01 N;  1JCC A;  1FZA A;  1HJ0 A;  2Y0D A;  2FAE A;  3LRY A;  1RHZ B;  2E43 A;  1NHL A;  2K0X A;  1VQ7 P;  5AW8 B;  1NOH A;  2C0X A;  2GDX A;  1IUQ A;  1K04 A;  1BCC J;  2WSF J;  2MR8 A;  2KG9 A;  1OR5 A;  3HUS A;  5DJU B;  1GMJ A;  5F2O A;  3L71 D;  1HBW A;  1T8K A;  1LT9 A;  2JP3 A;  3KYQ A;  4PJ0 H;  4PD4 E;  4K35 A;  1YIT P;  5B5E H;  1M1J A;  3H1H J;  3NY7 B;  1KQF B;  4KHX A;  3L70 J;  1H0T B;  2FFD A;  1KYO H;  1T2K D;  2QSI A;  3AEE C;  4NPF X;  3G29 A;  3W67 A;  5KJ7 C;  1J1D C;  2NPS C;  1SFC D;  1ZW0 A;  1PPJ D;  2QVA A;  1DD3 A;  2I8D A;  2WSS H;  3D6Y A;  3EJB A;  3QWO C;  1EZV E;  1P84 H;  1N73 B;  1EDJ A;  3S1K A;  2E74 B;  2H88 C;  1EOQ A;  1VQM P;  5APT A;  3A0B H;  3BCC G;  3AE5 C;  3DS5 A;  1JJ2 O;  4Y28 J;  1H0T A;  2NZ2 A;  1NTZ G;  2VRS A;  1KFN A;  3LW5 J;  3V2P A;  1JTH B;  3PP5 A;  2IX7 C;  4NPD A;  1S5L X;  3L71 J;  1FJP A;  1ZNV A;  1HQB A;  1ZMB A;  3A7O A;  1NTK E;  1LNQ A;  2AVA A;  2AXT E;  1S1C X;  3TYY A;  2XV6 A;  3DS4 A;  1LTS C;  1E6J P;  2EFJ A;  3WMM 0;  2E42 A;  3KZI E;  1EXJ A;  3L75 E;  2I1K A;  3R2P A;  3KHU A;  1R8E A;  2QA4 P;  1R5S A;  2ZYG A;  2Q3I A;  1BXI A;  2WT7 B;  4OH8 B;  5DCK A;  2QE7 H;  2CNR A;  3BCC D;  1NYH A;  3PHL A;  3Q2Y A;  1NTZ D;  3AE9 C;  4ZNC A;  3G26 A;  1SQB K;  2W90 A;  3MP7 B;  2K9J B;  3WUU A;  3RG2 A;  2E5T A;  2N9Y B;  1BE3 E;  1FDO A;  3GHG A;  1SQV K;  4BPH A;  2PEO A;  2O3J A;  3B5N C;  3RK3 D;  5AVY B;  5CCG A;  2E76 C;  2KGD A;  2IBZ D;  3H1I G;  5I4T G;  2JEE A;  5CCH D;  2J58 A;  4OWF A;  2WTY A;  1BGY G;  1L0L D;  2PEK A;  2Y0C A;  3E1I A;  2WMM A;  3LID A;  2A45 H;  4H0L D;  3HD7 D;  4EOT A;  2YIU C;  3CC7 P;  5HGO A;  2WSE J;  1URQ C;  2GYK A;  3A0H H;  3CXH H;  1LTB C;  4UB6 H;  3GMA A;  1NKN A;  3P7K A;  4COC A;  1Q86 Q;  1N2D C;  3DS2 A;  2O01 J;  3BCC J;  3FXE A;  4R4L A;  1L4A D;  3Q5S A;  1FZF A;  1MKM A;  5EW5 E;  2KS1 B;  2YXQ B;  3TGU E;  2PFX A;  4GT1 A;  1K30 A;  2AXC A;  1A02 J;  2VSQ A;  3JCU E;  5AVV B;  2R3C A;  5CJ4 A;  2ZT9 D;  2BEQ D;  