3CCRP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccrP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccrP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccrP02
3CMAP 1QVGO 3CCSP 1KD1Q 1YHQP 3G4SP 1VQ5P 1VQLP 1K73Q 3CCUP 3CCJP 1VQ6P 3CXCO 1VQ7P 3CCVP 1YJNP 1YI2P 2QA4P 1M1KQ 1K8AQ 3CCLP 1Q86Q 3OW2O 3I56P 2OTJP 1JJ2O 1VQMP 3I55P 1YIJP 3CCRP 1VQ4P 3CC2P 3CD6P 1VQ8P 1VQPP 1YJ9P 1KQSO 3G6EP 1S72P 1W2BO 2OTLP 3CPWO 3CC4P 3CC7P 1M90Q 1N8RQ 1VQOP 3CCEP 1VQKP 3CCQP 1VQNP 3CCMP 3G71P 1YJWP 1Q81Q 1KC8Q 2QEXP 3CMEP 1QVFO 1NJIQ 1Q82Q 1VQ9P 1YITP 1Q7YQ 1K9MQ
chains in the Genus database with same CATH superfamily
1NTZJ 4D6TD 2E1MA 5AVUB 2ROQA 1PEQA 3A0HE 3L36A 2YXQB 1OFCX 2ERHA 1FAVA 3CC4P 1RF1A 1PGPA 1BCCJ 3CMEP 1BDCA 1S9KD 3JCUH 1ZW0A 3O6QB 5KLVD 3KPEA 3BASA 3CE7A 1IFNA 1GW3A 4ZMDA 4UB6H 2E76D 2FXOA 5AVWB 2LOLA 1JEKA 3VMYA 4KHXA 1A43A 3B8EB 1JY2O 2WTYA 5HGOA 1IJDB 2Y0EA 3HE4A 1LTJA 4R4LA 3MZWB 3M06A 3AEFC 3VP8A 4K3AA 3CCRP 2LMLA 2FQ1A 2OYHC 4XRQA 4PV1B 4EOTA 1M6EX 1S72P 3JCUE 2HLOA 2XV5A 3USSA 4OH8B 4YPCA 1SQBJ 2WSEH 5CJ0A 4N78E 5KKZC 4R4MA 3H1HG 2KGDA 4H44B 1SQPG 1KB9D 4I6MC 1VQMP 4LGDE 2Q7CA 2PEKA 3AECC 5EW5E 5GTHH 1SVFA 3GHGB 2FFDC 3VMXA 4PJ0H 4L74A 1MFZA 3NTNA 1URQD 1S2EA 3CXHD 2KOPA 1MZ9A 2JAZA 2XV6A 3S4RA 3VOPA 3AE4C 3RL0B 2GDXA 1VQNP 1ZRTD 3KYQA 3BCCD 2JJLA 1EC5A 1RE4C 4HYTB 4W7ZA 1S5LH 1M7LA 3L70D 1DV5A 1J1EC 1E0HA 1L0LK 1IMQA 1URQA 4AYCA 2E75C 2H7HA 3EJBA 1KYOH 3IN6A 5B66H 2H43A 3CWBE 1A02F 3B71A 1ZV8A 4D6TG 4C7NA 2PP6A 3HYBA 3BVHA 2Y9ZA 2QJYC 1UJZA 3MTUE 5BS2A 2XXMA 1OIPA 4GOEA 2BEZF 3EJDA 2E74C 1VQ4P 1UNKA 5KLIC 3M0AA 5HGLA 2AXCA 3GHGA 2WQYC 4C46A 1S5LE 5APYA 2H8PD 2OTKE 5AVQB 1QL2A 1Z56A 5KLVG 5C39A 4QNBA 1UIIA 2JO0A 2QJPB 1FR2A 1H0TB 4L76A 1N7SC 1GDTA 1FDOA 1XTCC 1FDIA 5BU5A 1RQVA 2K92A 1E5WA 5AW5B 5KAFH 5TISH 2GZIA 2B88A 1RY3A 2QJKC 3AE5C 5AW9B 2VLPA 3SWFA 4R0MA 4BWNA 1NKZB 1U7JA 1LWUC 1JY2N 3CCVP 3JSVC 1K04A 4PD4D 2FXMA 3DS0A 2OGUA 3C9IA 1VQ8P 2P10A 3CWBJ 2FYUK 3OA7A 1L0NE 1X0TA 4I7ZC 2OYHB 1M57D 3RK3C 2PGDA 1OZHA 2NRGA 1OMIA 1YHQP 1T2KD 3HRNA 1XTGB 5KKZB 2GDWA 1MFTA 1ZR4A 5EJDA 5TISE 1MZ8A 2JWDA 3CX5E 2KNCB 1PEMA 1NGMB 3VYIA 1NJIQ 1KQGB 2YO2A 3I5CA 2E5TA 3G4SP 2OQQA 2Q3EA 2FQ2A 2IDBA 5KAIE 2FFDB 2QA4P 1GPJA 4GOFA 3LRYA 2JQ4A 3L74D 1KQFB 2BHVA 4XFYA 5KP7B 1WT6A 4GR2A 3L70G 1M56D 4XFZA 2PRRA 5BU8B 1L0LD 3CXCO 3BCCJ 4LC1A 1R8EA 2GZGA 1KZUB 2Q6QA 2QM7A 5CCGC 2QG4A 3PRJA 1L0NJ 1SQVE 2BUOA 2PY8A 1X8YA 1M1JC 1VF5C 1PGQA 1Y9BA 2E75B 2BASA 1BE3E 5AW7B 1DIPA 2FBWC 1LTGC 5F2NA 3P7KA 3K5BA 2JDIH 3M0DC 2KS1B 1LT9C 1YQ4C 2KNCA 2QJYB 1GK6A 1EXJA 1NTMG 2EFJA 2E74B 4OGQC 3D70A 1SQPK 1JCCA 2KORA 5KLIB 1RF1C 3Q20A 2VRSA 2E75D 2LXBA 1MUUA 1BGYE 4DT0A 1ZNVA 1YTZI 3AE3C 1OVUA 5H2FH 1N7SB 1P84E 1DEEG 1HUCA 2KZIA 1RE4A 2OARA 1LTJC 2E74D 1T3JA 3Q5RA 3L72E 3RL0g 2QJKB 2IX7C 1NU1G 2JU1A 4JBZA 3TF5A 4DCKA 2IYPA 1W2BO 1JY3P 5APTA 3Q3DA 2FXPA 1NWQA 1LTBC 1BE3J 3L71E 3SFDC 1GL2C 4I7ZB 1N7SD 2K9YA 1RQUA 4NPEA 2FYNC 1T3UA 3RK3B 1ACPA 1LGHB 1S4XA 1ZMBA 2IBZI 5H2FE 1EIAA 1WRGA 2XZRA 2PEQA 1FC2C 1QL1A 1KYOI 2BQ1E 3R2PA 2FQ0A 3NY7B 1IFDA 1BSHA 2WWWA 2ZXEB 2KR5A 1SP4A 2ITAA 2WITA 1JUNA 3O8ZA 3L73D 3AEGC 2P67A 1HTLC 3H1LD 2HR3A 1N7SA 3L74G 1AA0A 3EJEA 2FY8A 1EDKA 5KLVK 3VN0A 3RK3D 3CPWO 1IK7A 1MKMA 1EZVI 4IOIH 4U0AA 3UIAA 3RBXA 3L72J 1LWUA 1YI2P 2M8NA 1NTKD 2WPSA 4U0DA 2ZFCA 2FVEA 4XFJA 1NH4A 3H1JE 2HPCB 3M1MA 3L71J 2FYUE 2ZVNB 4GODA 1NQ4A 3H1ID 1FZAA 1M1JB 3IF4A 2ZJSE 1VF5B 1G1IA 3EWKA 3M9BA 1QLED 2WSCH 2BCCD 4YTPC 3V5BA 3A5TA 5CBNA 2JKVA 1FJKA 1SQPD 2JB0A 1D7MA 2KOOA 1GMJA 1F80D 5CZDB 3E1RA 2O01N 1NKNA 3EFFK 2GZEA 1KQLA 1SFCC 2QRXA 3MUDC 1ZR2A 3DTJA 1S1CX 1BCCE 4OGQB 1RF1B 2KI7B 5CCGD 1X9VA 2PEIA 