3CCRP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccrP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccrP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccrP02
3G4SP 3CC2P 3CCSP 1Q82Q 3CXCO 1VQLP 3CCMP 1K8AQ 3CCEP 1M1KQ 3I55P 3CMAP 3CPWO 1YJNP 1KD1Q 1NJIQ 3CC4P 1KQSO 1Q81Q 3I56P 3CD6P 2OTLP 1Q86Q 1YHQP 3CCLP 1VQ6P 1QVGO 1JJ2O 1YI2P 1K73Q 1YJ9P 1VQNP 1VQPP 1VQMP 2OTJP 3CMEP 3CCJP 1S72P 1VQ7P 2QA4P 1VQ4P 3G6EP 1K9MQ 1QVFO 1VQOP 1W2BO 3CCQP 3CC7P 1YIJP 1VQKP 1Q7YQ 3CCVP 1N8RQ 1M90Q 3G71P 3CCRP 1VQ8P 2QEXP 1VQ5P 1VQ9P 1YITP 3CCUP 1KC8Q 1YJWP 3OW2O
chains in the Genus database with same CATH superfamily
1IO4A 4GODA 1M56D 1K04A 1NTKG 2R32A 3H6PA 1L0IA 2N1TC 1BXIA 1YQ3C 1DEBA 3F5HA 5DJTB 3EJDA 2QJPC 3NTNA 2JB0A 1MKMA 3DS3A 3R2PA 3G1GA 1NU1K 3M0DC 2KZIA 1A02J 2E76D 4CA3A 3VMAA 3H4EA 1RF0A 1YTZI 1ZMEC 3CL3D 2HYNA 4H44B 2WSEJ 3AE6C 3H1HD 1A8OA 2QM7A 5KKZB 1GD2E 3IAOA 2FXOA 4IL6E 2A45H 3I55P 3L37A 1FAVA 3TGUG 1L0LG 1BGYG 3V2RA 1MUUA 2KLVA 3SFEC 2XZ0D 2C0XA 1NTMJ 1LTSC 3CWBJ 5KLVG 3M1MA 5CCHC 1N7LA 3B5NB 3O6QB 3M9QA 2QNWA 4H0LB 2KOSA 1BCCE 1G1JA 1IC2A 1KN7A 1RO2A 1IMPA 5TISE 1JY3P 2A06G 1KYOH 1P84D 1HH0A 2LXCB 3TNUB 3FX0A 3L73J 4EIJA 3RK3D 4GDOA 3H1KE 3JCUH 3H1LJ 2JU2A 3RBXA 1N7SD 1KQSO 2FYUE 1Q86Q 2WT7B 4BRYB 3A0BH 2I1KA 2N98A 2W6BA 3U59A 3B71A 1SQVG 1J1DC 1SQBK 1S3JA 1L0ND 2QJKB 3TK1A 4A7PA 3CCEP 1EZVD 2O01J 1VF5D 2LKIA 2KXPB 4U0BA 2HODB 2WWWA 5B66E 2KS1B 2PEJA 2IFMA 4L74A 3KQGA 5AVQB 2LPKA 1NTZK 3S1KA 1LP1B 3N7NA 3TSIA 3WMM0 4N78D 1JNMA 2LIWA 2OTLP 4BPHA 3PLNA 2A45G 1BE3D 1LGHB 2OARA 3CX5E 4XRQA 1NTMK 3L70E 2M5AB 1NTKJ 5E79H 1ZR4A 3AEAC 4PJ0H 5GTHH 1HUCA 5DJUB 5TJHA 1SQBD 3USSA 3WU2H 3L71E 1AA0A 1RQVA 2IBZG 1FR2A 1S72P 3C1LA 1MFZA 2AXTH 2CPBA 2LTEA 3GW6A 1P84H 1AQTA 3O6QA 4WWIA 1YJNP 3LW5J 4L73A 2E5TA 1NTZD 3P32A 1JOCA 1OVUA 4IPYA 1ZP0C 2P1JA 3E2DA 5F2KA 4HB1A 1IMQA 3TGUJ 4ASVA 1L0LJ 1BGYJ 2GA1A 3V4WA 4GKGA 4YTPC 2M3EA 3TNUA 3HYBA 1NKNA 3NFQA 2G8YA 5KJ7A 3CC2P 5AW2B 1GL2D 2OYOA 2P10A 2YNYA 1PP9E 5KLVJ 2KG9A 5DCKA 2FY8A 1SFCB 3C9IA 2KOQA 2WT7A 2Z5HA 3GLMA 3VOPA 4BRYA 4COPA 1HWTC 2QA4P 2WSFJ 4U3FG 4W80A 5BS2A 1IFMA 2YMKA 2Z5IA 2WMMA 3E1RA 1XTGB 3V5BA 2YO3A 2FYUK 3H1HG 4H44D 2K2QA 2KNCB 1A43A 3VN0A 2KORA 2PEOA 2HODA 1RQUA 3RK2B 2KS1A 1OVVA 4JQ0D 4HH2A 3W68A 2KGAA 4WB4A 3AE9C 2QSIA 1CI6A 2X2BA 1LP1A 1SQVJ 2CK3H 5CCGD 3V2PA 1KB9H 2P2UA 5KAIE 4BPGA 1SQXG 1PEMA 1ZOYC 1OIPA 2QG4A 1BDCA 1BCCD 1LTJC 3B5ND 3GJNA 4ZKPA 3CCRP 4H0LD 1G1IA 1KFNA 3A7OA 4O9BA 1R5LA 1A02F 3L74E 1ZN5A 1GXHA 2WPQA 2L9FA 1KILC 2ZAEB 1ZW0A 4PV1C 3H1KD 1S5LE 2QM8A 4NPFX 2O1KA 2FYUD 3P8CE 1SQPG 4HKGA 4AYCA 1D1DA 2PP6A 1AFOA 4QKOA 3CLQA 3IF4A 3IN6A 1M6NA 3SWKA 2Y0DA 5KLVK 2FYNB 1LTIC 5AVZB 1LTBC 4KJMA 3MZWB 1L0NG 2KOOA 4U7JA 1U7MA 1EZVG 2W6JH 2N1TB 3B5IA 4PWVB 2O3JA 3L36A 2K3RA 2KR5A 2VLPA 1WT6A 3D6ZA 3G28A 2QJPB 1GPJA 2IPPA 2NZ2A 2PRRA 4JYBA 2ZXEB 3IFMA 4UB6E 3Q2YA 2H43A 2FQ0A 2J59M 2M8RA 4KT0J 1SFCA 2RH0A 2HG5D 3M0AA 1LTTC 1OW6A 1BE3G 4IL6H 1M6EX 2YXRB 1EMVA 1J2JB 5AW5B 3CX5D 3L70D 4U0DA 1SQVK 1M7LA 4I1LA 1CZQA 2H89C 1R5SA 2KNCA 2KGDA 2GYKA 3H0DA 1NU1E 3M06A 3CCUP 3H47A 2MY5A 2PEMA 3L71D 5AW1B 3CCSP 3KXDA 1MFTA 4UB8E 3LMOA 1HY8A 4U3FJ 2Y9YA 2V7QH 1SS1A 2KZJA 3CXHE 2CNRA 5F2NA 3D6YA 2G3AA 1E5WA 1SQQE 3H1HJ 1SVFA 2P58A 1YBKA 5APXA 1IFDA 3MIWA 1OR5A 2J5UA 3Q3DA 1VF5B 3CCLP 3A0HE 1JMMA 2FHSC 3GMAA 1PP9D 1S9KE 2BCCE 2B88A 1IZNB 2KSJA 4OGQD 2NRGA 4LC1A 1SQXJ 2N6YA 4LGDE 1VQLP 2IZ1A 2OGUA 1J1DB 1FJPA 1SFCD 2W8ZA 4C7RA 4K35A 3EWKA 2M5RA 5AVWB 1L0HA 4ZMDA 2Z45A 1RE4A 1VQ4P 3V4QA 2KYVA 1URQC 2FYZA 2MR8A 3VP9A 2N1TA 4YPCA 3KDPB 3Q1MA 2WTYA 1OVRA 2AFEA 2GDXA 1DX7A 5EFWB 3RK2D 1OW7A 1H88A 4PXHB 2E75C 1SQPJ 2L6EA 3ABVC 3CX5H 