5KTB A;  5AW5 B;  1S5L H;  1MV8 A;  1RE4 C;  4PD4 H;  3TNU A;  2N5H A;  5APX A;  2FQ0 A;  3S9O A;  2M8P A;  1L0L J;  1VF5 C;  2PGD A;  1BSH A;  2HG5 D;  2Q1K A;  3H0D A;  5CCH C;  2LML A;  2LXC B;  2DGY A;  5GTI H;  1UIX A;  1NQ4 A;  3NFQ A;  1X79 B;  1A8O A;  4U3F G;  1VL2 A;  2W83 C;  2C9L Y;  1KIL C;  2AF8 A;  1AJY A;  5APV A;  2CPS A;  2JWD A;  1IFN A;  1PIX A;  4GKG A;  3HZQ A;  2B88 A;  3CME P;  3HE5 B;  1J1D B;  3H1J G;  5AVU B;  2K94 A;  3M91 A;  3FWL A;  3M0D A;  5CJ0 A;  4N6J A;  1OFC X;  3CWB G;  2WIT A;  3RL0 g;  2FYN C;  5AW2 B;  4Y99 C;  2AEF A;  2D2C D;  3M9Q A;  7CEI A;  1FJK A;  1ZRT D;  1JUN A;  4H2Y C;  2Z46 A;  3H32 B;  1S4X A;  1R5L A;  1Q81 Q;  1J1E B;  2IYO A;  2WVR A;  1GU4 A;  3II6 A;  2FXM A;  1JMB A;  3RG6 C;  3CCE P;  1FDI A;  1RE3 A;  2ZT9 C;  5AW9 B;  5TIS E;  2YMK A;  2Q5U A;  3B71 A;  1EDL A;  1NKZ B;  1ZP0 C;  4KJM A;  4C7N B;  2CQ8 A;  2G3A A;  3SWF A;  2KOS A;  3RL0 D;  2LF4 A;  4U3F D;  3KZI H;  2V7Q J;  2WSC H;  1SQV G;  2FQ1 A;  1E0H A;  1TU3 F;  1W2E A;  2N5I A;  2X2B A;  3VP9 A;  2QJY C;  2HPC B;  3RK2 D;  2HOD B;  4WBA A;  2H8P D;  3CPW O;  1L0N D;  3I56 P;  2JKV A;  4PJ0 E;  3TDK A;  1VQL P;  5E79 H;  1LTG C;  1IMQ A;  1GL2 B;  1ZN5 A;  5HV8 A;  5B5E E;  4C7N A;  3NTN A;  1YHQ P;  3IFM A;  3SFE C;  1IC2 A;  2FXO A;  1K8A Q;  1KYO E;  2QJK C;  2D2C C;  4PWV B;  3KXD A;  2XNX A;  4D6T E;  1ZXG A;  1CZQ A;  2GDW A;  2RKL A;  1VQP P;  2HOD A;  4LGD E;  3CE7 A;  3R4Y A;  1SQB D;  3IR9 A;  5CCG D;  2OYH C;  3H47 A;  1BDC A;  3B5N B;  1P84 E;  2E76 B;  4LC1 A;  1NTK K;  1GL2 A;  2K1A A;  4U0F A;  3CX5 H;  4N78 D;  3A0B E;  2IBZ I;  1SQV D;  2XXM A;  2K3R A;  2I1J A;  2FBW C;  3L74 D;  1NH4 A;  1NWQ A;  1PZQ A;  1YYC A;  3MUD C;  4MN4 C;  2LIU A;  1EIA A;  1BCC G;  2YIU B;  2RN0 A;  1ZV8 A;  2P58 A;  1IFI A;  1M74 A;  1L0N J;  1URQ B;  3LIE A;  2QJP C;  1UII A;  2HLO A;  2GZE A;  2ZYA A;  2R3S A;  2C9N Y;  1IJD B;  3E2D A;  1Q7Y Q;  3H1H G;  3L70 G;  5CHX A;  2Z5H A;  5H2F E;  1WT6 A;  3L72 E;  2KGE