3CCRP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccrP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccrP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccrP02
1KC8Q 1YIJP 1Q86Q 3CCQP 3CMAP 1KD1Q 2OTLP 3G6EP 1QVGO 3I55P 1K8AQ 1JJ2O 1VQNP 2OTJP 1VQKP 1Q7YQ 1YITP 1K9MQ 1VQ4P 1YJNP 3CCEP 1VQPP 3CCUP 1W2BO 2QA4P 2QEXP 3CC7P 1YI2P 3CCMP 1S72P 3G71P 1YHQP 1NJIQ 1YJ9P 1M1KQ 1VQ9P 1KQSO 1VQMP 3CC2P 1VQ8P 3CC4P 1VQ6P 3CD6P 3CCSP 1YJWP 1VQ7P 1Q82Q 1VQLP 1Q81Q 1N8RQ 1K73Q 3CMEP 3CCVP 3I56P 1VQOP 1VQ5P 3G4SP 1M90Q 3CCLP 3OW2O 1QVFO 3CCRP 3CPWO 3CCJP 3CXCO
chains in the Genus database with same CATH superfamily
2FHSC 4WY4C 2HPCB 3F5HA 3M9HA 1DEEG 2KGEA 1KD1Q 1GXHA 3MGNA 2M5AA 3L74D 1HQBA 1AYIA 3SFDC 2ROQA 2N6ZA 2E5YA 2P58A 1LGHB 4W80A 2XNDH 2QSIA 3H1JE 1AJYA 1LTBC 2NPSC 2ZT9B 5CHXA 3QWOC 2PEQA 3JCUE 2O01H 4KT0J 1T2KC 1CEIA 3H1HD 2QJPC 3CCEP 3VYIA 2FQ2A 2QEXP 3LRYA 2N1TB 1FU1A 3MP7B 1H0TB 3HE5A 3N4XA 4L75A 4HJGH 1PP9D 2QJPB 1JY3N 3B71A 2R44A 4L74A 3LW5H 1ZOYC 3G21A 2K37A 1S5LE 1IFIA 2JJLA 4PD4E 1YTZT 2L4BA 4N6JA 3RK3D 2M0BA 2FFDB 5KJ7D 2GZJA 2GDWA 3PP5A 1GDTA 2RKLA 3Q20A 3MUDA 5KP7B 4H2XC 4C7NB 1E79H 3Q5RA 3D70A 5AW0B 3U43A 2ERHA 3Q1MA 2Z4EA 2QIWA 2MF4A 3RG6C 2W90A 1L4AC 2IZ0A 5BU8B 2UWJE 2C9LY 3II6A 3IF4A 2E76D 5I4TG 2ZVNB 3AE9C 1S72P 1NTKK 1WRGA 1DD4A 3BRTB 2Z45A 1VQ7P 1SQVG 2IYPA 3H1HG 3NTEA 1VQ5P 1LT1A 2FXPA 2K3RA 1R8EA 2OYIC 2C0WA 3RL0g 4W7YA 4JYBA 1GPJA 3KQGA 2LOLA 3L71G 1PGOA 1IC2A 2Y0EA 4EI2A 2H89C 1NTZE 1FZCA 3P8CD 4N78D 5AW2B 3G9RA 1SQPK 1NJIQ 1BSHA 3H1JD 2K0XA 1ZN5A 2YO2A 2Y0CA 5AW4B 1JMMA 2WZ7A 1D1DA 1HGZA 3V2NA 1MUUA 1L4AA 3MIWA 1OX3A 4ASWA 1EC5A 1HH0A 1UIXA 2WT7A 3WU2H 1URQC 2KG8A 1Z6MA 4RKUJ 1PP9G 2OYOA 3CC4P 1VQ6P 2H8PD 2IX7C 1NU1E 1N73C 2QG4A 1LNQA 3H1KJ 2OYHB 2HODA 1KQFB 1BGYG 3SSUA 3NTNA 5HGLA 1EMVA 1J1EC 4D6TE 4DCKA 2QRXA 2ZYAA 4OWFA 1FS0E 1KB9D 2KNCB 2VRSA 4Z1MH 1M90Q 3GG2A 1RHZB 2LTEA 3NXSA 1T8ZA 4XRQA 4YXDC 2FYUE 5AVYB 4MN4C 1R5LA 3CE7A 4U0CA 5AVTB 1NGMB 1HY8A 3L36A 4I1LA 3EJEA 3L71E 5KKZB 1OFCX 1H8AA 5BS2A 2XDJA 1FE6A 3VMXA 3GZLA 3L72E 1T8KA 4PV1C 4B86A 1PIXA 2KSEA 2WPQA 2E1MA 2CPBA 3Q2YA 2OTLP 3L72G 2ZYGA 1L0NK 5GTHH 1LTTC 2R3SA 1NWQA 3TDKA 1JO5A 2Q1KA 1OZHA 3GZMA 3B5NB 3P05A 2SPZA 4WY4A 4BRYA 3B5NC 1IZNB 3V5BA 3DS0A 2KSJA 4H44C 3R4YA 2AVAA 2PRRA 3GW6A 1D7MA 4D6TG 3GLMA 2A45I 1RNIA 4WBAA 3AE4C 4IFMA 2FYZA 1BCCD 1S5LX 2ZXEB 5CCHA 3D6ZA 2IZ1A 4TLFA 2B88A 3EWKA 4PD4I 3VMAA 1OVRA 1SLQA 5KKZC 1N73A 2KI7B 5KLVD 1JY2N 1JY3P 2LMLA 2E76B 5BU5A 2P1JA 3RK3C 1Z56A 1DD3A 2GZGA 1RF1C 5JPAA 2KGAA 5APWA 3SWFA 2MVVA 2FXMA 2Q6QA 1IMPA 2PGDA 1J1EB 2E42A 1BE3G 2K0YA 1SQBE 1AUMA 1EDLA 4XE5B 2I1JA 3BVHA 2LXBA 1PV3A 3H1IJ 1Q81Q 2YXRB 1KMIZ 2AEFA 1T2KD 1QEXA 1IJDB 1NTZG 2N9YB 4ZKUA 5HVCA 1KYOD 2O1JA 1M8OB 2NPSD 3M9QA 2LF4A 2BASA 3VTPC 5B66H 2KGDA 4K35A 1BCCJ 4DT0A 1RE3C 2ZJSE 1Q90D 4IZ6A 1KQGB 5GTIE 3KYQA 1VQNP 3T97B 2AF8A 3A0BH 2WPRA 1KQLA 4AYCA 1VQ9P 2M8RA 3U59A 1PPJG 5AVQB 1QX8A 2LL8A 1JUNA 2XXMA 1M56D 2YKQA 1OXZA 2FFDC 3BCCJ 2ZYDA 3CCLP 4QMAA 2GDYA 5CCGC 2B87A 4UHPB 3GMAA 1MV8A 2EIAA 2HPCA 1SQXG 1X0TA 4IOIH 5KAFH 2PFXA 1MFZA 1X9VA 1SQPE 2FY8A 3CI9A 2N5HA 4XA4A 3FXEA 3RK3E 2YNYA 3H4EA 1NTMK 2FXOA 4WB4A 2QM8A 1JY2O 3HRNA 3A5TA 2W8ZA 2R3CA 5CMZA 5EW5E 1PPJE 1SQBD 2P2UA 2GZIA 3H6PA 1MKMA 2IBZI 1GL2B 3CX5H 3O6QB 2QVAA 4BPHA 2QNWA 1GL2A 3H1LD 2J59M 3A7OA 2BEQD 3L75D 2LPKA 2EHSA 3H1HJ 4IL6E 1N7SB 2WQYC 1FR2A 4KHXA 2H43A 2IYOA 3V2RA 3G26A 1KILE 1OVVA 1GU4A 3VMYA 1X22A 1YITP 1K9MQ 5AW7B 2RMZA 1FZBA 1URQB 3CC2P 4XFJA 1SQQK 1NQ4A 3G4SP 4HKGA 1GK4A 1IFDA 3I5CA 1NTKJ 1P84H 1KILA 1FDOA 3HD7B 2ZXXA 2J58A 1M7LA 3E1RA 4K3AA 3WUUA 2P67A 2XZ0D 2WSFJ 2WVRA 2KR5A 1S9KE 3WUTA 1LP1B 3K5BA 2BCCD 