5DCKA 3I55P 2HFED 4PH0A 3H25A 2LIWA 4U0BA 3NMDA 2GYKA 4N6JA 4COCA 3U1AA 2YKQA 2O1KA 1IK9A 4W7YA 4H2YC 3G1GA 2ZAEB 3HE4B 1LTJB 4ZKUA 5CCGA 3H1JJ 2FVAA 2FYUJ 1DD3A 2WPVB 5KJ7C 4U0CA 2EG5A 2OTJP 1M8OB 2K0DX 4WBAA 5HVCA 1HBWA 4IFMA 3L37A 3U1CA 2IFMA 3M0DA 4HKZH 3WUTA 1LT9A 1HQBA 1GL2B 3CC2P 3VTPC 3CD6P 2FYNB 2PEMA 3V2PA 1NYHA 1PEOA 3ITKA 3FX0A 1AQTA 1OW8A 1ZXGA 1JB0J 3H1HE 3HUSC 1KLPA 3HE5B 3L73G 2QSIA 2NPSC 3H1LG 1KILC 1NTMK 3TDKA 1L0IA 2KGAA 3DPHA 4IFDK 1T2KC 2KOSA 1SQXD 3Q5PA 3C1LA 1LT1A 2WSCJ 1PPJD 1GL2D 1KFNA 5APSA 4NPDA 1X22A 2RMZA 1HJ0A 2N5IA 1NTKG 1CEIA 4UB8H 5F2KA 3GZMA 2AFDA 3N4XA 3IAOA 4GIFA 2JBGA 2KOGA 3H1IG 1URQB 3G71P 1KC8Q 4BRYA 1NU1K 1LTSC 2NO8A 2BCCG 2N9BA 4TLFA 1GL2A 4IL6H 1LTAC 1GZLA 4C7NB 1NOHA 2O01J 1IMPA 3ABVC 4D6TE 3EQ2A 3TNUB 2RH0A 3HE5A 1WMKA 1EOQA 4KJMA 1M90Q 2XZ1C 3H1HJ 2KP8A 1SQPJ 3AE7C 2SPZA 2QNWA 2MR8A 4UB8E 2FVFA 2KZJA 2XT1A 2IYOA 1SFCB 5BVZA 2P1JA 4PXHB 2IBZD 3PP5A 3AE1C 1H89A 2WMMA 4JQ0D 1S9KE 4ASVA 3RGUA 5CHXA 5KLVE 4IL6E 2IFNA 3CCEP 1QRJA 3G26A 1BXIA 1JNMA 1ZOYC 3M9HA 3HD7C 1KB9H 4B86A 2WT7A 3HZQA 1CI6A 1IUQA 1AVOA 2KLVA 3D6YA 2FACA 1QX8A 2EHTA 2V4HA 5EFWB 1AUMA 3PLNA 2FADA 2KSJA 2W6BA 1SFCD 2C0XA 2GA1A 1RO2A 3MGNA 3TGUD 1USEA 3RK2C 1EZVD 3SSUA 4L75A 4U3FD 3CXHH 1QEXA 1HH0A 4H13C 3TNUA 1NAYA 1D1DA 4CA3A 4IFFA 4D6TJ 1BSNA 1PEUA 3QH9A 2V7QH 3GZLA 4WY4D 1KB9E 1PP9D 1JY2P 5CJ4A 1N2DC 1SFCA 1NTMD 4HKGA 2EIAA 3MUDA 4XA4A 1VQLP 1SQXG 3U59A 3HUSB 1RF0C 2YMYA 3MP7B 1L4AC 5B5EE 2NPSB 5KJ7D 5KLVJ 1PPJG 2A06D 2AXTH 2MVUA 1ZP0C 3KQGA 3CXHE 4H0LD 4WY4A 1GK4A 2AEMA 3II6A 1QVGO 3CX5H 4EYYQ 1ZRTE 2KB7P 1FZEA 3BCCE 3E7KA 3VRLC 2L4BA 1AF8A 5KAIH 1LNQA 1NU1D 2KG8A 2W8ZA 3L70E 5AVXB 2JYGA 3G29A 5KJ7A 2NPSD 1KILD 1KMIZ 2WVRA 4N3YB 2VLQA 4BXLA 2CG5B 2O3JA 3LW5J 2AXTE 4I1LA 2LR2A 4Y99C 2IPPA 2N5HA 2PAJA 2Q5UA 1SQQD 2MJZA 3MGEA 1G1JA 1NAFA 3L75D 2LPKA 1E79H 3HUSA 2AFEA 2B89A 2HODA 4JYCA 3GF3A 2VSQA 3P05A 2NPSA 2IBZG 3S1KA 1KILA 4PD4H 3HTKA 5AVVB 1T8ZA 2M8RA 2Z5HA 2IZ1A 4GDOA 5KTBA 2N6YA 4NEOA 1HF9A 1JY3O 4M3LA 2VLOA 4UHPB 4OWFA 5DJTB 2C9LY 1K05A 2Y9YA 1AVYA 3CCSP 5APQA 2V7QJ 2M0BA 2OYIC 1KN7A 4QKOA 2J58A 3U43A 5CMZA 4ASWA 1VQPP 2AEFA 3L70J 2MVVA 3TGUG 2JWAA 1J1EB 1EZVG 5M1BA 1NTKK 1VQKP 4PD4E 3B5ND 4U3FG 3WBHA 1NU1E 1P84H 3B4SA 3RK2B 4HB1A 2P7JA 3DS1A 4EIJA 1PP9G 1GW4A 4H13B 3G6EP 1GXHA 1KORA 1VQOP 1T6AA 1UIXA 3P8CD 3HD7D 3OAKA 2YO3A 1RO0A 5HV8A 2AVAA 2Z46A 3B5NA 2RN0A 3S9OA 1NTMJ 3P8MC 2FAEA 3OW2O 2A06G 2YNYA 2CWOA 4BPHA 1DX7A 1EDJA 1J1DC 3DS3A 1CSBA 3RK2D 1GTWA 1L4AB 1M74A 2QEXP 1T8KA 3F89A 4H13D 3HD7A 1VQ5P 3L74E 2K93A 4YXDC 1IFMA 3WUUA 3AEAC 3SWKA 1JJ2O 4WYMA 1YJ9P 2K88A 2KGEA 1LWUB 2X2BA 1L0LE 4RKUJ 1SQVG 3P32A 2KXPB 1DH3A 1PV3A 1VL2A 1Q90D 2K0YA 2M8PA 1NU1J 1KB9I 2K9JA 1L4AD 2QM8A 3AEEC 1YTZT 1SQQG 2Q9IA 1OVVA 2DW3A 2ZT9C 4JF7A 1NTZD 3L75G 5AW6B 3D71A 4Y99B 4IZ6A 5AW8B 3VMAA 1AQ5A 2WPTA 1ZMEC 2GZJA 2LIUA 2A45H 2GUSA 3SFEC 2KG9A 3CXHI 1RF0A 4Y28J 2GZFA 3DS2A 1L4AA 1BGYG 2WPQA 3BRTB 5AW2B 1SQXK 2N9YB 1IC2A 2MKVA 3H1KG 1Q82Q 1MV8A 1JY3N 3CMAP 1G2CA 3L74J 3M91A 1PFIA 4JYBA 2K2QA 1VQ6P 1OWAA 1FDMA 1JTHA 2K1AA 1L0LJ 2XNXA 4L73A 4ZNCA 2PENA 1FE6A 5GTIH 3M9QA 1RE3C 2R3CA 2PNGA 2JEEA 4PV1C 4AUWA 2Z44A 2Y0DA 3CX5I 1FZCA 2UWJE 2KSEA 3C8VA 1SQBD 2KODA 3RG6C 2NZ2A 4I2LC 3G0VA 1LT9B 4H2XC 2KIKA 3G28A 1K9MQ 2XDJA 3TK1A 2D2CD 1M6NA 3PJSK 3CCJP 2J5UA 4XROA 1J2JB 2KUBA 1EDIA 2H89C 2KK7A 5E79E 1GU5A 5GTIE 5KP6B 1EQ7A 4DZOA 3L73E 2LXCB 2FHSC 3GF7A 1PZQA 3H1LE 3Q5SA 2O01H 3OJAB 2LKIA 4WY4C 1J1DB 4QMAA 1YQ3C 2MF4A 2YMKA 4OVNF 3RK3E 4PD4I 2OYIA 3RL0C 5HGMA 3A7OA 2XU6A 1VDFA 3GLMA 3A3YB 1LTIC 1HY8A 4DOJA 5I4TG 4IPYA 2AF8A 1S5LX 2H88C 4WWIA 1OX3A 1NTKE 4O9BA 5AVZB 2CNRA 2O1JA 1IZNB 4H0LC 1U7MA 