3EJEA 1T6AA 3G6EP 1Y9BA 1GK6A 3AE3C 4DOJA 1U57A 2ZT9C 1NGMB 4BPFA 1L0NJ 1KD1Q 3FXDA 2ZVNB 4OH8B 1TU3F 1FOSE 1MV8A 3CXHI 2N50A 2BQ1E 2LMLA 2ERHA 1PZQA 2IDBA 3ITKA 1CEIA 1PGJA 2R5BA 5CZDB 2W83C 3GG2A 3RL0g 3S9OA 1LT9C 3A3YB 1GL2B 2KLUA 3KZIE 2O1JA 1LWUB 3P8CD 4XFZA 4WY4D 1N7SA 1VQPP 1H8AA 1BE3J 2IFNA 1QLED 3VP8A 1ZRTE 5H2FE 3AE2C 1NTME 1Z56A 1S4XA 3CWBE 2XNXA 2KW2A 3G71P 2B9BA 1VL2A 3L72E 2QVAA 2Q3IA 2J58A 3VMXA 4EYYQ 1FU1A 1SQXK 3G9RA 1UNKA 3O8ZA 2R5DA 3OA7A 1FZAA 2BEZF 3PP5A 2ZYGA 3Q5SA 3A2AA 1PL5A 2N1TD 1IFIA 3M91A 5AW4B 3U1AA 1SQQK 2AVAA 2LF4A 2FVAA 1Y47A 1LTGC 3H1LE 1KORA 1LJ2A 4DZOA 3PTZA 4D6TD 2R3CA 3F89A 3WUUA 1SQPK 5JPAA 2XT1A 2E1MA 4PD4H 2QEXP 2KOGA 1HGVA 3L70G 2AXCA 2FVFA 1FDOA 4TT3H 1PFIA 3HD7C 5CBNA 2KSEA 3TDKA 2QRXA 1QVGO 1S2EA 5BU5A 1NU1D 3UIAA 2DGYA 1K9MQ 2PY8A 1T8KA 3DTJA 3CMEP 5CCHD 5KAFH 2M8LA 1LTJB 3CXHD 3BCCG 2NO8A 2D2CC 2WSSH 2QE7H 4GOEA 1X9VA 4K3AA 3RL0C 4HJGH 5APTA 5K5GB 3HE5B 1S5LH 4JF7A 1BSHA 1JTHB 1KV4A 5APVA 2N6ZA 2JEEA 1NTKE 3AEEC 4B86A 5KLIB 3L4FA 1NYHA 1JY2O 1H89A 3CCMP 1KILE 1E79H 1IFNA 1S9KD 1PP9G 1YI2P 1GL2A 1FZCC 1Y8AA 3TYYA 1EIAA 1LWUA 3A5TA 3VMZA 2GZIA 1VQKP 2P7JA 3G4SP 4GT1A 2V7QJ 3AE1C 2JWDA 3MUDC 1LNQA 4YXWH 4QNBA 3M9BA 5BS1A 2L22A 2HPCB 3CCQP 5AVTB 3TGUE 2MVVA 3CE7A 1BGYE 2EHTA 1L0LE 3GHGC 4KHXA 3N4XA 1T2KC 2KWLA 3S4RA 1OFCX 5KLVE 5AW8B 3NMDA 1GK4A 5CCGA 2K92A 5B5EE 4AQRD 1HVVA 4H13C 1DIPA 2A06E 3B5NA 4UB8H 5AVUB 4QMAA 2SPZA 3D71A 1BAJA 3OJAB 1JM0A 2MKVA 4GR2A 2ONTA 3H1IE 5AVXB 1JUNA 5APUA 2VSQA 1RF1B 4IZ6A 2M0BA 1M57D 3PJSK 2FFDB 1KZUB 4OGQB 1W2EA 4BWNA 1NTMD 1PGPA 1OX3A 1LTJA 3AEBC 1SQVE 3MHVA 1GMJA 2HLOA 5M1BA 4AUWA 3A0HH 3L70J 3L72D 2VLQA 2GZGA 1F80D 3HE5A 1JTHA 2O01N 4N3YB 1L4AC 2PFXA 3EFGA 2JO1A 4U0CA 2KB7P 1UIXA 2PEQA 2I8DA 3HUSC 2OQQA 1GDTA 3BCCJ 3DS4A 1NTKK 2ZJSE 1Q90D 1VQ9P 3WUTA 4WVZA 1PIXA 4D6TG 2JWAA 2Z4EA 3W67A 1D7MA 1E0HA 1PGQA 3G3ZA 2LR2A 7CEIA 1IFJA 1JJ2O 2ZFCA 2OYIB 1RE3C 1M1JC 2Y0EA 1JY2N 1CSBA 3BASA 3MTUE 5AW7B 4IOIH 1M90Q 2E74C 2KODA 4U0EA 2M5AA 1NO4A 1PP9J 2XZRA 2ZXXA 3VYIA 2K1AA 2IBZE 3E1IA 3PHLA 1HBWA 4XE5B 5KJ7C 2W90A 3G1IA 1SLQA 2ZT9B 4DT0A 1RY3A 3NTEA 1AJYA 4L75A 4WY4B 2AEJA 2QJYB 4JPZB 1PGOA 2GZFA 1L0LK 1E6JP 1GW4A 1USEA 2OTKE 2PEIA 5GTIE 3CC4P 2CQ8A 2NPSC 3SFDC 2ROQA 3G26A 3G21A 2QJKC 3DS5A 1S1CX 2JP3A 3H1JE 4IFDK 1KILD 1LT9B 4PV1D 2K9YA 3SSUA 2FACA 1IFPA 3AEFC 2JO0A 1RF1A 2WZ7A 3LIEA 2PEKA 2FFDA 1Q81Q 4H2YC 4W7ZA 3L75E 1NVOA 1KTMA 4U3FE 3BATA 1NH4A 5KP6B 1Q2NA 4Y99C 1KFMA 3T97B 1RH5B 1LTAC 2EHSA 1J1EC 2M8NA 2EFJA 2IZ0A 3FWNA 2A45I 3VTPC 1H0TB 1FC2C 1LT1A 1EC5A 4RO0A 2YIUC 1N73C 5CMZA 3EJBA 1N86A 1BGYD 1ZNVA 1AV1A 2LKMA 2Z46A 5E79E 5GTHE 1OXZA 1GW3A 1VQ8P 4MN4C 5KLVD 3AE8C 2K0YA 4R0MA 1SQBG 2L4BA 2YKQA 1K8AQ 3G0VA 5APWA 2IBZI 1SQXE 2YMYA 5BU8B 3P05A 3FWLA 1HJ0A 3WU2E 1KYOI 3Q5PA 5TISH 2JKVA 1NKZB 3M9HA 2PGDA 3BRTB 2GZJA 3HD7B 1T3UA 2OYIA 2A06D 4H2WC 3GKLC 1P84E 2JYLA 1PV3A 3VRLC 2WSCH 3WBHA 4JBZA 2FQ1A 3CPWO 2C0WA 2PENA 1NTZG 3H1ID 2QIWA 4EI2A 1ZLLA 5APYA 5AVVB 2WITA 2EIAA 4D6TJ 1SQPE 3MP7B 2D2CB 1Q7YQ 4WY4A 1SQVD 1BSNA 5F2OA 2WQYC 2DNWA 2XZ1C 3L72G 3SWYA 2HR3A 1NAFA 1PEQA 3RBZA 3BVHA 5B66H 1EZVE 1RHZB 1GU4A 3V2QA 2Y0CA 2M8PA 3HTKB 1LT9A 2GUVA 2Q7CA 1FZCB 1YITP 1BDDA 3K5BA 1OMIA 1UJZA 1AUMA 1QRJA 4NPEA 2Q1KA 3GF7A 2LOLA 2CGQA 4L76A 1VQ6P 2FXMA 3P7KA 1R8EA 5KP7B 1X22A 3M0DA 1JY2P 1QVFO 1BE3E 3HRNA 1RNIA 4WBAA 5HGLA 2LL8A 3T97A 2FBWC 1VKUA 3NY7B 1URQD 4I7ZC 1OW8A 2JAZA 1FE6A 2B87B 1H0TA 1KB9E 5AVYB 3JSVC 2GDYA 3AECC 1X3OA 1BCCG 4PH1A 3OAKA 3GHGB 2N5IA 2KI7B 1AQ5A 1NWQA 1AVYA 3L74D 5B5EH 2E75D 2IBZD 3FGAD 1N8RQ 2R44A 5AVRB 3AE5C 1P84I 1M74A 4EDFA 4R4MA 1X8YA 2ZVOB 3H25A 2FAEA 3MGEA 4U0AA 3H1KG 2ZT9D 1GU5A 1NHLA 5CCHA 