4R4MA 1GTWA 3CCJP 1NU1G 2K94A 1YQ4C 1J2JB 2O01J 2CQ8A 2BCCJ 2KG6A 2GM4A 3A0HH 2FBWC 2BEZF 1AVOA 4GR6A 1XTGB 3CCMP 4L73A 3RK2D 2PEJA 2BQ1E 2KNCA 1KZUB 4ZMDA 2HYNA 1PEQA 1L0IA 3G29A 1FZEA 1M74A 2AEMA 4PXHB 1T3JA 1DNYA 3HE5B 2LIUA 5TJHA 1IK9A 3V4WA 4DJGA 4U3FJ 2I8DA 1LTJA 3TGUD 2C9NY 1RO2A 3H1LE 3KDPB 3TGUJ 1ZW0A 1U57A 1SQBJ 1X3OA 2JYLA 2AFEA 2DW3A 3JCUH 2W6JH 3TGUG 2QJKB 1RY3A 1VKUA 1HVVA 3GHGC 1VF5D 2R5DA 3D6YA 1NOHA 2WSCJ 3M0DC 3TNUB 4LC1A 1M1JA 2QJYB 2NPSA 3HE4B 4U3FE 2FKWB 2Y0DA 3JC22 1NU1K 1QL2A 3HTKB 3G6EP 4U3FG 1PEUA 4KJMA 1S5LH 3L70D 1USEA 4PD4H 2L0QA 2RN0A 5CCHD 2MD9A 2K88A 4PD4D 2MVUA 3RK2B 2J5UA 3CWBD 3KPEA 5B5EE 4U0BA 2A45G 3M0DA 1RE3A 1AF8A 2KIKA 4PV1D 5CCGA 1AV1A 4R0MA 3GF3A 1DV5A 1NTME 1HJBA 2N1TC 1M6EX 5B66E 5KLIC 2JGPA 1KYOI 1SQXJ 1ZMBA 3HTKA 2P10A 3DS5A 3VN0A 1DH3A 1ZRTD 2Q9IA 2ZT9C 1FAVA 1LT9A 1SS1A 3MUDC 3S9OA 4CPGA 1SQPD 2E43A 1W2BO 1YI2P 1IUQA 1EXJA 1M1KQ 1W2EA 1GXGA 2LR2A 4IL6X 2YIUB 2PEMA 5KLVE 1LTGC 1VF5C 4C46A 3NMDA 4GR2A 4H44D 4GKGA 3H47A 2O1KA 2RH0A 1JY2P 1YYCA 2A06D 1NHLA 2FQ1A 2IPPA 2L5GB 1L2PA 1AQTA 1JCCA 1BE3J 2FACA 1L0HA 3S1KA 1AVYA 1OMIA 2KORA 4U3FD 1X79B 1SQQJ 2KYVA 2AFDA 1CW5A 4PJ0H 4YPCA 4NPFX 2IBZG 1EDJA 2VSQA 1W5CE 2KGCA 2KB7P 4QNBA 1SP4A 5AW8B 3L4FA 1FZCB 1RE4C 3L70E 1HWTC 3AEDC 4AUWA 1LT9C 1HBWA 3AE6C 4F37A 2OYIA 3DS1A 1L0LD 2W6AA 2R32A 3VMZA 2JR8A 2OTKE 2I1KA 2FYUD 2N98A 1YJWP 2ZAEB 1SFCB 3EJDA 1OW6A 1S1CX 1EOQA 1L0LK 1FJKA 3V6IA 2XKMA 2JKVA 2D2CD 3NFQA 1RH5B 2YXQB 3L73J 5TISE 5HGNA 2PNGA 3CXHI 2WPVB 4GODA 3ZDMA 2JO1A 2N9BA 4EDFA 1CI6B 5KP6B 1KILC 3JSVC 3O6QA 4JPZB 2WMMA 3CX5E 1CSBA 2JU2A 2KWLA 2KOQA 5L8RJ 2BCCG 4UB8E 2MJZA 1QL1A 1FC2C 5HGMA 2KOGA 4IL6H 1F80D 3U1AA 2EFJA 1BSNA 1VF5B 3PH0A 5CZDB 2HFED 5E79E 4Y99C 2WSSH 2LKMA 3V2PA 3M06A 1YIJP 4Y99B 3Q5SA 2GYKA 1JEKA 2B87B 1FZFA 3CCUP 3P32A 2W83C 3H1JG 3L35A 4M3LA 3RK3B 2YO3A 1LTAC 5KLIB 1FZAA 1AQ5A 1BE3D 1USDA 1NAYA 1VL2A 1SQXK 3G3ZA 3L75J 2Z46A 2JWDA 1GL2D 2A45H 2QA4P 4LGDE 2L9FA 3RGUA 2XZRA 3L71D 1EZVI 3L75G 3AECC 1SQVK 1KORA 4EYYQ 1EIAA 2O01N 5AW6B 1E6JP 3WBHA 3CXCO 2WSEH 3OA7A 2LIWA 1OW8A 5CCGD 1L4AD 3AE1C 2FADA 4H44B 4BPGA 3EFGA 4U0AA 2JDIH 1U7JA 3CLQA 2CGQA 5C39A 2V7QH 2KLUA 1SQVD 2IDBA 2KOOA 2E74D 1VHNA 2WSFH 1HUCA 2NZ2A 4H0LD 2E74B 3I56P 2V4HA 1BE3E 3CX5D 2FQ0A 5APUA 2MY5A 1FZCC 4IFFA 4U0EA 1NAFA 3CL3D 3CXHE 3HZQA 1YJNP 1PEOA 2KOPA 4COPA 2FAEA 1NU1J 4I6MC 1SQXE 2LXCB 5KJ7C 1PEMA 5AVUB 3DS4A 2KZJA 1Q82Q 2V7QJ 1KFMA 3F89A 5KAIE 1GMJA 2K92A 4WYMA 1L4AB 1BGYJ 5KLVJ 3L70J 2G8YA 2IFNA 1NTMG 1DIPA 1KILB 4XFZA 1SQQG 2ZVOB 3WMM0 2JP3A 4CA3A 2HG5D 2BUOA 3L75E 3SWKA 2FVEA 2JEEA 1RF1A 3BATA 4UB6H 1JTHA 1NTMD 1P84E 5GTIH 4AQRD 1JB0J 1L0LJ 3KZIH 2ONTA 3OJAB 1OIPA 1LTSC 2O3JA 1QLED 2GUSA 1NTZD 1AA0A 1ZMEC 3GF7A 4UB8H 2B9BA 1NVOA 5DCKA 1S3JA 1NTZJ 3G71P 3A0HE 5F2NA 1ZXGA 4OH8B 2VLOA 3CCSP 2K9JB 1A8OA 4RESB 3G0VA 1K73Q 1Y47A 2Y9YA 3MGEA 3AE2C 3SWYA 1K05A 4YXWH 2E75B 1IFNA 1RE4A 2OARA 3VP8A 2OQQA 1SFCA 3B5ND 1VDFA 3RL0D 1KILD 1PP9E 1T6AA 5KJ7A 4BRYB 1EDKA 4GOEA 4TT3H 1UNKA 3MD0A 4U0FA 1SQQD 3RL0C 1KLPA 3PJSK 3NY7B 4XROA 5KLVG 2D2CC 3CCQP 2CWOA 2PY8A 1BCCE 2QJYC 3OAKA 3BCCG 2ITAA 3HUSB 4BWNA 3A2AA 1VQ4P 1N7LA 1RF0A 1M1JC 4R4LA 3B8EB 3HUSA 5H2FH 2JU1A 2VLPA 1ACPA 3CX5I 1JY3O 5APVA 1J1DB 3M9BA 5F2OA 5APSA 1T3UA 2KP8A 3LMOA 2FYNB 4HH2A 2AEJA 2K0DX 1NKZB 1K8AQ 1L0NJ 2POHA 1KB9H 3C9IA 1GK6A 1NKNA 5TISH 3W67A 3FX0A 3LIEA 3L71J 4BPFA 2KZIA 5CJ4A 5AVRB 3TSIA 1VPCA 3L72D 2X2BA 2PEKA 2N50A 3H1LJ 5DJTB 3HUSC 2K9YA 2KK7A 1FZGA 1GZLA 4W7ZA 1IFMA 1G1IA 3R2PA 1YHQP 1HF9A 5BVZA 2CG5B 2Q3EA 1HGVA 3H1IG 1PP9J 3OW2O 2BCCE 3V4QA 4RJTA 4NPDA 2E5TA 5KP8B 4IPYA 2KW2A 2KS1B 1U7MA 4QKOA 2NRGA 1A02F 4H0LB 3ITKA 4U0DA 3HD7C 2L91A 