4JPZB 3T97B 1FU1A 4BRYB 1M1KQ 1NTZG 2LKMA 3WU2H 2FKWB 3H1IE 3EFGA 3H47A 2BCCE 2CQ8A 2L5GB 2ZT9B 1PGOA 2WSSH 1SQPE 2YKOA 2ZYAA 3E2DA 4KT0J 1P84I 1RH5B 2P58A 1BCCG 2R44A 1IO4A 1N73C 2L9FA 4U7JA 2JGPA 4EDFA 1OVRA 1Y47A 2N1TC 3L73J 3LIDA 1Q2NA 4PWVB 3H1LJ 2Z4EA 2M5AA 2QJPC 3V2NA 3V2QA 5JPAA 3WU2E 2PFXA 2YKPA 2LF4A 2GUVA 2ZT9D 1Y8AA 3AE2C 2Q3IA 1DNYA 2W83C 2R32A 1FZFA 1S3JA 2WT7B 4AQRD 2CK3H 2JU2A 1CI6B 3KDPB 1FOSE 1EDLA 3BRVB 4CPGA 3CCMP 1QVFO 1NTKJ 3T97A 2QE7H 3CWBD 4MN4C 2KLUA 3FXEA 1SQBG 5TJHA 1SQVK 3VMZA 3H1IJ 4RO0A 1N7LA 1DD4A 1JCDA 2BCCJ 1HGZA 4W80A 2N6ZA 5AW4B 4RESB 1SQQK 2L91A 2XZ0D 4UB6E 3R4YA 3B5NC 1FBMA 1YJNP 2YIUC 2K0XA 2L0QA 1SLQA 3G9RA 2BEQD 1KQSO 2OTLP 2Z5IA 1KYOD 1AYIA 1N8RQ 3O6QA 3LW5H 2KOQA 2C0WA 1R5LA 1SQXE 4PV1D 1YITP 3V4WA 5K5GB 3NXSA 2P2UA 1LP1B 1VHNA 2A45I 3ZDMA 1PPJE 1FZBA 4WY4B 1KV4A 5HGNA 1CZQA 3V2RA 4H44D 2HYNA 1JO5A 1X79B 3MD0A 1SS1A 5B5EH 1HWTC 2WSFH 1GU4A 1RE3A 3H4EA 3GJNA 1L0ND 1LJ2A 2DGYA 5GTHE 2VLNA 1OW7A 5CCHC 4H0LB 1TU3F 4PJ0E 2Z45A 2R5BA 4U0EA 3RL0D 1A8OA 1EXIA 2ONTA 1YBKA 3G21A 3CX5D 1L0HA 2HODB 4COPA 1YYCA 4XFXA 4ZKPA 1AV1A 1CW5A 1KILB 4A7PA 3HTKB 1IFIA 2Y0CA 3KHUA 3MHVA 3CC7P 3B4QA 1N73B 1LP1A 1USDA 5CBOA 5BS1A 1SQXJ 2IBZE 4WB4A 1Q7YQ 2N1TB 4DJGA 3PH0A 1KYOE 5B66E 1KTMA 3A2AA 2WSEJ 2JO1A 2ZVOB 1RNIA 2KG6A 3CWBG 3CCLP 2QVAA 5AW0B 1SQVD 2W6JH 2WPRA 3QWOC 2B87B 1K30A 1FZCC 1BE3D 3TGUE 2CPBA 1EZVE 2N1TD 1H88A 2ZXXA 4XE5B 3VP9A 7CEIA 4U3FE 5APUA 5APWA 2MR7A 1GD2E 1NTZK 2M5RA 1ZN5A 2B9BA 3WUVA 3GW6A 3CLQA 1VQ7P 1LTTC 1PP9E 2ZYDA 3I56P 1NHLA 3Q2YA 1NTME 1N73A 5KAFE 2WSFJ 3B5NB 4WVZA 2LTEA 2YIUB 3AE8C 2N1TA 2RKLA 2N98A 2CPSA 3AE6C 1H0TA 1BGYD 1Q86Q 1VQ9P 5KP8B 2OYOA 1JMBA 2A06E 3AEDC 3H1KD 2IZ0A 1P84D 1JM0A 1YIJP 2D2CC 3HD7B 4EI2A 3G3ZA 5AVSB 2W27A 1EMVA 2E43A 3BCCG 2R3SA 2YXRB 3NTEA 3L72D 2B87A 2G3AA 1Q81Q 1L0NG 5AVRB 2XKMA 3DS4A 3TGUJ 1GXGA 4PH1A 3L71D 2W90A 1W2EA 3CI9A 1KILE 1Z6MA 4U0FA 3PTZA 2OYHA 5L8RJ 4U3FJ 2K9JB 5APXA 4HJGH 2N50A 1AFOA 1AJYA 1FOSF 4K35A 1SQBK 3FWNA 2LL8A 4C7RA 1SQQE 3V6IA 1H8AA 1PP9J 2JR8A 3KZIH 3L75E 1PGJA 2I1JA 2KWLA 3Q1MA 2K3RA 3CCQP 1RHZB 2FFDA 1K73Q 3TSIA 3CCUP 3LMOA 5AVYB 2M3EA 3PHLA 2DNWA 5CCHD 2P9XA 2G8YA 3RBZA 1G2CB 3H6PA 3IFMA 3NFQA 2L22A 3H1KE 2R5DA 5DJUB 2GDYA 1JTHB 1W5CE 1YJWP 4GT1A 3KZIE 3AEBC 3H1JD 1BE3G 2C9NY 4YXWH 2FYUD 1BAJA 1SQVJ 5CCHA 3H32B 2E5YA 1U57A 2E76C 1FZCB 3N7NA 3E1IA 4MRTC 3V4QA 3LIEA 2J59M 3GG2A 2KS1A 4TT3H 1SQQJ 1VPCA 1JMMA 2KYVA 3L35A 1KD1Q 3B5IA 2K94A 4BPFA 3L75J 2JP3A 1KFMA 1NVOA 3P8CE 1OR5A 1E6JP 3DS5A 3GKLC 3AE9C 1HJBA 1BCCD 2M8LA 1NO4A 2AEJA 3F5HA 1OW6A 3FGAD 3W68A 2K5XA 5F2OA 1PIXA 4Z1MH 1HGVA 2M3BA 1FS0E 1BGYJ 1K8AQ 3H0DA 4DG9A 3D6ZA 1L2PA 3H1KJ 3L72G 3A0BH 3BATA 2OYIB 2D2CB 5E79H 1L0LG 3FWLA 2WZ7A 2KW2A 2MY5A 3L71G 3L4FA 1IFPA 3FXDA 3IR9A 3H32A 2ZYGA 2PEOA 2GM4A 4LLHA 1JOCA 4HH2A 1URQC 3TYYA 2PEJA 4RJTA 5APVA 3CL3D 1FZGA 3KXDA 4H44C 4IL6X 2I1KA 5AW3B 2W6AA 1NTZE 2KGCA 3A0BE 1IFJA 3H1HD 4GR6A 5AW1B 3GHGC 2XNDH 5AVTB 1FJPA 1BDDA 3G1IA 2MD9A 2M5AB 4M0IA 1QGKB 2POHA 1OXZA 4NPFX 1VF5D 3MIWA 1A02J 3JC22 2L6EA 4H2WC 3A0HH 3H1JG 2QIWA 2FYUG 2FYZA 2A45G 2EHSA 3RG2A 1R5SA 2K37A 3W67A 2HG5D 1DEBA 2HPCA 1L0NK 4BPGA 4OGQD 3WMM0 2CGQA 2JYLA 4N78D 4F37A 1M1JA 1X3OA 1ZLLA 2I8DA 2E42A 4GKGA 1PL5A 3SWYA 2Q1KA 3GMAA 1N86A 1SQBE 2E76B 1VKUA 1HVVA
chains in the Genus database with same CATH topology