3GF3A 1XTCC 2KG8A 5BVZA 2FYUG 2P9XA 1EDJA 4Y28J 2E76C 2WPTA 3NXSA 3HD7A 1KQLA 4RESB 1KQGB 2GM4A 3JC22 2BEQD 1HGZA 4DCKA 3SWFA 1CW5A 3PH0A 2DW3A 3H1JD 1DNYA 1GZLA 2GUSA 4ASWA 2KIKA 2GDWA 2YKPA 1EZVI 1YTZT 3TF5A 1VQMP 1SQBJ 4N6JA 5I4TG 1EXJA 2R3SA 3KHUA 1Z6MA 2AEFA 3BRVB 4RKUJ 1WMKA 3L75D 2BHVA 2OYHC 3L73E 4U3FD 3AEGC 4I2LC 1X0TA 1EOQA 3LRYA 3V6IA 2K0XA 1L4AB 1L2PA 3E7KA 1GXGA 2UWJE 4LLHA 2E43A 4DG9A 2C9NY 1KLPA 3CC7P 2LXBA 1NTZJ 2JGPA 2AF8A 3L35A 2JBGA 3HTKA 1Q82Q 3HUSB 1FZCA 5AW0B 5APQA 1NAYA 1KB9I 1NJIQ 1VPCA 1L0NK 5KAIH 3RK3C 1DD3A 1ZMBA 2M3BA 3L72J 3L71G 1AF8A 1SQXD 1FJKA 4COCA 1N7SC 3MUDA 4PH0A 1M1JB 1EDLA 1NOHA 2E74B 1SQQD 2B87A 1YJ9P 1EQ7A 3HD7D 1RF0C 1PPJE 2ZYDA 3GHGA 5CBOA 3DS2A 3U43A 1DV5A 2E42A 2XKMA 1VF5C 1KILB 4IFMA 4PV1B 1KC8Q 3H1IG 1FDIA 2I1JA 5GTIH 1SQPD 2K88A 1QL1A 1JO5A 2Q9IA 1U7JA 3RG6C 2BCCD 2AFDA 3U1CA 2D2CD 5HGMA 2MF4A 2Q5UA 3RL0D 1DD4A 4ZKUA 2NPSB 4C7NB 1BCCJ 2XXMA 1ZV8A 1FZFA 1IUQA 4RJTA 3HZQA 2L5GB 4Z1MH 2BUOA 1EDKA 3II6A 4UB6H 2FQ2A 3PRJA 1VQ7P 2JR8A 4IL6X 5EW5E 1CI6B 2WSCJ 3H1KJ 2MVUA 1IJDB 2N5HA 3B4SA 3GZLA 2FYUJ 1M1KQ 4Y99B 2K93A 2CPSA 3B4QA 1T3JA 3R4YA 2Q3EA 1J1EB 1YHQP 2MJZA 2XV5A 4I6MC 1L4AA 4W7YA 1ZR2A 1GTWA 4F37A 2YIUB 1N73B 1UIIA 1VQOP 2CG5B 4DJGA 1KB9D 1JCDA 2L0QA 2K9JB 3CD6P 1QL2A 2K5XA 1IK7A 2VLOA 2KG6A 3HUSA 1MZ8A 2YXQB 3L74G 2VRSA 1T2KD 4OVNF 3CXHH 1HF9A 1WRGA 2FADA 1GL2C 3MD0A 1LWUC 3BCCE 4OWFA 5HV8A 1FBMA 3G29A 3H32B 1RE3A 1M1JA 5CJ4A 4H13D 1ZRTD 3CWBD 1EXIA 1T8ZA 2OTJP 3LIDA 2YO2A 2KP8A 2JDIH 1FS0E 3H1JG 1ACPA 4WYMA 1KQFB 5AVSB 3B8EB 4H44C 1KILA 3CXCO 3CMAP 1YYCA 4YXDC 2PNGA 3L71J 5KKZC 2POHA 3GZMA 5C39A 1VDFA 4HKZH 3L73D 1JCCA 3L75G 4NEOA 1JY3O 2MR7A 3H1LD 3ZDMA 3MGNA 1YQ4C 2VLNA 1RO0A 2XV6A 5CCGC 2NPSA 1JB0J 1AYIA 4C7NA 1OZHA 1URQB 1L4AD 3EFFK 1G2CB 3HE4B 3B5NC 2AEMA 4CPGA 3AEDC 3CX5I 2H8PD 3H1IJ 4H0LC 5HGOA 2V4HA 4PD4E 2ITAA 3QWOC 2CWOA 2WPRA 5KTBA 4EOTA 2HPCA 1NQ4A 2E75B 2N9BA 2IX7C 1NU1G 2KGCA 4R4LA 1X79B 1MZ9A 1KYOE 2MD9A 4I7ZB 2JQ4A 5HGNA 3IR9A 2WSEH 3FXEA 4MRTC 2H88C 1N73A 3DS0A 3JCUE 5KAFE 1SQQG 2WPVB 2W27A 2K9JA 2E74D 1PPJD 3Q5RA 2YKOA 4C46A 2Y9ZA 3A0BE 5KLIC 1FOSF 3KZIH 1NTKD 4XFJA 1KMIZ 5KJ7D 4TLFA 4IFFA 5H2FH 2FKWB 2E5YA 2H7HA 1K73Q 4M3LA 3AE4C 4U0FA 2BCCG 2E76B 1AVOA 3WUVA 3H32A 1HJBA 2Q6QA 2NPSD 4UHPB 4GOFA 4GIFA 4H2XC 3L74J 3H1HE 2BASA 1PEUA 1QGKB 3I56P 2IYOA 2XNDH 2OYHB 1DEEG 3RG2A 1FDMA 1IK9A 4HYTB 3TGUD 1L0LD 2RKLA 4PD4I 5KP8B 5AW9B 4D6TE 4PJ0E 1PEOA 2KUBA 3CI9A 3OW2O 2Z44A 4NPDA 4XROA 4XFYA 2FVEA 3QH9A 2P67A 2ZYAA 3DS1A 1ZXGA 2O01H 5AW3B 3H1JJ 2WVRA 1URQA 2WPSA 1G2CA 1JEKA 3HE4A 2RN0A 2AXTE 4M0IA 4XFXA 4JYCA 2JU1A 1VHNA 1W2BO 3RK3B 5HVCA 2IYPA 3L75J 3KPEA 2W6AA 1S5LX 3Q20A 2KGEA 1N7SB 3RK3E 5AW6B 3P8MC 1RF1C 1JY3N 3EQ2A 3RGUA 2PAJA 3BCCD 2FFDC 2B89A 4OGQC 5CJ0A 1K30A 1YIJP 2K0DX 3RL0B 5APSA 1SFCC 1NTMG 3CCVP 3CWBG 2C9LY 2RMZA 4GR6A 1L0NE 3I5CA 1VQNP 1OWAA 1NU1J 3V2NA 3DPHA 1SP4A 1VQ5P 2KOPA 1W5CE 2XDJA 3RK2C 2JYGA 3L73G 1USDA 1FZGA 3LW5H 3H1LG 1N2DC 2JJLA 4N78E 1SQQJ 3CCJP 1FZEA 3D70A 3KYQA 2OYIC 1JMBA 1FZBA 2EG5A 4XA4A 3C8VA 2L91A 4PD4D 1HQBA 2XU6A 5CHXA 1K05A 1DH3A 2FXPA 1EDIA 2N9YB 2OYHA 2HFED 2BCCJ 5L8RJ 1QEXA 1SQBE 2WSFH 1YJWP 1KYOD 1HTLC 4WY4C 2QJYC 4H13B 1M8OB 2KK7A 2K94A 2LIUA 4BXLA 3VMYA 4ZNCA 3AE7C 2K37A 2GZEA 1PPJG 5EJDA 1QX8A 2FYNC 1NTZE 1RE4C
chains in the Genus database with same CATH topology