A;  2CPB A;  5CBO A;  2XU6 A;  4EDF A;  2IDB A;  1U57 A;  3Q20 A;  3Q5P A;  2E75 D;  1SQB J;  4PH1 A;  4PV1 B;  1VQN P;  1LJ2 A;  4U0A A;  2N1T C;  1RF0 A;  2BCC E;  2KB7 P;  5CCG C;  2UWJ E;  1VQK P;  5KLI C;  3VOP A;  1SQV J;  3HTK A;  3GZM A;  2R5D A;  1LWU C;  4OGQ D;  4BRY B;  1VF5 B;  2ZAE B;  1LTT C;  3L74 J;  1L0L K;  2ZFC A;  3NXS A;  1DV5 A;  1BCC D;  2A06 E;  2WPV B;  3PTZ A;  4GOF A;  1N8R Q;  1HGZ A;  2POH A;  4XFJ A;  1S72 P;  1SQX E;  3L71 G;  3HRN A;  1KOR A;  2GZJ A;  2KOQ A;  2OGU A;  3H1L E;  2M5A B;  1L0H A;  2FYU E;  3VMY A;  1FZC C;  4A7P A;  1VQO P;  2KIK A;  3L70 D;  1K73 Q;  1OVV A;  1BAJ A;  2PEM A;  1IK7 A;  1H88 A;  2FYN B;  4Y99 B;  1PL5 A;  2R5B A;  5AVX B;  2KGC A;  4Z1M H;  5HVC A;  1K9M Q;  2BAS A;  3A0H E;  1FR2 A;  1JY3 P;  3CXH E;  2CWO A;  1YBK A;  4UB6 E;  3F89 A;  3H1K E;  2FHS C;  3CC2 P;  1QRJ A;  1N86 A;  3L36 A;  5KLV E;  1RQU A;  5KKZ C;  4NEO A;  3EFG A;  2J59 M;  5C39 A;  2OYO A;  4DOJ A;  1SLQ A;  2KOG A;  1RO0 A;  2WPQ A;  5BS2 A;  1WMK A;  1KB9 H;  1NO4 A;  1OWA A;  1VQ8 P;  4PD4 D;  1CI6 A;  1S5L E;  1N7S C;  2QJY B;  2XZ0 D;  2M0B A;  3CMA P;  2V4H A;  3CCJ P;  1PGQ A;  4WVZ A;  1QL1 A;  1IFM A;  1N7L A;  2XT1 A;  2Q6Q A;  1H89 A;  4I7Z C;  4GR2 A;  5KAF H;  5GTI E;  2KUB A;  1GK6 A;  1EZV D;  4R4M A;  5HGL A;  2YXR B;  2KI7 B;  4H13 D;  3CCR P;  1NU1 E;  2M8R A;  4WY4 C;  4JPZ B;  3PLN A;  1AV1 A;  2M3B A;  4OVN F;  3G0V A;  1L2P A;  1NVO A;  2KW2 A;  2WWW A;  2N9B A;  3E1R A;  3G21 A;  2PP6 A;  2Y9Z A;  1WRG A;  5CZD B;  1P84 I;  2OTJ P;  1VQ9 P;  1Q82 Q;  1YJW P;  2JYL A;  2VLP A;  1LTA C;  4IOI H;  1AF8 A;  3SSU A;  2K88 A;  2K2Q A;  1NTK D;  2MKV A;  3LMO A;  4AYC A;  1N73 A;  2IBZ G;  1FS0 E;  2OYI B;  1VDF A;  3AE3 C;  2GM4 A;  2QJP B;  2LKI A;  1JY3 N;  1L0L G;  3FXD A;  1L0N K;  3DTJ A;  4IL6 E;  2JB0 A;  2ONT A;  5H2F H;  3IF4 A;  1JTH A;  3VRL C;  3L73 E;  2BHV A;  3L75 D;  2IYP A;  4JQ0 D;  5JPA A;  2MF4 A;  2AEM A;  1T2K C;  1NGM B;  1XTG B;  3USS A;  3AEA C;  3IAO A;  