3CCVP 4YTPC 2JYGA 4NPEA 3MTUE 3H1KE 1E5WA 1G2CB 2CNRA 1LTJC 7CEIA 4ASVA 1BGYD 1BXIA 2Q7CA 2K1AA 2KXPB 4HYTB 2FYNC 2PEIA 5KAFE 2NPSB 1IK7A 1L0NE 3CD6P 2N1TD 4DG9A 3AEGC 2CK3H 2JAZA 1P84D 1UJZA 1OWAA 3I55P 5EJDA 1Y8AA 2M8LA 1EXIA 3VP9A 5AW1B 2JO0A 2W27A 1KV4A 1NTKE 1H89A 1N86A 1XTCC 2A06G 1VQOP 1GL2C 2E76C 1LTIC 3CCRP 2K93A 4JYCA 3L73E 1FOSF 1G1JA 1NYHA 5HV8A 2OTJP 2GDXA 3W68A 2HODB 2YKPA 2FYUG 4PH0A 1N2DC 2IBZE 2WPSA 3N7NA 1P84I 2FYUJ 4PWVB 1L0LG 5B5EH 3C1LA 3QH9A 1SQVE 1CZQA 4GOFA 5BS1A 2GZEA 2Q5UA 5H2FE 4H0LC 3FXDA 2E74C 2AXTE 1MFTA 1SQQE 2OYHA 1SQBK 5KAIH 4PH1A 2W6BA 1YTZI 1HTLC 4N78E 1NTKG 4UB6E 2DGYA 4I2LC 2LKIA 1MZ9A 1Q86Q 1YQ3C 2HLOA 1GW3A 3CXHH 2YKOA 3B4SA 4EIJA 2GZFA 1FDIA 2K9JA 1URQA 4GT1A 1N7SC 4PV1B 5F2KA 2M5RA 2YMYA 2GUVA 4LLHA 1M6NA 2M3BA 2FVFA 5CBNA 3CMEP 4OGQB 2WT7B 5APXA 2KODA 2JBGA 1Y9BA 1NTKD 4ZNCA 2Q3IA 3BRVB 4MRTC 2M8PA 2M8NA 2FYUK 2R5BA 3VOPA 3WUVA 2Z5HA 2KS1A 1KFNA 1SQPG 2WTYA 4JBZA 3H1IE 3H32A 1HJ0A 1FBMA 3PTZA 1JMBA 3L73D 3DTJA 3CMAP 2XV5A 4M0IA 4WY4D 4RO0A 4DOJA 4PJ0E 1ZNVA 2E75D 3KZIE 2P9XA 3AEEC 2Y9ZA 2XT1A 1PGJA 2OYHC 1M1JB 1VQ8P 1L0LE 1N73B 1SVFA 3M1MA 1LWUB 2IBZD 1N7SD 3DPHA 1QRJA 2PEOA 3UIAA 2QE7H 1RF1B 3GHGA 3E2DA 1DEBA 1OVUA 1ZP0C 3RL0B 3AEAC 1JNMA 1JTHB 3FWLA 3IR9A 1GU5A 2A06E 1IFPA 4HB1A 1MZ8A 1NTMJ 2E75C 2HR3A 5APTA 1AFOA 3EQ2A 3L74G 3CPWO 2MR7A 1UIIA 1ZRTE 1RO0A 5GTHE 3G28A 1PGPA 2PAJA 4JF7A 3PLNA 1EQ7A 1SQBG 2PP6A 3ABVC 2DNWA 1K04A 2P7JA 3IAOA 1EDIA 3L37A 1R5SA 2K2QA 3V2QA 4GIFA 3M0AA 3FGAD 2M3EA 2C0XA 4BXLA 3H0DA 2ZT9D 1LWUC 2OYIB 1JOCA 2XNXA 4I7ZB 1LT9B 3Q3DA 3E7KA 3DS2A 3BCCE 2JQ4A 1KQSO 3H1KG 3EJBA 2VLQA 3T97A 3EFFK 5AVVB 2OGUA 3TK1A 1Q2NA 3SFEC 3CWBJ 1ZR2A 4N3YB 3RBXA 3L72J 1SQVJ 3L74E 1NO4A 4XFYA 3CWBG 2Z5IA 1BDCA 3D71A 2NO8A 2VLNA 1H0TA 3RG2A 3AEBC 4DZOA 3GKLC 3MHVA 1TU3F 3L70G 1EZVD 3M91A 3C8VA 1NH4A 2EG5A 3AE3C 2G3AA 4OGQC 1EZVG 2IFMA 5EFWB 1Q7YQ 3G1IA 2H88C 2WPTA 5CBOA 3RBZA 3HD7D 4H13D 1M57D 3IN6A 1SFCC 3Q5PA 1N8RQ 1ZLLA 4GDOA 1BAJA 3P8CE 1OR5A 1KB9I 1PZQA 2WSCH 1KYOE 3P8MC 3AEFC 2M5AB 1KN7A 4I7ZC 3A3YB 3MZWB 1VQKP 1K30A 1IO4A 4D6TJ 4XFXA 1PGQA 2WSEJ 3CWBE 1G2CA 1YBKA 2Z44A 3BASA 4WWIA 4IFDK 2MKVA 3BCCD 3FWNA 1LWUA 5AW9B 2KUBA 1N7SA 1A02J 3IFMA 1IMQA 1NTZK 4O9BA 1FDMA 2XU6A 4NEOA 3E1IA 3USSA 2H7HA 5AVXB 2XV6A 2B89A 1L0NG 1E0HA 5CJ0A 1RQVA 5CCHC 2JB0A 4H2WC 3H32B 1CI6A 2XZ1C 1WT6A 2L6EA 1QGKB 3LW5J 1NU1D 2MR8A 1BCCG 3B5NA 2N6YA 1SFCD 1L0ND 2FFDA 2QM7A 4A7PA 3WU2E 1KTMA 4ZKPA 1FJPA 1PFIA 5AW5B 4H13C 1S2EA 4H2YC 3VRLC 2EHTA 1ZR4A 2YIUC 1QVFO 3KHUA 2KG9A 3HYBA 1KC8Q 4OGQD 2N5IA 1RQUA 2N1TA 1KB9E 3B5IA 1IFJA 1S4XA 1VQPP 1LP1A 2AXTH 5AVSB 2KOSA 1GW4A 3G1GA 1URQD 4C7RA 5M1BA 3DS3A 1LTJB 1GD2E 5AW3B 5DJUB 5E79H 3L73G 3HD7A 4COCA 1A43A 3H1ID 3PRJA 5KLVK 3B4QA 3TGUE 3U1CA 1OW7A 3RK2C 3H1HE 4C7NA 2WITA 3AE5C 1EZVE 4EOTA 3H1LG 3TF5A 2PENA 1SQPJ 1H88A 5APYA 3H1JJ 1FOSE 3L74J 2K5XA 1LJ2A 3O8ZA 5KTBA 3TYYA 4D6TD 2L22A 3GHGB 2QJKC 1PL5A 3S4RA 3A0BE 1QVGO 4Y28J 3GJNA 1BGYE 2FVAA 2JWAA 5APQA 5K5GB 1DX7A 1S9KD 5AVWB 4OVNF 3HE4A 1BDDA 3H1KD 2BHVA 4L76A 1JCDA 3PHLA 1VQLP 2AXCA 1JM0A 1KYOH 1SQXD 1J1DC 2GA1A 3KXDA 2YMKA 5AVZB 3H25A 4U7JA 1JJ2O 3CXHD 1ZV8A 4HKZH 1WMKA 2CPSA 3AE7C 4WVZA 3CC7P 2WWWA 1RF0C 2KLVA 1YJ9P 1X8YA 5HGOA 2ZFCA 3TNUA 1VQMP 4H13B 3P7KA 1PPJD 4JQ0D 3AE8C 4WY4B 3LIDA 2D2CB
chains in the Genus database with same CATH topology