2PEMA 1IUQA 1AUMA 3CCSP 1QRJA 4U0FA 3CXCO 3HZQA 3CMAP 1YJNP 1KD1Q 1KQSO 2BUOA 1EOQA 1Q86Q 3LRYA 4GR6A 1VQ6P 1QVGO 1JJ2O 1VQNP 2DGYA 4IPYA 1VQ7P 3E2DA 2Z46A 2BQ1E 5F2NA 5F2KA 1K9MQ 1QVFO 2PY8A 3CC7P 3DS3A 1M90Q 1VQ8P 3DPHA 3G1GA 1RNIA 2KODA 1RO0A 2XV6A 4U0EA 3DTJA 5HGLA 1VQ5P 3HYBA 3CMEP 1D1DA 3CC2P 1Q82Q 3CCEP 1PEUA 1K8AQ 1M1KQ 1M6NA 2M8LA 3G0VA 2JYGA 1NJIQ 3H4EA 3I56P 4U0BA 3P05A 1YHQP 3CCLP 1BAJA 3G1IA 5DCKA 4PH1A 4XFZA 1K73Q 1VQPP 3NTEA 4COPA 5HGOA 4GR2A 2ONTA 3CCJP 2QA4P 1ZMBA 1A8OA 2PEJA 2CWOA 1VQOP 1N8RQ 3B5IA 4COCA 3G71P 1PEOA 5BS2A 1M74A 1E6JP 4PH0A 3CD6P 2JYLA 3OW2O 3VRLC 2Z44A 3WBHA 4XROA 2EG5A 3G28A 4XFYA 2PEIA 3MGEA 3CCMP 1VQLP 3I55P 3CPWO 2PENA 3CC4P 4U0AA 2OTLP 3DS1A 1A43A 3G26A 3G21A 2PEOA 1YI2P 1YJ9P 3DS5A 1EIAA 2P9XA 2Z45A 2OARA 2EIAA 4XRQA 5HGNA 3DS2A 1VQ4P 4M0IA 3M1MA 1VQKP 1Q7YQ 4XFXA 3DS0A 1YITP 1KC8Q 5F2OA 1YJWP 1W2BO 3G4SP 2JO0A 2LF4A 1M6EX 3G29A 2PEKA 3Q20A 4U0CA 1Q81Q 4U0DA 1RO2A 1PEQA 4QNBA 3RG6C 5BS1A 2PEQA 1PEMA 1VQMP 2OTJP 2L6EA 5HGMA 5JPAA 2XT1A 2E1MA 1S72P 3H0DA 3G6EP 1K30A 5I4TG 3CCQP 1YIJP 2M8PA 3DS4A 3CCRP 2QEXP 2M8NA 2EFJA 1VQ9P 4WYMA 2BHVA 3CCUP 2XXMA 3CCVP 3H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S P;  3CC2 P;  3CCS P;  1Q82 Q;  3CXC O;  1VQL P;  3CCM P;  1K8A Q;  3CCE P;  1M1K Q;  3I55 P;  3CMA P;  3CPW O;  1YJN P;  1KD1 Q;  1NJI Q;  3CC4 P;  1KQS O;  1Q81 Q;  3I56 P;  3CD6 P;  2OTL P;  1Q86 Q;  1YHQ P;  3CCL P;  1VQ6 P;  1QVG O;  1JJ2 O;  1YI2 P;  1K73 Q;  1YJ9 P;  1VQN P;  1VQP P;  1VQM P;  2OTJ P;  3CME P;  3CCJ P;  1S72 P;  1VQ7 P;  2QA4 P;  1VQ4 P;  3G6E P;  1K9M Q;  1QVF O;  1VQO P;  1W2B O;  3CCQ P;  3CC7 P;  1YIJ P;  1VQK P;  1Q7Y Q;  3CCV P;  1N8R Q;  1M90 Q;  3G71 P;  3CCR P;  1VQ8 P;  2QEX P;  1VQ5 P;  1VQ9 P;  1YIT P;  3CCU P;  1KC8 Q;  1YJW P;  3OW2 O; 
#chains in the Genus database with same CATH topology
 1IO4 A;  4GOD A;  1M56 D;  1K04 A;  1NTK G;  2R32 A;  3H6P A;  1L0I A;  2N1T C;  1BXI A;  1YQ3 C;  1DEB A;  3F5H A;  5DJT B;  3EJD A;  2QJP C;  3NTN A;  2JB0 A;  1MKM A;  3DS3 A;  3R2P A;  3G1G A;  1NU1 K;  3M0D C;  2KZI A;  1A02 J;  2E76 D;  4CA3 A;  3VMA A;  3H4E A;  1RF0 A;  1YTZ I;  1ZME C;  3CL3 D;  2HYN A;  4H44 B;  2WSE J;  3AE6 C;  3H1H D;  1A8O A;  2QM7 A;  5KKZ B;  1GD2 E;  3IAO A;  2FXO A;  4IL6 E;  2A45 H;  3I55 P;  3L37 A;  1FAV A;  3TGU G;  1L0L G;  1BGY G;  3V2R A;  1MUU A;  2KLV A;  3SFE C;  2XZ0 D;  2C0X A;  1NTM J;  1LTS C;  3CWB J;  5KLV G;  3M1M A;  5CCH C;  1N7L A;  3B5N B;  3O6Q B;  3M9Q A;  2QNW A;  4H0L B;  2KOS A;  1BCC E;  1G1J A;  1IC2 A;  1KN7 A;  1RO2 A;  1IMP A;  5TIS E;  1JY3 P;  2A06 G;  1KYO H;  1P84 D;  1HH0 A;  2LXC B;  3TNU B;  3FX0 A;  3L73 J;  4EIJ A;  3RK3 D;  4GDO A;  3H1K E;  3JCU H;  3H1L J;  2JU2 A;  3RBX A;  1N7S D;  1KQS O;  2FYU E;  1Q86 Q;  2WT7 B;  4BRY B;  3A0B H;  2I1K A;  2N98 A;  2W6B A;  3U59 A;  3B71 A;  1SQV G;  1J1D C;  1SQB K;  1S3J A;  1L0N D;  2QJK B;  3TK1 A;  4A7P A;  3CCE P;  1EZV D;  2O01 J;  1VF5 D;  2LKI A;  2KXP B;  4U0B A;  2HOD B;  2WWW A;  5B66 E;  2KS1 B;  2PEJ A;  2IFM A;  4L74 A;  3KQG A;  5AVQ B;  2LPK A;  1NTZ K;  3S1K A;  1LP1 B;  3N7N A;  3TSI A;  3WMM 0;  4N78 D;  1JNM A;  2LIW A;  2OTL P;  4BPH A;  3PLN A;  2A45 G;  1BE3 D;  1LGH B;  2OAR A;  3CX5 E;  4XRQ A;  1NTM K;  3L70 E;  2M5A B;  1NTK J;  5E79 H;  1ZR4 A;  3AEA C;  4PJ0 H;  5GTH H;  1HUC A;  5DJU B;  5TJH A;  1SQB D;  3USS A;  3WU2 H;  3L71 E;  1AA0 A;  1RQV A;  2IBZ G;  1FR2 A;  1S72 P;  3C1L A;  1MFZ A;  2AXT H;  2CPB A;  2LTE A;  3GW6 A;  1P84 H;  1AQT A;  3O6Q A;  4WWI A;  1YJN P;  3LW5 J;  4L73 A;  2E5T A;  1NTZ D;  3P32 A;  1JOC A;  1OVU A;  4IPY A;  1ZP0 C;  2P1J A;  3E2D A;  5F2K A;  4HB1 A;  1IMQ A;  3TGU J;  4ASV A;  1L0L J;  1BGY J;  2GA1 A;  3V4W A;  4GKG A;  4YTP C;  2M3E A;  3TNU A;  3HYB A;  1NKN A;  3NFQ A;  2G8Y A;  5KJ7 A;  3CC2 P;  5AW2 B;  1GL2 D;  2OYO A;  2P10 A;  2YNY A;  1PP9 E;  5KLV J;  2KG9 A;  5DCK A;  2FY8 A;  1SFC B;  3C9I A;  2KOQ A;  2WT7 A;  2Z5H A;  3GLM A;  