1USE A;  2XDJ A;  3WUT A;  4DG9 A;  1SFC C;  1KQS O;  2JU2 A;  2FQ2 A;  2OYI A;  2W8Z A;  4XRQ A;  1ACP A;  2KYV A;  4I6M C;  5E79 E;  4AQR D;  2KSE A;  2N1T B;  1IFD A;  2P67 A;  3B8E B;  1Y47 A;  1BE3 D;  5KLI B;  4C46 A;  1X3O A;  4RES B;  4RKU J;  1HF9 A;  1NTK J;  5GTH H;  2BQ1 E;  1JY3 O;  1NTZ E;  2WT7 A;  1HY8 A;  5AVS B;  4IL6 X;  1FZE A;  1HUC A;  2WSF H;  4H44 D;  1IFP A;  1NAY A;  1X9V A;  3CX5 E;  1FZB A;  2PEQ A;  2K9J A;  3M0A A;  3MTU E;  1AVO A;  2ITA A;  2IPP A;  3L75 J;  2M5R A;  1FZC B;  1SS1 A;  4XFX A;  2KGA A;  3VTP C;  3GKL C;  2K92 A;  3T97 B;  5DJT B;  1FDM A;  2CGQ A;  2Z45 A;  1LTJ C;  5AW7 B;  5HGM A;  2IFM A;  2WPT A;  3I5C A;  3GF3 A;  1KIL E;  2KOP A;  2KNC B;  2E5Y A;  1FU1 A;  3TGU D;  4JF7 A;  3Q5R A;  1CSB A;  1BE3 J;  2L22 A;  3P05 A;  1YJ9 P;  4IZ6 A;  2Z44 A;  3CCM P;  1HH0 A;  3V5B A;  2VLQ A;  5KKZ B;  1M7L A;  3T97 A;  4EI2 A;  4M3L A;  3CC4 P;  2QM7 A;  3Q1M A;  2FVE A;  1YIJ P;  4ZKP A;  3O8Z A;  3LW5 H;  1G2C B;  3RK3 C;  2PEI A;  2KS1 A;  3BRT B;  1YTZ I;  1FZG A;  2JBG A;  1X8Y A;  1N7S B;  1RY3 A;  2PRR A;  4PD4 I;  2KZJ A;  3RBZ A;  2NO8 A;  3H1I E;  1RQV A;  2B87 B;  1RF1 C;  2XZR A;  2N6Y A;  1BGY E;  1OMI A;  4H0L C;  1JMM A;  2RMZ A;  3HD7 C;  4I7Z B;  3L37 A;  2C0W A;  3OW2 O;  2NPS B;  2QEX P;  5AW6 B;  1OW8 A;  4WYM A;  2N98 A;  1SP4 A;  3TGU J;  1L0N G;  3AE1 C;  1KQG B;  3CCS P;  2GDY A;  1EZV I;  4WY4 B;  3HYB A;  4PH0 A;  1L4A C;  5TJH A;  2OQQ A;  3V2Q A;  4L76 A;  1MUU A;  2QM8 A;  2W6A A;  1QEX A;  3D6Z A;  3P8M C;  3HE5 A;  1QX8 A;  5KJ7 A;  2NPS A;  1SQB G;  3HUS C;  2LXB A;  3G71 P;  2E74 D;  1NAF A;  3C1L A;  1LT9 C;  4IL6 H;  2YKQ A;  4IFD K;  2ZXE B;  1CW5 A;  4L73 A;  2FYZ A;  1QVG O;  3O6Q B;  2P7J A;  2K5X A;  3P8C E;  3MIW A;  3H32 A;  2ZVO B;  2KLU A;  3GJN A;  1M1J C;  1DNY A;  2GA1 A;  2AFE A;  1ZLL A;  2FFD C;  3L74 G;  4K3A A;  2B89 A;  1RO2 A;  1KB9 E;  5AVW B;  1OVR A;  2AEJ A;  2GUV A;  2GZG A;  2L0Q A;  3MHV A;  1PP9 E;  2P9X A;  1NU1 K;  1SFC B;  3S4R