1RO0A 2DGYA 1YIJP 1Q86Q 3CCQP 2CWOA 2PY8A 3G28A 1KD1Q 2EIAA 3G6EP 5HGLA 1PEUA 4XFZA 4COCA 1VQKP 1VQ4P 5I4TG 3CCUP 1A43A 1K30A 1S72P 5F2KA 2PEIA 2BUOA 4XFXA 4QNBA 3CD6P 1M6NA 2Z45A 1VQ7P 3CMEP 3NTEA 5F2OA 5JPAA 1VQ5P 1M90Q 2KODA 2Z44A 4U0BA 3CCJP 2PENA 3H4EA 3H0DA 3DS1A 4XRQA 2PEQA 1K8AQ 3I55P 2Z46A 4U0CA 2M8LA 1AUMA 3CCEP 2QA4P 2QEXP 2JO0A 4GR6A 3CCMP 3LRYA 3DS2A 1M6EX 2PEJA 2M8PA 1KQSO 2BQ1E 2M8NA 5BS2A 2XV6A 2ONTA 1YJWP 1ZMBA 1Q81Q 1EIAA 1PEQA 3DS5A 1VQOP 1EOQA 3CCRP 3G29A 1E6JP 3WBHA 3CXCO 2PEKA 1M74A 3G21A 2L6EA 3DTJA 2E1MA 3CMAP 4M0IA 2OTLP 1QVGO 2OTJP 2LF4A 4U0AA 4XFYA 5DCKA 1W2BO 2P9XA 1YI2P 1IUQA 1NJIQ 5HGNA 3G71P 1YHQP 1M1KQ 2XT1A 5F2NA 2PEMA 2BHVA 4PH0A 1VQ8P 3P05A 3CCSP 1A8OA 3M1MA 3G0VA 1VQLP 1K73Q 3VRLC 1RO2A 3I56P 4GR2A 3OW2O 3DPHA 1QVFO 1D1DA 1QRJA 2PEOA 3Q20A 3G26A 3MGEA 3HYBA 1KC8Q 3DS0A 2EG5A 3E2DA 3H47A 4U0EA 1VQNP 1JJ2O 2JYLA 3B5IA 5BS1A 2OARA 4IPYA 1Q7YQ 3HZQA 1YITP 1K9MQ 1YJNP 1VQPP 1PEOA 3G1IA 4COPA 3CC7P 5HGMA 1YJ9P 1RNIA 5HGOA 1VQ9P 2EFJA 1VQMP 3CC2P 1PEMA 3CC4P 2XXMA 1VQ6P 3DS4A 3G1GA 4U0DA 1Q82Q 4PH1A 1N8RQ 4U0FA 1BAJA 3RG6C 3CCVP 4XROA 3DS3A 2JYGA 3G4SP 4WYMA 3CCLP 3CPWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 Q;  1YIJ P;  1Q86 Q;  3CCQ P;  3CMA P;  1KD1 Q;  2OTL P;  3G6E P;  1QVG O;  3I55 P;  1K8A Q;  1JJ2 O;  1VQN P;  2OTJ P;  1VQK P;  1Q7Y Q;  1YIT P;  1K9M Q;  1VQ4 P;  1YJN P;  3CCE P;  1VQP P;  3CCU P;  1W2B O;  2QA4 P;  2QEX P;  3CC7 P;  1YI2 P;  3CCM P;  1S72 P;  3G71 P;  1YHQ P;  1NJI Q;  1YJ9 P;  1M1K Q;  1VQ9 P;  1KQS O;  1VQM P;  3CC2 P;  1VQ8 P;  3CC4 P;  1VQ6 P;  3CD6 P;  3CCS P;  1YJW P;  1VQ7 P;  1Q82 Q;  1VQL P;  1Q81 Q;  1N8R Q;  1K73 Q;  3CME P;  3CCV P;  3I56 P;  1VQO P;  1VQ5 P;  3G4S P;  1M90 Q;  3CCL P;  3OW2 O;  1QVF O;  3CCR P;  3CPW O;  3CCJ P;  3CXC O; 
#chains in the Genus database with same CATH topology
 2FHS C;  4WY4 C;  2HPC B;  3F5H A;  3M9H A;  1DEE G;  2KGE A;  1KD1 Q;  1GXH A;  3MGN A;  2M5A A;  3L74 D;  1HQB A;  1AYI A;  3SFD C;  2ROQ A;  2N6Z A;  2E5Y A;  2P58 A;  1LGH B;  4W80 A;  2XND H;  2QSI A;  3H1J E;  1AJY A;  1LTB C;  2NPS C;  2ZT9 B;  5CHX A;  3QWO C;  2PEQ A;  3JCU E;  2O01 H;  4KT0 J;  1T2K C;  1CEI A;  3H1H D;  2QJP C;  3CCE P;  3VYI A;  2FQ2 A;  2QEX P;  3LRY A;  2N1T B;  1FU1 A;  3MP7 B;  1H0T B;  3HE5 A;  3N4X A;  4L75 A;  4HJG H;  1PP9 D;  2QJP B;  1JY3 N;  3B71 A;  2R44 A;  4L74 A;  3LW5 H;  1ZOY C;  3G21 A;  2K37 A;  1S5L E;  1IFI A;  2JJL A;  4PD4 E;  1YTZ T;  2L4B A;  4N6J A;  3RK3 D;  2M0B A;  2FFD B;  5KJ7 D;  2GZJ A;  2GDW A;  3PP5 A;  1GDT A;  2RKL A;  3Q20 A;  3MUD A;  5KP7 B;  4H2X C;  4C7N B;  1E79 H;  3Q5R A;  3D70 A;  5AW0 B;  3U43 A;  2ERH A;  3Q1M A;  2Z4E A;  2QIW A;  2MF4 A;  3RG6 C;  2W90 A;  1L4A C;  2IZ0 A;  5BU8 B;  2UWJ E;  2C9L Y;  3II6 A;  3IF4 A;  2E76 D;  5I4T G;  2ZVN B;  3AE9 C;  1S72 P;  1NTK K;  1WRG A;  1DD4 A;  3BRT B;  2Z45 A;  1VQ7 P;  1SQV G;  2IYP A;  3H1H G;  3NTE A;  1VQ5 P;  1LT1 A;  2FXP A;  2K3R A;  1R8E A;  2OYI C;  2C0W A;  3RL0 g;  4W7Y A;  4JYB A;  1GPJ A;  3KQG A;  2LOL A;  3L71 G;  1PGO A;  1IC2 A;  2Y0E A;  4EI2 A;  2H89 C;  1NTZ E;  1FZC A;  3P8C D;  4N78 D;  5AW2 B;  3G9R A;  1SQP K;  1NJI Q;  1BSH A;  3H1J D;  2K0X A;  1ZN5 A;  2YO2 A;  2Y0C A;  5AW4 B;  1JMM A;  2WZ7 A;  1D1D A;  1HGZ A;  3V2N A;  1MUU A;  1L4A A;  3MIW A;  1OX3 A;  4ASW A;  1EC5 A;  1HH0 A;  1UIX A;  2WT7 A;  3WU2 H;  1URQ C;  2KG8 A;  1Z6M A;  4RKU J;  1PP9 G;  2OYO A;  3CC4 P;  1VQ6 P;  2H8P D;  2IX7 C;  1NU1 E;  1N73 C;  2QG4 A;  1LNQ A;  3H1K J;  2OYH B;  2HOD A;  1KQF B;  1BGY G;  3SSU A;  3NTN A;  5HGL A;  1EMV A;  1J1E C;  4D6T E;  4DCK A;  2QRX A;  2ZYA A;  4OWF A;  1FS0 E;  1KB9 D;  2KNC B;  2VRS A;  4Z1M H;  1M90 Q;  3GG2 A;  1RHZ B;  2LTE A;  3NXS A;  1T8Z A;  4XRQ A;  4YXD C;  2FYU E;  5AVY B;  4MN4 C;  1R5L A;  3CE7 A;  4U0C A;  5AVT B;  1NGM B;  1HY8 A;  3L36 A;  4I1L A;  3EJE A;  3L71 E;  5KKZ B;  1OFC X;  1H8A A;  5BS2 A;  2XDJ A;  1FE6 A;  3VMX A;  3GZL A;  3L72 E;  