3VOP A;  4BRY A;  4COP A;  1HWT C;  2QA4 P;  2WSF J;  4U3F G;  4W80 A;  5BS2 A;  1IFM A;  2YMK A;  2Z5I A;  2WMM A;  3E1R A;  1XTG B;  3V5B A;  2YO3 A;  2FYU K;  3H1H G;  4H44 D;  2K2Q A;  2KNC B;  1A43 A;  3VN0 A;  2KOR A;  2PEO A;  2HOD A;  1RQU A;  3RK2 B;  2KS1 A;  1OVV A;  4JQ0 D;  4HH2 A;  3W68 A;  2KGA A;  4WB4 A;  3AE9 C;  2QSI A;  1CI6 A;  2X2B A;  1LP1 A;  1SQV J;  2CK3 H;  5CCG D;  3V2P A;  1KB9 H;  2P2U A;  5KAI E;  4BPG A;  1SQX G;  1PEM A;  1ZOY C;  1OIP A;  2QG4 A;  1BDC A;  1BCC D;  1LTJ C;  3B5N D;  3GJN A;  4ZKP A;  3CCR P;  4H0L D;  1G1I A;  1KFN A;  3A7O A;  4O9B A;  1R5L A;  1A02 F;  3L74 E;  1ZN5 A;  1GXH A;  2WPQ A;  2L9F A;  1KIL C;  2ZAE B;  1ZW0 A;  4PV1 C;  3H1K D;  1S5L E;  2QM8 A;  4NPF X;  2O1K A;  2FYU D;  3P8C E;  1SQP G;  4HKG A;  4AYC A;  1D1D A;  2PP6 A;  1AFO A;  4QKO A;  3CLQ A;  3IF4 A;  3IN6 A;  1M6N A;  3SWK A;  2Y0D A;  5KLV K;  2FYN B;  1LTI C;  5AVZ B;  1LTB C;  4KJM A;  3MZW B;  1L0N G;  2KOO A;  4U7J A;  1U7M A;  1EZV G;  2W6J H;  2N1T B;  3B5I A;  4PWV B;  2O3J A;  3L36 A;  2K3R A;  2KR5 A;  2VLP A;  1WT6 A;  3D6Z A;  3G28 A;  2QJP B;  1GPJ A;  2IPP A;  2NZ2 A;  2PRR A;  4JYB A;  2ZXE B;  3IFM A;  4UB6 E;  3Q2Y A;  2H43 A;  2FQ0 A;  2J59 M;  2M8R A;  4KT0 J;  1SFC A;  2RH0 A;  2HG5 D;  3M0A A;  1LTT C;  1OW6 A;  1BE3 G;  4IL6 H;  1M6E X;  2YXR B;  1EMV A;  1J2J B;  5AW5 B;  3CX5 D;  3L70 D;  4U0D A;  1SQV K;  1M7L A;  4I1L A;  1CZQ A;  2H89 C;  1R5S A;  2KNC A;  2KGD A;  2GYK A;  3H0D A;  1NU1 E;  3M06 A;  3CCU P;  3H47 A;  2MY5 A;  2PEM A;  3L71 D;  5AW1 B;  3CCS P;  3KXD A;  1MFT A;  4UB8 E;  3LMO A;  1HY8 A;  4U3F J;  2Y9Y A;  2V7Q H;  1SS1 A;  2KZJ A;  3CXH E;  2CNR A;  5F2N A;  3D6Y A;  2G3A A;  1E5W A;  1SQQ E;  3H1H J;  1SVF A;  2P58 A;  1YBK A;  5APX A;  1IFD A;  3MIW A;  1OR5 A;  2J5U A;  3Q3D A;  1VF5 B;  3CCL P;  3A0H E;  1JMM A;  2FHS C;  3GMA A;  1PP9 D;  1S9K E;  2BCC E;  2B88 A;  1IZN B;  2KSJ A;  4OGQ D;  2NRG A;  4LC1 A;  1SQX J;  2N6Y A;  4LGD E;  1VQL P;  2IZ1 A;  2OGU A;  1J1D B;  1FJP A;  1SFC D;  2W8Z A;  4C7R A;  4K35 A;  3EWK A;  2M5R A;  5AVW B;  1L0H A;  4ZMD A;  2Z45 A;  1RE4 A;  1VQ4 P;  3V4Q A;  2KYV A;  1URQ C;  2FYZ A;  2MR8 A;  3VP9 A;  2N1T A;  4YPC A;  3KDP B;  3Q1M A;  2WTY A;  1OVR A;  2AFE A;  2GDX A;  1DX7 A;  5EFW B;  3RK2 D;  1OW7 A;  1H88 A;  4PXH B;  2E75 C;  1SQP J;  2L6E A;  3ABV C;  3CX5 H;  3EJE A;  1T6A A;  3G6E P;  1Y9B A;  1GK6 A;  3AE3 C;  4DOJ A;  1U57 A;  2ZT9 C;  1NGM B;  4BPF A;  1L0N J;  1KD1 Q;  3FXD A;  2ZVN B;  4OH8 B;  1TU3 F;  1FOS E;  1MV8 A;  3CXH I;  2N50 A;  2BQ1 E;  2LML A;  2ERH A;  1PZQ A;  2IDB A;  3ITK A;  1CEI A;  1PGJ A;  2R5B A;  5CZD B;  2W83 C;  3GG2 A;  3RL0 g;  3S9O A;  1LT9 C;  3A3Y B;  1GL2 B;  2KLU A;  3KZI E;  2O1J A;  1LWU B;  3P8C D;  4XFZ A;  4WY4 D;  1N7S A;  1VQP P;  1H8A A;  1BE3 J;  2IFN A;  1QLE D;  3VP8 A;  1ZRT E;  5H2F E;  3AE2 C;  1NTM E;  1Z56 A;  1S4X A;  3CWB E;  2XNX A;  2KW2 A;  3G71 P;  2B9B A;  1VL2 A;  3L72 E;  2QVA A;  2Q3I A;  2J58 A;  3VMX A;  4EYY Q;  1FU1 A;  1SQX K;  3G9R A;  1UNK A;  3O8Z A;  2R5D A;  3OA7 A;  1FZA A;  2BEZ F;  3PP5 A;  2ZYG A;  3Q5S A;  3A2A A;  1PL5 A;  2N1T D;  1IFI A;  3M91 A;  5AW4 B;  3U1A A;  1SQQ K;  2AVA A;  2LF4 A;  2FVA A;  1Y47 A;  1LTG C;  3H1L E;  1KOR A;  1LJ2 A;  4DZO A;  3PTZ A;  4D6T D;  2R3C A;  3F89 A;  3WUU A;  1SQP K;  5JPA A;  2XT1 A;  2E1M A;  4PD4 H;  2QEX P;  2KOG A;  1HGV A;  3L70 G;  2AXC A;  2FVF A;  1FDO A;  4TT3 H;  1PFI A;  3HD7 C;  5CBN A;  2KSE A;  3TDK A;  2QRX A;  1QVG O;  1S2E A;  5BU5 A;  1NU1 D;  3UIA A;  2DGY A;  1K9M Q;  2PY8 A;  1T8K A;  3DTJ A;  3CME P;  5CCH D;  5KAF