A;  1NTM E;  1IK9 A;  2WSE H;  2BUO A;  3JC2 2;  3WUV A;  3U1C A;  1PEO A;  1KYO D;  3H1J E;  1SVF A;  4D6T D;  3CWB E;  1G1J A;  1SQP E;  5KAF E;  3VN0 A;  3D71 A;  1OX3 A;  2HPC A;  1JOC A;  3MGE A;  1PEM A;  1IMP A;  3G9R A;  3AE8 C;  2W6B A;  4B86 A;  1P84 D;  3QH9 A;  1LTI C;  4GOE A;  3G6E P;  1OZH A;  3DS1 A;  2PY8 A;  3H25 A;  4EYY Q;  1JEK A;  1GU5 A;  2JGP A;  4HKG A;  2EIA A;  1KTM A;  2KOO A;  2H7H A;  1E5W A;  4O9B A;  3VYI A;  3RL0 C;  3MGN A;  4KT0 J;  3SWK A;  2ZXX A;  3CX5 I;  2A06 G;  4XFZ A;  1IFJ A;  4WWI A;  4ZMD A;  2LKM A;  1Y9B A;  1DEB A;  2Z5I A;  2MD9 A;  5HGN A;  1D1D A;  2JWA A;  2WPS A;  3B5N A;  1NTM J;  3RK2 C;  1LP1 B;  3CI9 A;  5APQ A;  3Q3D A;  1LTJ B;  3D70 A;  2CG5 B;  2JYG A;  1DIP A;  3PRJ A;  4DZO A;  4YPC A;  1AYI A;  4XFY A;  2B9B A;  4XRO A;  4D6T J;  3L72 D;  3PH0 A;  1GXH A;  5KP6 B;  3HE4 B;  3AE7 C;  3VP8 A;  1AA0 A;  3BAS A;  3WU2 H;  1EXI A;  5AVZ B;  3VMZ A;  2XZ1 C;  5L8R J;  1MFT A;  1URQ A;  3V4Q A;  2KZI A;  3GHG C;  2BCC D;  2HR3 A;  1LGH B;  2KK7 A;  1S9K E;  3F5H A;  3N4X A;  4TT3 H;  3AEG C;  2JO0 A;  2KOD A;  4L75 A;  2A06 D;  1JM0 A;  1DX7 A;  3GZL A;  4W7Y A;  1DH3 A;  1SQX D;  2FAC A;  1KIL B;  4XE5 B;  5GTH E;  4H0L B;  3HD7 B;  3H1L D;  2MVV A;  2O1K A;  2FYU D;  1RE4 A;  4JYB A;  4BRY A;  5APY A;  2HFE D;  3JSV C;  5AVT B;  5AW0 B;  3ABV C;  1FBM A;  3L72 J;  5CCH A;  2MJZ A;  1L4A B;  3GG2 A;  3CXH D;  1KIL A;  5AW4 B;  1F80 D;  4U0B A;  3H1H E;  5KJ7 D;  4R0M A;  2BCC J;  1EZV G;  2E75 C;  1EQ7 A;  4YXD C;  3H1K D;  3M9B A;  2M5A A;  2ZT9 B;  3K5B A;  1OXZ A;  4BWN A;  5KLV D;  2YMY A;  4H2W C;  3DPH A;  3HUS B;  4ZKU A;  2EHT A;  1MZ8 A;  1QL2 A;  3VMX A;  1UJZ A;  1SQQ E;  5BS1 A;  4OGQ C;  1AVY A;  2M8N A;  3V2R A;  1KFM A;  1JY2 P;  3A3Y B;  1IZN B;  1SQX J;  1M1J B;  1GD2 E;  2L4B A;  3H1L J;  1NTK G;  2FFD B;  1FE6 A;  1VQ6 P;  2FYU J;  3TSI A;  3EWK A;  1KB9 I;  1HJB A;  2Z4E A;  3CCU P;  1Q2N A;  3A5T A;  4CPG A;  3M0D C;  2PEJ A;  4BPF A;  5F2K A;  1KLP A;  