3H4EA 2M8PA 5F2NA 5JPAA 3CCSP 2E1MA 1VQLP 1K73Q 1M6NA 3CCUP 3CCJP 4XROA 2LF4A 2PEOA 1VQ7P 3CCVP 3G1GA 2DGYA 2P9XA 3I56P 1PEQA 3DS0A 2XV6A 1VQ8P 2PEJA 1VQPP 2Z45A 1EOQA 2EFJA 3CPWO 3CC4P 1M90Q 4U0EA 1VQKP 4U0CA 1VQNP 3CCMP 1YJWP 2EG5A 1QVFO 3CMEP 1Q86Q 1VQ9P 2OTJP 3WBHA 3Q20A 1QVGO 4U0AA 1YHQP 1A8OA 2XT1A 2ONTA 1K9MQ 3G21A 1BAJA 5HGMA 1YI2P 2M8NA 4COPA 4XFXA 1YIJP 3DS2A 3DS1A 4U0DA 3CC2P 4GR6A 3CD6P 3VRLC 2PEMA 5I4TG 3G6EP 1A43A 3CC7P 1PEOA 3M1MA 4IPYA 3NTEA 1VQOP 3CCEP 1PEMA 2JYGA 1QRJA 3G1IA 3G29A 3G26A 5BS1A 5HGOA 1Q81Q 3HYBA 1NJIQ 1Q82Q 1Q7YQ 1RO0A 2OARA 3CMAP 2Z46A 3B5IA 1KD1Q 3G4SP 3DS4A 4M0IA 1VQ6P 5BS2A 3HZQA 2XXMA 1YJNP 1IUQA 1M1KQ 2QA4P 4PH1A 3OW2O 3DPHA 1E6JP 3DS5A 3LRYA 4U0FA 3CCRP 2CWOA 1VQ4P 5HGLA 4XRQA 1KQSO 1AUMA 1M6EX 2L6EA 1S72P 1W2BO 2OTLP 2PENA 3DS3A 3MGEA 2M8LA 3H47A 1RNIA 1RO2A 1N8RQ 2BHVA 4XFYA 1M74A 4GR2A 5F2OA 2QEXP 3CCLP 1YITP 3DTJA 4QNBA 4XFZA 2JO0A 3P05A 1VQ5P 3E2DA 2Z44A 3CXCO 1K30A 2PEIA 1ZMBA 5DCKA 1K8AQ 1D1DA 5HGNA 1EIAA 1JJ2O 1VQMP 3I55P 3H0DA 4WYMA 5F2KA 2PEKA 2JYLA 2KODA 4PH0A 2PEQA 1PEUA 1YJ9P 3RG6C 2BUOA 2PY8A 2BQ1E 3G0VA 4U0BA 3CCQP 3G71P 1KC8Q 4COCA 2EIAA 3G28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA P;  1QVG O;  3CCS P;  1KD1 Q;  1YHQ P;  3G4S P;  1VQ5 P;  1VQL P;  1K73 Q;  3CCU P;  3CCJ P;  1VQ6 P;  3CXC O;  1VQ7 P;  3CCV P;  1YJN P;  1YI2 P;  2QA4 P;  1M1K Q;  1K8A Q;  3CCL P;  1Q86 Q;  3OW2 O;  3I56 P;  2OTJ P;  1JJ2 O;  1VQM P;  3I55 P;  1YIJ P;  3CCR P;  1VQ4 P;  3CC2 P;  3CD6 P;  1VQ8 P;  1VQP P;  1YJ9 P;  1KQS O;  3G6E P;  1S72 P;  1W2B O;  2OTL P;  3CPW O;  3CC4 P;  3CC7 P;  1M90 Q;  1N8R Q;  1VQO P;  3CCE P;  1VQK P;  3CCQ P;  1VQN P;  3CCM P;  3G71 P;  1YJW P;  1Q81 Q;  1KC8 Q;  2QEX P;  3CME P;  1QVF O;  1NJI Q;  1Q82 Q;  1VQ9 P;  1YIT P;  1Q7Y Q;  1K9M Q; 
#chains in the Genus database with same CATH topology
 1NTZ J;  4D6T D;  2E1M A;  5AVU B;  2ROQ A;  1PEQ A;  3A0H E;  3L36 A;  2YXQ B;  1OFC X;  2ERH A;  1FAV A;  3CC4 P;  1RF1 A;  1PGP A;  1BCC J;  3CME P;  1BDC A;  1S9K D;  3JCU H;  1ZW0 A;  3O6Q B;  5KLV D;  3KPE A;  3BAS A;  3CE7 A;  1IFN A;  1GW3 A;  4ZMD A;  4UB6 H;  2E76 D;  2FXO A;  5AVW B;  2LOL A;  1JEK A;  3VMY A;  4KHX A;  1A43 A;  3B8E B;  1JY2 O;  2WTY A;  5HGO A;  1IJD B;  2Y0E A;  3HE4 A;  1LTJ A;  4R4L A;  3MZW B;  3M06 A;  3AEF C;  3VP8 A;  4K3A A;  3CCR P;  2LML A;  2FQ1 A;  2OYH C;  4XRQ A;  4PV1 B;  4EOT A;  1M6E X;  1S72 P;  3JCU E;  2HLO A;  2XV5 A;  3USS A;  4OH8 B;  4YPC A;  1SQB J;  2WSE H;  5CJ0 A;  4N78 E;  5KKZ C;  4R4M A;  3H1H G;  2KGD A;  4H44 B;  1SQP G;  1KB9 D;  4I6M C;  1VQM P;  4LGD E;  2Q7C A;  2PEK A;  3AEC C;  5EW5 E;  5GTH H;  1SVF A;  3GHG B;  2FFD C;  3VMX A;  4PJ0 H;  4L74 A;  1MFZ A;  3NTN A;  1URQ D;  1S2E A;  3CXH D;  2KOP A;  1MZ9 A;  2JAZ A;  2XV6 A;  3S4R A;  3VOP A;  3AE4 C;  3RL0 B;  2GDX A;  1VQN P;  1ZRT D;  3KYQ A;  3BCC D;  2JJL A;  1EC5 A;  1RE4 C;  4HYT B;  4W7Z A;  1S5L H;  1M7L A;  3L70 D;  1DV5 A;  1J1E C;  1E0H A;  1L0L K;  1IMQ A;  1URQ A;  4AYC A;  2E75 C;  2H7H A;  3EJB A;  1KYO H;  3IN6 A;  5B66 H;  2H43 A;  3CWB E;  1A02 F;  3B71 A;  1ZV8 A;  4D6T G;  4C7N A;  2PP6 A;  3HYB A;  3BVH A;  2Y9Z A;  2QJY C;  1UJZ A;  3MTU E;  5BS2 A;  2XXM A;  1OIP A;  4GOE A;  2BEZ F;  3EJD A;  2E74 C;  1VQ4 P;  1UNK A;  5KLI C;  3M0A A;  5HGL A;  2AXC A;  3GHG A;  2WQY C;  4C46 A;  1S5L E;  5APY A;  2H8P D;  2OTK E;  5AVQ B;  1QL2 A;  1Z56 A;  5KLV G;  5C39 A;  4QNB A;  1UII A;  2JO0 A;  2QJP B;  1FR2 A;  1H0T B;  4L76 A;  1N7S C;  1GDT A;  1FDO A;  1XTC C;  1FDI A;  5BU5 A;  1RQV A;  2K92 A;  1E5W A;  5AW5 B;  5KAF H;  5TIS H;  2GZI A;  2B88 A;  1RY3 A;  2QJK C;  3AE5 C;  5AW9 B;  2VLP A;  3SWF A;  4R0M A;  4BWN A;  1NKZ B;  1U7J A;  1LWU C;  1JY2 N;  3CCV P;  3JSV C;  1K04 A;  4PD4 D;  2FXM A;  3DS0 A;  2OGU A;  3C9I A;  1VQ8 P;  2P10 A;  3CWB J;  2FYU K;  3OA7 A;  1L0N E;  1X0T A;  4I7Z C;  2OYH B;  1M57 D;  3RK3 C;  2PGD A;  1OZH A;  2NRG A;  1OMI A;  1YHQ P;  1T2K D;  3HRN A;  