H;  2M8L A;  1LTJ B;  3CXH D;  3BCC G;  2NO8 A;  2D2C C;  2WSS H;  2QE7 H;  4GOE A;  1X9V A;  4K3A A;  3RL0 C;  4HJG H;  5APT A;  5K5G B;  3HE5 B;  1S5L H;  4JF7 A;  1BSH A;  1JTH B;  1KV4 A;  5APV A;  2N6Z A;  2JEE A;  1NTK E;  3AEE C;  4B86 A;  5KLI B;  3L4F A;  1NYH A;  1JY2 O;  1H89 A;  3CCM P;  1KIL E;  1E79 H;  1IFN A;  1S9K D;  1PP9 G;  1YI2 P;  1GL2 A;  1FZC C;  1Y8A A;  3TYY A;  1EIA A;  1LWU A;  3A5T A;  3VMZ A;  2GZI A;  1VQK P;  2P7J A;  3G4S P;  4GT1 A;  2V7Q J;  3AE1 C;  2JWD A;  3MUD C;  1LNQ A;  4YXW H;  4QNB A;  3M9B A;  5BS1 A;  2L22 A;  2HPC B;  3CCQ P;  5AVT B;  3TGU E;  2MVV A;  3CE7 A;  1BGY E;  2EHT A;  1L0L E;  3GHG C;  4KHX A;  3N4X A;  1T2K C;  2KWL A;  3S4R A;  1OFC X;  5KLV E;  5AW8 B;  3NMD A;  1GK4 A;  5CCG A;  2K92 A;  5B5E E;  4AQR D;  1HVV A;  4H13 C;  1DIP A;  2A06 E;  3B5N A;  4UB8 H;  5AVU B;  4QMA A;  2SPZ A;  3D71 A;  1BAJ A;  3OJA B;  1JM0 A;  2MKV A;  4GR2 A;  2ONT A;  3H1I E;  5AVX B;  1JUN A;  5APU A;  2VSQ A;  1RF1 B;  4IZ6 A;  2M0B A;  1M57 D;  3PJS K;  2FFD B;  1KZU B;  4OGQ B;  1W2E A;  4BWN A;  1NTM D;  1PGP A;  1OX3 A;  1LTJ A;  3AEB C;  1SQV E;  3MHV A;  1GMJ A;  2HLO A;  5M1B A;  4AUW A;  3A0H H;  3L70 J;  3L72 D;  2VLQ A;  2GZG A;  1F80 D;  3HE5 A;  1JTH A;  2O01 N;  4N3Y B;  1L4A C;  2PFX A;  3EFG A;  2JO1 A;  4U0C A;  2KB7 P;  1UIX A;  2PEQ A;  2I8D A;  3HUS C;  2OQQ A;  1GDT A;  3BCC J;  3DS4 A;  1NTK K;  2ZJS E;  1Q90 D;  1VQ9 P;  3WUT A;  4WVZ A;  1PIX A;  4D6T G;  2JWA A;  2Z4E A;  3W67 A;  1D7M A;  1E0H A;  1PGQ A;  3G3Z A;  2LR2 A;  7CEI A;  1IFJ A;  1JJ2 O;  2ZFC A;  2OYI B;  1RE3 C;  1M1J C;  2Y0E A;  1JY2 N;  1CSB A;  3BAS A;  3MTU E;  5AW7 B;  4IOI H;  1M90 Q;  2E74 C;  2KOD A;  4U0E A;  2M5A A;  1NO4 A;  1PP9 J;  2XZR A;  2ZXX A;  3VYI A;  2K1A A;  2IBZ E;  3E1I A;  3PHL A;  1HBW A;  4XE5 B;  5KJ7 C;  2W90 A;  3G1I A;  1SLQ A;  2ZT9 B;  4DT0 A;  1RY3 A;  3NTE A;  1AJY A;  4L75 A;  4WY4 B;  2AEJ A;  2QJY B;  4JPZ B;  1PGO A;  2GZF A;  1L0L K;  1E6J P;  1GW4 A;  1USE A;  2OTK E;  2PEI A;  5GTI E;  3CC4 P;  2CQ8 A;  2NPS C;  3SFD C;  2ROQ A;  3G26 A;  3G21 A;  2QJK C;  3DS5 A;  1S1C X;  2JP3 A;  3H1J E;  4IFD K;  1KIL D;  1LT9 B;  4PV1 D;  2K9Y A;  3SSU A;  2FAC A;  1IFP A;  3AEF C;  2JO0 A;  1RF1 A;  2WZ7 A;  3LIE A;  2PEK A;  2FFD A;  1Q81 Q;  4H2Y C;  4W7Z A;  3L75 E;  1NVO A;  1KTM A;  4U3F E;  3BAT A;  1NH4 A;  5KP6 B;  1Q2N A;  4Y99 C;  1KFM A;  3T97 B;  1RH5 B;  1LTA C;  2EHS A;  1J1E C;  2M8N A;  2EFJ A;  2IZ0 A;  3FWN A;  2A45 I;  3VTP C;  1H0T B;  1FC2 C;  1LT1 A;  1EC5 A;  4RO0 A;  2YIU C;  1N73 C;  5CMZ A;  3EJB A;  1N86 A;  1BGY D;  1ZNV A;  1AV1 A;  2LKM A;  2Z46 A;  5E79 E;  5GTH E;  1OXZ A;  1GW3 A;  1VQ8 P;  4MN4 C;  5KLV D;  3AE8 C;  2K0Y A;  4R0M A;  1SQB G;  2L4B A;  2YKQ A;  1K8A Q;  3G0V A;  5APW A;  2IBZ I;  1SQX E;  2YMY A;  5BU8 B;  3P05 A;  3FWL A;  1HJ0 A;  3WU2 E;  1KYO I;  3Q5P A;  5TIS H;  2JKV A;  1NKZ B;  3M9H A;  2PGD A;  3BRT B;  2GZJ A;  3HD7 B;  1T3U A;  2OYI A;  2A06 D;  4H2W C;  3GKL C;  1P84 E;  2JYL A;  1PV3 A;  3VRL C;  2WSC H;  3WBH A;  4JBZ A;  2FQ1 A;  3CPW O;  2C0W A;  2PEN A;  1NTZ G;  3H1I D;  2QIW A;  4EI2 A;  1ZLL A;  5APY A;  5AVV B;  2WIT A;  2EIA A;  4D6T J;  1SQP E;  3MP7 B;  2D2C B;  1Q7Y Q;  4WY4 A;  1SQV D;  1BSN A;  5F2O A;  2WQY C;  2DNW A;  2XZ1 C;  3L72 G;  3SWY A;  2HR3 A;  1NAF A;  1PEQ A;  3RBZ A;  3BVH A;  5B66 H;  1EZV E;  1RHZ B;  1GU4 A;  3V2Q A;  2Y0C A;  2M8P A;  3HTK B;  1LT9 A;  2GUV A;  2Q7C A;  1FZC B;  1YIT P;  1BDD A;  3K5B A;  1OMI A;  1UJZ A;  1AUM A;  1QRJ A;  4NPE A;  2Q1K A;  3GF7 A;  2LOL A;  2CGQ A;  4L76 A;  1VQ6 P;  2FXM A;  3P7K A;  1R8E