3L71 E;  4BXL A;  3CD6 P;  2Q3E A;  4HB1 A;  3L73 G;  1OW6 A;  2PNG A;  1VQ4 P;  3L75 G;  2QJK B;  1A43 A;  2D2C B;  1CEI A;  1KYO I;  1NU1 D;  1EC5 A;  2OTL P;  1T3U A;  4EIJ A;  3H1K J;  2LOL A;  1USD A;  2M3E A;  1DD4 A;  2XKM A;  1T6A A;  5KLV J;  2OYH B;  1X0T A;  1RE3 C;  4YXW H;  1GL2 D;  2WQY C;  2RH0 A;  1PPJ E;  1SQQ J;  4M0I A;  1L0I A;  1KC8 Q;  3AED C;  1JNM A;  1KD1 Q;  1ZOY C;  1HWT C;  4W7Z A;  1BE3 G;  4N3Y B;  2QG4 A;  3G1I A;  4U7J A;  3BVH A;  3EQ2 A;  3B5I A;  1J1E C;  1Z56 A;  2LIW A;  3RL0 B;  1YI2 P;  1AQT A;  2H43 A;  2DNW A;  5KAI E;  1Q90 D;  3C9I A;  1PGP A;  2GZF A;  3AEF C;  4GIF A;  3B5N D;  3TK1 A;  2OYH A;  2E76 D;  2GZI A;  1JCD A;  4U0E A;  2K37 A;  3RK2 B;  4QNB A;  1W2B O;  3B4S A;  1QLE D;  2K9Y A;  4HKZ H;  1GK4 A;  3L73 D;  1NTM K;  3PJS K;  5B66 H;  5CMZ A;  2OTK E;  5KP8 B;  3EFF K;  1NU1 J;  2IZ1 A;  2QRX A;  3OAK A;  4I1L A;  1SQP K;  1AFO A;  3MUD A;  4JBZ A;  2PAJ A;  1U7M A;  1URQ D;  4IFF A;  1JY2 N;  2YKO A;  4H13 C;  4BPG A;  2E1M A;  3H6P A;  3GHG B;  1IO4 A;  3AEC C;  3TGU G;  2AFD A;  2ROQ A;  2YO2 A;  1M6N A;  1UNK A;  1AQ5 A;  1GL2 C;  3CCV P;  1LWU B;  5APU A;  2YO3 A;  1KN7 A;  3BCC E;  3N7N A;  5BU8 B;  1Y8A A;  2JDI H;  2Y0E A;  5KP7 B;  4PV1 D;  3NMD A;  2ZJS E;  4I2L C;  3AEB C;  3CX5 D;  4HYT B;  2N1T A;  2KOR A;  2FVF A;  3L73 J;  1M6E X;  1Z6M A;  2FKW B;  1VF5 D;  2WSC J;  3RK3 E;  1LWU A;  2IBZ E;  1JO5 A;  3RGU A;  1JY2 O;  4JYC A;  1OW7 A;  1GTW A;  2JO1 A;  1HGV A;  1XTC C;  1M56 D;  2KWL A;  1L0L E;  2A45 I;  4PXH B;  1KIL D;  3DS0 A;  1MZ9 A;  2HYN A;  1FOS E;  2L6E A;  3GLM A;  1DEE G;  4GOD A;  3CXH I;  4TLF A;  2E75 B;  4U0C A;  2VLN A;  2WZ7 A;  1EDK A;  1GW3 A;  1LT1 A;  1RF0 C;  1FZC A;  1QVF O;  1GZL A;  1AUM A;  3TNU B;  2FVA A;  5AW3 B;  2EHS A;  1NTZ J;  2OAR A;  1J2J B;  1GW4 A;  4OGQ B;  3WU2 E;  2R32 A;  4DT0 A;  5APS A;  1GXG A;  2KNC A;  1HVV A;  1SQX K;  1S2E A;  4NPE A;  2ERH A;  2FAD A;  4PV1 C;  2W27 A;  1S3J A;  3CLQ A;  3H1I D;  3U59 A;  4UB8 E;  