1T8K A;  4PV1 C;  4B86 A;  1PIX A;  2KSE A;  2WPQ A;  2E1M A;  2CPB A;  3Q2Y A;  2OTL P;  3L72 G;  2ZYG A;  1L0N K;  5GTH H;  1LTT C;  2R3S A;  1NWQ A;  3TDK A;  1JO5 A;  2Q1K A;  1OZH A;  3GZM A;  3B5N B;  3P05 A;  2SPZ A;  4WY4 A;  4BRY A;  3B5N C;  1IZN B;  3V5B A;  3DS0 A;  2KSJ A;  4H44 C;  3R4Y A;  2AVA A;  2PRR A;  3GW6 A;  1D7M A;  4D6T G;  3GLM A;  2A45 I;  1RNI A;  4WBA A;  3AE4 C;  4IFM A;  2FYZ A;  1BCC D;  1S5L X;  2ZXE B;  5CCH A;  3D6Z A;  2IZ1 A;  4TLF A;  2B88 A;  3EWK A;  4PD4 I;  3VMA A;  1OVR A;  1SLQ A;  5KKZ C;  1N73 A;  2KI7 B;  5KLV D;  1JY2 N;  1JY3 P;  2LML A;  2E76 B;  5BU5 A;  2P1J A;  3RK3 C;  1Z56 A;  1DD3 A;  2GZG A;  1RF1 C;  5JPA A;  2KGA A;  5APW A;  3SWF A;  2MVV A;  2FXM A;  2Q6Q A;  1IMP A;  2PGD A;  1J1E B;  2E42 A;  1BE3 G;  2K0Y A;  1SQB E;  1AUM A;  1EDL A;  4XE5 B;  2I1J A;  3BVH A;  2LXB A;  1PV3 A;  3H1I J;  1Q81 Q;  2YXR B;  1KMI Z;  2AEF A;  1T2K D;  1QEX A;  1IJD B;  1NTZ G;  2N9Y B;  4ZKU A;  5HVC A;  1KYO D;  2O1J A;  1M8O B;  2NPS D;  3M9Q A;  2LF4 A;  2BAS A;  3VTP C;  5B66 H;  2KGD A;  4K35 A;  1BCC J;  4DT0 A;  1RE3 C;  2ZJS E;  1Q90 D;  4IZ6 A;  1KQG B;  5GTI E;  3KYQ A;  1VQN P;  3T97 B;  2AF8 A;  3A0B H;  2WPR A;  1KQL A;  4AYC A;  1VQ9 P;  2M8R A;  3U59 A;  1PPJ G;  5AVQ B;  1QX8 A;  2LL8 A;  1JUN A;  2XXM A;  1M56 D;  2YKQ A;  1OXZ A;  2FFD C;  3BCC J;  2ZYD A;  3CCL P;  4QMA A;  2GDY A;  5CCG C;  2B87 A;  4UHP B;  3GMA A;  1MV8 A;  2EIA A;  2HPC A;  1SQX G;  1X0T A;  4IOI H;  5KAF H;  2PFX A;  1MFZ A;  1X9V A;  1SQP E;  2FY8 A;  3CI9 A;  2N5H A;  4XA4 A;  3FXE A;  3RK3 E;  2YNY A;  3H4E A;  1NTM K;  2FXO A;  4WB4 A;  2QM8 A;  1JY2 O;  3HRN A;  3A5T A;  2W8Z A;  2R3C A;  5CMZ A;  5EW5 E;  1PPJ E;  1SQB D;  2P2U A;  2GZI A;  3H6P A;  1MKM A;  2IBZ I;  1GL2 B;  3CX5 H;  3O6Q B;  2QVA A;  4BPH A;  2QNW A;  1GL2 A;  3H1L D;  2J59 M;  3A7O A;  2BEQ D;  3L75 D;  2LPK A;  2EHS A;  3H1H J;  4IL6 E;  1N7S B;  2WQY C;  1FR2 A;  4KHX A;  2H43 A;  2IYO A;  3V2R A;  3G26 A;  1KIL E;  1OVV A;  1GU4 A;  3VMY A;  1X22 A;  1YIT P;  1K9M Q;  5AW7 B;  2RMZ A;  1FZB A;  1URQ B;  3CC2 P;  4XFJ A;  1SQQ K;  1NQ4 A;  3G4S P;  4HKG A;  1GK4 A;  1IFD A;  3I5C A;  1NTK J;  1P84 H;  1KIL A;  1FDO A;  3HD7 B;  2ZXX A;  2J58 A;  1M7L A;  3E1R A;  4K3A A;  3WUU A;  2P67 A;  2XZ0 D;  2WSF J;  2WVR A;  2KR5 A;  1S9K E;  3WUT A;  1LP1 B;  3K5B A;  2BCC D;  4R4M A;  1GTW A;  3CCJ P;  1NU1 G;  2K94 A;  1YQ4 C;  1J2J B;  2O01 J;  2CQ8 A;  2BCC J;  2KG6 A;  2GM4 A;  3A0H H;  2FBW C;  2BEZ F;  1AVO A;  4GR6 A;  1XTG B;  3CCM P;  4L73 A;  3RK2 D;  2PEJ A;  2BQ1 E;  2KNC A;  1KZU B;  4ZMD A;  2HYN A;  1PEQ A;  1L0I A;  3G29 A;  1FZE A;  1M74 A;  2AEM A;  4PXH B;  1T3J A;  1DNY A;  3HE5 B;  2LIU A;  5TJH A;  1IK9 A;  3V4W A;  4DJG A;  4U3F J;  2I8D A;  1LTJ A;  3TGU D;  2C9N Y;  1RO2 A;  3H1L E;  3KDP B;  3TGU J;  1ZW0 A;  1U57 A;  1SQB J;  1X3O A;  2JYL A;  2AFE A;  2DW3 A;  3JCU H;  2W6J H;  3TGU G;  2QJK B;  1RY3 A;  1VKU A;  1HVV A;  3GHG C;  1VF5 D;  2R5D A;  3D6Y A;  1NOH A;  2WSC J;  3M0D C;  3TNU B;  4LC1 A;  1M1J A;  2QJY B;  2NPS A;  3HE4 B;  4U3F E;  2FKW B;  2Y0D A;  3JC2 2;  1NU1 K;  1QL2 A;  3HTK B;  3G6E P;  4U3F G;  1PEU A;  4KJM A;  1S5L H;  3L70 D;  1USE A;  4PD4 H;  2L0Q A;  2RN0 A;  5CCH D;  2MD9 A;  2K88 A;  4PD4 D;  2MVU A;  3RK2 B;  2J5U A;  3CWB D;  3KPE A;  5B5E E;  4U0B A;  2A45 G;  3M0D A;  1RE3 A;  1AF8 A;  2KIK A;  4PV1 D;  5CCG A;  1AV1 A;  4R0M A;  3GF3 A;  1DV5 A;  1NTM E;  1HJB A;  2N1T C;  1M6E X;  5B66 E;  5KLI C;  2JGP A;  1KYO I;  1SQX J;  1ZMB A;  3HTK A;  2P10 A;  3DS5 A;  3VN0 A;  1DH3 A;  1ZRT D;  2Q9I A;  2ZT9 C;  1FAV A;  