1XTG B;  5KKZ B;  2GDW A;  1MFT A;  1ZR4 A;  5EJD A;  5TIS E;  1MZ8 A;  2JWD A;  3CX5 E;  2KNC B;  1PEM A;  1NGM B;  3VYI A;  1NJI Q;  1KQG B;  2YO2 A;  3I5C A;  2E5T A;  3G4S P;  2OQQ A;  2Q3E A;  2FQ2 A;  2IDB A;  5KAI E;  2FFD B;  2QA4 P;  1GPJ A;  4GOF A;  3LRY A;  2JQ4 A;  3L74 D;  1KQF B;  2BHV A;  4XFY A;  5KP7 B;  1WT6 A;  4GR2 A;  3L70 G;  1M56 D;  4XFZ A;  2PRR A;  5BU8 B;  1L0L D;  3CXC O;  3BCC J;  4LC1 A;  1R8E A;  2GZG A;  1KZU B;  2Q6Q A;  2QM7 A;  5CCG C;  2QG4 A;  3PRJ A;  1L0N J;  1SQV E;  2BUO A;  2PY8 A;  1X8Y A;  1M1J C;  1VF5 C;  1PGQ A;  1Y9B A;  2E75 B;  2BAS A;  1BE3 E;  5AW7 B;  1DIP A;  2FBW C;  1LTG C;  5F2N A;  3P7K A;  3K5B A;  2JDI H;  3M0D C;  2KS1 B;  1LT9 C;  1YQ4 C;  2KNC A;  2QJY B;  1GK6 A;  1EXJ A;  1NTM G;  2EFJ A;  2E74 B;  4OGQ C;  3D70 A;  1SQP K;  1JCC A;  2KOR A;  5KLI B;  1RF1 C;  3Q20 A;  2VRS A;  2E75 D;  2LXB A;  1MUU A;  1BGY E;  4DT0 A;  1ZNV A;  1YTZ I;  3AE3 C;  1OVU A;  5H2F H;  1N7S B;  1P84 E;  1DEE G;  1HUC A;  2KZI A;  1RE4 A;  2OAR A;  1LTJ C;  2E74 D;  1T3J A;  3Q5R A;  3L72 E;  3RL0 g;  2QJK B;  2IX7 C;  1NU1 G;  2JU1 A;  4JBZ A;  3TF5 A;  4DCK A;  2IYP A;  1W2B O;  1JY3 P;  5APT A;  3Q3D A;  2FXP A;  1NWQ A;  1LTB C;  1BE3 J;  3L71 E;  3SFD C;  1GL2 C;  4I7Z B;  1N7S D;  2K9Y A;  1RQU A;  4NPE A;  2FYN C;  1T3U A;  3RK3 B;  1ACP A;  1LGH B;  1S4X A;  1ZMB A;  2IBZ I;  5H2F E;  1EIA A;  1WRG A;  2XZR A;  2PEQ A;  1FC2 C;  1QL1 A;  1KYO I;  2BQ1 E;  3R2P A;  2FQ0 A;  3NY7 B;  1IFD A;  1BSH A;  2WWW A;  2ZXE B;  2KR5 A;  1SP4 A;  2ITA A;  2WIT A;  1JUN A;  3O8Z A;  3L73 D;  3AEG C;  2P67 A;  1HTL C;  3H1L D;  2HR3 A;  1N7S A;  3L74 G;  1AA0 A;  3EJE A;  2FY8 A;  1EDK A;  5KLV K;  3VN0 A;  3RK3 D;  3CPW O;  1IK7 A;  1MKM A;  1EZV I;  4IOI H;  4U0A A;  3UIA A;  3RBX A;  3L72 J;  1LWU A;  1YI2 P;  2M8N A;  1NTK D;  2WPS A;  4U0D A;  2ZFC A;  2FVE A;  4XFJ A;  1NH4 A;  3H1J E;  2HPC B;  3M1M A;  3L71 J;  2FYU E;  2ZVN B;  4GOD A;  1NQ4 A;  3H1I D;  1FZA A;  1M1J B;  3IF4 A;  2ZJS E;  1VF5 B;  1G1I A;  3EWK A;  3M9B A;  1QLE D;  2WSC H;  2BCC D;  4YTP C;  3V5B A;  3A5T A;  5CBN A;  2JKV A;  1FJK A;  1SQP D;  2JB0 A;  1D7M A;  2KOO A;  1GMJ A;  1F80 D;  5CZD B;  3E1R A;  2O01 N;  1NKN A;  3EFF K;  2GZE A;  1KQL A;  1SFC C;  2QRX A;  3MUD C;  1ZR2 A;  3DTJ A;  1S1C X;  1BCC E;  4OGQ B;  1RF1 B;  2KI7 B;  5CCG D;  1X9V A;  2PEI A;  5DCK A;  3I55 P;  2HFE D;  4PH0 A;  3H25 A;  2LIW A;  4U0B A;  3NMD A;  2GYK A;  4N6J A;  4COC A;  3U1A A;  2YKQ A;  2O1K A;  1IK9 A;  4W7Y A;  4H2Y C;  3G1G A;  2ZAE B;  3HE4 B;  1LTJ B;  4ZKU A;  5CCG A;  3H1J J;  2FVA A;  2FYU J;  1DD3 A;  2WPV B;  5KJ7 C;  4U0C A;  2EG5 A;  2OTJ P;  1M8O B;  2K0D X;  4WBA A;  5HVC A;  1HBW A;  4IFM A;  3L37 A;  3U1C A;  2IFM A;  3M0D A;  4HKZ H;  3WUT A;  1LT9 A;  1HQB A;  1GL2 B;  3CC2 P;  3VTP C;  3CD6 P;  2FYN B;  2PEM A;  3V2P A;  1NYH A;  1PEO A;  3ITK A;  3FX0 A;  1AQT A;  1OW8 A;  1ZXG A;  1JB0 J;  3H1H E;  3HUS C;  1KLP A;  3HE5 B;  3L73 G;  2QSI A;  2NPS C;  3H1L G;  1KIL C;  1NTM K;  3TDK A;  1L0I A;  2KGA A;  3DPH A;  4IFD K;  1T2K C;  2KOS A;  1SQX D;  3Q5P A;  3C1L A;  1LT1 A;  2WSC J;  1PPJ D;  1GL2 D;  1KFN A;  5APS A;  4NPD A;  1X22 A;  2RMZ A;  1HJ0 A;  2N5I A;  1NTK G;  1CEI A;  4UB8 H;  5F2K A;  3GZM A;  2AFD A;  3N4X A;  3IAO A;  4GIF A;  2JBG A;  2KOG A;  3H1I G;  1URQ B;  3G71 P;  1KC8 Q;  4BRY A;  1NU1 K;  1LTS C;  2NO8 A;  2BCC G;  2N9B A;  4TLF A;  1GL2 A;  4IL6 H;  1LTA C;  1GZL A;  4C7N B;  1NOH A;  2O01 J;  1IMP A;  3ABV C;  4D6T E;  3EQ2 A;  3TNU B;  2RH0 A;  3HE5 A;  1WMK A;  1EOQ A;  4KJM A;  1M90 Q;  2XZ1 C;  3H1H J;  2KP8 A;  1SQP J;  