3V2N A;  4H44 C;  2FYU K;  2M8L A;  3IN6 A;  3V6I A;  2PEN A;  1BGY D;  1VHN A;  2KP8 A;  2MR7 A;  4ASV A;  1M90 Q;  1ZME C;  1A02 F;  2KXP B;  3FWN A;  1M1K Q;  2WPR A;  1G2C A;  4MRT C;  5AVQ B;  3G4S P;  4GR6 A;  2QNW A;  2FXP A;  1PP9 G;  3AE6 C;  2JAZ A;  4C7R A;  2IZ0 A;  1N7S A;  2QIW A;  1NTM G;  3M06 A;  2LR2 A;  1U7J A;  4UHP B;  1KZU B;  5KLV K;  2B87 A;  4LLH A;  4D6T G;  1SQP G;  2JQ4 A;  1FOS F;  1SQQ K;  2FY8 A;  3GW6 A;  5KAI H;  1M8O B;  4IFM A;  4QKO A;  1ZRT E;  3G28 A;  4U0D A;  5AW1 B;  2P1J A;  4IPY A;  4WY4 A;  1X22 A;  3H1I J;  2KG6 A;  2LTE A;  3B4Q A;  3P8C D;  3KPE A;  2SPZ A;  2JU1 A;  4H2X C;  1BGY J;  2KG8 A;  2P2U A;  2AXT H;  4AUW A;  1W5C E;  4HH2 A;  2KR5 A;  3CL3 D;  3CCL P;  2BEZ F;  2KSJ A;  1RH5 B;  1KB9 D;  3AE2 C;  1PGJ A;  2EG5 A;  3C8V A;  2J5U A;  1RNI A;  1PP9 D;  3SWY A;  4QMA A;  1KMI Z;  4U3F E;  3MD0 A;  1MFZ A;  1QGK B;  1NTM D;  1YQ4 C;  1VKU A;  2G8Y A;  3DS3 A;  2H89 C;  3A2A A;  3O6Q A;  3H1J D;  4H13 B;  4COP A;  3I55 P;  3CWB D;  1SQP D;  2O01 H;  3VMA A;  5K5G B;  3WBH A;  3L72 G;  3UIA A;  1L0N E;  1JB0 J;  2IFN A;  5F2N A;  3GF7 A;  1T8Z A;  3EJE A;  2N50 A;  2XV5 A;  1SFC A;  1VQ5 P;  2BCC G;  2DW3 A;  4DJG A;  4DCK A;  1N73 C;  2CK3 H;  2N1T D;  2E74 C;  3EJD A;  2MY5 A;  1HTL C;  1PGO A;  1SQB E;  2L5G B;  1GPJ A;  2L9F A;  3U1A A;  3MZW B;  2Q7C A;  3NTE A;  1PP9 J;  4N78 E;  3G1G A;  4U3F J;  4CA3 A;  1SQX G;  1SQV E;  3SFD C;  2JR8 A;  1KV4 A;  1T3J A;  3H1L G;  3P32 A;  2FYU G;  3H1J J;  3L74 E;  5AVR B;  5M1B A;  3ZDM A;  2R44 A;  3L4F A;  3V4W A;  1PFI A;  1KQL A;  1YQ3 C;  2OYI C;  3CWB J;  1SQP J;  2YKP A;  5BVZ A;  1ZR2 A;  2MVU A;  1D7M A;  2A45 G;  3E7K A;  1EDI A;  5B66 E;  2O1J A;  2P10 A;  1OVU A;  5CBN A;  3JCU H;  3HTK B;  3KDP B;  3W68 A;  3M9H A;  2L91 A;  1EMV A;  1S9K D;  1LP1 A;  4GDO A;  1NTZ K;  1OIP A;  1LTJ A;  3KQG A;  3H1K G;  4UB8 H;  2KLV A;  1E79 H;  3RK3 B;  5KLV G;  5EJD A;  1K05 A;  3FGA D;  3OJA B;  2ZVN B;  3M1M A;  1PEU A;  3HE4 A;  3RBX A;  1FAV A;  1SQQ G;  3L35 A;  4H44 B;  1G1I A;  3ITK A;  2XND H;  5BU5 A;  2K0Y A;  2N6Z A;  1BSN A;  1YJN P;  1RF1 B;  4L74 A;  3OA7 A;  2Q9I A;  4XA4 A;  2ZYD A;  2Y9Y A;  2V7Q H;  1PEQ A; 