A;  5KP7 B;  1X22 A;  3M0D A;  1JY2 P;  1QVF O;  1BE3 E;  3HRN A;  1RNI A;  4WBA A;  5HGL A;  2LL8 A;  3T97 A;  2FBW C;  1VKU A;  3NY7 B;  1URQ D;  4I7Z C;  1OW8 A;  2JAZ A;  1FE6 A;  2B87 B;  1H0T A;  1KB9 E;  5AVY B;  3JSV C;  2GDY A;  3AEC C;  1X3O A;  1BCC G;  4PH1 A;  3OAK A;  3GHG B;  2N5I A;  2KI7 B;  1AQ5 A;  1NWQ A;  1AVY A;  3L74 D;  5B5E H;  2E75 D;  2IBZ D;  3FGA D;  1N8R Q;  2R44 A;  5AVR B;  3AE5 C;  1P84 I;  1M74 A;  4EDF A;  4R4M A;  1X8Y A;  2ZVO B;  3H25 A;  2FAE A;  3MGE A;  4U0A A;  3H1K G;  2ZT9 D;  1GU5 A;  1NHL A;  5CCH A;  3GF3 A;  1XTC C;  2KG8 A;  5BVZ A;  2FYU G;  2P9X A;  1EDJ A;  4Y28 J;  2E76 C;  2WPT A;  3NXS A;  3HD7 A;  1KQL A;  4RES B;  1KQG B;  2GM4 A;  3JC2 2;  2BEQ D;  1HGZ A;  4DCK A;  3SWF A;  1CW5 A;  3PH0 A;  2DW3 A;  3H1J D;  1DNY A;  1GZL A;  2GUS A;  4ASW A;  2KIK A;  2GDW A;  2YKP A;  1EZV I;  1YTZ T;  3TF5 A;  1VQM P;  1SQB J;  4N6J A;  5I4T G;  1EXJ A;  2R3S A;  3KHU A;  1Z6M A;  2AEF A;  3BRV B;  4RKU J;  1WMK A;  3L75 D;  2BHV A;  2OYH C;  3L73 E;  4U3F D;  3AEG C;  4I2L C;  1X0T A;  1EOQ A;  3LRY A;  3V6I A;  2K0X A;  1L4A B;  1L2P A;  3E7K A;  1GXG A;  2UWJ E;  4LLH A;  2E43 A;  4DG9 A;  2C9N Y;  1KLP A;  3CC7 P;  2LXB A;  1NTZ J;  2JGP A;  2AF8 A;  3L35 A;  2JBG A;  3HTK A;  1Q82 Q;  3HUS B;  1FZC A;  5AW0 B;  5APQ A;  1NAY A;  1KB9 I;  1NJI Q;  1VPC A;  1L0N K;  5KAI H;  3RK3 C;  1DD3 A;  1ZMB A;  2M3B A;  3L72 J;  3L71 G;  1AF8 A;  1SQX D;  1FJK A;  4COC A;  1N7S C;  3MUD A;  4PH0 A;  1M1J B;  1EDL A;  1NOH A;  2E74 B;  1SQQ D;  2B87 A;  1YJ9 P;  1EQ7 A;  3HD7 D;  1RF0 C;  1PPJ E;  2ZYD A;  3GHG A;  5CBO A;  3DS2 A;  3U43 A;  1DV5 A;  2E42 A;  2XKM A;  1VF5 C;  1KIL B;  4IFM A;  4PV1 B;  1KC8 Q;  3H1I G;  1FDI A;  2I1J A;  5GTI H;  1SQP D;  2K88 A;  1QL1 A;  1JO5 A;  2Q9I A;  1U7J A;  3RG6 C;  2BCC D;  2AFD A;  3U1C A;  2D2C D;  5HGM A;  2MF4 A;  2Q5U A;  3RL0 D;  1DD4 A;  4ZKU A;  2NPS B;  4C7N B;  1BCC J;  2XXM A;  1ZV8 A;  1FZF A;  1IUQ A;  4RJT A;  3HZQ A;  2L5G B;  4Z1M H;  2BUO A;  1EDK A;  3II6 A;  4UB6 H;  2FQ2 A;  3PRJ A;  1VQ7 P;  2JR8 A;  4IL6 X;  5EW5 E;  1CI6 B;  2WSC J;  3H1K J;  2MVU A;  1IJD B;  2N5H A;  3B4S A;  3GZL A;  2FYU J;  1M1K Q;  4Y99 B;  2K93 A;  2CPS A;  3B4Q A;  1T3J A;  3R4Y A;  2Q3E A;  1J1E B;  1YHQ P;  2MJZ A;  2XV5 A;  4I6M C;  1L4A A;  4W7Y A;  1ZR2 A;  1GTW A;  4F37 A;  2YIU B;  1N73 B;  1UII A;  1VQO P;  2CG5 B;  4DJG A;  1KB9 D;  1JCD A;  2L0Q A;  2K9J B;  3CD6 P;  1QL2 A;  2K5X A;  1IK7 A;  2VLO A;  2KG6 A;  3HUS A;  1MZ8 A;  2YXQ B;  3L74 G;  2VRS A;  1T2K D;  4OVN F;  3CXH H;  1HF9 A;  1WRG A;  2FAD A;  1GL2 C;  3MD0 A;  1LWU C;  3BCC E;  4OWF A;  5HV8 A;  1FBM A;  3G29 A;  3H32 B;  1RE3 A;  1M1J A;  5CJ4 A;  4H13 D;  1ZRT D;  3CWB D;  1EXI A;  1T8Z A;  2OTJ P;  3LID A;  2YO2 A;  2KP8 A;  2JDI H;  1FS0 E;  3H1J G;  1ACP A;  4WYM A;  1KQF B;  5AVS B;  3B8E B;  4H44 C;  1KIL A;  3CXC O;  3CMA P;  1YYC A;  4YXD C;  2PNG A;  3L71 J;  5KKZ C;  2POH A;  3GZM A;  5C39 A;  1VDF A;  4HKZ H;  3L73 D;  1JCC A;  3L75 G;  4NEO A;  1JY3 O;  2MR7 A;  3H1L D;  3ZDM A;  3MGN A;  1YQ4 C;  2VLN A;  1RO0 A;  2XV6 A;  5CCG C;  2NPS A;  1JB0 J;  1AYI A;  4C7N A;  1OZH A;  1URQ B;  1L4A D;  3EFF K;  1G2C B;  3HE4 B;  3B5N C;  2AEM A;  4CPG A;  3AED C;  3CX5 I;  2H8P D;  3H1I J;  4H0L C;  5HGO A;  2V4H A;  4PD4 E;  2ITA A;  3QWO C;  2CWO A;  2WPR A;  5KTB A;  4EOT A;  2HPC A;  1NQ4 A;  2E75 B;  2N9B A;  2IX7 C;  1NU1 G;  2KGC A;  4R4L A;  1X79 B;  1MZ9 A;  1KYO E;  2MD9 A;  4I7Z B;  2JQ4 A;  5HGN A;  3IR9 A;  2WSE H;  3FXE A;  4MRT C;  2H88 C;  1N73 A;  3DS0 A;  3JCU E;  5KAF E;  1SQQ G;  2WPV B;  2W27 A;  2K9J