3AE7 C;  2SPZ A;  2QNW A;  2MR8 A;  4UB8 E;  2FVF A;  2KZJ A;  2XT1 A;  2IYO A;  1SFC B;  5BVZ A;  2P1J A;  4PXH B;  2IBZ D;  3PP5 A;  3AE1 C;  1H89 A;  2WMM A;  4JQ0 D;  1S9K E;  4ASV A;  3RGU A;  5CHX A;  5KLV E;  4IL6 E;  2IFN A;  3CCE P;  1QRJ A;  3G26 A;  1BXI A;  1JNM A;  1ZOY C;  3M9H A;  3HD7 C;  1KB9 H;  4B86 A;  2WT7 A;  3HZQ A;  1CI6 A;  1IUQ A;  1AVO A;  2KLV A;  3D6Y A;  2FAC A;  1QX8 A;  2EHT A;  2V4H A;  5EFW B;  1AUM A;  3PLN A;  2FAD A;  2KSJ A;  2W6B A;  1SFC D;  2C0X A;  2GA1 A;  1RO2 A;  3MGN A;  3TGU D;  1USE A;  3RK2 C;  1EZV D;  3SSU A;  4L75 A;  4U3F D;  3CXH H;  1QEX A;  1HH0 A;  4H13 C;  3TNU A;  1NAY A;  1D1D A;  4CA3 A;  4IFF A;  4D6T J;  1BSN A;  1PEU A;  3QH9 A;  2V7Q H;  3GZL A;  4WY4 D;  1KB9 E;  1PP9 D;  1JY2 P;  5CJ4 A;  1N2D C;  1SFC A;  1NTM D;  4HKG A;  2EIA A;  3MUD A;  4XA4 A;  1VQL P;  1SQX G;  3U59 A;  3HUS B;  1RF0 C;  2YMY A;  3MP7 B;  1L4A C;  5B5E E;  2NPS B;  5KJ7 D;  5KLV J;  1PPJ G;  2A06 D;  2AXT H;  2MVU A;  1ZP0 C;  3KQG A;  3CXH E;  4H0L D;  4WY4 A;  1GK4 A;  2AEM A;  3II6 A;  1QVG O;  3CX5 H;  4EYY Q;  1ZRT E;  2KB7 P;  1FZE A;  3BCC E;  3E7K A;  3VRL C;  2L4B A;  1AF8 A;  5KAI H;  1LNQ A;  1NU1 D;  2KG8 A;  2W8Z A;  3L70 E;  5AVX B;  2JYG A;  3G29 A;  5KJ7 A;  2NPS D;  1KIL D;  1KMI Z;  2WVR A;  4N3Y B;  2VLQ A;  4BXL A;  2CG5 B;  2O3J A;  3LW5 J;  2AXT E;  4I1L A;  2LR2 A;  4Y99 C;  2IPP A;  2N5H A;  2PAJ A;  2Q5U A;  1SQQ D;  2MJZ A;  3MGE A;  1G1J A;  1NAF A;  3L75 D;  2LPK A;  1E79 H;  3HUS A;  2AFE A;  2B89 A;  2HOD A;  4JYC A;  3GF3 A;  2VSQ A;  3P05 A;  2NPS A;  2IBZ G;  3S1K A;  1KIL A;  4PD4 H;  3HTK A;  5AVV B;  1T8Z A;  2M8R A;  2Z5H A;  2IZ1 A;  4GDO A;  5KTB A;  2N6Y A;  4NEO A;  1HF9 A;  1JY3 O;  4M3L A;  2VLO A;  4UHP B;  4OWF A;  5DJT B;  2C9L Y;  1K05 A;  2Y9Y A;  1AVY A;  3CCS P;  5APQ A;  2V7Q J;  2M0B A;  2OYI C;  1KN7 A;  4QKO A;  2J58 A;  3U43 A;  5CMZ A;  4ASW A;  1VQP P;  2AEF A;  3L70 J;  2MVV A;  3TGU G;  2JWA A;  1J1E B;  1EZV G;  5M1B A;  1NTK K;  1VQK P;  4PD4 E;  3B5N D;  4U3F G;  3WBH A;  1NU1 E;  1P84 H;  3B4S A;  3RK2 B;  4HB1 A;  2P7J A;  3DS1 A;  4EIJ A;  1PP9 G;  1GW4 A;  4H13 B;  3G6E P;  1GXH A;  1KOR A;  1VQO P;  1T6A A;  1UIX A;  3P8C D;  3HD7 D;  3OAK A;  2YO3 A;  1RO0 A;  5HV8 A;  2AVA A;  2Z46 A;  3B5N A;  2RN0 A;  3S9O A;  1NTM J;  3P8M C;  2FAE A;  3OW2 O;  2A06 G;  2YNY A;  2CWO A;  4BPH A;  1DX7 A;  1EDJ A;  1J1D C;  3DS3 A;  1CSB A;  3RK2 D;  1GTW A;  1L4A B;  1M74 A;  2QEX P;  1T8K A;  3F89 A;  4H13 D;  3HD7 A;  1VQ5 P;  3L74 E;  2K93 A;  4YXD C;  1IFM A;  3WUU A;  3AEA C;  3SWK A;  1JJ2 O;  4WYM A;  1YJ9 P;  2K88 A;  2KGE A;  1LWU B;  2X2B A;  1L0L E;  4RKU J;  1SQV G;  3P32 A;  2KXP B;  1DH3 A;  1PV3 A;  1VL2 A;  1Q90 D;  2K0Y A;  2M8P A;  1NU1 J;  1KB9 I;  2K9J A;  1L4A D;  2QM8 A;  3AEE C;  1YTZ T;  1SQQ G;  2Q9I A;  1OVV A;  2DW3 A;  2ZT9 C;  4JF7 A;  1NTZ D;  3L75 G;  5AW6 B;  3D71 A;  4Y99 B;  4IZ6 A;  5AW8 B;  3VMA A;  1AQ5 A;  2WPT A;  1ZME C;  2GZJ A;  2LIU A;  2A45 H;  2GUS A;  3SFE C;  2KG9 A;  3CXH I;  1RF0 A;  4Y28 J;  2GZF A;  3DS2 A;  1L4A A;  1BGY G;  2WPQ A;  3BRT B;  5AW2 B;  1SQX K;  2N9Y B;  1IC2 A;  2MKV A;  3H1K G;  1Q82 Q;  1MV8 A;  1JY3 N;  3CMA P;  1G2C A;  3L74 J;  3M91 A;  1PFI A;  4JYB A;  2K2Q A;  1VQ6 P;  1OWA A;  1FDM A;  1JTH A;  2K1A A;  1L0L J;  2XNX A;  4L73 A;  4ZNC A;  2PEN A;  1FE6 A;  5GTI H;  3M9Q A;  1RE3 C;  2R3C A;  2PNG A;  2JEE A;  4PV1 C;  4AUW A;  2Z44 A;  2Y0D A;  3CX5 I;  1FZC A;  2UWJ E;  2KSE A;  3C8V A;  1SQB D;  2KOD A;  3RG6 C;  2NZ2 A;  4I2L C;  3G0V A;  1LT9 B;  4H2X C;  2KIK A;  3G28 A;  1K9M Q;  2XDJ A;  3TK1 A;  2D2C D;  