#chains in the Genus database with same CATH homology
 1RO0 A;  4U0B A;  4PH1 A;  2BHV A;  3VRL C;  5BS2 A;  3CPW O;  3P05 A;  3I56 P;  1YJ9 P;  3G29 A;  1VQN P;  3H0D A;  1YI2 P;  2JYG A;  1VQL P;  1QVG O;  5JPA A;  2Z44 A;  3CCM P;  4U0A A;  1VQ8 P;  2DGY A;  4XFY A;  3DPH A;  4XRO A;  3DS0 A;  1YHQ P;  1VQK P;  1A8O A;  1KQS O;  2PEO A;  3CMA P;  1K8A Q;  3CC4 P;  3NTE A;  4U0E A;  3CCQ P;  3CCJ P;  2L6E A;  3G1G A;  3G28 A;  4QNB A;  4U0D A;  4XRQ A;  1YIJ P;  1W2B O;  4IPY A;  5BS1 A;  3HZQ A;  2M8N A;  1RO2 A;  5I4T G;  1EOQ A;  1NJI Q;  1VQM P;  2PEI A;  3CME P;  2XT1 A;  4U0C A;  3H4E A;  1VQP P;  4GR2 A;  3DS5 A;  1JJ2 O;  1QVF O;  1AUM A;  2PEK A;  2P9X A;  1N8R Q;  3H47 A;  2BUO A;  1VQ6 P;  1S72 P;  2OAR A;  1PEO A;  5HGL A;  4U0F A;  3CCL P;  3CC7 P;  5HGO A;  3CXC O;  3CCR P;  2BQ1 E;  2JO0 A;  2Z46 A;  2KOD A;  3CCU P;  2XXM A;  1ZMB A;  1Q81 Q;  2EG5 A;  1VQO P;  1RNI A;  3OW2 O;  2E1M A;  2PEJ A;  1K73 Q;  3G0V A;  1BAJ A;  2PEM A;  5F2K A;  2QEX P;  3LRY A;  3G21 A;  3MGE A;  3CD6 P;  4COC A;  1M6N A;  1Q86 Q;  1PEM A;  3DS2 A;  4WYM A;  3RG6 C;  3CCE P;  1VQ4 P;  1VQ7 P;  1EIA A;  2PEQ A;  3CCV P;  1A43 A;  3DS3 A;  2M8L A;  3G6E P;  1VQ9 P;  2OTJ P;  3CCS P;  1Q82 Q;  3DS1 A;  1IUQ A;  2PEN A;  1YJW P;  2PY8 A;  3HYB A;  2JYL A;  4COP A;  4PH0 A;  1K9M Q;  2XV6 A;  3DS4 A;  1M74 A;  2OTL P;  3I55 P;  1E6J P;  4XFX A;  2EFJ A;  2CWO A;  1M90 Q;  2EIA A;  1K30 A;  3WBH A;  5F2O A;  3M1M A;  1PEU A;  2LF4 A;  2Z45 A;  1M1K Q;  3E2D A;  5F2N A;  2QA4 P;  3CC2 P;  1QRJ A;  1Q7Y Q;  3G4S P;  5HGM A;  4GR6 A;  4M0I A;  4XFZ A;  1YJN P;  1YIT P;  5DCK A;  1KC8 Q;  1KD1 Q;  1M6E X;  5HGN A;  1D1D A;  3DTJ A;  2ONT A;  1VQ5 P;  3G26 A;  3Q20 A;  3G1I A;  1PEQ A;  3G71 P;  2M8P A;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...