1LT9 A;  1SS1 A;  3MUD C;  3S9O A;  4CPG A;  1SQP D;  2E43 A;  1W2B O;  1YI2 P;  1IUQ A;  1EXJ A;  1M1K Q;  1W2E A;  1GXG A;  2LR2 A;  4IL6 X;  2YIU B;  2PEM A;  5KLV E;  1LTG C;  1VF5 C;  4C46 A;  3NMD A;  4GR2 A;  4H44 D;  4GKG A;  3H47 A;  2O1K A;  2RH0 A;  1JY2 P;  1YYC A;  2A06 D;  1NHL A;  2FQ1 A;  2IPP A;  2L5G B;  1L2P A;  1AQT A;  1JCC A;  1BE3 J;  2FAC A;  1L0H A;  3S1K A;  1AVY A;  1OMI A;  2KOR A;  4U3F D;  1X79 B;  1SQQ J;  2KYV A;  2AFD A;  1CW5 A;  4PJ0 H;  4YPC A;  4NPF X;  2IBZ G;  1EDJ A;  2VSQ A;  1W5C E;  2KGC A;  2KB7 P;  4QNB A;  1SP4 A;  5AW8 B;  3L4F A;  1FZC B;  1RE4 C;  3L70 E;  1HWT C;  3AED C;  4AUW A;  1LT9 C;  1HBW A;  3AE6 C;  4F37 A;  2OYI A;  3DS1 A;  1L0L D;  2W6A A;  2R32 A;  3VMZ A;  2JR8 A;  2OTK E;  2I1K A;  2FYU D;  2N98 A;  1YJW P;  2ZAE B;  1SFC B;  3EJD A;  1OW6 A;  1S1C X;  1EOQ A;  1L0L K;  1FJK A;  3V6I A;  2XKM A;  2JKV A;  2D2C D;  3NFQ A;  1RH5 B;  2YXQ B;  3L73 J;  5TIS E;  5HGN A;  2PNG A;  3CXH I;  2WPV B;  4GOD A;  3ZDM A;  2JO1 A;  2N9B A;  4EDF A;  1CI6 B;  5KP6 B;  1KIL C;  3JSV C;  3O6Q A;  4JPZ B;  2WMM A;  3CX5 E;  1CSB A;  2JU2 A;  2KWL A;  2KOQ A;  5L8R J;  2BCC G;  4UB8 E;  2MJZ A;  1QL1 A;  1FC2 C;  5HGM A;  2KOG A;  4IL6 H;  1F80 D;  3U1A A;  2EFJ A;  1BSN A;  1VF5 B;  3PH0 A;  5CZD B;  2HFE D;  5E79 E;  4Y99 C;  2WSS H;  2LKM A;  3V2P A;  3M06 A;  1YIJ P;  4Y99 B;  3Q5S A;  2GYK A;  1JEK A;  2B87 B;  1FZF A;  3CCU P;  3P32 A;  2W83 C;  3H1J G;  3L35 A;  4M3L A;  3RK3 B;  2YO3 A;  1LTA C;  5KLI B;  1FZA A;  1AQ5 A;  1BE3 D;  1USD A;  1NAY A;  1VL2 A;  1SQX K;  3G3Z A;  3L75 J;  2Z46 A;  2JWD A;  1GL2 D;  2A45 H;  2QA4 P;  4LGD E;  2L9F A;  3RGU A;  2XZR A;  3L71 D;  1EZV I;  3L75 G;  3AEC C;  1SQV K;  1KOR A;  4EYY Q;  1EIA A;  2O01 N;  5AW6 B;  1E6J P;  3WBH A;  3CXC O;  2WSE H;  3OA7 A;  2LIW A;  1OW8 A;  5CCG D;  1L4A D;  3AE1 C;  2FAD A;  4H44 B;  4BPG A;  3EFG A;  4U0A A;  2JDI H;  1U7J A;  3CLQ A;  2CGQ A;  5C39 A;  2V7Q H;  2KLU A;  1SQV D;  2IDB A;  2KOO A;  2E74 D;  1VHN A;  2WSF H;  1HUC A;  2NZ2 A;  4H0L D;  2E74 B;  3I56 P;  2V4H A;  1BE3 E;  3CX5 D;  2FQ0 A;  5APU A;  2MY5 A;  1FZC C;  4IFF A;  4U0E A;  1NAF A;  3CL3 D;  3CXH E;  3HZQ A;  1YJN P;  1PEO A;  2KOP A;  4COP A;  2FAE A;  1NU1 J;  4I6M C;  1SQX E;  2LXC B;  5KJ7 C;  1PEM A;  5AVU B;  3DS4 A;  2KZJ A;  1Q82 Q;  2V7Q J;  1KFM A;  3F89 A;  5KAI E;  1GMJ A;  2K92 A;  4WYM A;  1L4A B;  1BGY J;  5KLV J;  3L70 J;  2G8Y A;  2IFN A;  1NTM G;  1DIP A;  1KIL B;  4XFZ A;  1SQQ G;  2ZVO B;  3WMM 0;  2JP3 A;  4CA3 A;  2HG5 D;  2BUO A;  3L75 E;  3SWK A;  2FVE A;  2JEE A;  1RF1 A;  3BAT A;  4UB6 H;  1JTH A;  1NTM D;  1P84 E;  5GTI H;  4AQR D;  1JB0 J;  1L0L J;  3KZI H;  2ONT A;  3OJA B;  1OIP A;  1LTS C;  2O3J A;  1QLE D;  2GUS A;  1NTZ D;  1AA0 A;  1ZME C;  3GF7 A;  4UB8 H;  2B9B A;  1NVO A;  5DCK A;  1S3J A;  1NTZ J;  3G71 P;  3A0H E;  5F2N A;  1ZXG A;  4OH8 B;  2VLO A;  3CCS P;  2K9J B;  1A8O A;  4RES B;  3G0V A;  1K73 Q;  1Y47 A;  2Y9Y A;  3MGE A;  3AE2 C;  3SWY A;  1K05 A;  4YXW H;  2E75 B;  1IFN A;  1RE4 A;  2OAR A;  3VP8 A;  2OQQ A;  1SFC A;  3B5N D;  1VDF A;  3RL0 D;  1KIL D;  1PP9 E;  1T6A A;  5KJ7 A;  4BRY B;  1EDK A;  4GOE A;  4TT3 H;  1UNK A;  3MD0 A;  4U0F A;  1SQQ D;  3RL0 C;  1KLP A;  3PJS K;  3NY7 B;  4XRO A;  5KLV G;  2D2C C;  3CCQ P;  2CWO A;  2PY8 A;  1BCC E;  2QJY C;  3OAK A;  3BCC G;  2ITA A;  3HUS B;  4BWN A;  3A2A A;  1VQ4 P;  1N7L A;  1RF0 A;  1M1J C;  4R4L A;  3B8E B;  3HUS A;  5H2F H;  2JU1 A;  2VLP A;  1ACP A;  3CX5 I;  1JY3 O;  5APV A;  1J1D B;  3M9B A;  5F2O A;  5APS A;  1T3U A;  2KP8 A;  3LMO A;  2FYN B;  4HH2 A;  2AEJ A;  2K0D X;  