1M6N A;  3PJS K;  3CCJ P;  2J5U A;  4XRO A;  1J2J B;  2KUB A;  1EDI A;  2H89 C;  2KK7 A;  5E79 E;  1GU5 A;  5GTI E;  5KP6 B;  1EQ7 A;  4DZO A;  3L73 E;  2LXC B;  2FHS C;  3GF7 A;  1PZQ A;  3H1L E;  3Q5S A;  2O01 H;  3OJA B;  2LKI A;  4WY4 C;  1J1D B;  4QMA A;  1YQ3 C;  2MF4 A;  2YMK A;  4OVN F;  3RK3 E;  4PD4 I;  2OYI A;  3RL0 C;  5HGM A;  3A7O A;  2XU6 A;  1VDF A;  3GLM A;  3A3Y B;  1LTI C;  1HY8 A;  4DOJ A;  5I4T G;  4IPY A;  2AF8 A;  1S5L X;  2H88 C;  4WWI A;  1OX3 A;  1NTK E;  4O9B A;  5AVZ B;  2CNR A;  2O1J A;  1IZN B;  4H0L C;  1U7M A;  4JPZ B;  3T97 B;  1FU1 A;  4BRY B;  1M1K Q;  1NTZ G;  2LKM A;  3WU2 H;  2FKW B;  3H1I E;  3EFG A;  3H47 A;  2BCC E;  2CQ8 A;  2L5G B;  2ZT9 B;  1PGO A;  2WSS H;  1SQP E;  2YKO A;  2ZYA A;  3E2D A;  4KT0 J;  1P84 I;  1RH5 B;  2P58 A;  1BCC G;  2R44 A;  1IO4 A;  1N73 C;  2L9F A;  4U7J A;  2JGP A;  4EDF A;  1OVR A;  1Y47 A;  2N1T C;  3L73 J;  3LID A;  1Q2N A;  4PWV B;  3H1L J;  2Z4E A;  2M5A A;  2QJP C;  3V2N A;  3V2Q A;  5JPA A;  3WU2 E;  2PFX A;  2YKP A;  2LF4 A;  2GUV A;  2ZT9 D;  1Y8A A;  3AE2 C;  2Q3I A;  1DNY A;  2W83 C;  2R32 A;  1FZF A;  1S3J A;  2WT7 B;  4AQR D;  2CK3 H;  2JU2 A;  1CI6 B;  3KDP B;  1FOS E;  1EDL A;  3BRV B;  4CPG A;  3CCM P;  1QVF O;  1NTK J;  3T97 A;  2QE7 H;  3CWB D;  4MN4 C;  2KLU A;  3FXE A;  1SQB G;  5TJH A;  1SQV K;  3VMZ A;  3H1I J;  4RO0 A;  1N7L A;  1DD4 A;  1JCD A;  2BCC J;  1HGZ A;  4W80 A;  2N6Z A;  5AW4 B;  4RES B;  1SQQ K;  2L91 A;  2XZ0 D;  4UB6 E;  3R4Y A;  3B5N C;  1FBM A;  1YJN P;  2YIU C;  2K0X A;  2L0Q A;  1SLQ A;  3G9R A;  2BEQ D;  1KQS O;  2OTL P;  2Z5I A;  1KYO D;  1AYI A;  1N8R Q;  3O6Q A;  3LW5 H;  2KOQ A;  2C0W A;  1R5L A;  1SQX E;  4PV1 D;  1YIT P;  3V4W A;  5K5G B;  3NXS A;  2P2U A;  1LP1 B;  1VHN A;  2A45 I;  3ZDM A;  1PPJ E;  1FZB A;  4WY4 B;  1KV4 A;  5HGN A;  1CZQ A;  3V2R A;  4H44 D;  2HYN A;  1JO5 A;  1X79 B;  3MD0 A;  1SS1 A;  5B5E H;  1HWT C;  2WSF H;  1GU4 A;  1RE3 A;  3H4E A;  3GJN A;  1L0N D;  1LJ2 A;  2DGY A;  5GTH E;  2VLN A;  1OW7 A;  5CCH C;  4H0L B;  1TU3 F;  4PJ0 E;  2Z45 A;  2R5B A;  4U0E A;  3RL0 D;  1A8O A;  1EXI A;  2ONT A;  1YBK A;  3G21 A;  3CX5 D;  1L0H A;  2HOD B;  4COP A;  1YYC A;  4XFX A;  4ZKP A;  1AV1 A;  1CW5 A;  1KIL B;  4A7P A;  3HTK B;  1IFI A;  2Y0C A;  3KHU A;  3MHV A;  3CC7 P;  3B4Q A;  1N73 B;  1LP1 A;  1USD A;  5CBO A;  5BS1 A;  1SQX J;  2IBZ E;  4WB4 A;  1Q7Y Q;  2N1T B;  4DJG A;  3PH0 A;  1KYO E;  5B66 E;  1KTM A;  3A2A A;  2WSE J;  2JO1 A;  2ZVO B;  1RNI A;  2KG6 A;  3CWB G;  3CCL P;  2QVA A;  5AW0 B;  1SQV D;  2W6J H;  2WPR A;  3QWO C;  2B87 B;  1K30 A;  1FZC C;  1BE3 D;  3TGU E;  2CPB A;  1EZV E;  2N1T D;  1H88 A;  2ZXX A;  4XE5 B;  3VP9 A;  7CEI A;  4U3F E;  5APU A;  5APW A;  2MR7 A;  1GD2 E;  1NTZ K;  2M5R A;  1ZN5 A;  2B9B A;  3WUV A;  3GW6 A;  3CLQ A;  1VQ7 P;  1LTT C;  1PP9 E;  2ZYD A;  3I56 P;  1NHL A;  3Q2Y A;  1NTM E;  1N73 A;  5KAF E;  2WSF J;  3B5N B;  4WVZ A;  2LTE A;  2YIU B;  3AE8 C;  2N1T A;  2RKL A;  2N98 A;  2CPS A;  3AE6 C;  1H0T A;  1BGY D;  1Q86 Q;  1VQ9 P;  5KP8 B;  2OYO A;  1JMB A;  2A06 E;  3AED C;  3H1K D;  2IZ0 A;  1P84 D;  1JM0 A;  1YIJ P;  2D2C C;  3HD7 B;  4EI2 A;  3G3Z A;  5AVS B;  2W27 A;  1EMV A;  2E43 A;  3BCC G;  2R3S A;  2YXR B;  3NTE A;  3L72 D;  2B87 A;  2G3A A;  1Q81 Q;  1L0N G;  5AVR B;  2XKM A;  3DS4 A;  3TGU J;  1GXG A;  4PH1 A;  3L71 D;  2W90 A;  1W2E A;  3CI9 A;  1KIL E;  1Z6M A;  4U0F A;  3PTZ A;  2OYH A;  5L8R J;  4U3F J;  2K9J B;  5APX A;  4HJG H;  2N50 A;  1AFO A;  1AJY A;  1FOS F;  4K35 A;  1SQB K;  3FWN A;  2LL8 A;  4C7R A;  1SQQ E;  3V6I A;  1H8A A;  1PP9 J;  2JR8 A;  3KZI H;  3L75 E;  1PGJ A;  2I1J A;  