A;  2E74 D;  1PPJ D;  3Q5R A;  2YKO A;  4C46 A;  2Y9Z A;  3A0B E;  5KLI C;  1FOS F;  3KZI H;  1NTK D;  4XFJ A;  1KMI Z;  5KJ7 D;  4TLF A;  4IFF A;  5H2F H;  2FKW B;  2E5Y A;  2H7H A;  1K73 Q;  4M3L A;  3AE4 C;  4U0F A;  2BCC G;  2E76 B;  1AVO A;  3WUV A;  3H32 A;  1HJB A;  2Q6Q A;  2NPS D;  4UHP B;  4GOF A;  4GIF A;  4H2X C;  3L74 J;  3H1H E;  2BAS A;  1PEU A;  1QGK B;  3I56 P;  2IYO A;  2XND H;  2OYH B;  1DEE G;  3RG2 A;  1FDM A;  1IK9 A;  4HYT B;  3TGU D;  1L0L D;  2RKL A;  4PD4 I;  5KP8 B;  5AW9 B;  4D6T E;  4PJ0 E;  1PEO A;  2KUB A;  3CI9 A;  3OW2 O;  2Z44 A;  4NPD A;  4XRO A;  4XFY A;  2FVE A;  3QH9 A;  2P67 A;  2ZYA A;  3DS1 A;  1ZXG A;  2O01 H;  5AW3 B;  3H1J J;  2WVR A;  1URQ A;  2WPS A;  1G2C A;  1JEK A;  3HE4 A;  2RN0 A;  2AXT E;  4M0I A;  4XFX A;  4JYC A;  2JU1 A;  1VHN A;  1W2B O;  3RK3 B;  5HVC A;  2IYP A;  3L75 J;  3KPE A;  2W6A A;  1S5L X;  3Q20 A;  2KGE A;  1N7S B;  3RK3 E;  5AW6 B;  3P8M C;  1RF1 C;  1JY3 N;  3EQ2 A;  3RGU A;  2PAJ A;  3BCC D;  2FFD C;  2B89 A;  4OGQ C;  5CJ0 A;  1K30 A;  1YIJ P;  2K0D X;  3RL0 B;  5APS A;  1SFC C;  1NTM G;  3CCV P;  3CWB G;  2C9L Y;  2RMZ A;  4GR6 A;  1L0N E;  3I5C A;  1VQN P;  1OWA A;  1NU1 J;  3V2N A;  3DPH A;  1SP4 A;  1VQ5 P;  2KOP A;  1W5C E;  2XDJ A;  3RK2 C;  2JYG A;  3L73 G;  1USD A;  1FZG A;  3LW5 H;  3H1L G;  1N2D C;  2JJL A;  4N78 E;  1SQQ J;  3CCJ P;  1FZE A;  3D70 A;  3KYQ A;  2OYI C;  1JMB A;  1FZB A;  2EG5 A;  4XA4 A;  3C8V A;  2L91 A;  4PD4 D;  1HQB A;  2XU6 A;  5CHX A;  1K05 A;  1DH3 A;  2FXP A;  1EDI A;  2N9Y B;  2OYH A;  2HFE D;  2BCC J;  5L8R J;  1QEX A;  1SQB E;  2WSF H;  1YJW P;  1KYO D;  1HTL C;  4WY4 C;  2QJY C;  4H13 B;  1M8O B;  2KK7 A;  2K94 A;  2LIU A;  4BXL A;  3VMY A;  4ZNC A;  3AE7 C;  2K37 A;  2GZE A;  1PPJ G;  5EJD A;  1QX8 A;  2FYN C;  1NTZ E;  1RE4 C; 
#chains in the Genus database with same CATH homology
 2PEM A;  1IUQ A;  1AUM A;  3CCS P;  1QRJ A;  4U0F A;  3CXC O;  3HZQ A;  3CMA P;  1YJN P;  1KD1 Q;  1KQS O;  2BUO A;  1EOQ A;  1Q86 Q;  3LRY A;  4GR6 A;  1VQ6 P;  1QVG O;  1JJ2 O;  1VQN P;  2DGY A;  4IPY A;  1VQ7 P;  3E2D A;  2Z46 A;  2BQ1 E;  5F2N A;  5F2K A;  1K9M Q;  1QVF O;  2PY8 A;  3CC7 P;  3DS3 A;  1M90 Q;  1VQ8 P;  3DPH A;  3G1G A;  1RNI A;  2KOD A;  1RO0 A;  2XV6 A;  4U0E A;  3DTJ A;  5HGL A;  1VQ5 P;  3HYB A;  3CME P;  1D1D A;  3CC2 P;  1Q82 Q;  3CCE P;  1PEU A;  1K8A Q;  1M1K Q;  1M6N A;  2M8L A;  3G0V A;  2JYG A;  1NJI Q;  3H4E A;  3I56 P;  4U0B A;  3P05 A;  1YHQ P;  3CCL P;  1BAJ A;  3G1I A;  5DCK A;  4PH1 A;  4XFZ A;  1K73 Q;  1VQP P;  3NTE A;  4COP A;  5HGO A;  4GR2 A;  2ONT A;  3CCJ P;  2QA4 P;  1ZMB A;  1A8O A;  2PEJ A;  2CWO A;  1VQO P;  1N8R Q;  3B5I A;  4COC A;  3G71 P;  1PEO A;  5BS2 A;  1M74 A;  1E6J P;  4PH0 A;  3CD6 P;  2JYL A;  3OW2 O;  3VRL C;  2Z44 A;  3WBH A;  4XRO A;  2EG5 A;  3G28 A;  4XFY A;  2PEI A;  3MGE A;  3CCM P;  1VQL P;  3I55 P;  3CPW O;  2PEN A;  3CC4 P;  4U0A A;  2OTL P;  3DS1 A;  1A43 A;  3G26 A;  3G21 A;  2PEO A;  1YI2 P;  1YJ9 P;  3DS5 A;  1EIA A;  2P9X A;  2Z45 A;  2OAR A;  2EIA A;  4XRQ A;  5HGN A;  3DS2 A;  1VQ4 P;  4M0I A;  3M1M A;  1VQK P;  1Q7Y Q;  4XFX A;  3DS0 A;  1YIT P;  1KC8 Q;  5F2O A;  1YJW P;  1W2B O;  3G4S P;  2JO0 A;  2LF4 A;  1M6E X;  3G29 A;  2PEK A;  3Q20 A;  4U0C A;  1Q81 Q;  4U0D A;  1RO2 A;  1PEQ A;  4QNB A;  3RG6 C;  5BS1 A;  2PEQ A;  1PEM A;  1VQM P;  2OTJ P;  2L6E A;  5HGM A;  5JPA A;  2XT1 A;  2E1M A;  1S72 P;  3H0D A;  3G6E P;  1K30 A;  5I4T G;  3CCQ P;  1YIJ P;  2M8P A;  3DS4 A;  3CCR P;  2QEX P;  2M8N A;  2EFJ A;  1VQ9 P;  4WYM A;  2BHV A;  3CCU P;  2XXM A;  3CCV P;  3H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...