1NKZ B;  1K8A Q;  1L0N J;  2POH A;  1KB9 H;  3C9I A;  1GK6 A;  1NKN A;  5TIS H;  3W67 A;  3FX0 A;  3LIE A;  3L71 J;  4BPF A;  2KZI A;  5CJ4 A;  5AVR B;  3TSI A;  1VPC A;  3L72 D;  2X2B A;  2PEK A;  2N50 A;  3H1L J;  5DJT B;  3HUS C;  2K9Y A;  2KK7 A;  1FZG A;  1GZL A;  4W7Z A;  1IFM A;  1G1I A;  3R2P A;  1YHQ P;  1HF9 A;  5BVZ A;  2CG5 B;  2Q3E A;  1HGV A;  3H1I G;  1PP9 J;  3OW2 O;  2BCC E;  3V4Q A;  4RJT A;  4NPD A;  2E5T A;  5KP8 B;  4IPY A;  2KW2 A;  2KS1 B;  1U7M A;  4QKO A;  2NRG A;  1A02 F;  4H0L B;  3ITK A;  4U0D A;  3HD7 C;  2L91 A;  3CCV P;  4YTP C;  2JYG A;  4NPE A;  3MTU E;  3H1K E;  1E5W A;  1G2C B;  2CNR A;  1LTJ C;  7CEI A;  4ASV A;  1BGY D;  1BXI A;  2Q7C A;  2K1A A;  2KXP B;  4HYT B;  2FYN C;  2PEI A;  5KAF E;  2NPS B;  1IK7 A;  1L0N E;  3CD6 P;  2N1T D;  4DG9 A;  3AEG C;  2CK3 H;  2JAZ A;  1P84 D;  1UJZ A;  1OWA A;  3I55 P;  5EJD A;  1Y8A A;  2M8L A;  1EXI A;  3VP9 A;  5AW1 B;  2JO0 A;  2W27 A;  1KV4 A;  1NTK E;  1H89 A;  1N86 A;  1XTC C;  2A06 G;  1VQO P;  1GL2 C;  2E76 C;  1LTI C;  3CCR P;  2K93 A;  4JYC A;  3L73 E;  1FOS F;  1G1J A;  1NYH A;  5HV8 A;  2OTJ P;  2GDX A;  3W68 A;  2HOD B;  2YKP A;  2FYU G;  4PH0 A;  1N2D C;  2IBZ E;  2WPS A;  3N7N A;  1P84 I;  2FYU J;  4PWV B;  1L0L G;  5B5E H;  3C1L A;  3QH9 A;  1SQV E;  1CZQ A;  4GOF A;  5BS1 A;  2GZE A;  2Q5U A;  5H2F E;  4H0L C;  3FXD A;  2E74 C;  2AXT E;  1MFT A;  1SQQ E;  2OYH A;  1SQB K;  5KAI H;  4PH1 A;  2W6B A;  1YTZ I;  1HTL C;  4N78 E;  1NTK G;  4UB6 E;  2DGY A;  4I2L C;  2LKI A;  1MZ9 A;  1Q86 Q;  1YQ3 C;  2HLO A;  1GW3 A;  3CXH H;  2YKO A;  3B4S A;  4EIJ A;  2GZF A;  1FDI A;  2K9J A;  1URQ A;  4GT1 A;  1N7S C;  4PV1 B;  5F2K A;  2M5R A;  2YMY A;  2GUV A;  4LLH A;  1M6N A;  2M3B A;  2FVF A;  5CBN A;  3CME P;  4OGQ B;  2WT7 B;  5APX A;  2KOD A;  2JBG A;  1Y9B A;  1NTK D;  4ZNC A;  2Q3I A;  3BRV B;  4MRT C;  2M8P A;  2M8N A;  2FYU K;  2R5B A;  3VOP A;  3WUV A;  2Z5H A;  2KS1 A;  1KFN A;  1SQP G;  2WTY A;  4JBZ A;  3H1I E;  3H32 A;  1HJ0 A;  1FBM A;  3PTZ A;  1JMB A;  3L73 D;  3DTJ A;  3CMA P;  2XV5 A;  4M0I A;  4WY4 D;  4RO0 A;  4DOJ A;  4PJ0 E;  1ZNV A;  2E75 D;  3KZI E;  2P9X A;  3AEE C;  2Y9Z A;  2XT1 A;  1PGJ A;  2OYH C;  1M1J B;  1VQ8 P;  1L0L E;  1N73 B;  1SVF A;  3M1M A;  1LWU B;  2IBZ D;  1N7S D;  3DPH A;  1QRJ A;  2PEO A;  3UIA A;  2QE7 H;  1RF1 B;  3GHG A;  3E2D A;  1DEB A;  1OVU A;  1ZP0 C;  3RL0 B;  3AEA C;  1JNM A;  1JTH B;  3FWL A;  3IR9 A;  1GU5 A;  2A06 E;  1IFP A;  4HB1 A;  1MZ8 A;  1NTM J;  2E75 C;  2HR3 A;  5APT A;  1AFO A;  3EQ2 A;  3L74 G;  3CPW O;  2MR7 A;  1UII A;  1ZRT E;  1RO0 A;  5GTH E;  3G28 A;  1PGP A;  2PAJ A;  4JF7 A;  3PLN A;  1EQ7 A;  1SQB G;  2PP6 A;  3ABV C;  2DNW A;  1K04 A;  2P7J A;  3IAO A;  1EDI A;  3L37 A;  1R5S A;  2K2Q A;  3V2Q A;  4GIF A;  3M0A A;  3FGA D;  2M3E A;  2C0X A;  4BXL A;  3H0D A;  2ZT9 D;  1LWU C;  2OYI B;  1JOC A;  2XNX A;  4I7Z B;  1LT9 B;  3Q3D A;  3E7K A;  3DS2 A;  3BCC E;  2JQ4 A;  1KQS O;  3H1K G;  3EJB A;  2VLQ A;  3T97 A;  3EFF K;  5AVV B;  2OGU A;  3TK1 A;  1Q2N A;  3SFE C;  3CWB J;  1ZR2 A;  4N3Y B;  3RBX A;  3L72 J;  1SQV J;  3L74 E;  1NO4 A;  4XFY A;  3CWB G;  2Z5I A;  1BDC A;  3D71 A;  2NO8 A;  2VLN A;  1H0T A;  3RG2 A;  3AEB C;  4DZO A;  3GKL C;  3MHV A;  1TU3 F;  3L70 G;  1EZV D;  3M91 A;  3C8V A;  1NH4 A;  2EG5 A;  3AE3 C;  2G3A A;  4OGQ C;  1EZV G;  2IFM A;  5EFW B;  1Q7Y Q;  3G1I A;  2H88 C;  2WPT A;  5CBO A;  3RBZ A;  3HD7 D;  4H13 D;  1M57 D;  3IN6 A;  1SFC C;  3Q5P A;  1N8R Q;  1ZLL A;  4GDO A;  1BAJ A;  3P8C E;  1OR5 A;  1KB9 I;  1PZQ A;  2WSC H;  1KYO E;  3P8M C;  3AEF C;  2M5A B;  1KN7 A;  4I7Z C;  3A3Y B;  3MZW B;  1VQK P;  