2KWL A;  3Q1M A;  2K3R A;  3CCQ P;  1RHZ B;  2FFD A;  1K73 Q;  3TSI A;  3CCU P;  3LMO A;  5AVY B;  2M3E A;  3PHL A;  2DNW A;  5CCH D;  2P9X A;  2G8Y A;  3RBZ A;  1G2C B;  3H6P A;  3IFM A;  3NFQ A;  2L22 A;  3H1K E;  2R5D A;  5DJU B;  2GDY A;  1JTH B;  1W5C E;  1YJW P;  4GT1 A;  3KZI E;  3AEB C;  3H1J D;  1BE3 G;  2C9N Y;  4YXW H;  2FYU D;  1BAJ A;  1SQV J;  5CCH A;  3H32 B;  2E5Y A;  1U57 A;  2E76 C;  1FZC B;  3N7N A;  3E1I A;  4MRT C;  3V4Q A;  3LIE A;  2J59 M;  3GG2 A;  2KS1 A;  4TT3 H;  1SQQ J;  1VPC A;  1JMM A;  2KYV A;  3L35 A;  1KD1 Q;  3B5I A;  2K94 A;  4BPF A;  3L75 J;  2JP3 A;  1KFM A;  1NVO A;  3P8C E;  1OR5 A;  1E6J P;  3DS5 A;  3GKL C;  3AE9 C;  1HJB A;  1BCC D;  2M8L A;  1NO4 A;  2AEJ A;  3F5H A;  1OW6 A;  3FGA D;  3W68 A;  2K5X A;  5F2O A;  1PIX A;  4Z1M H;  1HGV A;  2M3B A;  1FS0 E;  1BGY J;  1K8A Q;  3H0D A;  4DG9 A;  3D6Z A;  1L2P A;  3H1K J;  3L72 G;  3A0B H;  3BAT A;  2OYI B;  2D2C B;  5E79 H;  1L0L G;  3FWL A;  2WZ7 A;  2KW2 A;  2MY5 A;  3L71 G;  3L4F A;  1IFP A;  3FXD A;  3IR9 A;  3H32 A;  2ZYG A;  2PEO A;  2GM4 A;  4LLH A;  1JOC A;  4HH2 A;  1URQ C;  3TYY A;  2PEJ A;  4RJT A;  5APV A;  3CL3 D;  1FZG A;  3KXD A;  4H44 C;  4IL6 X;  2I1K A;  5AW3 B;  2W6A A;  1NTZ E;  2KGC A;  3A0B E;  1IFJ A;  3H1H D;  4GR6 A;  5AW1 B;  3GHG C;  2XND H;  5AVT B;  1FJP A;  1BDD A;  3G1I A;  2MD9 A;  2M5A B;  4M0I A;  1QGK B;  2POH A;  1OXZ A;  4NPF X;  1VF5 D;  3MIW A;  1A02 J;  3JC2 2;  2L6E A;  4H2W C;  3A0H H;  3H1J G;  2QIW A;  2FYU G;  2FYZ A;  2A45 G;  2EHS A;  3RG2 A;  1R5S A;  2K37 A;  3W67 A;  2HG5 D;  1DEB A;  2HPC A;  1L0N K;  4BPG A;  4OGQ D;  3WMM 0;  2CGQ A;  2JYL A;  4N78 D;  4F37 A;  1M1J A;  1X3O A;  1ZLL A;  2I8D A;  2E42 A;  4GKG A;  1PL5 A;  3SWY A;  2Q1K A;  3GMA A;  1N86 A;  1SQB E;  2E76 B;  1VKU A;  1HVV A; 
#chains in the Genus database with same CATH homology
 3H4E A;  2M8P A;  5F2N A;  5JPA A;  3CCS P;  2E1M A;  1VQL P;  1K73 Q;  1M6N A;  3CCU P;  3CCJ P;  4XRO A;  2LF4 A;  2PEO A;  1VQ7 P;  3CCV P;  3G1G A;  2DGY A;  2P9X A;  3I56 P;  1PEQ A;  3DS0 A;  2XV6 A;  1VQ8 P;  2PEJ A;  1VQP P;  2Z45 A;  1EOQ A;  2EFJ A;  3CPW O;  3CC4 P;  1M90 Q;  4U0E A;  1VQK P;  4U0C A;  1VQN P;  3CCM P;  1YJW P;  2EG5 A;  1QVF O;  3CME P;  1Q86 Q;  1VQ9 P;  2OTJ P;  3WBH A;  3Q20 A;  1QVG O;  4U0A A;  1YHQ P;  1A8O A;  2XT1 A;  2ONT A;  1K9M Q;  3G21 A;  1BAJ A;  5HGM A;  1YI2 P;  2M8N A;  4COP A;  4XFX A;  1YIJ P;  3DS2 A;  3DS1 A;  4U0D A;  3CC2 P;  4GR6 A;  3CD6 P;  3VRL C;  2PEM A;  5I4T G;  3G6E P;  1A43 A;  3CC7 P;  1PEO A;  3M1M A;  4IPY A;  3NTE A;  1VQO P;  3CCE P;  1PEM A;  2JYG A;  1QRJ A;  3G1I A;  3G29 A;  3G26 A;  5BS1 A;  5HGO A;  1Q81 Q;  3HYB A;  1NJI Q;  1Q82 Q;  1Q7Y Q;  1RO0 A;  2OAR A;  3CMA P;  2Z46 A;  3B5I A;  1KD1 Q;  3G4S P;  3DS4 A;  4M0I A;  1VQ6 P;  5BS2 A;  3HZQ A;  2XXM A;  1YJN P;  1IUQ A;  1M1K Q;  2QA4 P;  4PH1 A;  3OW2 O;  3DPH A;  1E6J P;  3DS5 A;  3LRY A;  4U0F A;  3CCR P;  2CWO A;  1VQ4 P;  5HGL A;  4XRQ A;  1KQS O;  1AUM A;  1M6E X;  2L6E A;  1S72 P;  1W2B O;  2OTL P;  2PEN A;  3DS3 A;  3MGE A;  2M8L A;  3H47 A;  1RNI A;  1RO2 A;  1N8R Q;  2BHV A;  4XFY A;  1M74 A;  4GR2 A;  5F2O A;  2QEX P;  3CCL P;  1YIT P;  3DTJ A;  4QNB A;  4XFZ A;  2JO0 A;  3P05 A;  1VQ5 P;  3E2D A;  2Z44 A;  3CXC O;  1K30 A;  2PEI A;  1ZMB A;  5DCK A;  1K8A Q;  1D1D A;  5HGN A;  1EIA A;  1JJ2 O;  1VQM P;  3I55 P;  3H0D A;  4WYM A;  5F2K A;  2PEK A;  2JYL A;  2KOD A;  4PH0 A;  2PEQ A;  1PEU A;  1YJ9 P;  3RG6 C;  2BUO A;  2PY8 A;  2BQ1 E;  3G0V A;  4U0B A;  3CCQ P;  3G71 P;  1KC8 Q;  4COC A;  2EIA A;  3G28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...