1K30 A;  1IO4 A;  4D6T J;  4XFX A;  1PGQ A;  2WSE J;  3CWB E;  1G2C A;  1YBK A;  2Z44 A;  3BAS A;  4WWI A;  4IFD K;  2MKV A;  3BCC D;  3FWN A;  1LWU A;  5AW9 B;  2KUB A;  1N7S A;  1A02 J;  3IFM A;  1IMQ A;  1NTZ K;  4O9B A;  1FDM A;  2XU6 A;  4NEO A;  3E1I A;  3USS A;  2H7H A;  5AVX B;  2XV6 A;  2B89 A;  1L0N G;  1E0H A;  5CJ0 A;  1RQV A;  5CCH C;  2JB0 A;  4H2W C;  3H32 B;  1CI6 A;  2XZ1 C;  1WT6 A;  2L6E A;  1QGK B;  3LW5 J;  1NU1 D;  2MR8 A;  1BCC G;  3B5N A;  2N6Y A;  1SFC D;  1L0N D;  2FFD A;  2QM7 A;  4A7P A;  3WU2 E;  1KTM A;  4ZKP A;  1FJP A;  1PFI A;  5AW5 B;  4H13 C;  1S2E A;  4H2Y C;  3VRL C;  2EHT A;  1ZR4 A;  2YIU C;  1QVF O;  3KHU A;  2KG9 A;  3HYB A;  1KC8 Q;  4OGQ D;  2N5I A;  1RQU A;  2N1T A;  1KB9 E;  3B5I A;  1IFJ A;  1S4X A;  1VQP P;  1LP1 A;  2AXT H;  5AVS B;  2KOS A;  1GW4 A;  3G1G A;  1URQ D;  4C7R A;  5M1B A;  3DS3 A;  1LTJ B;  1GD2 E;  5AW3 B;  5DJU B;  5E79 H;  3L73 G;  3HD7 A;  4COC A;  1A43 A;  3H1I D;  3PRJ A;  5KLV K;  3B4Q A;  3TGU E;  3U1C A;  1OW7 A;  3RK2 C;  3H1H E;  4C7N A;  2WIT A;  3AE5 C;  1EZV E;  4EOT A;  3H1L G;  3TF5 A;  2PEN A;  1SQP J;  1H88 A;  5APY A;  3H1J J;  1FOS E;  3L74 J;  2K5X A;  1LJ2 A;  3O8Z A;  5KTB A;  3TYY A;  4D6T D;  2L22 A;  3GHG B;  2QJK C;  1PL5 A;  3S4R A;  3A0B E;  1QVG O;  4Y28 J;  3GJN A;  1BGY E;  2FVA A;  2JWA A;  5APQ A;  5K5G B;  1DX7 A;  1S9K D;  5AVW B;  4OVN F;  3HE4 A;  1BDD A;  3H1K D;  2BHV A;  4L76 A;  1JCD A;  3PHL A;  1VQL P;  2AXC A;  1JM0 A;  1KYO H;  1SQX D;  1J1D C;  2GA1 A;  3KXD A;  2YMK A;  5AVZ B;  3H25 A;  4U7J A;  1JJ2 O;  3CXH D;  1ZV8 A;  4HKZ H;  1WMK A;  2CPS A;  3AE7 C;  4WVZ A;  3CC7 P;  2WWW A;  1RF0 C;  2KLV A;  1YJ9 P;  1X8Y A;  5HGO A;  2ZFC A;  3TNU A;  1VQM P;  4H13 B;  3P7K A;  1PPJ D;  4JQ0 D;  3AE8 C;  4WY4 B;  3LID A;  2D2C B; 
#chains in the Genus database with same CATH homology
 1RO0 A;  2DGY A;  1YIJ P;  1Q86 Q;  3CCQ P;  2CWO A;  2PY8 A;  3G28 A;  1KD1 Q;  2EIA A;  3G6E P;  5HGL A;  1PEU A;  4XFZ A;  4COC A;  1VQK P;  1VQ4 P;  5I4T G;  3CCU P;  1A43 A;  1K30 A;  1S72 P;  5F2K A;  2PEI A;  2BUO A;  4XFX A;  4QNB A;  3CD6 P;  1M6N A;  2Z45 A;  1VQ7 P;  3CME P;  3NTE A;  5F2O A;  5JPA A;  1VQ5 P;  1M90 Q;  2KOD A;  2Z44 A;  4U0B A;  3CCJ P;  2PEN A;  3H4E A;  3H0D A;  3DS1 A;  4XRQ A;  2PEQ A;  1K8A Q;  3I55 P;  2Z46 A;  4U0C A;  2M8L A;  1AUM A;  3CCE P;  2QA4 P;  2QEX P;  2JO0 A;  4GR6 A;  3CCM P;  3LRY A;  3DS2 A;  1M6E X;  2PEJ A;  2M8P A;  1KQS O;  2BQ1 E;  2M8N A;  5BS2 A;  2XV6 A;  2ONT A;  1YJW P;  1ZMB A;  1Q81 Q;  1EIA A;  1PEQ A;  3DS5 A;  1VQO P;  1EOQ A;  3CCR P;  3G29 A;  1E6J P;  3WBH A;  3CXC O;  2PEK A;  1M74 A;  3G21 A;  2L6E A;  3DTJ A;  2E1M A;  3CMA P;  4M0I A;  2OTL P;  1QVG O;  2OTJ P;  2LF4 A;  4U0A A;  4XFY A;  5DCK A;  1W2B O;  2P9X A;  1YI2 P;  1IUQ A;  1NJI Q;  5HGN A;  3G71 P;  1YHQ P;  1M1K Q;  2XT1 A;  5F2N A;  2PEM A;  2BHV A;  4PH0 A;  1VQ8 P;  3P05 A;  3CCS P;  1A8O A;  3M1M A;  3G0V A;  1VQL P;  1K73 Q;  3VRL C;  1RO2 A;  3I56 P;  4GR2 A;  3OW2 O;  3DPH A;  1QVF O;  1D1D A;  1QRJ A;  2PEO A;  3Q20 A;  3G26 A;  3MGE A;  3HYB A;  1KC8 Q;  3DS0 A;  2EG5 A;  3E2D A;  3H47 A;  4U0E A;  1VQN P;  1JJ2 O;  2JYL A;  3B5I A;  5BS1 A;  2OAR A;  4IPY A;  1Q7Y Q;  3HZQ A;  1YIT P;  1K9M Q;  1YJN P;  1VQP P;  1PEO A;  3G1I A;  4COP A;  3CC7 P;  5HGM A;  1YJ9 P;  1RNI A;  5HGO A;  1VQ9 P;  2EFJ A;  1VQM P;  3CC2 P;  1PEM A;  3CC4 P;  2XXM A;  1VQ6 P;  3DS4 A;  3G1G A;  4U0D A;  1Q82 Q;  4PH1 A;  1N8R Q;  4U0F A;  1BAJ A;  3RG6 C;  3CCV P;  4XRO A;  3DS3 A;  2JYG A;  3G4S P;  4WYM A;  3CCL P;  3CPW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...